4MPVA

Human beta-tryptase co-crystal structure with (2r,4s)-n,n'-bis[3-({4-[3-(aminomethyl)phenyl]piperidin-1-yl}carbonyl)phenyl]-4-hydroxy-2-(2-hydroxypropan-2-yl)-5,5-dimethyl-1,3-dioxolane-2,4-dicarboxamide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpvA01
3GCHC 1C5PA 5K7RA 1MKWK 1NTPA 3A81A 2FI3E 3E8LA 1AD8H 3P70B 4FU7A 1MUEB 5JBCS 1O5CB 1ZPBA 2BYAX 1PYTC 2QF0A 1ZHRA 1FI8A 3TJVA 3H7OA 3L3TA 1TA6A 3BTGE 1ZYOA 3DHKH 5TJXA 1BCUH 1OWEA 3GCNA 3SUFA 1J17T 2PHBA 2F3CE 4JK5A 1PQAA 3ZYEA 4DURA 4JYUH 1D4PB 4X8UH 5J4SA 3U9AH 1TPSA 1EPTC 3PV4A 4LZ1H 1ZZZA 1GI3A 3MWIU 1SGFA 2BY6X 1VGCB 1O3IA 2FOCA 1QNJA 2ZDVH 3SNAA 1W10U 2ZDMA 1OYTH 2DE8A 1HV7A 1IQGA 4RKJB 5DG6A 3PO1C 3RMLH 4H4FA 4MNXA 3RM0H 1SGTA 4JMYA 1K21H 5JB8S 1V2PT 2A7CA 3A7ZA 2C93B 3D62A 1OPHB 1TNKA 2PLXA 2ZI2H 1NRNH 3O8CA 1E35B 4FUEA 1C5TA 2ZDLA 1NS3A 2G55A 4UFGH 2BY7X 4X1RU 2HPQH 1C4U2 5E0GA 3STIA 4FVBA 1DWEH 1DDJA 1Q31A 3GCTG 2DE9A 1BMMH 3RXFA 1J14A 1BMAA 3GY3A 1VCWA 4TYDA 2ZNKH 1OWIA 5JBTA 5FPTA 1EOJA 5FCRA 1AZZA 1SFQB 1ANDA 1WTHD 4UONA 2G4UA 4NCYA 2BX3A 4A7IB 3HKJB 2VVCA 3BTEE 3P17H 3K6ZA 3VB5A 5ESBA 5GDSH 1W13U 2TGTA 5LPRA 2VGCC 2NU4E 1JIRA 1TGBA 2RDLA 3ZV9A 2O8UA 3F9HA 1EQ9A 3GY2A 2WINI 2B5TB 2Z9IA 1BUIA 1AWHB 1MTNB 1UTPA 4YT6H 1S6FA 2FEQH 3ODDA 3MO9A 1NO9H 4MPXA 3BTFE 1NRRH 4X2YA 1VGCC 3A82A 3AVZA 1ZSLA 3QN7A 3ZVAA 1ETRH 1P0SH 1Y3UA 5HXFA 1AFQB 3M7UA 4BAHB 2D8WA 1GBMA 4OS7A 1F0UA 3MNCA 1P12E 4Y7AA 4HGCA 3T26A 1C2JA 3S7HB 4FU9A 1YC0A 4FUFA 1XXFA 4XDEA 4OGXA 3PB1E 1FY1A 3M35A 2GP9B 1VR1H 3RXHA 1C5MD 2QY0B 4ZHAA 4O03A 3MU8A 3ZVGA 1CHOF 1HIAA 1YPGH 1ZGVA 3LU9B 2FOFA 3ZVDA 4CH8B 1YM0A 2H9EH 1C1MA 3RXEA 1P9SA 1SGQE 1YPLH 1HAOH 2A32A 4CHAC 4LXBH 3LOXA 4CRCA 5A0BA 5H4IB 3QZQA 5C1XA 2AIQA 3MFJA 1MH0A 1FDPA 1MBMA 1V2UT 2V6NA 4XBDA 3F9EA 3GY5A 1SGPE 1YKTA 1DLKB 2BVRH 1MTNC 4X2VA 2IOTA 3TLOA 3VB3A 2UWOA 3RXKA 1ABJH 4OS4A 1P9UA 1GBTA 4B75A 1QCPA 4YTAA 4OS6A 4D7GA 1V2JT 4ABHA 2QAAA 4Y76A 1M9UA 4AG2A 3CS0A 3NUMA 4IMQA 2FS9A 1TGCA 2F9BH 4WWYA 4X1QU 1KLIH 1BDAA 2ULLA 1BRUP 2BXTH 1S81A 3JZ1B 1L4DA 1LKBA 1O3CA 4OS1A 2FLBH 3UQVA 1DPOA 3NZIA 1H1BA 1E38B 2EI7A 3RLYH 2R9PA 4ESTE 1ID5H 5DP4A 3T28A 5AF9H 2P95A 4O3TA 4FUJA 1V2LT 3TK5A 1ELBA 2UUJB 2C4FH 3PLPA 5AHGH 3KEEA 2IPHA 1V2RT 1N6XA 2BDGA 1GBKA 1C1SA 3FZZA 4Y0ZE 2ZCHP 1VITH 3PTBA 2QCYA 4MNYA 2FS8A 5GWZA 8ESTE 1QL9A 4KGAA 5EPNA 3F1SB 3UR9A 1Q3XA 3LH3A 2ODQA 1BIOA 2FOGA 4FXGH 4JZEH 3VB4A 1UCYH 1ZMJA 4SGBE 1GBCA 2A45B 2UUKB 4J1YA 1MQ5A 1A1RA 1O3FA 4ABDA 1QL8A 1YPJH 1GI1A 1F92A 3RU4E 1FY5A 1BTXA 1KYNA 1QURH 1T4VH 1V2NT 4H6TA 4NSYA 3A8CA 2A1DB 3VPKA 3SGBE 3F6UH 5L6NH 1F0RA 2O9QA 2OC1A 2VIQA 3H7TA 4XBCA 3O8RA 3ZZ5A 4AGJA 4GUXA 1SLUB 1HAVA 1J8AA 4TWWA 1DLEA 2ZFPH 1SVPA 2F91A 1NRPH 1C9TA 5DKMA 1UK3A 1A5IA 1F0SA 1IQMA 4O3UA 2B0FA 4X1SU 1QQUA 2WPMS 3GDSA 5BRRE 1PPZA 1GG6C 1MKXK 1IHSH 4YO9A 1C4Y2 4LOYH 1O3BA 