4ABHA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abhA02
2VVCA 2FMJA 4HI3A 1QL9A 4DURA 2VIQA 8GCHG 1W7GH 1ELAA 3LGIA 1D3TB 3TGKE 3BTGE 1BRUP 1O3MA 3P95A 1HJAC 1KLJH 1PPHE 2TGTA 1MTWA 1SGFG 2ZGJA 3S0NA 1UTKA 1LQDB 1FUJA 1GHBF 3I29A 4ABEA 5DKMA 3SU4A 4FXGH 1G2MA 1C5YB 4WMFA 5L2YH 1PPCE 1NFUA 2FI5E 2OC8A 3A86A 1C2EA 2ZNKH 3BTKE 3M3SA 1O3KA 4CH2B 1LHFH 2CF8H 4GSOA 1YPLH 3U8TH 1KTSB 1NZQH 5DP5A 3F9HA 1WQSA 2QF0A 4NZQA 3RMMH 4BOHA 1MQ6A 3BG8A 1TRNA 3MO9A 1FY5A 1UO6A 2OC0A 4WWYA 3QN7A 3SI4H 1J8AA 3QWCH 1T8NA 1DVAH 1SOTA 1PQAA 5DP9A 3SNCA 2FOAA 2P16A 4U01A 4YTAA 1SQTA 1HGTH 1P9UA 5IDKA 1XUKA 2AIPA 3ZV9A 1DSUA 4GCHG 4Q80A 1XKAC 2QAAA 4JZEH 1UK3A 3M5LA 3L3TA 2VWNA 2WYJA 5JPMH 1WV7H 3URDA 1RGQA 5A8YA 2J94A 2ZPRA 4MTBA 1LVBA 4KTCA 1SGCA 2Y82A 4Q7ZA 1QFKH 4X2WA 3VGCC 1ELDE 3F1SB 2HPPH 3BEFB 1IQKA 3E0PB 2B5TB 3A7WA 2A5IA 4WH6A 2FOHA 1M9UA 1SGTA 1QNJA 1AI8H 4BANB 1AWHB 1D3DB 4D7GA 3KNXA 2A4GA 2OQ5A 2FX6A 3UIRA 2GD4B 1L4DA 2Z7FE 4K5ZA 4D9QA 2WPMS 3FVFB 1HB0B 1ANDA 1YP9A 3CENA 1PQ8A 1HAPH 1Q2WA 1UTOA 2BOHB 2GV6A 1P2MA 2Y80A 1IAUA 1NT1A 5SGAE 1GI3A 1TPPA 3UNSA 1ELEE 2NU4E 2P59A 2ZFTA 2H5CA 1O3NA 4J1YA 1O2NA 1UVTH 2B8OH 1F7ZA 1O5DH 2UUYA 1GHAF 1BJVA 4Y7BA 1PPFE 1FXYA 2QYIA 1BITA 1MU8B 1ZZZA 2PKAA 3P6ZB 1LVOA 2VB0A 4UDWH 4DIHH 2VU8E 3U98H 1A3BH 3SI3H 1SG8B 3RMOH 5AVDA 2BDYA 2FIRH 2P8OC 4O97A 1CT0E 4B73A 3BSQA 1GJCB 1FI8A 4CREA 1UHBB 5JBAS 4OS2A 3KQBA 1C5MD 2G55A 4HTCH 4X1QU 4XFQA 5L2ZH 2XWBI 1P2NA 3LU9B 1GL0E 3SU3A 1DUEA 1CU1A 4XBCA 3KHVA 2BDHA 3AAUA 1SHYA 1TQ0B 5A0BA 2BD3A 4FUIA 3SU5A 3ZZBA 1A46H 5E8EH 3ZZ7A 3V3MA 1H9IE 2Q1JA 1O2WA 5EOKA 4YOJA 3SHAH 1BRCE 5DO4H 3TK5A 1Y5UT 3PMBB 4AFSA 1O5AB 4I8JA 3MFJA 1TNGA 1GJDB 2OLGA 1L1JA 1V6DA 1XUJA 1GBHA 4CR9A 1ARCA 1OWDA 3RXUA 1ZSKA 3T27A 3MOCA 3JZ2B 1JIRA 2ZZUH 3MNCA 1BTPA 1C5OH 5J4SA 1BIOA 2AIQA 5DGJA 3SUGA 1EZSC 3KL6A 1GHZA 3P8OA 1W7XH 2D1JA 3RLWH 1BBRE 3Q76A 4Z0KA 4X6PA 1HAVB 3KGPA 2XBWA 3P17H 1P01A 1LHEH 1GGDB 4JMYA 1C5ZB 2BVRH 4WH8A 3P8GA 2A31A 1MUEB 2VWLA 4FUJA 2GZ9A 3TJOA 1AMHA 1NO9H 1GI2A 3D62A 4GUXA 4KTUA 3MU4A 1WU1A 4MG3A 4RN6A 3NPSA 4NFFA 1ZGIA 2C4FH 1V2RT 1B0EA 2BY7X 3SJKA 5C3NA 4NSYA 3PMAB 1XM1A 1D4PB 2ULLA 1O33A 2WPLS 2ZGBH 4X8UH 4JYTA 1Y5BT 4K3JA 1O3AA 4ISHH 2BOKA 1DLKB 2BLQA 4YT6H 2ZGCA 2ZFFH 2EC9H 1HAOH 1T8LA 1OYQA 4NGAH 5E0HA 5HXFA 1J9CH 3PWBA 4I31A 1NRRH 2EI7A 2ZDNA 2CV3A 3SOSA 1IQMA 2Y7XA 4WF8A 1SFQB 3QX5H 3FP6E 2XC4A 2D26C 1V2LT 3U69H 3P70B 3GCNA 1UCYE 2W3KA 2VNTA 7GCHF 1EJMA 1O2UA 2O8TA 1MKXK 1NPMA 5LH8A 1HNEE 4BAHB 2J92A 4YESB 4ABFA 1UCYH 1DSTA 1NY22 2OQUA 4Y8ZA 1D3QB 1ELGA 2TGDA 1W11U 2ZU2A 4X2XA 1GG6C 1OPHB 4B1TA 1F0UA 1SLVB 1O3DA 1SGIB 1KLIH 4MNWA 1QJ1B 1CA8B 2ZDVH 5A8ZA 2V35A 4BNRA 2Z9KA 1EJNA 3TGJE 1IQLA 1J14A 1E38B 1MBQA 2VVVA 1UHBA 3RXDA 1EOLA 3RXFA 1NRPH 2BY8X 3EYDA 4ABDA 1C9PA 1WBGB 4H6SB 4HFPB 5EW2H 3RP2A 1KIGH 3MMGA 1CT4E 4DT7B 3GY8A 2ZA5A 2M5TA 1CGHA 4WJG2 3TNSA 4A1VA 1BJUA 1LCYA 2FLBH 4MDSA 4UFFH 2DUCA 3B23B 4GVUA 3O8CA 2O8LA 2ODYB 3W94A 4F4OC 4UFEH 2C8WB 1FQ3A 3MU5A 2TBSA 4GHTA 1AUJA 1Y59T 4AFUA 1DY8A 7KMEH 1AVXA 1TX6A 3O8BA 3UWJH 5T6DA 1K1LA 1BTUA 5A2MH 2G4UA 2ZI2H 1GBIA 1DM4B 1CGJE 5DJ7A 4Y8YA 1DWDH 1KXEA 2A45B 5HM9A 3AAVA 2A32A 1GI9B 2HNTF 4VGCB 1UMAH 2GX4A 1XUHA 1AQ7A 2QA9E 4ZXXH 2CMYA 1ETRH 1VR1H 2QXHA 3QUMP 4D76A 3S7KB 1A1RA 2G81E 1DLEA 4NA9H 3ODDA 4FUFA 1LVMA 1HAVA 3TJVA 1VGCC 2ZTYA 1CBWB 4AOQA 1J17T 1HAIH 5FAHA 1O5FH 3ATIA 2ZPQA 4FUHA 6CHAC 1O30A 4SGAE 1Z71A 3GYMA 4CRDA 1L4ZA 1OX1A 3EA9A 3PYHA 1HFDA 1BT7A 3OYPA 3IITA 1ABJH 1MD7A 3S9CA 2OTVA 3A87A 3TLOA 2F9NA 4GHQA 4K8BA 1KY9A 1LPGB 3GY6A 3LPRA 1Z6EA 1OXGA 3VB6A 1GVZA 1OOKB 1HPGA 2OC7A 3A88A 2QXGA 3ZZDA 3UOPA 2HWLB 3MI4A 5E2OA 4O3TA 3MTYA 4ZHAA 4Y0YE 3MH4A 1GJBB 4A92A 1TX8A 1GI8B 5J4QA 5DP4A 3F6UH 1OKXA 1GVLA 3VB5A 3VFEA 3Q3KA 2PUXB 4GPGA 2BTCE 4UE7H 3ZVGA 1P05A 3BEIB 1PYTC 2HNTE 2WV5A 2ZEBA 4AG2A 4LZ1H 2C8ZB 4OS7A 2AMQA 4JZ1A 4ZROA 4OGXA 4WXIA 1EAUA 5HGGA 2BY9X 1O2SA 3H7TA 5ESTE 1HIAB 1P2IA 5BRRE 1AFQB 1YYY1 1GBKA 4I33A 2OINA 2QV1A 3ZZCA 4NFEA 5CMXH 3QGJA 1O2KA 1GJ8B 1P57B 3RXOA 3H5CB 3TK9A 3TGIE 1T4UH 1ZMJA 1N8OC 2FXRA 4CRBA 2ZU1A 3EQ0H 8KME2 1Z6JH 1HJ9A 4X1RU 1C2DA 3EDXB 3M5NA 4TYDA 1P2QA 1BMLA 1RS0A 2QIQA 1MU6B 4A1XA 3KCGH 1UVUH 2GGVB 4B71A 1QA7A 4YOGA 1T8MA 1BB0B 1BBRK 4YZUA 5JYIA 1C5XB 2H5DA 2AS9A 1GHAG 1LKAA 4ISNA 1SB1H 1ACBE 3ZZ4A 1SVPA 4FUBA 1PFXC 4B2BA 1XXFA 2TIOA 1RIWC 3Q3XA 4FVBA 4I32A 3GICB 4KGAA 1Z8GA 1KTTB 4ASHA 2AGIX 2R2MB 2A5AA 3BTWE 1C2FA 4CRCA 3RC6A 2SFAA 3HGPA 1TQ7B 3TH3H 3W95A 1A3EH 4O9VA 2GP9B 3SU0A 2A4OA 1AUTC 1IQNA 2B7DH 3GY2A 3VXFH 3A83A 2H1UA 2HALA 1NFXA 1XXDA 2G5VA 1LKBA 2Y5GA 4R8TB 3FZZA 1EATA 3A81A 4CBOA 1B0FA 3EE0B 1C1SA 1EPTC 1KXCA 2ZPSA 5F8XA 4ZXYH 5EQQA 3QTOH 3C1KA 5HYOA 2BLOA 2XBXA 4E7NA 1O2IA 1A7SA 3NWUA 1O2PA 2D8WA 5T3HA 1TIOA 3T26A 2BX4A 3L33A 1O3IA 4AGKA 4DOQA 4YLUA 4INKA 2PKSB 3LJJA 4FUEA 3M5OA 2NU0E 3T62A 1UCYK 1UVSH 2ZTZA 3SZNA 1O2HA 1OP2A 3V12A 1P12E 3BTHE 2QCYA 4TWYA 5C5NA 1C5RA 1PPEE 1MTNC 1SFIA 3A7XA 1P06A 