4ABHA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abhA02
3FANA 1NRSH 3SJ9A 1EAUA 2ASUB 4AOQA 1JIMA 1D9IA 3SW2B 3Q76A 1H9IE 1AZ8A 5EQQA 2PSXA 3RMOH 1P03A 1GJBB 5E2PA 2J4IA 5JB9S 1ESAA 1DE7H 3PTBA 2BLVA 1O3NA 1QB9A 1DUAA 4XBCA 1QURH 4E7NA 5DP8A 1Z8RA 5G4BA 2BM2A 1GMCF 5B6OA 4FUHA 4Y7AA 1A0JA 3ATLA 2H9TH 4KTSA 3BTHE 1EP6A 3SV6A 1FQ3A 3PO1B 2VIDA 1QTFA 3RXUA 1QA7A 1H1BA 4BXSA 4TY6A 5GCHF 1V2NT 4JYUH 3OY5U 1NFYA 4MPWA 3EQ0H 2AGGX 1Y3VA 1UCYK 1EZUC 2ZGBH 4WF8A 2BVRH 1F0TA 1PPZA 2FPZA 3HGNA 4ISNA 2IOTA 2Z3CA 2RDLA 1CT2E 4GCHF 4A1TA 2ANKH 3S9CA 3TGIE 3ESTA 3QWCH 4NSVA 3ZZDA 1C1VH 1V2JT 1O35A 1TRNA 2QCYA 4X1QU 6LPRA 1C5OH 4TPIZ 3N7OA 1PQ8A 1PFXC 3AW1A 4FUDA 2BDCA 1OOKB 4I31A 4NZLA 1BIOA 1C1PA 1ZTLA 3S7KB 4Y79A 3O8CA 1BBRE 1JXPA 2GT7A 2TGPZ 3RXKA 2Z9KA 1ZJDA 3BTDE 3GISB 1SQOA 1EB2A 1VGCC 1FPCH 3AVZA 3LC5A 4X2VA 1RIWC 2HPPH 1GG6C 2BD4A 1E37B 2Y5GA 2RG3A 1GI1A 1OWDA 1SGTA 1TGSZ 1H9LB 2SNWA 4CRAA 2EI7A 4NWKA 4DGJA 2GV6A 2BD5A 2VWNA 4TWYA 4H4FA 1Z71A 4MDSA 1GJ9B 1LTOA 2P3UB 1TRMA 3TGJE 3ATWA 4XOJA 3RXDA 5TCCA 1YPMH 2WUCA 1NN6A 1LKBA 1MZAA 1D4PB 1C4V2 2XYAA 3ATIA 2BZ6H 1TPOA 1SGNE 4NCYA 1C2GA 1TLDA 1AKSA 1SGPE 3T28A 1FIWA 1QBNA 2P8OB 2IJOB 4NIYA 5A0AE 4CBNA 2VIOA 4CH8B 4WH8A 1O3AA 1ZHPA 1G32B 1UTQA 2QYIA 7ESTE 1BTPA 1O2LA 3L33A 2J94A 1BTUA 2TIOA 2ZNKH 3P70B 3U8TH 1GJ8B 2F91A 4AB9A 3A80A 1MQ5A 3KQCA 3V12A 4IS5A 1O32A 3M61U 1EJAA 3EYDA 8ESTE 4OGYA 2BZAA 1CA0C 3M5MA 5DGJA 3GDUA 2F9UA 1UCYE 1O2WA 1FY8E 1OWEA 2B0FA 2BOKA 2ZI2H 3CENA 1Y5BT 4XE4A 5A8YA 2XCFA 1EPTB 1CHOG 1KXCA 2CHAC 3PV4A 1YC0A 5EODA 1ETRH 1JWTA 3GCHC 1GJAB 2HRVA 2FYQA 5EOKA 2PGQB 4X8UH 1FNIA 2GTBA 5EXNA 2FIRH 3VPKA 3RXGA 2G4TA 3PM3A 2ZU5A 9ESTA 1BTHH 3TJNA 4UEHH 2ESTE 2JH6D 1HJAC 3A7ZA 5A0CA 3HPTB 1GI2A 1OWJA 3NZIA 1AVXA 1FMGA 1KY9A 4X6NA 3V13A 1C5XB 1CSOE 1MTUA 2J34A 3EGKH 1AGJA 5EW2H 1QB6A 1GBTA 3ZVDA 3PROA 1FY5A 3L3TA 4K5ZA 1GWAA 1XM1A 3A83A 1MTWA 4ZMAH 3E91A 1KXEA 2OTVA 1AY6H 1TGCA 1BRCE 1PPFE 2GDDA 3B23B 3FFGA 2C8YB 1J16A 1TRYA 3BG8A 3AW0A 1YKTA 1SFQB 2G51A 4H6TA 3RXEA 4ZXXH 1FN6A 2FTLE 5AHGH 4FU9A 1O2OA 2R9PA 1TGBA 2CGAA 2C4FH 1O3KA 1S85A 1VCWA 1HAYB 5ESBA 1C1QA 2M5TA 4ABDA 3UPEA 4INKA 2AMQA 5IDKA 4GPGA 2UUKB 1EAXA 1THPB 1V2UT 4IC6A 2D8WA 2SGAA 4YZUA 4OS2A 3VB4A 2XNIA 3MU5A 3UY9A 3JZ1B 2GX4A 1AB9B 1XKBC 1GHWH 3MTYA 2BLWA 2F83A 5DK1A 2Z94A 4YT6H 2BXTH 3T62A 2ZEBA 2G4UA 2ZHQH 3NPSA 2C8ZB 2ZDMA 3RXRA 1AE5A 5FAHA 1BMLA 5LPFA 3QUMP 3RXIA 4YTAA 1A3EH 3TNSA 1J14A 1GHXH 3F1SB 2YOLA 3T5FH 1K2I1 3U9AH 1P57B 2ZDVH 2ANWA 3T27A 4Q2KA 3PMBB 1CHOF 1ZRBA 1MUEB 4OS1A 3NWUA 3T26A 1BRBE 5LH8A 2A31A 1IQHA 4FU8A 1QQUA 1J8AA 1P0SH 5T6DA 3SBKA 1SVPA 4GUXA 1BMNH 3A84A 4GLYA 3U1IB 1BCUH 1QA0A 3U8OH 1EP5A 1DITH 2W7UA 3MO9A 1BTYA 2KAIB 3MFJA 1F0UA 2Y80A 2YNAA 4Z6AH 3RXHA 4NA9H 4JCNA 1BMAA 3A88A 3TH2H 3KEEA 3GY3A 2A4QA 3LGVA 1WTGH 4M7GA 4CR5A 4CRDA 8KME2 1IQLA 1YM0A 4D7GA 1F5RA 4WY3A 5A8XA 4CR9A 1ELEE 1ETTH 3OSYA 5GWZA 1JIRA 2F3CE 1CVWH 1A3BH 2THFB 5HM2A 4JZFH 1P2IA 2CXVA 3QK1A 1RD3B 2ZTXA 3SORA 2P3TB 3SV8A 1ZGIA 4BAMB 4NFEA 1ARBA 2QXGA 1HAOH 2A7CA 2PKSB 2NU3E 1OX1A 1H8DH 4AYYB 3KCGH 1G30B 1C2DA 1P2NA 1HAGE 3V0XA 2A2QH 3M37A 4F49A 1D6WA 1O2ZA 3M5NA 2YNBA 3D23A 1ZMNA 4CREA 2BD8A 2VGCC 1BB0B 2EC9H 1UHBB 1DICA 2QXHA 1T8NA 1GCDA 3UNQA 2C8WB 1T8MA 2V0BA 3SU0A 2R3UA 3A87A 3VFEA 1UTPA 4AB8A 3BG4B 4DURA 1UTJA 1W8BH 1YPEH 3BEIB 1MTNC 1UTKA 1Y5AT 1KIGH 2VWLA 1YLDA 3BEFB 1GBMA 3NXPA 3DHKH 2OUAA 1NU7B 4H6SB 2BXUH 1HDTH 1AIXH 3M7UA 3STIA 2ZPSA 1WAYB 1TONA 2Z6BD 5JBAS 3M5LA 5E8EH 1C2EA 2HNTF 2BMGB 3E90B 2G55A 4R0IA 4WMEA 4O03A 1GVZA 3M5OA 2QXIA 2HWLB 1V2QT 1ZPZA 3SV2H 3A82A 1Y3WA 1GBCA 2P3FH 4X1PU 3OX7U 7KMEH 1CBWC 2WPKS 5AFYH 3ZVFA 4MNYA 1SI5H 2A45B 3AAVA 1HAHH 1AVGH 1N6YA 1C5TA 1JRSA 1FAKH 1HV7A 4ABFA 3SU2A 2BVSH 1Z1JA 1TBRH 2ODPA 2FO9A 8GCHF 4BAKB 1V2TT 1BJVA 1C5MD 1O3DA 4WWYA 1SBWA 2A7HA 1BMMH 1L4ZA 1QL8A 1EAIA 1YGCH 2PTNA 2ZECA 4NWLA 1H4WA 1B0FA 1V2PT 2R2MB 1HIAB 1NPMA 3LH3A 3DD2H 4ZHLU 4U32A 3ELAH 1C2IA 1NESE 2VU8E 1HYLA 1T7CA 2FOEA 3ZV9A 3RXPA 2OC7A 4HTCH 2D26C 4UONA 1C1NA 1LPKB 1UVPA 1GJ5H 1MKXH 1SPJA 3GCTG 5CHAC 1GDUA 2FYRA 4MG3A 2BY8X 3U1JB 1DUEA 1MTVA 1TIOA 3MU1A 1RIWB 1WCZA 6CHAC 1BJUA 4F4OC 1GG6B 2UWPA 1SLWB 1HFDA 2QXJA 1UTNA 4J2YB 2GGVB 4X0WU 4Q7YA 1QB1A 4X8SH 1GVKB 1J17T 1TFXA 4ZUHA 4JZEH 4K3JA 2BY5X 3O8BA 1TOCB 5BRRE 1SHYA 4DIHH 2FS8A 1QL7A 3K6ZA 2ZZUH 1G3CA 1BDAA 1SFIA 3LGYA 1CHGA 3JZ2B 1EKBB 2HALA 3SJIA 2WPMS 2ZFSA 3RXMA 1O2HA 3K65B 5FPYA 1MU8B 5SGAE 1IQKA 4CHAC 3SGAE 2SGEE 2FTMA 3CS0A 4TWWA 2KAIA 1SGEE 3C1KA 1RTLA 1DWEH 3F6UH 5GCHG 2PHBA 1GGDC 1WU1A 3SNAA 4OS6A 2PV9B 1K1MA 3TH3H 1FLEE 1QRWA 1ORFA 2DUCA 3OYPA 1QBOA 2D1JA 4ZHAA 5LPEA 3I77A 4GCHG 3MH7A 3TU7H 1DM4B 2PR3A 3MNSA 1H9HE 1UVTH 3E1XB 4UFFH 1LO6A 3SU3A 3L6PA 4AGKA 3KN2A 5FPSA 3AASA 2CHAB 2Z9JA 6GCHF 1C4U2 2H5CA 1K1IA 1O5CB 3EA7A 3HKIB 2AIQA 4K8YA 4MPUA 2SGDE 3E0NB 4SGBE 4CRGA 5DP7A 4K60A 1OXGA 5EQRA 2J38A 2GMTC 3SJOA 2XC5A 4X2WA 3UNSA 2A4GA 1D6RA 2W26A 2ZC9H 3MI4A 3A86A 3S69A 3S7HB 