2HPPH 2G5NA 4GSOA 3T5FH 5F8TA 3OY6U 1V3XA 4DIIH 3M61U 5ESTE 1HJAB 1LHFH 2BXUH 2VVVA 2TGAA 2QN5T 2FXRA 1O3JA 2B8OH 1GI0A 2FO9A 4GCHG 5F8ZA 2SGDE 5HGGA 2W3KA 1H8DH 1Y5BT 2F9NA 2W26A 5E2OA 3E90B 4GPGA 2Z9KA 2C8XB 1QTFA 5GIBA 3U69H 3TGJE 1TQ7B 2R2MB 5FX6A 1OWJA 3MU4A 1AVGH 1L1NA 1NU7B 2V3OH 1NZQH 3B9FH 1GHXH 1JOUB 2XCNA 5A0AE 2WV5A 3EGKH 1GJBB 3VB7A 1DY9A 3VEQB 4X8VH 1O5BB 1MQ6A 3VFEA 1O2ZA 1CHOG 1PQ8A 1ORFA 3A86A 1SQTA 4THNH 3TVJB 1Y59T 1IQIA 2Y5HA 1WYKA 1GL1A 1UK4A 3GOVB 3KQBA 1O3NA 3FP8E 1HAVB 3SJKA 4D76A 5LGOA 1LQDB 1BA8B 4Q7ZA 1E36B 4R8TB 3U1IB 1C5ZB 1F0TA 4I8HA 4B73A 1MKWH 1TGSZ 5GPIB 2A7HA 2XTTB 1AFEH 2ZP0H 1LHEH 3GICB 2P8OB 1K28D 3M5OA 1O2NA 3TH4H 1TMUH 1CT0E 4XE4A 2J34A 1GJ8B 5E8EH 1O2PA 2UUYA 3SI3H 1TX7A 1QB6A 3H5CB 1J15A 1BRBE 3A7TA 4K60A 4NIVA 4NWLA 5A09A 2UWPA 2SGFE 3TNSA 4CREA 5A2MH 5T6DA 5HMAA 1TOCB 2ZFQH 1FV9A 1SQOA 3FAOA 1CE5A 4MVNA 2Y6TA 3MH6A 2BD2A 6CHAC 2A0QB 3BTHE 3BTWE 1KDQA 1MBQA 1EUFA 2ZU1A 3MMGA 2Z6BD 2AYWA 1UTOA 1NESE 3KN2A 2BY9X 4J2YB 2PTCE 3M7QA 4AOQA 1FY8E 2GZ9A 2GGVB 3ZZ4A 2BQ6B 2GZ8A 3B8JA 4Y71A 1D3QB 3NXPA 1JIMA 1F5KU 1P10A 2GVFA 2PUXB 2UUFB 3SV2H 5HM2A 2W7SA 1N8OB 1THPB 3RXGA 3KQDA 2ALPA 1AB9B 1DICA 1GMCF 1C2IA 1GJ5H 4BAMB 2G51A 2GD4B 4AFZA 3RP2A 1EATA 5FAHA 1RXPA 1MAYA 3EA8A 5EXLA 3DD2H 3VXEH 4NA9H 4DCDA 3R0FA 4MG3A 4HTCH 1V2ST 2GDEH 3CS7A 5EPYA 4YT7H 2GTBA 5DP5A 2GZ7A 3ZZ8A 5L2YH 2ZGCA 5T3HA 8KME2 1AUJA 1C1QA 1Z6JH 2I6SA 4GAWA 1EJNA 2JKHA 4CRBA 1CGHA 3QLPH 3RXLA 4FUGA 3OX7U 1SQAA 1YLDA 4MPWA 1FPCH 2FI4E 2Z7FE 1HB0B 1K1MA 2HNTC 3MO3A 4MLFB 1NFXA 2ZU5A 2XCFA 3BEFB 1UTMA 1EZSC 4UE7H 3SBKA 4NIWA 3UWIA 2SFAA 2ZQ1A 2SNWA 2TBSA 2GMTB 1GL0E 5GXPA 2HNTF 2G8TA 1AUTC 1TBZH 3BTTE 2Y7XA 3UNRA 2STAE 3Q76A 3A84A 1HJ9A 2QC2A 3RU4D 3DA9B 3LT3A 1TX8A 2G00A 3AAUA 1N8OC 2XWAA 4NZLA 4ABJA 4H6SB 1GMDG 1GCTC 1FONA 1AB9C 1O3KA 5DP3A 1C5LH 1O2YA 4A5TS 4Y10E 1T8MA 2ZC9H 4O97A 5A8ZA 3Q3KA 3PWBA 1FIZA 1TRMA 3ATIA 3UNSA 1TMBH 3UUZA 1C4V2 2BB4A 3SQHE 3SO3A 1IQFA 3SZNA 3N7OA 3RXJA 4ASHA 1X7AC 3A8DA 3CP7A 1O2KA 1T32A 1ZTLA 1A5HA 2BOHB 1DFPA 2ZPSA 3ZVCA 4TPYA 1C2GA 1A2CH 2HVXA 2ZHQH 5HM9A 1K1NA 3P8FA 3SUGA 1OKXA 1TNGA 1D9IA 3MYWA 2ZCKP 3QO6A 1Z71A 2H2ZA 2Q6FA 1ZSKA 3LPRA 4FUCA 2VWLA 2A5KA 3UPEA 2CGAA 2QA9E 4WMFA 3C27B 3GCOA 3BEIB 2BLWA 3KF2A 4U01A 1CHGA 1ZJDA 3RM2H 3V12A 2PKSC 1S0RA 1O2VA 2ESTE 4KP0A 2TGPZ 1GHVH 1L1GA 1RRKA 2PTNA 2R0KA 4B1TA 1W12U 1BTHH 2XXLA 1K2I1 1S83A 3BIUH 2YOLA 4X6MA 3SV8A 4VGCB 1UMAH 1C2EA 4HZHA 3A7YA 1AY6H 4UFDH 1KXFA 1C2MA 4Q2KA 1NRQH 1IOEA 1MAXA 2ZG0H 1ACBE 2WYJA 1S82A 4YOJA 3E16B 1SGNE 4X1PU 1HRTH 4ABGA 1AIXH 1T31A 3RXTA 3NKKA 2VWMA 1C5SA 2OBQA 1EAXA 1LMWB 1PJPA 1C2DA 5TCCA 2AS9A 4IN2A 4ISHH 3B23B 1LDTT 2ANWA 3URDA 3BG8A 3MHWU 3QGNB 1SI5H 1XXDA 4MNWA 2CF8H 2BVXH 4WXIA 2J9NA 4Y8YA 4Y8ZA 1AGJA 3T29A 1GMHF 4XSKU 2BDBA 2VIOA 3UQOA 2BDIA 1ELAA 3SI4H 2GV6A 1DUEA 1TMTH 