5C67A

Human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combinatorial protein engineering of proteolytically resistant mesotrypsin inhibitors as candidates for cancer therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hyrdolase/hydrolase inhibitor
molecule keywords Trypsin-3
total genus 57
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A02
3SNEA 1L4DA 1XUGA 1JBUH 1QURH 4X6MA 2R0LA 1P2MA 1O33A 3QO6A 4D7FA 3NKKA 1PPBH 4CRFA 3BEFB 1M9UA 1F0RA 1NRPH 2FX4A 2FTMA 1SFQB 5F8ZA 2CGAA 3A83A 1ZHMA 4JZFH 1H9LB 5A8YA 1SVPA 1C9TA 1P8VC 3GY3A 1GJCB 1THSH 2EC9H 4VGCB 1O3BA 1UTNA 5ESTE 3MFJA 1LPGB 2BMGB 4WVPE 1TPPA 1P2KA 1BTUA 2ZNKH 1ELFA 2ANYA 5GJ4B 4MNXA 3RXMA 1EQ9A 1YPKH 1FAKH 3WY8A 3N7OA 2WUCA 3ELAH 4F49A 1ETRH 1PPZA 3F9GA 3GYMA 1TMUH 2ZZUH 4FXGH 1AUJA 2BVSH 1OSSA 2WPHS 3ZVAA 4KP0A 2ZGBH 1DSUA 4FUFA 1YGCH 5AFYH 4MG3A 3R3GB 3NZIA 2SNWA 4YT6H 3MYWA 2QAAA 1KY9A 2AH4X 1EKBB 5ETXA 2QA9E 4ASHA 1NFXA 1FPCH 3QGNB 2Z6BD 2VH0A 2R0KA 2BXUH 1UTMA 3ZVEA 3VB4A 1DUAA 5FHTA 4NFFA 2NU1E 1XUKA 3STIA 3TITA 2HNTC 3SI4H 1ZTLA 2H2ZA 1EAWA 1O31A 3GCNA 1C5NH 4NWKA 3SV8A 2FS8A 2BY8X 1GCDA 3A7VA 1MU8B 4AX9H 1MTWA 4A5TS 4NZLA 1O37A 4KTCA 3GCTG 4Y11E 1TNJA 2BOKA 2FOFA 2OC8A 4Y0ZE 1BRBE 1O5DH 1YPGH 3MU8A 3MHWU 4D9QA 5J4SA 3RLYH 3M5OA 1NRQH 1TYNA 5GXPA 1GHZA 2B5TB 1W12U 1ZGVA 1HAHH 1SGDE 4FUBA 3U9AH 3LGWA 1EZSC 3RXLA 4YLQH 2Y80A 1S0RA 1YBWA 1DWCH 1O5CB 4NA9H 1ZPZA 2OP9A 3LT3A 2FWWA 1ANDA 2BLQA 4ZUHA 4Y6DA 1IAUA 2GDEH 3KEEA 3S9AA 1FONA 1QBVH 2XTTB 4ZROA 1QTFA 2H9TH 3BF6H 2O9QA 4X2YA 4YESB 1SGFA 5DK1A 1KTSB 1GGDB 2G5VA 5TJXA 4BNRA 2OBOA 2ZFPH 4XBDA 1HAYB 1TFXA 1C1NA 1EP6A 1TALA 4J1YA 1EAUA 3L3TA 3M37A 1W14U 1Y3UA 2CF9H 3EA8A 1TIOA 3BTHE 4K1SA 2AGGX 2ZO3H 1C5UA 1O2LA 2BHGA 4X2VA 1KXFA 3RXBA 1FN6A 4AG1A 4QT8C 4THNH 2V0BA 1UTKA 5DO4H 2R2WU 1OYQA 3EDXB 1BIOA 4MVNA 3SGQE 4E7RG 1O2RA 2A7HA 3KHVA 1TGCA 1ETTH 2C3SA 2G4UA 1QA0A 3U98H 1EX3A 3O8BA 3TH3H 1DX5M 3U1IB 1C5RA 1AVWA 1Q31A 1VCWA 5T3HA 1MTNB 1TQ7B 5AF9H 2A0QB 1TBZH 4ZHAA 1O2TA 5T6FA 2R3YA 4ZH8A 1GJ5H 3A8CA 4NCYA 3BTWE 5EQRA 3TNTA 1A7SA 5DP9A 4TYDA 3SJ8A 1HXEH 2CHAB 5HGGA 4R0IA 1GHYH 2B9LA 4HI3A 2TGPZ 3OY6U 2VWNA 3IWMA 4B71A 2Z3CA 3TGKE 1QB6A 1TNHA 1Y3VA 4AOQA 3RU4T 3KQCA 1PPHE 2PKSB 4ZKOU 1O32A 2G51A 3HGNA 2FLBH 3LDXH 4ZHLU 5FBEA 5H4IB 2BOHB 5AHGH 1DICA 1SHYA 2WYGA 1OWIA 2ZU1A 1ELGA 1FY3A 1KLJH 2A5KA 1QFKH 2RDLA 4Q2KA 1O3KA 1ELBA 4CRGA 1AD8H 2ZFTA 1O3AA 3A80A 1IQNA 2C4FH 2ZDLA 3STJA 3B9FH 4K2YA 1CO7E 4ABIA 1DWBH 1NS3A 1O3PB 1EB2A 2BDYA 3QWCH 3CS0A 1EASA 2BYAX 1EAIA 3DFLA 1NU7B 1CGIE 4DIHH 2FTLE 1RTFB 3SU0A 1H4WA 4FUEA 2VNTA 4B2CA 3B8JA 1O2HA 4FUHA 2G8TA 3RUOA 3RXVA 2F9NA 2P3TB 3ODDA 2HOBA 2R2MB 4WY3A 2JKHA 1BB0B 1SGPE 1C2DA 2GZ9A 4KELA 2VGCC 1WBGB 1P2IA 4YM9A 1W3CA 3MO9A 4B2BA 4DOQA 3GY8A 1C1SA 4LZ1H 2RA0A 4I8GA 3HKIB 1HAVA 3T28A 2AMDA 2WPMS 1BTYA 2TBSA 3UR9A 1G3DA 4UDWH 2ZU5A 1F0SA 5E2OA 1QL7A 2QF3A 4O03A 4AFQA 2ZFQH 2O8UA 2BLOA 2ZFSA 2FI5E 2WV5A 5C5NA 3E0NB 1MTUA 1Y59T 1XVOA 3TJNA 5JB8S 1DVAH 2Q6GA 1C1MA 3QK1A 3V13A 6LPRA 4OGYA 1BTHH 5AFZH 3GCHC 2P94A 3T5FH 1O2XA 1SFIA 4XBCA 1LPZB 3ITIA 1SBWA 3BV9B 1UHBA 1ACBE 1OWHA 4MDSA 2PTNA 2ZG0H 3LJJA 4I7YH 1TAWA 1Y5AT 1C5XB 9LPRA 1FY8E 5EQSA 4FUDA 1SGEE 2ZGHA 5GWZA 4UONA 2H5CA 3K6ZA 3F6UH 2J2UA 3U69H 1GJ8B 1G3BA 1YPEH 2QCYA 1ZZZA 1D3TB 2GDDA 2CN0H 1ZR0A 4A1TA 1EZQA 5L6NH 1LCYA 1W13U 1THRH 4O3TA 3RMNH 1C9PA 1G32B 2QXIA 3SJOA 1ZPBA 1AWHB 2ZTYA 2A45B 4IS5A 3LC3A 3KGPA 1LHCH 1EOLA 4WH6A 3SUFA 2VU8E 1EAXA 1DY9A 4XSKU 5A2MH 3HGPA 4AFUA 5C1XA 3VEQB 4K69A 1C5MD 1V2QT 3QTOH 4ABGA 2ZU2A 1DM4B 2Z9GA 3CENA 3BG8A 4MQAA 3UQVA 1RTKA 4X1NU 3UUZA 1QCPA 2ZHWH 1K22H 1C5SA 2XBYA 2ANMH 1RFNA 4B1TA 2SGDE 1F5KU 2SGPE 1QR3E 4FU7A 5DPAA 1BTWA 1BOQA 1ZRKA 3BN9A 1QJ7B 3NK8A 1O2ZA 1PYTD 1FJSA 3ZYDA 1AVXA 1ZSJA 2JH0D 5BPEA 2QY0B 2XW9A 1MCTA 3KNXA 4K3JA 2Y81A 2O8MA 1C5TA 3NCLA 1HJ9A 1E38B 3HPTB 1S84A 1D6WA 3BEIB 5I25A 2UWLA 4MPUA 1UTOA 4E06H 1P3EA 3NXPA 1JIMA 2QF0A 4ISLA 3M3SA 2G81E 1AKSA 1QRWA 5FCKA 1GI3A 2ZU4A 1F5RA 1S81A 2FX6A 1HXFH 1PPCE 1UTQA 2J4IA 3NPSA 5HM9A 1DITH 3PTNA 1SLWB 3DFJA 1KXDA 1ESBA 1AZ8A 3SV9A 2WPKS 4LK4A 2FIRH 4I8LA 1OP8A 1YCPK 5EU8A 1IHTH 1UHBB 3BIUH 1NC6A 3FP8E 1BRAA 4A7IB 4Y76A 1BHXB 3UNQA 1LMWB 1FNIA 3ATIA 1G30B 1C5OH 2SNVA 1FV9A 4MTBA 2J95A 2BTCE 1QHRB 2H6MA 4IC5A 2F9BH 1UVSH 3TK5A 3KQDA 2Y5GA 1GDUA 2VIWA 1TRYA 5EODA 1Z1IA 4X2XA 7ESTE 1YLCA 2ZGXH 3NWUA 4LOYH 3Q00A 4FUCA 1V2TT 1A4WH 2ZA5A 1L2EA 2VIOA 3RXEA 2GKVE 2FP7B 1XM1A 4HFPB 1MU6B 3RXHA 1SI5H 2ZDMA 4Q7XA 5FPTA 2BQ7B 1W0ZU 1GVLA 4X8TH 1MUEB 2BD3A 3A7XA 1AO5A 4K8YA 2V6NA 2ZDAH 3D65E 2FLRH 1SGIB 3T26A 2F9PA 2B7DH 1C1QA 4SGAE 4Q80A 2Z9IA 2EA3A 1C5LH 1WOFA 3KL6A 4F4OC 1O5EH 2XNIA 4GAWA 2AS9A 5DG6A 1TNKA 2Y5HA 3OY5U 2GCTC 3RMOH 1G2LA 1C2EA 2ULLA 2NWNA 1YPHC 1ORFA 1MKXK 1ANCA 1HPGA 2HRVA 1E36B 4DY7B 4FVDA 1GI0A 1QQ4A 1SOZA 4NIVA 3M7UA 1GBMA 3V12A 4IMQA 1B0FA 4D9RA 3VXEH 1AFEH 3RMMH 3EGKH 1C1WH 2A7CA 4WMFA 4NA8A 3CP7A 1QGFA 3U8TH 3IITA 3RXUA 1MKWH 2TPIZ 2ZIQH 5DP5A 1Z6EA 2FDAA 1TQ0B 1LQDB 3TGJE 4B73A 