5C67A

Human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-3
publication title Combinatorial protein engineering of proteolytically resistant mesotrypsin inhibitors as candidates for cancer therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hyrdolase/hydrolase inhibitor
total genus 57
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5c67A02
2W5EA 2FLRH 3LPRA 2FX4A 2SGFE 3OY6U 4K3JA 2BXUH 1PQ7A 1C2DA 1SQOA 2SGDE 2RCEA 3KF2A 1A0LA 2ZDLA 2PWXA 1V2PT 3MU4A 1UTNA 1TNJA 3ATMA 2GZ8A 1L1GA 1FPCH 1K1JA 1TIOA 1W14U 2FLBH 1IOEA 1W3CA 2XBWA 3O8DA 4X8SH 2VH6A 2FX6A 1GI9B 4CHAC 4I8KA 3TIUA 1HIAB 1C4Y2 2G4UA 1F0RA 2BY9X 3D23A 3TITA 3T29A 3L33A 1P2KA 2HGTH 1SGYE 3M5LA 4DOQA 1LVOA 3RC4A 5LPFA 5EXLA 2TGDA 2O8WA 9ESTA 2WYJA 3PTBA 1C5WB 4X2WA 3STJA 2FDAA 1H8DH 2HWLB 4GHTA 5K7RA 2SGAA 1F5KU 1WQVH 2B5TB 5EODA 4ZKOU 2O8MA 1ZTLA 2XCFA 2ZGHA 3S69A 4E05H 1A4WH 1BRCE 3GYLB 2ZU1A 4X6NA 2BVRH 3ZV9A 1QTFA 4XBCA 3EAJA 3M7QA 2PTNA 4FUFA 3RXVA 5AF9H 1C1MA 1SGNE 1TPSA 1ZRKA 5DK1A 1YPJH 2H5CA 2ZPRA 1NRPH 2OTVA 1SSXA 2ZZUH 1LVYA 5DKMA 3A81A 1QB6A 2QCYA 4XFQA 3RP2A 3DFJA 2TGTA 4Y8XA 1SGQE 3SV6A 3SUDA 1DICA 2FYQA 3E16B 1NM6A 1XVOA 1Q31A 2ZTYA 1XUJA 2A2QH 1RTFB 2GMTC 2HPQH 2RA3A 1BUIA 1VZQH 3P8GA 1PPGE 2A4GA 1O3KA 3GY3A 3A87A 4CR9A 4BAKB 4FUEA 4JZFH 2P59A 1YM0A 3UR9A 3K6ZA 1GCTB 1GI4A 5TCCA 4OS1A 1DY9A 4X2YA 3ZVGA 4CRFA 4KTUA 1K2I1 4SGAE 2FIRH 2WPMS 3RXRA 1A5GH 1LHFH 1GJ5H 3EA7A 3SI3H 3SNCA 1QURH 1YLCA 3U1IB 3F68H 2ZHFH 6LPRA 3MU1A 1MZDA 1G9IE 4AFQA 3KNXA 4HI3A 3SN8A 2C8WB 2Z9KA 2VGCC 4DY7B 1DUEA 1ELEE 1AN1E 1SQAA 4Y7AA 4K8BA 1O2MA 3TJVA 2BD8A 2QXJA 1CT4E 3N7OA 3ZZ5A 3AASA 4CH2B 1WYKA 4AG1A 1LQDB 1EJMA 4TPYA 2P3UB 3ZVFA 4YTAA 1EXFA 1FIWA 4OS6A 4Y11E 1EX3A 1W12U 2ZU3A 4CHAB 2DE9A 2QN5T 2P3TB 4E7NA 1ELVA 5L30H 1TRMA 2O8TA 4MLFB 3U9AH 2PV9B 1MAYA 1TA6A 4FXGH 4I8LA 1AD8H 2WINI 3MH7A 1YC0A 3A7VA 6CHAC 8KME2 4YOIA 3TNTA 1DWBH 4BANB 4JYVH 2GV7A 1O33A 3TK9A 4Y71A 1AZ8A 1YF4A 1CGHA 1GI8B 1LKAA 1NPMA 3BEUA 1FY3A 3P70B 1O3BA 2VIOA 1XM1A 3CS0A 1BT7A 2R2MB 4AYYB 3ESTA 4BTUB 3EA8A 1G30B 4ZAEA 2BD5A 4RN6A 2ZDAH 3BTWE 2PR3A 2M5TA 2AEIH 3LJOA 2A7JA 3MWIU 4H4FA 1GBIA 3E3TA 1CGIE 1HAIH 2P95A 2FS8A 3E0PB 1DXPA 2GMTB 3AVZA 3MNCA 2BTCE 1E35B 2ZHQH 1Z6JH 1BMAA 4FU9A 2XWAA 4KKDA 5C1UA 5EW1H 1BTXA 4AN7A 1ETTH 1Y8TA 3SU0A 2FOHA 1L4DA 1OP8A 3GY6A 3LGTA 2SNWA 3A89A 2I6SA 3RMLH 1C5LH 1P02A 5CE1A 1O39A 2OCVB 2ULLA 2Y5FA 4DIHH 2VGCB 1DVAH 2HLCA 2ZGCA 1SMFE 1WQSA 4A1TA 1BBRK 4ZXXH 1JRSA 1BQYA 3QX5H 1QL7A 1CHOF 3BTHE 3M36A 4FUGA 1THPB 3RXGA 3V12A 2H1UA 1JOUB 5BPEA 1A2CH 2BDYA 1O2GH 3GCTF 1BB0B 1TNGA 1DWEH 1PPEE 3SJ9A 5DP8A 2WV5A 3SOSA 4WJG2 1Z1IA 1P8VC 1N1LA 4D76A 2GTBA 3VFEA 1IAUA 1V2TT 4NFEA 1F5LA 4K60A 2ODPA 5F8TA 5TCAA 3VXFH 1WBGB 3ATKA 1V2WT 4X1NU 3ZVBA 4Y8YA 4I8HA 5FPSA 1LDTT 2G51A 1C1VH 2BY7X 1GHBF 1ZRBA 3SNDA 1GBKA 6CHAB 2QV1A 1SVPA 1D4PB 1P3EA 1N6XA 3LC3A 4QT8C 3SUFA 1B0FA 2WUCA 1YPEH 5T6DA 3FP8E 1EB1H 1AUTC 2B7DH 2ZCLP 3BTKE 1FY8E 2UUYA 2ZGBH 2Z3CA 1FONA 2P94A 1T32A 3KQEA 3ENSB 1O2XA 1F2SE 1YKTA 3PB1E 3P17H 5FPYA 4E7RG 1LHEH 1EZUC 1EAXA 4AZ2B 3ZZ8A 1IHSH 2VVCA 1NY22 1YCPH 1HNEE 2HALA 1K22H 3LGYA 1FUJA 1L4ZA 2ZPSA 3KIDU 1SC8U 1KSNA 4MTBA 3GY5A 3ZZ6A 5AFYH 2BLQA 3A7ZA 4Q80A 1OWKA 2V3OH 4DJZB 4X8TH 1TBRH 2B9LA 2IJOB 5T3HA 1O2KA 1IQLA 4ISLA 1ESAA 1NRQH 1E38B 1O5CB 2Y82A 1Y3VA 4TY7A 4F4OC 2ZECA 1FAXA 1SFQB 2C93B 2VIVA 1NO9H 1O2VA 2BD9A 4WWYA 3MU0A 1DWDH 3O8BA 4H6TA 1T7CA 1TBZH 1LQEA 1P2IA 5C5OA 1V2ST 1EZXC 5IDKA 1GI7B 4MNXA 5DG6A 3Q3YA 2BQ7B 2F83A 1TOCB 1XKAC 1NT1A 1GJ9B 1FAKH 1GL1A 3RLWH 1C2MA 1DPOA 1P2QA 2BVSH 2HVXA 1GI5A 5T6FA 1G2MA 1EZQA 2QYIA 1QJ1B 1FNIA 1K21H 1O3EA 3VB6A 3FVFB 5GDSH 3RXJA 3ZVAA 4ZUHA 1ANBA 4GVUA 5F03A 1HCGA 1O3FA 3LONA 2RDLA 4FUBA 3S9BA 4Q2KA 4AGKA 1NC6A 1A7SA 5JB9S 1NN6A 4WMFA 2XBXA 2VNTA 1NROH 3ODFA 3RMNH 1ZHRA 3SQEE 1O2TA 2C3SA 1PPHE 1FY5A 1P2OA 2V3HH 1SGRE 4K5ZA 3NZIA 1BMLA 3SORA 3EQ0H 2GDEH 2VIDA 1C2HA 3TGJE 3B8JA 3E90B 3U8TH 2A4QA 2F9NA 1WAYB 1T8OA 2F91A 1IQKA 2G52A 5DP6A 3SGAE 3V7TA 4Y7BA 1MZAA 3CP7A 8LPRA 2BLOA 1CBWC 4JZEH 5C2ZA 1ANEA 5HGGA 1O3CA 3BSQA 1RTKA 3QZQA 4FUHA 2GCHG 3PLKA 3RXBA 2OQ5A 2BQ6B 4GHQA 1IQJA 1AY6H 1HRTH 4CRBA 2ZFSA 4UDWH 1TMTH 1ACBE 3GISB 1OYQA 2G55A 2ZI2H 2VWLA 1D3QB 2BXTH 3DA9B 4XDEA 3A7WA 1O36A 2Y7ZA 5E8EH 1T31A 3TJOA 2HOBA 4FUDA 1V2VT 1GHAF 2BLVA 1ZR0A 2XC5A 3A83A 1O2ZA 3MH4A 1SOZA 2C8YB 1V2NT 1MTWA 1MKWK 1LPKB 4NIWA 2Q6DA 1LVMA 1XUKA 1SGPE 2QF0A 2WUBA 3A7YA 1TGBA 1HYLA 5EU8A 1ZPCA 2O9QA 2FOAA 1ORFA 4Y79A 2CGAA 2VIWA 2PKAB 4YLUA 1GVKB 2EC9H 4FVDA 1KTSB 2THFB 1FIZA 5HXFA 1CA0B 3O8CA 3D49H 4DT7B 2GZ7A 1DLKB 4ABJA 1LHDH 3RUOA 2FTMA 4FUCA 3HPTB 4WF8A 2FESH 1O2QA 5A8XA 1TMUH 3PMJA 3UR6A 2VU8E 1IQHA 1EATA 1YPLH 1HJAC 3QWCH 4H42U 1ZOMA 2BD7A 2BZAA 3SNAA 2D2DA 2ZFPH 2HNTC 1GI0A 3M3TA 1G3EA 1D3TB 4K2YA 1H4WA 1QCPA 1Y5UT 1AQ7A 2VWNA 2STBE 4NIYA 4X6OA 5GXPA 1F0TA 2BB4A 2H9HA 4ABIA 4NIXA 5FCRA 1EPTA 1XUHA 1T8LA 3SZNA 1LO6A 1VJ9U 2J95A 2ANKH 2UUFB 4A5TS 1MQ5A 3DUXH 2YNAA 3UOPA 1YYY1 3CS7A 3K2UA 4U30A 2AIQA 1MTUA 