5C67A

Human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-3
publication title Combinatorial protein engineering of proteolytically resistant mesotrypsin inhibitors as candidates for cancer therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hyrdolase/hydrolase inhibitor
total genus 57
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A02
3AAVA 1RD3B 2SGPE 2BLVA 3EA9A 1LKAA 1C9TA 1C1RA 2GZ9A 1AKSA 1GVKB 1QL9A 3AAUA 4YESB 5FXLA 1QBVH 1T31A 3SO3A 3M3VA 1TQ0B 2ZHQH 4ZXYH 1ELCA 1NRPH 1TRNA 1YPEH 4FU7A 4A92A 2WUBA 1DX5M 4FUFA 1S83A 5IYTA 2Z6BD 4GSOA 5DP7A 2VIVA 4NGAH 1EAIA 3SJ8A 3W94A 2RDLA 4DVAU 4UFFH 8LPRA 2QCYA 2XBVA 2P3TB 1F0TA 1MKWK 4E06H 1QY6A 1SHYA 2BX4A 1K21H 3GYMA 5AF9H 5DO4H 1P02A 1MBQA 2PKAA 1CVWH 1FY1A 3M36A 3UNRA 1C5LH 3KL6A 1V2TT 2ZFRH 2ZIQH 1S6HA 2VGCC 3QO6A 1GI0A 2KAIA 1O2UA 1LPKB 2GGVB 2P94A 8GCHF 1MTVA 2ZQ2A 2R0LA 4NIXA 2FOCA 2Q1JA 4BXSA 1DSTA 1SGPE 1OWJA 1V2OT 1O3PB 1W14U 2XWBI 1ZPCA 3EAJA 2BVSH 1G3EA 3A86A 3UIRA 1LTOA 3H7OA 3RXUA 3PROA 4H4FA 2O8LA 3RLYH 3SW2B 1BJVA 2CF9H 1A5HA 2AGIX 1VZQH 2ZEBA 2VIPA 3SV8A 5DGJA 2C8ZB 4KTSA 1V2JT 2GKVE 1MBMA 2F91A 3JZ1B 1OWHA 4MTBA 1S0QA 1WSSH 2SFAA 1PPEE 2IN2A 2R2WU 2Z9KA 4Y8XA 1Y59T 1BMLA 1YPMH 3NK8A 3RM2H 2VH0A 2BXTH 5C1XA 1ACBE 2ZP0H 4YOIA 1P2IA 2NU4E 4KTUA 2C8XB 2F9VA 3RXTA 3ZZBA 6GCHG 3SV2H 2LPRA 4WXVA 1B7XB 3SOSA 4D9QA 2BD4A 1EX3A 1WU1A 4I33A 4Y0YE 1FY4A 1CO7E 4Y0ZE 3SJ9A 5EPYA 3MNXA 4J2YB 1TGNA 2EI8A 2BDCA 3PMAB 3NKKA 3I77A 4NSYA 3EYDA 2H6MA 1NT1A 1EZSC 1Y5AT 1HIAA 2DE8A 4A1VA 1EAUA 3MI4A 1TPPA 4CRFA 3ZZ4A 1AU8A 1BTPA 1UVPA 4D7GA 3SV9A 1BTYA 1ELTA 3SNDA 1XUGA 1F5LA 2ZO3H 1ZTLA 2ALPA 4UE7H 1EAXA 2SGQE 4WVPE 1NC6A 4YTAA 1E38B 3ZZ9A 2Y5GA 3T2NA 1A46H 1D4PB 1GGDC 3M7TA 1AIXH 1W8BH 1K1NA 2FLRH 1HAXB 4X6NA 4NZQA 5H4IB 2FPZA 1DFPA 3A80A 1L2EA 1S0RA 5HYOA 1L4DA 2BTCE 2Y81A 4X8UH 4H6TA 1PPZA 2FXRA 3URCA 2XCNA 1NTPA 3M37A 3MH7A 1CE5A 1PYTD 1P57B 3TK6A 4ZHMU 1HAVB 4ISLA 1SGFA 3TK5A 1DVAH 2UUFB 7GCHG 1QQ4A 1GMCF 4K1EA 1A5IA 1DOJA 1ZMNA 1NU9A 3PTNA 4X6MA 1C5ZB 3HKJB 3RXQA 2BD8A 4PROA 2GZ7A 3RMLH 4CH8B 4DJZB 3AVZA 4MNYA 3P8GA 3TGJE 2VWNA 1C2EA 3M61U 3ODFA 2ZPRA 1LPZB 1RJXB 2QF0A 1HRTH 3O8DA 1QA0A 3QGNB 4BANB 3PO1B 1GHAF 4TPIZ 3OU0A 3FP8E 1P10A 3S9CA 1IQFA 1FJSA 2XBWA 3S7KB 2C90B 5E2OA 3A8DA 1D3PB 1FAKH 1GBTA 4KP0A 3SORA 1HB0B 1ZGVA 3BIUH 2AIQA 2F9BH 3BF6H 5GWZA 1FNIA 2B9LA 2ZDNA 2ZPQA 1ORFA 4ZUHA 4K8YA 4YOJA 1VR1H 1G3BA 2BD7A 1O2TA 3VB3A 1DY9A 2BY8X 4Y11E 2VIDA 1GHWH 1O2ZA 1O39A 2Y5FA 4AB9A 2A2QH 1UJ1A 2WUCA 5T6DA 1NROH 2PFEA 1E36B 1TYNA 2FOMB 3D62A 4K1SA 2AIPA 3Q00A 3F6UH 4FVBA 4TY6A 1S85A 3ZZDA 2HGTH 1G30B 2ZCKP 2VNTA 2CV3A 3M3TA 3R0FA 4Y7BA 2ZU3A 1E34B 2FIRH 1T8OA 5F6MA 3L33A 3P8OA 1EAWA 3PTBA 3QZQA 1TLDA 4INKA 1ZJKA 1RTFB 5EODA 1J8AA 2ZFSA 1GGDB 4NIYA 1PPHE 1C4U2 4X2VA 4YLUA 3FAOA 3BEUA 2G5VA 1A7SA 1OP8A 1C2JA 1O5CB 1GHBF 3ATLA 1D6WA 1HAVA 1HJAB 4AFZA 1JWTA 1Z1IA 1IAUA 2NU2E 2HOBA 1FIZA 1HXEH 1V3XA 3A7XA 1ARCA 3HK3B 3RXEA 5A2MH 4R0IA 1GHZA 2ALVA 2Z9JA 3S9AA 2PTCE 5K0HA 1W7XH 2OINA 1FN8A 2HNTF 1TMUH 1EZUC 1F92A 1C5UA 1MTWA 1SVPA 2BOKA 1A3EH 1TWXB 1GG6C 3DUXH 1YLCA 1NESE 4BAMB 4ASHA 5B6OA 1MCTA 2ZGHA 3ESTA 5GCHF 1GI5A 2PSYA 2ZGBH 3NCLA 1AVXA 2BY5X 3RXAA 3QWCH 1BQYA 4WH8A 3BG4C 1BHXF 3ITIA 4NWKA 4MG3A 1SLWB 4GVUA 1ZOMA 4WXIA 3A83A 1IQKA 3G01A 3V3MA 1GI9B 1GMHG 1PQAA 1TOMH 4UEHH 3VXEH 1MD8A 2ZNKH 3A7YA 1V2KT 3QUMP 1N8OC 4E7NA 3A8CA 1UVUH 1YPKH 1GBEA 5GJ4B 5FAHA 1O2VA 3RXBA 2WV5A 1NM6A 4CRDA 3A8AA 1C5WB 2G52A 2R3YA 2CXVA 1DWCH 3PB1E 1O5AB 2PUXB 3PM3A 2O8TA 1UTMA 3UTUH 1MAXA 4RN6A 5EOKA 4AG1A 1MAYA 1MTUA 4ZKOU 1QCPA 5L2ZH 1KLTA 1O2IA 1ID5H 1THRH 3FFGA 6CHAC 4UDWH 1O3NA 2G4TA 1C4V2 1HFDA 3VEQB 1O2PA 1EOJA 3LGWA 3KQBA 5FX5A 1A5GH 3VB7A 4AGKA 1EASA 3L3TA 4ABHA 4ZHLU 4DY7B 1SB1H 2OP9A 4X6OA 2XCFA 3S9BA 1P2JA 1TPAE 2ZFTA 5FBEA 1HPGA 1RGQA 1S81A 4JYTA 2BQ7B 3NPSA 2PKSB 5BRRE 5GDSH 2PHBA 4NFFA 4GCHF 3Q3KA 3E8LA 1THSH 1BRCE 2HPPH 1ZTKA 1GMDG 5JPMH 1AWHB 3O8BA 3UOPA 2QGRA 3RC6A 4SGBE 4Y79A 1UTJA 1GG6B 2ESTE 1UCYH 1VITG 1MTSA 1EOLA 1ANEA 2Y6TA 4WMFA 1IHTH 1FY8E 1Z8JB 3LDXH 4D9RA 1GJ7B 4B73A 2ZTYA 5T6FA 2VVVA 2FTMA 1O3CA 1SGIB 1XUFA 2QA9E 3BG4B 2A5IA 1FV9A 2HVXA 4MNWA 2NWNA 2WPLS 5JBBS 2AGGX 3GY4A 2XYAA 1BTUA 2ZFQH 1C5QA 5DP6A 3QLPH 5GXPA 1GBLA 1LQDB 4LK4A 3RXDA 1DWBH 2ZHFH 3SJOA 3H5CB 5I46H 1QTFA 2ZQ1A 3P70B 5ABWA 1ZRBA 3I29A 1ABJH 2FZZA 4CRGA 1TRMA 3BTQE 1C1MA 2FOFA 3S7HB 1FAXA 1BHXB 4FVDA 1TGTA 2FYQA 2XBXA 1X7AC 3RMOH 3ZVBA 1JXPA 1RXPA 1T8LA 3PLPA 4IMZA 3RXJA 1ZGIA 2GCHG 3BEIB 3AW0A 3TJNA 5F03A 4Q80A 3H7TA 3E91A 3RXMA 1ZPZA 4WWYA 2FOGA 2OUAA 3LJJA 4OS7A 1UTKA 2QN5T 3LC3A 1RS0A 2BX3A 1EPTA 1TNLA 1DXWA 6CHAB 4GPGA 3TITA 1DT2A 1WOFA 3BTDE 1AGJA 2BMGB 3ATMA 2EI6A 3E0PB 4X8SH 3RP2A 1L1NA 1WAYB 1H9HE 2ZDLA 4INHA 1OS8A 4MPUA 4A7IB 1AB9C 3LONA 5F8TA 3KNXA 1MQ6A 1AY6H 1TGCA 1QL7A 3ELAH 2R2MB 4Y7AA 4YT7H 5ESTE 1ZTJA 1O34A 1Y3YA 1MUEB 4OGXA 1AFQC 1K1LA 3RU4T 1FI8A 3UPEA 2HALA 5DP8A 1YKTA 2PLXA 2XBYA 4DW2U 4MVNA 4DURA 1F2SE 3T62A 2ZTXA 4MNXA 1OSSA 5DP4A 3ZVCA 1C5MD 4U30A 