1HAGE 1SPJA 2ZDVH 3DD2H 5EOKA 5E2PA 2GCHG 2OINA 4ABAA 4A92A 4DVAU 1OWDA 3T25A 5EPNA 1O34A 2O8TA 1D9IA 1Q3XA 2GMTB 2ZECA 1CVWH 5K7RA 1GJBB 1TPSA 2JETB 1U6QA 1W7GH 4Y7AA 1QA7A 1KSNA 4YZUA 1V2JT 1ARBA 3Q77A 4AYYB 2CXVA 2W3KA 1GBEA 5LGOA 2Z9LA 4MPWA 1LQEA 3LU9B 2BM2A 1O3FA 1OYTH 2ANWA 7KMEH 4YLUA 1JMOH 1ABIH 2P3UB 3KF2A 1GHAG 1O38A 1HV7A 1YPJH 4NSVA 2AGIX 1XUJA 2TGDA 2OC1A 3KQBA 4IBLH 3RXOA 4AB8A 2J92A 4RN6A 5JDUB 3A88A 2ZCLP 1O2JA 3RDZA 1CU1A 3QDZB 3DHKH 3GDSA 2BD9A 3ZZBA 3ZVGA 1OWEA 1TRMA 3L33A 4ESTE 2FS9A 3S7KB 2ILNA 2OUAA 1BBRK 1BMNH 1D3DB 1KYNA 3BG4B 1NRRH 2WINI 4UFEH 1BTPA 1IHSH 1VZQH 3L6PA 2Y7XA 2Q6DA 1OWJA 1SGQE 1D4PB 3LIWA 1DY8A 1DUEA 2WPLS 1ANEA 2VIQA 3OX7U 2GT8A 2ZC9H 3MU4A 1A5GH 1HRTH 2FPZA 3PWBA 3TJOA 1GG6C 5F03A 3F1SB 5E0HA 1NZQH 1KLTA 1C4V2 3VB5A 1YCPH 1HUTH 3PM3A 1LO6A 1TX7A 1O2GH 1NROH 2R3UA 5GPIB 2BZAA 2A5AA 2TGAA 3S7HB 1DXWA 1Y5UT 1KXBA 1GI7B 6CHAB 1XUFA 3BTKE 2O8LA 1GHBG 1THPB 4MPVA 4DW2U 2BLWA 2PSXA 1W2KH 1C2KA 2A32A 3SU2A 5EXLA 1S0QA 2SFAA 7GCHG 1CE5A 4AFSA 1IQKA 2GD4B 3ATMA 2QGRA 3Q3YA 5HM2A 2VIVA 1CHOG 3M7TA 1AQ7A 4AGKA 1K2I1 3M5LA 3EA7A 5E8EH 5DP7A 1ANBA 1SGRE 2BX3A 1VR1H 3SNCA 2VB0A 3SN8A 1C1RA 4DURA 1E35B 1H8IH 2C8WB 3GICB 1WU1A 3K9XB 1LKAA 1Y5BT 3FZZA 3SNAA 4I8JA 2Q6FA 1V2UT 3QN7A 1NN6A 1L0ZA 2ZQ1A 2WV4A 1J14A 2A1DB 4BANB 1T8LA 3ZZDA 2W26A 3MH5A 1HAVB 3H7OA 3D23A 3QZQA 1SOTA 1C4U2 2Z3EA 4E7NA 3GYLB 1O3HA 2BDIA 3F68H 1K9OE 1WAYB 1Q2WA 2FYQA 2OXSA 4JYTA 3VXFH 1K28D 3T2NA 4TPIZ 2IN2A 2ZTZA 1BUIA 1P02A 2FOAA 2OLGA 1UK4A 3RU4E 3UTUH 4JZEH 4GHQA 1RJXB 4D8NA 1CT4E 5IYTA 1Y3WA 1FN8A 2HNTF 2GV7A 1AY6H 2A4GA 4AB9A 3KCGH 1P11E 1S82A 1K1MA 1BBRE 4NFEA 2VVCA 3UNSA 4B75A 3V7TA 3SNDA 3URCA 1P09A 1F2SE 3LJOA 1H8DH 5JBCS 1SQOA 4I31A 1TBQH 3TGIE 3E16B 2ODQA 1A61H 5E0GA 3OU0A 3RM0H 3QUMP 1F7ZA 2Y6TA 3UNRA 1KXCA 1XXDA 1HBTH 2FOMB 2XC4A 3EAJA 3RC5A 3C1KA 4TPYA 5HXFA 1MQ6A 1QRZA 2BLVA 1FPHH 1C5PA 1AWFH 1HAPH 3ATKA 4ZXXH 1ZGIA 1UCYK 4NG9H 2STAE 4JYUH 1MKXH 1P01A 3KIDU 2GT7A 3RXTA 1Z7KA 4GUXA 5A09A 2PKAB 1N1LA 1G3CA 1T4UH 1HCGA 3RXIA 5C20A 1IQGA 1T8OA 3JZ1B 1V2VT 1SR5C 1O5FH 3PV4A 3MNCA 4JK5A 5DP4A 4NA7A 4Y8ZA 4FVBA 1OS8A 1GCTB 1GVZA 2JH6D 4ZXYH 2THFB 2ZGJA 3D49H 2VWLA 4GVUA 1J9CH 2QV1A 3A7ZA 1VITG 1GBHA 1GBAA 3MMGA 2F9UA 1V2RT 3LGTA 1O3GA 3E8LA 1DT2A 1K1NA 2Z9JA 5L2ZH 1XUHA 2J94A 3VB3A 3PLPA 1NPMA 4B76A 4INKA 1SGCA 1WCZA 1BTZA 3I77A 3P95A 4GCHF 2RG3A 2A5IA 9ESTA 1O2VA 3E3TA 1WV7H 4GSOA 2Q1JA 1BBRH 1SGNE 1ZJKA 1MCVA 3A7WA 1VITF 1C1TA 4YOGA 5JYIA 1IQIA 2P59A 1VGCB 1QL8A 1K1LA 1GPZA 4MNWA 1L4ZA 8ESTE 1FXYA 4X8UH 4SGBE 3A7TA 1L1JA 1LVBA 1PFXC 4IN2A 4NGAH 5LH8A 2HWLB 2P93A 3A8AA 4GCHG 2OQUA 3U1JB 4KKDA 4I8HA 3F9HA 1XXFA 3PYHA 1D6RA 4WWYA 2ZGCA 1QBNA 4X0WU 3S9BA 1G9IE 1EB1H 1YPMH 2AGEX 1O39A 4FU9A 1HNEE 3TJUA 2VWOA 1FZZA 2BY6X 4X6PA 3ZV8A 1AVGH 3SI3H 4RKOB 3MOCA 1AE5A 5FX5A 1L1NA 2ZHEH 2QXGA 4VGCC 1BMMH 4H6SB 3T62A 1K1JA 1SGTA 4FU8A 4ISHH 3UWJH 2ZWLH 1TRNA 5B6OA 3GDVA 2HLCA 1ETSH 2G5NA 1C2IA 1INCA 2WPIS 1XKBC 1P2QA 2P16A 1MTVA 8KME2 3AW1A 2C8YB 1ID5H 2NU4E 3ZZ6A 1G37A 1TMTH 2UWOA 4MNVA 3EYDA 2BD8A 3AVZA 4OGXA 1O2MA 4U30A 4YOIA 4TY6A 2BDHA 4NIXA 1A5IA 2QYIA 2SGAA 2I6QA 2PGBB 3H5CB 1GI8B 1RIWC 5EPYA 1CGHA 3GY6A 4X1PU 5SGAE 2BD2A 1EXFA 1MD7A 2KAIB 1Y3YA 1VITH 3I78A 2FM2A 4WJG2 1IOEA 1TABE 1XUIA 2GMTC 2F3CE 3D62A 3SQHE 3A86A 1E34B 1TMBH 2XCFA 1TGTA 1AB9C 4WH8A 4JK6A 4X1QU 5DP3A 1IQFA 1GBTA 1UO6A 1YPHE 4INHA 3ESTA 1ZHPA 1GI1A 4PROA 4FUGA 1G3EA 1GL1A 1TNGA 5GIBA 1DWDH 3M3VA 1QRXA 3UQOA 3TK6A 1XX9A 1GBBA 1WQVH 1CGJE 1EZXC 1BHXF 1GDQA 2P95A 1O3CA 2XRCA 1EP5A 4GPGA 1AB9B 2F9VA 5A8XA 2XC0A 3FP7E 3A7YA 5A0CA 1GHXH 1V2KT 1C2LA 1X7AC 1WUNH 1O3IA 3ZVBA 1YKTA 3B23B 3IG6B 4LXBH 1AN1E 1DANH 4A1XA 3ZZ8A 1ARCA 4H42U 4XOJA 1P9SA 4ZHMU 1O2IA 5C3NA 4B74A 4DGJA 2GCHF 1A46H 3P70B 1CA8B 3A8DA 1P2NA 3ZVDA 3TK9A 1GMHG 1HIAA 1E37B 1HFDA 3U8RH 1AKSB 5HMAA 7GCHF 1ZRBA 3TNSA 3ATLA 1BITA 3T29A 1OP0A 4I8KA 2W7UA 5DGJA 1JOUB 3Q3XA 3UOPA 3PMAB 2FOBA 1SLUB 4H6TA 3SHCH 1GI2A 1SSXA 1YP9A 2D1JA 1SC8U 2HPQH 2PSYA 3RXSA 1TOMH 2FEQH 2BXTH 5GDSH 1QBOA 3PWCA 1PJPA 1KLIH 4O9VA 5F8XA 3BTQE 1HDTH 3MU0A 2PGQB 1PQ8A 5A0AE 1KDQB 3UR6A 1MTSA 2F83A 1P05A 1O5BB 1T8MA 4FUIA 2FI4E 2V35A 5F8TA 1C5VA 3EA9A 2OC7A 1TX6A 1NFWA 1FIZA 2ZHDA 2QN5T 3GCHB 1J16A 8GCHF 1CA0C 1P10A 4IW4E 3PLBA 3O8CA 4CBNA 4UFDH 3E91A 1A3BH 3AAVA 3O8DA 4Z0KA 1QJ1B 1HGTH 5JBAS 1O3OA 3ZYEA 2ZHQH 1YM0A 1YYY1 4UE7H 3VFEA 3MI4A 4DT7B 1GHWH 1TGBA 3PO1C 4BAKB 1D3PB 4AYVB 1RXPA 1OX1A 4BXWA 2ZDKA 1LVOA 2FMJA 1PYTC 2DE9A 2YOLA 3MTYA 3Q76A 2PHBA 3P8GA 3VB6A 4KTUA 2D8WA 4K1TA 1ESTA 4U32A 3BIVH 2PUXB 3UPEA 2PR3A 1SHHB 2UUJB 2DE8A 3VGCB 1DE7H 2CF8H 1JXPA 1TGNA 2BY7X 5CHAC 1GL0E 3AASA 4Y8YA 1UMAH 3E90B 1CHOF 1O2WA 1AMHA 1ZTKA 1O3DA 1UJ1A 3E1XB 2ALPA 4K8BA 2J9NA 3U8OH 1FMGA 1GMDG 1PPFE 4NIYA 1LVYA 2RCEA 1CA0B 2J38A 1P57B 1GHBF 1ELDE 4MNYA 3SV2H 4CHAB 2AYWA 2BD5A 1H9IE 1TLDA 1GHAF 4Q7ZA 2BVRH 2TRMA 5GCHG 2PFEA 4X1RU 3PMBB 2GTBA 4NWLA 2Z9KA 3ZZ3A 1KXEA 2GVFA 2ZF0H 1BMLA 4WXIA 1N8OC 3TU7H 2OBQA 2BVXH 1AU8A 1IQJA 