1A5HA 1Y5AT 2PUXB 3T26A 1EAIA 3UFAA 2NU3E 1BTYA 1M9UA 4YT7H 1O2HA 1B5GH 4J2YB 2WV4A 1UHBA 1QL9A 2G81E 2V0BA 1ESTA 1O2SA 1C5UA 1CBWB 2XRCA 3RXFA 1BMMH 4MPVA 2A4RA 2BDAA 1P03A 1B0EA 2F9BH 5AHGH 1RRKA 2TBSA 1QBVH 2A1DB 4ABFA 1ELDE 1O5AB 1X7AC 3O8RA 5K0HA 3TGKE 5A8ZA 3TJUA 2AFQB 2F3CE 1BJVA 5FXLA 8GCHG 3SU6A 1GHZA 1GJAB 4PROA 2YOLA 5DPAA 2QAAA 5GPIB 3F1SB 2AS9A 3ODDA 3OX7U 3V0XA 1W2KH 2R3UA 1CT0E 1CVWH 1PYTD 1C1NA 1IQEA 1BJUA 3LOXA 3ZVDA 2GT8A 1RD3B 3SO3A 1OYTH 3DT0H 1V2LT 4B2CA 5C1XA 3P8FA 4ZROA 2Q6FA 1O3JA 3TJNA 2R0LA 1YCPM 1GVZA 2P93A 4GUXA 4UEHH 5GIBA 1IQGA 4FUJA 1GBBA 4AB9A 2G8TA 1GBFA 5CMXH 4NIVA 2DE8A 1G3CA 1L2EA 1GBJA 1S85A 2ZCHP 8ESTE 4Q7YA 3E8LA 1E36B 3VB3A 4ZHMU 1O2PA 1QA0A 2XC4A 1TGTA 1K1PA 3Q76A 4FUIA 2VIQA 2UWPA 2ZFFH 1HJAB 1LMWB 2Q1JA 3NUMA 1AB9C 3SJIA 1AVXA 3SGBE 1IQMA 3IG6B 1D3DB 5HMAA 2W3IA 2H5DA 3NCLA 1C1OA 3FZDA 3MH6A 1DANH 4X1QU 2KAIB 2UUJB 2BM2A 1XUIA 1O2OA 1AFQB 3TH3H 2WYGA 3ZZ3A 1OPHB 3LH1A 1HIAA 1LPGB 3PMHB 4XE4A 5FX5A 2ZU2A 2PW8H 5JBAS 4CRGA 1SLXB 3P6ZB 3MO9A 4DVAU 1OP0A 1GHXH 1K1NA 1Y3YA 3UUZA 3SJ8A 4K8YA 5F8ZA 2AIPA 1HAVB 3RXAA 1E34B 1W0ZU 2ALPA 3HK6B 1GDUA 1SGCA 1SL3A 2H2ZA 3A8DA 3BIUH 3RXTA 4NA8A 1QBOA 2AERH 1O5GH 3GY7A 1W11U 3STIA 3SJKA 3SV2H 2ZQ1A 2G4TA 2J94A 3A80A 3M37A 3HATH 1VCQA 3NKKA 1H9LB 4OGYA 5J4QA 1C1UH 1NS3A 2FZZA 2A5AA 2TGAA 2ZU4A 4UE7H 5T6GA 1O2RA 1S6HA 2Y6TA 4YZUA 2A0QB 2W7SA 5B6OA 2Z3DA 1NESE 1O5DH 3BTQE 5PTPA 1FN8A 1AVGH 5JYIA 1GDNA 3RXUA 1OSSA 1EOJA 1QA7A 1FI8A 1A1RA 4X8UH 2OC7A 1O3MA 4O9VA 3ZZ9A 2R0KA 3BEFB 4IC6A 2CXVA 2ZDNA 2XBVA 3K6YA 4GPGA 1GBDA 1KLJH 5DGJA 3KQBA 2A32A 4LOYH 1FPHH 1ZZZA 1O38A 2ZFQH 3GY2A 4IN2A 4WH6A 4INKA 1RXPA 4ZXYH 1PQ8A 1K1IA 3UQOA 2ZIQH 4BAHB 1JXPA 2FI5E 1EUFA 1UTMA 5EG4A 2AGGX 1BRAA 1UCYK 2BD4A 2PKSC 3RU4T 2FWWA 3UWJH 1P9SA 3JZ2B 1HB0B 1C1TA 1TX6A 3GCHC 1DWCH 1O34A 1AB9B 2J9NA 1DXWA 2EI8A 2BDIA 4O3UA 2OC0A 3P92A 3T62A 3EA9A 1G32B 4AG2A 1D6WA 1HAZB 4Y10E 1HXEH 2FI3E 1IQFA 1WCZA 3HKIB 1DLEA 1SGEE 4TWWA 4UFDH 1V3XA 3KN2A 3RC5A 2FOMB 2ZHWH 4HZHA 1V2MT 2XC0A 4GAWA 1BITA 5E0GA 4BAOB 1Z8GA 1G37A 5LGOA 3SI4H 3H7OA 4A1VA 4Y6DA 1OOKB 4U01A 1L1NA 4AB8A 4IW4E 1JBUH 4MPWA 1N8OC 5CHAC 5L2YH 5G4BA 1F0SA 2J2UA 2OUAA 4Q7XA 2FMJA 3NPSA 3T27A 1TNIA 2ZP0H 3ZZCA 1EKBB 2C8XB 4ABGA 5A0AE 1QJ6B 4CH8B 2ZWLH 1C2FA 7GCHF 2IPHA 1DX5M 9LPRA 2BYAX 3QZRA 3V13A 1SGDE 1UK4A 1TQ0B 1A46H 4FU8A 3PM3A 3QGNB 1C5ZB 1MKXK 1DE7H 2A4OA 2BVXH 4HFPB 2EI7A 1AWFH 1GDQA 4OS5A 5EXNA 3ZVCA 4AORA 1QBNA 1DFPA 3RC6A 1Z6EA 1ARCA 3UIRA 2XTTB 3W95A 3ZV8A 3HKJB 1KXAA 2ZKSA 3PV4A 3QTVH 1EZSC 1P2NA 1EASA 2ZNKH 1D3PB 2UWOA 4ABDA 1AU8A 1Z1JA 3MHWU 4NZLA 3URCA 5JDUB 3DHKH 3F6UH 1O32A 1TGCA 4MPXA 4JMYA 3L6PA 1C1QA 2A7CA 1KXCA 1V6DA 1ANDA 1ZJDA 3PLPA 1KXBA 3LDXH 2DUCA 4BOHA 1G3BA 1SI5H 2WPHS 1ABIH 3V3MA 1PQ5A 1MTVA 1KDQB 1THRH 1O0DH 2NWNA 1NRNH 3BTME 1BTHH 2WPKS 3RXQA 2GZ9A 1QR3E 3W94A 2F9PA 2PKSB 1GMCG 1SGFA 4X6PA 3PWCA 5JPMH 2BOKA 4UONA 1O2NA 1RGQA 3GCNA 4ABEA 2W7UA 4AOQA 2GDDA 2FODA 3K9XB 4KELA 1S6FA 3SGQE 2BY5X 3GCHB 5DP7A 1Z71A 2BDHA 4J1YA 1PPCE 2QXGA 1O3HA 3Q00A 5L2ZH 4KTCA 3S0NA 3FANA 1HAHH 4BNRA 4B1TA 2QA9E 4E06H 1P01A 1P2JA 1O31A 2OXSA 3KHVA 5TJXA 2ZCKP 1GBCA 3KQDA 3LT3A 1AVWA 1SBWA 3RDZA 3MO3A 1GJDB 1QB1A 4O03A 1Q2WA 1TPAE 2C90B 3SUGA 1MKXH 1P10A 1QFKH 4JK6A 4O97A 1BBRE 1EP6A 1N8OB 5CHAB 1GHWH 1V2RT 1TABE 2SGPE 1CO7E 1XUFA 2CHAC 1BBRH 1DDJA 4NZQA 3SHAH 4I31A 2STAE 1QQ4A 2NU0E 2OQUA 1Z8IB 1JWTA 2ZDMA 2GGVB 3QTOH 1ZPBA 1K28D 4MG3A 1HV7A 2GX4A 5E0JA 2VVVA 1O3IA 2QY0B 1E0FD 2RG3A 2Z9GA 1NTPA 1RJXB 3SHCH 1WV7H 2XXLA 3S9CA 3PO1C 1IHTH 2TPIZ 4ESTE 2IOTA 2CF8H 1RFNA 4SGBE 4JZ1A 2ZPQA 2Z94A 1ZJKA 3E6PH 1VCWA 4YO9A 1VITG 2R3YA 4GCHG 5FAHA 1C5YB 1SGIB 1BZXE 2P3FH 2Y5GA 4JYUH 4MNWA 6GCHG 4LZ4B 5ETXA 1UTJA 4YESB 4MNYA 3ZVEA 1XXFA 4AYVB 1UTKA 1HPGA 3FP7E 1P0SH 4THNH 5FX6A 2BD3A 4R8TB 1S81A 3VEQB 5E2OA 1WTHD 1TRNA 1AE5A 2SNVA 4A7IB 2WPIS 3VXEH 2TGPZ 1ABJH 1CA8B 1P09A 2OBOA 3BG8A 3T28A 1AUJA 1AKSB 1C5RA 1QGFA 3ITIA 3GYMA 2H9TH 1OX1A 1O35A 3LKWA 3MFJA 2LPRA 1GMDG 2SGQE 3MI4A 1KYNA 4D9QA 4B2AA 2ODYB 1HJ8A 2BD2A 1EJNA 1MBQA 1TOMH 7ESTE 2G5VA 3BN9A 1BTWA 4GSOA 4TY6A 1ZSJA 1SR5C 2SFAA 1O30A 1EQ9A 1C5QA 1YPHC 4JCNA 2Z6BD 2PSYA 4YLQH 3KQCA 5GJ4B 3TH4H 4BTTB 2XW9A 3VPKA 1GBLA 1GMHG 1SFIA 2BX4A 1YPKH 1ZHMA 4B71A 1ESBA 1ELAA 1S84A 1CQQA 3RXLA 2D26C 3LGUA 4AFSA 1PJPA 1TGNA 5C20A 1D6RA 5E2PA 2FOFA 1XX9A 1Y59T 5JBCS 2NU4E 2QXIA 2XCNA 4Y0ZE 1C2EA 1QIXB 2CF9H 1P9UA 1OWIA 1MD7A 3M7TA 2ZQ2A 4NA9H 5A09A 3JZ1B 2H9EH 4XBDA 3U98H 4ABBA 4B74A 2CHAB 1V2UT 2JH6D 1W10U 1ZHPA 4D7FA 1TNKA 1TE0A 3TLOA 1OWDA 5DP3A 5L6NH 3P95A 2ZU5A 5A0CA 1SLWB 1QRWA 1T8NA 3F9HA 1J15A 1TB6H 4A92A 1MCTA 1SPJA 1RIWC 4B75A 4MNVA 4Y76A 2J38A 3UTUH 3GCOA 3VB5A 3PO1B 1TX8A 1K1LA 3QUMP 1NFXA 1BRBE 1TRYA 1GI2A 1C5XB 1GG6C 4XSKU 3RU4D 3U8OH 1W0YH 5GCHF 2BQWB 3A86A 4INHA 4D7GA 1SG8B 1KXFA 1GHYH 4ISHH 1HXFH 1UO6A 2D8WA 4RSPA 4IS5A 1GPZA 4KTSA 5ABWA 2Y80A 1QRZA 1UVUH 5EW2H 2EA3A 2VINA 1N6YA 1C1SA 3RXCA 1Y3WA 3BTFE 1SHHB 1P05A 2AMQA 3L3TA 3TGIE 1VCPA 2ZGJA 1V2JT 2ZG0H 