1UHBA 5GJ4B 3FAOA 1THSH 2BDIA 1GVLA 1HJAB 1O2MA 3A7WA 1PYTD 2GD4B 1TA2A 1C1TA 5FBEA 3RC6A 1F5KU 4U01A 4IW4E 2BD2A 2IN2A 1LQEA 3P8FA 1UK3A 1BT7A 3TK5A 4B73A 1BOQA 2ZU3A 1MAYA 1G3DA 4DW2U 2ULLA 5F8XA 2RA0A 3ODFA 3SN8A 3MH5A 3U69H 1C4Y2 4XBBA 3M7QA 1S84A 4NG9H 1IHSH 1L4DA 2CF9H 1HB0B 1WBGB 1VZQH 3H7TA 1O3HA 4O3TA 3ZVEA 3MMGA 1EOJA 1C5PA 2ZIQH 3UOUA 2BDAA 4XSKU 1O3BA 1LQDB 2D2DA 2O8MA 3UWIA 2TBSA 1A0LA 1MBMA 1FN8A 1Z8GA 3PMJA 3M3TA 1D3PB 1P11E 4ZH8A 1LCYA 3D62A 4BAHB 3MU4A 3RXJA 1Z8JB 4IMZA 3KGPA 4GHQA 3WY8A 6ESTA 4JMYA 1C2LA 1C2MA 3EAJA 3RXLA 1O0DH 4UFGH 5J4QA 4QT8C 2AFQB 3HKJB 1T4VH 3LDXH 1FDPA 5K7RA 1SGCA 1DS2E 1IQGA 1QHRB 4B2AA 4D7FA 5EXLA 3W94A 1HIAA 2IPHA 4BTTB 3SHCH 1YPHE 3CP7A 1JOUB 2VVUA 3OTJE 3SNEA 3T2NA 4X6PA 1P04A 3RXVA 2VWOA 2UUYA 3I29A 5EGMA 3SI4H 2G81E 1KXFA 2TGDA 1C5NH 4E05H 5EXMA 2W7SA 1PJPA 2ZQ2A 3BTTE 4ABBA 3Q3KA 2XW9A 1LMWB 1P3CA 1EQ9A 4RN6A 3UFAA 1G2MA 4WMFA 1ELGA 1F7ZA 5FPTA 1UVUH 3BTKE 4FUIA 1P2KA 3ENSB 1YCPM 2WINI 2TGAA 3SGQE 1N8OB 1OSSA 1FY3A 3FP6E 1WUNH 2A4RA 3QGJA 3V7TA 5CE1A 1YYY1 4YM9A 1Y3UA 3GYLB 2BQWB 2HNTE 1HJ8A 1O3GA 1TNGA 4KP0A 3K6YA 2XBVA 3LJOA 4UFEH 1NO9H 2A5AA 5C5OA 2BYAX 2VIQA 5C3NA 2PKAB 3MH4A 4ABHA 2F9BH 2PWXA 3QZRA 3RLWH 3RC5A 2CMYA 1SGQE 4ZXYH 2O9QA 1BUIA 4RSPA 5FHTA 4FXGH 1V2OT 2SFAA 2ZPRA 4OS5A 2BX3A 2OBQA 5FX6A 1PQ7A 3OY6U 2VGCB 1KLIH 3ZVCA 4Q7ZA 1GHBF 3SGBE 1A5IA 3QN7A 2AMPA 4DIIH 1CT0E 4K1SA 5A2MH 3UR9A 5JPMH 4Y0YE 3UWJH 4UFDH 1SOZA 2OXSA 2ZKSA 1P12E 3ZV8A 4BAQB 4KTCA 1XVOA 1XX9A 4NGAH 1MTNB 1V2MT 1DANH 1EB1H 1XUGA 1AWHB 2XBXA 1FAXA 1ACBE 1EXFA 3H5CB 4LZ1H 1MTSA 1AWFH 4NIVA 1YCPH 3DA9B 3GCNA 1E34B 2C3SA 1LVBA 1A0HB 1TNJA 1LPZB 5ABWA 1HRTH 2J92A 1DT2A 1KYNA 4X8TH 5AF9H 1N6XA 2ZDLA 3IG6B 1C1UH 2FEQH 1TBQH 5CMXH 1ZPBA 3SNCA 1CBWB 2G52A 2GKVE 3ZZ4A 2O8LA 5HGGA 4CBOA 1QL9A 1DX5M 1MU6B 2V3HH 4Z0KA 4JK6A 1GHYH 3ZVBA 1V2KT 4A1VA 1O5EH 1TYNA 1OP2A 4Y7BA 1ANBA 1GJDB 3R0FA 1AUTC 2J9NA 1NC6A 1L2EA 1O3FA 3MO6A 4Y6DA 3SQEE 2DE8A 3RP2A 1SHHB 1P09A 4AGJA 1Q3XA 3PLPA 1A46H 2EEKA 4CH2B 2BB4A 3BN9A 3RC4A 3K2UA 1G3EA 3TVJB 1DXPA 3PWBA 2SNVA 3RDZA 1SC8U 2BX4A 3LC3A 3Q3YA 5DG6A 5CHAB 3TIUA 1Z6JH 2AYWA 2XWBI 1LHCH 2ZU4A 3KQBA 4ABGA 6CHAB 1K1LA 1THRH 1FPHH 3FZDA 1DLKB 1TGNA 3BEUA 1K21H 4UE7H 5C67A 4I8HA 4K1EA 1O2UA 1V2ST 4GSOA 1NZQH 3F9GA 1EATA 3RUOA 3RXQA 1FY1A 2W3IA 4OS4A 1O2VA 5TJXA 2BY9X 4INHA 3BTFE 1GDNA 3O8RA 4JYVH 1V2WT 5A8ZA 4I32A 2P94A 3BTEE 1P8VC 1LHEH 1O30A 2CF8H 1GJ6A 1S0RA 2RCEA 4HFPB 4DVAU 4Q80A 1XXDA 3LGUA 1SLUB 1SGDE 4IN2A 2Z7FE 1KSNA 3P95A 2FODA 1T8LA 4A92A 1BA8B 1Y8TA 4CHAB 2H1UA 4X8VH 1F92A 2AGEX 4H42U 2BDYA 3ZVGA 3ZZ5A 1O2SA 1IHTH 5H4IB 3MWIU 3QTOH 2ZCLP 1AFQB 1DY9A 1YCPK 1ZSKA 2V6NA 2QAAA 4Y0ZE 1HAPH 1L1NA 8GCHG 5FCKA 5GPIB 3M3VA 1NRRH 2AERH 5JBBS 1JBUH 3HGPA 2Z9IA 1GI5A 2PKAA 3GDSA 4JK5A 1TNKA 3TH4H 2C90B 4DY7B 1C5SA 3W95A 1FJSA 1BQYA 1QQ4A 3TLOA 3ZYDA 1TPSA 5F8ZA 1ELAA 3LONA 1EAWA 1BRUP 1K1PA 4X1NU 3VXEH 1GCTB 2SGQE 2AMDA 4FUFA 2GZ9A 4ISIH 2PFEA 2Z3DA 2GMTB 4YT7H 3F9EA 4I8KA 1GI3A 1A2CH 1C1WH 2BQ7B 3P8OA 2FMJA 2UUFB 3ZZ6A 1OYQA 7LPRA 3CS7A 3UNRA 3T25A 2BOHB 2W5EA 1C2HA 1EJMA 1H8IH 3IITA 3EDXB 2QA9E 5DP5A 1BTZA 2B9LA 1AHTH 3LOXA 1O3PB 1O2QA 4TPYA 4X2YA 4ABJA 3LH1A 1WTHD 3RLYH 1RXPA 1LPGB 2WPIS 2FI4E 1TNIA 3NKKA 1GL1A 1OWHA 1GBEA 1AO5A 2P8OC 1ZTJA 4MPVA 1Q31A 4B76A 1W14U 3D49H 4I8LA 2UWLA 3A8AA 4TY7A 2HVXA 1GJ4H 4LOYH 3ATMA 1RFNA 1TX6A 1GBJA 1QNJA 1NFUA 2B7DH 4K2YA 1RGQA 5HYOA 4B74A 4Y10E 2BLQA 1T4UH 1UMAH 2VH6A 1O5DH 2ZCKP 3DFLA 1CU1A 1UTLM 2VIWA 3VB6A 4B2BA 1TA6A 3NK8A 2QY0B 1BHXF 3C27B 4ZKOU 1K1OA 2CV3A 1O33A 1CE5A 2FOHA 2FZZA 4JYTA 2NU1E 1EPTC 3PB1E 2QN5T 1P05A 3ZZ9A 3UIRA 2J2UA 2BVXH 6GCHG 1TQ7B 1W2KH 4A7IB 2OQUA 1L0ZA 5F8TA 1MKWH 2OINA 2ZFFH 4BTIB 4ESTE 2XC0A 4MVNA 5EPNA 4HGCA 4LK4A 1DSUA 2W3KA 1WV7H 3F9HA 4I8GA 3AAUA 1ZMJA 1AU8A 1NFWA 4R8TB 3SUDA 1TABE 4B1TA 1O5BB 3E6PH 1PQ5A 1QCPA 2P16A 2H2ZA 3Q77A 1GHAF 2ZG0H 2FP7B 1O38A 2FX4A 1O3MA 1UJ1A 2AGIX 4YLUA 1KTTB 1O2RA 3UREA 3QLPH 4E7RG 4AORA 1TNHA 5DJ7A 1VGCB 2OC8A 3MO3A 2BD7A 5EQSA 1GBLA 1K28D 1ZR0A 4FUBA 1C1RA 1TMTH 1VITF 4AG1A 3FVFB 2FI3E 1P06A 3F68H 3ZZCA 1QR3E 5L2ZH 1SGYE 1GI8B 2WYJA 9LPRA 2P59A 1GPZA 2ODQA 3RMMH 2R3YA 2I6QA 1QFKH 1TPAE 3I78A 3GY5A 2F9OA 4WVPE 1OS8A 3SZNA 3MNCA 1HAVB 2OD3B 1CGHA 2Y82A 1O2KA 1M9UA 2ZF0H 1GMDF 5T6GA 4CRFA 4AFQA 1PPHE 1AB9C 1RTFB 1XVMA 1A1RA 1U6QA 1FY4A 1GBFA 1V2RT 5E0HA 1IAUA 2FOGA 1TWXB 1ELVA 5IYTA 2FI5E 1DWDH 4DOQA 2DE9A 1CA0B 4YO9A 3RXOA 1LHGH 1C2KA 1YF4A 1VCPA 1QRZA 1RS0A 1DLEA 1MD7A 4JZIA 1S0QA 1VITH 1DOJA 5L2YH 4KKDA 4A6LA 2GCTC 1NFXA 1TNLA 1BHXB 3PLBA 4YOIA 4AZ2B 1GI9B 4SGAE 2ZHWH 1TBZH 1NY22 3GCHB 1LVYA 4KELA 1GMHF 2WV4A 1HXFH 1GL0E 1MKWK 2FLBH 2QF0A 2FOBA 1HUTH 1CA8B 3HK3B 5JBTA 1EX3A 1ID5H 1PQAA 1F5LA 5DP3A 2PUXB 2GCHF 3P8NA 5J4SA 2EI6A 3VEQB 4K69A 3E8LA 4FUEA 2PLXA 1VJ9U 1NTPA 1O37A 1O3IA 3MYWA 4VGCC 2ZDAH 2ZDKA 5DP4A 1WOFA 1ZPCA 1AUJA 4AFZA 4ZKNU 2ZDNA 4WXIA 1PPBH 3QX5H 2XTTB 5EG4A 1QBVH 1O3EA 1SG8B 2F9NA 4LZ4B 2BHGA 3M3SA 1GI0A 3LGIA 