3R3GB 4K60A 3PO1B 3A8AA 1C1OA 1GHXH 2NWNA 2VIDA 2ZHFH 4AYYB 2F91A 2TGPZ 1N6XA 4YOIA 1SQAA 3F9GA 2W7SA 2SGDE 1A0LA 4I8HA 3LH1A 1LDTT 1NFWA 3TVJB 2FWWA 2PKAB 1BTXA 2CN0H 1GVKB 4IS5A 4A5TS 1TLDA 3M37A 5EQRA 1S6HA 1CHGA 1DPOA 2PV9B 3A7YA 2EI8A 3RU4T 3LC3A 1AVGH 1IQHA 1NESE 2WINI 1BMNH 1AFEH 1W14U 3DHKH 1PQ7A 1HIAA 4NSVA 2BD5A 2J38A 4I8LA 3S7HB 2GT8A 2ZP0H 1GCTC 1GMDF 2GZ8A 1YPGH 1O3CA 1TWXB 1LVYA 3P8NA 3PMHB 2CHAC 2NU2E 4ZAEA 1O3HA 3LDXH 3MNXA 3RXSA 1XKBC 4MPUA 2XCNA 1KXBA 2R0KA 1MKXH 1A61H 1O5GH 3SU2A 1DDJA 2ODQA 2PHBA 1BMAA 1RD3B 4CRAA 1O3PB 2ZCLP 1GDQA 9ESTA 2F83A 7GCHG 1ELFA 2IN2A 4ABIA 2EEKA 3LGVA 3ODFA 1CGIE 1O3LA 3V0XA 1FIZA 2FESH 1ANEA 3RXGA 2FEQH 2ZHEH 1BTWA 3BIUH 1P04A 3M61U 1RXPA 1Y3YA 2BZAA 8ESTE 2UWPA 1QB6A 1O3JA 2TRMA 5TJXA 2P8OB 5DP8A 2SNWA 1EX3A 3M7UA 1ESTA 2BDBA 2ZFSA 4DG4A 3PMJA 5TCCA 3TU7H 5JB8S 1UJ1A 2Q6FA 3ZYDA 4BAQB 4IGDA 1FPHH 4IMZA 1HAXB 1GBMA 3BTTE 2GCTC 3MO6A 1HRTH 2Z3DA 1EZQA 3C27B 1S83A 2WUCA 3BN9A 1G3BA 1QBNA 6GCHF 3SV7A 1B5GH 4UFDH 4TPIZ 1K2I1 1GMCF 4CHAC 1BHXF 1CA0B 2FZZA 3ITIA 3SV6A 2C90B 3LGUA 1WYKA 1DANH 1W0ZU 2GT7A 1O2GH 1JRTA 1G37A 2ZF0H 4TY7A 1C2JA 1VJ9U 3TJUA 1RTFB 1ZRBA 3LGYA 4OS1A 5CE1A 1DITH 1ETSH 3SQEE 4Y8XA 1GJ6A 1ZHPA 3U1IB 1GI5A 3MH5A 1EXFA 2FPZA 3SBKA 3U8OH 4MQAA 1MTSA 3K6ZA 1L1GA 1AB9B 2ZDKA 3UR6A 1YPJH 1RTLA 1Z1JA 1F5RA 1THPB 1PQ5A 1AIXH 3SUEA 1QURH 1VCWA 1ZPCA 5FXLA 4MPXA 1ID5H 4E05H 3GCHB 1ZMNA 1A0JA 4YT7H 1T32A 4D7FA 5GWZA 5FPYA 1QGFA 2O8UA 1NU9A 5FPTA 1HYLA 1SPJA 4X8TH 1K9OE 3MU8A 1ZR0A 1GDUA 1MH0A 1TPAE 2C8YB 5DK1A 1XVOA 1QRZA 2WUBA 2JETB 1X7AC 2QN5T 1FAXA 3PROA 3PWCA 1Z8IB 4IC6A 1GJAB 2R0LA 1O0DH 3T28A 5JBTA 3GDSA 1Y8TA 2W26A 1JWTA 1S85A 1D3PB 5F03A 1S6FA 1C2IA 1TABE 1G9IE 2I6SA 4AB8A 3O8DA 1C1NA 4FUGA 1YPHE 1MKWK 1MAYA 2H6MA 1LMWB 1TGSZ 2IPHA 1MD8A 1WOFA 2B9LA 3Q3YA 1AVWA 1HDTH 1C1MA 1GPZA 3ENSB 3KQEA 1BTYA 1SOZA 3UNQA 2CGAA 1FN8A 1SQOA 1O3FA 4R0IA 3SQHE 1PYTD 3QO6A 3UTUH 4FVDA 2BD7A 1E37B 2PTCE 3RM2H 1JXPA 1YPEH 1ORFA 1T7CA 1GL1A 3SV9A 3LGWA 1VZQH 4IMQA 4X6NA 1TGBA 4RKOB 1TBRH 1JIMA 1XX9A 3KQDA 2XBYA 3NKKA 4E7RG 4NIYA 2THFB 3N7OA 5GIBA 3ZV8A 1HXFH 4YM9A 1F2SE 3I77A 1BRAA 5A0CA 1JBUH 1E34B 1O2OA 1QRWA 1WSSH 1Y3XA 3OSYA 1WTGH 1P2JA 2Z3CA 1CQQA 1C1UH 1OS8A 1BOQA 1C5VA 1INCA 1E0FD 2ZWLH 5FX6A 4BTTB 1Z1IA 1OWEA 3F9EA 2AYWA 2GZ7A 1BBRH 1EP6A 2ZDMA 4A1TA 1G3DA 4QT8C 1QQUA 3Q00A 3RC4A 1G36A 3ATLA 2XRCA 1TAWA 3LC5A 4X2VA 4OS4A 1TOCB 5EODA 2A2XH 1GBBA 3BG4C 1THRH 3PLKA 3FAOA 1G2LA 1DX5M 1QBVH 5GCHF 1MMJN 1EZUC 2A2QH 3AW1A 3A82A 1F92A 1OWIA 2A1DB 2K1QA 2HRVA 3STIA 3PTNA 1LHGH 1DY9A 1FPCH 1LO6A 2XBVA 1ZOMA 1FY1A 3QK1A 4NA7A 5G4BA 5LGOA 3RXTA 1VGCB 1GHVH 4NWKA 1TONA 2G00A 4CH8B 1DS2E 3RXCA 2ANKH 5JDUB 1TBZH 2ZECA 4Q2KA 1EZXC 1OSSA 1FDPA 3PLPA 3D49H 1GHYH 1XUGA 4BAMB 1F5LA 2FLRH 1P3EA 3GOVB 3MU0A 4KKDA 1UTQA 4ZKOU 2BLWA 3GDVA 1Z8RA 3A84A 3QZQA 2ZDLA 1EOJA 1BZXE 3ATWA 1VJAU 1IQJA 3ZVFA 1PPGE 1V2MT 2A7CA 3SGQE 1ANBA 1C5SA 1FAKH 1O2VA 4FU8A 2ZCHP 1TRYA 1W0YH 2AERH 5FHTA 1H8DH 1T31A 4AFQA 5LPRA 3RDZA 1L1NA 2WPJS 3U8RH 1SBWA 1LHDH 1KDQB 1YLDA 2G51A 2RA0A 3PB1E 1T4VH 4ABAA 3OX7U 1O32A 2NU3E 2XCFA 3SN8A 3DD2H 2W3IA 1TFXA 1J15A 2V0BA 1K1MA 1SGYE 2FO9A 3B9FH 1TMTH 1A5HA 1QL7A 2ZCKP 1GI6A 1LTOA 2F9PA 1GGDC 5L30H 2V6NA 1T8OA 4ZKRU 4K8YA 2ZG0H 1YLCA 2FS8A 4MNXA 3M7TA 1BA8B 5C1YA 3H7OA 2F9UA 2HOBA 1ABIH 2ZHQH 1QB9A 3M3VA 1GMDG 1O5CB 3TH2H 2QXIA 2Y7ZA 1EJAA 2GV7A 2FOGA 1NRSH 2VVUA 2FS9A 1FJSA 2FI3E 1O38A 1P09A 4XBDA 1WCZA 2BY5X 4NA8A 5EW1H 2BX3A 1FY3A 1RFNA 3T29A 2H9EH 4MNVA 2BM2A 1C2KA 2ILNA 4ZHLU 1NRNH 1P10A 1ZLRA 2H9HA 1BRBE 3L6PA 3TITA 1DWCH 3AVZA 5I25A 1GHBG 1B7XB 2SNVA 3UUZA 1TNIA 2Y5FA 3LJOA 1O3EA 1UTPA 3SU6A 4CR5A 1ZMLA 2ANYA 5ABWA 3DT0H 1TALA 3EGKH 4H4FA 1JMOH 3VB7A 2XNIA 3MH7A 3F68H 7ESTE 1C2LA 1C1VH 1AE8H 3E6PH 2VGCB 4AYVB 4FU9A 1TOMH 2GMTB 2GVFA 3TNTA 3V7TA 3VPKA 4UFGH 2A4QA 1FNIA 2V3OH 1C4Y2 2F9BH 2XC5A 3QDZB 1GI7B 2ZU3A 4ISOA 1L2EA 2P93A 8LPRA 3A85A 2XWAA 2JH6D 4JK5A 5EU8A 5LPFA 1RRKA 1ELTA 6GCHG 2FYQA 3RXRA 1FONA 3ZVBA 1EPTB 1GMCG 2P3TB 1VITF 1AZ8A 1D6RA 1O5BB 2W7UA 3FFGA 4GAWA 4H42U 1S84A 3MNSA 1ZPBA 3NUMA 4AG1A 5F8TA 1EAXA 1C4V2 4X0WU 1EUFA 2Y6TA 2XYAA 3P92A 3TH4H 1MCTA 3EA7A 5DP6A 2FDAA 1JOUB 3CP7A 2IJOB 1C5QA 2QGRA 3FP7E 1GCDA 1HV7A 1GMHF 4CBNA 2Y5HA 1RJXB 3PM3A 2BDCA 2OUAA 3SU1A 1KXDA 3KF2A 1GBJA 3ZYEA 1YPMH 1Z7KA 2BZ6H 1CE5A 3LOXA 5C1XA 4TY6A 1ESBA 5T6FA 4K1EA 1O2MA 2V3HH 4VGCC 1O3BA 1DXWA 4M7GA 2HGTH 1YM0A 1HLTH 4RSPA 1KDQA 1JRSA 3A8DA 3ZVCA 1UK2A 2PLXA 5C2ZA 1ZHMA 1UVOA 5T6GA 1V2QT 3U9AH 1GBFA 1W13U 1BUIA 3IG6B 3A8BA 4JCNA 1MTUA 1V2UT 1AHTH 1CBWC 3BV9B 2R3YA 1GI0A 1P2OA 3U1JB 4NCYA 2Z3EA 2WPKS 1MKWH 4JZIA 1AU8A 4BXSA 1TPOA 3CS7A 1MQ5A 1PJPA 5A09A 1O2LA 1SI5H 3K65B 2CHAB 3DFLA 3NZIA 4YLQH 4WMEA 3RXAA 1HXEH 4Y11E 3STJA 4NIXA 4U2WA 4DJZB 2BVSH 2YNBA 1TRMA 4Y10E 3BTDE 4IC5A 1HJAB 3K6YA 2LPRA 4PROA 1HUTH 1MZAA 2BDAA 1S81A 1IQEA 4OGYA 2ASUB 2FX4A 1O2TA 4ZKNU 1AZZA 1UTLM 1YCPH 3T2NA 1TA6A 5GDSH 1TB6H 5DP7A 4BAOB 1HJ8A 2BD8A 3ZZ6A 1V2KT 