2Z9JA 3M7UA 3KGPA 2FOGA 1CHGA 3A88A 4MVNA 2HNTF 4Z0KA 5EQSA 2TRMA 1BTPA 4AFZA 4D8NA 4ISIH 3GICB 4HGCA 3PMBB 1C5TA 2ZHEH 2BDBA 1YP9A 1C4U2 2OC8A 1OKXA 3UNSA 3Q77A 1C5NH 1UVOA 4CBNA 1S82A 2QF3A 1TYNA 1WUNH 1ZYOA 3UNRA 1MUEB 1BOQA 1GGDC 2PFEA 2ANMH 1O2UA 1GJ8B 1HUTH 4NSYA 2ASUB 1GHVH 1H9HE 2UWLA 3MU8A 4YM9A 1JIRA 3SU5A 1ID5H 1KLIH 3UQVA 1TA2A 2HPPH 2FOBA 4LZ1H 4CR5A 1P11E 4K69A 1O2WA 3K65B 3VGCC 1Y3UA 3E1XB 1MKWH 1VR1H 1ZPZA 3SU2A 3QN7A 1O3AA 3D62A 3T2NA 4RKJB 3URDA 2VB0A 1A3EH 3R0FA 3NWUA 5EQQA 1GJ7B 1O3PB 2UUKB 4CRAA 2VJ1A 1BMNH 2FS9A 2K1QA 2BOHB 3EGKH 1AWHB 4WXVA 1QY6A 2ZDVH 1QL8A 1TAWA 4UFEH 1AMHA 1C2LA 3Q3KA 4ISNA 1C5OH 3FFGA 3C1KA 1SOTA 3ATLA 3VB4A 3RMOH 2FOEA 1QNJA 1TMBH 2JKHA 2XBYA 4ASHA 1BCUH 1VITH 3KCGH 1RIWB 3P8OA 1C1RA 1CSOE 4H6SB 3LIWA 3EDXB 1YLDA 2NU1E 3S7HB 5DP9A 1ELTA 4WMEA 4IBLH 8GCHF 1YPMH 1GG6B 1C4V2 5EGMA 1HFDA 3H7TA 1Q3XA 4WVPE 2ZC9H 3MH5A 4LXBH 2GVFA 5FBEA 1TLDA 3MTYA 1YPHE 3M61U 4BXSA 1CU1A 1GJBB 1BHXB 2BY8X 1DOJA 2Y81A 1F5RA 1BRUP 3BTDE 3ZZDA 1TNHA 4A1XA 1P06A 1EOLA 1C2IA 2F9OA 1DT2A 4UD9H 1C1PA 1CGJE 1HGTH 1GCDA 4ZH8A 1P2MA 4ZHLU 3MOCA 3LC5A 3SU4A 2OINA 2H6MA 4X1RU 5AFZH 1NFWA 4NG9H 4ZMAH 1S0RA 1DUAA 1AHTH 2EI6A 5F8XA 1SQTA 4ZKSU 1QB9A 4INLA 2XNIA 4UFFH 4MQAA 3LJJA 2ALVA 4JZDH 3MO6A 1WOFA 1WTGH 1E37B 1GI1A 5JBBS 3TU7H 4ABAA 5EQRA 3G01A 1Y5BT 3RXSA 1FN6A 1W8BH 1ZMJA 1K9OE 1V2OT 4XOJA 2F9UA 3M3SA 1FQ3A 1KIGH 3BV9B 1G3DA 4F49A 4OGXA 1F92A 5AVDA 5LPEA 1LVBA 1FXYA 1QQUA 2ESTE 1TX7A 1EB2A 1ZGVA 2PUQH 1GGDB 2B0FA 2JH0D 3T5FH 3E0NB 1TONA 5H4IB 2ZEBA 5IYTA 3E91A 4YOGA 5C67A 4I33A 4R0IA 3AW1A 1SLUB 2J34A 1LHGH 2VIPA 4IMQA 1DSUA 1FLEE 4KGAA 1SGFG 1V2KT 4NWLA 4ISOA 4I8GA 3BF6H 3RXHA 3VGCB 1P12E 2KAIA 3UPEA 1TFXA 3GDUA 3RLYH 3WY8A 1WSSH 5FHTA 1XKBC 2HNTE 3GOVB 2AYWA 1HAVA 3HGPA 4HTCH 4UFGH 2JH5D 1RS0A 1DM4B 3H5CB 2O8LA 4MPUA 5HM9A 3RXDA 2O8UA 4X1SU 3QO6A 1UJ1A 4Y8ZA 3SU3A 2HRVA 1J16A 1O2IA 4FVBA 4NGAH 2A45B 4M7GA 4NA7A 1AZZA 1XUGA 2BMGB 2I6QA 3A8BA 3TPIZ 1SGTA 2GCTC 2IN2A 1GVLA 4U32A 2ZA5A 5E0HA 3F9FA 3ZYEA 4WH8A 5JB8S 1HAPH 4ABHA 2FO9A 2R2WU 1HAOH 4OS4A 1ELFA 4X0WU 5ESTE 4U2WA 4FU7A 3TNSA 2PGBB 3AAUA 3TH2H 3A8AA 4B73A 1ZGIA 3TK5A 1K1OA 1F7ZA 7LPRA 3M5MA 1C2JA 5C1YA 1TWXB 3S7KB 1XVMA 3ATIA 1C2KA 1MCVA 5C5NA 1HBTH 2CJIA 5DO4H 3PWBA 4XBBA 4BTIB 1BDAA 4NWKA 3A7TA 3FAOA 1QJ7B 4IMZA 1BIOA 3DD2H 1GBEA 7GCHG 3SNBA 2FEQH 1UVSH 1YPGH 1TQ7B 2BDCA 1NRRH 3ATWA 4Z6AH 4TPIZ 1Z7KA 4CREA 3QDZB 1GBAA 4WXIA 3SV7A 1MMJN 5DJ7A 3QK1A 3MMGA 3RM0H 3R3GB 3IITA 1G36A 1O3LA 3GY8A 3T25A 2QXHA 4B2BA 5BRRE 2Y7XA 1A3BH 1GBMA 3ZYDA 1C5MD 2FXRA 4AGJA 1CHOG 1MTNC 4IN1A 6ESTA 1FDPA 4NFFA 3LGVA 1IQIA 2A5IA 2BLWA 2FOCA 2GT7A 3A84A 2YNBA 3HK3B 3GCTG 1YCPK 2EEKA 2PHBA 3BTEE 5DP5A 3D65E 1ELCA 2BX3A 2V35A 4K1TA 1O3NA 3UOUA 3AAVA 1NFYA 2OLGA 1W7GH 3UWIA 5EPYA 1UCYE 1JRTA 3ZZ4A 1NRSH 3MNBA 4CRDA 3PLBA 1MTSA 1XXDA 3SW2B 2ZTZA 1UCYH 4WMDA 1IQNA 2ILNA 2W26A 1C5VA 3GDSA 3SNEA 1MH0A 1GHBG 2AMDA 1LHCH 3PMAB 1VGCC 2CN0H 3LGIA 3MNSA 3U69H 5C3NA 3F9EA 5A8YA 5LPRA 1FMGA 3OSYA 1Z8RA 3B23B 1AI8H 2FPZA 4Y0YE 3UNQA 4AFUA 1J17T 3MU5A 1AFEH 2GCTB 5F6MA 3I29A 1UMAH 3MNXA 3RM2H 2ZFRH 2FP7B 1LPZB 1J8AA 1V2QT 1TALA 2SGEE 2Z9IA 4JK5A 1PPBH 3M5OA 1PPFE 3OY5U 3M35A 1O2LA 2Z7FE 2G5NA 1ZSKA 1JMOH 2Y5HA 5EXMA 3DFLA 4BAMB 1C5SA 1LTOA 2BDGA 1SB1H 3CENA 3A7XA 2TIOA 3BTTE 2AH4X 4X8VH 3A85A 2B8OH 3UY9A 1JIMA 1W13U 5J4SA 1ZMNA 5SGAE 2GV6A 3IWMA 2G00A 3VB7A 5LH8A 2PLXA 5JBTA 4DIIH 1GMCF 1KDQA 4X2XA 3QGJA 1HJ9A 2AGIX 4GLYA 1O3GA 2WPJS 3BEIB 1BA8B 3SBKA 1L1JA 2GD4B 3ELAH 1J14A 1RTLA 3U1JB 4BXWA 5EPNA 3OTJE 2P16A 3ZZ7A 4Q7ZA 1UVTH 2RA0A 2A5KA 2JETC 4TWYA 1SHYA 3KEEA 3LGWA 2P8OC 4K1SA 4JZIA 3TK6A 3FP6E 3NXPA 2C8ZB 1MTNB 1AO5A 4OS2A 1LCYA 1GJCB 1K1MA 4TYDA 1G2LA 5I46H 4KP0A 3BIVH 1KTTB 1ZSLA 1FV9A 5FPTA 4ZKRU 1EPTC 1A5IA 1FZZA 4YT6H 4B76A 4O3TA 1C2GA 1UTQA 2VVUA 5I25A 1MD8A 1A0JA 1ZLRA 2PGQB 1P04A 4NSVA 1C9PA 1NU9A 1VJAU 2ZDKA 3TVJB 4LK4A 4DG4A 3B9FH 3SV9A 4JYTA 2CV3A 4I8JA 3M5NA 1CA0C 4AX9H 1ELBA 3LU9B 1GL0E 1THSH 2OP9A 1UTPA 1VGCB 2XWBI 1T8MA 4X2VA 3BG4C 3SQHE 2XYAA 1O2JA 1HAYB 1PYTC 1ZTKA 1OS8A 1EP5A 2FTLE 1GI6A 2GP9B 1F0UA 3QLPH 1UTLM 2FYRA 3GDVA 4YOJA 3PYHA 1HLTH 4WY3A 1VITF 1EJAA 1UTOA 4GCHF 5HM2A 3AW0A 2ZGXH 1S0QA 2Q6GA 1XMNB 1O5FH 1OP2A 1OWHA 3RMMH 1HAXB 4A6LA 3LH3A 1EAWA 6GCHF 1HAGE 1YBWA 1J9CH 1DITH 1YGCH 2OBQA 1B7XB 2QGRA 2VWMA 1S5SA 2A7HA 3C27B 3SV8A 3EE0B 4K1EA 4DURA 3OU0A 2BZ6H 1MAXA 1PQAA 1H8IH 5EOKA 3NK8A 1UK3A 3SJOA 2QC2A 1MQ6A 1TPPA 2BY6X 4VGCC 2ZFTA 1A0HB 1OWEA 2J4IA 1ANCA 3ZZAA 5FBIA 3F9GA 1AKSA 1GHAG 1GMDF 1L0ZA 1GBTA 4RKOB 5A0BA 2R9PA 1PFXC 4BAQB 2VH0A 5FCKA 1P57B 3FZZA 3RXPA 1SLVB 1D9IA 3GY4A 1KXEA 1FY1A 1DS2E 1Y3XA 3UREA 1GJ6A 1O2YA 4X1PU 1PPZA 4CRCA 2AMPA 2JETB 5GCHG 1GMHF 2P8OB 1ELGA 1DY8A 1INCA 2WPLS 2NU2E 2GCHF 3PROA 3M3VA 1FJSA 3HGNA 3I78A 1TBQH 1GBHA 2C4FH 1Z8JB 1CT2E 3Q3XA 4NCYA 1GI3A 3S9AA 4OS7A 1FY4A 3KL6A 3RXIA 3RXEA 1O3DA 1NFUA 1P3CA 2Z3EA 3A8CA 1KXDA 1OWJA 2FI4E 3RXMA 1EPTB 1O37A 2BHGA 1AIXH 2A31A 1A61H 3U8RH 3BTGE 5HYOA 4X6MA 2PTCE 1H1BA 1S83A 4MDSA 2J92A 4D9RA 2ZHDA 1O5BB 2CMYA 3RU4E 4DW2U 1MBMA 1MU6B 1H9IE 3OYPA 4DCDA 1AGJA 4IC5A 5ESBA 3MYWA 1O3OA 5A2MH 4I7YH 1BHXF 1KLTA 1OXGA 2VWOA 1U6QA 4CBOA 5DP4A 1NZQH 3RXOA 3BG4B 1UHBB 2ODQA 2W3KA 1GWAA 2AGEX 4IGDA 1BTZA 3PTNA 1ZMLA 1EAUA 2PKAA 1T4VH 1T4UH 3RXKA 2FM2A 1HDTH 1DSTA 1QRXA 5GWZA 1AFQC 1KY9A 2OC1A 3I77A 1QHRB 1LKBA 1O5EH 1MU8B 2LNCA 1UK2A 1C1WH 3EYDA 1ZTJA 1W7XH 3SUEA 4DGJA 1C9TA 2PSXA 2QIQA 1WU1A 3SU1A 3ZZBA 4ZKNU 1C5PA 4I32A 2F9VA 1UVPA 1ETRH 1ETSH 2D1JA 3A82A 1NU7B 1BTUA 2OD3B 1TGSZ 4VGCB 1TNLA 2ZO3H 2GKVE 3P8NA 1GCTC 1ARBA 2ANYA 2ZTXA 2ZF0H 2ANWA 7KMEH 1CE5A 1AE8H 2A2XH 2V6NA 4ZHAA 1TPOA 1GJ4H 2Z9LA