2ZU2A 4KTUA 1DPOA 1FUJA 4NA8A 5PTPA 1P01A 3LU9B 3Q00A 1F2SE 2PGBB 5C2ZA 1W13U 1ELDE 1JMOH 2VINA 2ZGHA 3SU1A 5EW1H 1L1JA 1KLTA 1S83A 4IBLH 2O8TA 1ELTA 1YPLH 1GHBG 2RA3A 3LPRA 2Q6FA 1C2FA 2GP9B 2H5DA 3ZVAA 1EZXC 1GBAA 3DFJA 4XBDA 2ZHDA 1TALA 3BG4C 1F0RA 1QIXB 2XRCA 1D3QB 1XKAC 1GBIA 4GAWA 1PPCE 3DT0H 3RXSA 3ZZBA 3VGCC 2BD3A 5A0BA 4D8NA 2A2XH 1INCA 1C5UA 1LVMA 3F9FA 3TITA 1HAZB 3SQHE 2XBWA 1PPGE 2ZPQA 3BF6H 3U98H 1ETSH 1UK2A 3RMLH 4A5TS 1O5GH 1O2PA 1P9SA 5HM9A 1GJCB 1NRQH 2WPHS 2ZCHP 4WH6A 3RU4T 1LDTT 3VB5A 5I46H 3EA9A 8LPRA 4AX9H 2STAE 4A1XA 4B75A 2VH0A 3B9FH 2ZWLH 2V35A 1OP0A 1UVOA 1O2YA 3RXTA 1C9PA 2G5VA 1IOEA 5C1UA 1C5YB 4WMDA 1ZJKA 5GIBA 2Y7ZA 3UTUH 1C5WB 1W7GH 3DUXH 5HXFA 2GVFA 3S9BA 5E0JA 1MMJN 2C93B 3SU4A 4I8JA 1C5RA 3ZZ3A 2LNCA 3SV9A 1D3DB 3O8DA 1TOMH 1YPGH 2NU4E 1ZSLA 4ZAEA 1V6DA 2R2WU 3SV7A 2AS9A 1LHFH 2ZA5A 4YOJA 2QV1A 1XUKA 1G3BA 3LJJA 2A4OA 1HAVA 3KF2A 4AFSA 1AQ7A 1ZRKA 1EUFA 3T29A 2VB0A 3URCA 4UD9H 2B8OH 1B0EA 4AN7A 4HI3A 1A5HA 5E0GA 1BRAA 4E06H 1ELBA 1V3XA 2GT8A 1TAWA 3TK6A 4AYVB 2Z3EA 2A7JA 1HNEE 1YPHC 2JETC 3FP7E 1W0YH 1YPKH 2FOFA 1EJNA 2HGTH 2O8WA 1ELFA 3RMNH 3VB3A 1W12U 4XFQA 3SNDA 2FOCA 3KHVA 4BNRA 1SB1H 4AFUA 2Z9LA 1UVSH 1QGFA 1E0FD 1ZYOA 1XUFA 2ZTZA 4OGXA 4ZKRU 5L30H 4X2XA 1FV9A 1G2LA 1GBHA 5AFZH 4I33A 4FUJA 1ZHMA 1N1LA 4NIWA 4B2CA 2ZFPH 7GCHG 3A85A 2G8TA 5JBCS 1OP8A 3ZZ7A 2BY7X 1G36A 1KTSB 3MH6A 3SO3A 1LHDH 2ZGCA 1MZDA 1A61H 4O3UA 3GCOA 2OP9A 1T32A 2OC1A 1W3CA 1S5SA 4FVDA 2TPIZ 2VIPA 2FWWA 1K9OE 3M35A 2HNTC 1ELCA 3KQEA 1KXDA 3HK6B 1A4WH 4I7YH 1L1GA 3STJA 5DP9A 2WPLS 4NA7A 1C2JA 3BTGE 4JZ1A 5JDUB 1O39A 2Z9GA 4U30A 5T3HA 2GZ8A 1O3JA 3ZYEA 4ISLA 3RU4E 1W7XH 3HATH 3RXAA 2AIPA 1W10U 1SR5C 1HAIH 4LXBH 4IN1A 1ZZZA 4B71A 5C20A 1HAXB 1SQAA 2ALVA 2PW8H 1NU9A 4CRCA 3RXCA 1VJAU 3BIUH 1GHZA 1E35B 2VNTA 1NT1A 4YESB 3UQVA 3A7VA 2Y5FA 3PWCA 1IQNA 1AN1E 5ETXA 1RRKA 5GXPA 3LGWA 2G5NA 2STBE 2OQ5A 1IQIA 1SOTA 3VXFH 2BTCE 1AD8H 3A81A 4IC5A 2Y81A 4X1RU 2FOMB 1P3EA 3NCLA 5EU8A 4ABEA 2R0LA 3GY8A 3A7YA 4MTBA 4X6OA 2ZFTA 1BTXA 1VR1H 4K1TA 2ILNA 3QZQA 2ZGJA 2OLGA 4O9VA 4WXVA 3BTWE 4YOGA 1B5GH 1T31A 2K1QA 2NU2E 1DDJA 1FONA 1ESTA 2H9EH 4GHTA 3BV9B 2AEIH 3E16B 1QRXA 4NFFA 1HGTH 1DFPA 2SGFE 4NIXA 5C5NA 4DG4A 1ANDA 1BZXE 3M7TA 3TPIZ 3PO1C 2WUBA 1O2JA 5FBIA 2HOBA 3BIVH 1XXFA 7GCHF 1TX8A 3ATKA 1AMHA 1ARCA 3LT3A 1ANEA 3FP8E 2QGRA 1GGDB 4OS7A 1TB6H 2FDAA 2V3OH 3BTME 5GDSH 5EPYA 4FVBA 1X7AC 2QF3A 1C5ZB 2BLOA 3UUZA 5LGOA 1P2MA 1E38B 2EA3A 2GDEH 4DT7B 3GY2A 5AVDA 3RXBA 1ZGVA 1FIZA 1GI7B 2C8XB 1O5AB 1MCVA 4IMQA 1WSSH 4ASHA 2GCTB 2Q1JA 4YLQH 4IGDA 1DXWA 1AE8H 3A8BA 3D65E 3QO6A 4K8BA 3K9XB 3PYHA 4D76A 1TMBH 2G00A 2LPRA 2XWAA 3MHWU 1GHAG 5TCAA 5JB8S 1KXAA 1P2JA 3MNXA 4INLA 2P93A 3UQOA 1AZZA 1N8OC 1GHVH 3MU8A 1PPEE 3P92A 1T8OA 5T6FA 2H9HA 1XUJA 1OKXA 2ZHFH 2QC2A 5LPRA 4TYDA 4X6MA 3SOSA 3ZZ8A 2ODYB 2WV5A 4VGCB 1VITG 1GBKA 2I6SA 4ZKSU 1IQJA 3GY4A 1UTOA 5DP6A 1SGRE 1S81A 1CGIE 4XDEA 4ZHMU 2NWNA 1EZSC 1DVAH 3G01A 1MD8A 4NZQA 5ESTE 2Y6TA 2CJIA 1O5FH 1RJXB 1Z1IA 2OCVB 3SUEA 2FS9A 1KDQB 1AFEH 1GBBA 1MH0A 1SLXB 1QJ1B 1Z7KA 3MU0A 2ALPA 1Z8IB 2PTCE 3KL6A 2F9PA 1G9IE 1IQFA 5DPAA 3TJVA 2BDHA 3GICB 5K0HA 3RU4D 1C1SA 3E3TA 3OU0A 3BSQA 1GMDG 3BTQE 3QTVH 1P9UA 1E36B 1O34A 3U8RH 1O31A 1AVWA 4WJG2 5DO4H 4Y76A 3LKWA 1UO6A 1Y5UT 1EOLA 5HMAA 1RTKA 1YBWA 4FUGA 1EPTA 1IQEA 2FX6A 1FZZA 3EA8A 1V2LT 5F03A 3GY6A 4FU7A 1J9CH 4X1SU 2F9VA 2XC4A 3SJKA 2NU0E 1G37A 4BOHA 2VVVA 4MNXA 3TK9A 3Q3XA 2CN0H 3VGCB 1S6HA 1VCQA 2ZO3H 1DWCH 1C5QA 1NS3A 3P8GA 4BANB 5FCRA 1HJ9A 3UOPA 1BITA 2Q6GA 3TNTA 2P95A 1OWIA 2ZGXH 1LVOA 4JZDH 2ZU1A 1MAXA 1SL3A 3SUFA 3SJ8A 2JH0D 1GMHG 1C9TA 1QJ7B 1ESBA 1SGFA 1DY8A 1O2GH 1UTMA 1SGIB 3RM2H 1DWBH 3MNBA 5FXLA 1P10A 3TGKE 1O3OA 2GCHG 4Y11E 1MCTA 2VJ1A 5BPEA 2ANMH 1SMFE 3MOCA 4CRBA 1FXYA 1V2VT 1ABIH 1JRTA 2OC0A 2XXLA 3FZZA 2A5IA 3B8JA 1NROH 4O97A 4BAOB 3A89A 1ZTKA 3NUMA 1CT4E 3ITIA 3E0PB 1BTWA 1C1MA 1NM6A 1IQMA 4DJZB 4THNH 2UWOA 5C1XA 1BBRH 4Q7XA 1CQQA 1TPPA 5I25A 1CO7E 2H6MA 1WYKA 1LKAA 3LIWA 3M36A 4Y8ZA 5FX5A 3PMHB 3ZZAA 2WYGA 4GVUA 1ABJH 3GOVB 4HZHA 4FUCA 1GDQA 1ANCA 1TMUH 1YP9A 4PROA 2WPJS 1PYTC 1TE0A 2J95A 2JKHA 2VVCA 4MNVA 3S9AA 3A7TA 1P2QA 3A8CA 3SI3H 1EZQA 2TRMA 1XMNB 3SUGA 1J15A 2Y5HA 2BDBA 4BXWA 2HPQH 2A1DB 1Y3YA 1KXBA 1ZMLA 2A0QB 2JETB 1A7SA 3SU5A 3A7XA 3QGNB 3KIDU 4ISOA 1OPHB 1SSXA 3QDZB 4D9QA 3SU6A 3S0NA 1Z6EA 4Y8XA 4J1YA 2HLCA 1KLJH 2XCNA 2ZFRH 2ZHEH 1P02A 1ZLRA 3ODDA 1S82A 3PMAB 2ZTYA 1O2IA 1A5GH 1YPJH 2Y7XA 4ABAA 1GMCG 4AG2A 1QY6A 1GI6A 2FLRH 3KNXA 2GZ7A 1OWKA 3IWMA 4Y8YA 1NRPH 3KQDA 1OYTH 1O3CA 2FESH 1SLVB 4MNWA 1AI8H 2PUQH 1C5LH 1Y3XA 2SGPE 3URDA 3P17H 1C1OA 1AFQC 1YLCA 2BDGA 1UCYH 2R0KA 2VIVA 4MLFB 1UK4A 1QJ6B 2B5TB 3PLKA 2PSYA 1Y59T 2JH5D 3H7OA 1EASA 1AKSB 1HBTH 1FI8A 3SHAH 1K1JA 1K1NA 2GV7A 1CGJE 1GI4A 3V3MA 4NSYA 1ZHRA 1GBDA 3LGTA 1WQSA 1K22H 1O2NA 1WQVH 1Q2WA 2FOAA 1ZOMA 4RKJB 4BTUB 2ANYA 4DCDA 1ZSJA 1MBQA 1SGFG 1S6FA 2TGTA 4UDWH 5E2OA 3GDVA 1TQ0B 1TX7A 2A5KA 2BD9A 3A8DA 2AH4X 1O2XA 1O36A 1KDQA 5DKMA 3UR6A 1O2TA 1P2OA 4KGAA 1GCTC 2FM2A 1HLTH 3PTNA 5L6NH 4U2WA 2OBOA 2Q6DA 4ISHH 2ZQ1A 3GYMA 4Y71A 1HCGA 4ZROA 4ABIA 5F6MA 3RXFA 3SNBA 2VWMA 4MQAA 2BQ6B 3EE0B 2PKSC 1BBRK 4RKOB 2XBYA 2FXRA 2EI8A 5A09A 1TGTA 1XUHA 2QIQA 1W0ZU 3TJUA 1HPGA 5C1YA 1NRNH 1B7XB 1F0SA 1W11U 2ZP0H 3P6ZB 1SQTA 3TJOA 3R3GB 3VB7A 2O8UA 2ZFQH 4MPXA 3RM0H 4D9RA 1MQ6A 3GCTF 2UUJB 5JYIA 1MKXK 3GY7A 1HXEH 1XUIA 1C5VA 1D3TB 1DSTA 2BY6X 2A32A 1O3LA 1GJ7B