3RUOA 2AGGX 4MNVA 1OXGA 1XUGA 2HOBA 3Q77A 3RU4T 1A0LA 1YPMH 3A83A 2CF9H 1T8NA 1O5DH 2R0LA 2GCHG 2BLOA 1YCPK 2ZHFH 1TOMH 3ATKA 5EW2H 1JWTA 1GMCG 1HAHH 1Y3WA 1AE5A 4VGCC 1EB1H 4ZKOU 3UNQA 4QT8C 2RA3A 1AWFH 3RC5A 1BTUA 1F5LA 5GCHF 5FBIA 1IAUA 4CRAA 1TIOA 5L30H 1O2TA 1AI8H 4DIHH 1A7SA 3UOPA 3HATH 1CGJE 1DM4B 4BANB 1HAGE 4MQAA 1MKXH 1Z8GA 2FTLE 2PW8H 2VIWA 1HPGA 2OLGA 4JYVH 1KXEA 2F83A 1OX1A 2FMJA 2CMYA 2Y5FA 3RXUA 2R3UA 3SJOA 3MH5A 1UVUH 4GVUA 1EP5A 3BF6H 4ZH8A 4ZROA 4TY6A 4WJG2 3SV9A 4PROA 1AU8A 1DWCH 1O39A 3SU6A 5FPSA 3TH3H 1BTPA 2P3TB 4ZAEA 1KY9A 1C2HA 5I25A 2SNVA 1ANEA 1Z7KA 3A7VA 3KCGH 2QGRA 2NU0E 3UWJH 1S6HA 1AKSA 1S5SA 2R2WU 2Z9GA 2AERH 1GHAF 1MTWA 4AGKA 1AVXA 2BHGA 1GBJA 3HPTB 2ZHDA 1FN8A 2WPLS 1FQ3A 1W2KH 1KIGH 5EODA 2G81E 4ABAA 1C9PA 1UO6A 1P2KA 3TGIE 3SOSA 1A5GH 3PLKA 4WMEA 1K1PA 1ZLRA 2ODYB 2NWNA 1PQ5A 4AORA 2WPIS 2O8TA 3QWCH 3LC5A 1GGDB 2ZDNA 4IGDA 4JZ1A 1GHBG 3KNXA 2BD4A 3FP6E 3ZZBA 1FY3A 1BTWA 1LPZB 4NSVA 2ZGHA 3TIUA 5SGAE 2P59A 1LVMA 3NK8A 2ZDKA 1UTQA 1L2EA 5EXMA 3SGQE 1QBNA 3P95A 3STJA 1O3OA 1BRCE 3L6PA 3RXMA 4LZ4B 3RC4A 1CT2E 1SSXA 1XVMA 3U98H 2AMQA 1Y8TA 3GY7A 3MTYA 4B2BA 3F68H 2PSXA 1N1LA 5E2PA 2BTCE 2V0BA 1AFQC 1DOJA 1G32B 1QJ1B 1ELEE 3PLBA 3UY9A 1C5OH 1YBWA 4K1EA 3M5MA 1F2SE 4IC6A 1IQHA 2ANYA 4RSPA 1BOQA 2Z3CA 7KMEH 4ABFA 1HAIH 1GHWH 1GCDA 5AVDA 3ENSB 3UIRA 5L2ZH 1P01A 1P2NA 1LVYA 4TPIZ 4CBOA 1EZXC 3RMMH 1Z6EA 1RGQA 1AKSB 1EAIA 3E3TA 3M3SA 4F49A 1W7XH 4TWYA 2ZEBA 1CA8B 1TGNA 1GGDC 1EZQA 3LKWA 3SNDA 3GY6A 1W3CA 1QJ6B 3HK3B 5J4QA 1P02A 2J94A 2ZFRH 3MNSA 4UFEH 2FOEA 3AW1A 4OS2A 1P11E 1AVWA 2HWLB 4OS5A 4ABIA 1YPEH 2ZF0H 1BMNH 2FI5E 4TY7A 3RDZA 1RTKA 4DW2U 2PGQB 3OYPA 1HIAB 1QB9A 1P3EA 1S85A 4ABEA 2ZPQA 1O0DH 1WAYB 2A4GA 2SGEE 3RXAA 1PQ7A 3M3TA 4K1SA 1MU8B 3UOUA 1G2MA 1ZHPA 4CR5A 2PGBB 3ZZ9A 2VIDA 1EZUC 1DE7H 2QYIA 1O30A 1TWXB 1GMHG 1GJ7B 1NFWA 2PWXA 1LCYA 3ZZCA 4WF8A 2FYQA 3C1KA 1QR3E 4ZKRU 2DUCA 1T7CA 3VB6A 1C1VH 3TH2H 4RN6A 2OQ5A 3IWMA 1SGDE 2C8ZB 1W0YH 2GV7A 4BAOB 2P3UB 3SU3A 4UDWH 4I8KA 5BPEA 3KQCA 2A2QH 1WUNH 4K8BA 3WY8A 1A0JA 1BBRK 4Y6DA 1GDUA 1SGRE 1GBEA 5FBEA 3SJIA 1DSTA 3K65B 5GCHG 1FN6A 3DFLA 1XMNB 1SHYA 4Q7YA 1GI4A 1J9CH 1C1NA 1H9LB 2BDAA 2Z3EA 2SGAA 3ZVBA 3TK6A 1QA7A 1K1LA 1MU6B 1NC6A 2V3HH 4JCNA 1ELTA 3LC3A 3A88A 1ZMLA 3DT0H 3T27A 1P3CA 2ZPRA 1ARCA 3URCA 4X2WA 2FTMA 2A5AA 2ZKSA 1OP0A 1MMJN 1YGCH 1TNJA 3E91A 3T25A 3BTKE 2BOKA 1OP8A 4B74A 1VITF 1OWKA 1DWDH 4WMDA 1CO7E 1H9HE 4IS5A 2UWLA 4AFQA 2XYAA 4X6NA 3PROA 4D9QA 1MCVA 1LKAA 3RXVA 1TQ0B 3SV7A 1MTUA 3U8RH 2GT8A 1GBLA 1GHAG 3UR6A 3MU5A 1O2RA 2LPRA 1O3GA 4DOQA 3SHAH 2VB0A 1HGTH 1O3DA 4CR9A 1BBRE 3BV9B 2P94A 1TNLA 1GHYH 1O2WA 3V13A 5IYTA 1NPMA 3ELAH 1FAXA 3GY8A 4HI3A 1FJSA 4E05H 3M3VA 3V3MA 3M37A 7LPRA 1DXWA 1A61H 2OC7A 1O34A 1A4WH 1A3BH 3SNEA 4ZXXH 3QTVH 2VU8E 1DT2A 1C1RA 1ZPCA 4INKA 3A7XA 2QF3A 2TGDA 3EAJA 1WQVH 2VH6A 