5C67A

Human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hyrdolase/hydrolase inhibitor
molecule keywords Trypsin-3
publication title Combinatorial protein engineering of proteolytically resistant mesotrypsin inhibitors as candidates for cancer therapy.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A02
5L6NH 1THSH 5JBCS 1N6XA 1FN6A 3PROA 4CREA 1IQIA 1BMLA 3CP7A 1DY8A 1KXDA 2FI3E 4MG3A 3A8DA 1HIAA 1MAYA 4CR5A 4AG1A 4A92A 3GY5A 3MI4A 2FYRA 3AVZA 5F6MA 1O5BB 2FMJA 1GBJA 1AZ8A 4OGXA 4ABAA 3OY6U 3FP6E 1OWKA 1QTFA 2ZTYA 1P2JA 1V2NT 3LPRA 1O3GA 4X8VH 1CQQA 2A7CA 1D9IA 4TY7A 3RXDA 2GD4B 1YYY1 2FX4A 1TX6A 1GHZA 1EASA 1TNHA 2ZGBH 1FQ3A 1OWJA 1GCTC 2OBQA 1IHSH 2Z94A 3BG4B 2AMDA 1IAUA 4Y11E 1C1VH 3RXMA 3MWIU 3O8RA 1O3NA 1TOMH 1O2QA 1OXGA 1XUIA 2TPIZ 1P9UA 3EYDA 3SU6A 2R2WU 2P3FH 4JZDH 3SOSA 1O2JA 3DFJA 1YGCH 2BXUH 3B9FH 2ANWA 4ISIH 1HXFH 1HAVA 1CT2E 1UTMA 1V2TT 4BXSA 5HYOA 2FPZA 3SJIA 4K69A 3S0NA 1XXDA 1GI9B 1K1MA 3M3VA 4I7YH 3C27B 1P8VC 1GHWH 1O2VA 1XKAC 2R3UA 3P8FA 1A0JA 3RXCA 1RRKA 2GGVB 1KLIH 2QXHA 1OPHB 1W7XH 1BT7A 2D8WA 8ESTE 1TOCB 2W7SA 4K1EA 1O5DH 4FVDA 1YCPK 1QB9A 3B23B 2CJIA 2VGCC 1YPHE 5EXMA 2WUCA 2BY7X 3BIUH 1MD8A 1GBTA 1DICA 3M7QA 1C5WB 2PFEA 3QDZB 4IBLH 1CU1A 1NM6A 1L0ZA 2AS9A 3BTME 4ZKRU 4CRAA 1BTPA 4ASHA 4Q7ZA 1K1NA 2FOFA 1RS0A 3A80A 1C2LA 4E7RG 5F8TA 6ESTA 3EE0B 1ZJKA 2ZQ2A 1O3CA 3MO9A 3E3TA 4IW4E 4J2YB 1GVZA 1B0EA 1C2GA 1O2KA 1UVOA 1HFDA 1HIAB 3LJJA 1UCYH 3SW2B 3UFAA 5A8ZA 1E34B 1HJ9A 3RXOA 1GHXH 3NZIA 3QTOH 1MBMA 1G30B 1ZPZA 2V35A 2HOBA 3TK5A 4X2VA 1QHRB 4K1SA 1V2LT 1SL3A 3CS7A 1O2NA 1YCPH 4MNYA 1UCYE 3SNBA 5DP5A 2WV5A 1V2PT 3F6UH 5A0AE 1O2TA 3QX5H 1SLVB 2BQ6B 5HM2A 4YLQH 1KDQB 2V3OH 2J9NA 4X1PU 2TIOA 4MNWA 2WPJS 3ATMA 1SGDE 3UNSA 1RFNA 4A6LA 4IN2A 2EI8A 4TYDA 4DG4A 3AAVA 5H4IB 5A8YA 1AUTC 4YM9A 4ABBA 3S9BA 1O3JA 1HAVB 2ILNA 2BY9X 2ZI2H 3HK3B 3QTVH 3LH3A 1BRCE 2PKSB 4MPUA 3PMAB 1P9SA 1V2OT 4VGCC 2BDGA 2YNAA 4MTBA 1PQ8A 3V0XA 5LPRA 1AN1E 1TONA 3BN9A 5DK1A 2CF9H 3I29A 1GJ6A 4U2WA 1XM1A 1ORFA 2XC5A 2BQ7B 1W10U 5EPYA 3P8GA 4XBDA 1DLEA 4UFEH 1CA8B 2ZHEH 1DFPA 1KY9A 3P6ZB 3ZVDA 2TGTA 1K1JA 1JOUB 1O2PA 1PYTC 1QY6A 4AOQA 1AFQC 1EP5A 5DPAA 3MTYA 1RIWB 1GMDG 1Z6JH 5CHAB 1GMHF 1K21H 3SV2H 1GVKB 2ZHQH 3ATWA 4NG9H 1WV7H 1ZPBA 2G4TA 3OU0A 3PLKA 2PWXA 1OS8A 1EB1H 1QJ7B 1O3IA 2BYAX 1GI4A 3R3GB 3T28A 5FBEA 2QV1A 3T26A 1DLKB 1ZMLA 3V3MA 2QC2A 5ESTE 1THPB 1Z71A 1NTPA 1TBRH 4A1VA 3A85A 5L30H 3ZZ5A 2FS9A 2C8WB 3PWBA 3SUFA 2UWPA 4UE7H 1AD8H 1LCYA 3ZZ8A 1W0ZU 1O32A 4FUCA 2AH4X 5GCHG 5EQQA 4FU9A 1HAPH 1P05A 3E0PB 3BG8A 3RXUA 1PJPA 1ESBA 1TAWA 1XKBC 1YLDA 1TMUH 1ZPCA 1LMWB 1NT1A 4ISOA 4YT6H 3A81A 1C2DA 4CH8B 2P94A 2UUFB 1GHAF 2VINA 1GI0A 5AFZH 1BJVA 3ZZ9A 1SQOA 1Z8RA 2FOAA 1ARCA 1C5RA 2ZU5A 3TITA 1Y3WA 2HWLB 4B76A 3SZNA 3UTUH 2BLWA 1LHFH 1GBEA 2WUBA 4Y0YE 3HKJB 1BTUA 1MKXK 4JYTA 1NFUA 3A7ZA 3SGAE 4DGJA 1YPLH 1ZRBA 4GUXA 4ESTE 2Q6FA 1O30A 4X1RU 2OLGA 4NIWA 4NZLA 1ZSKA 2ZHDA 2FOCA 1W12U 1QJ6B 2ZNKH 4ABHA 3ZZ7A 1WSSH 3SU3A 4Y10E 4DOQA 1P06A 2ZGJA 4YT7H 2BZ6H 1IQHA 1AKSA 1GL0E 5I25A 2PHBA 1GJCB 1Q31A 3BEFB 1LPGB 5E2PA 1C5MD 2A5AA 1GCTB 2ZCHP 3V13A 2BX4A 4K8YA 4ZXYH 1P11E 5LPEA 1P2NA 1B7XB 2KAIB 5GWZA 8GCHF 2GT8A 1SLUB 2BY8X 4X6OA 5EOKA 5AHGH 3S9CA 1A61H 3RMOH 5JYIA 4IC6A 3EAJA 1PPGE 3EGKH 3BTTE 5FBIA 4H4FA 1P12E 1GJ8B 4XE4A 3SGBE 1SR5C 1HAGE 5ESBA 1MKXH 3E16B 2BY5X 3UR9A 4CBOA 5DP8A 1P2MA 1T8OA 1ZTLA 4B2AA 4TPIZ 3LGYA 2V0BA 2QYIA 2G5VA 3KF2A 4B2BA 1C1OA 5EXNA 1OWIA 5GPIB 4DJZB 1MQ5A 2BDHA 1EATA 1P01A 1C1TA 1LPKB 2CHAB 4GCHF 1ZSJA 4ZKSU 1B5GH 3LOXA 4ABDA 1MZAA 4CRDA 1GJAB 1SLXB 1O2XA 1SHYA 2Z3EA 2Z3DA 5J4SA 2ZHWH 2FI4E 1ZHRA 2OQ5A 3GDUA 3ODDA 4ZHAA 7GCHG 1ELTA 3GCOA 3KQCA 4IS5A 3OX7U 1QQ4A 1ETSH 4FUFA 2LPRA 2F9VA 4O9VA 3M36A 3RLWH 3UY9A 3TJNA 1YP9A 1O5FH 1FIZA 4NFEA 4Q80A 3U69H 1SC8U 1O0DH 3GY3A 2ZU4A 1TGTA 3M5NA 1ZHPA 1O34A 4NGAH 2B5TB 3NXPA 3M7TA 1YM0A 2ZDVH 3JZ1B 1G32B 3MNBA 2YOLA 1MTUA 1ZGVA 5E0GA 4HFPB 1TGSZ 4FUGA 1K1PA 1UTQA 1BTXA 2GTBA 3NCLA 1SPJA 1AKSB 3RLYH 4K8BA 4KTUA 1GI3A 1W13U 3I78A 3ZZDA 2VJ1A 5BPEA 2M5TA 3A8BA 2ANMH 2QXJA 4MNVA 3A88A 5HXFA 2A5IA 1GJBB 3M7UA 4K3JA 5FPTA 1O2HA 2PSYA 4ABFA 2J38A 3WY8A 1GJ4H 1KXAA 2EI6A 1H9IE 2A2QH 1YPEH 5L2ZH 2P93A 2FTMA 3BTHE 1FPHH 1T4VH 2Z9LA 1O2YA 1SFIA 2ZU1A 1MCVA 2BD7A 4CBNA 1KIGH 1A0LA 2HGTH 4CRFA 4CRCA 1CA0C 2BXTH 1BA8B 4X1NU 1PPHE 2ZIQH 3VB3A 5K7RA 2P59A 1SQAA 2PUQH 1DPOA 5C20A 1GBDA 3UNQA 1JXPA 1O2WA 1JIMA 2ZEBA 4VGCB 2VWOA 4UD9H 1BJUA 4F4OC 3GCHC 1UTPA 4HI3A 3RXLA 4A7IB 3FP7E 3DFLA 2VIWA 1QL8A 2AGIX 2STBE 3PV4A 3ZVCA 3M5OA 1GI2A 3GDSA 3H7TA 1NPMA 1GL1A 5C5OA 3DHKH 3TH4H 3PMHB 4Y8ZA 1O3PB 2BHGA 2UUJB 3PTBA 4KP0A 3UQOA 2VIPA 3IWMA 4RKOB 3ZZCA 4I33A 5JB9S 1ZGIA 2VVUA 1AFQB 3GYLB 1ZTJA 1SGCA 3M35A 1W3CA 1BHXB 3FAOA 1OP0A 1EOJA 1FV9A 1G37A 1GDUA 1VGCC 2J95A 3RM0H 1C5SA 5E2OA 2Z9KA 1TNKA 4FUBA 3SI3H 2GP9B 3E90B 2IN2A 1NRNH 2ZDKA 5T6GA 3SO3A 2BX3A 2QY0B 1CT0E 2VIOA 3QGNB 2PLXA 3K6YA 1Y3XA 5IYTA 1C1WH 2FLRH 4BAMB 3PWCA 1PPBH 1W14U 5DG6A 2BLQA 3DT0H 4K5ZA 1C1RA 1ZYOA 