chains in the Genus database with same CATH superfamily
3FANA 1NRSH 3SJ9A 1EAUA 2ASUB 4AOQA 1JIMA 1D9IA 3SW2B 3Q76A 1H9IE 2JIZD 1AZ8A 5EQQA 2PSXA 3RMOH 1P03A 1GJBB 4RI0A 5E2PA 2J4IA 5JB9S 1ESAA 1DE7H 3PTBA 2BLVA 1O3NA 1QB9A 1DUAA 3OE7D 4XBCA 1QURH 4E7NA 5DP8A 1Z8RA 5G4BA 2BM2A 1GMCF 5B6OA 4FUHA 1SQRA 4Y7AA 1A0JA 3ATLA 2H9TH 4KTSA 3BTHE 1EP6A 3SV6A 1FQ3A 3PO1B 2VIDA 1QTFA 3RXUA 1QA7A 1H1BA 4BXSA 4TY6A 5GCHF 1V2NT 2V7QD 3OY5U 4JYUH 1NFYA 4MPWA 3EQ0H 2AGGX 1Y3VA 1UCYK 1EZUC 2ZGBH 4WF8A 2BVRH 1F0TA 1PPZA 3F0OA 2FPZA 3HGNA 4ISNA 2IOTA 2Z3CA 2RDLA 1CT2E 4GCHF 4A1TA 3PV2A 2ANKH 2XNDD 3S9CA 2YMSC 3TGIE 1NBME 3ESTA 3QWCH 4NSVA 3ZZDA 1C1VH 1V2JT 1O35A 1TRNA 2QCYA 4X1QU 6LPRA 1C5OH 4TPIZ 3N7OA 1PQ8A 1PFXC 3AW1A 4FUDA 2BDCA 1OOKB 4I31A 4NZLA 1BIOA 1C1PA 1ZTLA 3S7KB 4Y79A 3O8CA 1BBRE 1JXPA 2VBCA 4ASUD 2GT7A 2TGPZ 3RXKA 2F43B 2Z9KA 1ZJDA 3BTDE 3GISB 1SQOA 1EB2A 1VGCC 1FPCH 3AVZA 4OM9A 3LC5A 4X2VA 1RIWC 2HPPH 1GG6C 2BD4A 1E37B 2Y5GA 2RG3A 4RT1A 1GI1A 1OWDA 1SGTA 1TGSZ 1H9LB 2SNWA 4CRAA 2EI7A 4NWKA 3PRDA 4DGJA 2GV6A 2BD5A 3SYJA 2VWNA 4TWYA 4H4FA 1Z71A 4MDSA 1GJ9B 1LTOA 2P3UB 2V3MA 1TRMA 3TGJE 3ATWA 4XOJA 3RXDA 5TCCA 1YPMH 2WUCA 1NN6A 1LKBA 3OTPA 1MZAA 1D4PB 1C4V2 2XYAA 3ATIA 5C17A 2BZ6H 1TPOA 1SGNE 3EE7A 4NCYA 1C2GA 1TLDA 1AKSA 1SGPE 3T28A 1FIWA 1QBNA 2P8OB 2IJOB 4NIYA 5A0AE 3MQKC 4CBNA 2VIOA 4CH8B 4WH8A 1O3AA 1ZHPA 1G32B 1UTQA 2QYIA 3UB0A 7ESTE 1BTPA 1O2LA 3L33A 2J94A 1BTUA 2TIOA 2ZNKH 3P70B 3U8TH 1GJ8B 2F91A 3CNRA 3OEHD 4AB9A 3A80A 1MQ5A 3KQCA 3V12A 4IS5A 1O32A 3M61U 1EJAA 3EYDA 8ESTE 4OGYA 2BZAA 1CA0C 1MABB 3M5MA 5DGJA 3GDUA 2F9UA 1UCYE 1O2WA 1FY8E 1OWEA 2B0FA 2BOKA 2ZI2H 3CENA 1Y5BT 4XE4A 5A8YA 2XCFA 1EPTB 1CHOG 1KXCA 2CHAC 3PV4A 1YC0A 5EODA 1ETRH 2YMSD 1JWTA 3GCHC 1GJAB 2HRVA 2KR7A 2FYQA 5EOKA 2PGQB 4X8UH 1FNIA 2GTBA 5EXNA 2FIRH 3VPKA 3RXGA 2WHXA 1OHHD 2G4TA 3PM3A 2LELA 2ZU5A 9ESTA 1BTHH 3TJNA 4UEHH 2ESTE 2JH6D 1HJAC 3A7ZA 5A0CA 3HPTB 1GI2A 1OWJA 3NZIA 1AVXA 1FMGA 1KY9A 4X6NA 4XRNA 3V13A 1C5XB 1CSOE 1MTUA 2J34A 3EGKH 1AGJA 5EW2H 1QB6A 1GBTA 3ZVDA 3PROA 1FY5A 3L3TA 4K5ZA 1GWAA 1XM1A 3A83A 1MTWA 4ZMAH 3E91A 1KXEA 2OTVA 1AY6H 1TGCA 1BRCE 1PPFE 3F3BA 2GDDA 3B23B 3FFGA 2C8YB 1J16A 1TRYA 3BG8A 3AW0A 1YKTA 1SFQB 2G51A 4H6TA 3RXEA 4ZXXH 1FN6A 2FTLE 5AHGH 4FU9A 1O2OA 4F48B 2R9PA 1TGBA 2CGAA 2C4FH 1O3KA 1S85A 1VCWA 1HAYB 5ESBA 1C1QA 2M5TA 4ABDA 3UPEA 4INKA 2AMQA 5IDKA 4GPGA 2UUKB 1EAXA 1THPB 1V2UT 4IC6A 2D8WA 2SGAA 4YZUA 4OS2A 3VB4A 2XNIA 3MU5A 3UY9A 3JZ1B 2GX4A 1AB9B 1XKBC 1GHWH 3MTYA 2BLWA 2F83A 5DK1A 2Z94A 4YT6H 5DSFA 2BXTH 3T62A 2ZEBA 2G4UA 2ZHQH 5HIYA 3NPSA 2C8ZB 2ZDMA 3RXRA 1AE5A 2OK5A 5FAHA 1BMLA 2KM0A 5LPFA 3QUMP 3RXIA 4YTAA 1A3EH 3TNSA 1J14A 1GHXH 3F1SB 2YOLA 3T5FH 1K2I1 3U9AH 1P57B 2ZDVH 2ANWA 3T27A 4Q2KA 3PMBB 1CHOF 1BMFD 1MUEB 1ZRBA 4OS1A 3NWUA 3T26A 1BRBE 5LH8A 2A31A 1IQHA 4FU8A 1QQUA 1J8AA 1P0SH 5T6DA 3SBKA 1SVPA 4GUXA 1BMNH 3A84A 4GLYA 3U1IB 1BCUH 1QA0A 3U8OH 1EP5A 1DITH 2W7UA 3MO9A 1BTYA 2KAIB 3MFJA 1F0UA 3DSOA 2Y80A 2YNAA 4Z6AH 3RXHA 4NA9H 4JCNA 1BMAA 3A88A 3TH2H 3KEEA 3GY3A 2A4QA 3LGVA 4ZCNA 1EFRD 1WTGH 4M7GA 4CR5A 4CRDA 8KME2 1IQLA 1YM0A 4D7GA 2L74A 1F5RA 4WY3A 5A8XA 4CR9A 1ELEE 1ETTH 3OSYA 5GWZA 1JIRA 2F3CE 1CVWH 1A3BH 2THFB 5FL7D 5HM2A 4JZFH 1P2IA 2CXVA 3QK1A 1RD3B 2ZTXA 3SORA 2P3TB 3UAIC 3SV8A 4M9FA 1ZGIA 4BAMB 4NFEA 1ARBA 2QXGA 1HAOH 2A7CA 2PKSB 2NU3E 1OX1A 1H8DH 4AYYB 3KCGH 1G30B 1C2DA 1P2NA 1HAGE 3V0XA 2A2QH 3M37A 4F49A 1D6WA 1O2ZA 3M5NA 2YNBA 3D23A 1ZMNA 4CREA 2BD8A 2VGCC 1BB0B 2EC9H 1UHBB 1DICA 2QXHA 1T8NA 3U28C 1GCDA 3UNQA 2C8WB 1T8MA 2V0BA 3SU0A 2R3UA 3A87A 3VFEA 1UTPA 1E1QD 4AB8A 3BG4B 4DURA 1UTJA 1W8BH 1YPEH 3BEIB 1MTNC 3DSPA 1UTKA 1Y5AT 1KIGH 2VWLA 1YLDA 3BEFB 1GBMA 3NXPA 3DHKH 2OUAA 2F4LA 1NU7B 4H6SB 2BXUH 1HDTH 1AIXH 3M7UA 3STIA 2ZPSA 1WAYB 1TONA 2Z6BD 5JBAS 3M5LA 5E8EH 1C2EA 2HNTF 2BMGB 3E90B 5KGOA 5HIZA 2G55A 4R0IA 4WMEA 4O03A 1GVZA 3M5OA 2QXIA 2HWLB 1V2QT 1ZPZA 3SV2H 3A82A 1Y3WA 1GBCA 2P3FH 4X1PU 3OX7U 7KMEH 1CBWC 2WPKS 5AFYH 3ZVFA 3KYFA 4MNYA 1SI5H 2A45B 3AAVA 1HAHH 1AVGH 1N6YA 1C5TA 1JRSA 1FAKH 1HV7A 4ABFA 3SU2A 2BVSH 1Z1JA 1TBRH 2ODPA 2FO9A 8GCHF 4BAKB 1V2TT 1BJVA 1C5MD 1O3DA 4WWYA 1SBWA 2A7HA 1BMMH 1L4ZA 1QL8A 1EAIA 1YGCH 2PTNA 2YMSB 2ZECA 4NWLA 1H4WA 1B0FA 1WXRA 1V2PT 2R2MB 1HIAB 1NPMA 3LH3A 3DD2H 4ZHLU 4U32A 3ELAH 1C2IA 1NESE 2VU8E 1HYLA 1T7CA 2FOEA 3ZV9A 3RXPA 2OC7A 4HTCH 2D26C 4UONA 1C1NA 1LPKB 4B6EA 1UVPA 1GJ5H 1MKXH 5CDFE 1SPJA 3GCTG 5CHAC 1GDUA 1FX0B 2FYRA 2L6OA 4MG3A 2BY8X 3U1JB 1DUEA 1MTVA 1TIOA 3MU1A 1RIWB 1WCZA 6CHAC 1BJUA 