4LOYH 1CBWC 1K9OE 3URDA 1PYTC 4FUEA 2EI7A 4CBNA 2GCTC 1GBJA 1ZSKA 4AYYB 1GJ5H 3M3SA 1EATA 1XX9A 3M5MA 3A7TA 4DIIH 5DP5A 1DPOA 4BAQB 3SV6A 5JBCS 2ASUB 3LH1A 1CGHA 5AHGH 3TIUA 4U01A 3MU4A 1O2QA 3PV4A 3UY9A 1PPBH 1QBNA 1GJAB 2V35A 3LIWA 1D6RA 3HATH 2NU3E 3MNCA 1KXDA 1TNJA 1B0EA 4YT6H 2H9EH 5FHTA 2ZG0H 3KQDA 1FONA 6GCHF 1GBHA 1O5DH 4X0WU 1O3HA 3RXOA 3GCNA 5JBAS 3JZ2B 1GJ8B 1QA7A 1B0FA 1M9UA 5GPIB 2W3IA 1WTHD 2FI4E 2OBQA 2Y80A 1TRYA 1ETRH 2J95A 3BTEE 1HXFH 7KMEH 2P3FH 4Q2KA 4ABFA 2Y82A 1K2I1 4INLA 1FN6A 3KF2A 5EXNA 2TGPZ 3SUFA 2BY6X 4KGAA 1GBMA 1QURH 2OQUA 5HXFA 5A0AE 4ABDA 1O2RA 4IN1A 3T27A 3ODDA 1C5VA 1C9PA 5EQSA 3MU8A 2BLQA 2ZC9H 1HLTH 1O3MA 4I8KA 2QXIA 4TWYA 3ZV8A 3M5OA 2M5TA 1HJ9A 2O8UA 1QJ7B 5L6NH 1OWDA 4XDEA 1LVYA 1AFQB 1RFNA 1G2LA 1TNKA 3K65B 4MPWA 1W10U 1WYKA 2ZHEH 1Q3XA 2ZHDA 3RXVA 3ZZ6A 4NSVA 1TBZH 2A7JA 2FX6A 1GJDB 1EUFA 2VVUA 7GCHF 1PQ7A 1LVMA 1BA8B 2SNVA 1PJPA 1O3GA 1IQLA 1GI1A 3D49H 4ZH8A 2BB4A 2ZZUH 1EP6A 2FLBH 2ANKH 2BD3A 2ZCLP 4ABGA 4MDSA 4X2XA 2A7CA 5FCKA 4HZHA 3CS0A 4ZKRU 2Z3EA 3E0NB 1P12E 1F7ZA 1F0UA 4DCDA 1V2PT 1KXCA 4X6PA 1MQ5A 1JBUH 2ILNA 3SZNA 4TYDA 3ZVAA 2GDEH 4FUCA 2ZFPH 2XC0A 1AWFH 1LMWB 2P59A 2NU0E 1QRWA 1LHEH 2QF3A 1DITH 1O3BA 2VB0A 1K28D 1TB6H 3GY6A 3ZV9A 1AZZA 1YPGH 3SI3H 3OY6U 5EQRA 4XBCA 1QRZA 1W12U 1D3DB 3RXCA 2JH5D 4KELA 1ESAA 1P05A 1P8VC 4IN2A 3UNQA 1CHOG 3SHCH 1C1NA 1O3EA 4X1SU 4K1TA 3BIVH 5C20A 1WUNH 4JMYA 4ABEA 3KIDU 5SGAE 3LGYA 3RC4A 1BTXA 2Q6GA 1KIGH 1C2IA 2A4RA 3HKIB 2P93A 1SR5C 1DWDH 1O3IA 3M35A 1ZJDA 2OBOA 4FUBA 1FPHH 1B5GH 1BRAA 3U1IB 2UUYA 2H5CA 3F9FA 4UD9H 3QZRA 1GBCA 1O2SA 1W11U 1H9IE 5C1UA 5LPEA 3P6ZB 1V2UT 3QGJA 2I6QA 2Z9GA 5A8YA 1EB2A 1SG8B 4AFQA 4O03A 4MQAA 2WINI 2G81E 3BN9A 3QX5H 1MZDA 3F9GA 1C1TA 1NO9H 1C1OA 4O3UA 2RA3A 3MHWU 5CE1A 3IG6B 1ZHMA 2W5EA 1G36A 2J9NA 1UMAH 1P2NA 2D8WA 2FOAA 2SGFE 5HGGA 4WMEA 1XM1A 3TU7H 1BJUA 4X1PU 3RDZA 4ZHAA 2K1QA 2VGCB 2W26A 1GCTC 1SL3A 1GHVH 3VPKA 1DY8A 2ZKSA 3K9XB 3MO9A 2VVCA 3M5NA 4A1TA 5LPFA 2VH6A 3ZVFA 3LGTA 1BTWA 3ZZCA 1S84A 2D2DA 1A0HB 2FTLE 3TJOA 2ZCHP 2J2UA 4NWLA 1BTHH 8ESTE 3CP7A 3W95A 1AE8H 1EJAA 2JH0D 1MCVA 5GIBA 4Y71A 1IHSH 3BTKE 3PYHA 1C2DA 1Z71A 1V2NT 1EZQA 1MTNC 4BAHB 1C1PA 1LCYA 1T8NA 3TGIE 1H8DH 3UUZA 2GT7A 3SNEA 5AFYH 5FCRA 2CMYA 1TA6A 3GY7A 2BHGA 2WPHS 1JIMA 4Q7ZA 4DIHH 1LVOA 3RXFA 1QQUA 3UWJH 1FZZA 3LPRA 4E7RG 1ANDA 4MLFB 1O30A 4WJG2 1KDQB 4A6LA 1K1MA 2ODPA 1O2NA 1HYLA 5DG6A 3PMBB 3LGIA 2ZU2A 3TH4H 4HFPB 1Y3XA 3M5LA 1HJ8A 2OD3B 1NFUA 4YLQH 4D76A 1A1RA 2QAAA 1ARBA 1HGTH 1VJ9U 1G3DA 4XFQA 3VXFH 5EW1H 4R8TB 4B74A 2FEQH 3T29A 1SMFE 3RM0H 1OWKA 1AVWA 1K1OA 3C27B 2ZI2H 1QB9A 2BZAA 4FUJA 2ZF0H 4O3TA 1E35B 2C8WB 1OPHB 1WCZA 4H6SB 1ETTH 4UONA 1O38A 3GCTF 1GDUA 1PPCE 3BTFE 5F8XA 4BAKB 4CH2B 5K7RA 4Y6DA 1GMDF 4IW4E 3MO3A 3E6PH 3SV7A 1V2QT 3BEFB 5A0CA 1C2MA 1VITF 4XE4A 1GCTB 1TFXA 4KKDA 4DGJA 3EGKH 1ELBA 1JMOH 1NFXA 1P9SA 1PPGE 2H5DA 4FUIA 1W0ZU 4JYVH 1SOTA 1BOQA 3NWUA 1PPFE 2AERH 2HPQH 4F49A 5C5OA 4A1XA 1SBWA 2BY7X 4RKJB 2JKHA 2D26C 1HBTH 1TPOA 2ANMH 4O9VA 1SC8U 2GV7A 1GI7B 5TCAA 4FUGA 1C2KA 2AMQA 1GVLA 3U1JB 2EEKA 3EE0B 1UCYK 4BTUB 1P2MA 2A7HA 1WTGH 3RXPA 2PV9B 1L0ZA 4HGCA 2Z94A 2VWLA 1O3OA 1G37A 1O35A 2GTBA 1MTNB 1C5PA 5EW2H 3LU9B 3MU0A 2VU8E 5ESBA 1LO6A 1ZSLA 2OC1A 5TCCA 2GVFA 2AMDA 2XW9A 4WF8A 3VB4A 3BTTE 1NPMA 1V2RT 2PW8H 4THNH 1HCGA 3QDZB 1QFKH 4IC5A 4OS4A 1KDQA 2GCHF 1QB6A 4OS1A 1YPLH 4DG4A 3TNTA 1QB1A 4KTCA 5E0GA 3STJA 2Y5HA 3UNSA 5CMXH 4CRAA 4GUXA 4UFDH 4FXGH 5PTPA 1LDTT 2TPIZ 3LGVA 1C5SA 3ATWA 1TBRH 2BXUH 5DP9A 1GHAG 1TIOA 2BOHB 1P11E 9LPRA 1C2FA 3RU4E 9ESTA 1GVZA 2P95A 1CA8B 2V3OH 3FZZA 3PMJA 1MKXH 1AQ7A 1VCWA 2GMTC 1EZXC 4CHAC 1Y5BT 2GT8A 4B76A 3OYPA 1GBBA 1H9LB 1A0JA 1CSOE 4YO9A 1OWEA 1S5SA 1GI2A 1S82A 2BQWB 1BDAA 1EJNA 2XTTB 1SLUB 1W2KH 3A82A 5JYIA 3CENA 1Y8TA 5FX6A 2BLWA 4AOQA 4LZ4B 1DICA 1DDJA 3PWBA 1GJBB 4TWWA 3ZZ8A 2OTVA 5I25A 3GCHC 1FDPA 1NRNH 4X8TH 2Y7XA 3RC5A 1CHGA 1YLDA 4U32A 4BXWA 1GJ4H 2BYAX 4NG9H 3MU1A 2AS9A 1F0RA 1O5EH 4Y76A 1ELEE 4I8HA 1F0SA 1SLXB 1HAHH 1F5RA 2QY0B 3LOXA 3ZYDA 1WQSA 2GP9B 3GY2A 4AB8A 2W3KA 5A0BA 3BTME 1AO5A 2Z9IA 1EQ9A 1SFIA 1DLKB 4AORA 2B8OH 1UTNA 1P2QA 1RTLA 1FY3A 1Z6EA 2QC2A 1BRUP 1GI3A 2SGDE 3L6PA 1L1GA 2BDHA 2FO9A 1XVMA 5JBTA 3P17H 3MH5A 1C1VH 4AX9H 1SGCA 1O3FA 4NA7A 3NUMA 4IC6A 3E3TA 1ZRKA 3DD2H 3V12A 2BDYA 1O2KA 1N8OB 1YM0A 3SGQE 2VINA 5DJ7A 4JZ1A 2A45B 1L1JA 2OLGA 1WBGB 2FS8A 1C1SA 4I31A 1HAOH 2H1UA 3UR6A 5GCHG 4IGDA 2FI3E 3RXLA 2HNTE 1UTLM 4NA9H 3K2UA 3U8OH 3E16B 1GBKA 4Y8ZA 1AUJA 3KCGH 4AFUA 3CS7A 3Q76A 1NZQH 3TK9A 1ABIH 1OOKB 1LHFH 2R9PA 2GMTB 1LVBA 1KXBA 3D23A 1QJ6B 1GJ6A 4VGCC 4FU8A 1Z6JH 1O3KA 1O2YA 1AZ8A 2OC7A 2ZGXH 4XBBA 1Z8IB 3MOCA 4YM9A 1ANBA 1T4UH 3U9AH 1BTZA 3KEEA 3A85A 2STBE 2Z7FE 4OGYA 2HWLB 5EU8A 2P3UB 2AEIH 1NS3A 2QYIA 1UCYE 4NCYA 1ZPBA 3GCHB 1IQMA 1TONA 2SGEE 5HM9A 4JZEH 2BDIA 4K69A 3FANA 1AFEH 1Q2WA 2OQ5A 4ZKNU 3A84A 4LZ1H 4I8GA 4A5TS 5C2ZA 3U98H 3A87A 1NRSH 1YBWA 3MYWA 3V0XA 1HAIH 2WPJS 2JH6D 4NZLA 2BM2A 2IPHA 4AFSA 3IITA 3MU5A 2ZGJA 3PLKA 1HNEE 