2ZFQH 5GJ4B 3RXQA 5CHAC 3LT3A 2C3SA 3NXPA 4U32A 5JBCS 1AN1E 1O37A 1QTFA 1W3CA 2HPQH 4K2YA 1A2CH 5HMAA 3SNEA 1P3CA 4ESTE 4Y79A 5EXNA 1QA0A 3KQCA 1OWHA 9LPRA 3SV8A 3ATMA 2VH0A 1TYNA 3QLPH 1MCVA 4ZH8A 5LPEA 1NS3A 2ZU5A 1HAZB 4CHAB 1THSH 1ESAA 1SSXA 3RXKA 1EPTA 3WY8A 2CJIA 4K1TA 3R0FA 1GHWH 1FZZA 4TWWA 3MYWA 3F9FA 4K1SA 2UUJB 2SGQE 1A4WH 1HAHH 1S82A 2BXUH 3VGCB 2GCHF 3BEUA 3GCTF 3QTVH 5GCHG 2BD2A 2ZHDA 3Q77A 1Q31A 5EQSA 1XMNB 2OCVB 5HM2A 1EAWA 1G3EA 3FZDA 3PTBA 2BQWB 1J16A 3MU1A 4ZMAH 2OP9A 1YC0A 3GISB 1V2NT 4WXVA 1ZRKA 1P02A 2BD9A 2R3UA 2JH0D 3OU0A 4BAKB 2BLVA 1V3XA 2UUFB 4H6TA 3A80A 3TIUA 4Z6AH 1C1WH 1ZSLA 2AGEX 3RXMA 1O2ZA 2WPIS 3HKJB 1HAYB 2J4IA 1SC8U 3IWMA 1E36B 3D65E 1DWEH 1O3OA 3HPTB 1UTMA 3URCA 5I46H 2A5KA 4U30A 4AFZA 1GDNA 3KIDU 1D9IA 3HATH 3UQVA 2FTMA 1G3CA 1XUIA 4IN1A 1EB1H 5EGMA 1P0SH 1BCUH 1MTVA 3ZZ8A 4DW2U 1UTNA 4NZLA 4WY3A 3OY6U 1TMBH 2ZGHA 1ANCA 1ARBA 5DPAA 1C2HA 2Z9LA 2A7JA 2SGPE 2DE8A 1NN6A 2PKSC 1TMUH 3A8CA 3MH6A 3UR9A 4ABHA 5C67A 1EAIA 2FYRA 2ANMH 1QB1A 3BTEE 3UY9A 4UONA 3TJNA 1HAGE 1G32B 2G4TA 4O3UA 2AMPA 3PO1C 1SGDE 2AFQB 1O5EH 5AFYH 4AORA 2CXVA 2FOMB 2Z94A 1GBTA 4ABBA 1NU7B 1ZJKA 1AO5A 4KP0A 5EG4A 3SJOA 1ELBA 4X8VH 2YOLA 1WAYB 4ZKSU 1GBDA 1ELVA 3FANA 1C5PA 3S69A 1GJ7B 1GJ9B 1SR5C 1CHOF 3OY5U 4D8NA 2GDEH 1HCGA 1NM6A 2XC0A 4NG9H 4X1NU 4X1SU 2DE9A 2J9NA 3PV4A 4BTUB 4MLFB 4KELA 2ZFRH 1CSOE 3SO3A 1Q3XA 2STBE 1GI4A 2A7HA 1C9TA 2A4RA 4MVNA 4Y0ZE 2D2DA 2TPIZ 3BTFE 3NK8A 3VB4A 3BG4B 3SNBA 4DIIH 3LKWA 1O2QA 4INHA 2XW9A 1O2XA 1QJ7B 3SGAE 2Z9JA 1V2WT 2J2UA 2Z9GA 1S0QA 1AKSB 2OC1A 3VEQB 1GWAA 1O34A 3ZZAA 1C4U2 1KSNA 4B75A 4A6LA 1SLUB 1YPKH 3AASA 4WMDA 5FCRA 3UREA 5B6OA 2VWOA 4LXBH 2VIPA 1SGRE 1SGNE 3ELAH 1AWFH 2OD3B 4AZ2B 1TNHA 4E06H 2O9QA 3ATKA 4TPYA 5A8XA 3RXLA 5FPSA 3NCLA 1VITG 5IYTA 3UOUA 1AGJA 4J2YB 1TGNA 4B76A 1U6QA 5AHGH 3K2UA 4MPVA 3B8JA 2C93B 1QJ6B 4ZHMU 1GG6B 1GBCA 2ESTE 5E2PA 4MNYA 1TNKA 1CA0C 4JK6A 3SUFA 1K1IA 1GMHG 4FUCA 1C5LH 5K0HA 1YCPK 4HZHA 1O36A 2VH6A 1FN6A 2H9TH 3UQOA 3BTME 1ETTH 1K1PA 3P8FA 4AGJA 4OS6A 2ANWA 1BHXB 1H4WA 4YO9A 4ZUHA 2PSXA 2A0QB 4A7IB 3BF6H 3LGTA 1SLWB 1O35A 1KXFA 1SHHB 2PUQH 5BPEA 5PTPA 1FMGA 4AB9A 1CT2E 3RU4D 3V13A 1CVWH 1AB9C 1AD8H 1IHTH 1Y5AT 1C5UA 3MO3A 4FUDA 2ZC9H 2OBQA 3QGNB 4X1PU 2BY6X 4X2YA 1TNJA 1WQVH 3E91A 1EB2A 4UD9H 1NROH 3SGBE 5FCKA 1C2MA 4JZDH 5H4IB 1EQ9A 2TGAA 5F8ZA 4X6OA 3GCHC 1F0SA 4ABJA 2GTBA 1C2GA 1O2YA 1K1NA 4F49A 1ZTJA 4Y7AA 1DUAA 1OWJA 3ZVAA 2BQ7B 3RXVA 3RXIA 3RXBA 1SMFE 2WYGA 1SGPE 2WPHS 5C20A 2JETC 3TK6A 3MHWU 2UUKB 4FU7A 3E90B 1DWBH 4X8SH 2BDGA 2F9VA 2VINA 1SGQE 2ZHWH 3M5MA 4OS5A 3KN2A 1H8IH 1EP5A 4Y76A 1V2TT 8GCHF 6CHAB 4I8KA 1C1QA 1ZSJA 2FM2A 3RMNH 3RMLH 3ZZ9A 2Q6DA 1TE0A 2R9PA 1RTKA 2Y81A 1DXPA 1P2KA 1OYTH 1NFYA 1OP0A 1D6WA 2H2ZA 5E0JA 3UPEA 1C5NH 3DFJA 1N1LA 1C5TA 1AKSA 3KEEA 4X6MA 1QHRB 1BQYA 1UVPA 4DVAU 3RXJA 2JKHA 1ZTLA 3RXPA 4UEHH 1CO7E 2HVXA 1O3GA 2OBOA 3GY7A 3E1XB 4BXWA 1Z8JB 4JYUH 4Q7YA 2ZFPH 2BXTH 3ZVDA 3RU4E 1O2RA 5GXPA 1YCPM 1YPHC 2B0FA 2FTLE 4HGCA 3T25A 3S9BA 3S9AA 5FBIA 1O31A 3RXHA 1P03A 4GCHF 2GCHG 3GCTG 1YBWA 3VXEH 5ESBA 1FIWA 1OP8A 1XUFA 1N6YA 5K7RA 1EKBB 1DOJA 1TA2A 2KAIB 1ZJDA 2QC2A 3D23A 3GDUA 4B74A 2QXJA 3MNBA 2G5NA 1W2KH 3EA8A 2AEIH 1F0RA 5C1UA 4NIVA 1ZTKA 4XOJA 3SNDA 2Z9IA 5C5OA 2FODA 1N8OB 3SJIA 1MBMA 5EPNA 1KYNA 2SGFE 5DG6A 2P3UB 2BB4A 3DA9B 1QCPA 2R2WU 1DFPA 4DY7B 1VCQA 5FX5A 3SORA 1BDAA 5DP3A 1Y3UA 3BIVH 6LPRA 2ZTXA 2ODPA 3DUXH 3AW0A 1GBEA 5EXMA 1NC6A 3RM0H 1W10U 3RC5A 1RIWB 1G30B 1KXAA 1TBQH 2SGAA 1K21H 2J95A 2ZGXH 1Y3VA 2WV4A 4LOYH 4XDEA 1S5SA 2OXSA 2Q6GA 2FOBA 3MWIU 1GJ5H 2VIVA 1K1OA 1TX7A 5FBEA 1TNLA 2QY0B 1GBLA 3OTJE 5JB9S 1F5KU 4AX9H 1WTHD 3T5FH 1UTJA 1TPSA 2BQ6B 3E3TA 3M35A 3ZZ3A 3M7QA 1DICA 3SJ9A 2ZIQH 2AMDA 1A5IA 1KLTA 1MAXA 1QL8A 3A7VA 3I78A 4IW4E 1LPKB 3HK6B 4XSKU 1V2PT 3RLYH 1A5GH 1K22H 3GY4A 7LPRA 4WVPE 1OWKA 4DGJA 1FV9A 3CS0A 3M3TA 4IN2A 3GY5A 4O03A 2FOCA 4NWLA 1K28D 1S0RA 1O39A 4B2AA 1PPBH 3HK3B 2O8MA 3UFAA 3FP8E 3SW2B 2VIOA 5CHAB 1F0TA 2RDLA 4AN7A 1MTNB 1LHCH 2PTNA 3RUOA 2C8XB 6ESTA 1CHOG 1Y3WA 3E0NB 3SJ8A 2IOTA 3GCOA 1VCPA 1A0HB 1V2OT 1FY8E 3SNAA 2RCEA 2BHGA 1PPZA 1V2VT 5F6MA 1QQ4A 4IBLH 1ZGVA 1NTPA 2XXLA 1C1PA 4THNH 2JH5D 3PLBA 2EA3A 3A7TA 1NRQH 1XVMA 4JYVH 2GDDA 3K9XB 1LQEA 4DCDA 1TGTA 1IQFA 1L0ZA 1SLXB 2YNAA 3EAJA 1FY4A 3SV2H 2AGGX 2BD4A 1GCTB 4XE4A 3GY3A 2QF3A 2KAIA 2SGEE 4I8GA 2HLCA 2I6QA 2W5EA 2BDIA 1ZYOA 4K69A 1C5WB 2PR3A 4B2CA 2ZU4A 1BTHH 1DT2A 5EXLA 2VGCC 2FI4E 1SGEE 1VITH 5ETXA 2GMTC 1AE5A 4BTIB 1HBTH 2BMGB 4Y6DA 1V2JT 2RA3A 2FP7B 1C1TA 1YKTA 1BTZA 1P9SA 2XTTB 1DE7H 2UWOA 2PFEA 2ZKSA 4GLYA 1SL3A 2ZQ1A 1QIXB 5GPIB 2VWMA 3UWIA 2FOFA 3SUDA 1FLEE 2P95A 4RKJB 5JBBS 1V2ST 2BYAX 1W12U 4XBBA 1H1BA 5AF9H 2F9OA 1MZDA 1IOEA 4KTSA 2P3FH 4Y71A 1E35B 1QR3E 1W8BH 3TPIZ 3GYLB 1BMMH 3E8LA 1AY6H 2PWXA 2PW8H 1QRXA 2GCTB 3HKIB 2ZO3H 2AH4X 1AFQC 4SGBE 1LPZB 2STAE 2ALVA 1ZPZA 1YF4A 3ZZ5A 3HGNA 1GBAA 3O8RA 4LZ4B 1IQIA 2G8TA 3LONA 4CRFA 4MPWA 5EPYA 1EASA 4JZFH 3A7ZA 3QZRA 2ZDAH 1C1RA 1GI1A 3A89A 1P11E 1SGFA 2FOEA 2NU1E 5AFZH 1P8VC 3UNRA 2O8WA 2ALPA 4Q7XA 4I7YH 2LNCA 1QBOA 3E16B 2PGQB 3SHCH 3G01A 4ISLA 1K1JA 1ELCA 2UWLA 1TGCA 2VIWA 4LK4A 3RXEA 2ZQ2A 3ZVEA 3LH3A 1QY6A 1ZHRA 2GKVE 3LIWA 2PGBB 2G52A 3ESTA 4INLA 2PSYA 1IHSH 4CRGA 5TCAA 2HNTC 2J34A 2BVXH 3BTQE 5L6NH 1H9LB 4NIWA 2Z6BD 1IQGA 1WUNH 5E0GA 2RG3A 1O2JA 1H9HE 2CF9H 2F3CE 2VJ1A 4ABGA 1GJ4H 1UK4A 4D9RA 3JZ1B 2EI6A 4ISIH 5A0AE 3M36A 3VB3A 2P94A 1YGCH