chains in the Genus database with same CATH superfamily
2W5EA 2FLRH 3LPRA 2FX4A 2SGFE 3OY6U 4K3JA 2BXUH 1PQ7A 1C2DA 1SQOA 2SGDE 2RCEA 3KF2A 1A0LA 2ZDLA 2PWXA 1V2PT 3MU4A 4ACAA 1UTNA 1TNJA 3ATMA 1E1RD 2GZ8A 1L1GA 1FPCH 1K1JA 1TIOA 1W14U 2FLBH 1IOEA 2JIZD 1W3CA 2XBWA 3O8DA 4X8SH 2VH6A 2FX6A 1GI9B 4CHAC 4I8KA 3TIUA 5CHBA 4F48B 1HIAB 1C4Y2 2G4UA 1F0RA 2BY9X 3D23A 3TITA 3T29A 3L33A 1P2KA 2HGTH 1SGYE 3M5LA 4DOQA 1LVOA 3RC4A 5LPFA 5EXLA 2TGDA 2O8WA 9ESTA 2WYJA 3PTBA 1C5WB 4X2WA 3PRDA 3STJA 2FDAA 1H8DH 2HWLB 4GHTA 5K7RA 2SGAA 1F5KU 1WQVH 2B5TB 5EODA 4ZKOU 2O8MA 1ZTLA 2XCFA 2ZGHA 3S69A 4E05H 1A4WH 1BRCE 3GYLB 2ZU1A 4X6NA 4Q63A 2BVRH 3ZV9A 1QTFA 4XBCA 3FO8D 3EAJA 3M7QA 2PTNA 4FUFA 3RXVA 5AF9H 1C1MA 1SGNE 1TPSA 1ZRKA 5DK1A 1YPJH 2H5CA 2ZPRA 1NRPH 2OTVA 1SSXA 2ZZUH 1LVYA 5DKMA 3A81A 1QZ8A 1QB6A 2QCYA 4XFQA 3RP2A 3DFJA 3FN8A 2TGTA 4Y8XA 1SGQE 3SV6A 3SUDA 1DICA 2FYQA 3E16B 1NM6A 1XVOA 1Q31A 2ZTYA 1XUJA 2A2QH 1RTFB 2GMTC 2HPQH 2RA3A 1BUIA 1VZQH 3P8GA 1PPGE 2A4GA 1O3KA 4YXWD 3GY3A 2YMSB 3A87A 4CR9A 4BAKB 4FUEA 4JZFH 2P59A 1YM0A 3UR9A 3K6ZA 1GCTB 1GI4A 5TCCA 4OS1A 1DY9A 4X2YA 3ZVGA 4CRFA 4KTUA 1K2I1 4SGAE 2FIRH 2WPMS 3RXRA 1A5GH 1LHFH 1GJ5H 3EA7A 3SI3H 3SNCA 1QURH 1YLCA 3U1IB 3F68H 2ZHFH 6LPRA 3MU1A 1MZDA 1G9IE 4AFQA 3KNXA 4HI3A 3SN8A 2C8WB 2Z9KA 5T1VA 2VGCC 4DY7B 1DUEA 1ELEE 2KCYA 1AN1E 1SQAA 4Y7AA 4K8BA 1O2MA 3TJVA 2BD8A 2QXJA 1CT4E 3KYFA 3N7OA 3ZZ5A 3AASA 4CH2B 1WYKA 4AG1A 1LQDB 1EJMA 4TPYA 2P3UB 3EE7A 3ZVFA 4YTAA 1EXFA 1FIWA 4OS6A 4Y11E 1EX3A 1W12U 2ZU3A 4CHAB 2DE9A 2QN5T 2P3TB 4E7NA 1ELVA 5L30H 1TRMA 2O8TA 2F4LA 4MLFB 3U9AH 2PV9B 1MAYA 1TA6A 2LP6A 4FXGH 5GNDA 4I8LA 1AD8H 2WINI 3MH7A 1YC0A 3A7VA 6CHAC 8KME2 4YOIA 3TNTA 1DWBH 4BANB 4JYVH 2GV7A 1O33A 3TK9A 4Y71A 3DCLA 1AZ8A 1YF4A 1CGHA 1GI8B 1LKAA 1NPMA 3BEUA 1FY3A 3P70B 1O3BA 2VIOA 1XM1A 3CS0A 2GJGA 4FOUC 1BT7A 2R2MB 4AYYB 3ESTA 4BTUB 3EA8A 1G30B 1W0KD 4ZAEA 2BD5A 4RN6A 2ZDAH 3BTWE 2PR3A 2M5TA 2AEIH 3LJOA 2A7JA 3MWIU 4H4FA 1GBIA 3E3TA 1CGIE 1COWD 2J98B 1HAIH 2P95A 2FS8A 3E0PB 1WXRA 1DXPA 2GMTB 3AVZA 3MNCA 2BTCE 1E35B 2ZHQH 1Z6JH 1BMAA 4FU9A 2XWAA 4KKDA 5C1UA 4Z1MD 5EW1H 1BTXA 4AN7A 1BMFD 1ETTH 1Y8TA 3SU0A 2FOHA 3CNRA 1L4DA 1OP8A 3GY6A 3LGTA 3MQKC 2SNWA 3A89A 2I6SA 3RMLH 1C5LH 1P02A 5CE1A 1NBMD 1O39A 2OCVB 2ULLA 2Y5FA 4DIHH 2VGCB 1DVAH 2HLCA 2ZGCA 1SMFE 1WQSA 4A1TA 1BBRK 4ZXXH 1JRSA 1BQYA 3QX5H 4XD7D 1QL7A 1CHOF 3BTHE 3M36A 4FUGA 1THPB 3RXGA 3V12A 2H1UA 1JOUB 5BPEA 1A2CH 2W6JD 2BDYA 1O2GH 3GCTF 1BB0B 1TNGA 3AK5A 1DWEH 1PPEE 3SJ9A 5DP8A 2WV5A 3DSPA 3SOSA 4WJG2 1Z1IA 1P8VC 1N1LA 4D76A 2GTBA 3VFEA 1IAUA 1V2TT 4NFEA 1F5LA 4K60A 2ODPA 5F8TA 5TCAA 3VXFH 1WBGB 3ATKA 5KECA 1V2WT 3OEED 4X1NU 3ZVBA 4Y8YA 4I8HA 5FPSA 1LDTT 2G51A 1C1VH 2BY7X 1GHBF 1ZRBA 3SNDA 1GBKA 6CHAB 2QV1A 1SVPA 1D4PB 1P3EA 1N6XA 3LC3A 4QT8C 3SUFA 1B0FA 2WUCA 1YPEH 5T6DA 3FP8E 1EB1H 1AUTC 2B7DH 2ZCLP 3BTKE 4OM9A 1FY8E 1MABB 2UUYA 2ZGBH 2Z3CA 1FONA 2P94A 3PRBA 1T32A 3KQEA 3ENSB 1O2XA 1F2SE 1YKTA 3PB1E 3P17H 5FPYA 4E7RG 5EJ1A 1LHEH 1EZUC 1EAXA 3SYJA 4AZ2B 3ZZ8A 1IHSH 2VVCA 1NY22 1YCPH 1HNEE 2HALA 1K22H 3LGYA 1FUJA 1L4ZA 3KYGA 2ZPSA 3KIDU 1SC8U 1KSNA 4MTBA 3GY5A 3ZZ6A 5AFYH 2BLQA 3A7ZA 4Q80A 1OWKA 2V3OH 4DJZB 4X8TH 3N7DA 1TBRH 2B9LA 2IJOB 3N99A 1O2KA 5T3HA 1IQLA 4ISLA 1ESAA 1NRQH 1E38B 1O5CB 2Y82A 1Y3VA 4TY7A 2EQNA 4F4OC 2ZECA 1FAXA 1SFQB 2C93B 2VIVA 1NO9H 1O2VA 2BD9A 4WWYA 3MU0A 1DWDH 3O8BA 4H6TA 1T7CA 1TBZH 1LQEA 1P2IA 5C5OA 1V2ST 1EZXC 5IDKA 1GI7B 4I86A 4MNXA 5DG6A 3Q3YA 2BQ7B 2F83A 1TOCB 1XKAC 1NT1A 1GJ9B 1FAKH 1GL1A 3RLWH 1C2MA 1DPOA 1P2QA 2BVSH 2HVXA 1GI5A 5T6FA 1G2MA 1EZQA 2QYIA 3ZIAD 1QJ1B 1FNIA 1H8ED 1K21H 1O3EA 3DSOA 3VB6A 2KCPA 3FVFB 5GDSH 3RXJA 3ZVAA 2WHXA 4ZUHA 1ANBA 4GVUA 5F03A 1HCGA 1O3FA 3LONA 2RDLA 4FUBA 3S9BA 4Q2KA 4AGKA 1NC6A 1A7SA 5JB9S 1NN6A 5F53A 4WMFA 2XBXA 2VNTA 1NROH 3ODFA 5IK2D 3RMNH 1ZHRA 3SQEE 1O2TA 2C3SA 2J5UA 1PPHE 1FY5A 3F0PA 1P2OA 2V3HH 1SGRE 4K5ZA 3NZIA 1BMLA 5B6LA 3SORA 3EQ0H 2GDEH 2VIDA 1C2HA 3TGJE 3B8JA 3E90B 3U8TH 2A4QA 2F9NA 1WAYB 1T8OA 2F91A 1IQKA 2G52A 5DP6A 3SGAE 3V7TA 4Y7BA 1MZAA 1YY3A 3CP7A 8LPRA 2BLOA 1CBWC 3FOAA 4JZEH 5C2ZA 1ANEA 1K0HA 5HGGA 5KGOA 1O3CA 3BSQA 1RTKA 3QZQA 4FUHA 2GCHG 3PLKA 3RXBA 2OQ5A 2BQ6B 2XNDD 4ZCNA 4GHQA 1IQJA 1AY6H 1HRTH 4CRBA 2ZFSA 4UDWH 1TMTH 1ACBE 3GISB 1OYQA 2G55A 2ZI2H 2VWLA 1D3QB 2BXTH 3DA9B 4XDEA 3A7WA 1O36A 1FX0B 2Y7ZA 5E8EH 