1C4V2 2A4RA 1RD3B 2XCFA 4THNH 2ZTXA 2FOBA 1AU8A 3SV9A 3L6PA 1O2ZA 1EPTC 3MO6A 4MNXA 1NRQH 3ENSB 2WYJA 4Z6AH 1XMNB 1THRH 1WBGB 1EZSC 3RXTA 2Y7XA 1PFXC 5AVDA 2TRMA 4UDWH 2GX4A 2Y7ZA 1AHTH 1NFWA 2OD3B 1O3FA 4IMZA 1OP8A 2A31A 2QA9E 1NN6A 3UPEA 1S85A 5PTPA 2VVVA 1GHAG 1E38B 3U1IB 2TGPZ 3QK1A 4ZHLU 2W5EA 5C1UA 3FZDA 4RSPA 2XBYA 2ZP0H 1FUJA 2F91A 3TPIZ 2QXIA 1DSUA 3MU1A 3LDXH 3MH5A 2ZCLP 4KTSA 2A0QB 3ITIA 3VFEA 1GDNA 5EW1H 2ZPQA 2FXRA 3ATKA 2ZA5A 1SVPA 1O3BA 1V2MT 1KXCA 2PTNA 5T3HA 1P2IA 4K1TA 5C67A 1DXWA 1K1IA 2QAAA 3Q3YA 4ISHH 3RXAA 1C4Y2 1SOZA 2QIQA 2Z3CA 1C1NA 3RC6A 2FOGA 1HLTH 1KDQA 4WJG2 4PROA 6LPRA 2SFAA 3GCTF 3HGPA 3EA9A 2ZGHA 3A86A 4X8SH 3GICB 1GVLA 1S82A 1A1RA 2ZGCA 1ELBA 2B7DH 3P92A 4Y71A 3U9AH 2NU1E 3SQEE 4X2WA 4BTIB 3M3TA 1TRNA 4NA7A 1G3EA 3URCA 1GBFA 3MFJA 1AI8H 2Y81A 4Y8XA 5L2YH 2P8OC 3LC3A 4NFFA 8GCHG 1AVXA 1PPZA 1FLEE 2ZPSA 2PGQB 3SJKA 2I6SA 1DS2E 2B9LA 1FMGA 1SGFA 1O2GH 1TLDA 3BTQE 3PMJA 3S9AA 1KTTB 2BD5A 3AAUA 5ETXA 3SNCA 1XX9A 1ELVA 1EP6A 1UTJA 1W11U 4AZ2B 2HNTF 5E8EH 2FOMB 2Y80A 3QO6A 1S0QA 1WAYB 2FTLE 1ANBA 1C4U2 3O8DA 1UHBA 3EDXB 1SGEE 1L1NA 1QRXA 1Y8TA 2PR3A 1QURH 1MZDA 4YLUA 3ZVAA 1W2KH 1OWHA 3M5MA 2FOHA 3OTJE 1VCWA 4I8JA 1Q3XA 3E1XB 3RMMH 4D7FA 3VB5A 1Y5AT 1YPHC 4FU8A 1UTKA 2ALPA 1OP2A 4GCHG 3KCGH 1TQ7B 1NRSH 3RXRA 3GISB 2LNCA 2PV9B 3B8JA 4QT8C 4YOIA 1P3CA 1O3DA 2CXVA 1O5GH 1AY6H 1O5EH 3JZ2B 1D3DB 4MQAA 1LKBA 1TBZH 3ELAH 1QA0A 4MVNA 3MNXA 4NSVA 1TA2A 2R0LA 2FS8A 4BXWA 1C2JA 3ZYEA 3A89A 2XW9A 5HM9A 3U1JB 7GCHF 3VB4A 5FCRA 3D62A 4X8TH 3MH4A 3ZVGA 2ANKH 1YLCA 2G81E 1V2VT 4RN6A 2BD2A 1P09A 1C5VA 3VGCC 3Q77A 1DVAH 2AFQB 1C5ZB 2Y5HA 2ZWLH 2RA0A 1P0SH 3VEQB 1S6HA 2OCVB 1F2SE 1G3BA 5I46H 3FP8E 1A46H 2CF8H 1L4DA 1AUJA 1V2KT 2OUAA 3TIUA 1UK2A 4WF8A 4X6NA 1NROH 1BMNH 2P3UB 3RXHA 3EA7A 1AZZA 4BAQB 7ESTE 1GI8B 1HRTH 3BTKE 3TJVA 5C1YA 1RTFB 1X7AC 1V2ST 2O8LA 4JZFH 3TNSA 2WPKS 3I77A 1VCPA 1Z7KA 1D6WA 4IMQA 2H2ZA 1UO6A 2QF0A 1E35B 1ARBA 1GHYH 3LGWA 2A2XH 2UWOA 5FXLA 1CBWC 6CHAC 1EPTA 2ALVA 2GZ8A 4FUDA 3TJOA 1SI5H 3RUOA 1CT4E 1LHEH 1AMHA 4GLYA 4D9QA 4Y76A 4AORA 1BB0B 1BDAA 5EXLA 4YZUA 2Y5GA 4NIVA 1DXPA 2WPIS 1EKBB 1F92A 2D1JA 1K22H 1WQSA 2TGDA 2BLOA 4XOJA 1UHBB 4YOGA 4CHAC 2SNVA 2GCHF 1DUEA 1TNIA 1PQ7A 1Z1IA 3SUEA 5AFYH 3Q3XA 1CA0B 3U8RH 3CS0A 7KMEH 3MNCA 2WPMS 1WU1A 1MTVA 2AMQA 3GDVA 2IOTA 4MPWA 2ZFPH 1MQ6A 3NPSA 3GCHB 4U32A 1PQAA 1P3EA 3T5FH 1L1GA 1O2MA 2PSXA 1SGYE 2P95A 3ZV8A 2G55A 1LTOA 3M37A 5J4QA 3UWIA 1EOLA 2KAIA 2WYGA 1AVWA 1C5OH 4X2XA 2BB4A 1DSTA 1DITH 1H8IH 5GIBA 2F9UA 4B75A 4DURA 1BIOA 1RTLA 3MHWU 3M3SA 5JBAS 1W8BH 4OS7A 2R3YA 1T7CA 1GG6C 3AW0A 2C3SA 5T6DA 5ABWA 1Q2WA 1TMBH 2GZ7A 4CH2B 1VR1H 1HAZB 3BF6H 1BRBE 1QBOA 1VGCB 2OC8A 5F8XA 1MMJN 1AWFH 1AE8H 1TGNA 3BTWE 1TPOA 5C3NA 2FIRH 5G4BA 1O3AA 1QCPA 1BMAA 1NRPH 1ZMJA 2ZFTA 1WOFA 1GGDC 1C5LH 1MU8B 2BOHB 2OC0A 3MH6A 2ZTZA 1TPPA 4AB8A 1EAWA 1O3LA 3FZZA 4XSKU 1OX1A 1BRUP 1EPTB 1Y59T 2FDAA 1AWHB 1A0HB 4UONA 1NESE 1GBAA 1ELDE 5DGJA 2UUYA 1KXEA 5TCAA 3NUMA 1SSXA 2A32A 1G36A 2G8TA 5DP9A 1KYNA 4MPVA 1T31A 2BDIA 4AFSA 1F0RA 4DCDA 3S7HB 4WH8A 1C1PA 4I32A 4ISNA 4WXVA 5FPYA 4U01A 1VJAU 3D23A 4X2YA 3ZZ6A 9ESTA 1GDQA 1D3TB 3SGQE 2JETC 2J92A 1EUFA 3M61U 1VJ9U 2XCNA 4M7GA 1FY5A 1C9PA 4K60A 1WTHD 2HVXA 3RXFA 1D3PB 3RM2H 3OY5U 4K2YA 3BV9B 1CO7E 2J2UA 4GHQA 3RXBA 1O3MA 1RTKA 2V6NA 3GCTG 4Q7YA 3PMBB 3TVJB 1ZZZA 1GBBA 2OC1A 1GBLA 2OP9A 2EI7A 1FDPA 1GWAA 4INKA 4NA9H 5LGOA 4ZUHA 1O2OA 3RXSA 1SB1H 2ANYA 2BQWB 3ZVBA 2VH0A 1P02A 3MO3A 5GJ4B 1A5IA 4FUHA 3PLPA 3ZVFA 2FP7B 2WINI 4ZROA 1P2KA 2GMTC 4A1TA 2Z9JA 1Y3VA 1O5AB 2GV7A 4RKJB 1F5RA 2TBSA 1DY9A 2UWLA 4ZXXH 4BAKB 4WMEA 3W94A 1Y5BT 2P8OB 1ZHMA 3EQ0H 5EQRA 1IHTH 2GZ9A 1K9OE 3IG6B 1L4ZA 2FM2A 2XYAA 1D3QB 1A7SA 4ISLA 3OYPA 1HJAC 1LPZB 2W7UA 1GBMA 1TE0A 2PGBB 2NU0E 4FUIA 3MU0A 4NWKA 2O9QA 2ODPA 3TU7H 3RXGA 4LXBH 2VWNA 1G3DA 2VGCB 5C1XA 7LPRA 2WPHS 1FY4A 5JPMH 1AB9C 5EQSA 4YESB 2RG3A 1SBWA 3TGKE 3RU4T 4R0IA 1CGHA 1V2RT 2XTTB 2WV4A 1BCUH 5A0CA 1XVOA 2VWMA 1FXYA 3G01A 3U8OH 1FAKH 1TNJA 1H9LB 2BDCA 1UK3A 1AFEH 3T25A 1SMFE 1WYKA 4XFQA 3RXJA 5JDUB 1FPCH 2DE9A 1A3EH 2P3TB 5EG4A 2PKAA 1TNLA 1G2MA 5EGMA 8KME2 5B6OA 2K1QA 1C2EA 1C2FA 2Y5FA 1T32A 3T29A 1MU6B 1BHXF 1C9TA 1DWBH 2OC7A 3FANA 1V2WT 1NZQH 4XDEA 5LPFA 2XWAA 1QBVH 1TPSA 2STAE 5AF9H 4GSOA 2H9HA 1TBQH 1TPAE 4ABGA 3V7TA 1EAIA 5E0HA 1QRWA 1ID5H 1EQ9A 4AFUA 1TALA 4BANB 2SGDE 4AX9H 1XVMA 1SGIB 2P16A 1M9UA 3STJA 1EB2A 1ANCA 3KNXA 4E05H 4ZKOU 1TX8A 2HRVA 3RXIA 1DX5M 2H5CA 5TCCA 1KXFA 2XNIA 4BAHB 4DT7B 2IJOB 2ZQ1A 5JBTA 4NSYA 3A82A 3MU4A 3A83A 1CBWB 1FY8E 6CHAB 1W0YH 2FODA 1JRSA 3PO1C 3NK8A 4JCNA 5EODA 4BTTB 5JB8S 1FZZA 1QRZA 3E91A 3D65E 5K0HA 1NRRH 2AMPA 3SJOA 2ODQA 2AIQA 2ODYB 2GCHG 5A0BA 1YC0A 3SU5A 3GY2A 1QL9A 3LGVA 3RP2A 1YCPM 1V3XA 4BOHA 1C1SA 2PUXB 3H7OA 1ZSLA 1XXFA 4WH6A 5F03A 1CVWH 1SHHB 4CHAB 1V2QT 4MDSA 1MKWK 1CGJE 3R0FA 5HGGA 3HGNA 4HTCH 4LOYH 1HAHH 2W3IA 1ELEE 1QBNA 1NU9A 2EA3A 2F9PA 4Y6DA 1O33A 6GCHF 1ETRH 1IQNA 1O31A 3Q3KA 1UTLM 3UQVA 4IGDA 1SQTA 1ELFA 4HGCA 1INCA 