4GHQA 1TGBA 3R3GB 1L4ZA 2ANWA 1BMMH 1OX1A 1E0FD 1OYQA 3SBKA 3SU0A 1HV7A 1TPSA 4OS2A 4ZXXH 5C67A 2TBSA 3BSQA 2DE9A 2XC4A 3MO6A 1VGCC 1ESTA 4BTTB 2AGEX 1TX7A 1V6DA 1OP2A 1CHOF 1NFYA 1K1PA 1CGJE 1O3JA 2VIWA 4K3JA 4JCNA 3P95A 3B9FH 3C1KA 3MFJA 2Y7ZA 1AVGH 1C1UH 1KXFA 5F8ZA 1YP9A 4ZMAH 1TNGA 1Y5UT 6LPRA 1AE5A 3RXGA 2C4FH 3GDSA 2Q6DA 3DFLA 2TRMA 1W7GH 3LGUA 2I6SA 1UVOA 1GL1A 2STAE 1MZAA 2Z3CA 4VGCB 1GPZA 4DOQA 1ZR0A 3ZVGA 1BITA 3B8JA 1BB0B 1XUJA 1HUTH 1D9IA 1G32B 2A4GA 1DS2E 1SGDE 1AB9B 1V2WT 3F1SB 1DSUA 4GLYA 1C2GA 1UO6A 5FPYA 3NXPA 1QL8A 2WPKS 3BTGE 1XXFA 2A4QA 4Z0KA 1IQHA 2ZDAH 2FESH 3SUDA 1O3LA 1DXPA 1RRKA 4ZROA 2P16A 3SGAE 1XKBC 2RG3A 2CN0H 2D1JA 4IS5A 3U69H 2PGQB 1O3AA 1GHXH 1Y3WA 5LH8A 1V2MT 1YPHE 3Q77A 1T8MA 3TNSA 1DM4B 2CHAC 4Q7XA 2BDAA 1HIAB 3HGPA 5HMAA 1OXGA 3MH4A 1CBWB 5T6GA 2PSXA 1JRTA 2GCTB 1ZSJA 1EP5A 1K1JA 4M7GA 2UUKB 1EXFA 1YCPM 4ESTE 4XSKU 1ZLRA 3GCOA 3GISB 3SNAA 2ZECA 5DP3A 2ZPSA 3I78A 1P2OA 1UHBB 4AN7A 2B5TB 3MNBA 3BTWE 1SGFG 4JZFH 1O2MA 3UQVA 1H4WA 1C1WH 1TX6A 4BAOB 1QHRB 2ULLA 3SU2A 3GICB 4K5ZA 2OC0A 1C5TA 1VGCB 2IOTA 3M7UA 4JK6A 4IBLH 3MTYA 2FS9A 4JZDH 1P3CA 3GDVA 3N7OA 3SNCA 5IDKA 5E2PA 4NA8A 1N1LA 3UFAA 3A89A 2P8OC 1RTKA 3T26A 1GL0E 7LPRA 3TVJB 2BVXH 1MMJN 2VIQA 1BCUH 1O36A 3F9EA 3V13A 2CGAA 4OS5A 2BDGA 4F4OC 1YC0A 1KLIH 1BRBE 4AGJA 1P09A 1BMNH 1JOUB 2YNBA 1C5YB 1K22H 2DUCA 3BV9B 1GDNA 1TA2A 3PO1C 1DLEA 1RIWC 1SQOA 5J4QA 1YPJH 2ZU5A 1Y3UA 4WMDA 1EB1H 5ETXA 1KLJH 3SJKA 1SGEE 1TOCB 2PGBB 1QBOA 1E37B 1AHTH 3E1XB 1FUJA 1VJAU 1MU6B 1O33A 1O2WA 4K8BA 2PUQH 3TJVA 3RXRA 1GDQA 4O97A 1IQGA 3GOVB 2WPMS 2V0BA 2A32A 1HAYB 4ZAEA 3SHAH 3SU1A 4GHTA 3GDUA 3LJOA 4Y8YA 1AN1E 1H8IH 1YCPK 2ZHWH 3TGKE 1TGSZ 2FOBA 4FUHA 1C2HA 3QTOH 2GV6A 1SGRE 3QTVH 1C5OH 1EKBB 4I8JA 2FODA 2CHAB 2G00A 1O0DH 1KTSB 3FP7E 4X1NU 3Q3XA 1MKWH 4FU9A 5L30H 4X1RU 1GJ9B 2WYJA 3A8BA 1UHBA 3U8TH 4B2BA 1O2LA 3LC5A 2VWOA 1C2LA 1ZHPA 4U2WA 3ZZ3A 2NU1E 2WPIS 1HJAC 5HM2A 5E0JA 3T28A 1TMBH 1PQ5A 2RCEA 1A61H 1KTTB 3V7TA 2TIOA 3A7VA 5JB9S 1GMHF 4I7YH 5EQQA 4CBOA 2G55A 2J94A 3SUGA 1FPCH 1AD8H 1TALA 5AFZH 1C5NH 4HI3A 1DUEA 1ELDE 3KQEA 4Z6AH 4X8VH 1P01A 5EXLA 3ZZ7A 2QXGA 2YOLA 3F9HA 1OP0A 1D3QB 3S0NA 8GCHG 2P8OB 3SI4H 1DUAA 3UQOA 1GBIA 3TLOA 7ESTE 4ISOA 1G9IE 3EDXB 2H9TH 3PMHB 1IQNA 2J92A 5CHAC 2G8TA 3RXIA 1AUTC 2XNIA 1GCDA 2ZWLH 4CREA 1FIWA 1C1QA 3SNBA 1RIWB 5DPAA 1TMTH 2QXHA 2AFQB 2GD4B 4RSPA 1CT0E 1AI8H 1UTQA 5C3NA 1J9CH 4CR9A 4MPXA 1SPJA 1T32A 2A2XH 4B75A 2F83A 1N6XA 2TGAA 1A3BH 1O3DA 2A1DB 2PTNA 3T5FH 2YNAA 4BNRA 1ELGA 1TE0A 2LNCA 2VIOA 3SU3A 1CT4E 1YF4A 4ABIA 3Q3YA 1YCPH 2O9QA 3SU4A 1TNIA 3P8FA 1DANH 1W0YH 1MKXK 1A4WH 1MD7A 3A7ZA 3HK6B 1ELAA 1SFQB 1A2CH 2A4OA 2IJOB 2J4IA 3FZDA 4SGAE 2AMPA 4J1YA 1FLEE 3KN2A 2TGDA 1GI4A 3TPIZ 3P8NA 1QNJA 1ELVA 2FOEA 4QT8C 4XBDA 4LXBH 1UK4A 2F3CE 4B1TA 4E05H 1EPTC 2UWPA 3FVFB 3ZVDA 2FX4A 3VB6A 1LHDH 2B0FA 2QIQA 1PQ8A 2ODYB 1WQVH 2ZU1A 1HAGE 3GY5A 5C1YA 1T4VH 2Z9LA 1O2OA 3PLBA 1W13U 6ESTA 3UOUA 1CU1A 2VJ1A 2V3HH 1NRQH 3ZVEA 5L2YH 2PKSC 1BUIA 1JRSA 3GY8A 4MNVA 1ESBA 2C93B 3GY3A 5G4BA 3F68H 1XUHA 4XOJA 4ABBA 4B2CA 2H2ZA 3SQHE 4AZ2B 2CJIA 2FYRA 1W3CA 3FP6E 2WV4A 4BOHA 3S69A 1TAWA 2OC8A 4Y10E 3TJUA 4TPYA 2F9NA 2V6NA 3A81A 1N6YA 3LH3A 4OS6A 1KY9A 1JIRA 5E8EH 1ZMLA 1J15A 4ABJA 3MWIU 1BMAA 3PWCA 1GMCG 2R0KA 3ATIA 2AYWA 5CHAB 3RMMH 2F9OA 1O2XA 4H42U 1CQQA 1MU8B 2RA0A 1A0LA 1C4Y2 4D7FA 1Z8RA 4IMQA 1U6QA 2HNTC 1Z8GA 1SGYE 3TH2H 2HRVA 1AMHA 4YZUA 1BBRK 1J14A 2H9HA 1LPGB 1OYTH 2A5KA 2TGTA 2ZGCA 4I32A 1TNHA 1THPB 3E90B 5JB8S 2GDDA 4ABAA 2A0QB 3OY5U 1YYY1 4WH6A 3K6ZA 1DE7H 5J4SA 3SUEA 5TJXA 2PWXA 3RLWH 3UWIA 4CRBA 2VWMA 1UK3A 1VITH 3UREA 1FMGA 2ZFFH 1DWEH 1V2VT 4ZKSU 3U8RH 2W7SA 1SSXA 2Z3DA 1Z7KA 3EQ0H 4NIWA 1XKAC 1NFWA 1TQ7B 1BIOA 1F5KU 3SU5A 2A31A 1O5FH 2BZ6H 1CA0C 2QV1A 2SGAA 2FI5E 1UVSH 3DT0H 1UVTH 4JK5A 5LPRA 1GBAA 2OXSA 1O2JA 1QR3E 2XXLA 2CF8H 1KXEA 3EA7A 2ZTZA 1KXAA 4TY7A 5A8XA 4X1QU 2W7UA 3ZZAA 4NIVA 1EPTB 3HPTB 1LQEA 3QK1A 2R3UA 3A88A 1VCQA 2XWAA 1NN6A 1SQAA 4B71A 1VCPA 2XRCA 1LKBA 1LHCH 1TBQH 4X2YA 4X2WA 1KYNA 2JETC 4UFEH 3SGBE 2BDBA 3HGNA 1BZXE 3AASA 3GCTG 5LGOA 5EXMA 3IWMA 3VGCC 1GHBG 3WY8A 1O32A 1GI6A 3OX7U 2J34A 3KHVA 2FP7B 5A09A 1V2ST 1GJCB 2ANYA 2BQ6B 1QGFA 1QJ1B 1NY22 3SQEE 2C8YB 2B7DH 1GHYH 1O5GH 2O8WA 2ODQA 3RUOA 3ZYEA 5AVDA 1UK2A 5EPNA 2FMJA 3RXSA 1P9UA 2F9PA 1XMNB 1V2LT 4MPVA 1TABE 3STIA 1ZZZA 1ELFA 2BY9X 2FDAA 4GAWA 1BBRH 2ZA5A 1P03A 4RKOB 1XVOA 1G3CA 3B23B 2THFB 1TX8A 1K1IA 1YGCH 1P06A 1SLVB 2WYGA 2Q6FA 1INCA 3VFEA 2PR3A 3RU4D 3DA9B 5FPSA 1P2KA 2EC9H 1H1BA 1OWIA 2A5AA 4AYVB 3ATKA 3MNSA 2FOHA 1ZMJA 5T3HA 4D8NA 4CHAB 1ANCA 5A8ZA 3ZZ5A 1XXDA 1CGIE 3LKWA 3A7WA 2F9UA 3K6YA 4UFGH 1HDTH 1WV7H 4JYUH 1O2GH 1UTOA 4K60A 4ISNA 1O31A 1NU7B 4DT7B 1CA0B 3O8RA 2BD5A 1SGQE 1MH0A 3BG8A 3LT3A 1FXYA 2ZDVH 5EGMA 5EG4A 1C5RA 2BVRH 1Q31A 1P3EA 1YPHC 1G2MA 3RXHA 3SN8A 1Z1JA 4JZIA 5FBIA 1AKSB 1QIXB 2SNWA 1ZHRA 1IOEA 1QRXA 1CT2E 3UR9A 1PFXC 2QXJA 2GX4A 4CR5A 1XUIA 2BLOA 1GI8B 3NZIA 4BTIB 1Y3VA 1C5XB 2JETB 3DFJA 1P04A 8KME2 4B2AA 4NFEA 3GYLB 2FWWA 3RMNH 2G5NA 3T25A 3KGPA 1SHHB 2BD2A 3VGCB 3MMGA 1OKXA 1LHGH 5FPTA 1J16A 3SU6A 2FM2A 3D65E 3SJIA 3O8CA 1BBRE 3TH3H 5DK1A 3EA8A 2PKAB 4WY3A 1IQIA 4K2YA 4GCHG 1J17T 5DKMA 3AW1A 1XUKA 4HTCH 1HAPH 1UTPA 2KAIB 2UWOA 2XC5A 3VB5A 1IQJA 1IQEA 1GWAA 3P92A 3M7QA 4FUDA 4ISIH 2J38A 4Q7YA 2AH4X 5BPEA 2C3SA 4CRCA 3OSYA 1BT7A 1FY5A 1SI5H 2G4UA 1O5BB 1P0SH 2EA3A 3BTHE 4ISHH 1KSNA 1GBFA 1S6FA 2G51A 5E0HA 3DHKH 5JDUB 2ZDMA 4YOGA 3OTJE 2GZ8A 2HLCA 3ENSB 1NRRH 1SOZA 1O2HA 2O8MA 1SGNE 1EJMA 2ZDKA 1O37A 1GBDA 2BD9A 2OCVB 1HAZB 3QN7A 1SQTA 3KQCA 3RXKA 4AG2A 2UUJB 1FQ3A 1D3TB 1ETSH 4I8LA 1ZYOA 1SGTA 1T7CA 2UWLA 5C5NA 3MH6A 2ZU4A