5JYIA 1V2VT 3M5LA 4X8TH 1HAPH 4DY7B 2BLQA 5DP9A 3FVFB 3EA7A 3HKIB 4ZHLU 1HJAC 6GCHF 1TPAE 3NCLA 2GKVE 5C1UA 1G3CA 4B71A 2H9TH 2ZFFH 1KTSB 1BT7A 3FZDA 1ESAA 4FUHA 4X6PA 3RXPA 4X0WU 2G5VA 2J92A 2WV4A 2A2XH 1DS2E 4K2YA 4U30A 1AN1E 4JK6A 2D26C 3BIVH 2ZGJA 2G4TA 1CA0B 2A5IA 4ZUHA 2XBXA 3RLWH 4JZFH 1GJ4H 3I29A 3IG6B 1V2MT 2BD8A 2Q6DA 1L1JA 3TITA 1GVLA 3P8GA 2ZTXA 1SGFG 1GI7B 1SC8U 3S9BA 1ZTJA 4GLYA 1B5GH 3BTQE 1IQLA 4D9RA 1P57B 1WQSA 1UVSH 3U8OH 1ESBA 4M7GA 5DPAA 3T2NA 3MI4A 2ANMH 1F5RA 1T8OA 3W94A 2FX6A 1DANH 2F9PA 2J38A 2ZDAH 2CN0H 2QXGA 1WU1A 1YCPH 3E0PB 1ANCA 2BM2A 2ASUB 3A85A 4AYVB 4Q80A 1C1WH 2XBVA 1O3AA 1KXAA 3BSQA 1C5RA 1UTLM 2K1QA 2P8OC 1O3MA 2THFB 4R0IA 1ELFA 4YESB 4Y8XA 1QIXB 1GBDA 4YOIA 2BVSH 1ANBA 2CHAB 3FP7E 4CBNA 2FODA 2OC0A 1GDNA 2WPKS 2TPIZ 4ABBA 4Z0KA 2ILNA 2QXHA 2TIOA 1QBVH 3K9XB 1ELVA 1GJCB 1TBRH 4IW4E 2CXVA 3SJ9A 1TA2A 2H5DA 1YLCA 3RXOA 3ZVFA 1A0HB 1CA0C 1C5NH 1P2OA 1UTNA 2PSYA 1OS8A 1SLVB 1HAYB 4NA7A 2QV1A 1FUJA 1DY8A 1ELGA 1BQYA 3BEUA 4WH8A 1BTYA 3HK6B 1INCA 3KHVA 1O38A 2OC8A 4ZMAH 4HFPB 3QK1A 2P3FH 1O33A 4CRGA 1W11U 4NIXA 1O5EH 2J95A 1FIWA 5G4BA 2XBYA 1YF4A 2PUQH 2XNIA 2Q1JA 1Y5UT 3AW0A 1W14U 3E1XB 2BQ7B 1PPBH 1DVAH 4ISLA 4YLUA 3K2UA 1KDQB 2I6QA 1QQ4A 5JDUB 1O3HA 1PYTD 1VCQA 3SJ8A 2VWNA 1VITG 3LIWA 2LNCA 4YZUA 4JZIA 2BD5A 1P2JA 1SBWA 1SMFE 1K9OE 1XUIA 2ZU3A 1EASA 1N6YA 1Y3VA 3VGCB 2EEKA 3QUMP 1RTFB 2FWWA 1TX6A 1MCTA 3L33A 1DXPA 1BMLA 2XBWA 1DSUA 1O2IA 9ESTA 3IITA 1YPHE 1F7ZA 1L4ZA 2VIVA 4I8LA 3SN8A 1UTJA 2ZIQH 3FANA 3OTJE 1FZZA 1Z8RA 3ZZAA 4NZQA 1TBQH 2WPHS 2B7DH 3I77A 1ESTA 1JBUH 1FLEE 1JRSA 1O37A 3MNBA 3SU4A 1ETTH 1DWBH 1C1OA 2OD3B 3K6YA 2Y80A 3MH4A 3NPSA 4K8YA 4E7RG 2FOHA 4XFQA 1LHGH 3PYHA 5A0CA 2C3SA 3T62A 2ALVA 3O8BA 2GMTC 3P92A 4MPVA 1LQEA 5JB9S 2FESH 1P09A 5DO4H 2Q6GA 4FUIA 1HJ8A 1Z8IB 4YM9A 3SU2A 3TJOA 1LTOA 1BITA 6GCHG 5EOKA 1EJAA 1TNHA 3QZRA 2Z9JA 1HBTH 4INLA 1ELCA 1ZGIA 3ESTA 1O3EA 1HXEH 1TNIA 1HLTH 3M5NA 1YCPM 2G52A 1VJAU 3TJNA 1P04A 1TABE 4KELA 3HGNA 1IHTH 1EOLA 3BTME 2ZO3H 4BOHA 1AE8H 1UVOA 3I78A 5CHAB 4Y7BA 2P16A 1ZMNA 1OP2A 1C1TA 5E0HA 1V2WT 1JXPA 1O36A 4KTCA 2BD3A 1BTZA 2VNTA 5FXLA 5LPFA 2BDYA 3QGJA 1D3TB 4ZHMU 1NM6A 5CE1A 1HDTH 4NGAH 4A1VA 1DUAA 4K1TA 3M7TA 2ZU2A 5K0HA 2IN2A 2EI6A 2BQWB 2ANKH 4AYYB 2VINA 2ZA5A 3RXIA 2OQUA 1TYNA 3CENA 3RC6A 1ZSJA 1GVZA 2AFQB 4U2WA 2ZFTA 2VGCB 3GDVA 3BG4B 2J2UA 4NWKA 1CQQA 1QA0A 1ARBA 1BBRH 1C2LA 1FAKH 3M36A 1BRAA 5F6MA 1H8IH 4X6OA 1HNEE 3SHCH 1Y5AT 3AASA 5EW1H 2ZTZA 1EB2A 1YP9A 4NFFA 1FXYA 2TRMA 1HAXB 2GX4A 3LGYA 3PTNA 2AMPA 3RMOH 1O2MA 1T8LA 1W0ZU 3SW2B 4WXVA 4X2XA 2FP7B 1XVOA 4O9VA 5CHAC 1AZ8A 1GI6A 5C67A 3D49H 4MTBA 3MO6A 2BMGB 2QIQA 3FFGA 1XUJA 1QHRB 1HUTH 4WY3A 3SV6A 2ZGXH 1TPPA 1WBGB 1AHTH 1IQJA 1U6QA 3S7KB 2VVUA 2H5CA 1ZHMA 1BB0B 1QGFA 1O2HA 3KGPA 1D3PB 1UVPA 3EE0B 2AIPA 2ZHWH 1GBFA 1VJ9U 4CHAB 1O2SA 1ZPZA 1G2LA 