2TIOA 1HJAB 4E05H 1BZXE 1V2WT 1WYKA 2VVVA 1BQYA 1S6HA 4CHAC 3A81A 3QGJA 4UD9H 2ZPSA 1GMCF 2AFQB 5C1YA 3SJKA 1GG6B 1NRSH 2D2DA 2FOGA 2ANKH 3ZZ4A 3SBKA 1GJDB 2H9EH 2XCNA 2UWPA 1MKWK 5FBIA 2WUBA 4DJZB 4XBBA 1C1PA 2CJIA 4XDEA 1IQLA 2A31A 2ZFRH 2B8OH 1KTTB 1ZPCA 2BY5X 4CRCA 3FZDA 1SGYE 2GX4A 3SU3A 4CRBA 2CV3A 1GI4A 1B5GH 2PTCE 3RM2H 2FO9A 4ABBA 1V2PT 1O3NA 4AFZA 1LHFH 3RXJA 1O5GH 1VCPA 3ZZ7A 1SLXB 2OC0A 2ESTE 2I6SA 2XC5A 1ZMNA 3M5NA 4AGJA 3LONA 2P8OC 1GJ6A 4IGDA 4ZKNU 3VGCC 4AN7A 3M36A 4XE4A 1JRSA 4B2AA 1C1VH 1GJAB 3BTDE 2HNTE 1SG8B 2ODYB 5FCRA 1MD8A 5JBTA 4AORA 1GGDC 8LPRA 1ZMLA 2Y82A 1DWEH 5L30H 3BEUA 3MU5A 3Q3KA 5PTPA 3P6ZB 3SNBA 1O3LA 4Y0YE 1JWTA 3UWIA 2NU0E 2ZTXA 1NM6A 1GMDF 5J4QA 1BJUA 3MH4A 1C1UH 1KIGH 3RXCA 1TWXB 1ELTA 2XBWA 1O30A 3QLPH 1ZLRA 2W7SA 3BTTE 3SZNA 1EPTB 5DJ7A 3AW0A 5C67A 2AEIH 3SV6A 1DOJA 2AERH 1LVMA 2XYAA 4D76A 1KDQA 1O2YA 1G2MA 3V3MA 3SU4A 3MO3A 1S6FA 1RRKA 3JZ2B 1C5YB 3PMJA 3BTGE 5K0HA 3E6PH 4NSYA 5A8ZA 2SGFE 3MH6A 4CRAA 1TPOA 3RXAA 2EEKA 4LZ4B 3S9CA 3BSQA 1GJ7B 1TE0A 1ZSLA 1O2OA 4YOJA 3PROA 1NFUA 1LHEH 1QNJA 2NU2E 3H7TA 1GI9B 1UVUH 1ZJDA 4TWWA 3SU1A 1XMNB 3UY9A 2IJOB 1HYLA 3FP6E 1EOJA 1F92A 1C5QA 2V3HH 1K1PA 3T27A 2EI8A 3LH3A 2F9OA 3HATH 3P92A 4OS1A 3EQ0H 4YTAA 1A0JA 1EPTA 4ZKSU 4WXVA 3KQEA 1GWAA 1C5ZB 1SQAA 4OS2A 2HPPH 2VINA 2FXRA 2ZCHP 1LHDH 1RD3B 2OQ5A 3RP2A 4BTIB 3GCTF 1Z8GA 2UUKB 1C2GA 3FANA 2ZP0H 2A4RA 1HIAB 3A84A 2Z7FE 1CSOE 1EJAA 4I33A 2BZ6H 1HAZB 2ZEBA 2XBVA 1GI5A 2XXLA 1N6XA 3RU4D 4BAQB 2CHAC 2A2XH 2IPHA 4JYVH 2H5DA 3SQEE 2ASUB 5TCCA 3DA9B 4BOHA 1A2CH 1TOCB 3LOXA 4ISOA 4WMEA 3SUDA 5T6GA 3GCOA 1GDNA 3TIUA 2P3FH 3P8NA 1O35A 1BRUP 5C2ZA 3ATWA 4X2WA 1QY6A 4GLYA 1HJ8A 2B0FA 2FOHA 5IDKA 1O3EA 3K2UA 2AIPA 4M7GA 3PLKA 5HYOA 2C8XB 5A0BA 1BCUH 1RGQA 1DLKB 3DUXH 3TH4H 1MAXA 1V2MT 4AZ2B 1AI8H 1EPTC 5EG4A 1LDTT 3GY2A 1H9HE 3GY5A 2PWXA 1GCTC 3RXQA 2Z3DA 2KAIA 1UTPA 1FI8A 3ZZAA 1Z8JB 5EXMA 1EUFA 1WTHD 4FUJA 2GCTB 1ZYOA 1C2MA 1RIWB 2ZKSA 1GI6A 2G00A 4ABDA 4RKJB 2ZQ2A 3TPIZ 4ABHA 1MQ5A 2WPJS 3AAUA 1VCQA 1WSSH 1YLDA 5LPFA 6GCHF 2G4TA 1BA8B 1FQ3A 1GHVH 3PO1B 4TWYA 3A85A 3TLOA 1K21H 1K1IA 3LH1A 3MO6A 1MZAA 3C27B 5JPMH 5F6MA 2K1QA 1XKAC 3ZZCA 4Y7BA 1FY5A 4U2WA 1ZSKA 1FLEE 2O8WA 1AHTH 1A1RA 1BMAA 1T8NA 2J34A 3BTME 4CR9A 6CHAC 3M3TA 1P03A 4NZQA 4NIWA 1LPKB 5DKMA 4IC6A 1TGSZ 1BDAA 1IQHA 2FYRA 4DG4A 3E0PB 1ELEE 3SGAE 2FOCA 4ZKRU 1FUJA 1O2QA 1GMCG 3SJ9A 5AVDA 1DLEA 1OXGA 4RSPA 2LPRA 1FIWA 1Y3XA 3LGUA 1V3XA 1CBWB 2SGQE 1P06A 4BTUB 3SJIA 1UTJA 1OP2A 1PQ7A 2UUYA 4O3UA 4KGAA 4X8SH 2PUQH 2IOTA 1DFPA 1P2OA 3GY7A 4I32A 2G52A 4HGCA 1JIRA 1LTOA 2DUCA 2W5EA 1T32A 4H4FA 1E0FD 2XWBI 1ABJH 1P04A 2OTVA 4BAOB 4MLFB 1BTXA 3PTBA 2HVXA 4UEHH 1XVMA 3PMHB 3DT0H 2GGVB 2BDBA 2H9HA 4GHTA 3SUEA 5CE1A 2D26C 1UK2A 1NESE 4OS6A 1GJ4H 1GMHF 1SL3A 1AE8H 1A0HB 2Z94A 1AZZA 1TA2A 1LKBA 1A0LA 4X6OA 4UFGH 1P9UA 3I29A 4Z6AH 3TVJB 1NU9A 1DXPA 1GBJA 3TH2H 4JZDH 2Y7ZA 2W3IA 3BG4C 3ZZ9A 1FY4A 2PW8H 1CHGA 1GBFA 1OOKB 3HK6B 1ZTJA 4Y10E 5JB9S 3RXGA 2BQWB 1SGFG 3UREA 4ABFA 2ZHFH 2PLXA 5FAHA 2ALVA 4CRDA 3HKJB 3SGBE 2VIDA 1O2UA 1H1BA 2GZ7A 1Z71A 5CHAB 1MH0A 1O2SA 3NUMA 4WMDA 4CH2B 5ESBA 1GVKB 1IQEA 2FI3E 2A2QH 2ZCKP 1F5LA 1EJNA 3W94A 1EJMA 3UFAA 1W7XH 1F0UA 5GCHF 3CS7A 5FPYA 5G4BA 1EZUC 1C2FA 1ELVA 1O36A 1LHGH 5ABWA 2VGCB 1J17T 4DCDA 4OS7A 3MNSA 5EQQA 1J15A 1W8BH 3SV7A 4O97A 1K1OA 1NY22 1T31A 2BDAA 3M35A 4R8TB 1TPAE 3QZRA 4JMYA 1NT1A 6GCHG 3OTJE 3GDUA 1O2PA 5EGMA 1V2NT 4HZHA 1WQSA 2A7JA 1GBKA 1QQUA 4X6NA 1Z8IB 1YCPM 3RXDA 1TB6H 1G36A 3K6YA 2ZPQA 1V2LT 2A4OA 1GBDA 1O3JA 2R9PA 4MPXA 8GCHG 3URDA 4Y71A 2JH5D 1AFQC 1B7XB 3ZVFA 5LPEA 3RMLH 6ESTA 2Y5FA 3LPRA 3RC4A 1TX8A 2PKSC 3QTVH 2VH6A 2AMQA 3P8FA 1CQQA 3FAOA 2BDGA 1O0DH 4Y8XA 4A6LA 2ZFFH 4Q7YA 3LGYA 2ZI2H 1Z8RA 1ZOMA 3SOSA 5BRRE 1O2KA 4K1EA 1FY1A 3PB1E 3RXKA 3LGIA 2BDCA 3MWIU 4BXSA 3HK3B 1TA6A 4IMZA 1WTGH 4BAMB 3A87A 3W95A 5EXNA 4Y79A 2F91A 1N8OB 2AMPA 2HGTH 1T4VH 2QIQA 1NTPA 3ZVCA 1PQ5A 1QB9A 3LC5A 2TGTA 3A82A 2FZZA 2LNCA 1TONA 2C93B 2AIQA 4OS5A 1A3EH 1Z1JA 4K60A 2FODA 1AGJA 2VWMA 3P8OA 3FVFB 4YT7H 4XFQA 3M5MA 1C5WB 4HTCH 1TNIA 1UTLM 3BTFE 1CT2E 1P0SH 3P17H 1DPOA 1D3QB 2RA3A 3RXFA 1NFYA 1PPEE 1SLVB 2V3OH 4YO9A 3A89A 1SQTA 3RC6A 1S83A 1S85A 1V2OT 5EW1H 1P3CA 3M7QA 4K5ZA 2EI7A 4ISNA 1OKXA 1VJ9U 2C90B 1C4Y2 3SHAH 4KTSA 2HALA 2PKAA 3MH7A 1UVOA 4U01A 3RLWH 3SW2B 2ZDNA 2STBE 3A8BA 3ENSB 1AIXH 5LPRA 1V2ST 2BX4A 2GP9B 2EI6A 2A4QA 3SORA 2VJ1A 3MU1A 1AFQB 2ZPRA 4OS4A 3S69A 3S0NA 1PQAA 3ZV9A 7LPRA 1QL9A 2SGEE 3SUGA 1QIXB 1QB1A 2QXJA 1S5SA 3GISB 1GBLA 2ODPA 1TBRH 5FX6A 3G01A 1MBMA 1Z6JH 1C1OA 2BQ6B 1ELCA 5E0JA 3VB7A 3LGVA 2BD7A 1O5AB 3UIRA 2P8OB 3FFGA 3QX5H 4ABJA 3VPKA 3GY4A 4AG2A 3F9FA 2FESH 1UCYH 2GZ8A 1HAIH 1O3MA 2GV6A 2C8ZB 3MNXA 2XBXA 5I46H 1BRCE 4TY7A 1HAXB 1MAYA 2YNBA 1UK3A 5C5OA 1MBQA 3LKWA 3V0XA 4ABEA 2ZU3A 3M61U 4JZIA 3BTEE 3R0FA 1L1GA 1P2JA 5FPSA 1UVTH 4ZAEA 1QJ6B 1YF4A 3SU6A 2NU3E 1ELAA 4UFFH 3F9EA 1N6YA 2CMYA 1P12E 1MMJN 4INLA 1YC0A 1TNLA 1FAXA 1DDJA 1JRTA 1A5HA 1W11U 1AUTC 2BY9X 2OCVB 1O2NA 4CR5A 3ZZ5A 1C2HA 2M5TA 4CH8B 1W10U 1EATA 1SMFE 5L2YH 5C1UA 1ZMJA 1HB0B 4JZ1A 4IN1A 1KXAA 4ISIH 4BTTB 1GJ9B 5EW2H 3OYPA 3K65B 1NRNH 4CBOA 2FOEA 1BJVA 1HJAC 4CREA 2WYJA 4JCNA 3RXRA 1IQMA 1F0TA 1GBIA 4WF8A 2QXHA 4X1SU 1MTNC 1FDPA 4D7GA 5TCAA 1GBCA 1RTLA 1T7CA 2VVUA 1VGCC 2XWAA 3TJVA 3O8RA 1VJAU 4DIIH 2PV9B 1CBWC 5FXLA 1OWKA 2VIPA 2UUFB 1W0YH 1YPLH 3GOVB 4A1VA 4X8VH 4BAHB 3SO3A 4ZMAH 5T6DA 3KN2A 2OD3B 5JBBS 1HLTH 1HAOH 5CMXH 3UOUA 1ESAA 2BB4A 3EE0B 5DP6A 1NO9H 1CT0E 1ZHRA 3ODFA 4J2YB 3OSYA 1UVPA 1BT7A 2YNAA 1B0EA 1DS2E 1SB1H 2QC2A 1C2JA 1MZDA 5DP8A 2BD4A 1DSTA 2JETC 3RXPA 1UCYE 2G55A 1PPGE 1Y8TA 2H1UA 1OPHB 1J8AA 1RS0A 3SU5A 3MNBA 1V6DA