chains in the Genus database with same CATH superfamily
3AAVA 3N7DA 1RD3B 2KR7A 2SGPE 2BLVA 3EA9A 1LKAA 1C9TA 1C1RA 1YWUA 2GZ9A 1AKSA 1GVKB 1QL9A 3FOAA 3AAUA 4YESB 5FXLA 1QBVH 1T31A 2RFKC 3SO3A 3M3VA 1TQ0B 2ZHQH 4ZXYH 1ELCA 1NRPH 1TRNA 1YPEH 4FU7A 4A92A 2WUBA 1DX5M 4FUFA 1S83A 5IYTA 2Z6BD 4ZCNA 4GSOA 5DP7A 3DCLA 2VIVA 4NGAH 1EAIA 3SJ8A 3W94A 2RDLA 4DVAU 4UFFH 8LPRA 2QCYA 2XBVA 2P3TB 1F0TA 1MKWK 4E06H 1QY6A 1SHYA 2BX4A 1K21H 3GYMA 5AF9H 5DO4H 1P02A 1MBQA 2PKAA 1CVWH 1FY1A 3M36A 3UNRA 1C5LH 3KL6A 1V2TT 2RDEA 2ZFRH 2ZIQH 1S6HA 2VGCC 3F2GA 1GI0A 2KAIA 1O2UA 3QO6A 1LPKB 2GGVB 2P94A 8GCHF 1MTVA 2ZQ2A 2YMSC 2R0LA 4NIXA 3WW7A 2FOCA 2Q1JA 4BXSA 1DSTA 1SGPE 1OWJA 1V2OT 5EJ1A 1O3PB 1W14U 2XWBI 5C94A 1ZPCA 3EAJA 2BVSH 1G3EA 3A86A 3UIRA 1LTOA 3H7OA 4M9FA 1E79D 3RXUA 3PROA 4H4FA 2O8LA 3RLYH 3SW2B 1BJVA 2CF9H 1A5HA 2AGIX 1VZQH 2ZEBA 2VIPA 3SV8A 5DGJA 2C8ZB 4KTSA 1V2JT 2GKVE 1MBMA 2F91A 3JZ1B 1OWHA 4MTBA 1S0QA 1WSSH 2SFAA 1PPEE 2IN2A 2R2WU 2Z9KA 4Y8XA 1Y59T 1BMLA 1YPMH 3NK8A 3RM2H 2KCYA 2VH0A 2BXTH 5C1XA 1ACBE 2ZP0H 4YOIA 1P2IA 2NU4E 4KTUA 2C8XB 2F9VA 3RXTA 3ZZBA 6GCHG 3SV2H 2LPRA 4WXVA 1B7XB 3SOSA 4D9QA 2BD4A 1EX3A 1WU1A 4I33A 4Y0YE 1FY4A 1CO7E 4Y0ZE 3SJ9A 5F53A 5EPYA 3MNXA 4J2YB 1TGNA 2EI8A 2BDCA 3PMAB 3NKKA 3I77A 4NSYA 3EYDA 2H6MA 1NT1A 1EZSC 1Y5AT 2K0QA 1HIAA 2DE8A 4A1VA 1EAUA 3MI4A 1TPPA 4CRFA 3ZZ4A 1AU8A 1BTPA 1UVPA 4D7GA 3SV9A 1BTYA 1ELTA 3SNDA 1XUGA 1F5LA 2ZO3H 1ZTLA 2ALPA 4UE7H 1EAXA 2SGQE 4WVPE 1NC6A 4YTAA 1E38B 3ZZ9A 2Y5GA 3T2NA 1A46H 1D4PB 4XD7D 1GGDC 3M7TA 1AIXH 1W8BH 1K1NA 2FLRH 1HAXB 4X6NA 4NZQA 5H4IB 2FPZA 1DFPA 3A80A 1L2EA 1S0RA 5HYOA 1L4DA 2BTCE 2Y81A 4X8UH 4H6TA 1PPZA 2FXRA 3URCA 1H8ED 2XCNA 1NTPA 3M37A 5C0TA 3MH7A 1CE5A 1PYTD 1P57B 3TK6A 4ZHMU 1HAVB 2L6OA 4ISLA 1SGFA 3TK5A 1DVAH 2UUFB 7GCHG 1QQ4A 1GMCF 4K1EA 1A5IA 1DOJA 1ZMNA 1NU9A 3PTNA 4X6MA 1C5ZB 3HKJB 3RXQA 2BD8A 4PROA 2GZ7A 3RMLH 2IJD1 4CH8B 2J5UA 4DJZB 3AVZA 4MNYA 3P8GA 3TGJE 2VWNA 1C2EA 3M61U 3ODFA 2ZPRA 1LPZB 1RJXB 2QF0A 2GJGA 1HRTH 3O8DA 1QA0A 3QGNB 4BANB 1MABB 3PO1B 1GHAF 4TPIZ 3OU0A 3FP8E 1P10A 3S9CA 1IQFA 1FJSA 2XBWA 3S7KB 2C90B 5E2OA 3A8DA 1D3PB 1FAKH 1GBTA 4KP0A 3SORA 1HB0B 1ZGVA 3BIUH 2AIQA 2F9BH 3BF6H 5GWZA 1FNIA 2B9LA 2ZDNA 2ZPQA 1ORFA 4ZUHA 4K8YA 4YOJA 1VR1H 1G3BA 1UW7A 2BD7A 1O2TA 3VB3A 1DY9A 2BY8X 4Y11E 2VIDA 1GHWH 1O2ZA 1O39A 2Y5FA 4AB9A 2A2QH 1UJ1A 2WUCA 1W0JD 5T6DA 1NROH 2PFEA 1E36B 1TYNA 2FOMB 3D62A 4K1SA 2AIPA 3Q00A 3F6UH 4FVBA 4TY6A 5CHBA 1S6LA 1S85A 3ZZDA 2HGTH 1G30B 2ZCKP 2VNTA 2CV3A 3M3TA 3R0FA 4Y7BA 2ZU3A 1E34B 2FIRH 1T8OA 5F6MA 3L33A 3P8OA 1EAWA 2PP6A 3PTBA 3QZQA 1TLDA 4INKA 1ZJKA 1RTFB 5EODA 1J8AA 2ZFSA 1GGDB 4NIYA 5CDFE 1PPHE 1C4U2 4X2VA 4YLUA 3FAOA 3BEUA 2G5VA 1A7SA 1OP8A 1C2JA 1O5CB 1GHBF 3ATLA 1D6WA 1HAVA 1HJAB 4AFZA 1JWTA 1Z1IA 1IAUA 2NU2E 2HOBA 1FIZA 1HXEH 1V3XA 3A7XA 1ARCA 3HK3B 3RXEA 5A2MH 4R0IA 1GHZA 2ALVA 2Z9JA 3S9AA 2PTCE 5K0HA 2YMSD 1W7XH 2OINA 1FN8A 2HNTF 1TMUH 1EZUC 1F92A 1C5UA 1MTWA 1SVPA 2BOKA 2K8IA 1A3EH 1TWXB 1GG6C 3DUXH 1YLCA 1NESE 4BAMB 4ASHA 1VKYA 5B6OA 1MCTA 3F3BA 2ZGHA 3ESTA 5GCHF 1GI5A 2PSYA 2ZGBH 3NCLA 1AVXA 1WXRA 2BY5X 3RXAA 3QWCH 1BQYA 4WH8A 3BG4C 1BHXF 3ITIA 4NWKA 4MG3A 1SLWB 4GVUA 1ZOMA 4WXIA 2KZ4A 3UAIC 3A83A 1IQKA 3G01A 3V3MA 1GI9B 1GMHG 1PQAA 1TOMH 4UEHH 2XOKD 3VXEH 2WPDD 1MD8A 2ZNKH 3A7YA 1V2KT 3QUMP 1N8OC 4E7NA 3A8CA 1UVUH 1YPKH 1GBEA 5GJ4B 5FAHA 1O2VA 3RXBA 2WV5A 1NM6A 4CRDA 3A8AA 1C5WB 2G52A 2R3YA 2CXVA 1DWCH 3PB1E 1O5AB 2PUXB 3PM3A 2O8TA 1UTMA 3DSPA 3UTUH 1MAXA 4RN6A 5EOKA 4AG1A 1MAYA 1MTUA 4ZKOU 1QCPA 5L2ZH 1KLTA 1O2IA 4OM9A 1ID5H 3KQ5A 1THRH 4ACAA 3FFGA 6CHAC 4UDWH 1O3NA 2G4TA 1C4V2 1HFDA 3VEQB 1O2PA 1EOJA 3LGWA 3KQBA 5FX5A 1A5GH 3VB7A 4AGKA 1EASA 3L3TA 3N99A 4ABHA 4ZHLU 4DY7B 1SB1H 2OP9A 4X6OA 2XCFA 3S9BA 1P2JA 1TPAE 2ZFTA 5FBEA 1HPGA 1RGQA 1S81A 4JYTA 2BQ7B 5B6LA 3NPSA 2PKSB 5BRRE 5GDSH 2PHBA 4NFFA 4GCHF 3Q3KA 3E8LA 1THSH 1BRCE 2HPPH 1ZTKA 1GMDG 5JPMH 1AWHB 3O8BA 3UOPA 2QGRA 3RC6A 4SGBE 4Y79A 2CK3D 1UTJA 1GG6B 2ESTE 1UCYH 1VITG 1MTSA 1EOLA 1ANEA 2Y6TA 4WMFA 1IHTH 1FY8E 1Z8JB 3LDXH 4D9RA 1GJ7B 4B73A 2ZTYA 5T6FA 2VVVA 2FTMA 1O3CA 1SGIB 1XUFA 3EE7A 2QA9E 3BG4B 2A5IA 1FV9A 2HVXA 4MNWA 2NWNA 2WPLS 5JBBS 2AGGX 3GY4A 3F2FA 2XYAA 1BTUA 2ZFQH 1C5QA 5DP6A 3QLPH 5GXPA 1GBLA 1LQDB 4LK4A 3RXDA 1DWBH 2ZHFH 3SJOA 3H5CB 5I46H 1QTFA 2ZQ1A 3P70B 5ABWA 1ZRBA 1H8HD 3I29A 1ABJH 4XRNA 