1T31A 2W6ID 3TJOA 2HOBA 3F2GA 4FUDA 1V2VT 1GHAF 2BLVA 1ZR0A 2JJ2D 2XC5A 3A83A 1O2ZA 3MH4A 1SOZA 2C8YB 1V2NT 1MTWA 1MKWK 1LPKB 4NIWA 2Q6DA 1LVMA 1XUKA 1SGPE 2QF0A 2WUBA 3A7YA 1TGBA 1WDIA 1HYLA 5EU8A 1ZPCA 2O9QA 2FOAA 1ORFA 4Y79A 2CGAA 2VIWA 2PKAB 4YLUA 1GVKB 2EC9H 4FVDA 1KTSB 2THFB 1FIZA 5HXFA 1CA0B 3O8CA 3D49H 4DT7B 2GZ7A 1DLKB 4ABJA 1LHDH 3RUOA 2FTMA 4FUCA 3HPTB 4WF8A 2FESH 1O2QA 5A8XA 3NRLA 1TMUH 3PMJA 3UR6A 2VU8E 1IQHA 1EATA 1YPLH 1HJAC 3QWCH 4H42U 1ZOMA 2BD7A 2BZAA 3SNAA 2D2DA 2ZFPH 3UB0A 2HNTC 1GI0A 3M3TA 1G3EA 1D3TB 4K2YA 1H4WA 1QCPA 1Y5UT 1AQ7A 2VWNA 2STBE 4NIYA 4X6OA 2EY4C 5GXPA 1F0TA 2BB4A 2H9HA 4ABIA 4NIXA 5FCRA 1EPTA 1XUHA 1T8LA 3SZNA 1LO6A 1VJ9U 2KR7A 2J95A 2ANKH 2UUFB 4A5TS 1MQ5A 3DUXH 2V3MA 2YNAA 3UOPA 2AHME 1YYY1 3CS7A 3K2UA 4U30A 2AIQA 1MTUA 1A5HA 2IJD1 1Y5AT 2PUXB 3T26A 1EAIA 3UFAA 2NU3E 1BTYA 1M9UA 4YT7H 1O2HA 1B5GH 3OEHD 2WV4A 4J2YB 1UHBA 1QL9A 2G81E 2V0BA 1ESTA 1O2SA 1C5UA 1CBWB 2XRCA 3RXFA 3DSGA 1BMMH 4MPVA 2A4RA 2BDAA 1P03A 1B0EA 2F9BH 5AHGH 1RRKA 2TBSA 1QBVH 2A1DB 4ABFA 1ELDE 1O5AB 1X7AC 3O8RA 5K0HA 3TGKE 5A8ZA 3TJUA 2AFQB 2F3CE 1BJVA 5FXLA 8GCHG 3SU6A 1GHZA 1GJAB 4PROA 2YOLA 5DPAA 2QAAA 5GPIB 3F1SB 2AS9A 3ODDA 3OX7U 3V0XA 1W2KH 2R3UA 1CT0E 3OTPA 1CVWH 1PYTD 1C1NA 2QF4A 1IQEA 1BJUA 3LOXA 3ZVDA 2GT8A 1RD3B 3SO3A 1OYTH 3WWBA 3DT0H 2HVYB 1V2LT 4B2CA 5C1XA 3P8FA 4ZROA 2Q6FA 1O3JA 3TJNA 2R0LA 1YCPM 1GVZA 2P93A 4GUXA 4UEHH 5GIBA 1IQGA 4FUJA 1GBBA 4AB9A 2G8TA 1GBFA 4TSFD 5CMXH 4NIVA 2DE8A 1G3CA 1L2EA 1GBJA 2WPDD 1S85A 2ZCHP 8ESTE 4Q7YA 3E8LA 1E36B 3VB3A 4ZHMU 1O2PA 1QA0A 2XC4A 1TGTA 1K1PA 3Q76A 4FUIA 2VIQA 2UWPA 2ZFFH 1HJAB 1LMWB 2Q1JA 3NUMA 5C17A 1AB9C 3SJIA 1AVXA 3SGBE 1IQMA 3IG6B 1D3DB 5HMAA 2W3IA 2H5DA 3NCLA 1C1OA 3FZDA 3MH6A 1DANH 3F0OA 4X1QU 2KAIB 2UUJB 2BM2A 1XUIA 1O2OA 1AFQB 3TH3H 2WYGA 3ZZ3A 1OPHB 3LH1A 1HIAA 3PV2A 1LPGB 3PMHB 4XE4A 5FX5A 2ZU2A 2PW8H 5JBAS 4CRGA 1SLXB 3P6ZB 3MO9A 4DVAU 1OP0A 1GHXH 1K1NA 1Y3YA 3UUZA 3SJ8A 4K8YA 5F8ZA 2AIPA 1HAVB 3RXAA 1E34B 1W0ZU 2ALPA 3HK6B 1GDUA 1SGCA 1SL3A 2H2ZA 3A8DA 3BIUH 3RXTA 4NA8A 1QBOA 2AERH 1O5GH 3GY7A 1W11U 3STIA 3SJKA 3SV2H 2ZQ1A 2G4TA 2J94A 3A80A 3M37A 3HATH 1VCQA 3NKKA 4B6FA 4ACBA 1H9LB 4OGYA 5J4QA 1C1UH 1NS3A 2FZZA 2A5AA 2TGAA 2ZU4A 4UE7H 5T6GA 1O2RA 1S6HA 2Y6TA 4YZUA 2A0QB 2W7SA 5B6OA 2Z3DA 1NESE 1O5DH 3BTQE 5PTPA 1FN8A 1AVGH 5JYIA 1GDNA 3RXUA 2RDEA 1OSSA 1EOJA 1QA7A 1FI8A 1A1RA 4X8UH 2OC7A 1O3MA 4O9VA 3ZZ9A 1H8HD 2R0KA 3BEFB 4IC6A 2CXVA 2ZDNA 2XBVA 3K6YA 4GPGA 1GBDA 1KLJH 5DGJA 3KQBA 4RT0A 2A32A 4LOYH 1FPHH 1ZZZA 1O38A 2ZFQH 3GY2A 4IN2A 4WH6A 5EIYA 4INKA 1RXPA 4ZXYH 1PQ8A 1K1IA 3UQOA 2ZIQH 4BAHB 1JXPA 2FI5E 1EUFA 1UTMA 5EG4A 2AGGX 1BRAA 1UCYK 2BD4A 2PKSC 3RU4T 2FWWA 2YMSD 3UWJH 1P9SA 3JZ2B 1HB0B 1C1TA 1TX6A 3GCHC 1DWCH 1O34A 1AB9B 2J9NA 1DXWA 2EI8A 2BDIA 4O3UA 2OC0A 3P92A 3T62A 3EA9A 1G32B 4AG2A 1D6WA 1HAZB 4Y10E 1HXEH 2FI3E 1IQFA 1WCZA 3HKIB 1DLEA 1SGEE 4TWWA 4UFDH 1V3XA 3KN2A 3RC5A 2FOMB 2ZHWH 4HZHA 1V2MT 2XC0A 4GAWA 1BITA 5E0GA 4BAOB 1Z8GA 1G37A 5LGOA 3SI4H 3H7OA 4A1VA 4Y6DA 1OOKB 4U01A 1L1NA 4AB8A 4IW4E 1JBUH 4MPWA 1N8OC 5CHAC 5DSFA 5L2YH 5G4BA 1F0SA 2J2UA 2OUAA 4Q7XA 2FMJA 3NPSA 3T27A 1TNIA 2ZP0H 3ZZCA 1EKBB 2C8XB 4ABGA 5A0AE 1QJ6B 4CH8B 2ZWLH 1C2FA 7GCHF 2IPHA 1DX5M 9LPRA 2BYAX 3QZRA 3V13A 1SGDE 1UK4A 1EFRD 1A46H 1TQ0B 4DT4A 4FU8A 3PM3A 3QGNB 1C5ZB 1MKXK 1DE7H 2A4OA 2BVXH 4HFPB 2EI7A 1AWFH 1GDQA 4OS5A 5EXNA 3ZVCA 4AORA 1QBNA 1DFPA 3RC6A 1Z6EA 1ARCA 3UIRA 2XTTB 3W95A 3ZV8A 3HKJB 1KXAA 2ZKSA 3PV4A 3QTVH 1EZSC 1P2NA 1EASA 2ZNKH 5EJLA 1D3PB 2UWOA 5C94A 4ABDA 1AU8A 1SKYE 1Z1JA 3MHWU 4NZLA 3URCA 5JDUB 3DHKH 2WSSD 1O32A 1TGCA 3F6UH 4MPXA 4TT3D 4JMYA 3L6PA 1C1QA 2A7CA 1KXCA 3F3BA 1V6DA 2RFKC 1ANDA 1ZJDA 3PLPA 1KXBA 3LDXH 2DUCA 4BOHA 1G3BA 1SI5H 2WPHS 1ABIH 3V3MA 1PQ5A 1MTVA 1KDQB 1THRH 1O0DH 2NWNA 1NRNH 3BTME 1BTHH 2WPKS 3RXQA 2GZ9A 1QR3E 3W94A 2F9PA 2PKSB 1GMCG 1SGFA 2QF5A 3PWCA 4X6PA 5JPMH 2BOKA 5FL7D 4UONA 1O2NA 1RGQA 3GCNA 4ABEA 2W7UA 4AOQA 2GDDA 2FODA 3K9XB 4KELA 1S6FA 2KX4A 3SGQE 2BY5X 3GCHB 5DP7A 1Z71A 2BDHA 4J1YA 1PPCE 2QXGA 1O3HA 3Q00A 5L2ZH 4KTCA 3S0NA 3FANA 1HAHH 4BNRA 4B1TA 2QA9E 4E06H 1P01A 1P2JA 1O31A 2OXSA 3KHVA 5TJXA 2ZCKP 1GBCA 3KQDA 5KEDA 3LT3A 1AVWA 1SBWA 3RDZA 3MO3A 1GJDB 1QB1A 4O03A 1Q2WA 1TPAE 2C90B 3SUGA 1MKXH 1P10A 1QFKH 4JK6A 4O97A 1BBRE 1EP6A 1N8OB 5CHAB 1GHWH 1V2RT 1TABE 2SGPE 1CO7E 1XUFA 2CHAC 1BBRH 1DDJA 4NZQA 3SHAH 4I31A 2STAE 1QQ4A 2NU0E 2OQUA 1Z8IB 1JWTA 2ZDMA 2GGVB 3QTOH 1ZPBA 1K28D 4MG3A 1HV7A 2GX4A 5E0JA 2VVVA 1O3IA 2QY0B 1E0FD 2RG3A 2Z9GA 1NTPA 1RJXB 3SHCH 1WV7H 2XXLA 3S9CA 3PO1C 1IHTH 2TPIZ 4ESTE 2IOTA 2CF8H 1RFNA 4SGBE 2V7QD 4JZ1A 2ZPQA 2KM0A 2Z94A 3OAAD 1ZJKA 3E6PH 1VCWA 4YO9A 1VITG 2R3YA 4GCHG 5FAHA 3WW7A 1C5YB 1SGIB 1BZXE 2P3FH 2Y5GA 4JYUH 4MNWA 6GCHG 4LZ4B 5ETXA 3F2FA 1UTJA 4YESB 4MNYA 3ZVEA 1XXFA 4AYVB 1UTKA 1HPGA 3FP7E 1P0SH 4THNH 5FX6A 2BD3A 4R8TB 1S81A 2OK5A 3VEQB 2KZ4A 5E2OA 1WTHD 1TRNA 1AE5A 2SNVA 4A7IB 2WPIS 3VXEH 2TGPZ 1ABJH 1CA8B 1P09A 2OBOA 3BG8A 3T28A 1AUJA 1AKSB 1C5RA 1QGFA 3ITIA 3GYMA 