1QBOA 3F9FA 4DGJA 2H6MA 1PPCE 3BG4C 4BTUB 4AZ2B 1C1UH 3P6ZB 3LDXH 4A1XA 2Z3DA 2PKAA 1EJMA 2W3IA 3GISB 4WVPE 6LPRA 4GCHF 5F8XA 4D8NA 1XX9A 1G3DA 1HFDA 2A4QA 1O5AB 2VJ1A 3ATLA 4BTTB 1AQ7A 1LO6A 3SUEA 2HNTE 1GJAB 2RA0A 4CRDA 2KAIA 1FNIA 2BDHA 1FY4A 1EAUA 1QRZA 2D1JA 1C5QA 1UHBA 3KL6A 2Y5GA 3V0XA 1SLXB 4JZDH 4UFFH 3RXSA 4AFUA 1KLTA 4ZKSU 1K1OA 1ZR0A 2FOBA 1SPJA 4U32A 1NRSH 4Y11E 5C2ZA 2H1UA 3PMHB 1QFKH 1XUFA 3SU0A 1W7GH 3TK9A 2XC0A 2H9HA 3MU1A 4WH6A 1C5VA 1QJ7B 3F9GA 3GY4A 5E0JA 1TE0A 4CH2B 4Z6AH 1A3EH 1GI5A 1UJ1A 5FCKA 3MNXA 2JETB 1DITH 3UREA 2FLRH 4K3JA 1O2LA 2BD9A 5LH8A 3LGTA 1CU1A 2D2DA 2IJOB 1GJ9B 5AFYH 3GDUA 2Y7ZA 4I8JA 2C90B 2R3YA 5B6OA 2FZZA 2FPZA 5TCAA 1H9IE 1O3PB 5CMXH 4ZXYH 2BY8X 1IQKA 3RXRA 2PKAB 2F9VA 4IC5A 2GT7A 8GCHF 1TONA 1QY6A 2YNAA 4X1NU 1C5UA 1GI8B 1Z1JA 2EI8A 2HRVA 1WSSH 1SOZA 3LGWA 1O2JA 2B9LA 2ZECA 1NY22 4I8GA 3ATWA 1PPGE 3S9AA 5FPYA 5A8YA 3LGVA 1P05A 1LPKB 1G3EA 1S0QA 4H42U 2PV9B 1UTKA 4X8SH 1VCPA 3JZ2B 1HXFH 2KAIB 2HLCA 5JPMH 4Y79A 3GYLB 3UFAA 2A7JA 1UHBB 2AGEX 4FUDA 2ZQ2A 1GWAA 1V2KT 1SHHB 3OSYA 1Y3YA 3RXBA 1TFXA 4A92A 1ZRBA 2A4RA 2JETC 1GG6B 1TRYA 3Q3YA 1L0ZA 8LPRA 4I33A 5EQSA 2OXSA 3PMBB 1GPZA 3SUDA 2ZTYA 1SLWB 1ABIH 2M5TA 1V2OT 5IDKA 2BLVA 5C3NA 4INHA 2WYGA 3E0NB 2C8YB 1O5FH 2A31A 1D3DB 4GHQA 1FPHH 2BZ6H 1PFXC 5DJ7A 3OU0A 1PPEE 1C2KA 3QX5H 1C1PA 2AEIH 1SOTA 2BZAA 1E34B 3TPIZ 3EDXB 4A1TA 1G37A 4YLQH 1GJ6A 7ESTE 1O2UA 3AAVA 1K1IA 2FDAA 3MOCA 1BZXE 1MD8A 4IN1A 4DT7B 1AMHA 1YPHC 5EGMA 1E37B 4BAQB 7GCHF 1B7XB 1GVKB 4RKOB 1TAWA 3MU0A 2O8LA 1ZOMA 3QDZB 2GDDA 4E7NA 3EQ0H 1O2GH 3UTUH 1KXBA 2QXIA 1GBAA 4B2CA 5AFZH 1OWDA 1K22H 1GDQA 1UK2A 1RIWB 1G30B 3ATMA 2JH5D 4ZKNU 1LVBA 1KTTB 5JBBS 1WOFA 3D65E 1MZDA 1C5XB 1NN6A 4B76A 1XKAC 1HCGA 1GMDF 1BHXB 2BX4A 2CV3A 1W8BH 2FX4A 2ODPA 3A7WA 1CT4E 3RMNH 2ZZUH 5DGJA 2F9UA 2C8WB 3TU7H 1MTVA 3LH1A 3SU5A 2Z94A 1MD7A 4KTSA 3SU1A 1ZRKA 4DVAU 1WV7H 3TGKE 4BAKB 4Q7XA 2FM2A 3EYDA 1A46H 3DFJA 2JH0D 2FOAA 2XC5A 1GHZA 2HGTH 4AB9A 1IQEA 4D7FA 1XUKA 2XRCA 2QXJA 3RXQA 4OGYA 2OUAA 2RG3A 2XC4A 5GJ4B 1P2MA 3QTOH 1V2TT 1RJXB 3TJUA 6ESTA 1NFUA 1SB1H 1RFNA 4B2AA 6CHAB 2AGIX 5C5NA 1P8VC 1QRWA 2XWBI 1SL3A 2JH6D 1OWHA 1NROH 2RCEA 2PFEA 5DK1A 4DG4A 1C5YB 1RIWC 1GJDB 1KSNA 1XUHA 2BDCA 2OCVB 2ZU4A 4DJZB 3GYMA 4MPUA 1P03A 5T6FA 3ODFA 4E06H 4I7YH 3BN9A 1RS0A 4K69A 3RXDA 4XBBA 2VWOA 2EA3A 3PMAB 4MDSA 3U1JB 1JMOH 1H4WA 1SG8B 2F9OA 2STBE 3S0NA 1HAZB 1Z1IA 4BNRA 3P8NA 1EAWA 1VZQH 1DX5M 1ETSH 1TALA 3W95A 1D6WA 4IBLH 4KTUA 3R3GB 1BHXF 1KLJH 5HYOA 8GCHG 5DP7A 3SORA 4I31A 3ZYDA 1TLDA 5EG4A 1O5GH 1P06A 2O8MA 2NU3E 3P8OA 3Q3XA 1GI9B 1O2OA 4BXWA 3SNBA 3VXFH 1KXDA 1B0FA 9LPRA 1IQNA 3ZV8A 5LPEA 1B0EA 5EQQA 2BD7A 4FUBA 5ETXA 1D6RA 3SGAE 3Q00A 1P2IA 1QRXA 4CRFA 3PWCA 5I46H 5FX5A 2VH0A 1SGIB 3O8DA 4F4OC 1G3BA 3ZVEA 3LGUA 4KKDA 1BJUA 4FVDA 3ITIA 3ZZ7A 4JYTA 1S84A 4UD9H 1GI2A 2PR3A 1RTLA 