4F4OC 1GG6B 2UWPA 1SLWB 1HFDA 2QXJA 2HVYB 1UTNA 4J2YB 2GGVB 4X0WU 4Q7YA 1QB1A 4X8SH 4AC9A 1GVKB 5T1VA 1J17T 5KEDA 3GS9A 1TFXA 4ZUHA 4JZEH 4K3JA 2BY5X 3O8BA 2J5UA 1TOCB 4TT3D 5BRRE 1SHYA 4DIHH 2FS8A 1QL7A 3K6ZA 2ZZUH 1G3CA 1BDAA 1SFIA 3LGYA 1CHGA 3JZ2B 1EKBB 2HALA 3SJIA 2WPMS 2ZFSA 3RXMA 1O2HA 2IPQX 3K65B 5FPYA 1MU8B 5SGAE 1IQKA 4CHAC 3SGAE 2SGEE 2FTMA 3CS0A 4TWWA 2KAIA 1SGEE 3C1KA 1RTLA 1DWEH 5HKKD 3F6UH 5GCHG 2PHBA 1GGDC 1WU1A 3SNAA 4OS6A 2PV9B 1K1MA 1H8ED 3TH3H 1FLEE 1QRWA 1ORFA 2DUCA 3OYPA 1QBOA 2D1JA 4ZHAA 5LPEA 3I77A 4GCHG 3MH7A 3TU7H 1DM4B 2PR3A 3DSGA 3MNSA 1H9HE 1UVTH 3E1XB 4UFFH 1LO6A 3SU3A 3L6PA 4AGKA 3KN2A 5FPSA 3AASA 2CHAB 2Z9JA 6GCHF 1C4U2 2H5CA 1K1IA 1O5CB 3EA7A 3HKIB 2AIQA 4K8YA 4MPUA 2SGDE 3E0NB 4SGBE 4CRGA 5DP7A 4K60A 1OXGA 5EQRA 2J38A 2GMTC 3SJOA 2XC5A 3KQ5A 4X2WA 3UNSA 2A4GA 1D6RA 2W26A 2ZC9H 3MI4A 3A86A 3S69A 3S7HB 1UHBA 5GJ4B 3FAOA 1THSH 2BDIA 1GVLA 1HJAB 1O2MA 3A7WA 1PYTD 2GD4B 1TA2A 1C1TA 5FBEA 5GNDA 3RC6A 1F5KU 4U01A 4IW4E 2BD2A 2IN2A 1LQEA 3P8FA 1UK3A 1BT7A 3TK5A 4B73A 1W0JD 1BOQA 2ZU3A 1MAYA 1G3DA 4DW2U 2ULLA 5F8XA 2RA0A 3ODFA 3SN8A 3MH5A 3U69H 1C4Y2 4XBBA 3M7QA 1S84A 4RT0A 4NG9H 1IHSH 1L4DA 2CF9H 1HB0B 1WBGB 1VZQH 3H7TA 1O3HA 4O3TA 3ZVEA 3MMGA 1EOJA 1C5PA 2ZIQH 3UOUA 2BDAA 4XSKU 1O3BA 1LQDB 2D2DA 2O8MA 3UWIA 2TBSA 1A0LA 1MBMA 1FN8A 1Z8GA 3PMJA 3M3TA 1D3PB 1P11E 4ZH8A 1LCYA 3D62A 4BAHB 3MU4A 3RXJA 1Z8JB 4IMZA 3KGPA 4GHQA 3WY8A 6ESTA 4JMYA 1C2LA 1C2MA 3EAJA 3RXLA 1O0DH 4UFGH 5IK2D 5J4QA 4QT8C 2AFQB 3HKJB 1T4VH 3LDXH 1FDPA 5K7RA 2RFKC 1SGCA 1DS2E 1IQGA 1QHRB 4B2AA 4D7FA 5EXLA 3W94A 1HIAA 2IPHA 4BTTB 3SHCH 1YPHE 3CP7A 1JOUB 2VVUA 3OTJE 3SNEA 3T2NA 4X6PA 1P04A 3N7EA 3RXVA 2VWOA 2UUYA 3I29A 5EGMA 3SI4H 2G81E 1KXFA 2TGDA 2IJD1 1C5NH 4E05H 5EXMA 2W7SA 1PJPA 2ZQ2A 3BTTE 4ABBA 3Q3KA 2XW9A 1LMWB 1P3CA 1EQ9A 4RN6A 3UFAA 1G2MA 4WMFA 1ELGA 1F7ZA 3OFND 1UVUH 5FPTA 3BTKE 3DCLA 4FUIA 1P2KA 3ENSB 1YCPM 2WINI 2TGAA 3SGQE 1N8OB 1OSSA 1FY3A 2KFWA 3FN8A 3FP6E 1WUNH 2A4RA 3QGJA 3V7TA 5CE1A 1YYY1 4YM9A 1Y3UA 3GYLB 2BQWB 2HNTE 3H09A 1HJ8A 1O3GA 1TNGA 4KP0A 3K6YA 2XBVA 3LJOA 4UFEH 1NO9H 2A5AA 5C5OA 2BYAX 2VIQA 5C3NA 1QZ8A 2PKAB 3MH4A 4ABHA 2F9BH 2PWXA 3QZRA 3RLWH 3RC5A 2CMYA 1SGQE 4ZXYH 2O9QA 1BUIA 4RSPA 5FHTA 4FXGH 1V2OT 2SFAA 2ZPRA 4OS5A 2BX3A 2OBQA 5FX6A 1PQ7A 3OY6U 2VGCB 1KLIH 2KCAA 3ZVCA 4Q7ZA 1GHBF 3SGBE 1A5IA 3QN7A 2AMPA 4DIIH 5EJZA 2GJGA 1CT0E 4K1SA 4P00A 5A2MH 3UR9A 5JPMH 4Y0YE 3UWJH 4UFDH 1SOZA 2OXSA 2ZKSA 4I86A 1P12E 3ZV8A 4BAQB 4KTCA 1XVOA 1XX9A 4NGAH 1MTNB 1V2MT 1DANH 1EB1H 3VG8A 1XUGA 1AWHB 2XBXA 1FAXA 1ACBE 1EXFA 3H5CB 4LZ1H 1MTSA 1AWFH 4NIVA 1YCPH 3DA9B 3GCNA 1E34B 2C3SA 1LVBA 1A0HB 1TNJA 1LPZB 5ABWA 1HRTH 2J92A 1DT2A 1KYNA 4X8TH 5AF9H 1N6XA 2ZDLA 3IG6B 1C1UH 2FEQH 2J98A 1TBQH 5CMXH 1ZPBA 3SNCA 1CBWB 2G52A 2GKVE 3WW7A 3ZZ4A 2O8LA 5HGGA 4CBOA 1QL9A 1DX5M 1MU6B 2V3HH 4Z0KA 4JK6A 1GHYH 3ZVBA 1V2KT 4A1VA 1O5EH 1TYNA 1OP2A 4Y7BA 1KMHB 1ANBA 1GJDB 3R0FA 1AUTC 2J9NA 1NC6A 1L2EA 1O3FA 3MO6A 4Y6DA 2WPDD 3SQEE 2DE8A 3RP2A 1SHHB 1P09A 4ACAA 4AGJA 1Q3XA 3PLPA 1A46H 2EEKA 4CH2B 2BB4A 3BN9A 3RC4A 3K2UA 1G3EA 3TVJB 4YXWD 1DXPA 3PWBA 2QF4A 2SNVA 3RDZA 1SC8U 2BX4A 3LC3A 3Q3YA 5DG6A 5CHAB 3TIUA 1Z6JH 2AYWA 2XWBI 1LHCH 2ZU4A 3F2HA 3KQBA 4ABGA 6CHAB 1K1LA 1THRH 1FPHH 3FZDA 1DLKB 1TGNA 3BEUA 1K21H 4UE7H 5C67A 4I8HA 4K1EA 1O2UA 1V2ST 4GSOA 1NZQH 3F9GA 1EATA 3RUOA 3RXQA 1FY1A 2W3IA 4OS4A 1O2VA 5TJXA 2BY9X 4INHA 3BTFE 1GDNA 3O8RA 4JYVH 1V2WT 2K8IA 5A8ZA 4I32A 2P94A 3BTEE 1P8VC 2KCOA 1LHEH 1O30A 2CF8H 1GJ6A 1S0RA 2RCEA 4HFPB 4DVAU 4Q80A 1XXDA 3LGUA 1SLUB 1SGDE 4IN2A 2Z7FE 1KSNA 5C0TA 3P95A 2FODA 1T8LA 4A92A 1BA8B 1Y8TA 4CHAB 2H1UA 4X8VH 1F92A 2XOKD 2AGEX 4FETA 1SKYE 4H42U 2BDYA 3ZVGA 3ZZ5A 1O2SA 2JJ2D 1IHTH 5H4IB 3MWIU 3QTOH 2ZCLP 1AFQB 1DY9A 1YCPK 1ZSKA 2V6NA 2QAAA 4Y0ZE 1HAPH 1L1NA 8GCHG 5FCKA 5GPIB 3M3VA 1NRRH 2AERH 5JBBS 1JBUH 3HGPA 2Z9IA 4P02A 1GI5A 2PKAA 3GDSA 4JK5A 1TNKA 3TH4H 2C90B 1E79D 4DY7B 2RDEA 1C5SA 3W95A 1FJSA 1BQYA 1QQ4A 3TLOA 3ZYDA 1TPSA 5F8ZA 1ELAA 3LONA 1EAWA 1BRUP 1K1PA 4X1NU 3VXEH 1GCTB 2SGQE 2AMDA 4FUFA 2GZ9A 4ISIH 2PFEA 2Z3DA 2GMTB 4YT7H 3F9EA 4I8KA 1GI3A 1A2CH 1C1WH 2BQ7B 3P8OA 2FMJA 2UUFB 3ZZ6A 1OYQA 7LPRA 3CS7A 3UNRA 3T25A 2BOHB 2W5EA 1C2HA 1EJMA 2WSSD 1H8IH 3IITA 3EDXB 2QA9E 3SZEA 5DP5A 1BTZA 2B9LA 1AHTH 3LOXA 1O3PB 1O2QA 4TPYA 4X2YA 4ABJA 3ZIAD 3LH1A 1WTHD 3RLYH 1RXPA 1LPGB 2WPIS 2FI4E 1TNIA 3NKKA 1GL1A 1OWHA 5F53A 1GBEA 1AO5A 2P8OC 1ZTJA 4MPVA 1Q31A 4B76A 1W14U 3D49H 4I8LA 2UWLA 3A8AA 4TY7A 2HVXA 1GJ4H 4LOYH 3ATMA 1RFNA 1TX6A 1GBJA 1QNJA 1E1RD 1NFUA 2B7DH 4K2YA 1RGQA 5HYOA 4B74A 4Y10E 2BLQA 1T4UH 2J97A 1UMAH 2VH6A 2AHME 1O5DH 2ZCKP 3DFLA 1CU1A 1UTLM 2VIWA 3NRLA 3VB6A 4B2BA 1TA6A 3NK8A 2QY0B 1BHXF 3C27B 4ZKOU 1K1OA 2CV3A 1O33A 1CE5A 2FOHA 2FZZA 4JYTA 2NU1E 1EPTC 3PB1E 2QN5T 1P05A 3ZZ9A 3UIRA 2J2UA 2BVXH 3AK5A 6GCHG 1TQ7B 1W2KH 4A7IB 2OQUA 1L0ZA 5F8TA 1MKWH 2OINA 2ZFFH 4TSFD 2QE7D 4BTIB 4ESTE 2XC0A 4MVNA 5EPNA 4HGCA 4LK4A 1DSUA 2W3KA 1WV7H 3F9HA 4I8GA 3AAUA 