1C1QA 2PKAB 3LH1A 2A4OA 2HPQH 1YPMH 1HGTH 4H6TA 4LZ1H 2FO9A 1C5XB 1QB1A 2G00A 4AB9A 4H6SB 4O97A 1JWTA 4O03A 5DKMA 1C2MA 1GI6A 1TGCA 2Z6BD 1XUGA 3GY7A 3UWJH 2JH5D 1C2HA 2B0FA 3S7KB 2H9EH 4GVUA 1GG6B 1SGTA 3A7WA 1SGRE 1GMCF 4TY6A 1XUJA 3P17H 2O8UA 1AO5A 2RCEA 3RU4D 4NA8A 2BVSH 1TQ0B 4OS4A 1ESAA 2SGEE 1LHCH 1O38A 3TGIE 4X6PA 2THFB 1EJNA 1G3CA 1RJXB 4Y7BA 3MU5A 4TWWA 1BBRK 3VPKA 3NWUA 3A84A 2BVRH 3OSYA 1FN8A 1DE7H 1YPJH 2F9NA 1A5HA 4FUJA 1LQEA 1BZXE 2ZC9H 2OXSA 1TABE 1C5YB 1P2OA 1ABIH 4NCYA 1GGDB 2AERH 3SV7A 4SGAE 1K1OA 4ZAEA 1HJ8A 9LPRA 1E37B 1GJ5H 1QGFA 2VH6A 4KGAA 4FXGH 1MTNC 1KSNA 2GKVE 3HPTB 5BRRE 1P10A 3F1SB 4JYVH 4Z0KA 2VNTA 2ZO3H 3UOPA 3FFGA 4DW2U 1ZMNA 1J9CH 1GBKA 5FHTA 4X1SU 3SN8A 1HAOH 3CENA 1JRTA 1V2JT 1SG8B 4D7GA 1CE5A 1HYLA 1CHGA 5FAHA 1EZQA 3K9XB 1BQYA 4D76A 4I31A 1D6RA 2JETB 3LT3A 1O2IA 3KQBA 3LGIA 1HAIH 2CMYA 1UVUH 1S84A 2Q6DA 2BMGB 1BBRH 5CMXH 4I8HA 2BD4A 3PB1E 2ESTE 5C2ZA 3LGUA 3P8OA 1IQJA 2BLVA 5FPSA 3VB7A 4B2CA 1ELGA 2XC0A 1NU7B 3LGTA 4H42U 1TA6A 2XXLA 1QJ1B 1CGIE 2A1DB 2SGQE 1FJSA 2V3HH 3W95A 2VWLA 3BTEE 1FONA 1BBRE 3A7VA 1MTSA 4I8KA 1F5KU 1AE5A 1OYQA 2NU2E 1DM4B 3KEEA 5A8XA 4CRGA 3UOUA 1EAUA 2DUCA 2FOEA 2C90B 4U30A 4TWYA 1C5UA 1UCYK 3SJ9A 2GMTB 3GY8A 4LK4A 5DP7A 1HCGA 4D9RA 2BDYA 3U98H 4JZIA 1LO6A 4E06H 4UFFH 1BMMH 4NZQA 2ZCKP 1HAXB 2H5DA 3MOCA 3L3TA 3GYMA 1NS3A 4KELA 5C5NA 1FI8A 1TNGA 1GI1A 4FVBA 1WUNH 2Q6GA 1IQLA 1KTSB 4D8NA 1NC6A 1HJAB 2CHAC 2Z7FE 3FVFB 3QZRA 3SUDA 1T4UH 2JH6D 3QN7A 1LVMA 3QGJA 4JYUH 4GAWA 1HNEE 3PTNA 1DOJA 3F9EA 4UEHH 1P57B 1SGQE 5FX6A 3M5LA 1GHVH 3TH2H 4Y8YA 1HUTH 1AB9B 3AASA 1DT2A 2VIQA 2TGAA 2ZZUH 3T62A 3F9FA 1Z8JB 3SU1A 4OS6A 1IQEA 2Z9IA 4J1YA 2OBOA 1AIXH 1EJMA 2H9TH 1SGNE 3Q00A 2CGAA 2FX6A 1TWXB 2HLCA 2JH0D 2UUKB 1RXPA 2XC4A 4DY7B 5IDKA 3UR6A 4GPGA 1IQKA 4MLFB 1TX7A 3TNTA 1O5CB 4AFQA 3F9HA 1T8LA 3TGJE 4R8TB 2ZGXH 2A5KA 1XUHA 4O3TA 2AIPA 1YF4A 4JZ1A 3BEUA 4INLA 2VU8E 2XBVA 2AGEX 3RC4A 2IPHA 1TIOA 3SORA 4ZHMU 3URDA 1ESTA 1BTWA 1FNIA 3RMNH 5TJXA 3SU4A 1ELAA 2BD8A 1H8DH 4DVAU 2R2MB 4UFDH 3SQHE 1O3HA 1TGBA 2F9BH 2Y82A 4BTUB 1N8OC 1O3KA 4ABIA 4Q2KA 1UMAH 3SV6A 1F5LA 3HKIB 1UK4A 2VVCA 2G52A 1VITF 2C8XB 2W26A 3PM3A 1EZXC 2JKHA 3SI4H 4F49A 1PPFE 4B71A 1AQ7A 3E6PH 2Z9GA 3P8NA 1EX3A 5LH8A 1HAYB 1F0UA 1TFXA 3KIDU 2ZU2A 3PO1B 3ZYDA 2ZFSA 2PW8H 2VIDA 3MYWA 1LVYA 2A7JA 1CHOF 2FLBH 4SGBE 2GDDA 1A2CH 3BIVH 1BOQA 1JIRA 1DANH 3O8BA 2RA3A 1LDTT 2ZPRA 1UVPA 5DP6A 2ASUB 3LU9B 2OTVA 1O35A 4JMYA 3HK6B 3RXKA 2DE8A 2GCTC 2C8YB 1C5NH 2ZU3A 6GCHG 2I6QA 3SNDA 2A7HA 3MMGA 4Y79A 1J15A 2BDBA 3C1KA 1O3OA 2BOKA 4WWYA 4A5TS 3VXEH 4Q7XA 4WVPE 1OOKB 2ZDNA 1IQGA 1Y5UT 4Y0ZE 3O8CA 1K28D 2FZZA 2B8OH 1O3EA 3K65B 1ANDA 5EPNA 1Y3UA 3BTDE 3QWCH 1MH0A 3GOVB 4B74A 1K2I1 1GI7B 2AYWA 2BTCE 1GMCG 1VCQA 3D49H 3MNSA 1EAXA 4OGYA 1HPGA 2GT7A 3TK9A 1P03A 3L33A 5GXPA 2XBWA 1ANEA 1F0TA 1GBHA 1FAXA 3F9GA 1T8NA 3SU0A 1YBWA 1F7ZA 1TB6H 3KL6A 4XBBA 1Z8IB 5GDSH 3UNRA 1KLTA 1GHBF 4JZEH 3SJ8A 3VXFH 4AN7A 3ZZ4A 1C5QA 1EXFA 3DA9B 2J34A 4CR9A 1JBUH 4B1TA 3A8CA 1MCTA 1DWCH 2ZDLA 2XRCA 5DP4A 1O2SA 4WXIA 1TYNA 1O2LA 2C8ZB 1FY3A 4DIIH 1HBTH 3KN2A 3S69A 3T2NA 1S0RA 1IOEA 1T8MA 2EEKA 1LHDH 3KQEA 1B0FA 3BEIB 3Q76A 2RDLA 2G51A 4KKDA 2GDEH 1TRYA 2BDAA 2W3KA 1GCDA 1MTNB 1YPGH 3SU2A 2ULLA 1L1JA 2AGGX 4BAOB 2BM2A 2HALA 3STIA 2A4QA 5FX5A 1PQ5A 1C1MA 1YPKH 2QN5T 3BG4C 3SNEA 3H5CB 1SFQB 3ZV9A 3UUZA 2AEIH 5A2MH 1G9IE 2NU4E 1O36A 1SOTA 4OS2A 3IITA 3AW1A 3K2UA 4X0WU 1WCZA 1FY1A 1GBCA 3GY6A 1ETTH 1JMOH 1U6QA 3TJUA 2H1UA 1GPZA 1P04A 1DUAA 1HB0B 3A8AA 4E7NA 3TLOA 2NWNA 2F9OA 1E0FD 4AGJA 2SGFE 4CRBA 3UIRA 5SGAE 3ODFA 3RC5A 1XUKA 3GY4A 3RU4E 2ZF0H 4ZMAH 1L2EA 1LQDB 2WPLS 3DD2H 1BUIA 3NKKA 1H9HE 4INHA 3BTFE 1RGQA 2Q1JA 3LJOA 1UTNA 1ABJH 1P2QA 1DWDH 1SGFG 2ZDMA 2QXGA 3T27A 3ATIA 1BRAA 4AFZA 1QIXB 1BTHH 1A4WH 1Z6EA 2BVXH 1MUEB 1OWDA 3LONA 2XBXA 4JK5A 2BY6X 1HV7A 1UJ1A 5EW2H 2ZDAH 1TMTH 2ZECA 1E36B 1UTOA 3QUMP 3TH3H 2OINA 5FCKA 3QLPH 1QQUA 1WTGH 2BD9A 3SNAA 2EC9H 4IC5A 3ESTA 1BTYA 1HXEH 4KTCA 1O39A 1QFKH 1ZOMA 2CV3A 3SHCH 4AGKA 1LVBA 1F0SA 3ATLA 5F8ZA 1OKXA 4ZKNU 2CN0H 1ELCA 1Y3YA 2J4IA 1PPCE 3DUXH 3VB6A 2NU3E 1PYTD 1DDJA 2G5NA 1C5PA 2FWWA 1CSOE 1UVSH 2VB0A 1YKTA 2F83A 3PYHA 1VZQH 1Z1JA 2R0KA 2Y6TA 1N1LA 2QCYA 3U8TH 4AYVB 1MBQA 1SLWB 3ZVEA 4AYYB 2FESH 1S81A 1MD7A 1V2UT 1ZR0A 3MU8A 1AVGH 5E0JA 4YOJA 2GVFA 1V6DA 4YO9A 3VGCB 4X1QU 1G2LA 2ZFFH 4GHTA 4A1XA 3KGPA 1MTWA 2QF3A 5T6FA 1BITA 2HNTE 2O8TA 3EA8A 3PLBA 1GJ9B 2PTCE 2ZKSA 2YNBA 1IQFA 4I8GA 1QB6A 3KHVA 3P70B 3TK6A 1A5GH 1O37A 1EZUC 2HNTC 1HDTH 2BZAA 3RXQA 3A7XA 3A7YA 1LKAA 1GI5A 1S6FA 1J14A 3LKWA 1O2RA 2PKSC 2XWBI 3P95A 1LHGH 4JK6A 1NY22 1C2KA 2A4GA 1Z8GA 1AGJA 1C5TA 4FU7A 2F3CE 2FEQH 4NWLA 1ZTKA 3MH7A 2SGPE 2QGRA 4NIYA 4LZ4B 1QA7A 3K6ZA 1QL7A 1VITG 3LC5A 2O8WA 3ZZ3A 1FIWA 1N6YA 4ABJA 3RXVA 2HPPH 4WY3A 1N8OB 2OQUA 3UREA 1IQMA 4O3UA 1H4WA 1GJDB 4IN1A 4I8LA 1NO9H 3BSQA 2A45B 1C2IA 4X6MA 3HATH 1CHOG 2C93B 2D2DA 4NIXA 1UVTH 3BTGE 3LIWA 3RDZA 1RIWC 1ACBE 1OSSA 4WMFA 4YTAA 5CE1A 5CHAC 4AG2A 2G4UA 2J94A 3N7OA 4X8UH 1EJAA 1H1BA 3KQDA 1A3BH 5DP3A 2SGAA 4TPYA 2D26C 1C1UH 1DWEH 1BTZA 4DIHH 3QZQA 3A87A 1J17T 1MAXA 4OS1A 1QNJA 2FI5E 3RMLH 3SHAH 1KLJH 1J8AA 1GMDF 1GMHG 4ZH8A 2ZFRH 4ABEA 1QR3E 2GCTB 1GJ7B 1SGPE 2SNWA 2ZFQH 1KXBA 4OS5A 1S5SA 1PPEE 3E8LA 4Y7AA 4HZHA 1OYTH 2C4FH 3RXPA 3SUGA 3RXEA 2H6MA 4FUEA 1VITH 5HMAA 5EU8A 5DO4H 2O8MA 3GCNA 4BNRA 1J16A 4MPXA 3SV8A 1NFYA 4WMDA 1S83A 2GV6A 1LVOA 1W7GH 1ZRKA 5JBBS 4B73A 2BD3A 3A7TA 3V12A 1O2UA 2VIVA 1MKWH 2ZG0H 1NFXA 8LPRA 5GCHF 1GHBG 2R9PA 4UFGH 1XUFA 1ZLRA 3ZZBA 4XBCA 1GBIA 3ZZAA 3F68H 5DJ7A 5A09A 1D4PB 1WQVH 2ZHFH 1K1LA 3E0NB 2FYQA 1ZJDA 1TRMA 1OWEA 3SBKA