chains in the Genus database with same CATH superfamily
3SNEA 2J97A 1L4DA 1XUGA 1JBUH 3MQKC 1QURH 4X6MA 2R0LA 1P2MA 1O33A 3QO6A 4D7FA 3NKKA 1PPBH 4CRFA 3BEFB 3OAAD 1M9UA 1F0RA 1NRPH 2FX4A 2FTMA 1SFQB 5F8ZA 2CGAA 3A83A 1ZHMA 4JZFH 1H9LB 5A8YA 1SVPA 1C9TA 1P8VC 3GY3A 1GJCB 1THSH 2EC9H 4VGCB 1O3BA 1UTNA 5ESTE 3MFJA 1LPGB 2AHME 2BMGB 4WVPE 1TPPA 1P2KA 1BTUA 2ZNKH 3PRBA 1ELFA 2ANYA 5GJ4B 4MNXA 3RXMA 1EQ9A 1YPKH 1FAKH 3WY8A 3N7OA 2WUCA 3ELAH 4F49A 2HVYB 1ETRH 1PPZA 3F9GA 3GYMA 1TMUH 2ZZUH 4FXGH 1AUJA 2BVSH 1OSSA 2WPHS 3ZVAA 5DN6D 4KP0A 2IJD1 1E79D 2ZGBH 1DSUA 4FUFA 1YGCH 5AFYH 4MG3A 3R3GB 3NZIA 2SNWA 4YT6H 3MYWA 2QAAA 1KY9A 2AH4X 1EKBB 3DSPA 2QA9E 5ETXA 4ASHA 4TSFD 1NFXA 1FPCH 3QGNB 2Z6BD 2VH0A 2R0KA 2BXUH 1UTMA 3ZVEA 3VB4A 1DUAA 5FHTA 4NFFA 2NU1E 1XUKA 3STIA 3TITA 2HNTC 3WWBA 3SI4H 1ZTLA 2H2ZA 1EAWA 1O31A 3GCNA 1C5NH 4NWKA 3SV8A 2FS8A 2BY8X 1GCDA 3A7VA 1MU8B 4AX9H 1MTWA 4A5TS 4NZLA 1O37A 2XNDD 4KTCA 3GCTG 4Y11E 1TNJA 2BOKA 2FOFA 3FOAA 2OC8A 3PV2A 4Y0ZE 3EE7A 1BRBE 1O5DH 1YPGH 3SYJA 3MU8A 3MHWU 4D9QA 1WXRA 5J4SA 3RLYH 3M5OA 1NRQH 5FL7D 1TYNA 5GXPA 1GHZA 2B5TB 1VKYA 1W12U 1ZGVA 1HAHH 1SGDE 4FUBA 3U9AH 3LGWA 4B6FA 1EZSC 3RXLA 4YLQH 2Y80A 1S0RA 1YBWA 1DWCH 1O5CB 4NA9H 1ZPZA 2OP9A 3LT3A 2FWWA 1ANDA 2BLQA 4ZUHA 4Y6DA 1IAUA 2GDEH 3KEEA 3S9AA 1FONA 1QBVH 2XTTB 4ZROA 1QTFA 2H9TH 3BF6H 2O9QA 4X2YA 4YESB 1SGFA 5DK1A 1KTSB 1GGDB 2G5VA 5TJXA 4BNRA 2OBOA 2ZFPH 4XBDA 1HAYB 1TFXA 1C1NA 1EP6A 1TALA 4J1YA 1EAUA 3L3TA 3M37A 1W14U 1Y3UA 2CF9H 3EA8A 1TIOA 3BTHE 4K1SA 2AGGX 2ZO3H 1C5UA 1O2LA 2BHGA 4X2VA 1KXFA 3RXBA 1FN6A 4AG1A 4QT8C 4THNH 2V0BA 1UTKA 5DO4H 2R2WU 5GNDA 1OYQA 3EDXB 1BIOA 4MVNA 3SGQE 4E7RG 3WWFA 1O2RA 2A7HA 3KHVA 1TGCA 1ETTH 4Q63A 3F2FA 2C3SA 2G4UA 1QA0A 3AK5A 3U98H 5EIYA 1EX3A 3O8BA 3TH3H 1DX5M 3U1IB 1C5RA 1AVWA 1Q31A 1VCWA 5T3HA 1MTNB 1TQ7B 5AF9H 2A0QB 1TBZH 1COWD 4ZHAA 1O2TA 5T6FA 2R3YA 4ZH8A 1GJ5H 3A8CA 4NCYA 3BTWE 5EQRA 3TNTA 1A7SA 3PRDA 5DP9A 4TYDA 3SJ8A 1HXEH 2CHAB 5HGGA 4R0IA 1GHYH 2B9LA 4HI3A 2TGPZ 3OY6U 2VWNA 3IWMA 4B71A 2Z3CA 3TGKE 1QB6A 1TNHA 1Y3VA 4AOQA 3RU4T 3KQCA 1PPHE 2PKSB 3PV5A 4ZKOU 1O32A 2G51A 3HGNA 2FLBH 3LDXH 4ZHLU 5FBEA 5H4IB 4XD7D 2BOHB 5AHGH 1DICA 1SHYA 2WYGA 1OWIA 2ZU1A 1ELGA 1FY3A 1KLJH 2A5KA 1QFKH 2RDLA 4ASUD 4Q2KA 1O3KA 1ELBA 4CRGA 1AD8H 2ZFTA 1O3AA 3A80A 1IQNA 2C4FH 2ZDLA 3STJA 3B9FH 4K2YA 1CO7E 4ABIA 1DWBH 1NS3A 1O3PB 1EB2A 2BDYA 3QWCH 3CS0A 1EASA 2BYAX 1EAIA 3DFLA 1NU7B 1CGIE 4DIHH 2FTLE 1RTFB 3SU0A 1H4WA 4FUEA 2VNTA 4B2CA 3B8JA 1O2HA 4FUHA 2G8TA 3RUOA 3RXVA 2F9NA 2P3TB 3ODDA 2HOBA 2R2MB 4WY3A 2JKHA 1BB0B 1YWUA 1SGPE 1C2DA 2GZ9A 4KELA 2VGCC 1WBGB 1P2IA 4YM9A 1W3CA 3MO9A 4B2BA 4DOQA 3GY8A 1C1SA 4LZ1H 2RA0A 4I8GA 3HKIB 1HAVA 3DCLA 5C0TA 3T28A 2AMDA 2WPMS 1BTYA 2TBSA 3UR9A 1G3DA 4UDWH 2ZU5A 1F0SA 5E2OA 1QL7A 2L6OA 2QF3A 4O03A 4ACBA 2F43B 2ZFQH 4AFQA 2O8UA 2BLOA 2ZFSA 2FI5E 2WV5A 5C5NA 3E0NB 1MTUA 1NBMD 1Y59T 1XVOA 3TJNA 5JB8S 1DVAH 2Q6GA 1C1MA 3QK1A 3V13A 6LPRA 4OGYA 1BTHH 5AFZH 3GCHC 3OE7D 2P94A 3T5FH 1O2XA 1SFIA 4XBCA 1LPZB 3ITIA 1SBWA 3BV9B 1UHBA 5EJ1A 1ACBE 1OWHA 4MDSA 2PTNA 2ZG0H 3LJJA 4I7YH 1TAWA 1Y5AT 1C5XB 9LPRA 1FY8E 5EQSA 4FUDA 1SGEE 2ZGHA 5GWZA 4UONA 2H5CA 3K6ZA 3F6UH 2J2UA 3U69H 1GJ8B 1G3BA 1YPEH 2QCYA 1ZZZA 1D3TB 2GDDA 2CN0H 1ZR0A 4A1TA 1EZQA 5L6NH 1LCYA 1W13U 1THRH 4O3TA 3RMNH 1C9PA 1G32B 2QXIA 3SJOA 1ZPBA 1AWHB 2ZTYA 2A45B 5C94A 4IS5A 3LC3A 3KGPA 1LHCH 1EOLA 4WH6A 3SUFA 2VU8E 1EAXA 1DY9A 4XSKU 5A2MH 3HGPA 4AFUA 1SKYE 5C1XA 3VEQB 4K69A 1C5MD 1V2QT 3VG8A 3QTOH 4ABGA 2ZU2A 1DM4B 2Z9GA 3CENA 3BG8A 4MQAA 3UQVA 1RTKA 4X1NU 3UUZA 1QCPA 2ZHWH 1K22H 1C5SA 2XBYA 2ANMH 1RFNA 4B1TA 2SGDE 1F5KU 1W0JD 2J98B 2SGPE 2YMSB 1QR3E 2LP6A 4FU7A 5DPAA 1BTWA 3N99A 1BOQA 4F48B 1ZRKA 3BN9A 2V3MA 1QJ7B 2EQNA 3NK8A 1O2ZA 1PYTD 1FJSA 3ZYDA 3UAIC 1AVXA 1ZSJA 2JH0D 5BPEA 2QY0B 2XW9A 1MCTA 3KNXA 4K3JA 2Y81A 2O8MA 1C5TA 3NCLA 1HJ9A 1E38B 2JJ1D 3HPTB 1S84A 1D6WA 3BEIB 5I25A 2UWLA 4MPUA 3DSGA 1UTOA 4E06H 2W6JD 1P3EA 3NXPA 4M9FA 1JIMA 2QF0A 4ISLA 3M3SA 2G81E 1AKSA 1QRWA 5FCKA 1GI3A 2ZU4A 1F5RA 1S81A 2FX6A 1HXFH 1PPCE 1UTQA 2J4IA 3NPSA 5HM9A 1DITH 3PTNA 1SLWB 3DFJA 1KXDA 1ESBA 1AZ8A 3SV9A 2WPKS 4LK4A 2FIRH 4I8LA 1OP8A 1YCPK 5EU8A 1IHTH 1UHBB 3BIUH 1NC6A 3FP8E 1BRAA 4A7IB 4Y76A 1BHXB 3UNQA 1LMWB 1FNIA 3ATIA 1G30B 4Q4LA 1C5OH 2SNVA 1FV9A 4MTBA 2J95A 2BTCE 1QHRB 2H6MA 4IC5A 2F9BH 1UVSH 3TK5A 3KQDA 