1ZMJA 1AU8A 1NFWA 4R8TB 3SUDA 1TABE 4B1TA 5KECA 1O5BB 3E6PH 1PQ5A 1QCPA 2P16A 2H2ZA 3Q77A 1GHAF 2ZG0H 2FP7B 1O38A 2FX4A 1O3MA 1UJ1A 2AGIX 2JJ1D 4YLUA 1KTTB 1O2RA 3UREA 3QLPH 4E7RG 4AORA 1TNHA 5DJ7A 1VGCB 2OC8A 3MO3A 2BD7A 3F0PA 5EQSA 1GBLA 1K28D 1ZR0A 4FUBA 1C1RA 1TMTH 1VITF 4AG1A 3FVFB 2FI3E 1P06A 3F68H 3ZZCA 1QR3E 5L2ZH 1SGYE 1GI8B 2WYJA 9LPRA 2P59A 1GPZA 2ODQA 3RMMH 2R3YA 4Z1MD 2I6QA 1QFKH 1TPAE 3I78A 3GY5A 2F9OA 4WVPE 1OS8A 3SZNA 3MNCA 1HAVB 2OD3B 1CGHA 2Y82A 1O2KA 1M9UA 3FOAA 2ZF0H 1GMDF 5T6GA 4CRFA 2KCYA 4AFQA 1PPHE 1AB9C 1RTFB 1XVMA 1A1RA 1U6QA 1FY4A 3F2FA 1GBFA 1V2RT 2K0QA 5E0HA 1IAUA 2FOGA 1TWXB 1ELVA 5IYTA 2FI5E 1DWDH 4DOQA 2DE9A 5C0UA 1CA0B 4YO9A 3RXOA 1LHGH 1C2KA 1YF4A 1VCPA 1QRZA 1RS0A 1W0KD 1DLEA 1MD7A 4JZIA 1S0QA 1VITH 1DOJA 5L2YH 2KZ4A 4KKDA 2GCTC 4A6LA 1NFXA 1TNLA 3KYGA 1BHXB 3PLBA 4YOIA 4AZ2B 1GI9B 4SGAE 2ZHWH 1TBZH 1NY22 3GCHB 1LVYA 4KELA 1GMHF 2WV4A 1HXFH 1GL0E 1MKWK 2FLBH 2QF0A 2FOBA 1HUTH 1CA8B 3HK3B 5JBTA 1EX3A 1ID5H 1PQAA 1F5LA 5DP3A 2PUXB 2GCHF 3P8NA 5J4SA 2EI6A 3VEQB 4K69A 3E8LA 4FUEA 2PLXA 1VJ9U 1NTPA 1O37A 1O3IA 3MYWA 4VGCC 2ZDAH 2ZDKA 5DP4A 1WOFA 1ZPCA 2LP6A 1AUJA 2J98B 4AFZA 4ZKNU 4Q4LA 2ZDNA 4WXIA 1PPBH 3QX5H 2XTTB 5EG4A 1QBVH 1O3EA 1SG8B 2F9NA 4LZ4B 2BHGA 3M3SA 1GI0A 3LGIA 2ZU2A 4KTUA 1DPOA 1FUJA 4NA8A 5PTPA 1P01A 3LU9B 3Q00A 1F2SE 2PGBB 5C2ZA 1W13U 1ELDE 1JMOH 2VINA 2ZGHA 3SU1A 5EW1H 1L1JA 1KLTA 1S83A 4IBLH 2O8TA 5EIYA 1ELTA 1YPLH 1GHBG 2RA3A 3LPRA 2Q6FA 1C2FA 1VKYA 3N99A 2GP9B 3PRBA 2H5DA 3ZVAA 1EZXC 1GBAA 3DFJA 4XBDA 2ZHDA 1TALA 3BG4C 1F0RA 1QIXB 2XRCA 1D3QB 1XKAC 1GBIA 4GAWA 1PPCE 2W6JD 3DT0H 3RXSA 3VGCC 2BD3A 3ZZBA 5A0BA 2QF5A 4D8NA 2A2XH 1INCA 1C5UA 1LVMA 3F9FA 3TITA 1HAZB 3SQHE 2XBWA 1PPGE 2ZPQA 3BF6H 3U98H 1ETSH 1UK2A 1K0HA 3RMLH 4A5TS 1O5GH 1O2PA 1P9SA 5HM9A 1GJCB 1NRQH 2WPHS 2ZCHP 4WH6A 3RU4T 1LDTT 3VB5A 5I46H 3WWFA 3EA9A 8LPRA 2W6ID 4AX9H 2STAE 4A1XA 4B75A 2VH0A 3B9FH 2ZWLH 2V35A 1OP0A 1UVOA 1O2YA 3RXTA 1C9PA 2G5VA 1IOEA 5C1UA 1C5YB 4WMDA 1ZJKA 5GIBA 2WZQA 2Y7ZA 3UTUH 1C5WB 1W7GH 3DUXH 4DT4A 5HXFA 2GVFA 3S9BA 5E0JA 1MMJN 2C93B 3SU4A 4I8JA 1C5RA 3ZZ3A 2LNCA 3SV9A 1D3DB 3O8DA 1TOMH 1YPGH 2NU4E 1ZSLA 4ZAEA 1V6DA 2R2WU 3SV7A 2AS9A 1LHFH 2ZA5A 4YOJA 2QV1A 1XUKA 1G3BA 3LJJA 2A4OA 1HAVA 3KF2A 4AFSA 1AQ7A 1ZRKA 1EUFA 2EQNA 3T29A 2VB0A 3URCA 4UD9H 2B8OH 1B0EA 4AN7A 2WV9A 4HI3A 1A5HA 1WDIA 5E0GA 1BRAA 4E06H 1ELBA 1V3XA 2GT8A 1TAWA 3TK6A 4AYVB 2Z3EA 2A7JA 1HNEE 1YPHC 2JETC 3FP7E 1W0YH 1YPKH 2FOFA 1EJNA 2HGTH 2O8WA 1ELFA 3RMNH 3VB3A 1W12U 4XFQA 3SNDA 2FOCA 3KHVA 4BNRA 1SB1H 4AFUA 2Z9LA 1UVSH 1QGFA 1E0FD 1ZYOA 1XUFA 2ZTZA 4OGXA 4ZKRU 5L30H 4X2XA 1FV9A 1G2LA 1GBHA 5AFZH 4I33A 4FUJA 1ZHMA 1N1LA 4NIWA 4B2CA 2ZFPH 7GCHG 3A85A 2G8TA 5JBCS 1OP8A 3ZZ7A 2BY7X 1G36A 1KTSB 3MH6A 3SO3A 1LHDH 2ZGCA 1MZDA 1A61H 4O3UA 3GCOA 2OP9A 3PV5A 1T32A 2OC1A 1W3CA 1S5SA 4FVDA 2KX4A 2TPIZ 2VIPA 2FWWA 1K9OE 3M35A 2HNTC 2M2AA 1ELCA 3KQEA 1KXDA 3HK6B 1A4WH 4I7YH 1L1GA 3STJA 5DP9A 2WPLS 4NA7A 1C2JA 3BTGE 4Q63A 4JZ1A 5EJ1A 5JDUB 1O39A 2Z9GA 3FKSD 4U30A 5T3HA 2GZ8A 1O3JA 3ZYEA 4ISLA 3RU4E 1W7XH 3HATH 3RXAA 2AIPA 1W10U 1SR5C 1HAIH 2HLDD 4LXBH 4IN1A 1ZZZA 4B71A 5C20A 1HAXB 1SQAA 2ALVA 2JDID 1NU9A 2PW8H 4CRCA 3RXCA 1VJAU 3BIUH 1GHZA 1E35B 2VNTA 1NT1A 4YESB 3UQVA 3A7VA 2Y5FA 3PWCA 1IQNA 1AN1E 5ETXA 1RRKA 5GXPA 5B6LA 3LGWA 2G5NA 2STBE 2OQ5A 1IQIA 1SOTA 3VXFH 2BTCE 1AD8H 3A81A 4IC5A 2Y81A 4X1RU 2FOMB 1P3EA 3NCLA 5EU8A 4ABEA 2R0LA 3GY8A 3A7YA 4MTBA 4X6OA 2ZFTA 1BTXA 1VR1H 4K1TA 4F55A 2ILNA 3QZQA 2ZGJA 2OLGA 4O9VA 1NBMD 4WXVA 3BTWE 4YOGA 1B5GH 1T31A 2K1QA 2NU2E 1DDJA 1COWD 1FONA 1ESTA 2H9EH 4GHTA 3BV9B 2AEIH 3E16B 1QRXA 4NFFA 1HGTH 1DFPA 2SGFE 4NIXA 5C5NA 4DG4A 1ANDA 1BZXE 3M7TA 3TPIZ 3PO1C 2WUBA 1O2JA 5FBIA 2HOBA 3BIVH 1XXFA 7GCHF 1TX8A 3ATKA 1AMHA 1ARCA 3LT3A 1ANEA 3FP8E 2QGRA 1GGDB 3W1EA 4OS7A 1TB6H 2FDAA 2V3OH 3BTME 5GDSH 5EPYA 4FVBA 1X7AC 2QF3A 1C5ZB 2BLOA 3UUZA 5LGOA 1P2MA 1E38B 2EA3A 2GDEH 4DT7B 3GY2A 5AVDA 3RXBA 1ZGVA 1FIZA 1GI7B 2C8XB 1O5AB 1MCVA 4IMQA 1WSSH 4ASHA 2GCTB 2Q1JA 4YLQH 4IGDA 1UW7A 1DXWA 1AE8H 3A8BA 3D65E 3QO6A 4K8BA 3K9XB 3PYHA 4D76A 1TMBH 2G00A 2LPRA 2XWAA 3MHWU 1GHAG 5TCAA 5JB8S 1KXAA 1P2JA 2EY4C 3MNXA 4INLA 2P93A 3UQOA 1AZZA 1N8OC 1GHVH 3MU8A 1PPEE 3P92A 1T8OA 5T6FA 2H9HA 1XUJA 1OKXA 2ZHFH 2PP6A 2QC2A 5LPRA 4TYDA 4X6MA 3SOSA 3ZZ8A 2ODYB 2WV5A 4VGCB 1VITG 1GBKA 2I6SA 4ZKSU 1IQJA 3GY4A 1UTOA 5DP6A 1SGRE 1S81A 1CGIE 4XDEA 4ZHMU 2NWNA 1EZSC 1DVAH 3G01A 1MD8A 4NZQA 5ESTE 2Y6TA 2CJIA 1O5FH 1RJXB 1Z1IA 2OCVB 3SUEA 2FS9A 3WWBA 1KDQB 1AFEH 1GBBA 1MH0A 1SLXB 1QJ1B 1Z7KA 3MU0A 2ALPA 1Z8IB 2PTCE 3KL6A 2F9PA 1G9IE 1IQFA 5DPAA 3TJVA 2BDHA 3GICB 5K0HA 3RU4D 1C1SA 3E3TA 3OU0A 3BSQA 1GMDG 3BTQE 3QTVH 1P9UA 1E36B 1O34A 3U8RH 1O31A 1AVWA 4WJG2 5DO4H 4Y76A 3LKWA 1UO6A 1Y5UT 1EOLA 5HMAA 1RTKA 1YBWA 4FUGA 1EPTA 1IQEA 2FX6A 1FZZA 3EA8A 1S6LA 1V2LT 5F03A 3GY6A 4FU7A 1J9CH 4X1SU 2F9VA 2XC4A 3SJKA 2NU0E 1G37A 4BOHA 2VVVA 4FOUC 4MNXA 3TK9A 3Q3XA 2CN0H 3VGCB 1S6HA 1VCQA 2ZO3H 1DWCH 1C5QA 