chains in the Genus database with same CATH superfamily
5L6NH 1THSH 5JBCS 1N6XA 1FN6A 3PROA 4CREA 1IQIA 1BMLA 3CP7A 1DY8A 1KXDA 2FI3E 3U28C 4MG3A 3A8DA 1HIAA 1MAYA 4CR5A 4AG1A 4A92A 3GY5A 3MI4A 2FYRA 3AVZA 5F6MA 1O5BB 2FMJA 1GBJA 1AZ8A 4OGXA 4ABAA 3OY6U 3FP6E 1OWKA 1QTFA 2ZTYA 1P2JA 1V2NT 3LPRA 1O3GA 4X8VH 1CQQA 2A7CA 1D9IA 4TY7A 3RXDA 2GD4B 1YYY1 2FX4A 1TX6A 2CK3D 1GHZA 1EASA 1TNHA 2ZGBH 1FQ3A 1OWJA 1GCTC 2OBQA 1IHSH 2Z94A 3BG4B 2AMDA 1IAUA 4Y11E 1C1VH 3RXMA 3MWIU 3O8RA 1O3NA 1TOMH 1O2QA 1OXGA 1XUIA 2TPIZ 1P9UA 2QE7D 3EYDA 3SU6A 2R2WU 2P3FH 4JZDH 3SOSA 1O2JA 3DFJA 2J97A 1YGCH 2BXUH 3B9FH 2ANWA 4ISIH 1HXFH 1HAVA 1CT2E 1EFRD 1UTMA 1V2TT 4BXSA 5HYOA 2FPZA 3SJIA 4K69A 3S0NA 1XXDA 1GI9B 1K1MA 3M3VA 4I7YH 3C27B 1P8VC 1GHWH 1O2VA 1XKAC 2R3UA 3P8FA 1A0JA 3RXCA 1RRKA 2GGVB 1KLIH 2QXHA 1OPHB 1W7XH 1BT7A 2D8WA 8ESTE 1S6LA 1TOCB 2W7SA 5KECA 4K1EA 1O5DH 4FVDA 1YCPK 1QB9A 3B23B 2CJIA 2VGCC 3OEHD 1YPHE 5EXMA 2WUCA 2BY7X 3BIUH 1MD8A 4I86A 1GBTA 1DICA 3M7QA 1C5WB 2PFEA 3QDZB 4IBLH 1CU1A 1NM6A 1L0ZA 2AS9A 3BTME 4RT0A 4ZKRU 4CRAA 1BTPA 4ASHA 4Q7ZA 1K1NA 2FOFA 1RS0A 3A80A 1C2LA 4E7RG 5F8TA 6ESTA 3EE0B 1ZJKA 2ZQ2A 1O3CA 3MO9A 5KEDA 3E3TA 4IW4E 4J2YB 1GVZA 1B0EA 1C2GA 1O2KA 1UVOA 1HFDA 1HIAB 3LJJA 1UCYH 3SW2B 3UFAA 5A8ZA 1E34B 1HJ9A 3RXOA 1GHXH 3NZIA 3QTOH 1MBMA 1G30B 1ZPZA 2V35A 2HLDD 2HOBA 2WZQA 3TK5A 4X2VA 1QHRB 4K1SA 1V2LT 1SL3A 3CS7A 1O2NA 1YCPH 4MNYA 1UCYE 3SNBA 5DP5A 2WV5A 1V2PT 3F6UH 5A0AE 1O2TA 3QX5H 1SLVB 2BQ6B 5HM2A 4YLQH 1KDQB 2V3OH 2J9NA 4X1PU 2TIOA 4MNWA 2WPJS 3ATMA 1SGDE 3UNSA 2QF4A 1RFNA 4A6LA 4IN2A 2EI8A 4TYDA 2LP6A 4DG4A 3AAVA 5H4IB 5A8YA 1AUTC 4YM9A 1UW7A 4ABBA 3S9BA 1O3JA 1HAVB 2ILNA 2RDEA 2BY9X 2LELA 2ZI2H 3HK3B 3QTVH 3LH3A 1BRCE 2PKSB 1KMHB 4MPUA 3PMAB 1P9SA 1V2OT 4VGCC 2BDGA 2YNAA 4MTBA 1PQ8A 3V0XA 5LPRA 1AN1E 1TONA 3BN9A 5DK1A 2CF9H 3I29A 1GJ6A 3NRLA 4U2WA 1XM1A 1ORFA 2XC5A 2BQ7B 1W10U 5EPYA 3P8GA 4XBDA 1DLEA 4UFEH 1CA8B 5DN6D 2ZHEH 1DFPA 1COWD 1KY9A 3P6ZB 3ZVDA 2TGTA 1K1JA 1JOUB 1O2PA 2YMSC 1PYTC 1QY6A 4AOQA 1AFQC 1EP5A 5DPAA 3MTYA 2J98A 1RIWB 1GMDG 1Z6JH 5CHAB 4ACBA 1GMHF 1K21H 3SV2H 1GVKB 2ZHQH 3ATWA 4NG9H 3FO8D 1WV7H 1ZPBA 2G4TA 3OU0A 3PLKA 2PWXA 1YWUA 1OS8A 1EB1H 1QJ7B 1O3IA 2M2AA 2BYAX 1GI4A 3R3GB 3T28A 5FBEA 2QV1A 3T26A 1DLKB 1ZMLA 3V3MA 2QC2A 2QF5A 5ESTE 1THPB 1Z71A 1NTPA 1TBRH 4A1VA 3A85A 5L30H 3ZZ5A 2FS9A 2C8WB 3PWBA 3SUFA 2WSSD 2UWPA 4UE7H 5CHBA 1AD8H 1LCYA 3ZZ8A 3OE7D 1W0ZU 1O32A 4FUCA 2AH4X 5GCHG 5EQQA 4FU9A 1HAPH 1P05A 3E0PB 3BG8A 3RXUA 3SYJA 4RI0A 1PJPA 1ESBA 1TAWA 4B6EA 1XKBC 1YLDA 1TMUH 1ZPCA 1LMWB 1NT1A 4ISOA 2K0QA 4YT6H 3A81A 1C2DA 4CH8B 2P94A 2UUFB 1GHAF 2VINA 1GI0A 5AFZH 1BJVA 3ZZ9A 1SQOA 1Z8RA 3CNRA 2FOAA 1ARCA 1C5RA 2ZU5A 3TITA 1Y3WA 2HWLB 4B76A 3SZNA 3UTUH 2BLWA 1LHFH 1GBEA 2WUBA 4Y0YE 3HKJB 1BTUA 1MKXK 4JYTA 1NFUA 3A7ZA 3SGAE 4DGJA 1YPLH 1ZRBA 4GUXA 4ESTE 2Q6FA 1O30A 4X1RU 2OLGA 4NIWA 4NZLA 1ZSKA 2ZHDA 2FOCA 1W12U 1QJ6B 2ZNKH 4ABHA 3ZZ7A 1WSSH 3SU3A 4Y10E 4DOQA 1P06A 2ZGJA 4YT7H 2BZ6H 1IQHA 2J98B 1AKSA 1GL0E 5I25A 2PHBA 3WWFA 1GJCB 1Q31A 3BEFB 1LPGB 5E2PA 1C5MD 2A5AA 1GCTB 2ZCHP 3V13A 2BX4A 4K8YA 4ZXYH 1P11E 5LPEA 1P2NA 1B7XB 2KAIB 5GWZA 8GCHF 2GT8A 1SLUB 2BY8X 4X6OA 5EOKA 5AHGH 3S9CA 1A61H 3RMOH 5JYIA 5EJ1A 4IC6A 3EAJA 1PPGE 2L74A 3EGKH 3BTTE 5FBIA 4H4FA 1P12E 3F2FA 1GJ8B 4XE4A 3SGBE 4HG6A 3OAAD 1SR5C 1HAGE 5ESBA 1MKXH 3E16B 2BY5X 3H09A 3UR9A 4CBOA 5DP8A 1P2MA 1WDIA 1T8OA 1ZTLA 4B2AA 4TPIZ 3LGYA 2V0BA 2KCAA 3PRBA 2QYIA 2G5VA 3KF2A 4B2BA 1C1OA 5EXNA 1OWIA 5GPIB 4DJZB 1MQ5A 2BDHA 1EATA 1P01A 1C1TA 1LPKB 2CHAB 4GCHF 1ZSJA 4ZKSU 1B5GH 3LOXA 4ABDA 1MZAA 4CRDA 1GJAB 1SLXB 1O2XA 1SHYA 2Z3EA 2XOKD 2Z3DA 5J4SA 2ZHWH 2FI4E 1ZHRA 2OQ5A 3GDUA 3ODDA 4ZHAA 7GCHG 1ELTA 3GCOA 3KQCA 4IS5A 3OX7U 1QQ4A 1ETSH 4FUFA 5C0UA 2LPRA 2F9VA 4O9VA 3M36A 3RLWH 3UY9A 3TJNA 1YP9A 1O5FH 1FIZA 4NFEA 4Q80A 3U69H 1SC8U 1O0DH 3GY3A 2ZU4A 1TGTA 3M5NA 1ZHPA 1O34A 2GJGA 4NGAH 5C17A 2B5TB 3NXPA 3M7TA 1YM0A 2ZDVH 3JZ1B 5KGOA 1G32B 3MNBA 2YOLA 1MTUA 1ZGVA 5E0GA 4HFPB 1TGSZ 4FUGA 1K1PA 1UTQA 1BTXA 2GTBA 3NCLA 1SPJA 1AKSB 3RLYH 4K8BA 4KTUA 1GI3A 1W13U 3I78A 3ZIAD 3ZZDA 2VJ1A 5BPEA 2M5TA 3A8BA 2ANMH 2QXJA 4MNVA 2WHXA 3A88A 5HXFA 2A5IA 1GJBB 3M7UA 4K3JA 5FPTA 1O2HA 2PSYA 4ABFA 2J38A 3WY8A 1GJ4H 1KXAA 2EI6A 1H9IE 2A2QH 1YPEH 5L2ZH 2P93A 2FTMA 3BTHE 1FPHH 1T4VH 2Z9LA 1O2YA 1SFIA 2ZU1A 1MCVA 2BD7A 3DSOA 4CBNA 1KIGH 1A0LA 2HGTH 4CRFA 