chains in the Genus database with same CATH superfamily
3WWFA 2VVCA 2FMJA 4HI3A 1QL9A 4DURA 2VIQA 8GCHG 1W7GH 1ELAA 3LGIA 1D3TB 4FOUC 3TGKE 3BTGE 1BRUP 1O3MA 3P95A 1HJAC 1KLJH 1PPHE 2TGTA 1MTWA 1SGFG 2ZGJA 2IJD1 3S0NA 3AK5A 1UTKA 1LQDB 1FUJA 1GHBF 3I29A 4ABEA 5DKMA 3SU4A 4FXGH 1G2MA 1C5YB 4WMFA 5L2YH 1PPCE 3FKSD 1NFUA 2FI5E 2OC8A 3A86A 1C2EA 2V7QD 2ZNKH 3BTKE 3M3SA 1O3KA 4CH2B 1LHFH 3OFND 2CF8H 4GSOA 1YPLH 3U8TH 1KTSB 1NZQH 5DP5A 3F9HA 1WQSA 2QF0A 4NZQA 3RMMH 4BOHA 1MQ6A 3BG8A 1TRNA 3MO9A 1FY5A 1UO6A 2OC0A 4WWYA 3QN7A 3SI4H 1J8AA 3QWCH 1T8NA 1DVAH 1SOTA 1PQAA 5DP9A 3SNCA 2FOAA 2P16A 4U01A 4YTAA 1SQTA 1HGTH 1P9UA 5IDKA 1XUKA 2AIPA 3ZV9A 1DSUA 4GCHG 4Q80A 1XKAC 2QAAA 4JZEH 1UK3A 3M5LA 3L3TA 2KX4A 2VWNA 2WYJA 5JPMH 1WV7H 1FX0B 3URDA 1RGQA 5A8YA 2J94A 2ZPRA 4MTBA 1LVBA 4KTCA 1SGCA 2Y82A 4Q7ZA 1QFKH 4X2WA 3VGCC 1ELDE 3F1SB 2HPPH 3BEFB 1IQKA 3E0PB 2B5TB 3A7WA 2A5IA 5DN6D 4WH6A 2FOHA 1M9UA 1SGTA 1QNJA 1AI8H 4BANB 1AWHB 1D3DB 4D7GA 2RDEA 3KNXA 2A4GA 2OQ5A 2FX6A 3UIRA 2GD4B 1L4DA 2Z7FE 4K5ZA 4D9QA 2WPMS 3FVFB 1HB0B 1ANDA 1YP9A 3CENA 1PQ8A 1HAPH 1Q2WA 1UTOA 2BOHB 2GV6A 1P2MA 2Y80A 1IAUA 1NT1A 5SGAE 1GI3A 1TPPA 3UNSA 1ELEE 2NU4E 2P59A 2ZFTA 2H5CA 1O3NA 4J1YA 1O2NA 1UVTH 2B8OH 1F7ZA 1O5DH 2UUYA 1GHAF 1BJVA 4Y7BA 1PPFE 1FXYA 2QYIA 1BITA 1MU8B 1ZZZA 2PKAA 3P6ZB 1LVOA 2VB0A 4UDWH 4DIHH 2VU8E 3U98H 1A3BH 3SI3H 3EE7A 1SG8B 3RMOH 5AVDA 2BDYA 2FIRH 2P8OC 4O97A 1CT0E 4B73A 3BSQA 1GJCB 1FI8A 4CREA 1UHBB 5JBAS 4OS2A 3KQBA 1C5MD 2G55A 4HTCH 4X1QU 4XFQA 4P02A 5L2ZH 2XWBI 1P2NA 3LU9B 1GL0E 3SU3A 1DUEA 1CU1A 4XBCA 3KHVA 2BDHA 3AAUA 1SHYA 1TQ0B 5A0BA 2BD3A 4FUIA 3SU5A 3ZZBA 1A46H 5E8EH 4B6EA 3ZZ7A 3V3MA 1H9IE 2Q1JA 1O2WA 5EOKA 4YOJA 3SHAH 1BRCE 5DO4H 2M2AA 1Y5UT 3TK5A 3PMBB 4AFSA 1O5AB 4I8JA 3MFJA 1TNGA 1GJDB 2OLGA 1OHHD 1L1JA 1V6DA 1XUJA 1GBHA 4CR9A 3GS9A 1ARCA 1OWDA 3RXUA 1ZSKA 3T27A 3MOCA 3JZ2B 1JIRA 2ZZUH 3MNCA 1BTPA 1C5OH 5J4SA 1BIOA 2AIQA 5DGJA 3SUGA 1EZSC 3KL6A 1GHZA 3P8OA 1W7XH 2D1JA 3RLWH 1BBRE 3Q76A 4Z0KA 4X6PA 2W6JD 1HAVB 3KGPA 2XBWA 3P17H 1P01A 1LHEH 1GGDB 4JMYA 1C5ZB 2BVRH 4WH8A 3P8GA 2A31A 2GJGA 1MUEB 2VWLA 4FUJA 5EJLA 2GZ9A 3TJOA 1AMHA 1NO9H 1GI2A 3D62A 4GUXA 4KTUA 3MU4A 1WU1A 4MG3A 4RN6A 3NPSA 4NFFA 1ZGIA 2C4FH 1V2RT 1B0EA 2BY7X 3SJKA 5C3NA 4NSYA 3PMAB 1XM1A 1D4PB 2ULLA 1O33A 2WPLS 2ZGBH 4X8UH 4JYTA 1Y5BT 4K3JA 1O3AA 4ISHH 2BOKA 1DLKB 2BLQA 4YT6H 2ZGCA 2ZFFH 2EC9H 1HAOH 1T8LA 1OYQA 4NGAH 5E0HA 5HXFA 1J9CH 3PWBA 4I31A 1NRRH 2EI7A 2ZDNA 2CV3A 3SOSA 1IQMA 2Y7XA 4WF8A 1SFQB 3QX5H 3FP6E 2XC4A 2D26C 1V2LT 3U69H 3P70B 3GCNA 1UCYE 2W3KA 2VNTA 7GCHF 1EJMA 1O2UA 2O8TA 1MKXK 5EJZA 1NPMA 5LH8A 1HNEE 4BAHB 2WSSD 2J92A 4YESB 4ABFA 1UCYH 1DSTA 1NY22 2OQUA 4Y8ZA 1D3QB 1ELGA 2TGDA 1W11U 2ZU2A 4X2XA 1GG6C 1OPHB 4B1TA 1F0UA 1SLVB 1O3DA 1SGIB 1KLIH 4MNWA 1QJ1B 3DCLA 1CA8B 2ZDVH 5A8ZA 2V35A 4BNRA 2Z9KA 1EJNA 3TGJE 1IQLA 1J14A 1E38B 1MBQA 2VVVA 1UHBA 3RXDA 1EOLA 3RXFA 1NRPH 2BY8X 3EYDA 4ABDA 1C9PA 2KR7A 1WBGB 2QF5A 4H6SB 4HFPB 5EW2H 3RP2A 1KIGH 3MMGA 1CT4E 5KECA 4DT7B 3GY8A 2ZA5A 2M5TA 1CGHA 4WJG2 3TNSA 4A1VA 1BJUA 1LCYA 2FLBH 4MDSA 4UFFH 2DUCA 3B23B 4GVUA 3O8CA 2O8LA 2ODYB 3W94A 4F4OC 4UFEH 2C8WB 1FQ3A 3MU5A 2TBSA 4GHTA 1AUJA 1Y59T 4AFUA 1DY8A 7KMEH 1AVXA 1TX6A 3FOAA 3O8BA 3UWJH 5T6DA 1K1LA 1BTUA 5A2MH 2G4UA 2ZI2H 1GBIA 1DM4B 1CGJE 5DJ7A 4Q63A 4Y8YA 1DWDH 1KXEA 2A45B 5HM9A 3AAVA 2A32A 1GI9B 2HNTF 4VGCB 1UMAH 2GX4A 1XUHA 1AQ7A 2QA9E 4ZXXH 2CMYA 1ETRH 1VR1H 2QXHA 3QUMP 4D76A 3S7KB 1A1RA 2G81E 1DLEA 3N99A 4NA9H 3ODDA 4FUFA 1LVMA 1HAVA 3TJVA 1VGCC 2ZTYA 1SQRA 1CBWB 4AOQA 1J17T 1HAIH 5FAHA 1O5FH 4RT1A 3ATIA 2ZPQA 4FUHA 6CHAC 1O30A 5C17A 4SGAE 1Z71A 3GYMA 4CRDA 1L4ZA 1OX1A 3EA9A 3PYHA 1HFDA 4F48B 1BT7A 3OYPA 3IITA 1ABJH 1MD7A 3S9CA 2OTVA 3A87A 3TLOA 2F9NA 4GHQA 4K8BA 1KY9A 1LPGB 3GY6A 3LPRA 1Z6EA 1OXGA 3VB6A 1GVZA 1OOKB 1HPGA 2OC7A 3A88A 2QXGA 3ZZDA 3UOPA 2HWLB 3MI4A 5E2OA 4O3TA 3MTYA 4ZHAA 4Y0YE 3MH4A 1GJBB 4A92A 1MABB 1TX8A 1GI8B 5J4QA 5DP4A 3F6UH 1OKXA 1GVLA 3VB5A 3VFEA 3Q3KA 3OAAD 2PUXB 4GPGA 2BTCE 4UE7H 3ZVGA 1P05A 3BEIB 1PYTC 3DSGA 2HNTE 2WV5A 2ZEBA 4AG2A 4LZ1H 2C8ZB 4OS7A 2AMQA 4JZ1A 4ZROA 4OGXA 4WXIA 1EAUA 5HGGA 2BY9X 1O2SA 3H7TA 5ESTE 1HIAB 1P2IA 5BRRE 1AFQB 1YYY1 1GBKA 4I33A 2OINA 2QV1A 3ZZCA 3PV2A 4NFEA 5CMXH 3QGJA 1O2KA 1GJ8B 1P57B 3RXOA 3H5CB 3TK9A 3TGIE 1T4UH 1ZMJA 1N8OC 2FXRA 4CRBA 2ZU1A 3EQ0H 8KME2 1Z6JH 1HJ9A 3SYJA 1K0HA 4X1RU 1C2DA 3EDXB 3M5NA 4TYDA 1P2QA 1BMLA 1RS0A 2XNDD 2QIQA 1MU6B 4A1XA 3KCGH 1UVUH 2GGVB 4B71A 1QA7A 4YOGA 1T8MA 1BB0B 1BBRK 4YZUA 1S6LA 5JYIA 1C5XB 2H5DA 