2H9TH 1OX1A 1O35A 3LKWA 3MFJA 2LPRA 1GMDG 2SGQE 3MI4A 1KYNA 4D9QA 4B2AA 2ODYB 1HJ8A 2BD2A 1EJNA 1MBQA 1TOMH 7ESTE 2G5VA 3BN9A 1BTWA 4GSOA 4TY6A 1ZSJA 1SR5C 2SFAA 1O30A 1EQ9A 1C5QA 1YPHC 4JCNA 2J97A 2PP6A 2Z6BD 2PSYA 4YLQH 3KQCA 5GJ4B 3TH4H 4BTTB 2XW9A 3VPKA 1GBLA 1GMHG 1SFIA 2BX4A 1YPKH 1ZHMA 2KCAA 1ESBA 4B71A 1ELAA 1S84A 1CQQA 3RXLA 2D26C 3LGUA 4AFSA 2JJ1D 1PJPA 1TGNA 5C20A 1D6RA 5E2PA 2FOFA 1XX9A 1Y59T 5JBCS 3FKSD 2NU4E 2QXIA 2XCNA 4Y0ZE 1C2EA 1QIXB 2CF9H 1P9UA 1OWIA 1MD7A 3PV5A 4Q4LA 3M7TA 1YWUA 2ZQ2A 4NA9H 5A09A 3JZ1B 2H9EH 4XBDA 3U98H 4ABBA 4B74A 2CHAB 1V2UT 2JH6D 1W10U 1ZHPA 4D7FA 1TNKA 1TE0A 3TLOA 1OWDA 5DP3A 5L6NH 3P95A 2ZU5A 5A0CA 1SLWB 4B6EA 1QRWA 1T8NA 3F9HA 1J15A 1TB6H 4A92A 1MCTA 1SPJA 1RIWC 4B75A 4MNVA 4Y76A 2J38A 3UTUH 3GCOA 3VB5A 3PO1B 1TX8A 1K1LA 3QUMP 1NFXA 1BRBE 1TRYA 1GI2A 1C5XB 1GG6C 4XSKU 3RU4D 3U8OH 1W0YH 5GCHF 2BQWB 3A86A 4INHA 4D7GA 1SG8B 1KXFA 1GHYH 4ISHH 1HXFH 1UO6A 2D8WA 4RSPA 4IS5A 1GPZA 4KTSA 5ABWA 2Y80A 1QRZA 1UVUH 5EW2H 2EA3A 2VINA 4F55A 1N6YA 1C1SA 3RXCA 1Y3WA 3BTFE 1SHHB 1P05A 2AMQA 3L3TA 3TGIE 1VCPA 2ZGJA 1V2JT 2ZG0H 2Z9JA 3M7UA 3KGPA 3UAIC 2FOGA 1CHGA 3A88A 4MVNA 2HNTF 2KFWA 4Z0KA 5EQSA 2TRMA 1BTPA 4AFZA 4D8NA 4ISIH 3GICB 4HGCA 3PMBB 1C5TA 2ZHEH 2BDBA 1YP9A 1C4U2 2OC8A 1OKXA 3UNSA 3Q77A 1C5NH 1UVOA 4CBNA 1S82A 2QF3A 1TYNA 1WUNH 1ZYOA 3UNRA 1MUEB 4ASUD 1BOQA 1GGDC 2ANMH 2PFEA 1O2UA 1GJ8B 1HUTH 4NSYA 2ASUB 1GHVH 1H9HE 2UWLA 3MU8A 4YM9A 4M9FA 1JIRA 3SU5A 1ID5H 1KLIH 3UQVA 1TA2A 2HPPH 2FOBA 2YMSC 1UW7A 4LZ1H 4CR5A 1P11E 4K69A 1O2WA 3K65B 3VGCC 1Y3UA 2M2AA 3E1XB 1MKWH 1VR1H 1ZPZA 3SU2A 3QN7A 1O3AA 3D62A 3T2NA 4RKJB 3URDA 2VB0A 1A3EH 3R0FA 3NWUA 5EQQA 1GJ7B 1O3PB 2UUKB 4CRAA 2VJ1A 1BMNH 2FS9A 2K1QA 2BOHB 3EGKH 1AWHB 4WXVA 1QY6A 2ZDVH 1QL8A 1TAWA 4UFEH 1AMHA 1C2LA 3Q3KA 4ISNA 1C5OH 3FFGA 3C1KA 1SOTA 3ATLA 3VB4A 3RMOH 2FOEA 1QNJA 5C0TA 1TMBH 2JKHA 2XBYA 4ASHA 1BCUH 1VITH 1SQRA 3KCGH 1RIWB 3P8OA 1C1RA 1CSOE 4H6SB 2IPQX 3LIWA 3EDXB 1YLDA 2NU1E 3S7HB 5DP9A 1ELTA 4WMEA 4IBLH 8GCHF 1YPMH 1GG6B 1C4V2 5EGMA 4RI0A 1HFDA 3H7TA 1Q3XA 2WZQA 4WVPE 2ZC9H 3MH5A 4LXBH 2GVFA 5FBEA 1TLDA 3MTYA 1YPHE 3M61U 4BXSA 1CU1A 1GJBB 1BHXB 2BY8X 1DOJA 2Y81A 1F5RA 1BRUP 3BTDE 3ZZDA 1TNHA 4A1XA 1P06A 1EOLA 1C2IA 2F9OA 1DT2A 4UD9H 1C1PA 3N7EA 1CGJE 1HGTH 1GCDA 4ZH8A 1P2MA 4ZHLU 3MOCA 3LC5A 3SU4A 2OINA 2H6MA 4X1RU 5AFZH 1NFWA 4NG9H 4ZMAH 1S0RA 1DUAA 1AHTH 2EI6A 5F8XA 1SQTA 4ZKSU 1QB9A 4INLA 2XNIA 4UFFH 4MQAA 3LJJA 2ALVA 5DN6D 4JZDH 2L74A 3MO6A 1WOFA 1WTGH 1E37B 1GI1A 5JBBS 2WV9A 3TU7H 5EQRA 4ABAA 3G01A 1E79D 1Y5BT 3RXSA 1FN6A 1W8BH 1ZMJA 1K9OE 1V2OT 4XOJA 2F9UA 3M3SA 1FQ3A 1KIGH 3BV9B 1G3DA 4F49A 4OGXA 2VBCA 1F92A 5AVDA 5LPEA 1LVBA 1FXYA 1QQUA 2ESTE 1TX7A 1EB2A 1ZGVA 2PUQH 1GGDB 2B0FA 2JH0D 3T5FH 3E0NB 1TONA 5H4IB 2ZEBA 5IYTA 3E91A 4YOGA 5C67A 4I33A 4R0IA 3AW1A 1SLUB 2J34A 1LHGH 2VIPA 4IMQA 1DSUA 1FLEE 4KGAA 1SGFG 1V2KT 4NWLA 4ISOA 3KQ5A 4I8GA 3BF6H 3RXHA 3VGCB 1P12E 2KAIA 3WWFA 3UPEA 1TFXA 3GDUA 3RLYH 3WY8A 1WSSH 5FHTA 1XKBC 2HNTE 3GOVB 2AYWA 1HAVA 3HGPA 4HTCH 4UFGH 2JH5D 1RS0A 1DM4B 3H5CB 2O8LA 4MPUA 5HM9A 3RXDA 2O8UA 4X1SU 3QO6A 1UJ1A 4XRNA 4Y8ZA 3SU3A 2HRVA 1J16A 1O2IA 4FVBA 4NGAH 2A45B 3F2HA 4M7GA 4NA7A 1AZZA 1XUGA 2BMGB 2I6QA 3A8BA 3TPIZ 1SGTA 2GCTC 2IN2A 1GVLA 4U32A 2ZA5A 5E0HA 3F9FA 3ZYEA 4WH8A 5JB8S 5HKKD 1HAPH 2KCOA 4ABHA 2FO9A 2R2WU 1HAOH 2XOKD 4OS4A 4AC9A 1ELFA 2K8IA 4X0WU 5ESTE 4U2WA 4FU7A 3TNSA 3W1EA 2PGBB 3AAUA 3TH2H 3A8AA 4B73A 1ZGIA 2L6OA 4HG6A 3TK5A 1K1OA 1F7ZA 7LPRA 3M5MA 1C2JA 5C1YA 1TWXB 3S7KB 1XVMA 3ATIA 1C2KA 1MCVA 5C5NA 1HBTH 4P00A 2CJIA 5DO4H 3PWBA 4XBBA 4BTIB 1BDAA 4NWKA 3A7TA 3FAOA 1QJ7B 4IMZA 1BIOA 3DD2H 1GBEA 7GCHG 3SNBA 2FEQH 1UVSH 1YPGH 1TQ7B 2BDCA 1NRRH 3ATWA 4Z6AH 4TPIZ 1Z7KA 4CREA 3QDZB 1GBAA 4WXIA 3SV7A 1MMJN 5DJ7A 3QK1A 3MMGA 3RM0H 3R3GB 3IITA 1G36A 1O3LA 3GY8A 3T25A 2QXHA 4B2BA 5BRRE 2Y7XA 1A3BH 1GBMA 3ZYDA 1C5MD 2FXRA 4AGJA 1CHOG 1MTNC 4IN1A 6ESTA 3OFND 4FETA 1FDPA 4NFFA 3LGVA 1IQIA 2A5IA 2BLWA 2FOCA 2GT7A 3A84A 2YNBA 3HK3B 3GCTG 1YCPK 2EEKA 2PHBA 3BTEE 5DP5A 3D65E 1ELCA 2BX3A 2V35A 4K1TA 1O3NA 3UOUA 3AAVA 1NFYA 2OLGA 2J98A 1W7GH 1NBME 3UWIA 5EPYA 1UCYE 1JRTA 3ZZ4A 1NRSH 3MNBA 4CRDA 3PLBA 1MTSA 1XXDA 3SW2B 2ZTZA 1UCYH 4WMDA 1IQNA 2ILNA 2W26A 1C5VA 3GDSA 3SNEA 1MH0A 1S6LA 1GHBG 2AMDA 2JDID 1LHCH 3PMAB 1VGCC 2K0QA 2CN0H 3LGIA 3MNSA 3U69H 5C3NA 3F9EA 5A8YA 5LPRA 1FMGA 3OSYA 1Z8RA 1OHHD 3B23B 1AI8H 2FPZA 4Y0YE 3UNQA 5HIZA 4AFUA 1J17T 3MU5A 1AFEH 2GCTB 5F6MA 3I29A 1UMAH 3MNXA 3RM2H 2ZFRH 2FP7B 1LPZB 1J8AA 1V2QT 1TALA 2SGEE 2Z9IA 4JK5A 1PPBH 3M5OA 1PPFE 3OY5U 3M35A 1O2LA 2Z7FE 2G5NA 1ZSKA 1JMOH 2Y5HA 5EXMA 3DFLA 4BAMB 1C5SA 1LTOA 2BDGA 1SB1H 3CENA 3A7XA 2TIOA 2F43B 3BTTE 2AH4X 4X8VH 3A85A 2B8OH 3UY9A 1JIMA 1W13U 5J4SA 1ZMNA 5SGAE 2GV6A 3IWMA 2G00A 3VB7A 5LH8A 2HLDD 2PLXA 4RT1A 5JBTA 4DIIH 5C0UA 1GMCF 1KDQA 4X2XA 3QGJA 1HJ9A 2AGIX 4GLYA 1O3GA 2WPJS 3BEIB 1BA8B 3SBKA 1L1JA 2GD4B 3ELAH 1J14A 1RTLA 3U1JB 4BXWA 5EPNA 3OTJE 2P16A 3ZZ7A 4Q7ZA 1UVTH 2RA0A 2A5KA 2JETC 4TWYA 1SHYA 3KEEA 