1NS3A 2KCPA 3P8GA 4BANB 5FCRA 1HJ9A 3UOPA 1BITA 2Q6GA 3TNTA 4B6FA 2P95A 1OWIA 2ZGXH 1LVOA 4JZDH 2ZU1A 1MAXA 1SL3A 3SUFA 3SJ8A 2JH0D 1GMHG 1C9TA 1QJ7B 1ESBA 1SGFA 1DY8A 1O2GH 1UTMA 1SGIB 3RM2H 1DWBH 3MNBA 5FXLA 3OEED 1P10A 3TGKE 1O3OA 2GCHG 4Y11E 1MCTA 2VJ1A 5BPEA 2ANMH 1SMFE 3MOCA 4CRBA 1FXYA 1V2VT 1ABIH 1JRTA 2OC0A 2XXLA 3FZZA 2A5IA 3B8JA 1NROH 4O97A 4BAOB 3A89A 1ZTKA 3NUMA 3OAAD 1CT4E 3ITIA 3E0PB 1BTWA 1C1MA 1NM6A 1IQMA 4HG6A 4DJZB 4THNH 2UWOA 5C1XA 1BBRH 4Q7XA 1CQQA 1TPPA 5I25A 1CO7E 2H6MA 1WYKA 1LKAA 3LIWA 3M36A 4Y8ZA 5FX5A 3PMHB 3ZZAA 2WYGA 4GVUA 1ABJH 3GOVB 4HZHA 3FO8D 4FUCA 1GDQA 1ANCA 1TMUH 1YP9A 4PROA 2WPJS 2J95A 1PYTC 1TE0A 2JKHA 2VVCA 4MNVA 3S9AA 3A7TA 1P2QA 3A8CA 3F2GA 3SI3H 1EZQA 2TRMA 1YY3A 1XMNB 3SUGA 5DN6D 1J15A 2Y5HA 2BDBA 4BXWA 2HPQH 2A1DB 1Y3YA 1KXBA 1ZMLA 2A0QB 1YWUA 1A7SA 2JETB 3SU5A 3A7XA 3QGNB 3KIDU 4ISOA 1OPHB 1SSXA 3QDZB 5CHBA 3SU6A 4D9QA 3S0NA 5C94A 1Z6EA 4Y8XA 4J1YA 2HLCA 1KLJH 2XCNA 2ZFRH 2ZHEH 1P02A 1ZLRA 3ODDA 1S82A 3PMAB 2ZTYA 1O2IA 1A5GH 1YPJH 2Y7XA 4ABAA 1GMCG 4AG2A 1QY6A 1GI6A 2FLRH 3KNXA 2GZ7A 1OWKA 3IWMA 4Y8YA 1NRPH 3KQDA 1OYTH 1O3CA 2FESH 1SLVB 1YLNA 4XD7D 4MNWA 1AI8H 2PUQH 1C5LH 1Y3XA 2SGPE 3URDA 3P17H 1C1OA 1AFQC 1YLCA 2BDGA 1UCYH 2R0KA 2VIVA 4MLFB 1UK4A 1QJ6B 2B5TB 3PLKA 2PSYA 1Y59T 2JH5D 3H7OA 1EASA 1AKSB 1HBTH 1FI8A 3SHAH 1K1JA 1K1NA 2GV7A 1CGJE 1H8HD 1GI4A 3V3MA 4NSYA 1ZHRA 1GBDA 3LGTA 1WQSA 1K22H 1O2NA 1WQVH 1Q2WA 2FOAA 1ZOMA 4RKJB 4BTUB 2ANYA 4DCDA 1ZSJA 1MBQA 1SGFG 1S6FA 2TGTA 4UDWH 5E2OA 3GDVA 1TQ0B 1TX7A 2A5KA 2BD9A 3A8DA 2AH4X 1O2XA 1O36A 5EJLA 1KDQA 5DKMA 3UR6A 1O2TA 1P2OA 4KGAA 3N7DA 1GCTC 2FM2A 4ACBA 1HLTH 3PTNA 5L6NH 4U2WA 2OBOA 2Q6DA 4ISHH 2ZQ1A 3GYMA 4Y71A 1HCGA 4ZROA 4ABIA 5F6MA 3RXFA 3SNBA 2VWMA 4MQAA 2BQ6B 3EE0B 2PKSC 1BBRK 4RKOB 2XBYA 2FXRA 2EI8A 5A09A 1TGTA 1XUHA 2QIQA 1W0ZU 3TJUA 1HPGA 5C1YA 1NRNH 1B7XB 1F0SA 1W11U 2ZP0H 3P6ZB 1SQTA 3TJOA 3R3GB 3VB7A 2O8UA 2ZFQH 4MPXA 3RM0H 4D9RA 1MQ6A 3GCTF 2UUJB 5JYIA 1MKXK 3GY7A 1HXEH 1XUIA 1C5VA 1D3TB 1DSTA 2BY6X 2A32A 1O3LA 1GJ7B 2CK3D
chains in the Genus database with same CATH topology
3FANA 1NRSH 3SJ9A 1EAUA 2ASUB 4AOQA 1JIMA 1D9IA 3SW2B 3Q76A 1H9IE 1AZ8A 5EQQA 2PSXA 3RMOH 1P03A 1GJBB 5E2PA 2J4IA 5JB9S 1ESAA 1DE7H 3PTBA 2BLVA 1O3NA 1QB9A 1DUAA 4XBCA 1QURH 4E7NA 5DP8A 1Z8RA 5G4BA 2BM2A 1GMCF 5B6OA 4FUHA 4Y7AA 1A0JA 3ATLA 2H9TH 4KTSA 3BTHE 1EP6A 3SV6A 1FQ3A 3PO1B 2VIDA 1QTFA 3RXUA 1QA7A 1H1BA 4BXSA 4TY6A 5GCHF 1V2NT 4JYUH 3OY5U 1NFYA 4MPWA 3EQ0H 2AGGX 1Y3VA 1UCYK 1EZUC 2ZGBH 4WF8A 2BVRH 1F0TA 1PPZA 2FPZA 3HGNA 4ISNA 2IOTA 2Z3CA 2RDLA 1CT2E 4GCHF 4A1TA 2ANKH 3S9CA 3TGIE 3ESTA 3QWCH 4NSVA 3ZZDA 1C1VH 1V2JT 1O35A 1TRNA 2QCYA 4X1QU 6LPRA 1C5OH 4TPIZ 3N7OA 1PQ8A 1PFXC 3AW1A 4FUDA 2BDCA 1OOKB 4I31A 4NZLA 1BIOA 1C1PA 1ZTLA 3S7KB 4Y79A 3O8CA 1BBRE 1JXPA 2GT7A 2TGPZ 3RXKA 2Z9KA 1ZJDA 3BTDE 3GISB 1SQOA 1EB2A 1VGCC 1FPCH 3AVZA 3LC5A 4X2VA 1RIWC 2HPPH 1GG6C 2BD4A 1E37B 2Y5GA 2RG3A 1GI1A 1OWDA 1SGTA 1TGSZ 1H9LB 2SNWA 4CRAA 2EI7A 4NWKA 4DGJA 2GV6A 2BD5A 2VWNA 4TWYA 4H4FA 1Z71A 4MDSA 1GJ9B 1LTOA 2P3UB 1TRMA 3TGJE 3ATWA 4XOJA 3RXDA 5TCCA 1YPMH 2WUCA 1NN6A 1LKBA 1MZAA 1D4PB 1C4V2 2XYAA 3ATIA 2BZ6H 1TPOA 1SGNE 4NCYA 1C2GA 1TLDA 1AKSA 1SGPE 3T28A 1FIWA 1QBNA 2P8OB 2IJOB 4NIYA 5A0AE 4CBNA 2VIOA 4CH8B 4WH8A 1O3AA 1ZHPA 1G32B 1UTQA 2QYIA 7ESTE 1BTPA 1O2LA 3L33A 2J94A 1BTUA 2TIOA 2ZNKH 3P70B 3U8TH 1GJ8B 2F91A 4AB9A 3A80A 1MQ5A 3KQCA 3V12A 4IS5A 1O32A 3M61U 1EJAA 3EYDA 8ESTE 4OGYA 2BZAA 1CA0C 3M5MA 5DGJA 3GDUA 2F9UA 1UCYE 1O2WA 1FY8E 1OWEA 2B0FA 2BOKA 2ZI2H 3CENA 1Y5BT 4XE4A 5A8YA 2XCFA 1EPTB 1CHOG 1KXCA 2CHAC 3PV4A 1YC0A 5EODA 1ETRH 1JWTA 3GCHC 1GJAB 2HRVA 2FYQA 5EOKA 2PGQB 4X8UH 1FNIA 2GTBA 5EXNA 2FIRH 3VPKA 3RXGA 2G4TA 3PM3A 2ZU5A 9ESTA 1BTHH 3TJNA 4UEHH 2ESTE 2JH6D 1HJAC 3A7ZA 5A0CA 3HPTB 1GI2A 1OWJA 3NZIA 1AVXA 1FMGA 1KY9A 4X6NA 3V13A 1C5XB 1CSOE 1MTUA 2J34A 3EGKH 1AGJA 5EW2H 1QB6A 1GBTA 3ZVDA 3PROA 1FY5A 3L3TA 4K5ZA 1GWAA 1XM1A 3A83A 1MTWA 4ZMAH 3E91A 1KXEA 2OTVA 1AY6H 1TGCA 1BRCE 1PPFE 2GDDA 3B23B 3FFGA 2C8YB 1J16A 1TRYA 3BG8A 3AW0A 1YKTA 1SFQB 2G51A 4H6TA 3RXEA 4ZXXH 1FN6A 2FTLE 5AHGH 4FU9A 1O2OA 2R9PA 1TGBA 2CGAA 2C4FH 1O3KA 1S85A 1VCWA 1HAYB 5ESBA 1C1QA 2M5TA 4ABDA 3UPEA 4INKA 2AMQA 5IDKA 4GPGA 2UUKB 1EAXA 1THPB 1V2UT 4IC6A 2D8WA 2SGAA 4YZUA 4OS2A 3VB4A 2XNIA 3MU5A 3UY9A 3JZ1B 2GX4A 1AB9B 1XKBC 1GHWH 3MTYA 2BLWA 2F83A 5DK1A 2Z94A 4YT6H 2BXTH 3T62A 2ZEBA 2G4UA 2ZHQH 3NPSA 2C8ZB 2ZDMA 3RXRA 1AE5A 5FAHA 1BMLA 5LPFA 3QUMP 3RXIA 4YTAA 1A3EH 3TNSA 1J14A 1GHXH 3F1SB 2YOLA 3T5FH 1K2I1 3U9AH 1P57B 2ZDVH 2ANWA 3T27A 4Q2KA 3PMBB 1CHOF 1ZRBA 1MUEB 4OS1A 3NWUA 3T26A 1BRBE 5LH8A 2A31A 1IQHA 4FU8A 1QQUA 1J8AA 1P0SH 5T6DA 3SBKA 1SVPA 4GUXA 1BMNH 3A84A 4GLYA 3U1IB 1BCUH 1QA0A 3U8OH 1EP5A 1DITH 2W7UA 3MO9A 1BTYA 2KAIB 3MFJA 1F0UA 2Y80A 2YNAA 4Z6AH 3RXHA 4NA9H 4JCNA 1BMAA 3A88A 3TH2H 3KEEA 3GY3A 2A4QA 3LGVA 1WTGH 4M7GA 4CR5A 4CRDA 8KME2 1IQLA 1YM0A 4D7GA 1F5RA 4WY3A 5A8XA 4CR9A 1ELEE 1ETTH 3OSYA 5GWZA 1JIRA 