2AS9A 1GHAG 1LKAA 4ISNA 1SB1H 1ACBE 3ZZ4A 1SVPA 4FUBA 1PFXC 4B2BA 1XXFA 2TIOA 1RIWC 3Q3XA 4FVBA 4TSFD 1COWD 4I32A 3GICB 4KGAA 1Z8GA 1KTTB 4ASHA 2AGIX 2R2MB 2A5AA 3BTWE 1C2FA 4CRCA 3RC6A 2SFAA 3HGPA 1TQ7B 3TH3H 3W95A 1A3EH 2KZ4A 2GP9B 4O9VA 3SU0A 2A4OA 1AUTC 1IQNA 2B7DH 3GY2A 3VXFH 3A83A 2H1UA 2HALA 1NFXA 1XXDA 2G5VA 1LKBA 2Y5GA 4R8TB 3FZZA 1EATA 3A81A 4CBOA 1B0FA 1QZ8A 3EE0B 1C1SA 1EPTC 1KXCA 2ZPSA 5F8XA 4ZXYH 5EQQA 3QTOH 3C1KA 5HYOA 2BLOA 2K8IA 2XBXA 4E7NA 1O2IA 1A7SA 3NWUA 1O2PA 2D8WA 5T3HA 1TIOA 3T26A 2BX4A 3L33A 1O3IA 4AGKA 4DOQA 4YLUA 4INKA 2PKSB 3LJJA 4FUEA 3M5OA 2NU0E 3T62A 1UCYK 1UVSH 2ZTZA 3SZNA 1O2HA 1OP2A 3V12A 1P12E 3BTHE 2QCYA 4TWYA 5C5NA 3MQKC 3KQ5A 1C5RA 1UW7A 1PPEE 1MTNC 1SFIA 1W0KD 3A7XA 1P06A 3R3GB 4K60A 3PO1B 3A8AA 4TT3D 1C1OA 1GHXH 2NWNA 2VIDA 2ZHFH 4AYYB 2F91A 2TGPZ 1N6XA 4YOIA 2WHXA 1SQAA 2HVYB 3F9GA 2W7SA 2SGDE 1A0LA 4I8HA 3LH1A 1LDTT 1NFWA 3TVJB 2FWWA 2PKAB 1BTXA 2CN0H 1GVKB 4IS5A 4A5TS 1TLDA 3M37A 5EQRA 1S6HA 1CHGA 3PRBA 1DPOA 2PV9B 3A7YA 2EI8A 3RU4T 3LC3A 1AVGH 1IQHA 1NESE 2JIZD 1BMNH 2WINI 1AFEH 1W14U 3DHKH 1PQ7A 1HIAA 4NSVA 2K0QA 2BD5A 2J38A 4I8LA 5CDFE 3S7HB 2GT8A 2ZP0H 1GCTC 1GMDF 2GZ8A 1YPGH 1O3CA 1TWXB 1LVYA 3P8NA 3PMHB 2CHAC 2NU2E 4AC9A 4ZAEA 1O3HA 3LDXH 3MNXA 5T1VA 1XKBC 3RXSA 4MPUA 2XCNA 1KXBA 2R0KA 1MKXH 1A61H 1O5GH 3SU2A 1DDJA 2ODQA 2PHBA 1BMAA 1RD3B 4CRAA 1O3PB 2YMSC 2ZCLP 1GDQA 9ESTA 2F83A 7GCHG 1ELFA 1W0JD 2IN2A 1E1RD 4ABIA 5KGOA 2EEKA 3LGVA 3ODFA 1CGIE 1O3LA 3V0XA 1FIZA 2FESH 1ANEA 3RXGA 2FEQH 2ZHEH 1BTWA 3BIUH 1P04A 3M61U 1RXPA 1Y3YA 2BZAA 8ESTE 2UWPA 1QB6A 1O3JA 2TRMA 5TJXA 5CHBA 2P8OB 5DP8A 2SNWA 1EX3A 3M7UA 1ESTA 2BDBA 2ZFSA 4DG4A 3PMJA 5TCCA 3TU7H 5JB8S 1UJ1A 2Q6FA 3ZYDA 4BAQB 4IGDA 1FPHH 4IMZA 1HAXB 1GBMA 3BTTE 2GCTC 3MO6A 1HRTH 2Z3DA 1EZQA 3C27B 1S83A 2WUCA 3BN9A 1G3BA 1QBNA 1YY3A 6GCHF 3SV7A 1B5GH 4UFDH 4TPIZ 1K2I1 1GMCF 4CHAC 1BHXF 1CA0B 2FZZA 3ITIA 3SV6A 2C90B 3LGUA 1WYKA 1DANH 3SZEA 1W0ZU 2GT7A 1O2GH 1JRTA 1G37A 2ZF0H 4TY7A 1C2JA 1VJ9U 3TJUA 1RTFB 1ZRBA 3LGYA 4OS1A 4XRNA 1DITH 1ETSH 3SQEE 4Y8XA 5CE1A 1GJ6A 1ZHPA 3U1IB 1GI5A 3MH5A 1EXFA 2FPZA 3SBKA 3U8OH 4MQAA 1MTSA 3K6ZA 1L1GA 2RFKC 1AB9B 2ZDKA 3UR6A 2J5UA 1YPJH 1RTLA 1Z1JA 1F5RA 1THPB 1PQ5A 1AIXH 3SUEA 1QURH 1VCWA 1ZPCA 5FXLA 4MPXA 1ID5H 4E05H 3GCHB 1ZMNA 1A0JA 4YT7H 1T32A 4B6FA 4D7FA 5GWZA 5F53A 5FPYA 1QGFA 2O8UA 1NU9A 5FPTA 1HYLA 1SPJA 2J98B 4X8TH 1K9OE 4ACBA 3MU8A 1ZR0A 1GDUA 1MH0A 1TPAE 2C8YB 5DK1A 1XVOA 1QRZA 2WUBA 2JETB 1X7AC 2QN5T 1FAXA 3PROA 3PWCA 1Z8IB 4IC6A 1GJAB 2R0LA 1O0DH 3T28A 5JBTA 3GDSA 1Y8TA 2W26A 5GNDA 5HIZA 1JWTA 1S85A 1D3PB 5F03A 1S6FA 1C2IA 1TABE 1G9IE 2I6SA 4AB8A 3O8DA 1C1NA 4FUGA 1YPHE 1MKWK 1MAYA 2H6MA 1LMWB 1TGSZ 2IPHA 1MD8A 1WOFA 2B9LA 3Q3YA 1AVWA 1HDTH 1C1MA 1GPZA 3ENSB 1NBMD 3KQEA 1BTYA 1SOZA 3UNQA 2CGAA 1FN8A 1SQOA 1O3FA 4R0IA 3SQHE 1PYTD 3QO6A 3UTUH 4FVDA 2BD7A 1E37B 2PTCE 3RM2H 1JXPA 1YPEH 1ORFA 1T7CA 1GL1A 3SV9A 3LGWA 2F4LA 1VZQH 4IMQA 4X6NA 1TGBA 4RKOB 1TBRH 2F43B 1JIMA 1XX9A 3KQDA 2VBCA 4DT4A 5HKKD 2XBYA 3NKKA 4E7RG 4NIYA 3CNRA 2THFB 3N7OA 5GIBA 3ZV8A 1HXFH 4YM9A 1F2SE 3I77A 1BRAA 5A0CA 1JBUH 1E34B 1O2OA 1QRWA 1WSSH 1Y3XA 3OSYA 1WTGH 1P2JA 2Z3CA 1CQQA 1C1UH 1OS8A 1BOQA 1C5VA 1INCA 1E0FD 2ZWLH 5FX6A 4BTTB 1Z1IA 1OWEA 4Q4LA 3F9EA 2AYWA 2GZ7A 1BBRH 1EP6A 2ZDMA 4A1TA 1G3DA 3DSOA 3OEHD 4QT8C 1QQUA 2KCPA 3Q00A 3RC4A 1G36A 3ATLA 1YLNA 2XRCA 1TAWA 3LC5A 2L6OA 4X2VA 4OS4A 1TOCB 5EODA 2A2XH 1GBBA 3BG4C 1THRH 3PLKA 3FAOA 1G2LA 1DX5M 1QBVH 5GCHF 1MMJN 1EZUC 2A2QH 3AW1A 3A82A 1F92A 1OWIA 2A1DB 2K1QA 2HRVA 3STIA 3PTNA 1LHGH 1DY9A 1FPCH 1LO6A 2XBVA 1ZOMA 1FY1A 3QK1A 4NA7A 5G4BA 3FN8A 5LGOA 3RXTA 1VGCB 1GHVH 4NWKA 5C0TA 1NBME 1TONA 2G00A 4CH8B 1DS2E 3RXCA 2ANKH 1E79D 5JDUB 1TBZH 3OE7D 2ZECA 4Q2KA 1EZXC 1OSSA 1FDPA 3PLPA 3D49H 1GHYH 5C94A 1XUGA 4BAMB 1F5LA 2FLRH 1P3EA 3GOVB 3MU0A 4KKDA 1UTQA 2J98A 4ZKOU 5HIYA 2BLWA 3GDVA 1Z8RA 5C0UA 3A84A 3QZQA 2ZDLA 1EOJA 1BZXE 3ATWA 1VJAU 1IQJA 3ZVFA 1PPGE 1V2MT 2A7CA 3SGQE 1ANBA 1C5SA 1FAKH 1O2VA 4FU8A 2ZCHP 1TRYA 1W0YH 2AERH 5FHTA 1H8DH 1T31A 4AFQA 5LPRA 3RDZA 1L1NA 2WPJS 3U8RH 1SBWA 1LHDH 1KDQB 1YLDA 2G51A 2RA0A 3PB1E 1T4VH 4ABAA 3OX7U 1O32A 2NU3E 2XCFA 3SN8A 3DD2H 2W3IA 1TFXA 1J15A 2V0BA 1K1MA 1SGYE 2FO9A 3B9FH 1TMTH 1A5HA 1QL7A 2ZCKP 1GI6A 1LTOA 2F9PA 1GGDC 5L30H 2V6NA 1T8OA 4ZKRU 1KMHB 4K8YA 2ZG0H 1YLCA 2FS8A 4MNXA 3M7TA 1BA8B 5C1YA 3H7OA 2F9UA 2HOBA 1ABIH 2ZHQH 1QB9A 3M3VA 1GMDG 1O5CB 3TH2H 2QXIA 2Y7ZA 1EJAA 2GV7A 2FOGA 1NRSH 2VVUA 2FS9A 2WZQA 1FJSA 2FI3E 1O38A 1P09A 4XBDA 1WCZA 2BY5X 4NA8A 3U28C 2BX3A 5EW1H 1FY3A 1RFNA 3T29A 2H9EH 4MNVA 2BM2A 1C2KA 2ILNA 2YMSD 4ZHLU 3PV5A 1NRNH 1P10A 1ZLRA 2H9HA 1BRBE 3L6PA 3TITA 1DWCH 3AVZA 5I25A 1GHBG 1B7XB 2SNVA 3UUZA 1TNIA 2Y5FA 3LJOA 1O3EA 1UTPA 3SU6A 4CR5A 2EY4C 1ZMLA 2ANYA 5ABWA 3DT0H 1TALA 3DSPA 3EGKH 1JMOH 4H4FA 3VB7A 2XNIA 3MH7A 3F68H 7ESTE 1C2LA 1C1VH 1AE8H 3E6PH 2VGCB 4AYVB 4FU9A 1TOMH 2GMTB 2GVFA 3TNTA 3V7TA 3VPKA 4UFGH 2A4QA 1YWUA 1FNIA 2V3OH 1C4Y2 2F9BH 2XC5A 3QDZB 