5C20A 4NIYA 1CVWH 1SFIA 2GCHF 4YOGA 1KXCA 3A8BA 3V7TA 3ZZDA 1GCTB 2WUBA 1NT1A 2V35A 2ZWLH 4AFSA 2NU2E 3GCTF 1TPOA 5FHTA 4NA8A 1QB1A 1CSOE 3OY5U 1C2FA 1UCYK 1EPTA 1V2QT 1BJVA 1HYLA 2FOMB 2SGQE 3DUXH 1GBHA 3KIDU 3A80A 1LVOA 1THSH 3SQEE 2HALA 2WUCA 3RXCA 4Y0YE 4ISOA 1RD3B 1WTGH 4K5ZA 2GCTB 1LHDH 1J16A 1Q2WA 1GBBA 1CBWB 5ABWA 3TNTA 1SGYE 4AB8A 1XKBC 1E0FD 7GCHG 2SGPE 4FU8A 1EKBB 2ZHEH 1G36A 3MH7A 2BY5X 1Z8JB 1THRH 3PMJA 2CHAC 1EX3A 1OOKB 1PPHE 1O2XA 1O32A 2ZGBH 1YPKH 5PTPA 2WPJS 2Y81A 3LJJA 2CJIA 1ZJKA 4XOJA 5DP8A 4AX9H 1JRTA 2PKSB 2ZFSA 2FYRA 1QL7A 1Y3XA 1T4UH 1ZTKA 3HGPA 1FMGA 2Y82A 4GHTA 4NFEA 2W7UA 2YNBA 3GCHB 2AH4X 1K1JA 3LGIA 1EP6A 1MTSA 1GBIA 1SGCA 4IMZA 5C1YA 3ZZ3A 1SR5C 2OTVA 1G9IE 2J4IA 3A8AA 5JBAS 5EU8A 5C5OA 4NG9H 2FIRH 1UCYE 2OP9A 3U8TH 3NWUA 1SGEE 5T6GA 4UEHH 1GHBF 3A87A 1ELDE 2OBOA 2A4OA 1NFYA 5F03A 3EA9A 4BTIB 5EXNA 1UVTH 4I32A 3E6PH 1TGTA 1MZAA 3KQEA 4A6LA 3S9CA 2W5EA 1CGIE 2GCTC 1CBWC 1WCZA 3S69A 2O8WA 5A8XA 4AN7A 1EPTB 1LPGB 2VIPA 1P2QA 2OINA 2ZCLP 2NU1E 2XW9A 3LJOA 3SNCA 2Z9LA 1TB6H 4ISIH 3VGCC 3A89A 1O31A 1AO5A 1PPFE 1XM1A 4BXSA 3ZZ6A 1V6DA 5EQRA 4LK4A 1LHCH 3G01A 4ISNA 1YYY1 4SGAE 3D23A 1OYQA 1NU9A 5DP6A 3PO1B 4AG1A 1C5WB 2AMDA 1EXFA 2P93A 3BTDE 3LONA 1OSSA 2EC9H 1O3LA 1O2QA 1O35A 1TRNA 3PM3A
chains in the Genus database with same CATH superfamily
3GCHC 5KEDA 1C5PA 5K7RA 1MKWK 1NTPA 3A81A 2FI3E 3E8LA 1AD8H 3P70B 4FU7A 3OEED 1MUEB 3GS9A 5JBCS 1O5CB 1ZPBA 2BYAX 1PYTC 2QF0A 1ZHRA 1FI8A 3TJVA 3H7OA 3L3TA 1TA6A 1E79D 3BTGE 1ZYOA 3DHKH 5TJXA 1BCUH 1OWEA 3GCNA 3SUFA 1J17T 2PHBA 2F3CE 4JK5A 1PQAA 3ZYEA 4DURA 4JYUH 1D4PB 4X8UH 5J4SA 3U9AH 1TPSA 1EPTC 3PV4A 4LZ1H 1ZZZA 1GI3A 2EY4C 3MWIU 1SGFA 2BY6X 3PRDA 1VGCB 1O3IA 2FOCA 1QNJA 2ZDVH 3SNAA 1W10U 2ZDMA 1OYTH 2DE8A 1HV7A 1IQGA 4RKJB 5DG6A 3PO1C 3RMLH 4H4FA 4MNXA 3RM0H 1SGTA 4JMYA 1K21H 5JB8S 1V2PT 2A7CA 3A7ZA 2C93B 3D62A 1OPHB 1TNKA 2PLXA 2ZI2H 1NRNH 2KX4A 3O8CA 1E35B 4FUEA 1C5TA 2ZDLA 1NS3A 2G55A 4UFGH 2BY7X 4X1RU 2HPQH 1C4U2 5E0GA 3STIA 4FVBA 1DWEH 1DDJA 1Q31A 3GCTG 4RT0A 2DE9A 1BMMH 3RXFA 1J14A 1BMAA 3GY3A 1VCWA 4TYDA 3F0PA 2ZNKH 1OWIA 5JBTA 5FPTA 1EOJA 5FCRA 1H8HD 1AZZA 1SFQB 1ANDA 1WTHD 4UONA 2G4UA 4NCYA 2BX3A 4A7IB 3HKJB 2KCOA 2VVCA 3BTEE 3P17H 3K6ZA 3VB5A 5ESBA 5GDSH 1W13U 2TGTA 5LPRA 2VGCC 2NU4E 1JIRA 1TGBA 2RDLA 3ZV9A 2O8UA 3F9HA 1EQ9A 3GY2A 2WINI 2B5TB 2Z9IA 1BUIA 1AWHB 1MTNB 1UTPA 4YT6H 1S6FA 2FEQH 3ODDA 3MO9A 1NO9H 4MPXA 2L6OA 3BTFE 1NRRH 4X2YA 4ACAA 1VGCC 3A82A 3AVZA 1ZSLA 3QN7A 3ZVAA 1ETRH 1P0SH 1Y3UA 5HXFA 1AFQB 3M7UA 4BAHB 5CHBA 2D8WA 1GBMA 4OS7A 1F0UA 3MNCA 1P12E 4Y7AA 3OE7D 4RT1A 4HGCA 3T26A 1C2JA 3S7HB 4FU9A 1YC0A 4FUFA 3OEHD 1XXFA 4XDEA 4OGXA 3PB1E 1FY1A 3M35A 2GP9B 1VR1H 3RXHA 1C5MD 2QY0B 4ZHAA 4O03A 3MU8A 3ZVGA 1CHOF 1HIAA 1YPGH 1ZGVA 3LU9B 2FOFA 3ZVDA 4CH8B 1YM0A 2H9EH 1C1MA 1E1RD 3PV2A 3RXEA 1P9SA 1SGQE 1YPLH 