2Y5GA 1GDUA 2VIWA 1TRYA 5EODA 1Z1IA 4X2XA 7ESTE 1YLCA 2ZGXH 3NWUA 4LOYH 5IK2D 3Q00A 4FUCA 1V2TT 1A4WH 2ZA5A 1L2EA 2VIOA 3RXEA 2GKVE 2FP7B 1XM1A 4HFPB 1MU6B 3RXHA 1SI5H 2ZDMA 4Q7XA 5FPTA 2BQ7B 1W0ZU 3FKSD 1GVLA 4X8TH 1MUEB 2BD3A 3A7XA 1AO5A 4K8YA 2V6NA 2ZDAH 3D65E 2FLRH 1SGIB 3T26A 2F9PA 2B7DH 1C1QA 4SGAE 4Q80A 2Z9IA 1QZ8A 2EA3A 1C5LH 1WOFA 3KL6A 4F4OC 1O5EH 2XNIA 2WHXA 4GAWA 2AS9A 5DG6A 1TNKA 2Y5HA 3OY5U 2GCTC 3RMOH 1G2LA 1C2EA 2ULLA 2NWNA 1YPHC 1ORFA 1MKXK 4HG6A 1ANCA 1HPGA 2HRVA 1E36B 4DY7B 4FVDA 1GI0A 1QQ4A 1SOZA 4NIVA 3M7UA 1GBMA 3V12A 4IMQA 1B0FA 4D9RA 3VXEH 1AFEH 3RMMH 3EGKH 1C1WH 2A7CA 4WMFA 4NA8A 3CP7A 1QGFA 3U8TH 3IITA 3RXUA 3GS9A 1MKWH 2TPIZ 2ZIQH 5DP5A 1Z6EA 2FDAA 1TQ0B 1LQDB 3TGJE 4B73A 1HAGE 1SPJA 2ZDVH 3DD2H 5EOKA 5E2PA 2GCHG 2OINA 4ABAA 4A92A 4DVAU 1OWDA 3T25A 5EPNA 1O34A 2O8TA 1D9IA 1Q3XA 2GMTB 2ZECA 1CVWH 5K7RA 1GJBB 1TPSA 2JETB 1U6QA 1W7GH 4Y7AA 1QA7A 1KSNA 4YZUA 1V2JT 1ARBA 3Q77A 4AYYB 2CXVA 2W3KA 1GBEA 5LGOA 2Z9LA 4MPWA 1LQEA 3LU9B 2BM2A 1O3FA 1OYTH 2ANWA 7KMEH 4YLUA 1JMOH 1ABIH 2P3UB 3KF2A 1GHAG 1O38A 1HV7A 1YPJH 4NSVA 2AGIX 1XUJA 2TGDA 2OC1A 3KQBA 4IBLH 3RXOA 4AB8A 2J92A 4RN6A 5JDUB 3A88A 2ZCLP 1O2JA 3RDZA 1CU1A 3QDZB 3DHKH 3GDSA 2BD9A 3ZZBA 3ZVGA 3OEHD 1OWEA 1TRMA 3L33A 4ESTE 2FS9A 3S7KB 4DT4A 2ILNA 2OUAA 1BBRK 1BMNH 1D3DB 1KYNA 3BG4B 1NRRH 2WINI 1E1QD 4UFEH 1BTPA 1IHSH 1VZQH 3L6PA 2Y7XA 2Q6DA 1OWJA 4RT0A 1SGQE 1D4PB 4XRNA 3LIWA 1DY8A 1DUEA 2WPLS 1ANEA 2J5UA 2VIQA 3OX7U 2GT8A 4FETA 2ZC9H 3MU4A 1A5GH 1HRTH 2FPZA 3PWBA 3TJOA 3NRLA 1GG6C 5F03A 3F1SB 5E0HA 1NZQH 1KLTA 1C4V2 3VB5A 1YCPH 1HUTH 3PM3A 1LO6A 1TX7A 1O2GH 1NROH 2R3UA 5GPIB 2BZAA 2A5AA 2TGAA 3S7HB 1DXWA 4B6EA 5C17A 1Y5UT 1KXBA 1GI7B 6CHAB 1XUFA 3BTKE 2O8LA 1GHBG 1FX0B 1THPB 4MPVA 4DW2U 2BLWA 2PSXA 1W2KH 1C2KA 2A32A 3SU2A 3U28C 5EXLA 1S0QA 2SFAA 1H8ED 7GCHG 1CE5A 4AFSA 1IQKA 2GD4B 3ATMA 2QGRA 3Q3YA 5HM2A 2VIVA 1CHOG 1MABB 3M7TA 3F3BA 1AQ7A 4AGKA 1K2I1 3M5LA 3EA7A 5E8EH 5DP7A 1ANBA 1SGRE 2BX3A 1VR1H 3SNCA 2VB0A 4Z1MD 3SN8A 1C1RA 4DURA 1E35B 1H8IH 2PP6A 2C8WB 5F53A 3GICB 1WU1A 3K9XB 1LKAA 1Y5BT 2YMSD 3FZZA 3SNAA 4I8JA 2Q6FA 1V2UT 3QN7A 1NN6A 1L0ZA 2ZQ1A 2WV4A 1J14A 2A1DB 4BANB 1T8LA 3ZZDA 2W26A 3MH5A 1HAVB 2CK3D 3H7OA 3D23A 3QZQA 1SOTA 4ZCNA 1C4U2 2Z3EA 4E7NA 3GYLB 1O3HA 2BDIA 3F68H 1K9OE 1WAYB 1Q2WA 2FYQA 2OXSA 4JYTA 3VXFH 1K28D 3T2NA 4TPIZ 2IN2A 2ZTZA 1BUIA 1P02A 2FOAA 2OLGA 1UK4A 3RU4E 3UTUH 4JZEH 4GHQA 1RJXB 3KYFA 4D8NA 1CT4E 5IYTA 1Y3WA 1FN8A 2HNTF 2GV7A 1AY6H 2A4GA 4AB9A 3KCGH 1P11E 1S82A 1K1MA 1BBRE 4NFEA 2VVCA 3UNSA 4B75A 3V7TA 3SNDA 3URCA 1P09A 1F2SE 3LJOA 1H8DH 5JBCS 1SQOA 4I31A 1TBQH 3TGIE 3E16B 2ODQA 1A61H 5E0GA 2JJ2D 3OU0A 3RM0H 3QUMP 1F7ZA 2Y6TA 3UNRA 1KXCA 1XXDA 1HBTH 2FOMB 2XC4A 3EAJA 3RC5A 3C1KA 4TPYA 5HXFA 1MQ6A 1QRZA 2BLVA 1KMHB 1FPHH 1C5PA 1AWFH 1HAPH 3ATKA 4ZXXH 1ZGIA 1UCYK 4NG9H 2STAE 4JYUH 1MKXH 1P01A 3KIDU 2GT7A 3RXTA 1Z7KA 4GUXA 5A09A 2PKAB 1N1LA 1G3CA 1T4UH 2W6ID 1HCGA 3RXIA 5C20A 1IQGA 1T8OA 3JZ1B 1V2VT 1SR5C 1O5FH 3PV4A 3MNCA 4JK5A 5DP4A 4NA7A 4Y8ZA 4FVBA 1OS8A 1GCTB 1GVZA 2JH6D 4ZXYH 2THFB 2ZGJA 3D49H 2VWLA 4GVUA 1J9CH 2QV1A 3A7ZA 4P02A 1VITG 1GBHA 1GBAA 3MMGA 3H09A 2F9UA 1V2RT 3LGTA 1O3GA 3E8LA 1DT2A 1K1NA 2Z9JA 5L2ZH 1XUHA 2J94A 3VB3A 3PLPA 1NPMA 4B76A 4INKA 1EFRD 1SGCA 1WCZA 1BTZA 3I77A 3P95A 4GCHF 2RG3A 2A5IA 9ESTA 1O2VA 3E3TA 1WV7H 4GSOA 2Q1JA 1BBRH 1SGNE 1ZJKA 1MCVA 3A7WA 1VITF 1C1TA 4YOGA 5JYIA 4I86A 1IQIA 2P59A 1VGCB 1QL8A 1K1LA 1GPZA 4MNWA 1L4ZA 8ESTE 1FXYA 4X8UH 4SGBE 3A7TA 1L1JA 1LVBA 1PFXC 4IN2A 4NGAH 5LH8A 2HWLB 2P93A 3A8AA 2OK5A 4GCHG 2OQUA 3U1JB 4KKDA 4I8HA 3F9HA 1XXFA 3PYHA 1D6RA 4WWYA 2ZGCA 1QBNA 4X0WU 3S9BA 1G9IE 1EB1H 1YPMH 2AGEX 1O39A 4FU9A 1HNEE 3TJUA 2VWOA 1FZZA 2BY6X 4X6PA 3ZV8A 1AVGH 3SI3H 4RKOB 3MOCA 1AE5A 5FX5A 1L1NA 1H8HD 2ZHEH 2QXGA 4VGCC 1BMMH 4H6SB 3T62A 1K1JA 1SGTA 4FU8A 4ISHH 3UWJH 2ZWLH 1TRNA 5B6OA 3GDVA 2HLCA 1ETSH 2G5NA 1C2IA 1INCA 2WPIS 1XKBC 1P2QA 2P16A 1MTVA 8KME2 3AW1A 2C8YB 1ID5H 2NU4E 3ZZ6A 1G37A 1TMTH 2UWOA 4MNVA 3N7EA 2IPQX 3EYDA 2BD8A 3AVZA 4OGXA 1O2MA 4U30A 4YOIA 4TY6A 2BDHA 4NIXA 1A5IA 4F55A 2QYIA 2SGAA 2I6QA 2PGBB 3H5CB 1GI8B 1RIWC 5EPYA 1CGHA 3GY6A 4X1PU 5SGAE 2BD2A 1EXFA 1MD7A 2KAIB 1Y3YA 1VITH 3I78A 2FM2A 4WJG2 1IOEA 1TABE 1XUIA 2GMTC 2F3CE 3D62A 5CDFE 3SQHE 3A86A 1E34B 1TMBH 1S6LA 2XCFA 1TGTA 1AB9C 4WH8A 4JK6A 4X1QU 5DP3A 1IQFA 1GBTA 1UO6A 1YPHE 4INHA 3ESTA 1ZHPA 1GI1A 4PROA 4FUGA 1G3EA 1GL1A 1TNGA 5GIBA 1DWDH 3M3VA 1QRXA 3UQOA 3TK6A 1XX9A 1GBBA 1WQVH 1CGJE 1EZXC 1BHXF 1GDQA 2P95A 1O3CA 2XRCA 1EP5A 4GPGA 1AB9B 2F9VA 5A8XA 2XC0A 3FP7E 3A7YA 5A0CA 1GHXH 1V2KT 2KM0A 1C2LA 1X7AC 1WUNH 1O3IA 3ZVBA 1YKTA 3B23B 3IG6B 4LXBH 1AN1E 1DANH 4A1XA 3ZZ8A 1ARCA 4H42U 4XOJA 1P9SA 4FOUC 4ZHMU 1O2IA 5C3NA 1W0KD 3F2GA 2QF5A 4B74A 2GCHF 4DGJA 1A46H 3P70B 1CA8B 3A8DA 1P2NA 3ZVDA 3TK9A 1GMHG 1HIAA 1E37B 1HFDA 3U8RH 1AKSB 5HMAA 7GCHF 1ZRBA 3TNSA 3ATLA 1BITA 3T29A 1OP0A 4I8KA 2W7UA 5DGJA 1JOUB 3Q3XA 3UOPA 3PMAB 3OTPA 2FOBA 4YXWD 1SLUB 4H6TA 3SHCH 1GI2A 1SSXA 1YP9A 2D1JA 1SC8U 2HPQH 