1GI7B 2ZU3A 4ISOA 1L2EA 2P93A 8LPRA 3A85A 2XWAA 2JH6D 4JK5A 5EU8A 5LPFA 1RRKA 1ELTA 6GCHG 2FYQA 3RXRA 1FONA 3ZVBA 1EPTB 1GMCG 2P3TB 1VITF 1AZ8A 1D6RA 1O5BB 2W7UA 3FFGA 4GAWA 4H42U 1S84A 3MNSA 1ZPBA 3NUMA 4AG1A 5F8TA 3WW7A 1EAXA 1C4V2 4X0WU 1EUFA 2Y6TA 2XYAA 3P92A 3TH4H 1MCTA 3EA7A 5DP6A 2FDAA 1JOUB 3CP7A 2IJOB 1C5QA 2QGRA 3FP7E 1GCDA 1HV7A 1GMHF 4CBNA 2KCOA 2Y5HA 1RJXB 3PM3A 2BDCA 2OUAA 3SU1A 1KXDA 3KF2A 1GBJA 3ZYEA 1YPMH 1Z7KA 2BZ6H 1CE5A 3LOXA 5C1XA 4TY6A 1ESBA 5T6FA 4K1EA 1O2MA 2V3HH 4VGCC 1O3BA 1DXWA 4M7GA 3NRLA 2HGTH 1YM0A 1HLTH 4RSPA 1KDQA 1JRSA 3A8DA 3ZVCA 1UK2A 2PLXA 5C2ZA 1ZHMA 1UVOA 5T6GA 1V2QT 3U9AH 1GBFA 1W13U 1BUIA 3UAIC 3IG6B 3A8BA 4JCNA 1MTUA 1V2UT 1AHTH 1CBWC 3BV9B 2R3YA 1GI0A 1P2OA 3U1JB 4NCYA 2Z3EA 2WPKS 3F2GA 1MKWH 4JZIA 1AU8A 4BXSA 1TPOA 5EIYA 3CS7A 1MQ5A 1PJPA 5A09A 1O2LA 1SI5H 2QE7D 3K65B 2CHAB 3DFLA 3NZIA 4YLQH 2JJ2D 4WMEA 3RXAA 1HXEH 4Y11E 3STJA 4NIXA 2HLDD 3N7DA 4U2WA 2BVSH 2YNBA 4DJZB 1TRMA 4Y10E 3BTDE 4IC5A 1HJAB 3K6YA 1VKYA 2LPRA 4PROA 1HUTH 1MZAA 2BDAA 3ZIAD 2YMSB 1S81A 1IQEA 4OGYA 2ASUB 2FX4A 1O2TA 4ZKNU 1AZZA 1UTLM 4HG6A 1YCPH 3T2NA 1TA6A 5GDSH 1TB6H 5DP7A 4BAOB 1HJ8A 2BD8A 3ZZ6A 1BMFD 1V2KT 2ZFQH 5GJ4B 3RXQA 5CHAC 3LT3A 2C3SA 3NXPA 4U32A 5JBCS 1AN1E 1O37A 1QTFA 1W3CA 2HPQH 4K2YA 1A2CH 5HMAA 3SNEA 1P3CA 4ESTE 4Y79A 5EXNA 1QA0A 3KQCA 1OWHA 2LP6A 9LPRA 3SV8A 3ATMA 2KCYA 2VH0A 1TYNA 3QLPH 1MCVA 4ZH8A 2EQNA 5LPEA 1NS3A 2ZU5A 1HAZB 4CHAB 1THSH 1ESAA 1SSXA 3RXKA 1EPTA 5EJ1A 3WY8A 2CJIA 4K1TA 3R0FA 1GHWH 1FZZA 4TWWA 3MYWA 3F9FA 4K1SA 2UUJB 2SGQE 1A4WH 1HAHH 1S82A 2BXUH 3VGCB 2GCHF 3BEUA 3GCTF 3QTVH 5GCHG 2BD2A 2ZHDA 3Q77A 1Q31A 5EQSA 1XMNB 2OCVB 5HM2A 1EAWA 1G3EA 3FZDA 3PTBA 2BQWB 1J16A 3MU1A 4ZMAH 2OP9A 1YC0A 3GISB 1V2NT 2IPQX 4WXVA 1ZRKA 1P02A 2BD9A 2R3UA 2JH0D 3OU0A 4BAKB 2BLVA 1V3XA 2UUFB 4H6TA 3A80A 3TIUA 4Z6AH 1C1WH 1ZSLA 2AGEX 3RXMA 1O2ZA 2WPIS 3HKJB 1HAYB 2J4IA 1SC8U 3IWMA 1E36B 3D65E 1DWEH 1O3OA 3HPTB 1UTMA 3URCA 5I46H 2A5KA 4U30A 4AFZA 1GDNA 3KIDU 1D9IA 3HATH 3UQVA 2FTMA 1G3CA 1XUIA 4IN1A 1EB1H 5EGMA 1P0SH 1BCUH 1MTVA 3ZZ8A 4DW2U 1UTNA 4NZLA 4WY3A 3OY6U 1TMBH 2ZGHA 1ANCA 1ARBA 5DPAA 1C2HA 2Z9LA 2A7JA 2SGPE 2DE8A 1NN6A 2PKSC 1TMUH 3A8CA 3MH6A 3UR9A 4ABHA 5C67A 1EAIA 2FYRA 2ANMH 1QB1A 3BTEE 3UY9A 4UONA 3TJNA 1HAGE 1G32B 2G4TA 2OK5A 4O3UA 2AMPA 2XOKD 3PO1C 1SGDE 2AFQB 1O5EH 5AFYH 4AORA 2CXVA 2FOMB 2Z94A 1GBTA 4ABBA 1NU7B 1ZJKA 1AO5A 4KP0A 5EG4A 2AHME 3SJOA 1ELBA 3OEED 4X8VH 2YOLA 1WAYB 2KFWA 4ZKSU 1GBDA 1ELVA 3FANA 1C5PA 3S69A 1GJ7B 1GJ9B 1SR5C 1CHOF 3OY5U 4D8NA 2GDEH 1HCGA 1NM6A 2XC0A 4NG9H 4X1NU 4X1SU 2DE9A 2J9NA 1EFRD 3PV4A 4BTUB 4P00A 4MLFB 4KELA 2ZFRH 1CSOE 3SO3A 1Q3XA 2STBE 1GI4A 4OM9A 2A7HA 1C9TA 4YXWD 2A4RA 2CK3D 4MVNA 4Y0ZE 2D2DA 2TPIZ 3BTFE 3NK8A 3VB4A 3BG4B 3SNBA 4DIIH 3LKWA 1O2QA 4INHA 2XW9A 1O2XA 1QJ7B 3SGAE 2Z9JA 1V2WT 2J2UA 2Z9GA 1S0QA 1AKSB 2OC1A 3VEQB 1GWAA 4I86A 1O34A 3ZZAA 1C4U2 2QF4A 1KSNA 4B75A 4A6LA 1SLUB 1YPKH 3AASA 4ZCNA 4WMDA 5FCRA 3UREA 5B6OA 2VWOA 4LXBH 2VIPA 1SGRE 1SGNE 3ELAH 1AWFH 2OD3B 4AZ2B 1TNHA 4E06H 3F2FA 2O9QA 3ATKA 4TPYA 5A8XA 3RXLA 5FPSA 3NCLA 1VITG 5IYTA 3UOUA 1AGJA 4J2YB 1TGNA 4B76A 1U6QA 5AHGH 3K2UA 4MPVA 3B8JA 3FO8D 2C93B 1QJ6B 4ZHMU 2J97A 1GG6B 1GBCA 2ESTE 5E2PA 4MNYA 1TNKA 1CA0C 4JK6A 3SUFA 3H09A 1K1IA 1GMHG 4FUCA 1C5LH 5K0HA 1YCPK 4HZHA 1O36A 2VH6A 1FN6A 2H9TH 3UQOA 3BTME 1ETTH 1K1PA 2W6ID 3P8FA 4AGJA 4OS6A 2ANWA 1BHXB 1H4WA 3KYFA 4YO9A 4ZUHA 3N7EA 2PSXA 2A0QB 4A7IB 2LELA 3BF6H 3LGTA 1SLWB 1O35A 1KXFA 1SHHB 2PUQH 5BPEA 5PTPA 1FMGA 4AB9A 1CT2E 3RU4D 3V13A 1CVWH 2WPDD 2WV9A 1AB9C 1AD8H 1IHTH 1Y5AT 1C5UA 3MO3A 4FUDA 2ZC9H 2OBQA 3QGNB 4X1PU 2BY6X 4X2YA 1TNJA 1WQVH 3E91A 1EB2A 4UD9H 1NROH 3SGBE 4RI0A 5FCKA 1C2MA 4JZDH 5H4IB 1EQ9A 2TGAA 5F8ZA 4X6OA 3GCHC 1F0SA 2PP6A 4ABJA 2GTBA 1C2GA 3KYGA 1O2YA 1K1NA 4F49A 1ZTJA 4Y7AA 1DUAA 1OWJA 3ZVAA 2BQ7B 3RXVA 3RXIA 3RXBA 1SMFE 2WYGA 1SGPE 2WPHS 5C20A 2JETC 3TK6A 3MHWU 2UUKB 4FU7A 3E90B 3PRDA 1DWBH 4X8SH 2BDGA 2F9VA 2VINA 1SGQE 2ZHWH 3M5MA 4OS5A 3KN2A 1H8IH 4ACAA 1EP5A 4Y76A 1V2TT 8GCHF 6CHAB 4I8KA 1C1QA 1ZSJA 2FM2A 3RMNH 3RMLH 3ZZ9A 2Q6DA 1TE0A 2R9PA 1RTKA 2Y81A 1DXPA 1P2KA 1OYTH 1NFYA 1OP0A 1D6WA 2H2ZA 5E0JA 3UPEA 1E1QD 1C5NH 3DFJA 1N1LA 1C5TA 3WWBA 1AKSA 3KEEA 4X6MA 1QHRB 4RT0A 2JJ1D 1BQYA 1UVPA 4DVAU 3RXJA 2JKHA 1ZTLA 3RXPA 4UEHH 1CO7E 2HVXA 1O3GA 2OBOA 3GY7A 3E1XB 4BXWA 1Z8JB 4M9FA 4JYUH 4Q7YA 2ZFPH 2BXTH 3ZVDA 3RU4E 1O2RA 5GXPA 1YCPM 1YPHC 2B0FA 2FTLE 4HGCA 3T25A 3S9BA 3S9AA 5FBIA 1O31A 3RXHA 1P03A 4GCHF 2GCHG 3GCTG 1YBWA 3VXEH 5ESBA 1FIWA 1OP8A 1XUFA 1N6YA 5K7RA 1EKBB 1DOJA 1TA2A 2KAIB 1ZJDA 2QC2A 3D23A 3GDUA 4B74A 2QXJA 3MNBA 2G5NA 1W2KH 3EA8A 2AEIH 1F0RA 5C1UA 4NIVA 1ZTKA 4XOJA 3SNDA 2Z9IA 5C5OA 2FODA 1N8OB 3SJIA 1MBMA 5EPNA 4XD7D 1KYNA 2SGFE 5DG6A 2P3UB 2BB4A 3DA9B 1QCPA 2R2WU 1DFPA 4DY7B 1VCQA 5FX5A 3SORA 1BDAA 5DP3A 1Y3UA 2KCAA 3BIVH 6LPRA 2ZTXA 2ODPA 2V3MA 3DUXH 1WDIA 3AW0A 1GBEA 5EXMA 1NC6A 3RM0H 1W10U 3RC5A 1RIWB 1G30B 1KXAA 1TBQH 2SGAA 1K21H 2J95A 2ZGXH 