4CRCA 1CA0C 2BXTH 1BA8B 4X1NU 1PPHE 2ZIQH 3VB3A 2PP6A 5K7RA 2P59A 1SQAA 2KCPA 2PUQH 1DPOA 5C20A 1GBDA 3UNQA 1JXPA 1O2WA 1JIMA 2ZEBA 4VGCB 2VWOA 4UD9H 1BJUA 4F4OC 3GCHC 2IPQX 5HKKD 1UTPA 4HI3A 3RXLA 4A7IB 3FP7E 3DFLA 2VIWA 1QL8A 2AGIX 2STBE 3PV4A 3ZVCA 3M5OA 1GI2A 3GDSA 3H7TA 1NPMA 1GL1A 5C5OA 3DHKH 3TH4H 3PMHB 4Y8ZA 1O3PB 2BHGA 2UUJB 3PTBA 4KP0A 3UQOA 2VIPA 3IWMA 4RKOB 3ZZCA 4I33A 5JB9S 1ZGIA 2VVUA 1AFQB 3GYLB 1ZTJA 2KX4A 1SGCA 3WW7A 3M35A 1W3CA 1BHXB 3FAOA 1OP0A 1EOJA 1FV9A 1G37A 1GDUA 1VGCC 2J95A 3RM0H 1C5SA 5E2OA 5F53A 2Z9KA 1TNKA 4FUBA 3SI3H 2GP9B 3E90B 2IN2A 1E1QD 1NRNH 2ZDKA 5T6GA 3SO3A 2BX3A 2QY0B 1CT0E 2VIOA 3QGNB 2PLXA 3K6YA 1Y3XA 5IYTA 1C1WH 2FLRH 4OM9A 4BAMB 3PWCA 1PPBH 1W14U 5DG6A 2BLQA 3DT0H 4K5ZA 1C1RA 1ZYOA 1C4V2 2A4RA 1RD3B 2XCFA 4THNH 2ZTXA 2FOBA 1AU8A 3SV9A 3L6PA 1O2ZA 1EPTC 3MO6A 4MNXA 1NRQH 3ENSB 2WYJA 4Z6AH 1XMNB 1THRH 1WBGB 1EZSC 3RXTA 2Y7XA 1PFXC 5AVDA 2TRMA 4UDWH 2GX4A 2Y7ZA 1AHTH 1NFWA 2OD3B 1O3FA 4IMZA 1OP8A 2A31A 2QA9E 1NN6A 3UPEA 1S85A 5PTPA 2VVVA 1GHAG 1E38B 3U1IB 2TGPZ 3QK1A 4ZHLU 2W5EA 5C1UA 3FZDA 4RSPA 2XBYA 2ZP0H 1FUJA 2F91A 3TPIZ 2VBCA 2QXIA 1DSUA 3MU1A 3LDXH 3MH5A 2ZCLP 4KTSA 2A0QB 3ITIA 3VFEA 4FOUC 1GDNA 5EW1H 2ZPQA 2FXRA 3ATKA 2ZA5A 1SVPA 1O3BA 1V2MT 1KXCA 2PTNA 5T3HA 1P2IA 4K1TA 5C67A 1DXWA 1K1IA 2QAAA 3Q3YA 4ISHH 3RXAA 1C4Y2 1SOZA 2QIQA 2Z3CA 1C1NA 3RC6A 2FOGA 1HLTH 1KDQA 4WJG2 5T1VA 4PROA 6LPRA 2SFAA 3GCTF 3HGPA 3EA9A 2ZGHA 3A86A 4X8SH 3GICB 1GVLA 1S82A 1A1RA 2ZGCA 3KQ5A 1ELBA 2B7DH 3P92A 4Y71A 3U9AH 2NU1E 3SQEE 4X2WA 4BTIB 1NBMD 3M3TA 1TRNA 4NA7A 1G3EA 3URCA 1GBFA 3MFJA 1AI8H 2Y81A 4Y8XA 5L2YH 2P8OC 3LC3A 4NFFA 8GCHG 1AVXA 1PPZA 1FLEE 2ZPSA 2PGQB 3SJKA 2I6SA 1DS2E 2B9LA 1FMGA 1SGFA 1O2GH 1TLDA 3BTQE 3PMJA 3S9AA 1KTTB 2BD5A 3AAUA 5ETXA 3SNCA 1XX9A 1ELVA 1EP6A 1UTJA 1W11U 4AZ2B 2HNTF 5E8EH 2FOMB 2Y80A 3QO6A 1S0QA 1WAYB 2FTLE 1SKYE 1ANBA 1C4U2 3O8DA 1UHBA 3EDXB 1SGEE 1L1NA 1QRXA 1Y8TA 2IJD1 2PR3A 1QURH 1MZDA 4YLUA 3ZVAA 1W2KH 1OWHA 3M5MA 1K0HA 2FOHA 3F2HA 3OTJE 1VCWA 4I8JA 1Q3XA 3E1XB 3RMMH 4D7FA 3VB5A 1Y5AT 1YPHC 4FU8A 1UTKA 2ALPA 1OP2A 4GCHG 3KCGH 1TQ7B 1NRSH 3RXRA 3GISB 5FL7D 2LNCA 2PV9B 3B8JA 1WXRA 4QT8C 4YOIA 1P3CA 1O3DA 2CXVA 1O5GH 1AY6H 1O5EH 3JZ2B 1D3DB 4MQAA 1LKBA 1TBZH 3ELAH 1QA0A 4MVNA 3MNXA 4NSVA 1TA2A 2R0LA 2FS8A 4BXWA 1C2JA 3ZYEA 3A89A 2XW9A 5HM9A 3F2GA 3U1JB 7GCHF 3VB4A 5FCRA 3D62A 4X8TH 3MH4A 3ZVGA 2ANKH 1YLCA 2G81E 1V2VT 4RN6A 2BD2A 1P09A 1C5VA 3VGCC 3Q77A 1DVAH 2AFQB 1C5ZB 2Y5HA 2ZWLH 2RA0A 1P0SH 3VEQB 1S6HA 2OCVB 1F2SE 1G3BA 5I46H 3FP8E 1A46H 2CF8H 1L4DA 1AUJA 1V2KT 2OUAA 3TIUA 1UK2A 4WF8A 4X6NA 1NROH 1BMNH 2P3UB 3RXHA 3EA7A 1AZZA 4BAQB 7ESTE 1GI8B 1HRTH 3BTKE 3TJVA 5C1YA 1RTFB 1X7AC 1V2ST 2O8LA 4JZFH 3TNSA 2WPKS 3I77A 1VCPA 1Z7KA 1D6WA 4IMQA 2H2ZA 1UO6A 2QF0A 1E35B 1ARBA 1GHYH 3LGWA 2A2XH 2J5UA 2UWOA 5FXLA 1CBWC 6CHAC 1EPTA 2ALVA 2GZ8A 4FUDA 3TJOA 1SI5H 3RUOA 1CT4E 1LHEH 1AMHA 4GLYA 4D9QA 4Y76A 4AORA 1BB0B 1BDAA 5EXLA 4YZUA 2Y5GA 4NIVA 1DXPA 2WPIS 1EKBB 1F92A 2D1JA 1K22H 1WQSA 2TGDA 2BLOA 4XOJA 3W1EA 1UHBB 4YOGA 4CHAC 2SNVA 2GCHF 1DUEA 1TNIA 1PQ7A 1Z1IA 3SUEA 5AFYH 3Q3XA 1CA0B 3U8RH 3CS0A 7KMEH 3MNCA 2WPMS 1WU1A 1MTVA 2AMQA 2F43B 2EQNA 3GDVA 2IOTA 4MPWA 2ZFPH 5DSFA 1MQ6A 3NPSA 3AK5A 3GCHB 4U32A 1PQAA 1P3EA 3T5FH 1L1GA 1O2MA 2PSXA 1SGYE 2P95A 3ZV8A 2G55A 1LTOA 3M37A 5J4QA 3UWIA 1EOLA 2KFWA 2KAIA 2WYGA 1AVWA 1C5OH 4X2XA 2BB4A 1DSTA 1DITH 1H8IH 5GIBA 2F9UA 4B75A 4DURA 1BIOA 1RTLA 3MHWU 3M3SA 5JBAS 1W8BH 4OS7A 2R3YA 2KCOA 1T7CA 1GG6C 3AW0A 2C3SA 5T6DA 2WPDD 5ABWA 1Q2WA 1TMBH 2GZ7A 4ACAA 4CH2B 1VR1H 1HAZB 3BF6H 1BRBE 1QBOA 1VGCB 2OC8A 5F8XA 1MMJN 1AWFH 1AE8H 1TGNA 3BTWE 1TPOA 4P02A 5C3NA 2FIRH 5G4BA 1O3AA 5B6LA 1QCPA 1BMAA 3OTPA 1NRPH 1ZMJA 2ZFTA 1WOFA 1GGDC 1C5LH 1MU8B 2BOHB 2OC0A 3MH6A 2ZTZA 4ZCNA 1TPPA 4AB8A 1EAWA 1O3LA 3FZZA 4XSKU 1OX1A 1BRUP 1EPTB 1Y59T 2FDAA 1AWHB 1A0HB 4UONA 1NESE 1GBAA 1ELDE 5DGJA 2UUYA 1KXEA 5TCAA 3NUMA 1SSXA 2A32A 1G36A 2G8TA 5DP9A 1KYNA 4MPVA 1T31A 4B6FA 2BDIA 4AFSA 1F0RA 4DCDA 3S7HB 4WH8A 1C1PA 4I32A 4ISNA 4WXVA 5FPYA 4U01A 1VJAU 3D23A 4X2YA 3ZZ6A 9ESTA 1GDQA 1D3TB 3SGQE 2JETC 2J92A 1EUFA 3M61U 1VJ9U 2XCNA 3F3BA 4M7GA 1FY5A 1C9PA 4K60A 1WTHD 2HVXA 3RXFA 1D3PB 3RM2H 3OY5U 4FETA 4K2YA 3BV9B 1CO7E 2J2UA 4GHQA 3RXBA 1O3MA 1RTKA 2V6NA 3GCTG 4Q7YA 3PMBB 3TVJB 1ZZZA 1GBBA 2OC1A 1GBLA 2OP9A 2EI7A 1FDPA 1GWAA 4INKA 4NA9H 5LGOA 2V7QD 4ZUHA 1O2OA 3RXSA 1SB1H 2ANYA 2BQWB 3ZVBA 2VH0A 1P02A 3MO3A 5GJ4B 1A5IA 4FUHA 3PLPA 3ZVFA 2FP7B 2WINI 4ZROA 1P2KA 2GMTC 4A1TA 2Z9JA 2F4LA 1Y3VA 1O5AB 2GV7A 4RKJB 1F5RA 2TBSA 1DY9A 2UWLA 4ZXXH 4BAKB 4WMEA 3W94A 2KR7A 5EJLA 1Y5BT 2P8OB 1ZHMA 3EQ0H 5EQRA 1IHTH 2GZ9A 1K9OE 3IG6B 1L4ZA 2FM2A 2XYAA 1D3QB 5EJZA 1A7SA 4ISLA 3OYPA 1HJAC 1LPZB 2W7UA 1GBMA 1TE0A 2PGBB 2NU0E 4FUIA 3MU0A 4NWKA 2O9QA 2ODPA 3TU7H 3RXGA 4LXBH 2VWNA 1G3DA 2VGCB 5C1XA 7LPRA 2WPHS 2L6OA 1FY4A 5JPMH 1AB9C 5EQSA 4YESB 2RG3A 1SBWA 3TGKE 3RU4T 4R0IA 1CGHA 1V2RT 2XTTB 2WV4A 2RFKC 1BCUH 5A0CA 1XVOA 2VWMA 1FXYA 3G01A 3U8OH 1FAKH 1TNJA 1H9LB 