1HAOH 2A32A 4CHAC 4LXBH 3LOXA 4CRCA 5A0BA 2GJGA 5H4IB 3QZQA 5C1XA 2AIQA 3MFJA 1MH0A 1FDPA 1MBMA 1V2UT 2V6NA 4XBDA 3F9EA 3GY5A 1SGPE 1YKTA 1DLKB 2BVRH 1MTNC 4X2VA 2IOTA 3TLOA 3VB3A 2UWOA 4TT3D 3RXKA 1ABJH 4OS4A 1P9UA 1GBTA 4B75A 1QCPA 4YTAA 2M2AA 4OS6A 4D7GA 1V2JT 4ABHA 2QAAA 4Y76A 1M9UA 4AG2A 3CS0A 3NUMA 4IMQA 2FS9A 1TGCA 2F9BH 4WWYA 4X1QU 1KLIH 1BDAA 2ULLA 1BRUP 2JDID 2BXTH 1S81A 3JZ1B 1L4DA 1LKBA 1O3CA 4OS1A 2FLBH 3UQVA 1DPOA 3NZIA 1H1BA 1E38B 2EI7A 3RLYH 2R9PA 4FETA 4ESTE 1ID5H 5DP4A 3T28A 5AF9H 2P95A 4O3TA 4FUJA 3U28C 1V2LT 3TK5A 1ELBA 2UUJB 2C4FH 5B6LA 3PLPA 5AHGH 3KEEA 2HLDD 2IPHA 1V2RT 1N6XA 2BDGA 1GBKA 1C1SA 3FZZA 4Y0ZE 2ZCHP 1VITH 3PTBA 2QCYA 4MNYA 2FS8A 5GWZA 4TSFD 8ESTE 1QL9A 4KGAA 5EPNA 3F1SB 3UR9A 1Q3XA 3LH3A 2ODQA 1BIOA 2FOGA 4FXGH 4JZEH 3VB4A 1UCYH 1ZMJA 4SGBE 1GBCA 2A45B 2UUKB 4J1YA 1MQ5A 1NBME 1A1RA 1O3FA 4ABDA 1QL8A 2JJ1D 1YPJH 1GI1A 1F92A 3RU4E 1FY5A 1BTXA 1KYNA 1QURH 1T4VH 1V2NT 4H6TA 4NSYA 3A8CA 2A1DB 3VPKA 3SGBE 3F6UH 5L6NH 1F0RA 2O9QA 2OC1A 2VIQA 3H7TA 4XBCA 3O8RA 3ZZ5A 4AGJA 4GUXA 2QE7D 1SLUB 1K0HA 1HAVA 1J8AA 4TWWA 1DLEA 2ZFPH 1SVPA 2F91A 1NRPH 1C9TA 3N99A 5DKMA 1UK3A 1A5IA 1F0SA 1IQMA 4O3UA 3SZEA 2B0FA 4X1SU 1QQUA 2WPMS 3GDSA 5BRRE 3F2GA 1PPZA 1GG6C 1MKXK 1IHSH 4YO9A 1C4Y2 4LOYH 1O3BA 2HPPH 2G5NA 4GSOA 3VG8A 3T5FH 5F8TA 3OY6U 1V3XA 4DIIH 3M61U 5ESTE 1HJAB 1LHFH 2BXUH 2VVVA 2TGAA 2QN5T 2FXRA 1O3JA 2B8OH 1GI0A 2FO9A 4GCHG 2QF4A 5F8ZA 2SGDE 5HGGA 2W3KA 1H8DH 2KM0A 1Y5BT 2F9NA 2W26A 5E2OA 3E90B 4GPGA 2Z9KA 2C8XB 1QTFA 5GIBA 3U69H 3TGJE 1TQ7B 2R2MB 5FX6A 1OWJA 3MU4A 1AVGH 1L1NA 1NU7B 2V3OH 1NZQH 3B9FH 1GHXH 1JOUB 2XCNA 5A0AE 2WV5A 3EGKH 1GJBB 3VB7A 1DY9A 3VEQB 4X8VH 1O5BB 1MQ6A 3VFEA 1O2ZA 1CHOG 1PQ8A 1ORFA 3A86A 1SQTA 4THNH 3TVJB 1Y59T 1IQIA 2Y5HA 1WYKA 1GL1A 1UK4A 3GOVB 3KQBA 1O3NA 3FP8E 1HAVB 3SJKA 4D76A 5LGOA 1LQDB 1BA8B 4Q7ZA 1E36B 4R8TB 3U1IB 1C5ZB 1F0TA 4I8HA 4B73A 1MKWH 1TGSZ 5GPIB 2A7HA 2XTTB 1AFEH 2ZP0H 1LHEH 3GICB 2P8OB 1K28D 3M5OA 1O2NA 3TH4H 1TMUH 2L74A 3FO8D 1CT0E 4XE4A 2J34A 1GJ8B 5E8EH 1O2PA 2UUYA 3SI3H 1TX7A 1QB6A 3H5CB 1J15A 1BRBE 3A7TA 4K60A 4NIVA 4NWLA 5A09A 2UWPA 2SGFE 3TNSA 4CREA 5A2MH 5T6DA 5C0UA 5HMAA 1TOCB 2ZFQH 5EJZA 1FV9A 1SQOA 3FAOA 1CE5A 4MVNA 2Y6TA 5IK2D 3MH6A 2BD2A 4OM9A 6CHAC 2A0QB 3BTHE 3BTWE 1KDQA 1MBQA 1EUFA 2ZU1A 3MMGA 2Z6BD 2AYWA 1UTOA 1NESE 3KN2A 2BY9X 4J2YB 2PTCE 3M7QA 4AOQA 1FY8E 2GZ9A 2GGVB 3ZZ4A 2BQ6B 2GZ8A 1O2QA 3B8JA 4Y71A 1D3QB 3NXPA 1JIMA 1F5KU 1P10A 2GVFA 2PUXB 2UUFB 3SV2H 5HM2A 2W7SA 1N8OB 1THPB 3RXGA 3KQDA 2ALPA 1AB9B 1DICA 1GMCF 1C2IA 1GJ5H 4BAMB 2G51A 2GD4B 4AFZA 3RP2A 1EATA 5FAHA 1RXPA 1MAYA 3EA8A 5EXLA 3DD2H 3VXEH 4NA9H 4DCDA 3R0FA 4MG3A 4HTCH 1V2ST 2GDEH 3CS7A 5EPYA 4YT7H 2GTBA 5DP5A 2GZ7A 3ZZ8A 5L2YH 2ZGCA 5T3HA 8KME2 1AUJA 1C1QA 1Z6JH 2I6SA 4GAWA 1EJNA 2JKHA 4CRBA 1CGHA 3QLPH 3RXLA 4FUGA 3OX7U 1SQAA 1YLDA 4MPWA 1FPCH 