2PSYA 3RXSA 1TOMH 2FEQH 2BXTH 5GDSH 1QBOA 3PWCA 1PJPA 1KLIH 4O9VA 5F8XA 3BTQE 1HDTH 3MU0A 2PGQB 1PQ8A 5A0AE 1KDQB 3UR6A 1MTSA 2F83A 1P05A 1O5BB 1T8MA 4FUIA 2FI4E 2V35A 5F8TA 1C5VA 3EA9A 2OC7A 1TX6A 1NFWA 1FIZA 2ZHDA 2QN5T 3GCHB 1J16A 8GCHF 1CA0C 2GJGA 1P10A 4IW4E 3PLBA 3O8CA 4CBNA 4UFDH 3E91A 1A3BH 3AAVA 3O8DA 4Z0KA 1QJ1B 1HGTH 5JBAS 1O3OA 1OHHD 4RI0A 3ZYEA 2ZHQH 1YM0A 1YYY1 4UE7H 3VFEA 3MI4A 4DT7B 1GHWH 1TGBA 3PO1C 4BAKB 1D3PB 4AYVB 1RXPA 1OX1A 4BXWA 2ZDKA 1LVOA 2FMJA 1PYTC 2DE9A 5HIZA 2YOLA 3MTYA 3Q76A 2PHBA 3P8GA 3VB6A 4KTUA 2D8WA 4K1TA 1ESTA 4U32A 3BIVH 2PUXB 3F0PA 2PR3A 3UPEA 1SHHB 2UUJB 2DE8A 3VGCB 1DE7H 2CF8H 1JXPA 1TGNA 2BY7X 5CHAC 1GL0E 3AASA 4Y8YA 1UMAH 3E90B 1CHOF 1O2WA 1WDIA 3DSOA 1AMHA 5KECA 5EJZA 1ZTKA 1O3DA 1UJ1A 3E1XB 2XOKD 2ALPA 4K8BA 2J9NA 3U8OH 1FMGA 1GMDG 1PPFE 4NIYA 1LVYA 2RCEA 1CA0B 2J38A 3N7DA 1P57B 1GHBF 1ELDE 4MNYA 1YLNA 3SV2H 4CHAB 2AYWA 2BD5A 1H9IE 1TLDA 3FO8D 1GHAF 4Q7ZA 5B6LA 2BVRH 2TRMA 5GCHG 2PFEA 4X1RU 3PMBB 2GTBA 4NWLA 2Z9KA 3ZZ3A 5KEDA 1KXEA 2GVFA 2ZF0H 1BMLA 4WXIA 1N8OC 3TU7H 2OBQA 2BVXH 1AU8A 1IQJA 2TIOA 1HJAB 4E05H 1BZXE 1V2WT 1WYKA 2JIZD 2VVVA 1BQYA 1S6HA 4CHAC 3A81A 3QGJA 4UD9H 2ZPSA 1GMCF 2AFQB 5C1YA 3SJKA 1GG6B 1NRSH 2D2DA 2FOGA 2ANKH 3ZZ4A 3SBKA 3OEED 1GJDB 2H9EH 2XCNA 2UWPA 1MKWK 5FBIA 2WUBA 4DJZB 4XBBA 1C1PA 2CJIA 4XDEA 2K0QA 2KX4A 1IQLA 2KCYA 2A31A 2ZFRH 2B8OH 1KTTB 2KCOA 1ZPCA 2BY5X 4CRCA 3FZDA 1SGYE 2GX4A 3SU3A 4CRBA 2CV3A 1GI4A 1B5GH 2PTCE 3RM2H 2FO9A 5HIYA 4ABBA 1V2PT 1O3NA 4AFZA 1LHFH 3RXJA 1O5GH 1VCPA 3ZZ7A 1SLXB 2OC0A 2ESTE 2I6SA 2XC5A 1ZMNA 3M5NA 4AGJA 3LONA 2P8OC 1GJ6A 4IGDA 4ZKNU 3VGCC 2JDID 4AN7A 3M36A 4XE4A 1JRSA 4B2AA 1C1VH 2J98A 1GJAB 3BTDE 2HNTE 1SG8B 2ODYB 5FCRA 1MD8A 5JBTA 4AORA 1GGDC 8LPRA 1ZMLA 2Y82A 1DWEH 5L30H 3BEUA 3MU5A 3Q3KA 3WW7A 5PTPA 3P6ZB 3SNBA 1O3LA 4Y0YE 1JWTA 3UWIA 2NU0E 2ZTXA 1NM6A 1GMDF 5J4QA 1BJUA 3MH4A 1C1UH 2WZQA 1KIGH 3RXCA 1TWXB 1ELTA 2XBWA 1O30A 3QLPH 1ZLRA 2W7SA 3BTTE 3SZNA 1EPTB 2KFWA 5DJ7A 3AW0A 5C67A 2AEIH 3SV6A 1DOJA 2AERH 1LVMA 2XYAA 4D76A 1KDQA 1O2YA 1G2MA 3V3MA 3SU4A 3MO3A 1S6FA 1RRKA 3JZ2B 1C5YB 3PMJA 3BTGE 5K0HA 1YY3A 3E6PH 4NSYA 5A8ZA 2SGFE 3MH6A 2YMSC 4CRAA 1TPOA 3RXAA 2EEKA 4LZ4B 3S9CA 3BSQA 1GJ7B 1TE0A 1ZSLA 1O2OA 4YOJA 3PROA 1NFUA 1LHEH 1QNJA 2NU2E 3H7TA 1GI9B 1UVUH 1ZJDA 4TWWA 3SU1A 1XMNB 3UY9A 2IJOB 1HYLA 3FP6E 1EOJA 1F92A 1C5QA 2V3HH 1K1PA 3T27A 2EI8A 3LH3A 2F9OA 3ZIAD 3HATH 3P92A 4OS1A 3EQ0H 4YTAA 1A0JA 1EPTA 4ZKSU 4WXVA 3KQEA 1GWAA 1C5ZB 1SQAA 4OS2A 2HPPH 2FXRA 2VINA 2ZCHP 1LHDH 1RD3B 2OQ5A 3RP2A 4BTIB 3GCTF 1Z8GA 2UUKB 1C2GA 3FANA 2ZP0H 3SZEA 2A4RA 1HIAB 3A84A 2Z7FE 1CSOE 1EJAA 4I33A 2BZ6H 1HAZB 2ZEBA 2XBVA 1GI5A 2XXLA 1N6XA 3RU4D 4BAQB 2CHAC 2A2XH 2IPHA 4JYVH 2H5DA 3SQEE 2ASUB 5TCCA 3DA9B 4BOHA 1A2CH 4TT3D 1TOCB 3LOXA 4ISOA 4WMEA 3SUDA 5T6GA 3GCOA 1GDNA 3KQ5A 3TIUA 2P3FH 3P8NA 1O35A 1BRUP 5C2ZA 3ATWA 4X2WA 1QY6A 4GLYA 1HJ8A 2B0FA 2FOHA 5IDKA 1O3EA 3K2UA 2AIPA 4M7GA 3PLKA 5HYOA 2C8XB 5A0BA 1BCUH 2KR7A 1RGQA 1DLKB 3DUXH 3TH4H 1MAXA 1V2MT 4AZ2B 1AI8H 1EPTC 5EG4A 1LDTT 3GY2A 1H9HE 3GY5A 2PWXA 2WSSD 1GCTC 3RXQA 2Z3DA 2KAIA 1UTPA 1FI8A 3ZZAA 1Z8JB 5EXMA 1EUFA 1WTHD 4FUJA 2GCTB 1ZYOA 1C2MA 1RIWB 2ZKSA 1GI6A 2G00A 4ABDA 4RKJB 2ZQ2A 3TPIZ 4ABHA 1MQ5A 2WPJS 3AAUA 1VCQA 1WSSH 1YLDA 5LPFA 6GCHF 2G4TA 1BA8B 1FQ3A 1GHVH 3PO1B 4TWYA 3A85A 3TLOA 1K21H 1K1IA 3LH1A 3MO6A 1MZAA 3C27B 5JPMH 5F6MA 2K1QA 1XKAC 3ZZCA 4Y7BA 1FY5A 4U2WA 1ZSKA 1FLEE 2O8WA 2V7QD 1AHTH 1A1RA 1BMAA 1T8NA 2J34A 3BTME 4CR9A 1SQRA 6CHAC 3M3TA 1P03A 3CNRA 4NZQA 4NIWA 1LPKB 5DKMA 4IC6A 1TGSZ 1BDAA 1IQHA 2FYRA 4DG4A 3E0PB 1ELEE 3SGAE 2FOCA 4ZKRU 1FUJA 1O2QA 1GMCG 3SJ9A 5AVDA 1DLEA 1OXGA 4RSPA 2LPRA 1FIWA 1Y3XA 3LGUA 1V3XA 1CBWB 2SGQE 1P06A 4BTUB 3SJIA 1UTJA 1OP2A 1PQ7A 2UUYA 4O3UA 4KGAA 4X8SH 2PUQH 2IOTA 1DFPA 1P2OA 3GY7A 4I32A 2G52A 4HGCA 5T1VA 1JIRA 2DUCA 1LTOA 2W5EA 1T32A 4H4FA 1E0FD 2XWBI 1ABJH 1P04A 2OTVA 4BAOB 4MLFB 1BTXA 3PTBA 2KCPA 2HVXA 4UEHH 2KCAA 1XVMA 3PMHB 3DT0H 2GGVB 2BDBA 2H9HA 1K0HA 4GHTA 3SUEA 5CE1A 2D26C 1UK2A 1NESE 4OS6A 1GJ4H 1GMHF 1SL3A 1AE8H 1A0HB 2Z94A 1AZZA 1TA2A 3FN8A 5C0UA 1LKBA 1A0LA 4X6OA 4UFGH 1P9UA 3KYGA 3I29A 4Z6AH 3TVJB 1NU9A 2QE7D 1DXPA 1GBJA 3TH2H 4JZDH 2Y7ZA 2W3IA 3BG4C 3ZZ9A 1FY4A 2PW8H 1CHGA 1GBFA 1OOKB 3HK6B 1ZTJA 4P00A 4Y10E 5JB9S 3RXGA 2BQWB 1SGFG 3UREA 4ABFA 2ZHFH 2PLXA 5FAHA 2ALVA 4CRDA 3HKJB 3SGBE 2VIDA 1O2UA 1H1BA 2GZ7A 1Z71A 5CHAB 1MH0A 1O2SA 3NUMA 4WMDA 4OM9A 4CH2B 5ESBA 1GVKB 1IQEA 2FI3E 2A2QH 2ZCKP 1F5LA 1E1RD 1EJNA 1EJMA 3W94A 3UFAA 1W7XH 1F0UA 5GCHF 3CS7A 5FPYA 5G4BA 1EZUC 1C2FA 1ELVA 1O36A 1LHGH 5ABWA 2VGCB 1J17T 4DCDA 4OS7A 3MNSA 5EQQA 1J15A 1W8BH 3SV7A 4O97A 1K1OA 1NY22 1T31A 2BDAA 3M35A 4R8TB 1TPAE 3QZRA 4JMYA 1NT1A 6GCHG 3OTJE 3GDUA 1O2PA 5EGMA 1V2NT 4HZHA 1WQSA 2A7JA 1UW7A 1GBKA 1QQUA 4X6NA 1Z8IB 1YCPM 3RXDA 1TB6H 1BMFD 1G36A 3K6YA 2ZPQA 1V2LT 2A4OA 1GBDA 1O3JA 2R9PA 4MPXA 8GCHG 3URDA 4Y71A 2JH5D 1AFQC 1B7XB 3ZVFA 5LPEA 3RMLH 6ESTA 2Y5FA 3LPRA 3RC4A 1TX8A 2PKSC 3QTVH 2VH6A 2AMQA 3P8FA 1CQQA 3FAOA 