2V3MA 2BDCA 3OFND 1UK3A 1AFEH 3T25A 1SMFE 1WYKA 4XFQA 3RXJA 5JDUB 1FPCH 2DE9A 1A3EH 2P3TB 5EG4A 2PKAA 1TNLA 1G2MA 5EGMA 8KME2 5B6OA 2K1QA 1C2EA 1C2FA 2Y5FA 1T32A 3T29A 1MU6B 1BHXF 1NBME 1C9TA 1DWBH 2OC7A 3FANA 3MQKC 1V2WT 1NZQH 4XDEA 5LPFA 2XWAA 1QBVH 1TPSA 2STAE 5AF9H 4GSOA 2H9HA 1TBQH 1TPAE 4ABGA 3V7TA 1EAIA 5E0HA 1QRWA 1ID5H 1EQ9A 4AFUA 3KYFA 1TALA 2KCYA 3PV5A 4Q63A 4BANB 2SGDE 4AX9H 1XVMA 1SGIB 2P16A 1M9UA 3STJA 1EB2A 1ANCA 3KNXA 4E05H 4ZKOU 1TX8A 2HRVA 5EIYA 3RXIA 1DX5M 2H5CA 5TCCA 1KXFA 2XNIA 4BAHB 4DT7B 2IJOB 2ZQ1A 5JBTA 4NSYA 3A82A 3MU4A 3A83A 1CBWB 1FY8E 6CHAB 1W0YH 2FODA 1JRSA 3PO1C 3NK8A 4JCNA 5EODA 4BTTB 5JB8S 1FZZA 1QRZA 3E91A 3D65E 5K0HA 1NRRH 2AMPA 3SJOA 2ODQA 2AIQA 2ODYB 2GCHG 5A0BA 1YC0A 3SU5A 3GY2A 1QL9A 3LGVA 3RP2A 1YCPM 1V3XA 4BOHA 2XNDD 1C1SA 2PUXB 3H7OA 1ZSLA 1XXFA 4WH6A 5F03A 1CVWH 1SHHB 4CHAB 1V2QT 4MDSA 1MKWK 1CGJE 3R0FA 5GNDA 5HGGA 3HGNA 4HTCH 4LOYH 1HAHH 2W3IA 1ELEE 1QBNA 2YMSB 1NU9A 2EA3A 3UAIC 2F9PA 4Y6DA 1O33A 6GCHF 1ETRH 1FX0B 1IQNA 1O31A 3Q3KA 1UTLM 4ASUD 1H8ED 3UQVA 4IGDA 1SQTA 4AC9A 1ELFA 4HGCA 1INCA 1C1QA 2PKAB 3LH1A 2A4OA 2HPQH 1YPMH 1HGTH 4H6TA 4LZ1H 2FO9A 1C5XB 1QB1A 3FN8A 2G00A 4AB9A 4H6SB 4O97A 1JWTA 4O03A 5DKMA 1C2MA 1GI6A 1TGCA 2Z6BD 1XUGA 3GY7A 3UWJH 2JH5D 1C2HA 2B0FA 3S7KB 4F48B 2H9EH 4GVUA 1GG6B 1SGTA 3A7WA 1SGRE 1GMCF 4TY6A 1XUJA 3P17H 2O8UA 4DT4A 1AO5A 2RCEA 3RU4D 4NA8A 2BVSH 1TQ0B 4OS4A 1ESAA 2SGEE 1LHCH 1O38A 3TGIE 4X6PA 2THFB 1EJNA 1G3CA 1RJXB 4Y7BA 3MU5A 4TWWA 1BBRK 3VPKA 3NWUA 3A84A 2BVRH 3OSYA 1FN8A 1DE7H 1YPJH 2F9NA 1A5HA 3EE7A 1LQEA 4FUJA 1BZXE 2ZC9H 2OXSA 1TABE 1C5YB 1P2OA 1ABIH 4NCYA 1GGDB 2AERH 3SV7A 4XRNA 4SGAE 1K1OA 4ZAEA 1HJ8A 9LPRA 1E37B 3OEED 1GJ5H 3F0PA 1QGFA 2VH6A 4KGAA 4FXGH 1MTNC 1KSNA 2GKVE 3HPTB 5BRRE 1P10A 3F1SB 4JYVH 4Z0KA 2VNTA 2ZO3H 3UOPA 3FFGA 4DW2U 1ZMNA 1J9CH 1SQRA 1GBKA 5FHTA 4X1SU 3SN8A 1HAOH 3CENA 1JRTA 1V2JT 1SG8B 4D7GA 1CE5A 1HYLA 1CHGA 5FAHA 1EZQA 3K9XB 1BQYA 4D76A 4I31A 1D6RA 2JETB 3LT3A 1O2IA 3KQBA 3LGIA 1HAIH 2CMYA 1UVUH 1S84A 2Q6DA 2BMGB 1BBRH 5CMXH 4I8HA 2BD4A 3PB1E 2ESTE 5C2ZA 3LGUA 3P8OA 1IQJA 2BLVA 5FPSA 3VB7A 4B2CA 1ELGA 2XC0A 1NU7B 3LGTA 4H42U 1TA6A 2XXLA 1QJ1B 1CGIE 2A1DB 2SGQE 1FJSA 2V3HH 3W95A 3UB0A 2VWLA 3BTEE 1FONA 4F55A 3FKSD 1BBRE 3A7VA 1MTSA 4I8KA 1F5KU 1AE5A 1OYQA 2NU2E 4P00A 1DM4B 3KEEA 5A8XA 4CRGA 3UOUA 1EAUA 2DUCA 2FOEA 2C90B 4U30A 4TWYA 1C5UA 1BMFD 1UCYK 3SJ9A 2GMTB 3GY8A 4LK4A 2JIZD 5DP7A 1HCGA 4D9RA 2BDYA 3U98H 3N99A 4JZIA 1LO6A 4E06H 4UFFH 4M9FA 1BMMH 4NZQA 2ZCKP 1HAXB 2H5DA 2KZ4A 3MOCA 3L3TA 3GYMA 1NS3A 4KELA 5C5NA 1FI8A 1TNGA 1GI1A 4FVBA 1WUNH 2Q6GA 1IQLA 1KTSB 4D8NA 1NC6A 1HJAB 2CHAC 2Z7FE 3FVFB 3QZRA 3SUDA 1T4UH 2JH6D 3QN7A 1LVMA 3QGJA 4JYUH 4GAWA 1HNEE 3PTNA 1DOJA 3F9EA 4UEHH 1P57B 1SGQE 5FX6A 3M5LA 1GHVH 3TH2H 4Y8YA 1HUTH 1AB9B 3AASA 1DT2A 2VIQA 2TGAA 2ZZUH 3T62A 3F9FA 1Z8JB 3SU1A 4OS6A 1IQEA 2Z9IA 4J1YA 2OBOA 1QZ8A 1AIXH 1EJMA 2H9TH 1SGNE 3Q00A 2CGAA 2FX6A 1TWXB 2HLCA 2JH0D 2UUKB 1RXPA 2XC4A 4DY7B 5IDKA 3UR6A 4GPGA 1IQKA 2JDID 2AHME 4MLFB 1TX7A 3TNTA 1O5CB 4AFQA 3F9HA 1T8LA 3TGJE 4R8TB 2ZGXH 2A5KA 1XUHA 4O3TA 2AIPA 1YF4A 4JZ1A 3BEUA 4INLA 2VU8E 2XBVA 2AGEX 3RC4A 2IPHA 1TIOA 3SORA 4ZHMU 3URDA 1ESTA 1BTWA 1FNIA 3RMNH 5TJXA 3SU4A 1ELAA 2BD8A 1H8DH 4DVAU 2R2MB 4UFDH 3SQHE 1O3HA 1TGBA 2F9BH 2Y82A 4BTUB 1N8OC 1O3KA 4ABIA 4Q2KA 1UMAH 2EY4C 3SV6A 1F5LA 3HKIB 1UK4A 5HIYA 2VVCA 2G52A 1VITF 2C8XB 2W26A 3PM3A 1EZXC 2JKHA 3SI4H 4F49A 1PPFE 4B71A 1AQ7A 3E6PH 2Z9GA 3P8NA 1EX3A 5LH8A 1HAYB 1F0UA 1TFXA 3N7DA 3KIDU 2ZU2A 3PO1B 3ZYDA 2ZFSA 2PW8H 2VIDA 3MYWA 1LVYA 2A7JA 1CHOF 2FLBH 4SGBE 2GDDA 1A2CH 3BIVH 4TSFD 1BOQA 1JIRA 1DANH 3O8BA 2RA3A 1LDTT 2ZPRA 1UVPA 5DP6A 2ASUB 3LU9B 2OTVA 1O35A 4JMYA 3HK6B 3RXKA 2DE8A 2GCTC 2C8YB 1C5NH 2ZU3A 6GCHG 2I6QA 3SNDA 2WV9A 2A7HA 3MMGA 4Y79A 1J15A 2BDBA 3C1KA 1O3OA 2BOKA 4WWYA 4A5TS 3VXEH 4Q7XA 4WVPE 1OOKB 5C94A 2ZDNA 1IQGA 1Y5UT 4Y0ZE 3O8CA 1K28D 2FZZA 2B8OH 1O3EA 3K65B 1ANDA 5EPNA 1Y3UA 1VKYA 3BTDE 4Z1MD 3QWCH 1MH0A 3GOVB 4B74A 1K2I1 1GI7B 2AYWA 2BTCE 1GMCG 1VCQA 3D49H 3MNSA 1EAXA 4OGYA 1HPGA 2GT7A 3TK9A 1P03A 3L33A 5GXPA 2XBWA 1ANEA 1F0TA 1FAXA 1GBHA 3F9GA 1T8NA 4TT3D 3SU0A 1YBWA 1F7ZA 1TB6H 3KL6A 4XBBA 1Z8IB 5GDSH 3UNRA 1KLTA 1GHBF 4JZEH 3SJ8A 3VXFH 4AN7A 3ZZ4A 1C5QA 1EXFA 3DA9B 2J34A 4CR9A 2K8IA 2HVYB 1JBUH 4B1TA 3A8CA 1MCTA 1DWCH 2ZDLA 2XRCA 5DP4A 1O2SA 4WXIA 1TYNA 1O2LA 2C8ZB 1FY3A 4DIIH 1HBTH 3KN2A 3S69A 3T2NA 1S0RA 1IOEA 1T8MA 2EEKA 1LHDH 3KQEA 1B0FA 3BEIB 3Q76A 2RDLA 2G51A 3DSPA 4KKDA 2GDEH 1TRYA 2BDAA 1H8HD 2W3KA 1GCDA 1MTNB 1YPGH 3SU2A 2ULLA 1L1JA 2AGGX 4BAOB 2BM2A 2HALA 3STIA 2A4QA 5FX5A 1PQ5A 1C1MA 1YPKH 2QN5T 3BG4C 3SNEA 3H5CB 1SFQB 3ZV9A 3UUZA 2AEIH 5A2MH 1G9IE 2NU4E 1O36A 1SOTA 4OS2A 1E1RD 3IITA 3AW1A 3K2UA 4X0WU 1WCZA 1FY1A 1GBCA 5C0TA 3GY6A 1ETTH 1JMOH 1U6QA 3TJUA 2H1UA 1GPZA 1P04A 1DUAA 1HB0B 3A8AA 4E7NA 3TLOA 2NWNA 2F9OA 1E0FD 4AGJA 2SGFE 4CRBA 3UIRA 5HIZA 5SGAE 3ODFA 1MABB 3RC5A 1XUKA 3GY4A 3RU4E 2ZF0H 4ZMAH 1L2EA 1LQDB 2WPLS 3DD2H 1BUIA 3NKKA 1H9HE 2OK5A 