1Y3VA 2WV4A 4LOYH 4XDEA 1S5SA 3OTPA 2OXSA 2Q6GA 3F0PA 2FOBA 3MWIU 1GJ5H 2VIVA 1K1OA 1TX7A 5FBEA 1TNLA 2QY0B 1GBLA 3OTJE 5JB9S 1F5KU 4AX9H 1WTHD 3T5FH 1UTJA 1TPSA 2BQ6B 3E3TA 3M35A 3ZZ3A 3M7QA 1DICA 3SJ9A 1WXRA 2ZIQH 2AMDA 1A5IA 1KLTA 1MAXA 1QL8A 3A7VA 3I78A 4IW4E 1LPKB 3HK6B 4XSKU 1V2PT 3RLYH 1A5GH 1K22H 3GY4A 7LPRA 4WVPE 1OWKA 4DGJA 1FV9A 3CS0A 3M3TA 4IN2A 3GY5A 4O03A 2FOCA 4NWLA 1K28D 1S0RA 1O39A 4B2AA 4F55A 1PPBH 3HK3B 2O8MA 3UFAA 3FP8E 3SW2B 4ASUD 2VIOA 5CHAB 1F0TA 2RDLA 4AN7A 1MTNB 1LHCH 2PTNA 3RUOA 2C8XB 6ESTA 1CHOG 1Y3WA 3E0NB 3SJ8A 2IOTA 3GCOA 1VCPA 1A0HB 1V2OT 3F3BA 1FY8E 3SNAA 2RCEA 2BHGA 1PPZA 1V2VT 5F6MA 1QQ4A 4IBLH 1ZGVA 1NTPA 2XXLA 1C1PA 4THNH 2JH5D 3PLBA 2EA3A 3A7TA 1NRQH 1XVMA 4JYVH 2GDDA 3K9XB 1LQEA 5IK2D 1H8ED 4DCDA 1TGTA 1IQFA 5B6LA 5FL7D 1L0ZA 1SLXB 2YNAA 3F2HA 3EAJA 1FY4A 3SV2H 2AGGX 2BD4A 1GCTB 4XE4A 3GY3A 2QF3A 2KAIA 2SGEE 4I8GA 2HLCA 2I6QA 2W5EA 2BDIA 1ZYOA 4K69A 1C5WB 2PR3A 4B2CA 2ZU4A 1BTHH 1DT2A 5EXLA 2VGCC 2FI4E 1SGEE 1VITH 5ETXA 2GMTC 1AE5A 4BTIB 1HBTH 2BMGB 4Y6DA 1V2JT 2RA3A 2FP7B 1C1TA 1YKTA 1BTZA 1P9SA 2XTTB 1DE7H 2UWOA 2PFEA 2ZKSA 4GLYA 1SL3A 2ZQ1A 1QIXB 5KEDA 5GPIB 2VWMA 3UWIA 2FOFA 3SUDA 1FLEE 2P95A 4RKJB 5JBBS 1V2ST 2BYAX 1W12U 4XBBA 1H1BA 5AF9H 2F9OA 1MZDA 1IOEA 4KTSA 2P3FH 4Y71A 1E35B 1QR3E 1W8BH 3TPIZ 3GYLB 1BMMH 3E8LA 1AY6H 2PWXA 2PW8H 1QRXA 2GCTB 3HKIB 2ZO3H 2AH4X 1AFQC 4SGBE 1LPZB 2STAE 2ALVA 1ZPZA 1YF4A 3ZZ5A 3HGNA 1GBAA 3O8RA 4LZ4B 1IQIA 2G8TA 3LONA 4CRFA 4MPWA 5EPYA 1EASA 4JZFH 3A7ZA 3QZRA 2ZDAH 1C1RA 3UB0A 1GI1A 3A89A 1P11E 1SGFA 2FOEA 2NU1E 5AFZH 1P8VC 3UNRA 2O8WA 2ALPA 4Q7XA 4I7YH 2L74A 2LNCA 1QBOA 3E16B 2PGQB 3SHCH 3G01A 4ISLA 1K1JA 1ELCA 2UWLA 1TGCA 2VIWA 4FETA 4LK4A 3RXEA 2ZQ2A 3W1EA 3ZVEA 3LH3A 1QY6A 1ZHRA 2GKVE 3LIWA 2PGBB 3VG8A 2G52A 3ESTA 4INLA 2KM0A 2JDID 2PSYA 1IHSH 3F0OA 4CRGA 5TCAA 2HNTC 2J34A 2BVXH 3BTQE 5DSFA 5L6NH 1H9LB 4NIWA 2Z6BD 1IQGA 1WUNH 5E0GA 2RG3A 4Z1MD 1O2JA 1H9HE 2CF9H 2F3CE 2VJ1A 4ABGA 1GJ4H 1SKYE 1UK4A 4D9RA 1H8HD 3JZ1B 2EI6A 4ISIH 5A0AE 3M36A 3VB3A 2P94A 1YGCH
chains in the Genus database with same CATH topology
2VVCA 2FMJA 4HI3A 1QL9A 4DURA 2VIQA 8GCHG 1W7GH 1ELAA 3LGIA 1D3TB 3TGKE 3BTGE 1BRUP 1O3MA 3P95A 1HJAC 1KLJH 1PPHE 2TGTA 1MTWA 1SGFG 2ZGJA 3S0NA 1UTKA 1LQDB 1FUJA 1GHBF 3I29A 4ABEA 5DKMA 3SU4A 4FXGH 1G2MA 1C5YB 4WMFA 5L2YH 1PPCE 1NFUA 2FI5E 2OC8A 3A86A 1C2EA 2ZNKH 3BTKE 3M3SA 1O3KA 4CH2B 1LHFH 2CF8H 4GSOA 1YPLH 3U8TH 1KTSB 1NZQH 5DP5A 3F9HA 1WQSA 2QF0A 4NZQA 3RMMH 4BOHA 1MQ6A 3BG8A 1TRNA 3MO9A 1FY5A 1UO6A 2OC0A 4WWYA 3QN7A 3SI4H 1J8AA 3QWCH 1T8NA 1DVAH 1SOTA 1PQAA 5DP9A 3SNCA 2FOAA 2P16A 4U01A 4YTAA 1SQTA 1HGTH 1P9UA 5IDKA 1XUKA 2AIPA 3ZV9A 1DSUA 4GCHG 4Q80A 1XKAC 2QAAA 4JZEH 1UK3A 3M5LA 3L3TA 2VWNA 2WYJA 5JPMH 1WV7H 3URDA 1RGQA 5A8YA 2J94A 2ZPRA 4MTBA 1LVBA 4KTCA 1SGCA 2Y82A 4Q7ZA 1QFKH 4X2WA 3VGCC 1ELDE 3F1SB 2HPPH 3BEFB 1IQKA 3E0PB 2B5TB 3A7WA 2A5IA 4WH6A 2FOHA 1M9UA 1SGTA 1QNJA 1AI8H 4BANB 1AWHB 1D3DB 4D7GA 3KNXA 2A4GA 2OQ5A 2FX6A 3UIRA 2GD4B 1L4DA 2Z7FE 4K5ZA 4D9QA 2WPMS 3FVFB 1HB0B 1ANDA 1YP9A 3CENA 1PQ8A 1HAPH 1Q2WA 1UTOA 2BOHB 2GV6A 1P2MA 2Y80A 1IAUA 1NT1A 5SGAE 1GI3A 1TPPA 3UNSA 1ELEE 2NU4E 2P59A 2ZFTA 2H5CA 1O3NA 4J1YA 1O2NA 1UVTH 2B8OH 1F7ZA 1O5DH 2UUYA 1GHAF 1BJVA 4Y7BA 1PPFE 1FXYA 2QYIA 1BITA 1MU8B 1ZZZA 2PKAA 3P6ZB 1LVOA 2VB0A 4UDWH 4DIHH 2VU8E 3U98H 1A3BH 3SI3H 1SG8B 3RMOH 5AVDA 2BDYA 2FIRH 2P8OC 4O97A 1CT0E 4B73A 3BSQA 1GJCB 1FI8A 4CREA 1UHBB 5JBAS 4OS2A 3KQBA 1C5MD 2G55A 4HTCH 4X1QU 4XFQA 5L2ZH 2XWBI 1P2NA 3LU9B 1GL0E 3SU3A 1DUEA 1CU1A 4XBCA 3KHVA 2BDHA 3AAUA 1SHYA 1TQ0B 5A0BA 2BD3A 4FUIA 3SU5A 3ZZBA 1A46H 5E8EH 3ZZ7A 3V3MA 1H9IE 2Q1JA 1O2WA 5EOKA 4YOJA 3SHAH 1BRCE 5DO4H 3TK5A 1Y5UT 3PMBB 4AFSA 1O5AB 4I8JA 3MFJA 1TNGA 1GJDB 2OLGA 1L1JA 1V6DA 1XUJA 1GBHA 4CR9A 1ARCA 1OWDA 3RXUA 1ZSKA 3T27A 3MOCA 3JZ2B 1JIRA 2ZZUH 3MNCA 1BTPA 1C5OH 5J4SA 1BIOA 2AIQA 5DGJA 3SUGA 1EZSC 3KL6A 1GHZA 3P8OA 1W7XH 2D1JA 3RLWH 1BBRE 3Q76A 4Z0KA 4X6PA 1HAVB 3KGPA 2XBWA 3P17H 1P01A 1LHEH 1GGDB 4JMYA 1C5ZB 2BVRH 4WH8A 3P8GA 2A31A 1MUEB 2VWLA 4FUJA 2GZ9A 3TJOA 1AMHA 1NO9H 1GI2A 3D62A 4GUXA 4KTUA 3MU4A 1WU1A 4MG3A 4RN6A 3NPSA 4NFFA 1ZGIA 2C4FH 1V2RT 1B0EA 2BY7X 3SJKA 5C3NA 4NSYA 3PMAB 1XM1A 1D4PB 2ULLA 1O33A 2WPLS 2ZGBH 4X8UH 4JYTA 1Y5BT 4K3JA 1O3AA 4ISHH 2BOKA 1DLKB 2BLQA 4YT6H 2ZGCA 2ZFFH 2EC9H 1HAOH 1T8LA 1OYQA 4NGAH 5E0HA 5HXFA 1J9CH 3PWBA 4I31A 1NRRH 2EI7A 2ZDNA 2CV3A 3SOSA 1IQMA 2Y7XA 4WF8A 1SFQB 3QX5H 3FP6E 2XC4A 2D26C 1V2LT 3U69H 3P70B 3GCNA 1UCYE 2W3KA 2VNTA 7GCHF 1EJMA 1O2UA 2O8TA 1MKXK 1NPMA 5LH8A 1HNEE 4BAHB 2J92A 4YESB 4ABFA 1UCYH 1DSTA 1NY22 2OQUA 4Y8ZA 1D3QB 1ELGA 2TGDA 1W11U 2ZU2A 4X2XA 1GG6C 1OPHB 4B1TA 1F0UA 1SLVB 1O3DA 1SGIB 1KLIH 4MNWA 1QJ1B 1CA8B 2ZDVH 5A8ZA 2V35A 4BNRA 2Z9KA 1EJNA 3TGJE 1IQLA 1J14A 1E38B 1MBQA 2VVVA 1UHBA 3RXDA 1EOLA 3RXFA 1NRPH 2BY8X 3EYDA 4ABDA 1C9PA 1WBGB 4H6SB 4HFPB 5EW2H 3RP2A 1KIGH 3MMGA 1CT4E 4DT7B 3GY8A 2ZA5A 2M5TA 1CGHA 4WJG2 3TNSA 4A1VA 1BJUA 1LCYA 2FLBH 4MDSA 