3LGWA 2P8OC 4K1SA 4JZIA 3TK6A 3FP6E 3NXPA 2C8ZB 1MTNB 1AO5A 4OS2A 1LCYA 1GJCB 1K1MA 4TYDA 1G2LA 5I46H 4KP0A 3BIVH 1KTTB 1ZSLA 1FV9A 5FPTA 4ZKRU 1EPTC 1A5IA 1FZZA 4YT6H 5CDFE 4B76A 4O3TA 1C2GA 1UTQA 2VVUA 5I25A 1MD8A 1A0JA 1E1QD 1ZLRA 2PGQB 1P04A 4NSVA 1C9PA 1NU9A 1VJAU 2ZDKA 3TVJB 4LK4A 4DG4A 3B9FH 3SV9A 4JYTA 2CV3A 4I8JA 3M5NA 1CA0C 4AX9H 1ELBA 3LU9B 1GL0E 1THSH 2OP9A 1UTPA 1VGCB 2XWBI 1T8MA 4X2VA 3BG4C 3SQHE 2XYAA 1O2JA 1HAYB 1PYTC 1ZTKA 1OS8A 1EP5A 2FTLE 1GI6A 2GP9B 1F0UA 3QLPH 1UTLM 2FYRA 3GDVA 4YOJA 3PYHA 1HLTH 4WY3A 1VITF 1EJAA 1UTOA 4GCHF 5HM2A 3AW0A 2ZGXH 1S0QA 1YLNA 2Q6GA 1XMNB 1O5FH 1OP2A 1OWHA 3RMMH 1HAXB 4A6LA 3LH3A 1EAWA 6GCHF 1HAGE 3U28C 1YBWA 1J9CH 1DITH 1YGCH 2OBQA 1B7XB 2QGRA 2VWMA 1S5SA 2A7HA 3C27B 3SV8A 3EE0B 4K1EA 4DURA 3OU0A 2BZ6H 1MAXA 1PQAA 1H8IH 5EOKA 3NK8A 1UK3A 3SJOA 2QC2A 1MQ6A 1TPPA 2BY6X 4VGCC 2ZFTA 1A0HB 1OWEA 2J4IA 1ANCA 3ZZAA 5FBIA 3F9GA 3VG8A 1AKSA 1GHAG 1GMDF 1L0ZA 1GBTA 4RKOB 5A0BA 2R9PA 1PFXC 4BAQB 2VH0A 5FCKA 1P57B 3FZZA 3RXPA 1SLVB 1D9IA 3GY4A 1KXEA 1FY1A 1DS2E 1Y3XA 3UREA 1GJ6A 1O2YA 4X1PU 1PPZA 4CRCA 2AMPA 2JETB 2LELA 5GCHG 5HIYA 1GMHF 2P8OB 1ELGA 1DY8A 1W0JD 1INCA 2WPLS 2NU2E 2GCHF 3PROA 3M3VA 1FJSA 3HGNA 3I78A 4P02A 1TBQH 1GBHA 2C4FH 1Z8JB 1CT2E 3Q3XA 4NCYA 1GI3A 3S9AA 4OS7A 1FY4A 3KL6A 3RXIA 3RXEA 1O3DA 1NFUA 1P3CA 2Z3EA 3A8CA 1KXDA 1OWJA 2FI4E 3RXMA 1EPTB 1O37A 2BHGA 1AIXH 2A31A 1A61H 3U8RH 3BTGE 5HYOA 4X6MA 2PTCE 3OE7D 1H1BA 1S83A 4MDSA 2J92A 4D9RA 2ZHDA 1O5BB 2CMYA 3RU4E 4DW2U 1MBMA 1MU6B 1H9IE 3OYPA 4DCDA 1AGJA 4IC5A 5ESBA 3MYWA 1O3OA 5A2MH 4I7YH 1BHXF 1KLTA 1OXGA 2VWOA 1U6QA 2QE7D 4CBOA 1VKYA 5DP4A 1NZQH 3RXOA 3BG4B 1UHBB 2ODQA 2W3KA 3H09A 1GWAA 2AGEX 4IGDA 1BTZA 3PTNA 3GS9A 1ZMLA 1EAUA 2PKAA 1T4VH 1T4UH 2CK3D 3RXKA 2FM2A 1HDTH 1DSTA 1QRXA 5GWZA 1AFQC 1KY9A 2OC1A 3I77A 1QHRB 1LKBA 1O5EH 1MU8B 2LNCA 3SZEA 1UK2A 1C1WH 3EYDA 1ZTJA 1W7XH 3SUEA 4DGJA 1C9TA 2PSXA 2QIQA 1KMHB 1WU1A 3SU1A 3ZZBA 4ZKNU 1C5PA 4I32A 2F9VA 1UVPA 1ETRH 1ETSH 2D1JA 3A82A 1NU7B 1BTUA 2OD3B 1TGSZ 4VGCB 1TNLA 2ZO3H 2GKVE 3P8NA 1GCTC 5EJZA 1ARBA 2ANYA 2ZTXA 2ZF0H 2ANWA 7KMEH 1CE5A 1AE8H 2A2XH 2V6NA 4ZHAA 1TPOA 1GJ4H 2Z9LA
chains in the Genus database with same CATH topology
2W5EA 2FLRH 3LPRA 2FX4A 2SGFE 3OY6U 4K3JA 2BXUH 1PQ7A 1C2DA 1SQOA 2SGDE 2RCEA 3KF2A 1A0LA 2ZDLA 2PWXA 1V2PT 3MU4A 1UTNA 1TNJA 3ATMA 2GZ8A 1L1GA 1FPCH 1K1JA 1TIOA 1W14U 2FLBH 1IOEA 1W3CA 2XBWA 3O8DA 4X8SH 2VH6A 2FX6A 1GI9B 4CHAC 4I8KA 3TIUA 1HIAB 1C4Y2 2G4UA 1F0RA 2BY9X 3D23A 3TITA 3T29A 3L33A 1P2KA 2HGTH 1SGYE 3M5LA 4DOQA 1LVOA 3RC4A 5LPFA 5EXLA 2TGDA 2O8WA 9ESTA 2WYJA 3PTBA 1C5WB 4X2WA 3STJA 2FDAA 1H8DH 2HWLB 4GHTA 5K7RA 2SGAA 1F5KU 1WQVH 2B5TB 5EODA 4ZKOU 2O8MA 1ZTLA 2XCFA 2ZGHA 3S69A 4E05H 1A4WH 1BRCE 3GYLB 2ZU1A 4X6NA 2BVRH 3ZV9A 1QTFA 4XBCA 3EAJA 3M7QA 2PTNA 4FUFA 3RXVA 5AF9H 1C1MA 1SGNE 1TPSA 1ZRKA 5DK1A 1YPJH 2H5CA 2ZPRA 1NRPH 2OTVA 1SSXA 2ZZUH 1LVYA 5DKMA 3A81A 1QB6A 2QCYA 4XFQA 3RP2A 3DFJA 2TGTA 4Y8XA 1SGQE 3SV6A 3SUDA 1DICA 2FYQA 3E16B 1NM6A 1XVOA 1Q31A 2ZTYA 1XUJA 2A2QH 1RTFB 2GMTC 2HPQH 2RA3A 1BUIA 1VZQH 3P8GA 1PPGE 2A4GA 1O3KA 3GY3A 3A87A 4CR9A 4BAKB 4FUEA 4JZFH 2P59A 1YM0A 3UR9A 3K6ZA 1GCTB 1GI4A 5TCCA 4OS1A 1DY9A 4X2YA 3ZVGA 4CRFA 4KTUA 1K2I1 4SGAE 2FIRH 2WPMS 3RXRA 1A5GH 1LHFH 1GJ5H 3EA7A 3SI3H 3SNCA 1QURH 1YLCA 3U1IB 3F68H 2ZHFH 6LPRA 3MU1A 1MZDA 1G9IE 4AFQA 3KNXA 4HI3A 3SN8A 2C8WB 2Z9KA 2VGCC 4DY7B 1DUEA 1ELEE 1AN1E 1SQAA 4Y7AA 4K8BA 1O2MA 3TJVA 2BD8A 2QXJA 1CT4E 3N7OA 3ZZ5A 3AASA 4CH2B 1WYKA 4AG1A 1LQDB 1EJMA 4TPYA 2P3UB 3ZVFA 4YTAA 1EXFA 1FIWA 4OS6A 4Y11E 1EX3A 1W12U 2ZU3A 4CHAB 2DE9A 2QN5T 2P3TB 4E7NA 1ELVA 5L30H 1TRMA 2O8TA 4MLFB 3U9AH 2PV9B 1MAYA 1TA6A 4FXGH 4I8LA 1AD8H 2WINI 3MH7A 1YC0A 3A7VA 6CHAC 8KME2 4YOIA 3TNTA 1DWBH 4BANB 4JYVH 2GV7A 1O33A 3TK9A 4Y71A 1AZ8A 1YF4A 1CGHA 1GI8B 1LKAA 1NPMA 3BEUA 1FY3A 3P70B 1O3BA 2VIOA 1XM1A 3CS0A 1BT7A 2R2MB 4AYYB 3ESTA 4BTUB 3EA8A 1G30B 4ZAEA 2BD5A 4RN6A 2ZDAH 3BTWE 2PR3A 2M5TA 2AEIH 3LJOA 2A7JA 3MWIU 4H4FA 1GBIA 3E3TA 1CGIE 1HAIH 2P95A 2FS8A 3E0PB 1DXPA 2GMTB 3AVZA 3MNCA 2BTCE 1E35B 2ZHQH 1Z6JH 1BMAA 4FU9A 2XWAA 4KKDA 5C1UA 5EW1H 1BTXA 4AN7A 1ETTH 1Y8TA 3SU0A 2FOHA 1L4DA 1OP8A 3GY6A 3LGTA 2SNWA 3A89A 2I6SA 3RMLH 1C5LH 1P02A 5CE1A 1O39A 2OCVB 2ULLA 2Y5FA 4DIHH 2VGCB 1DVAH 2HLCA 2ZGCA 1SMFE 1WQSA 4A1TA 1BBRK 4ZXXH 1JRSA 1BQYA 3QX5H 1QL7A 1CHOF 3BTHE 3M36A 4FUGA 1THPB 3RXGA 3V12A 2H1UA 1JOUB 5BPEA 1A2CH 2BDYA 1O2GH 3GCTF 1BB0B 1TNGA 1DWEH 1PPEE 3SJ9A 5DP8A 2WV5A 3SOSA 4WJG2 1Z1IA 1P8VC 1N1LA 4D76A 2GTBA 3VFEA 1IAUA 1V2TT 4NFEA 1F5LA 4K60A 2ODPA 5F8TA 5TCAA 3VXFH 1WBGB 3ATKA 1V2WT 4X1NU 3ZVBA 4Y8YA 4I8HA 5FPSA 1LDTT 2G51A 1C1VH 2BY7X 1GHBF 1ZRBA 3SNDA 1GBKA 6CHAB 2QV1A 1SVPA 1D4PB 1P3EA 1N6XA 3LC3A 4QT8C 3SUFA 1B0FA 2WUCA 1YPEH 5T6DA 3FP8E 1EB1H 1AUTC 2B7DH 2ZCLP 3BTKE 1FY8E 2UUYA 2ZGBH 2Z3CA 1FONA 2P94A 1T32A 3KQEA 3ENSB 1O2XA 1F2SE 1YKTA 3PB1E 3P17H 5FPYA 4E7RG 1LHEH 1EZUC 1EAXA 4AZ2B 3ZZ8A 1IHSH 2VVCA 1NY22 1YCPH 1HNEE 2HALA 1K22H 3LGYA 1FUJA 1L4ZA 2ZPSA 3KIDU 