2FZZA 4CRGA 1TRMA 3BTQE 1C1MA 5HIYA 2FOFA 3S7HB 1FAXA 1BHXB 4FVDA 1TGTA 2FYQA 2XBXA 1X7AC 3RMOH 3ZVBA 1JXPA 1RXPA 1T8LA 3PLPA 4IMZA 3RXJA 1ZGIA 2GCHG 3BEIB 3AW0A 3TJNA 5F03A 4Q80A 3H7TA 3E91A 3RXMA 1ZPZA 4WWYA 2FOGA 2OUAA 3LJJA 4OS7A 1UTKA 2QN5T 3LC3A 1RS0A 2BX3A 1EPTA 1TNLA 1DXWA 6CHAB 4GPGA 3TITA 1DT2A 1WOFA 3BTDE 1AGJA 2BMGB 3ATMA 2EI6A 3E0PB 4X8SH 3RP2A 1L1NA 1WAYB 1H9HE 2ZDLA 4INHA 1OS8A 4MPUA 4A7IB 1AB9C 3LONA 5F8TA 3KNXA 1MQ6A 1AY6H 2JDID 1TGCA 1QL7A 3ELAH 2R2MB 4Y7AA 4YT7H 5ESTE 1ZTJA 1O34A 3AK5A 1Y3YA 1MUEB 4P02A 4OGXA 1AFQC 1K1LA 3RU4T 1FI8A 3UPEA 2HALA 5DP8A 1YKTA 2PLXA 2XBYA 4DW2U 4MVNA 4DURA 1F2SE 3T62A 3SYJA 2ZTXA 4MNXA 1OSSA 2LP6A 5DP4A 4Q63A 3ZVCA 4F55A 1C5MD 4U30A 4LOYH 1CBWC 1K9OE 3URDA 1PYTC 4FUEA 2EI7A 4CBNA 2GCTC 1GBJA 1ZSKA 4AYYB 1GJ5H 3M3SA 1EATA 1XX9A 3M5MA 3A7TA 4DIIH 5DP5A 1DPOA 4BAQB 3SV6A 5JBCS 2HLDD 2ASUB 3LH1A 1CGHA 5AHGH 3TIUA 4U01A 3MU4A 1O2QA 3PV4A 3UY9A 1PPBH 1QBNA 3UB0A 1GJAB 2V35A 3LIWA 1D6RA 3HATH 2NU3E 3MNCA 1KXDA 1TNJA 1B0EA 4YT6H 2H9EH 5FHTA 2ZG0H 3KQDA 1FONA 6GCHF 1GBHA 1O5DH 2KFWA 4X0WU 1O3HA 3RXOA 3GCNA 5JBAS 3JZ2B 3CNRA 1GJ8B 4P00A 1QA7A 1B0FA 1M9UA 5GPIB 2W3IA 1WTHD 2FI4E 2OBQA 2Y80A 1TRYA 1ETRH 2J95A 3BTEE 1HXFH 7KMEH 2P3FH 4Q2KA 4ABFA 2Y82A 1K2I1 4INLA 1FN6A 3KF2A 5EXNA 2TGPZ 3SUFA 2BY6X 4KGAA 1GBMA 1QURH 2OQUA 5HXFA 5A0AE 4ABDA 2F4LA 1O2RA 4IN1A 3T27A 3ODDA 5IK2D 1C5VA 1C9PA 5EQSA 3MU8A 2BLQA 2ZC9H 1HLTH 1O3MA 3N7EA 4I8KA 2QXIA 4TWYA 3ZV8A 3M5OA 2M5TA 1HJ9A 2O8UA 1QJ7B 5L6NH 1OWDA 4XDEA 1LVYA 1AFQB 1RFNA 1G2LA 1TNKA 3K65B 4MPWA 1W10U 1WYKA 2ZHEH 1Q3XA 2ZHDA 3RXVA 3ZZ6A 4NSVA 1TBZH 2A7JA 2FX6A 1GJDB 1EUFA 2VVUA 7GCHF 1PQ7A 1LVMA 1BA8B 2SNVA 1PJPA 1O3GA 1IQLA 1GI1A 3D49H 4ZH8A 2BB4A 2ZZUH 1EP6A 2FLBH 3OAAD 2ANKH 2BD3A 2ZCLP 4ABGA 4MDSA 4X2XA 2A7CA 5FCKA 4HZHA 3CS0A 4ZKRU 2Z3EA 3E0NB 1P12E 1F7ZA 1F0UA 4DCDA 1V2PT 1KXCA 4X6PA 1MQ5A 1JBUH 2ILNA 3SZNA 4TYDA 3ZVAA 2GDEH 4FUCA 2ZFPH 2XC0A 1AWFH 1LMWB 2P59A 4FETA 2NU0E 1QRWA 1LHEH 2QF3A 1DITH 1O3BA 2VB0A 1K28D 1TB6H 3GY6A 3ZV9A 1AZZA 1YPGH 3SI3H 3OY6U 5EQRA 4XBCA 1QRZA 1W12U 3DSOA 1D3DB 2QF5A 3RXCA 4RT0A 2JH5D 4KELA 1ESAA 1P05A 1P8VC 4IN2A 3UNQA 1CHOG 3SHCH 1C1NA 1O3EA 4X1SU 5KECA 4K1TA 3BIVH 5C20A 1WUNH 2JJ1D 4JMYA 4ABEA 3KIDU 5SGAE 3LGYA 3RC4A 1BTXA 2Q6GA 1KIGH 1C2IA 2A4RA 3HKIB 2P93A 1SR5C 1DWDH 1O3IA 3VG8A 3M35A 1ZJDA 2OBOA 4FUBA 1FPHH 1B5GH 1BRAA 3U1IB 2UUYA 2H5CA 3F9FA 4UD9H 4TSFD 3QZRA 1GBCA 1O2SA 1W11U 1H9IE 5C1UA 5LPEA 3P6ZB 1V2UT 3QGJA 2I6QA 2Z9GA 5A8YA 3OFND 1EB2A 1SG8B 4AFQA 4O03A 2VBCA 4MQAA 2WINI 2G81E 3BN9A 3QX5H 1MZDA 3F9GA 1C1TA 1NBME 1NO9H 1C1OA 4O3UA 2RA3A 3MHWU 5CE1A 3IG6B 1ZHMA 2KCOA 2W5EA 1G36A 5C0UA 2J9NA 1UMAH 1P2NA 2D8WA 2FOAA 2SGFE 5HGGA 4WMEA 1XM1A 3TU7H 1BJUA 4X1PU 3RDZA 4ZHAA 2K1QA 2VGCB 2W26A 1GCTC 1SL3A 2YMSB 1GHVH 3F0PA 3VPKA 1DY8A 2ZKSA 3K9XB 3MO9A 2VVCA 3M5NA 4A1TA 5LPFA 2VH6A 3ZVFA 3LGTA 1BTWA 3ZZCA 1S84A 2D2DA 1A0HB 4RI0A 2FTLE 3TJOA 2ZCHP 2J2UA 4NWLA 1BTHH 8ESTE 3CP7A 3W95A 1AE8H 1EJAA 2JH0D 1MCVA 5GIBA 4Y71A 1IHSH 3BTKE 3PYHA 1C2DA 1Z71A 1V2NT 1EZQA 1MTNC 4BAHB 1C1PA 1LCYA 1T8NA 3TGIE 1H8DH 3UUZA 2GT7A 3SNEA 5AFYH 5FCRA 4F48B 2CMYA 1TA6A 3GY7A 2BHGA 2WPHS 1JIMA 4Q7ZA 4DIHH 1LVOA 3RXFA 1QQUA 3UWJH 1FZZA 3LPRA 4E7RG 1ANDA 4MLFB 1O30A 4WJG2 1KDQB 4A6LA 1K1MA 2ODPA 2W6JD 1O2NA 3U28C 1HYLA 5DG6A 3PMBB 3LGIA 2ZU2A 3TH4H 4HFPB 1Y3XA 3M5LA 1HJ8A 2OD3B 1NFUA 4YLQH 4D76A 1A1RA 2QAAA 1ARBA 1HGTH 1VJ9U 1G3DA 3H09A 4XFQA 3VXFH 5EW1H 4R8TB 4B74A 2FEQH 3T29A 1NBMD 1SMFE 3RM0H 1OWKA 1AVWA 1K1OA 3C27B 2ZI2H 1QB9A 3NRLA 2BZAA 5EJZA 4FUJA 2ZF0H 4O3TA 4TT3D 4ACBA 1E35B 2C8WB 1OPHB 1WCZA 4H6SB 1ETTH 4UONA 1O38A 3GCTF 1GDUA 1PPCE 3BTFE 5F8XA 4BAKB 4CH2B 5K7RA 4Y6DA 2HVYB 1GMDF 4IW4E 3MO3A 2JJ2D 3E6PH 3SV7A 1V2QT 3BEFB 5A0CA 1C2MA 1VITF 4XE4A 1EFRD 1GCTB 1TFXA 4KKDA 4DGJA 3EGKH 1ELBA 1JMOH 1NFXA 1P9SA 1PPGE 2H5DA 4FUIA 1W0ZU 4JYVH 1SOTA 1BOQA 3NWUA 1PPFE 2EY4C 2AERH 2HPQH 4F49A 5C5OA 4A1XA 1SBWA 2BY7X 4RKJB 2JKHA 2D26C 1HBTH 1TPOA 2ANMH 4O9VA 1SC8U 2F43B 2GV7A 1GI7B 5TCAA 4FUGA 1C2KA 2AMQA 1GVLA 3U1JB 2EEKA 3EE0B 4I86A 1UCYK 4BTUB 1P2MA 2A7HA 1WTGH 3RXPA 2PV9B 1L0ZA 4HGCA 2Z94A 2VWLA 1O3OA 1G37A 1O35A 2GTBA 1MTNB 1C5PA 5EW2H 3LU9B 3MU0A 2VU8E 5ESBA 1LO6A 1ZSLA 2OC1A 5TCCA 2GVFA 2AMDA 2XW9A 4WF8A 3VB4A 3BTTE 1NPMA 1V2RT 2PW8H 4THNH 1HCGA 3QDZB 1QFKH 4IC5A 4OS4A 1KDQA 2GCHF 1QB6A 5DN6D 4OS1A 1YPLH 2QE7D 4DG4A 3TNTA 1QB1A 4KTCA 5E0GA 3STJA 2Y5HA 3UNSA 5CMXH 4CRAA 5EIYA 4GUXA 4UFDH 1E1QD 4FXGH 5PTPA 1LDTT 2TPIZ 3LGVA 1C5SA 3ATWA 1TBRH 2BXUH 5DP9A 1GHAG 1TIOA 2BOHB 1P11E 9LPRA 1C2FA 3RU4E 9ESTA 1GVZA 2P95A 1CA8B 2V3OH 3FZZA 3PMJA 1MKXH 1AQ7A 1VCWA 2GMTC 1EZXC 4CHAC 1BMFD 1Y5BT 2GT8A 4B76A 3OYPA 1GBBA 1H9LB 1A0JA 1CSOE 4B6FA 4YO9A 1OWEA 1S5SA 1GI2A 1S82A 2BQWB 1BDAA 1EJNA 2XTTB 1SLUB 1W2KH 3A82A 5JYIA 3CENA 1Y8TA 5FX6A 2BLWA 2WHXA 4AOQA 4LZ4B 1DICA 1DDJA 3PWBA 1GJBB 4TWWA 3ZZ8A 2OTVA 5I25A 3GCHC 3KYFA 1FDPA 1NRNH 4X8TH 2Y7XA 3RC5A 1CHGA 1YLDA 4U32A 4BXWA 1GJ4H 2BYAX 2V3MA 3MU1A 2AS9A 4NG9H 1F0RA 1O5EH 4Y76A 1ELEE 