2BDGA 1O0DH 4Y8XA 4A6LA 2ZFFH 4Q7YA 3LGYA 2ZI2H 1Z8RA 1ZOMA 3SOSA 5BRRE 1O2KA 4K1EA 1FY1A 3PB1E 3RXKA 3LGIA 2BDCA 3MWIU 2EY4C 4BXSA 3HK3B 1TA6A 4IMZA 1WTGH 4BAMB 3A87A 3W95A 5EXNA 4Y79A 2F91A 1N8OB 2AMPA 2HGTH 1T4VH 2QF4A 2QIQA 1NTPA 3F2HA 3ZVCA 1PQ5A 1QB9A 3LC5A 2TGTA 3A82A 2LELA 2FZZA 2LNCA 1TONA 2C93B 5KGOA 2AIQA 4OS5A 1A3EH 1Z1JA 2RFKC 4K60A 2FODA 2VBCA 1AGJA 2VWMA 3P8OA 3FVFB 4YT7H 4XFQA 3M5MA 1C5WB 4HTCH 1TNIA 1UTLM 3BTFE 2L74A 1CT2E 1P0SH 3P17H 1DPOA 1D3QB 2RA3A 3RXFA 1NFYA 1PPEE 1SLVB 2V3OH 4YO9A 3A89A 1SQTA 3RC6A 1S83A 1S85A 1V2OT 5EW1H 1P3CA 3M7QA 4K5ZA 2EI7A 4ISNA 1OKXA 1VJ9U 2C90B 3F0OA 3OFND 1C4Y2 3SHAH 4KTSA 2HALA 2PKAA 3MH7A 1UVOA 4U01A 3RLWH 3SW2B 2ZDNA 2STBE 3A8BA 3ENSB 1AIXH 5LPRA 1V2ST 2BX4A 2GP9B 2EI6A 2RDEA 2A4QA 3SORA 2HLDD 2VJ1A 3MU1A 1AFQB 2ZPRA 4OS4A 3S69A 4RT1A 3S0NA 1PQAA 5EJLA 3ZV9A 7LPRA 1QL9A 2SGEE 3SUGA 1QIXB 1QB1A 2QXJA 1S5SA 3GISB 1GBLA 2ODPA 1TBRH 5FX6A 3G01A 1MBMA 1Z6JH 1C1OA 2BQ6B 1ELCA 5E0JA 3VB7A 3LGVA 2BD7A 1O5AB 3UIRA 2P8OB 3FFGA 3QX5H 4ABJA 3VPKA 3GY4A 4AG2A 3F9FA 2FESH 1UCYH 2GZ8A 1HAIH 1O3MA 2GV6A 2C8ZB 3MNXA 2XBXA 5I46H 1BRCE 4TY7A 1HAXB 1MAYA 2YNBA 1UK3A 5C5OA 1MBQA 3LKWA 3V0XA 4ABEA 2ZU3A 3M61U 4JZIA 3BTEE 3R0FA 1L1GA 1P2JA 5FPSA 1UVTH 4ZAEA 1QJ6B 1YF4A 3SU6A 2NU3E 1ELAA 4UFFH 3F9EA 1N6YA 2CMYA 1P12E 1MMJN 4INLA 1YC0A 5HKKD 1TNLA 1FAXA 1DDJA 1JRTA 1A5HA 1W11U 1AUTC 2BY9X 2OCVB 1O2NA 4CR5A 3ZZ5A 1C2HA 2M5TA 4CH8B 1W10U 1EATA 5DSFA 1SMFE 5L2YH 5C1UA 1ZMJA 1HB0B 4JZ1A 4IN1A 1KXAA 4ISIH 4BTTB 1GJ9B 2K8IA 5EW2H 3OYPA 3K65B 1NRNH 4CBOA 2FOEA 1BJVA 1HJAC 4CREA 2WYJA 4JCNA 2WPDD 3RXRA 1IQMA 1F0TA 1GBIA 4WF8A 2QXHA 4X1SU 1MTNC 1FDPA 5CHBA 4D7GA 5TCAA 1GBCA 1RTLA 1T7CA 2VVUA 1VGCC 2XWAA 3TJVA 3O8RA 2M2AA 2F4LA 1VJAU 4DIIH 2PV9B 2KZ4A 1CBWC 5FXLA 1OWKA 2VIPA 2UUFB 1W0YH 1YPLH 3GOVB 4A1VA 1NBME 4X8VH 4BAHB 3SO3A 4ZMAH 5T6DA 3KN2A 2OD3B 5JBBS 1HLTH 1HAOH 3W1EA 2WV9A 3UOUA 5CMXH 1ESAA 2BB4A 3EE0B 5DP6A 4ACAA 1NO9H 1CT0E 1ZHRA 3ODFA 4J2YB 3OSYA 4AC9A 1UVPA 1BT7A 2YNAA 1B0EA 1DS2E 1SB1H 2QC2A 1C2JA 1MZDA 5DP8A 2BD4A 1DSTA 2JETC 3RXPA 1UCYE 2G55A 1PPGE 1Y8TA 2H1UA 1OPHB 1J8AA 1RS0A 3SU5A 3UB0A 3MNBA 1V6DA
chains in the Genus database with same CATH topology
3SNEA 1L4DA 1XUGA 1JBUH 1QURH 4X6MA 2R0LA 1P2MA 1O33A 3QO6A 4D7FA 3NKKA 1PPBH 4CRFA 3BEFB 1M9UA 1F0RA 1NRPH 2FX4A 2FTMA 1SFQB 5F8ZA 2CGAA 3A83A 1ZHMA 4JZFH 1H9LB 5A8YA 1SVPA 1C9TA 1P8VC 3GY3A 1GJCB 1THSH 2EC9H 4VGCB 1O3BA 1UTNA 5ESTE 3MFJA 1LPGB 2BMGB 4WVPE 1TPPA 1P2KA 1BTUA 2ZNKH 1ELFA 2ANYA 5GJ4B 4MNXA 3RXMA 1EQ9A 1YPKH 1FAKH 3WY8A 3N7OA 2WUCA 3ELAH 4F49A 1ETRH 1PPZA 3F9GA 3GYMA 1TMUH 2ZZUH 4FXGH 1AUJA 2BVSH 1OSSA 2WPHS 3ZVAA 4KP0A 2ZGBH 1DSUA 4FUFA 1YGCH 5AFYH 4MG3A 3R3GB 3NZIA 2SNWA 4YT6H 3MYWA 2QAAA 1KY9A 2AH4X 1EKBB 5ETXA 2QA9E 4ASHA 1NFXA 1FPCH 3QGNB 2Z6BD 2VH0A 2R0KA 2BXUH 1UTMA 3ZVEA 3VB4A 1DUAA 5FHTA 4NFFA 2NU1E 1XUKA 3STIA 3TITA 2HNTC 3SI4H 1ZTLA 2H2ZA 1EAWA 1O31A 3GCNA 1C5NH 4NWKA 3SV8A 2FS8A 2BY8X 1GCDA 3A7VA 1MU8B 4AX9H 1MTWA 4A5TS 4NZLA 1O37A 4KTCA 3GCTG 4Y11E 1TNJA 2BOKA 2FOFA 2OC8A 4Y0ZE 1BRBE 1O5DH 1YPGH 3MU8A 3MHWU 4D9QA 5J4SA 3RLYH 3M5OA 1NRQH 1TYNA 5GXPA 1GHZA 2B5TB 1W12U 1ZGVA 1HAHH 1SGDE 4FUBA 3U9AH 3LGWA 1EZSC 3RXLA 4YLQH 2Y80A 1S0RA 1YBWA 1DWCH 1O5CB 4NA9H 1ZPZA 2OP9A 3LT3A 2FWWA 1ANDA 2BLQA 4ZUHA 4Y6DA 1IAUA 2GDEH 3KEEA 3S9AA 1FONA 1QBVH 2XTTB 4ZROA 1QTFA 2H9TH 3BF6H 2O9QA 4X2YA 4YESB 1SGFA 5DK1A 1KTSB 1GGDB 2G5VA 5TJXA 4BNRA 2OBOA 2ZFPH 4XBDA 1HAYB 1TFXA 1C1NA 1EP6A 1TALA 4J1YA 1EAUA 3L3TA 3M37A 1W14U 1Y3UA 2CF9H 3EA8A 1TIOA 3BTHE 4K1SA 2AGGX 2ZO3H 1C5UA 1O2LA 2BHGA 4X2VA 1KXFA 3RXBA 1FN6A 4AG1A 4QT8C 4THNH 2V0BA 1UTKA 5DO4H 2R2WU 1OYQA 3EDXB 1BIOA 4MVNA 3SGQE 4E7RG 1O2RA 2A7HA 3KHVA 1TGCA 1ETTH 2C3SA 2G4UA 1QA0A 3U98H 1EX3A 3O8BA 3TH3H 1DX5M 3U1IB 1C5RA 1AVWA 1Q31A 1VCWA 5T3HA 1MTNB 1TQ7B 5AF9H 2A0QB 1TBZH 4ZHAA 1O2TA 5T6FA 2R3YA 4ZH8A 1GJ5H 3A8CA 4NCYA 3BTWE 5EQRA 3TNTA 1A7SA 5DP9A 4TYDA 3SJ8A 1HXEH 2CHAB 5HGGA 4R0IA 1GHYH 2B9LA 4HI3A 2TGPZ 3OY6U 2VWNA 3IWMA 4B71A 2Z3CA 3TGKE 1QB6A 1TNHA 1Y3VA 4AOQA 3RU4T 3KQCA 1PPHE 2PKSB 4ZKOU 1O32A 2G51A 3HGNA 2FLBH 3LDXH 4ZHLU 5FBEA 5H4IB 2BOHB 5AHGH 1DICA 1SHYA 2WYGA 1OWIA 2ZU1A 1ELGA 1FY3A 1KLJH 2A5KA 1QFKH 2RDLA 4Q2KA 1O3KA 1ELBA 4CRGA 1AD8H 2ZFTA 1O3AA 3A80A 1IQNA 2C4FH 2ZDLA 3STJA 3B9FH 4K2YA 1CO7E 4ABIA 1DWBH 1NS3A 1O3PB 1EB2A 2BDYA 3QWCH 3CS0A 1EASA 2BYAX 1EAIA 3DFLA 1NU7B 1CGIE 4DIHH 2FTLE 1RTFB 3SU0A 1H4WA 4FUEA 2VNTA 4B2CA 3B8JA 1O2HA 4FUHA 2G8TA 3RUOA 3RXVA 2F9NA 2P3TB 3ODDA 2HOBA 2R2MB 4WY3A 2JKHA 1BB0B 1SGPE 1C2DA 2GZ9A 4KELA 2VGCC 1WBGB 1P2IA 4YM9A 1W3CA 3MO9A 4B2BA 4DOQA 3GY8A 1C1SA 4LZ1H 2RA0A 4I8GA 3HKIB 1HAVA 3T28A 2AMDA 2WPMS 1BTYA 2TBSA 3UR9A 1G3DA 4UDWH 2ZU5A 1F0SA 5E2OA 1QL7A 2QF3A 4O03A 4AFQA 2ZFQH 2O8UA 2BLOA 2ZFSA 2FI5E 2WV5A 5C5NA 3E0NB 1MTUA 1Y59T 1XVOA 3TJNA 5JB8S 1DVAH 2Q6GA 1C1MA 3QK1A 3V13A 6LPRA 4OGYA 1BTHH 5AFZH 3GCHC 2P94A 3T5FH 1O2XA 1SFIA 4XBCA 1LPZB 3ITIA 1SBWA 3BV9B 1UHBA 1ACBE 1OWHA 4MDSA 2PTNA 2ZG0H 3LJJA 4I7YH 1TAWA 1Y5AT 