4INHA 3BTFE 1RGQA 2Q1JA 3LJOA 1UTNA 1ABJH 1P2QA 1DWDH 1SGFG 2ZDMA 2QXGA 1OHHD 3T27A 3ATIA 1BRAA 4AFZA 1QIXB 1BTHH 1A4WH 1Z6EA 2BVXH 1MUEB 1OWDA 3LONA 2XBXA 4JK5A 2BY6X 1HV7A 1UJ1A 5EW2H 2ZDAH 1TMTH 2ZECA 1E36B 1UTOA 3QUMP 4Q4LA 1W0JD 3TH3H 2OINA 5FCKA 3QLPH 1QQUA 1WTGH 2BD9A 3SNAA 2EC9H 4IC5A 3ESTA 1BTYA 1HXEH 4KTCA 3DCLA 3WWBA 1O39A 1QFKH 1ZOMA 2CV3A 3SHCH 2JJ2D 4AGKA 1LVBA 1F0SA 3ATLA 5F8ZA 1OKXA 4ZKNU 2CN0H 1ELCA 1Y3YA 2J4IA 1PPCE 3DUXH 3VB6A 2NU3E 3N7EA 2YMSD 1PYTD 2W6JD 1DDJA 2G5NA 1C5PA 2FWWA 1CSOE 1UVSH 2VB0A 1YKTA 3KYGA 2F83A 3PYHA 1VZQH 1Z1JA 2R0KA 2Y6TA 4RT1A 1N1LA 2QCYA 3U8TH 4AYVB 1MBQA 1SLWB 3ZVEA 4AYYB 2FESH 1S81A 3F0OA 1MD7A 1V2UT 1ZR0A 3MU8A 1AVGH 3GS9A 5E0JA 4YOJA 2GVFA 1V6DA 4YO9A 3VGCB 4X1QU 1G2LA 2ZFFH 4GHTA 4A1XA 3KGPA 1MTWA 2QF3A 5T6FA 1BITA 2HNTE 2O8TA 3EA8A 3PLBA 1GJ9B 2PTCE 2ZKSA 2YNBA 1IQFA 3VG8A 4XD7D 4I8GA 1QB6A 3PRDA 3KHVA 3P70B 3TK6A 1A5GH 1O37A 1EZUC 2HNTC 1HDTH 2BZAA 3RXQA 3A7XA 3A7YA 1LKAA 1GI5A 1S6FA 1J14A 3LKWA 3FOAA 1O2RA 2PKSC 2XWBI 3P95A 1LHGH 4JK6A 1NY22 1C2KA 2A4GA 1Z8GA 2KM0A 1AGJA 1C5TA 4FU7A 2F3CE 2FEQH 4NWLA 1ZTKA 3MH7A 2SGPE 2QGRA 4NIYA 1YY3A 4LZ4B 1QA7A 3K6ZA 1QL7A 1VITG 3LC5A 2O8WA 3ZZ3A 1FIWA 1N6YA 3PV2A 1W0KD 3DSGA 4ABJA 3RXVA 2HPPH 4WY3A 1N8OB 2OQUA 3UREA 1IQMA 4O3UA 1H4WA 1GJDB 4IN1A 4I8LA 1NO9H 3BSQA 2A45B 1C2IA 4X6MA 3HATH 1CHOG 2C93B 2D2DA 4NIXA 1UVTH 3BTGE 3LIWA 3RDZA 1RIWC 1ACBE 1OSSA 4WMFA 4YTAA 5CE1A 5CHAC 4AG2A 2G4UA 2J94A 3N7OA 4X8UH 1EJAA 1H1BA 3KQDA 1A3BH 2W6ID 5DP3A 2SGAA 4TPYA 2D26C 1C1UH 5IK2D 1DWEH 1BTZA 4DIHH 3QZQA 3A87A 1J17T 1MAXA 4OS1A 1QNJA 2FI5E 3RMLH 3SHAH 2JJ1D 1KLJH 1J8AA 1GMDF 1GMHG 4ZH8A 2ZFRH 4ABEA 1QR3E 2GCTB 1GJ7B 1SGPE 2SNWA 2ZFQH 1KXBA 4OS5A 4YXWD 1S5SA 1PPEE 3E8LA 4Y7AA 4HZHA 1OYTH 2C4FH 3RXPA 3SUGA 3SZEA 3RXEA 2H6MA 4FUEA 1VITH 5HMAA 5EU8A 5DO4H 2O8MA 3GCNA 4BNRA 1J16A 4MPXA 3SV8A 1NFYA 4WMDA 1S83A 2GV6A 1YLNA 1LVOA 1W7GH 1ZRKA 5JBBS 4B73A 2BD3A 3A7TA 3V12A 1O2UA 2VIVA 5CDFE 1MKWH 2ZG0H 1NFXA 8LPRA 5GCHF 1GHBG 2R9PA 4UFGH 1XUFA 1ZLRA 3ZZBA 4XBCA 1GBIA 3ZZAA 3F68H 5DJ7A 5A09A 1D4PB 1WQVH 1E79D 2ZHFH 1K1LA 3E0NB 2FYQA 1ZJDA 1TRMA 1OWEA 3SBKA
chains in the Genus database with same CATH topology
5L6NH 1THSH 5JBCS 1N6XA 1FN6A 3PROA 4CREA 1IQIA 1BMLA 3CP7A 1DY8A 1KXDA 2FI3E 4MG3A 3A8DA 1HIAA 1MAYA 4CR5A 4AG1A 4A92A 3GY5A 3MI4A 2FYRA 3AVZA 5F6MA 1O5BB 2FMJA 1GBJA 1AZ8A 4OGXA 4ABAA 3OY6U 3FP6E 1OWKA 1QTFA 2ZTYA 1P2JA 1V2NT 3LPRA 1O3GA 4X8VH 1CQQA 2A7CA 1D9IA 4TY7A 3RXDA 2GD4B 1YYY1 2FX4A 1TX6A 1GHZA 1EASA 1TNHA 2ZGBH 1FQ3A 1OWJA 1GCTC 2OBQA 1IHSH 2Z94A 3BG4B 2AMDA 1IAUA 4Y11E 1C1VH 3RXMA 3MWIU 3O8RA 1O3NA 1TOMH 1O2QA 1OXGA 1XUIA 2TPIZ 1P9UA 3EYDA 3SU6A 2R2WU 2P3FH 4JZDH 3SOSA 1O2JA 3DFJA 1YGCH 2BXUH 3B9FH 2ANWA 4ISIH 1HXFH 1HAVA 1CT2E 1UTMA 1V2TT 4BXSA 5HYOA 2FPZA 3SJIA 4K69A 3S0NA 1XXDA 1GI9B 1K1MA 3M3VA 4I7YH 3C27B 1P8VC 1GHWH 1O2VA 1XKAC 2R3UA 3P8FA 1A0JA 3RXCA 1RRKA 2GGVB 1KLIH 2QXHA 1OPHB 1W7XH 1BT7A 2D8WA 8ESTE 1TOCB 2W7SA 4K1EA 1O5DH 4FVDA 1YCPK 1QB9A 3B23B 2CJIA 2VGCC 1YPHE 5EXMA 2WUCA 2BY7X 3BIUH 1MD8A 1GBTA 1DICA 3M7QA 1C5WB 2PFEA 3QDZB 4IBLH 1CU1A 1NM6A 1L0ZA 2AS9A 3BTME 4ZKRU 4CRAA 1BTPA 4ASHA 4Q7ZA 1K1NA 2FOFA 1RS0A 3A80A 1C2LA 4E7RG 5F8TA 6ESTA 3EE0B 1ZJKA 2ZQ2A 1O3CA 3MO9A 3E3TA 4IW4E 4J2YB 1GVZA 1B0EA 1C2GA 1O2KA 1UVOA 1HFDA 1HIAB 3LJJA 1UCYH 3SW2B 3UFAA 5A8ZA 1E34B 1HJ9A 3RXOA 1GHXH 3NZIA 3QTOH 1MBMA 1G30B 1ZPZA 2V35A 2HOBA 3TK5A 4X2VA 1QHRB 4K1SA 1V2LT 1SL3A 3CS7A 1O2NA 1YCPH 4MNYA 1UCYE 3SNBA 5DP5A 2WV5A 1V2PT 3F6UH 5A0AE 1O2TA 3QX5H 1SLVB 2BQ6B 5HM2A 4YLQH 1KDQB 2V3OH 2J9NA 4X1PU 2TIOA 4MNWA 2WPJS 3ATMA 1SGDE 3UNSA 1RFNA 4A6LA 4IN2A 2EI8A 4TYDA 4DG4A 3AAVA 5H4IB 5A8YA 1AUTC 4YM9A 4ABBA 3S9BA 1O3JA 1HAVB 2ILNA 2BY9X 2ZI2H 3HK3B 3QTVH 3LH3A 1BRCE 2PKSB 4MPUA 3PMAB 1P9SA 1V2OT 4VGCC 2BDGA 2YNAA 4MTBA 1PQ8A 3V0XA 5LPRA 1AN1E 1TONA 3BN9A 5DK1A 2CF9H 3I29A 1GJ6A 4U2WA 1XM1A 1ORFA 2XC5A 2BQ7B 1W10U 5EPYA 3P8GA 4XBDA 1DLEA 4UFEH 1CA8B 2ZHEH 1DFPA 1KY9A 3P6ZB 3ZVDA 2TGTA 1K1JA 1JOUB 1O2PA 1PYTC 1QY6A 4AOQA 1AFQC 1EP5A 5DPAA 3MTYA 1RIWB 1GMDG 1Z6JH 5CHAB 1GMHF 1K21H 3SV2H 1GVKB 2ZHQH 3ATWA 4NG9H 1WV7H 1ZPBA 2G4TA 3OU0A 3PLKA 2PWXA 1OS8A 1EB1H 1QJ7B 1O3IA 2BYAX 1GI4A 3R3GB 3T28A 5FBEA 2QV1A 3T26A 1DLKB 1ZMLA 3V3MA 2QC2A 5ESTE 1THPB 1Z71A 1NTPA 1TBRH 4A1VA 3A85A 5L30H 3ZZ5A 2FS9A 2C8WB 3PWBA 3SUFA 2UWPA 4UE7H 1AD8H 1LCYA 3ZZ8A 1W0ZU 1O32A 4FUCA 2AH4X 5GCHG 5EQQA 4FU9A 1HAPH 1P05A 3E0PB 3BG8A 3RXUA 1PJPA 1ESBA 1TAWA 1XKBC 1YLDA 1TMUH 1ZPCA 1LMWB 1NT1A 4ISOA 4YT6H 3A81A 1C2DA 4CH8B 2P94A 2UUFB 1GHAF 2VINA 1GI0A 5AFZH 1BJVA 3ZZ9A 1SQOA 1Z8RA 2FOAA 1ARCA 1C5RA 2ZU5A 3TITA 1Y3WA 2HWLB 4B76A 3SZNA 3UTUH 2BLWA 1LHFH 1GBEA 2WUBA 4Y0YE 3HKJB 1BTUA 1MKXK 4JYTA 1NFUA 3A7ZA 3SGAE 4DGJA 1YPLH 1ZRBA 4GUXA 4ESTE 2Q6FA 1O30A 4X1RU 2OLGA 4NIWA 4NZLA 1ZSKA 2ZHDA 2FOCA 1W12U 1QJ6B 2ZNKH 4ABHA 3ZZ7A 1WSSH 3SU3A 4Y10E 4DOQA 1P06A 2ZGJA 4YT7H 2BZ6H 1IQHA 1AKSA 1GL0E 5I25A 2PHBA 1GJCB 1Q31A 3BEFB 1LPGB 5E2PA 1C5MD 2A5AA 1GCTB 2ZCHP 3V13A 