4I8HA 1F0SA 1SLXB 1HAHH 1F5RA 2QY0B 3LOXA 3ZYDA 1WQSA 2GP9B 3GY2A 4AB8A 2W3KA 5A0BA 3BTME 1AO5A 2Z9IA 1EQ9A 1SFIA 1DLKB 4AORA 2B8OH 1UTNA 1P2QA 1RTLA 1FY3A 2LELA 1Z6EA 2QC2A 1BRUP 1GI3A 5KEDA 2SGDE 3L6PA 1L1GA 2BDHA 2FO9A 1XVMA 5JBTA 3P17H 3MH5A 1C1VH 4AX9H 1SGCA 1O3FA 4NA7A 3NUMA 4IC6A 3E3TA 1ZRKA 3DD2H 3V12A 2BDYA 1O2KA 1N8OB 1YM0A 4FOUC 3SGQE 2VINA 5DJ7A 4JZ1A 2A45B 1L1JA 2OLGA 1WBGB 2KCPA 2FS8A 1C1SA 3GS9A 4I31A 1HAOH 2H1UA 3UR6A 5GCHG 4IGDA 2FI3E 3RXLA 2HNTE 1UTLM 4NA9H 3K2UA 3U8OH 3E16B 1GBKA 4Y8ZA 1AUJA 3KCGH 4AFUA 3CS7A 2J97A 2IPQX 3Q76A 1NZQH 3TK9A 1ABIH 1OOKB 1LHFH 2R9PA 2GMTB 1LVBA 1KXBA 3D23A 1QJ6B 1GJ6A 4VGCC 4FU8A 1Z6JH 1O3KA 1O2YA 1AZ8A 2OC7A 2ZGXH 4XBBA 1Z8IB 3MOCA 4YM9A 1W0KD 1ANBA 1T4UH 5T1VA 3U9AH 1BTZA 3KEEA 3A85A 2STBE 2Z7FE 4OGYA 2HWLB 3PV2A 5EU8A 2P3UB 2KX4A 2AEIH 1NS3A 2QYIA 1UCYE 4NCYA 1ZPBA 3GCHB 1IQMA 1TONA 2SGEE 5HM9A 4JZEH 2BDIA 4K69A 3FANA 1AFEH 1Q2WA 2OQ5A 4ZKNU 3A84A 4LZ1H 4I8GA 4A5TS 5C2ZA 3U98H 2W6ID 3WWBA 3A87A 1NRSH 1YBWA 3MYWA 3V0XA 1HAIH 2WPJS 2JH6D 4NZLA 2BM2A 2V7QD 4Z1MD 2IPHA 4AFSA 3OEHD 3IITA 3MU5A 2ZGJA 3PLKA 1HNEE 4GHQA 1TGBA 3R3GB 1L4ZA 2ANWA 1BMMH 1OX1A 1E0FD 5KGOA 1OYQA 3SBKA 3SU0A 1HV7A 1TPSA 4OS2A 4ZXXH 5C67A 2TBSA 3BSQA 2DE9A 2XC4A 3MO6A 1VGCC 1ESTA 4BTTB 3F2HA 2AGEX 1TX7A 1V6DA 1OP2A 1CHOF 1NFYA 1K1PA 1CGJE 1O3JA 2VIWA 4K3JA 4YXWD 4JCNA 3P95A 3B9FH 3C1KA 3MFJA 2Y7ZA 1AVGH 3WWFA 1C1UH 1KXFA 5F8ZA 1YP9A 4ZMAH 1TNGA 1Y5UT 6LPRA 1AE5A 3RXGA 2C4FH 3GDSA 2Q6DA 3DFLA 2TRMA 1W7GH 3LGUA 2I6SA 1UVOA 2J98B 1GL1A 2STAE 1MZAA 2Z3CA 4VGCB 1GPZA 4DOQA 1ZR0A 3ZVGA 1BITA 3B8JA 1BB0B 1XUJA 1HUTH 1D9IA 1G32B 2A4GA 1DS2E 1SGDE 1AB9B 1V2WT 3F1SB 1DSUA 4GLYA 1C2GA 1UO6A 4RT1A 5FPYA 3NXPA 1QL8A 2WPKS 3BTGE 1XXFA 2A4QA 4Z0KA 1IQHA 2ZDAH 2FESH 3SUDA 1O3LA 1DXPA 1RRKA 3KYGA 2P16A 4ZROA 3SGAE 1XKBC 2RG3A 2CN0H 2D1JA 4IS5A 2OK5A 3U69H 2PGQB 1O3AA 1GHXH 1Y3WA 5LH8A 1V2MT 1YPHE 3Q77A 1T8MA 3TNSA 2QF4A 1DM4B 2CHAC 4Q7XA 2BDAA 1HIAB 3HGPA 5HMAA 1OXGA 3MH4A 1CBWB 5T6GA 2PSXA 1JRTA 2GCTB 1ZSJA 1EP5A 1K1JA 4M7GA 2UUKB 1EXFA 1YCPM 4ESTE 4XSKU 1ZLRA 3GCOA 3GISB 3SNAA 2ZECA 5DP3A 2ZPSA 3I78A 3W1EA 1P2OA 1UHBB 4AN7A 2B5TB 3MNBA 2WSSD 3BTWE 1SGFG 4JZFH 1O2MA 3UQVA 1H4WA 1C1WH 1TX6A 4BAOB 1QHRB 2ULLA 3SU2A 3GICB 4K5ZA 2OC0A 1C5TA 1VGCB 2IOTA 3M7UA 4JK6A 4IBLH 3MTYA 2FS9A 4JZDH 1P3CA 3GDVA 3N7OA 3SNCA 5IDKA 5E2PA 4NA8A 1N1LA 3UFAA 3A89A 2P8OC 1RTKA 3T26A 1GL0E 7LPRA 3TVJB 2BVXH 1MMJN 2VIQA 1BCUH 1O36A 3F9EA 3V13A 2EQNA 2CGAA 4OS5A 2BDGA 4F4OC 1YC0A 1KLIH 2J98A 1BRBE 4AGJA 1P09A 1BMNH 1JOUB 2YNBA 1C5YB 1K22H 2DUCA 3BV9B 1GDNA 1TA2A 3PO1C 1DLEA 1RIWC 1SQOA 5J4QA 1YPJH 2ZU5A 1Y3UA 4WMDA 2JIZD 1EB1H 5ETXA 1KLJH 3SJKA 1SGEE 1TOCB 2PGBB 1QBOA 4B6EA 1E37B 1AHTH 3E1XB 1FUJA 1VJAU 1MU6B 1O33A 1O2WA 4K8BA 2PUQH 3TJVA 3RXRA 1GDQA 4O97A 1IQGA 3GOVB 2WPMS 1YLNA 2V0BA 2A32A 1HAYB 4ZAEA 3SHAH 3SU1A 4GHTA 3GDUA 3LJOA 4ASUD 4Y8YA 3FO8D 1AN1E 1H8IH 1YCPK 2ZHWH 3TGKE 1TGSZ 2FOBA 4FUHA 1C2HA 3QTOH 2GV6A 1SGRE 3QTVH 1C5OH 1EKBB 4I8JA 2FODA 2CHAB 2G00A 1O0DH 1KTSB 3FP7E 4X1NU 5C17A 3Q3XA 1MKWH 4FU9A 5L30H 4X1RU 3MQKC 3OTPA 1GJ9B 2WYJA 3A8BA 5DSFA 2KM0A 1UHBA 3U8TH 4B2BA 1O2LA 3LC5A 2VWOA 1C2LA 1ZHPA 4U2WA 3ZZ3A 2NU1E 2WPIS 1HJAC 5HM2A 5E0JA 3T28A 1TMBH 1PQ5A 2RCEA 1A61H 1KTTB 3V7TA 2TIOA 3A7VA 5JB9S 1GMHF 4I7YH 5EQQA 4CBOA 2G55A 2J94A 3SUGA 1FPCH 1AD8H 1TALA 5AFZH 1C5NH 4HI3A 1DUEA 1ELDE 5FL7D 3KQEA 4Z6AH 4X8VH 1P01A 5EXLA 3ZZ7A 2QXGA 2YOLA 3F9HA 1OP0A 1D3QB 3S0NA 8GCHG 2P8OB 3SI4H 1DUAA 3UQOA 1GBIA 3TLOA 7ESTE 4ISOA 1G9IE 3EDXB 2H9TH 3PMHB 1IQNA 2J92A 5CHAC 2G8TA 3RXIA 1AUTC 2XNIA 1GCDA 2ZWLH 4CREA 1FIWA 2WZQA 1C1QA 3SNBA 1RIWB 5DPAA 1TMTH 2QXHA 2AFQB 2GD4B 4RSPA 1CT0E 1AI8H 1UTQA 5C3NA 1J9CH 4CR9A 4MPXA 1SPJA 1T32A 2A2XH 4B75A 2F83A 1N6XA 2TGAA 1A3BH 1O3DA 2A1DB 2PTNA 3T5FH 2YNAA 4BNRA 1ELGA 1TE0A 2LNCA 2VIOA 3SU3A 1CT4E 1YF4A 4ABIA 3Q3YA 1YCPH 2O9QA 3SU4A 1TNIA 3P8FA 1DANH 1W0YH 1MKXK 1A4WH 1MD7A 3A7ZA 3HK6B 1ELAA 1SFQB 1A2CH 2A4OA 2IJOB 2J4IA 3FZDA 4SGAE 2AMPA 4J1YA 1FLEE 3KN2A 2TGDA 1GI4A 3TPIZ 3P8NA 1QNJA 1ELVA 2FOEA 4QT8C 4XBDA 4LXBH 1UK4A 2F3CE 4B1TA 4E05H 1EPTC 2UWPA 3FVFB 3FKSD 3ZVDA 2FX4A 3VB6A 1LHDH 2B0FA 2QIQA 1PQ8A 2ODYB 3PRDA 3FN8A 1WQVH 2ZU1A 1K0HA 1HAGE 3GY5A 5C1YA 1T4VH 2Z9LA 1O2OA 3PLBA 1W13U 6ESTA 2KCAA 5GNDA 1CU1A 2VJ1A 3UOUA 2V3HH 1NRQH 3ZVEA 5L2YH 2PKSC 1BUIA 1JRSA 3GY8A 4MNVA 1ESBA 2C93B 3GY3A 5G4BA 3F68H 1XUHA 4XOJA 4ABBA 4B2CA 2H2ZA 3SQHE 1OHHD 4AZ2B 2CJIA 2FYRA 1W3CA 3FP6E 2WV4A 4BOHA 3S69A 1TAWA 2OC8A 4Y10E 3TJUA 4TPYA 2F9NA 2V6NA 3A81A 1N6YA 3LH3A 4OS6A 1KY9A 1JIRA 5E8EH 1ZMLA 1J15A 4ABJA 3MWIU 1BMAA 3PWCA 1GMCG 2R0KA 3ATIA 2AYWA 5CHAB 3RMMH 2F9OA 1O2XA 4H42U 1CQQA 1MU8B 2RA0A 1A0LA 1C4Y2 4D7FA 1Z8RA 4IMQA 1U6QA 2HNTC 1Z8GA 1SGYE 3TH2H 2HRVA 2XNDD 5HKKD 1AMHA 4YZUA 1BBRK 1J14A 2H9HA 1LPGB 1OYTH 2A5KA 2TGTA 2ZGCA 4I32A 1TNHA 1THPB 3E90B 5JB8S 1COWD 2GDDA 4DT4A 4ABAA 2A0QB 3OY5U 1YYY1 4WH6A 3K6ZA 1DE7H 5J4SA 3SUEA 5TJXA 2PWXA 3RLWH 3UWIA 4CRBA 2VWMA 1UK3A 1VITH 3UREA 1FMGA 2ZFFH 1DWEH 1V2VT 