4UFFH 2DUCA 3B23B 4GVUA 3O8CA 2O8LA 2ODYB 3W94A 4F4OC 4UFEH 2C8WB 1FQ3A 3MU5A 2TBSA 4GHTA 1AUJA 1Y59T 4AFUA 1DY8A 7KMEH 1AVXA 1TX6A 3O8BA 3UWJH 5T6DA 1K1LA 1BTUA 5A2MH 2G4UA 2ZI2H 1GBIA 1DM4B 1CGJE 5DJ7A 4Y8YA 1DWDH 1KXEA 2A45B 5HM9A 3AAVA 2A32A 1GI9B 2HNTF 4VGCB 1UMAH 2GX4A 1XUHA 1AQ7A 2QA9E 4ZXXH 2CMYA 1ETRH 1VR1H 2QXHA 3QUMP 4D76A 3S7KB 1A1RA 2G81E 1DLEA 4NA9H 3ODDA 4FUFA 1LVMA 1HAVA 3TJVA 1VGCC 2ZTYA 1CBWB 4AOQA 1J17T 1HAIH 5FAHA 1O5FH 3ATIA 2ZPQA 4FUHA 6CHAC 1O30A 4SGAE 1Z71A 3GYMA 4CRDA 1L4ZA 1OX1A 3EA9A 3PYHA 1HFDA 1BT7A 3OYPA 3IITA 1ABJH 1MD7A 3S9CA 2OTVA 3A87A 3TLOA 2F9NA 4GHQA 4K8BA 1KY9A 1LPGB 3GY6A 3LPRA 1Z6EA 1OXGA 3VB6A 1GVZA 1OOKB 1HPGA 2OC7A 3A88A 2QXGA 3ZZDA 3UOPA 2HWLB 3MI4A 5E2OA 4O3TA 3MTYA 4ZHAA 4Y0YE 3MH4A 1GJBB 4A92A 1TX8A 1GI8B 5J4QA 5DP4A 3F6UH 1OKXA 1GVLA 3VB5A 3VFEA 3Q3KA 2PUXB 4GPGA 2BTCE 4UE7H 3ZVGA 1P05A 3BEIB 1PYTC 2HNTE 2WV5A 2ZEBA 4AG2A 4LZ1H 2C8ZB 4OS7A 2AMQA 4JZ1A 4ZROA 4OGXA 4WXIA 1EAUA 5HGGA 2BY9X 1O2SA 3H7TA 5ESTE 1HIAB 1P2IA 5BRRE 1AFQB 1YYY1 1GBKA 4I33A 2OINA 2QV1A 3ZZCA 4NFEA 5CMXH 3QGJA 1O2KA 1GJ8B 1P57B 3RXOA 3H5CB 3TK9A 3TGIE 1T4UH 1ZMJA 1N8OC 2FXRA 4CRBA 2ZU1A 3EQ0H 8KME2 1Z6JH 1HJ9A 4X1RU 1C2DA 3EDXB 3M5NA 4TYDA 1P2QA 1BMLA 1RS0A 2QIQA 1MU6B 4A1XA 3KCGH 1UVUH 2GGVB 4B71A 1QA7A 4YOGA 1T8MA 1BB0B 1BBRK 4YZUA 5JYIA 1C5XB 2H5DA 2AS9A 1GHAG 1LKAA 4ISNA 1SB1H 1ACBE 3ZZ4A 1SVPA 4FUBA 1PFXC 4B2BA 1XXFA 2TIOA 1RIWC 3Q3XA 4FVBA 4I32A 3GICB 4KGAA 1Z8GA 1KTTB 4ASHA 2AGIX 2R2MB 2A5AA 3BTWE 1C2FA 4CRCA 3RC6A 2SFAA 3HGPA 1TQ7B 3TH3H 3W95A 1A3EH 4O9VA 2GP9B 3SU0A 2A4OA 1AUTC 1IQNA 2B7DH 3GY2A 3VXFH 3A83A 2H1UA 2HALA 1NFXA 1XXDA 2G5VA 1LKBA 2Y5GA 4R8TB 3FZZA 1EATA 3A81A 4CBOA 1B0FA 3EE0B 1C1SA 1EPTC 1KXCA 2ZPSA 5F8XA 4ZXYH 5EQQA 3QTOH 3C1KA 5HYOA 2BLOA 2XBXA 4E7NA 1O2IA 1A7SA 3NWUA 1O2PA 2D8WA 5T3HA 1TIOA 3T26A 2BX4A 3L33A 1O3IA 4AGKA 4DOQA 4YLUA 4INKA 2PKSB 3LJJA 4FUEA 3M5OA 2NU0E 3T62A 1UCYK 1UVSH 2ZTZA 3SZNA 1O2HA 1OP2A 3V12A 1P12E 3BTHE 2QCYA 4TWYA 5C5NA 1C5RA 1PPEE 1MTNC 1SFIA 3A7XA 1P06A 3R3GB 4K60A 3PO1B 3A8AA 1C1OA 1GHXH 2NWNA 2VIDA 2ZHFH 4AYYB 2F91A 2TGPZ 1N6XA 4YOIA 1SQAA 3F9GA 2W7SA 2SGDE 1A0LA 4I8HA 3LH1A 1LDTT 1NFWA 3TVJB 2FWWA 2PKAB 1BTXA 2CN0H 1GVKB 4IS5A 4A5TS 1TLDA 3M37A 5EQRA 1S6HA 1CHGA 1DPOA 2PV9B 3A7YA 2EI8A 3RU4T 3LC3A 1AVGH 1IQHA 1NESE 2WINI 1BMNH 1AFEH 1W14U 3DHKH 1PQ7A 1HIAA 4NSVA 2BD5A 2J38A 4I8LA 3S7HB 2GT8A 2ZP0H 1GCTC 1GMDF 2GZ8A 1YPGH 1O3CA 1TWXB 1LVYA 3P8NA 3PMHB 2CHAC 2NU2E 4ZAEA 1O3HA 3LDXH 3MNXA 3RXSA 1XKBC 4MPUA 2XCNA 1KXBA 2R0KA 1MKXH 1A61H 1O5GH 3SU2A 1DDJA 2ODQA 2PHBA 1BMAA 1RD3B 4CRAA 1O3PB 2ZCLP 1GDQA 9ESTA 2F83A 7GCHG 1ELFA 2IN2A 4ABIA 2EEKA 3LGVA 3ODFA 1CGIE 1O3LA 3V0XA 1FIZA 2FESH 1ANEA 3RXGA 2FEQH 2ZHEH 1BTWA 3BIUH 1P04A 3M61U 1RXPA 1Y3YA 2BZAA 8ESTE 2UWPA 1QB6A 1O3JA 2TRMA 5TJXA 2P8OB 5DP8A 2SNWA 1EX3A 3M7UA 1ESTA 2BDBA 2ZFSA 4DG4A 3PMJA 5TCCA 3TU7H 5JB8S 1UJ1A 2Q6FA 3ZYDA 4BAQB 4IGDA 1FPHH 4IMZA 1HAXB 1GBMA 3BTTE 2GCTC 3MO6A 1HRTH 2Z3DA 1EZQA 3C27B 1S83A 2WUCA 3BN9A 1G3BA 1QBNA 6GCHF 3SV7A 1B5GH 4UFDH 4TPIZ 1K2I1 1GMCF 4CHAC 1BHXF 1CA0B 2FZZA 3ITIA 3SV6A 2C90B 3LGUA 1WYKA 1DANH 1W0ZU 2GT7A 1O2GH 1JRTA 1G37A 2ZF0H 4TY7A 1C2JA 1VJ9U 3TJUA 1RTFB 1ZRBA 3LGYA 4OS1A 5CE1A 1DITH 1ETSH 3SQEE 4Y8XA 1GJ6A 1ZHPA 3U1IB 1GI5A 3MH5A 1EXFA 2FPZA 3SBKA 3U8OH 4MQAA 1MTSA 3K6ZA 1L1GA 1AB9B 2ZDKA 3UR6A 1YPJH 1RTLA 1Z1JA 1F5RA 1THPB 1PQ5A 1AIXH 3SUEA 1QURH 1VCWA 1ZPCA 5FXLA 4MPXA 1ID5H 4E05H 3GCHB 1ZMNA 1A0JA 4YT7H 1T32A 4D7FA 5GWZA 5FPYA 1QGFA 2O8UA 1NU9A 5FPTA 1HYLA 1SPJA 4X8TH 1K9OE 3MU8A 1ZR0A 1GDUA 1MH0A 1TPAE 2C8YB 5DK1A 1XVOA 1QRZA 2WUBA 2JETB 1X7AC 2QN5T 1FAXA 3PROA 3PWCA 1Z8IB 4IC6A 1GJAB 2R0LA 1O0DH 3T28A 5JBTA 3GDSA 1Y8TA 2W26A 1JWTA 1S85A 1D3PB 5F03A 1S6FA 1C2IA 1TABE 1G9IE 2I6SA 4AB8A 3O8DA 1C1NA 4FUGA 1YPHE 1MKWK 1MAYA 2H6MA 1LMWB 1TGSZ 2IPHA 1MD8A 1WOFA 2B9LA 3Q3YA 1AVWA 1HDTH 1C1MA 1GPZA 3ENSB 3KQEA 1BTYA 1SOZA 3UNQA 2CGAA 1FN8A 1SQOA 1O3FA 4R0IA 3SQHE 1PYTD 3QO6A 3UTUH 4FVDA 2BD7A 1E37B 2PTCE 3RM2H 1JXPA 1YPEH 1ORFA 1T7CA 1GL1A 3SV9A 3LGWA 1VZQH 4IMQA 4X6NA 1TGBA 4RKOB 1TBRH 1JIMA 1XX9A 3KQDA 2XBYA 3NKKA 4E7RG 4NIYA 2THFB 3N7OA 5GIBA 3ZV8A 1HXFH 4YM9A 1F2SE 3I77A 1BRAA 5A0CA 1JBUH 1E34B 1O2OA 1QRWA 1WSSH 1Y3XA 3OSYA 1WTGH 1P2JA 2Z3CA 1CQQA 1C1UH 1OS8A 1BOQA 1C5VA 1INCA 1E0FD 2ZWLH 5FX6A 4BTTB 1Z1IA 1OWEA 3F9EA 2AYWA 2GZ7A 1BBRH 1EP6A 2ZDMA 4A1TA 1G3DA 4QT8C 1QQUA 3Q00A 3RC4A 1G36A 3ATLA 2XRCA 1TAWA 3LC5A 4X2VA 4OS4A 1TOCB 5EODA 2A2XH 1GBBA 3BG4C 1THRH 3PLKA 3FAOA 1G2LA 1DX5M 1QBVH 5GCHF 1MMJN 1EZUC 2A2QH 3AW1A 3A82A 1F92A 1OWIA 2A1DB 2K1QA 2HRVA 3STIA 3PTNA 1LHGH 1DY9A 1FPCH 1LO6A 2XBVA 1ZOMA 1FY1A 3QK1A 4NA7A 5G4BA 5LGOA 3RXTA 1VGCB 1GHVH 4NWKA 1TONA 2G00A 4CH8B 1DS2E 3RXCA 2ANKH 5JDUB 1TBZH 2ZECA 4Q2KA 1EZXC 1OSSA 1FDPA 3PLPA 3D49H 1GHYH 1XUGA 4BAMB 1F5LA 2FLRH 1P3EA 3GOVB 3MU0A 4KKDA 1UTQA 4ZKOU 2BLWA 3GDVA 1Z8RA 3A84A 3QZQA 2ZDLA 1EOJA 1BZXE 3ATWA 1VJAU 1IQJA 3ZVFA 1PPGE 1V2MT 2A7CA 3SGQE 1ANBA 1C5SA <