1SC8U 1KSNA 4MTBA 3GY5A 3ZZ6A 5AFYH 2BLQA 3A7ZA 4Q80A 1OWKA 2V3OH 4DJZB 4X8TH 1TBRH 2B9LA 2IJOB 5T3HA 1O2KA 1IQLA 4ISLA 1ESAA 1NRQH 1E38B 1O5CB 2Y82A 1Y3VA 4TY7A 4F4OC 2ZECA 1FAXA 1SFQB 2C93B 2VIVA 1NO9H 1O2VA 2BD9A 4WWYA 3MU0A 1DWDH 3O8BA 4H6TA 1T7CA 1TBZH 1LQEA 1P2IA 5C5OA 1V2ST 1EZXC 5IDKA 1GI7B 4MNXA 5DG6A 3Q3YA 2BQ7B 2F83A 1TOCB 1XKAC 1NT1A 1GJ9B 1FAKH 1GL1A 3RLWH 1C2MA 1DPOA 1P2QA 2BVSH 2HVXA 1GI5A 5T6FA 1G2MA 1EZQA 2QYIA 1QJ1B 1FNIA 1K21H 1O3EA 3VB6A 3FVFB 5GDSH 3RXJA 3ZVAA 4ZUHA 1ANBA 4GVUA 5F03A 1HCGA 1O3FA 3LONA 2RDLA 4FUBA 3S9BA 4Q2KA 4AGKA 1NC6A 1A7SA 5JB9S 1NN6A 4WMFA 2XBXA 2VNTA 1NROH 3ODFA 3RMNH 1ZHRA 3SQEE 1O2TA 2C3SA 1PPHE 1FY5A 1P2OA 2V3HH 1SGRE 4K5ZA 3NZIA 1BMLA 3SORA 3EQ0H 2GDEH 2VIDA 1C2HA 3TGJE 3B8JA 3E90B 3U8TH 2A4QA 2F9NA 1WAYB 1T8OA 2F91A 1IQKA 2G52A 5DP6A 3SGAE 3V7TA 4Y7BA 1MZAA 3CP7A 8LPRA 2BLOA 1CBWC 4JZEH 5C2ZA 1ANEA 5HGGA 1O3CA 3BSQA 1RTKA 3QZQA 4FUHA 2GCHG 3PLKA 3RXBA 2OQ5A 2BQ6B 4GHQA 1IQJA 1AY6H 1HRTH 4CRBA 2ZFSA 4UDWH 1TMTH 1ACBE 3GISB 1OYQA 2G55A 2ZI2H 2VWLA 1D3QB 2BXTH 3DA9B 4XDEA 3A7WA 1O36A 2Y7ZA 5E8EH 1T31A 3TJOA 2HOBA 4FUDA 1V2VT 1GHAF 2BLVA 1ZR0A 2XC5A 3A83A 1O2ZA 3MH4A 1SOZA 2C8YB 1V2NT 1MTWA 1MKWK 1LPKB 4NIWA 2Q6DA 1LVMA 1XUKA 1SGPE 2QF0A 2WUBA 3A7YA 1TGBA 1HYLA 5EU8A 1ZPCA 2O9QA 2FOAA 1ORFA 4Y79A 2CGAA 2VIWA 2PKAB 4YLUA 1GVKB 2EC9H 4FVDA 1KTSB 2THFB 1FIZA 5HXFA 1CA0B 3O8CA 3D49H 4DT7B 2GZ7A 1DLKB 4ABJA 1LHDH 3RUOA 2FTMA 4FUCA 3HPTB 4WF8A 2FESH 1O2QA 5A8XA 1TMUH 3PMJA 3UR6A 2VU8E 1IQHA 1EATA 1YPLH 1HJAC 3QWCH 4H42U 1ZOMA 2BD7A 2BZAA 3SNAA 2D2DA 2ZFPH 2HNTC 1GI0A 3M3TA 1G3EA 1D3TB 4K2YA 1H4WA 1QCPA 1Y5UT 1AQ7A 2VWNA 2STBE 4NIYA 4X6OA 5GXPA 1F0TA 2BB4A 2H9HA 4ABIA 4NIXA 5FCRA 1EPTA 1XUHA 1T8LA 3SZNA 1LO6A 1VJ9U 2J95A 2ANKH 2UUFB 4A5TS 1MQ5A 3DUXH 2YNAA 3UOPA 1YYY1 3CS7A 3K2UA 4U30A 2AIQA 1MTUA 1A5HA 1Y5AT 2PUXB 3T26A 1EAIA 3UFAA 2NU3E 1BTYA 1M9UA 4YT7H 1O2HA 1B5GH 4J2YB 2WV4A 1UHBA 1QL9A 2G81E 2V0BA 1ESTA 1O2SA 1C5UA 1CBWB 2XRCA 3RXFA 1BMMH 4MPVA 2A4RA 2BDAA 1P03A 1B0EA 2F9BH 5AHGH 1RRKA 2TBSA 1QBVH 2A1DB 4ABFA 1ELDE 1O5AB 1X7AC 3O8RA 5K0HA 3TGKE 5A8ZA 3TJUA 2AFQB 2F3CE 1BJVA 5FXLA 8GCHG 3SU6A 1GHZA 1GJAB 4PROA 2YOLA 5DPAA 2QAAA 5GPIB 3F1SB 2AS9A 3ODDA 3OX7U 3V0XA 1W2KH 2R3UA 1CT0E 1CVWH 1PYTD 1C1NA 1IQEA 1BJUA 3LOXA 3ZVDA 2GT8A 1RD3B 3SO3A 1OYTH 3DT0H 1V2LT 4B2CA 5C1XA 3P8FA 4ZROA 2Q6FA 1O3JA 3TJNA 2R0LA 1YCPM 1GVZA 2P93A 4GUXA 4UEHH 5GIBA 1IQGA 4FUJA 1GBBA 4AB9A 2G8TA 1GBFA 5CMXH 4NIVA 2DE8A 1G3CA 1L2EA 1GBJA 1S85A 2ZCHP 8ESTE 4Q7YA 3E8LA 1E36B 3VB3A 4ZHMU 1O2PA 1QA0A 2XC4A 1TGTA 1K1PA 3Q76A 4FUIA 2VIQA 2UWPA 2ZFFH 1HJAB 1LMWB 2Q1JA 3NUMA 1AB9C 3SJIA 1AVXA 3SGBE 1IQMA 3IG6B 1D3DB 5HMAA 2W3IA 2H5DA 3NCLA 1C1OA 3FZDA 3MH6A 1DANH 4X1QU 2KAIB 2UUJB 2BM2A 1XUIA 1O2OA 1AFQB 3TH3H 2WYGA 3ZZ3A 1OPHB 3LH1A 1HIAA 1LPGB 3PMHB 4XE4A 5FX5A 2ZU2A 2PW8H 5JBAS 4CRGA 1SLXB 3P6ZB 3MO9A 4DVAU 1OP0A 1GHXH 1K1NA 1Y3YA 3UUZA 3SJ8A 4K8YA 5F8ZA 2AIPA 1HAVB 3RXAA 1E34B 1W0ZU 2ALPA 3HK6B 1GDUA 1SGCA 1SL3A 2H2ZA 3A8DA 3BIUH 3RXTA 4NA8A 1QBOA 2AERH 1O5GH 3GY7A 1W11U 3STIA 3SJKA 3SV2H 2ZQ1A 2G4TA 2J94A 3A80A 3M37A 3HATH 1VCQA 3NKKA 1H9LB 4OGYA 5J4QA 1C1UH 1NS3A 2FZZA 2A5AA 2TGAA 2ZU4A 4UE7H 5T6GA 1O2RA 1S6HA 2Y6TA 4YZUA 2A0QB 2W7SA 5B6OA 2Z3DA 1NESE 1O5DH 3BTQE 5PTPA 1FN8A 1AVGH 5JYIA 1GDNA 3RXUA 1OSSA 1EOJA 1QA7A 1FI8A 1A1RA 4X8UH 2OC7A 1O3MA 4O9VA 3ZZ9A 2R0KA 3BEFB 4IC6A 2CXVA 2ZDNA 2XBVA 3K6YA 4GPGA 1GBDA 1KLJH 5DGJA 3KQBA 2A32A 4LOYH 1FPHH 1ZZZA 1O38A 2ZFQH 3GY2A 4IN2A 4WH6A 4INKA 1RXPA 4ZXYH 1PQ8A 1K1IA 3UQOA 2ZIQH 4BAHB 1JXPA 2FI5E 1EUFA 1UTMA 5EG4A 2AGGX 1BRAA 1UCYK 2BD4A 2PKSC 3RU4T 2FWWA 3UWJH 1P9SA 3JZ2B 1HB0B 1C1TA 1TX6A 3GCHC 1DWCH 1O34A 1AB9B 2J9NA 1DXWA 2EI8A 2BDIA 4O3UA 2OC0A 3P92A 3T62A 3EA9A 1G32B 4AG2A 1D6WA 1HAZB 4Y10E 1HXEH 2FI3E 1IQFA 1WCZA 3HKIB 1DLEA 1SGEE 4TWWA 4UFDH 1V3XA 3KN2A 3RC5A 2FOMB 2ZHWH 4HZHA 1V2MT 2XC0A 4GAWA 1BITA 5E0GA 4BAOB 1Z8GA 1G37A 5LGOA 3SI4H 3H7OA 4A1VA 4Y6DA 1OOKB 4U01A 1L1NA 4AB8A 4IW4E 1JBUH 4MPWA 1N8OC 5CHAC 5L2YH 5G4BA 1F0SA 2J2UA 2OUAA 4Q7XA 2FMJA 3NPSA 3T27A 1TNIA 2ZP0H 3ZZCA 1EKBB 2C8XB 4ABGA 5A0AE 1QJ6B 4CH8B 2ZWLH 1C2FA 7GCHF 2IPHA 1DX5M 9LPRA 2BYAX 3QZRA 3V13A 1SGDE 1UK4A 1TQ0B 1A46H 4FU8A 3PM3A 3QGNB 1C5ZB 1MKXK 1DE7H 2A4OA 2BVXH 4HFPB 2EI7A 1AWFH 1GDQA 4OS5A 5EXNA 3ZVCA 4AORA 1QBNA 1DFPA 3RC6A 1Z6EA 1ARCA 3UIRA 2XTTB 3W95A 3ZV8A 3HKJB 1KXAA 2ZKSA 3PV4A 3QTVH 1EZSC 1P2NA 1EASA 2ZNKH 1D3PB 2UWOA 4ABDA 1AU8A 1Z1JA 3MHWU 4NZLA 3URCA 5JDUB 3DHKH 3F6UH 1O32A 1TGCA 4MPXA 4JMYA 3L6PA 1C1QA 2A7CA 1KXCA 1V6DA 1ANDA 1ZJDA 3PLPA 1KXBA 3LDXH 2DUCA 4BOHA 1G3BA 1SI5H 2WPHS 1ABIH 3V3MA 1PQ5A 1MTVA 1KDQB 1THRH 1O0DH 2NWNA 1NRNH 3BTME 1BTHH 2WPKS 3RXQA 2GZ9A 1QR3E 3W94A 2F9PA 2PKSB 1GMCG 1SGFA 4X6PA 3PWCA 5JPMH 2BOKA 4UONA 1O2NA 1RGQA 3GCNA 4ABEA 2W7UA 4AOQA 2GDDA 2FODA 3K9XB 4KELA 1S6FA 3SGQE 2BY5X 3GCHB 5DP7A 1Z71A 2BDHA 4J1YA 1PPCE 2QXGA 1O3HA 3Q00A 5L2ZH 4KTCA 3S0NA 3FANA 1HAHH 4BNRA 4B1TA 2QA9E 4E06H 1P01A 1P2JA 1O31A 2OXSA 3KHVA 5TJXA 2ZCKP 1GBCA 3KQDA