4ZKSU 3U8RH 2W7SA 1SSXA 2Z3DA 1Z7KA 3EQ0H 4NIWA 1XKAC 1NFWA 1TQ7B 1WDIA 1BIOA 1F5KU 3SU5A 2A31A 1O5FH 2BZ6H 1CA0C 2QV1A 2SGAA 1KMHB 2FI5E 1UVSH 3DT0H 1UVTH 4JK5A 5LPRA 1GBAA 2OXSA 1O2JA 1QR3E 2XXLA 2CF8H 1KXEA 1QZ8A 3EA7A 2ZTZA 4Q4LA 1KXAA 4TY7A 3PRBA 5A8XA 4X1QU 2W7UA 3ZZAA 4NIVA 1EPTB 3HPTB 1LQEA 3QK1A 2R3UA 3A88A 2AHME 1VCQA 2XWAA 1NN6A 1SQAA 4B71A 1VCPA 2XRCA 1LKBA 1LHCH 1TBQH 4X2YA 4X2WA 1KYNA 2JETC 4UFEH 3SGBE 2BDBA 3HGNA 1BZXE 3AASA 3GCTG 5LGOA 5EXMA 4AC9A 3IWMA 3VGCC 1GHBG 3WY8A 1O32A 1GI6A 3OX7U 2J34A 3KHVA 2FP7B 5A09A 1V2ST 1GJCB 2ANYA 2BQ6B 5EJLA 1QGFA 1QJ1B 1NY22 3SQEE 2C8YB 2B7DH 1GHYH 1O5GH 2O8WA 2ODQA 3OEED 3RUOA 3ZYEA 5AVDA 1E1RD 1UK2A 5EPNA 2FMJA 3RXSA 1P9UA 2F9PA 1XMNB 1V2LT 4MPVA 1TABE 3STIA 1ZZZA 1ELFA 2BY9X 2FDAA 4GAWA 3ZIAD 1BBRH 2ZA5A 1P03A 4RKOB 1XVOA 1G3CA 3B23B 2THFB 3PV5A 1TX8A 1K1IA 1YGCH 1P06A 1SLVB 2WYGA 2Q6FA 1INCA 3VFEA 2PR3A 3RU4D 3DA9B 5FPSA 1P2KA 2EC9H 1H1BA 1OWIA 2A5AA 4AYVB 3ATKA 3MNSA 2FOHA 1FX0B 1ZMJA 5T3HA 4D8NA 4CHAB 1ANCA 5A8ZA 3ZZ5A 1XXDA 1CGIE 3LKWA 3A7WA 2F9UA 3K6YA 4UFGH 1HDTH 1WV7H 3F0OA 1O2GH 1UTOA 4JYUH 4K60A 4ISNA 1O31A 1NU7B 4DT7B 1CA0B 3O8RA 2BD5A 1SGQE 1MH0A 3BG8A 3LT3A 1FXYA 2ZDVH 5EGMA 5EG4A 1YY3A 1C5RA 2BVRH 1Q31A 3DSGA 1P3EA 1YPHC 1G2MA 3RXHA 3SN8A 1Z1JA 4JZIA 5FBIA 1AKSB 1QIXB 2SNWA 1ZHRA 1IOEA 1QRXA 3OE7D 1CT2E 3UR9A 1PFXC 2QXJA 2GX4A 4CR5A 1XUIA 2BLOA 1GI8B 2WV9A 3NZIA 4BTIB 1Y3VA 1C5XB 2JETB 3DFJA 1P04A 8KME2 4B2AA 4NFEA 3GYLB 2FWWA 3RMNH 2G5NA 3T25A 3KGPA 1SHHB 2BD2A 3VGCB 3MMGA 1OKXA 1LHGH 5FPTA 4HG6A 1J16A 3SU6A 2FM2A 3D65E 3SJIA 3O8CA 1BBRE 3TH3H 5DK1A 3EA8A 2PKAB 4WY3A 1IQIA 4K2YA 4GCHG 1J17T 5DKMA 3AW1A 1XUKA 4HTCH 5HIZA 1HAPH 2M2AA 1UTPA 2KAIB 2UWOA 2XC5A 3SZEA 3VB5A 1IQJA 1IQEA 1GWAA 3P92A 3M7QA 4FUDA 4ISIH 2J38A 4Q7YA 2AH4X 5BPEA 2C3SA 4CRCA 3OSYA 1BT7A 1FY5A 1SI5H 2G4UA 1O5BB 1P0SH 1SKYE 2EA3A 3BTHE 4ISHH 1KSNA 1GBFA 1S6FA 2G51A 5E0HA 3DHKH 5JDUB 2ZDMA 4YOGA 3OTJE 2GZ8A 2HLCA 3ENSB 1NRRH 1SOZA 1O2HA 2O8MA 1SGNE 1EJMA 2ZDKA 1O37A 1GBDA 2BD9A 2OCVB 1HAZB 3QN7A 1SQTA 3KQCA 3RXKA 4AG2A 2UUJB 1FQ3A 1D3TB 1ETSH 4I8LA 1ZYOA 1SGTA 1T7CA 2UWLA 1SQRA 3MH6A 5C5NA 2ZU4A 2L74A
chains in the Genus database with same CATH topology
3AAVA 1RD3B 2SGPE 2BLVA 3EA9A 1LKAA 1C9TA 1C1RA 2GZ9A 1AKSA 1GVKB 1QL9A 3AAUA 4YESB 5FXLA 1QBVH 1T31A 3SO3A 3M3VA 1TQ0B 2ZHQH 4ZXYH 1ELCA 1NRPH 1TRNA 1YPEH 4FU7A 4A92A 2WUBA 1DX5M 4FUFA 1S83A 5IYTA 2Z6BD 4GSOA 5DP7A 2VIVA 4NGAH 1EAIA 3SJ8A 3W94A 2RDLA 4DVAU 4UFFH 8LPRA 2QCYA 2XBVA 2P3TB 1F0TA 1MKWK 4E06H 1QY6A 1SHYA 2BX4A 1K21H 3GYMA 5AF9H 5DO4H 1P02A 1MBQA 2PKAA 1CVWH 1FY1A 3M36A 3UNRA 1C5LH 3KL6A 1V2TT 2ZFRH 2ZIQH 1S6HA 2VGCC 3QO6A 1GI0A 2KAIA 1O2UA 1LPKB 2GGVB 2P94A 8GCHF 1MTVA 2ZQ2A 2R0LA 4NIXA 2FOCA 2Q1JA 4BXSA 1DSTA 1SGPE 1OWJA 1V2OT 1O3PB 1W14U 2XWBI 1ZPCA 3EAJA 2BVSH 1G3EA 3A86A 3UIRA 1LTOA 3H7OA 3RXUA 3PROA 4H4FA 2O8LA 3RLYH 3SW2B 1BJVA 2CF9H 1A5HA 2AGIX 1VZQH 2ZEBA 2VIPA 3SV8A 5DGJA 2C8ZB 4KTSA 1V2JT 2GKVE 1MBMA 2F91A 3JZ1B 1OWHA 4MTBA 1S0QA 1WSSH 2SFAA 1PPEE 2IN2A 2R2WU 2Z9KA 4Y8XA 1Y59T 1BMLA 1YPMH 3NK8A 3RM2H 2VH0A 2BXTH 5C1XA 1ACBE 2ZP0H 4YOIA 1P2IA 2NU4E 4KTUA 2C8XB 2F9VA 3RXTA 3ZZBA 6GCHG 3SV2H 2LPRA 4WXVA 1B7XB 3SOSA 4D9QA 2BD4A 1EX3A 1WU1A 4I33A 4Y0YE 1FY4A 1CO7E 4Y0ZE 3SJ9A 5EPYA 3MNXA 4J2YB 1TGNA 2EI8A 2BDCA 3PMAB 3NKKA 3I77A 4NSYA 3EYDA 2H6MA 1NT1A 1EZSC 1Y5AT 1HIAA 2DE8A 4A1VA 1EAUA 3MI4A 1TPPA 4CRFA 3ZZ4A 1AU8A 1BTPA 1UVPA 4D7GA 3SV9A 1BTYA 1ELTA 3SNDA 1XUGA 1F5LA 2ZO3H 1ZTLA 2ALPA 4UE7H 1EAXA 2SGQE 4WVPE 1NC6A 4YTAA 1E38B 3ZZ9A 2Y5GA 3T2NA 1A46H 1D4PB 1GGDC 3M7TA 1AIXH 1W8BH 1K1NA 2FLRH 1HAXB 4X6NA 4NZQA 5H4IB 2FPZA 1DFPA 3A80A 1L2EA 1S0RA 5HYOA 1L4DA 2BTCE 2Y81A 4X8UH 4H6TA 1PPZA 2FXRA 3URCA 2XCNA 1NTPA 3M37A 3MH7A 1CE5A 1PYTD 1P57B 3TK6A 4ZHMU 1HAVB 4ISLA 1SGFA 3TK5A 1DVAH 2UUFB 7GCHG 1QQ4A 1GMCF 4K1EA 1A5IA 1DOJA 1ZMNA 1NU9A 3PTNA 4X6MA 1C5ZB 3HKJB 3RXQA 2BD8A 4PROA 2GZ7A 3RMLH 4CH8B 4DJZB 3AVZA 4MNYA 3P8GA 3TGJE 2VWNA 1C2EA 3M61U 3ODFA 2ZPRA 1LPZB 1RJXB 2QF0A 1HRTH 3O8DA 1QA0A 3QGNB 4BANB 3PO1B 1GHAF 4TPIZ 3OU0A 3FP8E 1P10A 3S9CA 1IQFA 1FJSA 2XBWA 3S7KB 2C90B 5E2OA 3A8DA 1D3PB 1FAKH 1GBTA 4KP0A 3SORA 1HB0B 1ZGVA 3BIUH 2AIQA 2F9BH 3BF6H 5GWZA 1FNIA 2B9LA 2ZDNA 2ZPQA 1ORFA 4ZUHA 4K8YA 4YOJA 1VR1H 1G3BA 2BD7A 1O2TA 3VB3A 1DY9A 2BY8X 4Y11E 2VIDA 1GHWH 1O2ZA 1O39A 2Y5FA 4AB9A 2A2QH 1UJ1A 2WUCA 5T6DA 1NROH 2PFEA 1E36B 1TYNA 2FOMB 3D62A 4K1SA 2AIPA 3Q00A 3F6UH 4FVBA 4TY6A 1S85A 3ZZDA 2HGTH 1G30B 2ZCKP 2VNTA 2CV3A 3M3TA 3R0FA 4Y7BA 2ZU3A 1E34B 2FIRH 1T8OA 5F6MA 3L33A 3P8OA 1EAWA 3PTBA 3QZQA 1TLDA 4INKA 1ZJKA 1RTFB 5EODA 1J8AA 2ZFSA 1GGDB 4NIYA 1PPHE 1C4U2 4X2VA 4YLUA 3FAOA 3BEUA 2G5VA 1A7SA 1OP8A 1C2JA 1O5CB 1GHBF 3ATLA 1D6WA 1HAVA 1HJAB 4AFZA 1JWTA 1Z1IA 1IAUA 2NU2E 2HOBA 1FIZA 1HXEH 1V3XA 3A7XA 1ARCA 3HK3B 3RXEA 5A2MH 4R0IA 1GHZA 2ALVA 2Z9JA 3S9AA 2PTCE 5K0HA 1W7XH 2OINA 1FN8A 2HNTF 1TMUH 1EZUC 1F92A 1C5UA 1MTWA 1SVPA 2BOKA 1A3EH 1TWXB 1GG6C 3DUXH 1YLCA 1NESE 4BAMB 4ASHA 5B6OA 1MCTA 2ZGHA 3ESTA 5GCHF 1GI5A 