2F3CE 1CVWH 1A3BH 2THFB 5HM2A 4JZFH 1P2IA 2CXVA 3QK1A 1RD3B 2ZTXA 3SORA 2P3TB 3SV8A 1ZGIA 4BAMB 4NFEA 1ARBA 2QXGA 1HAOH 2A7CA 2PKSB 2NU3E 1OX1A 1H8DH 4AYYB 3KCGH 1G30B 1C2DA 1P2NA 1HAGE 3V0XA 2A2QH 3M37A 4F49A 1D6WA 1O2ZA 3M5NA 2YNBA 3D23A 1ZMNA 4CREA 2BD8A 2VGCC 1BB0B 2EC9H 1UHBB 1DICA 2QXHA 1T8NA 1GCDA 3UNQA 2C8WB 1T8MA 2V0BA 3SU0A 2R3UA 3A87A 3VFEA 1UTPA 4AB8A 3BG4B 4DURA 1UTJA 1W8BH 1YPEH 3BEIB 1MTNC 1UTKA 1Y5AT 1KIGH 2VWLA 1YLDA 3BEFB 1GBMA 3NXPA 3DHKH 2OUAA 1NU7B 4H6SB 2BXUH 1HDTH 1AIXH 3M7UA 3STIA 2ZPSA 1WAYB 1TONA 2Z6BD 5JBAS 3M5LA 5E8EH 1C2EA 2HNTF 2BMGB 3E90B 2G55A 4R0IA 4WMEA 4O03A 1GVZA 3M5OA 2QXIA 2HWLB 1V2QT 1ZPZA 3SV2H 3A82A 1Y3WA 1GBCA 2P3FH 4X1PU 3OX7U 7KMEH 1CBWC 2WPKS 5AFYH 3ZVFA 4MNYA 1SI5H 2A45B 3AAVA 1HAHH 1AVGH 1N6YA 1C5TA 1JRSA 1FAKH 1HV7A 4ABFA 3SU2A 2BVSH 1Z1JA 1TBRH 2ODPA 2FO9A 8GCHF 4BAKB 1V2TT 1BJVA 1C5MD 1O3DA 4WWYA 1SBWA 2A7HA 1BMMH 1L4ZA 1QL8A 1EAIA 1YGCH 2PTNA 2ZECA 4NWLA 1H4WA 1B0FA 1V2PT 2R2MB 1HIAB 1NPMA 3LH3A 3DD2H 4ZHLU 4U32A 3ELAH 1C2IA 1NESE 2VU8E 1HYLA 1T7CA 2FOEA 3ZV9A 3RXPA 2OC7A 4HTCH 2D26C 4UONA 1C1NA 1LPKB 1UVPA 1GJ5H 1MKXH 1SPJA 3GCTG 5CHAC 1GDUA 2FYRA 4MG3A 2BY8X 3U1JB 1DUEA 1MTVA 1TIOA 3MU1A 1RIWB 1WCZA 6CHAC 1BJUA 4F4OC 1GG6B 2UWPA 1SLWB 1HFDA 2QXJA 1UTNA 4J2YB 2GGVB 4X0WU 4Q7YA 1QB1A 4X8SH 1GVKB 1J17T 1TFXA 4ZUHA 4JZEH 4K3JA 2BY5X 3O8BA 1TOCB 5BRRE 1SHYA 4DIHH 2FS8A 1QL7A 3K6ZA 2ZZUH 1G3CA 1BDAA 1SFIA 3LGYA 1CHGA 3JZ2B 1EKBB 2HALA 3SJIA 2WPMS 2ZFSA 3RXMA 1O2HA 3K65B 5FPYA 1MU8B 5SGAE 1IQKA 4CHAC 3SGAE 2SGEE 2FTMA 3CS0A 4TWWA 2KAIA 1SGEE 3C1KA 1RTLA 1DWEH 3F6UH 5GCHG 2PHBA 1GGDC 1WU1A 3SNAA 4OS6A 2PV9B 1K1MA 3TH3H 1FLEE 1QRWA 1ORFA 2DUCA 3OYPA 1QBOA 2D1JA 4ZHAA 5LPEA 3I77A 4GCHG 3MH7A 3TU7H 1DM4B 2PR3A 3MNSA 1H9HE 1UVTH 3E1XB 4UFFH 1LO6A 3SU3A 3L6PA 4AGKA 3KN2A 5FPSA 3AASA 2CHAB 2Z9JA 6GCHF 1C4U2 2H5CA 1K1IA 1O5CB 3EA7A 3HKIB 2AIQA 4K8YA 4MPUA 2SGDE 3E0NB 4SGBE 4CRGA 5DP7A 4K60A 1OXGA 5EQRA 2J38A 2GMTC 3SJOA 2XC5A 4X2WA 3UNSA 2A4GA 1D6RA 2W26A 2ZC9H 3MI4A 3A86A 3S69A 3S7HB 1UHBA 5GJ4B 3FAOA 1THSH 2BDIA 1GVLA 1HJAB 1O2MA 3A7WA 1PYTD 2GD4B 1TA2A 1C1TA 5FBEA 3RC6A 1F5KU 4U01A 4IW4E 2BD2A 2IN2A 1LQEA 3P8FA 1UK3A 1BT7A 3TK5A 4B73A 1BOQA 2ZU3A 1MAYA 1G3DA 4DW2U 2ULLA 5F8XA 2RA0A 3ODFA 3SN8A 3MH5A 3U69H 1C4Y2 4XBBA 3M7QA 1S84A 4NG9H 1IHSH 1L4DA 2CF9H 1HB0B 1WBGB 1VZQH 3H7TA 1O3HA 4O3TA 3ZVEA 3MMGA 1EOJA 1C5PA 2ZIQH 3UOUA 2BDAA 4XSKU 1O3BA 1LQDB 2D2DA 2O8MA 3UWIA 2TBSA 1A0LA 1MBMA 1FN8A 1Z8GA 3PMJA 3M3TA 1D3PB 1P11E 4ZH8A 1LCYA 3D62A 4BAHB 3MU4A 3RXJA 1Z8JB 4IMZA 3KGPA 4GHQA 3WY8A 6ESTA 4JMYA 1C2LA 1C2MA 3EAJA 3RXLA 1O0DH 4UFGH 5J4QA 4QT8C 2AFQB 3HKJB 1T4VH 3LDXH 1FDPA 5K7RA 1SGCA 1DS2E 1IQGA 1QHRB 4B2AA 4D7FA 5EXLA 3W94A 1HIAA 2IPHA 4BTTB 3SHCH 1YPHE 3CP7A 1JOUB 2VVUA 3OTJE 3SNEA 3T2NA 4X6PA 1P04A 3RXVA 2VWOA 2UUYA 3I29A 5EGMA 3SI4H 2G81E 1KXFA 2TGDA 1C5NH 4E05H 5EXMA 2W7SA 1PJPA 2ZQ2A 3BTTE 4ABBA 3Q3KA 2XW9A 1LMWB 1P3CA 1EQ9A 4RN6A 3UFAA 1G2MA 4WMFA 1ELGA 1F7ZA 5FPTA 1UVUH 3BTKE 4FUIA 1P2KA 3ENSB 1YCPM 2WINI 2TGAA 3SGQE 1N8OB 1OSSA 1FY3A 3FP6E 1WUNH 2A4RA 3QGJA 3V7TA 5CE1A 1YYY1 4YM9A 1Y3UA 3GYLB 2BQWB 2HNTE 1HJ8A 1O3GA 1TNGA 4KP0A 3K6YA 2XBVA 3LJOA 4UFEH 1NO9H 2A5AA 5C5OA 2BYAX 2VIQA 5C3NA 2PKAB 3MH4A 4ABHA 2F9BH 2PWXA 3QZRA 3RLWH 3RC5A 2CMYA 1SGQE 4ZXYH 2O9QA 1BUIA 4RSPA 5FHTA 4FXGH 1V2OT 2SFAA 2ZPRA 4OS5A 2BX3A 2OBQA 5FX6A 1PQ7A 3OY6U 2VGCB 1KLIH 3ZVCA 4Q7ZA 1GHBF 3SGBE 1A5IA 3QN7A 2AMPA 4DIIH 1CT0E 4K1SA 5A2MH 3UR9A 5JPMH 4Y0YE 3UWJH 4UFDH 1SOZA 2OXSA 2ZKSA 1P12E 3ZV8A 4BAQB 4KTCA 1XVOA 1XX9A 4NGAH 1MTNB 1V2MT 1DANH 1EB1H 1XUGA 1AWHB 2XBXA 1FAXA 1ACBE 1EXFA 3H5CB 4LZ1H 1MTSA 1AWFH 4NIVA 1YCPH 3DA9B 3GCNA 1E34B 2C3SA 1LVBA 1A0HB 1TNJA 1LPZB 5ABWA 1HRTH 2J92A 1DT2A 1KYNA 4X8TH 5AF9H 1N6XA 2ZDLA 3IG6B 1C1UH 2FEQH 1TBQH 5CMXH 1ZPBA 3SNCA 1CBWB 2G52A 2GKVE 3ZZ4A 2O8LA 5HGGA 4CBOA 1QL9A 1DX5M 1MU6B 2V3HH 4Z0KA 4JK6A 1GHYH 3ZVBA 1V2KT 4A1VA 1O5EH 1TYNA 1OP2A 4Y7BA 1ANBA 1GJDB 3R0FA 1AUTC 2J9NA 1NC6A 1L2EA 1O3FA 3MO6A 4Y6DA 3SQEE 2DE8A 3RP2A 1SHHB 1P09A 4AGJA 1Q3XA 3PLPA 1A46H 2EEKA 4CH2B 2BB4A 3BN9A 3RC4A 3K2UA 1G3EA 3TVJB 1DXPA 3PWBA 2SNVA 3RDZA 1SC8U 2BX4A 3LC3A 3Q3YA 5DG6A 5CHAB 3TIUA 1Z6JH 2AYWA 2XWBI 1LHCH 2ZU4A 3KQBA 4ABGA 6CHAB 1K1LA 1THRH 1FPHH 3FZDA 1DLKB 1TGNA 3BEUA 1K21H 4UE7H 5C67A 4I8HA 4K1EA 1O2UA 1V2ST 4GSOA 1NZQH 3F9GA 1EATA 3RUOA 3RXQA 1FY1A 2W3IA 4OS4A 1O2VA 5TJXA 2BY9X 4INHA 3BTFE 1GDNA 3O8RA 4JYVH 1V2WT 5A8ZA 4I32A 2P94A 3BTEE 1P8VC 1LHEH 1O30A 2CF8H 1GJ6A 1S0RA 2RCEA 4HFPB 4DVAU 4Q80A 1XXDA 3LGUA 1SLUB 1SGDE 4IN2A 2Z7FE 1KSNA 3P95A 2FODA 1T8LA 4A92A 1BA8B 1Y8TA 4CHAB 2H1UA 4X8VH 1F92A 2AGEX 4H42U 2BDYA 3ZVGA 3ZZ5A 1O2SA 1IHTH 5H4IB 3MWIU 3QTOH 2ZCLP 1AFQB 1DY9A 1YCPK 1ZSKA 2V6NA 2QAAA 4Y0ZE 1HAPH 1L1NA 8GCHG 5FCKA 5GPIB 3M3VA 1NRRH 2AERH 5JBBS 1JBUH 3HGPA 2Z9IA 1GI5A 2PKAA 3GDSA 4JK5A 1TNKA 3TH4H 2C90B 4DY7B 1C5SA 3W95A 1FJSA 1BQYA 1QQ4A 3TLOA 3ZYDA 1TPSA 5F8ZA 1ELAA 3LONA 1EAWA 1BRUP 1K1PA 4X1NU 3VXEH 1GCTB 2SGQE