1C5XB 9LPRA 1FY8E 5EQSA 4FUDA 1SGEE 2ZGHA 5GWZA 4UONA 2H5CA 3K6ZA 3F6UH 2J2UA 3U69H 1GJ8B 1G3BA 1YPEH 2QCYA 1ZZZA 1D3TB 2GDDA 2CN0H 1ZR0A 4A1TA 1EZQA 5L6NH 1LCYA 1W13U 1THRH 4O3TA 3RMNH 1C9PA 1G32B 2QXIA 3SJOA 1ZPBA 1AWHB 2ZTYA 2A45B 4IS5A 3LC3A 3KGPA 1LHCH 1EOLA 4WH6A 3SUFA 2VU8E 1EAXA 1DY9A 4XSKU 5A2MH 3HGPA 4AFUA 5C1XA 3VEQB 4K69A 1C5MD 1V2QT 3QTOH 4ABGA 2ZU2A 1DM4B 2Z9GA 3CENA 3BG8A 4MQAA 3UQVA 1RTKA 4X1NU 3UUZA 1QCPA 2ZHWH 1K22H 1C5SA 2XBYA 2ANMH 1RFNA 4B1TA 2SGDE 1F5KU 2SGPE 1QR3E 4FU7A 5DPAA 1BTWA 1BOQA 1ZRKA 3BN9A 1QJ7B 3NK8A 1O2ZA 1PYTD 1FJSA 3ZYDA 1AVXA 1ZSJA 2JH0D 5BPEA 2QY0B 2XW9A 1MCTA 3KNXA 4K3JA 2Y81A 2O8MA 1C5TA 3NCLA 1HJ9A 1E38B 3HPTB 1S84A 1D6WA 3BEIB 5I25A 2UWLA 4MPUA 1UTOA 4E06H 1P3EA 3NXPA 1JIMA 2QF0A 4ISLA 3M3SA 2G81E 1AKSA 1QRWA 5FCKA 1GI3A 2ZU4A 1F5RA 1S81A 2FX6A 1HXFH 1PPCE 1UTQA 2J4IA 3NPSA 5HM9A 1DITH 3PTNA 1SLWB 3DFJA 1KXDA 1ESBA 1AZ8A 3SV9A 2WPKS 4LK4A 2FIRH 4I8LA 1OP8A 1YCPK 5EU8A 1IHTH 1UHBB 3BIUH 1NC6A 3FP8E 1BRAA 4A7IB 4Y76A 1BHXB 3UNQA 1LMWB 1FNIA 3ATIA 1G30B 1C5OH 2SNVA 1FV9A 4MTBA 2J95A 2BTCE 1QHRB 2H6MA 4IC5A 2F9BH 1UVSH 3TK5A 3KQDA 2Y5GA 1GDUA 2VIWA 1TRYA 5EODA 1Z1IA 4X2XA 7ESTE 1YLCA 2ZGXH 3NWUA 4LOYH 3Q00A 4FUCA 1V2TT 1A4WH 2ZA5A 1L2EA 2VIOA 3RXEA 2GKVE 2FP7B 1XM1A 4HFPB 1MU6B 3RXHA 1SI5H 2ZDMA 4Q7XA 5FPTA 2BQ7B 1W0ZU 1GVLA 4X8TH 1MUEB 2BD3A 3A7XA 1AO5A 4K8YA 2V6NA 2ZDAH 3D65E 2FLRH 1SGIB 3T26A 2F9PA 2B7DH 1C1QA 4SGAE 4Q80A 2Z9IA 2EA3A 1C5LH 1WOFA 3KL6A 4F4OC 1O5EH 2XNIA 4GAWA 2AS9A 5DG6A 1TNKA 2Y5HA 3OY5U 2GCTC 3RMOH 1G2LA 1C2EA 2ULLA 2NWNA 1YPHC 1ORFA 1MKXK 1ANCA 1HPGA 2HRVA 1E36B 4DY7B 4FVDA 1GI0A 1QQ4A 1SOZA 4NIVA 3M7UA 1GBMA 3V12A 4IMQA 1B0FA 4D9RA 3VXEH 1AFEH 3RMMH 3EGKH 1C1WH 2A7CA 4WMFA 4NA8A 3CP7A 1QGFA 3U8TH 3IITA 3RXUA 1MKWH 2TPIZ 2ZIQH 5DP5A 1Z6EA 2FDAA 1TQ0B 1LQDB 3TGJE 4B73A 1HAGE 1SPJA 2ZDVH 3DD2H 5EOKA 5E2PA 2GCHG 2OINA 4ABAA 4A92A 4DVAU 1OWDA 3T25A 5EPNA 1O34A 2O8TA 1D9IA 1Q3XA 2GMTB 2ZECA 1CVWH 5K7RA 1GJBB 1TPSA 2JETB 1U6QA 1W7GH 4Y7AA 1QA7A 1KSNA 4YZUA 1V2JT 1ARBA 3Q77A 4AYYB 2CXVA 2W3KA 1GBEA 5LGOA 2Z9LA 4MPWA 1LQEA 3LU9B 2BM2A 1O3FA 1OYTH 2ANWA 7KMEH 4YLUA 1JMOH 1ABIH 2P3UB 3KF2A 1GHAG 1O38A 1HV7A 1YPJH 4NSVA 2AGIX 1XUJA 2TGDA 2OC1A 3KQBA 4IBLH 3RXOA 4AB8A 2J92A 4RN6A 5JDUB 3A88A 2ZCLP 1O2JA 3RDZA 1CU1A 3QDZB 3DHKH 3GDSA 2BD9A 3ZZBA 3ZVGA 1OWEA 1TRMA 3L33A 4ESTE 2FS9A 3S7KB 2ILNA 2OUAA 1BBRK 1BMNH 1D3DB 1KYNA 3BG4B 1NRRH 2WINI 4UFEH 1BTPA 1IHSH 1VZQH 3L6PA 2Y7XA 2Q6DA 1OWJA 1SGQE 1D4PB 3LIWA 1DY8A 1DUEA 2WPLS 1ANEA 2VIQA 3OX7U 2GT8A 2ZC9H 3MU4A 1A5GH 1HRTH 2FPZA 3PWBA 3TJOA 1GG6C 5F03A 3F1SB 5E0HA 1NZQH 1KLTA 1C4V2 3VB5A 1YCPH 1HUTH 3PM3A 1LO6A 1TX7A 1O2GH 1NROH 2R3UA 5GPIB 2BZAA 2A5AA 2TGAA 3S7HB 1DXWA 1Y5UT 1KXBA 1GI7B 6CHAB 1XUFA 3BTKE 2O8LA 1GHBG 1THPB 4MPVA 4DW2U 2BLWA 2PSXA 1W2KH 1C2KA 2A32A 3SU2A 5EXLA 1S0QA 2SFAA 7GCHG 1CE5A 4AFSA 1IQKA 2GD4B 3ATMA 2QGRA 3Q3YA 5HM2A 2VIVA 1CHOG 3M7TA 1AQ7A 4AGKA 1K2I1 3M5LA 3EA7A 5E8EH 5DP7A 1ANBA 1SGRE 2BX3A 1VR1H 3SNCA 2VB0A 3SN8A 1C1RA 4DURA 1E35B 1H8IH 2C8WB 3GICB 1WU1A 3K9XB 1LKAA 1Y5BT 3FZZA 3SNAA 4I8JA 2Q6FA 1V2UT 3QN7A 1NN6A 1L0ZA 2ZQ1A 2WV4A 1J14A 2A1DB 4BANB 1T8LA 3ZZDA 2W26A 3MH5A 1HAVB 3H7OA 3D23A 3QZQA 1SOTA 1C4U2 2Z3EA 4E7NA 3GYLB 1O3HA 2BDIA 3F68H 1K9OE 1WAYB 1Q2WA 2FYQA 2OXSA 4JYTA 3VXFH 1K28D 3T2NA 4TPIZ 2IN2A 2ZTZA 1BUIA 1P02A 2FOAA 2OLGA 1UK4A 3RU4E 3UTUH 4JZEH 4GHQA 1RJXB 4D8NA 1CT4E 5IYTA 1Y3WA 1FN8A 2HNTF 2GV7A 1AY6H 2A4GA 4AB9A 3KCGH 1P11E 1S82A 1K1MA 1BBRE 4NFEA 2VVCA 3UNSA 4B75A 3V7TA 3SNDA 3URCA 1P09A 1F2SE 3LJOA 1H8DH 5JBCS 1SQOA 4I31A 1TBQH 3TGIE 3E16B 2ODQA 1A61H 5E0GA 3OU0A 3RM0H 3QUMP 1F7ZA 2Y6TA 3UNRA 1KXCA 1XXDA 1HBTH 2FOMB 2XC4A 3EAJA 3RC5A 3C1KA 4TPYA 5HXFA 1MQ6A 1QRZA 2BLVA 1FPHH 1C5PA 1AWFH 1HAPH 3ATKA 4ZXXH 1ZGIA 1UCYK 4NG9H 2STAE 4JYUH 1MKXH 1P01A 3KIDU 2GT7A 3RXTA 1Z7KA 4GUXA 5A09A 2PKAB 1N1LA 1G3CA 1T4UH 1HCGA 3RXIA 5C20A 1IQGA 1T8OA 3JZ1B 1V2VT 1SR5C 1O5FH 3PV4A 3MNCA 4JK5A 5DP4A 4NA7A 4Y8ZA 4FVBA 1OS8A 1GCTB 1GVZA 2JH6D 4ZXYH 2THFB 2ZGJA 3D49H 2VWLA 4GVUA 1J9CH 2QV1A 3A7ZA 1VITG 1GBHA 1GBAA 3MMGA 2F9UA 1V2RT 3LGTA 1O3GA 3E8LA 1DT2A 1K1NA 2Z9JA 5L2ZH 1XUHA 2J94A 3VB3A 3PLPA 1NPMA 4B76A 4INKA 1SGCA 1WCZA 1BTZA 3I77A 3P95A 4GCHF 2RG3A 2A5IA 9ESTA 1O2VA 3E3TA 1WV7H 4GSOA 2Q1JA 1BBRH 1SGNE 1ZJKA 1MCVA 3A7WA 1VITF 1C1TA 4YOGA 5JYIA 1IQIA 2P59A 1VGCB 1QL8A 1K1LA 1GPZA 4MNWA 1L4ZA 8ESTE 1FXYA 4X8UH 4SGBE 3A7TA 1L1JA 1LVBA 1PFXC 4IN2A 4NGAH 5LH8A 2HWLB 2P93A 3A8AA 4GCHG 2OQUA 3U1JB 4KKDA 4I8HA 3F9HA 1XXFA 3PYHA 1D6RA 4WWYA 2ZGCA 1QBNA 4X0WU 3S9BA 1G9IE 1EB1H 1YPMH 2AGEX 1O39A 4FU9A 1HNEE 3TJUA 2VWOA 1FZZA 2BY6X 4X6PA 3ZV8A 1AVGH 3SI3H 4RKOB 3MOCA 1AE5A 5FX5A 1L1NA 2ZHEH 2QXGA 4VGCC 1BMMH 4H6SB 3T62A 1K1JA 1SGTA 4FU8A 4ISHH 3UWJH 2ZWLH 1TRNA 5B6OA 3GDVA 2HLCA 1ETSH 2G5NA 1C2IA 1INCA 2WPIS 1XKBC 1P2QA 2P16A 1MTVA 8KME2 3AW1A 2C8YB 1ID5H 2NU4E 3ZZ6A 1G37A 1TMTH 2UWOA 4MNVA 3EYDA 2BD8A 3AVZA 4OGXA 1O2MA 4U30A 4YOIA 4TY6A 2BDHA 4NIXA 1A5IA 2QYIA 2SGAA 2I6QA 2PGBB 3H5CB 1GI8B 1