2PSYA 2ZGBH 3NCLA 1AVXA 2BY5X 3RXAA 3QWCH 1BQYA 4WH8A 3BG4C 1BHXF 3ITIA 4NWKA 4MG3A 1SLWB 4GVUA 1ZOMA 4WXIA 3A83A 1IQKA 3G01A 3V3MA 1GI9B 1GMHG 1PQAA 1TOMH 4UEHH 3VXEH 1MD8A 2ZNKH 3A7YA 1V2KT 3QUMP 1N8OC 4E7NA 3A8CA 1UVUH 1YPKH 1GBEA 5GJ4B 5FAHA 1O2VA 3RXBA 2WV5A 1NM6A 4CRDA 3A8AA 1C5WB 2G52A 2R3YA 2CXVA 1DWCH 3PB1E 1O5AB 2PUXB 3PM3A 2O8TA 1UTMA 3UTUH 1MAXA 4RN6A 5EOKA 4AG1A 1MAYA 1MTUA 4ZKOU 1QCPA 5L2ZH 1KLTA 1O2IA 1ID5H 1THRH 3FFGA 6CHAC 4UDWH 1O3NA 2G4TA 1C4V2 1HFDA 3VEQB 1O2PA 1EOJA 3LGWA 3KQBA 5FX5A 1A5GH 3VB7A 4AGKA 1EASA 3L3TA 4ABHA 4ZHLU 4DY7B 1SB1H 2OP9A 4X6OA 2XCFA 3S9BA 1P2JA 1TPAE 2ZFTA 5FBEA 1HPGA 1RGQA 1S81A 4JYTA 2BQ7B 3NPSA 2PKSB 5BRRE 5GDSH 2PHBA 4NFFA 4GCHF 3Q3KA 3E8LA 1THSH 1BRCE 2HPPH 1ZTKA 1GMDG 5JPMH 1AWHB 3O8BA 3UOPA 2QGRA 3RC6A 4SGBE 4Y79A 1UTJA 1GG6B 2ESTE 1UCYH 1VITG 1MTSA 1EOLA 1ANEA 2Y6TA 4WMFA 1IHTH 1FY8E 1Z8JB 3LDXH 4D9RA 1GJ7B 4B73A 2ZTYA 5T6FA 2VVVA 2FTMA 1O3CA 1SGIB 1XUFA 2QA9E 3BG4B 2A5IA 1FV9A 2HVXA 4MNWA 2NWNA 2WPLS 5JBBS 2AGGX 3GY4A 2XYAA 1BTUA 2ZFQH 1C5QA 5DP6A 3QLPH 5GXPA 1GBLA 1LQDB 4LK4A 3RXDA 1DWBH 2ZHFH 3SJOA 3H5CB 5I46H 1QTFA 2ZQ1A 3P70B 5ABWA 1ZRBA 3I29A 1ABJH 2FZZA 4CRGA 1TRMA 3BTQE 1C1MA 2FOFA 3S7HB 1FAXA 1BHXB 4FVDA 1TGTA 2FYQA 2XBXA 1X7AC 3RMOH 3ZVBA 1JXPA 1RXPA 1T8LA 3PLPA 4IMZA 3RXJA 1ZGIA 2GCHG 3BEIB 3AW0A 3TJNA 5F03A 4Q80A 3H7TA 3E91A 3RXMA 1ZPZA 4WWYA 2FOGA 2OUAA 3LJJA 4OS7A 1UTKA 2QN5T 3LC3A 1RS0A 2BX3A 1EPTA 1TNLA 1DXWA 6CHAB 4GPGA 3TITA 1DT2A 1WOFA 3BTDE 1AGJA 2BMGB 3ATMA 2EI6A 3E0PB 4X8SH 3RP2A 1L1NA 1WAYB 1H9HE 2ZDLA 4INHA 1OS8A 4MPUA 4A7IB 1AB9C 3LONA 5F8TA 3KNXA 1MQ6A 1AY6H 1TGCA 1QL7A 3ELAH 2R2MB 4Y7AA 4YT7H 5ESTE 1ZTJA 1O34A 1Y3YA 1MUEB 4OGXA 1AFQC 1K1LA 3RU4T 1FI8A 3UPEA 2HALA 5DP8A 1YKTA 2PLXA 2XBYA 4DW2U 4MVNA 4DURA 1F2SE 3T62A 2ZTXA 4MNXA 1OSSA 5DP4A 3ZVCA 1C5MD 4U30A 4LOYH 1CBWC 1K9OE 3URDA 1PYTC 4FUEA 2EI7A 4CBNA 2GCTC 1GBJA 1ZSKA 4AYYB 1GJ5H 3M3SA 1EATA 1XX9A 3M5MA 3A7TA 4DIIH 5DP5A 1DPOA 4BAQB 3SV6A 5JBCS 2ASUB 3LH1A 1CGHA 5AHGH 3TIUA 4U01A 3MU4A 1O2QA 3PV4A 3UY9A 1PPBH 1QBNA 1GJAB 2V35A 3LIWA 1D6RA 3HATH 2NU3E 3MNCA 1KXDA 1TNJA 1B0EA 4YT6H 2H9EH 5FHTA 2ZG0H 3KQDA 1FONA 6GCHF 1GBHA 1O5DH 4X0WU 1O3HA 3RXOA 3GCNA 5JBAS 3JZ2B 1GJ8B 1QA7A 1B0FA 1M9UA 5GPIB 2W3IA 1WTHD 2FI4E 2OBQA 2Y80A 1TRYA 1ETRH 2J95A 3BTEE 1HXFH 7KMEH 2P3FH 4Q2KA 4ABFA 2Y82A 1K2I1 4INLA 1FN6A 3KF2A 5EXNA 2TGPZ 3SUFA 2BY6X 4KGAA 1GBMA 1QURH 2OQUA 5HXFA 5A0AE 4ABDA 1O2RA 4IN1A 3T27A 3ODDA 1C5VA 1C9PA 5EQSA 3MU8A 2BLQA 2ZC9H 1HLTH 1O3MA 4I8KA 2QXIA 4TWYA 3ZV8A 3M5OA 2M5TA 1HJ9A 2O8UA 1QJ7B 5L6NH 1OWDA 4XDEA 1LVYA 1AFQB 1RFNA 1G2LA 1TNKA 3K65B 4MPWA 1W10U 1WYKA 2ZHEH 1Q3XA 2ZHDA 3RXVA 3ZZ6A 4NSVA 1TBZH 2A7JA 2FX6A 1GJDB 1EUFA 2VVUA 7GCHF 1PQ7A 1LVMA 1BA8B 2SNVA 1PJPA 1O3GA 1IQLA 1GI1A 3D49H 4ZH8A 2BB4A 2ZZUH 1EP6A 2FLBH 2ANKH 2BD3A 2ZCLP 4ABGA 4MDSA 4X2XA 2A7CA 5FCKA 4HZHA 3CS0A 4ZKRU 2Z3EA 3E0NB 1P12E 1F7ZA 1F0UA 4DCDA 1V2PT 1KXCA 4X6PA 1MQ5A 1JBUH 2ILNA 3SZNA 4TYDA 3ZVAA 2GDEH 4FUCA 2ZFPH 2XC0A 1AWFH 1LMWB 2P59A 2NU0E 1QRWA 1LHEH 2QF3A 1DITH 1O3BA 2VB0A 1K28D 1TB6H 3GY6A 3ZV9A 1AZZA 1YPGH 3SI3H 3OY6U 5EQRA 4XBCA 1QRZA 1W12U 1D3DB 3RXCA 2JH5D 4KELA 1ESAA 1P05A 1P8VC 4IN2A 3UNQA 1CHOG 3SHCH 1C1NA 1O3EA 4X1SU 4K1TA 3BIVH 5C20A 1WUNH 4JMYA 4ABEA 3KIDU 5SGAE 3LGYA 3RC4A 1BTXA 2Q6GA 1KIGH 1C2IA 2A4RA 3HKIB 2P93A 1SR5C 1DWDH 1O3IA 3M35A 1ZJDA 2OBOA 4FUBA 1FPHH 1B5GH 1BRAA 3U1IB 2UUYA 2H5CA 3F9FA 4UD9H 3QZRA 1GBCA 1O2SA 1W11U 1H9IE 5C1UA 5LPEA 3P6ZB 1V2UT 3QGJA 2I6QA 2Z9GA 5A8YA 1EB2A 1SG8B 4AFQA 4O03A 4MQAA 2WINI 2G81E 3BN9A 3QX5H 1MZDA 3F9GA 1C1TA 1NO9H 1C1OA 4O3UA 2RA3A 3MHWU 5CE1A 3IG6B 1ZHMA 2W5EA 1G36A 2J9NA 1UMAH 1P2NA 2D8WA 2FOAA 2SGFE 5HGGA 4WMEA 1XM1A 3TU7H 1BJUA 4X1PU 3RDZA 4ZHAA 2K1QA 2VGCB 2W26A 1GCTC 1SL3A 1GHVH 3VPKA 1DY8A 2ZKSA 3K9XB 3MO9A 2VVCA 3M5NA 4A1TA 5LPFA 2VH6A 3ZVFA 3LGTA 1BTWA 3ZZCA 1S84A 2D2DA 1A0HB 2FTLE 3TJOA 2ZCHP 2J2UA 4NWLA 1BTHH 8ESTE 3CP7A 3W95A 1AE8H 1EJAA 2JH0D 1MCVA 5GIBA 4Y71A 1IHSH 3BTKE 3PYHA 1C2DA 1Z71A 1V2NT 1EZQA 1MTNC 4BAHB 1C1PA 1LCYA 1T8NA 3TGIE 1H8DH 3UUZA 2GT7A 3SNEA 5AFYH 5FCRA 2CMYA 1TA6A 3GY7A 2BHGA 2WPHS 1JIMA 4Q7ZA 4DIHH 1LVOA 3RXFA 1QQUA 3UWJH 1FZZA 3LPRA 4E7RG 1ANDA 4MLFB 1O30A 4WJG2 1KDQB 4A6LA 1K1MA 2ODPA 1O2NA 1HYLA 5DG6A 3PMBB 3LGIA 2ZU2A 3TH4H 4HFPB 1Y3XA 3M5LA 1HJ8A 2OD3B 1NFUA 4YLQH 4D76A 1A1RA 2QAAA 1ARBA 1HGTH 1VJ9U 1G3DA 4XFQA 3VXFH 5EW1H 4R8TB 4B74A 2FEQH 3T29A 1SMFE 3RM0H 1OWKA 1AVWA 1K1OA 3C27B 2ZI2H 1QB9A 2BZAA 4FUJA 2ZF0H 4O3TA 1E35B 2C8WB 1OPHB 1WCZA 4H6SB 1ETTH 4UONA 1O38A 3GCTF 1GDUA 1PPCE 3BTFE 5F8XA 4BAKB 4CH2B 5K7RA 4Y6DA 1GMDF 4IW4E 3MO3A 3E6PH 3SV7A 1V2QT 3BEFB 5A0CA 1C2MA 1VITF 4XE4A 1GCTB 1TFXA 4KKDA 4DGJA 3EGKH 1ELBA 1JMOH 1NFXA 1P9SA 1PPGE 2H5DA 4FUIA 1W0ZU 4JYVH 1SOTA 1BOQA 3NWUA 1PPFE 2AERH 2HPQH 4F49A 5C5OA 4A1XA 1SBWA 2BY7X 4RKJB 2JKHA 2D26C 1HBTH 1TPOA 2ANMH 4O9VA 1SC8U 2GV7A 1GI7B 5TCAA 4FUGA 1C2KA 2AMQA 1GVLA 3U1JB 2EEKA 3EE0B 1UCYK 4BTUB 1P2MA 2A7HA 1WTGH 3RXPA 2PV9B 1L0ZA 4HGCA 2Z94A 2VWLA