2BX4A 4K8YA 4ZXYH 1P11E 5LPEA 1P2NA 1B7XB 2KAIB 5GWZA 8GCHF 2GT8A 1SLUB 2BY8X 4X6OA 5EOKA 5AHGH 3S9CA 1A61H 3RMOH 5JYIA 4IC6A 3EAJA 1PPGE 3EGKH 3BTTE 5FBIA 4H4FA 1P12E 1GJ8B 4XE4A 3SGBE 1SR5C 1HAGE 5ESBA 1MKXH 3E16B 2BY5X 3UR9A 4CBOA 5DP8A 1P2MA 1T8OA 1ZTLA 4B2AA 4TPIZ 3LGYA 2V0BA 2QYIA 2G5VA 3KF2A 4B2BA 1C1OA 5EXNA 1OWIA 5GPIB 4DJZB 1MQ5A 2BDHA 1EATA 1P01A 1C1TA 1LPKB 2CHAB 4GCHF 1ZSJA 4ZKSU 1B5GH 3LOXA 4ABDA 1MZAA 4CRDA 1GJAB 1SLXB 1O2XA 1SHYA 2Z3EA 2Z3DA 5J4SA 2ZHWH 2FI4E 1ZHRA 2OQ5A 3GDUA 3ODDA 4ZHAA 7GCHG 1ELTA 3GCOA 3KQCA 4IS5A 3OX7U 1QQ4A 1ETSH 4FUFA 2LPRA 2F9VA 4O9VA 3M36A 3RLWH 3UY9A 3TJNA 1YP9A 1O5FH 1FIZA 4NFEA 4Q80A 3U69H 1SC8U 1O0DH 3GY3A 2ZU4A 1TGTA 3M5NA 1ZHPA 1O34A 4NGAH 2B5TB 3NXPA 3M7TA 1YM0A 2ZDVH 3JZ1B 1G32B 3MNBA 2YOLA 1MTUA 1ZGVA 5E0GA 4HFPB 1TGSZ 4FUGA 1K1PA 1UTQA 1BTXA 2GTBA 3NCLA 1SPJA 1AKSB 3RLYH 4K8BA 4KTUA 1GI3A 1W13U 3I78A 3ZZDA 2VJ1A 5BPEA 2M5TA 3A8BA 2ANMH 2QXJA 4MNVA 3A88A 5HXFA 2A5IA 1GJBB 3M7UA 4K3JA 5FPTA 1O2HA 2PSYA 4ABFA 2J38A 3WY8A 1GJ4H 1KXAA 2EI6A 1H9IE 2A2QH 1YPEH 5L2ZH 2P93A 2FTMA 3BTHE 1FPHH 1T4VH 2Z9LA 1O2YA 1SFIA 2ZU1A 1MCVA 2BD7A 4CBNA 1KIGH 1A0LA 2HGTH 4CRFA 4CRCA 1CA0C 2BXTH 1BA8B 4X1NU 1PPHE 2ZIQH 3VB3A 5K7RA 2P59A 1SQAA 2PUQH 1DPOA 5C20A 1GBDA 3UNQA 1JXPA 1O2WA 1JIMA 2ZEBA 4VGCB 2VWOA 4UD9H 1BJUA 4F4OC 3GCHC 1UTPA 4HI3A 3RXLA 4A7IB 3FP7E 3DFLA 2VIWA 1QL8A 2AGIX 2STBE 3PV4A 3ZVCA 3M5OA 1GI2A 3GDSA 3H7TA 1NPMA 1GL1A 5C5OA 3DHKH 3TH4H 3PMHB 4Y8ZA 1O3PB 2BHGA 2UUJB 3PTBA 4KP0A 3UQOA 2VIPA 3IWMA 4RKOB 3ZZCA 4I33A 5JB9S 1ZGIA 2VVUA 1AFQB 3GYLB 1ZTJA 1SGCA 3M35A 1W3CA 1BHXB 3FAOA 1OP0A 1EOJA 1FV9A 1G37A 1GDUA 1VGCC 2J95A 3RM0H 1C5SA 5E2OA 2Z9KA 1TNKA 4FUBA 3SI3H 2GP9B 3E90B 2IN2A 1NRNH 2ZDKA 5T6GA 3SO3A 2BX3A 2QY0B 1CT0E 2VIOA 3QGNB 2PLXA 3K6YA 1Y3XA 5IYTA 1C1WH 2FLRH 4BAMB 3PWCA 1PPBH 1W14U 5DG6A 2BLQA 3DT0H 4K5ZA 1C1RA 1ZYOA 1C4V2 2A4RA 1RD3B 2XCFA 4THNH 2ZTXA 2FOBA 1AU8A 3SV9A 3L6PA 1O2ZA 1EPTC 3MO6A 4MNXA 1NRQH 3ENSB 2WYJA 4Z6AH 1XMNB 1THRH 1WBGB 1EZSC 3RXTA 2Y7XA 1PFXC 5AVDA 2TRMA 4UDWH 2GX4A 2Y7ZA 1AHTH 1NFWA 2OD3B 1O3FA 4IMZA 1OP8A 2A31A 2QA9E 1NN6A 3UPEA 1S85A 5PTPA 2VVVA 1GHAG 1E38B 3U1IB 2TGPZ 3QK1A 4ZHLU 2W5EA 5C1UA 3FZDA 4RSPA 2XBYA 2ZP0H 1FUJA 2F91A 3TPIZ 2QXIA 1DSUA 3MU1A 3LDXH 3MH5A 2ZCLP 4KTSA 2A0QB 3ITIA 3VFEA 1GDNA 5EW1H 2ZPQA 2FXRA 3ATKA 2ZA5A 1SVPA 1O3BA 1V2MT 1KXCA 2PTNA 5T3HA 1P2IA 4K1TA 5C67A 1DXWA 1K1IA 2QAAA 3Q3YA 4ISHH 3RXAA 1C4Y2 1SOZA 2QIQA 2Z3CA 1C1NA 3RC6A 2FOGA 1HLTH 1KDQA 4WJG2 4PROA 6LPRA 2SFAA 3GCTF 3HGPA 3EA9A 2ZGHA 3A86A 4X8SH 3GICB 1GVLA 1S82A 1A1RA 2ZGCA 1ELBA 2B7DH 3P92A 4Y71A 3U9AH 2NU1E 3SQEE 4X2WA 4BTIB 3M3TA 1TRNA 4NA7A 1G3EA 3URCA 1GBFA 3MFJA 1AI8H 2Y81A 4Y8XA 5L2YH 2P8OC 3LC3A 4NFFA 8GCHG 1AVXA 1PPZA 1FLEE 2ZPSA 2PGQB 3SJKA 2I6SA 1DS2E 2B9LA 1FMGA 1SGFA 1O2GH 1TLDA 3BTQE 3PMJA 3S9AA 1KTTB 2BD5A 3AAUA 5ETXA 3SNCA 1XX9A 1ELVA 1EP6A 1UTJA 1W11U 4AZ2B 2HNTF 5E8EH 2FOMB 2Y80A 3QO6A 1S0QA 1WAYB 2FTLE 1ANBA 1C4U2 3O8DA 1UHBA 3EDXB 1SGEE 1L1NA 1QRXA 1Y8TA 2PR3A 1QURH 1MZDA 4YLUA 3ZVAA 1W2KH 1OWHA 3M5MA 2FOHA 3OTJE 1VCWA 4I8JA 1Q3XA 3E1XB 3RMMH 4D7FA 3VB5A 1Y5AT 1YPHC 4FU8A 1UTKA 2ALPA 1OP2A 4GCHG 3KCGH 1TQ7B 1NRSH 3RXRA 3GISB 2LNCA 2PV9B 3B8JA 4QT8C 4YOIA 1P3CA 1O3DA 2CXVA 1O5GH 1AY6H 1O5EH 3JZ2B 1D3DB 4MQAA 1LKBA 1TBZH 3ELAH 1QA0A 4MVNA 3MNXA 4NSVA 1TA2A 2R0LA 2FS8A 4BXWA 1C2JA 3ZYEA 3A89A 2XW9A 5HM9A 3U1JB 7GCHF 3VB4A 5FCRA 3D62A 4X8TH 3MH4A 3ZVGA 2ANKH 1YLCA 2G81E 1V2VT 4RN6A 2BD2A 1P09A 1C5VA 3VGCC 3Q77A 1DVAH 2AFQB 1C5ZB 2Y5HA 2ZWLH 2RA0A 1P0SH 3VEQB 1S6HA 2OCVB 1F2SE 1G3BA 5I46H 3FP8E 1A46H 2CF8H 1L4DA 1AUJA 1V2KT 2OUAA 3TIUA 1UK2A 4WF8A 4X6NA 1NROH 1BMNH 2P3UB 3RXHA 3EA7A 1AZZA 4BAQB 7ESTE 1GI8B 1HRTH 3BTKE 3TJVA 5C1YA 1RTFB 1X7AC 1V2ST 2O8LA 4JZFH 3TNSA 2WPKS 3I77A 1VCPA 1Z7KA 1D6WA 4IMQA 2H2ZA 1UO6A 2QF0A 1E35B 1ARBA 1GHYH 3LGWA 2A2XH 2UWOA 5FXLA 1CBWC 6CHAC 1EPTA 2ALVA 2GZ8A 4FUDA 3TJOA 1SI5H 3RUOA 1CT4E 1LHEH 1AMHA 4GLYA 4D9QA 4Y76A 4AORA 1BB0B 1BDAA 5EXLA 4YZUA 2Y5GA 4NIVA 1DXPA 2WPIS 1EKBB 1F92A 2D1JA 1K22H 1WQSA 2TGDA 2BLOA 4XOJA 1UHBB 4YOGA 4CHAC 2SNVA 2GCHF 1DUEA 1TNIA 1PQ7A 1Z1IA 3SUEA 5AFYH 3Q3XA 1CA0B 3U8RH 3CS0A 7KMEH 3MNCA 2WPMS 1WU1A 1MTVA 2AMQA 3GDVA 2IOTA 4MPWA 2ZFPH 1MQ6A 3NPSA 3GCHB 4U32A 1PQAA 1P3EA 3T5FH 1L1GA 1O2MA 2PSXA 1SGYE 2P95A 3ZV8A 2G55A 1LTOA 3M37A 5J4QA 3UWIA 1EOLA 2KAIA 2WYGA 1AVWA 1C5OH 4X2XA 2BB4A 1DSTA 1DITH 1H8IH 5GIBA 2F9UA 4B75A 4DURA 1BIOA 1RTLA 3MHWU 3M3SA 5JBAS 1W8BH 4OS7A 2R3YA 1T7CA 1GG6C 3AW0A 2C3SA 5T6DA 5ABWA 1Q2WA 1TMBH 2GZ7A 4CH2B 1VR1H 1HAZB 3BF6H 1BRBE 1QBOA 1VGCB 2OC8A 5F8XA 1MMJN 1AWFH 1AE8H 1TGNA 3BTWE 1TPOA 5C3NA 2FIRH 5G4BA 1O3AA 1QCPA 1BMAA 1NRPH 1ZMJA 2ZFTA 1WOFA 1GGDC 1C5LH 1MU8B 2BOHB 2OC0A 3MH6A 2ZTZA 1TPPA 4AB8A 1EAWA 1O3LA 3FZZA 4XSKU 1OX1A 1BRUP 1EPTB 1Y59T 2FDAA 1AWHB 1A0HB 4UONA 1NESE 1GBAA 1ELDE 5DGJA 2UUYA 1KXEA 5TCAA 3NUMA 1SSXA 2A32A 1G36A 2G8TA 5DP9A 1KYNA 4MPVA 1T31A 2BDIA 4AFSA 1F0RA 4DCDA 3S7HB 4WH8A 1C1PA 4I32A 4ISNA 4WXVA 5FPYA 4U01A 1VJAU 3D23A