2FI4E 2Z7FE 1HB0B 1K1MA 2HNTC 3MO3A 4MLFB 1NFXA 2ZU5A 2XCFA 4XRNA 5CDFE 3BEFB 1UTMA 1EZSC 1VKYA 4UE7H 3SBKA 4NIWA 3UWIA 2SFAA 2ZQ1A 2SNWA 2TBSA 2GMTB 1GL0E 5GXPA 2HNTF 2G8TA 1AUTC 1TBZH 1NBMD 2Y7XA 3BTTE 3UNRA 2JIZD 2STAE 3Q76A 3A84A 1HJ9A 2QC2A 3RU4D 3DA9B 3LT3A 1TX8A 2G00A 3AAUA 1N8OC 2XWAA 4NZLA 4ABJA 2KZ4A 4H6SB 1GMDG 1GCTC 1FONA 1AB9C 1O3KA 5DP3A 4F48B 1C5LH 1O2YA 4ASUD 4A5TS 4Y10E 1T8MA 2ZC9H 4O97A 5A8ZA 3Q3KA 3PWBA 1FIZA 1TRMA 3ATIA 3UNSA 1TMBH 2K0QA 1C4V2 2BB4A 3UUZA 3SQHE 3SO3A 1IQFA 3SZNA 3N7OA 3RXJA 4ASHA 1X7AC 3A8DA 3CP7A 1O2KA 1T32A 1ZTLA 1A5HA 2J98A 2BOHB 1DFPA 2ZPSA 3ZVCA 4TPYA 1C2GA 1A2CH 2HVXA 2ZHQH 5HM9A 1K1NA 3P8FA 3SUGA 1QZ8A 1OKXA 1COWD 1TNGA 1D9IA 3MYWA 2ZCKP 3QO6A 1Z71A 2H2ZA 2Q6FA 1ZSKA 3LPRA 4FUCA 2VWLA 2A5KA 3UPEA 2CGAA 2QA9E 4WMFA 3C27B 3GCOA 3BEIB 2BLWA 3KF2A 4U01A 1CHGA 5F53A 1ZJDA 3RM2H 3V12A 2AHME 1YY3A 2PKSC 4XD7D 1S0RA 1O2VA 2ESTE 4KP0A 2TGPZ 1GHVH 1L1GA 1RRKA 2PTNA 5T1VA 2R0KA 4B1TA 1W12U 1BTHH 2XXLA 1K2I1 1S83A 3BIUH 2YOLA 4X6MA 3SV8A 4VGCB 1UMAH 1C2EA 4HZHA 3A7YA 1AY6H 4UFDH 1KXFA 1C2MA 4Q2KA 1NRQH 1IOEA 1MAXA 2ZG0H 1ACBE 2WYJA 1S82A 4YOJA 3E16B 3WWFA 1SGNE 4X1PU 1HRTH 2J97A 4ABGA 1AIXH 1T31A 3RXTA 3NKKA 2VWMA 1C5SA 2OBQA 1EAXA 1LMWB 1PJPA 1C2DA 5TCCA 2AS9A 4IN2A 4ISHH 3B23B 1LDTT 1WDIA 2ANWA 3BG8A 3URDA 3MHWU 3QGNB 1SI5H 1XXDA 4MNWA 4B6FA 2CF8H 2BVXH 4WXIA 2J9NA 4Y8YA 4Y8ZA 1AGJA 3T29A 1GMHF 4XSKU 2BDBA 2VIOA 2J98B 2F4LA 3UQOA 2BDIA 1ELAA 3SI4H 2GV6A 1DUEA 1TMTH 3RUOA 2AGGX 4MNVA 1OXGA 1XUGA 2HOBA 3Q77A 3RU4T 1A0LA 1YPMH 3A83A 2CF9H 1T8NA 1O5DH 2R0LA 2GCHG 2BLOA 1BMFD 1YCPK 2ZHFH 1TOMH 3ATKA 5EW2H 1JWTA 1GMCG 1HAHH 1Y3WA 1AE5A 4VGCC 1EB1H 4ZKOU 3UNQA 4QT8C 2RA3A 1AWFH 3RC5A 1BTUA 1F5LA 5GCHF 5FBIA 1IAUA 4CRAA 1TIOA 5L30H 1O2TA 1AI8H 4DIHH 1A7SA 3UOPA 3HATH 1CGJE 1DM4B 1KMHB 4BANB 1HAGE 4MQAA 1MKXH 1Z8GA 2FTLE 2PW8H 2VIWA 1HPGA 2OLGA 4JYVH 1KXEA 3N7DA 2F83A 1OX1A 2FMJA 2CMYA 2Y5FA 3RXUA 2R3UA 3SJOA 3MH5A 3PRBA 1UVUH 4GVUA 1EP5A 3BF6H 4ZH8A 4ZROA 4TY6A 4WJG2 3SV9A 4PROA 1AU8A 1DWCH 1O39A 3SU6A 5FPSA 3TH3H 1BTPA 1S6LA 2P3TB 5EJLA 3FN8A 4ZAEA 3DSGA 1KY9A 1C2HA 5I25A 2SNVA 1ANEA 1Z7KA 3A7VA 3KCGH 3F2HA 2QGRA 2NU0E 3UWJH 1S6HA 1AKSA 1S5SA 2R2WU 2Z9GA 2AERH 1GHAF 1MTWA 4AGKA 1AVXA 2BHGA 1GBJA 3HPTB 2ZHDA 1FN8A 2WPLS 1FQ3A 1W2KH 1KIGH 5EODA 2G81E 4ABAA 1C9PA 1UO6A 1P2KA 3TGIE 3SOSA 1A5GH 3PLKA 4WMEA 1K1PA 1ZLRA 2ODYB 2NWNA 1PQ5A 4AORA 2WPIS 2O8TA 3QWCH 3LC5A 1GGDB 2ZDNA 4IGDA 4JZ1A 1GHBG 3KNXA 2BD4A 3FP6E 3ZZBA 1FY3A 1BTWA 1LPZB 4NSVA 2ZGHA 3TIUA 5SGAE 2P59A 1LVMA 3NK8A 2ZDKA 1UTQA 1L2EA 5EXMA 3SGQE 1QBNA 3P95A 3STJA 1O3OA 1BRCE 3L6PA 3RXMA 4LZ4B 3RC4A 1CT2E 1SSXA 1XVMA 4P02A 3U98H 2AMQA 1Y8TA 3GY7A 3MTYA 3W1EA 4B2BA 3F68H 2PSXA 1N1LA 5E2PA 2BTCE 2EQNA 2V0BA 1AFQC 2J5UA 1DOJA 1G32B 1QJ1B 1ELEE 3PLBA 3UY9A 1C5OH 1YBWA 4K1EA 3M5MA 1F2SE 4IC6A 1IQHA 2ANYA 4RSPA 1BOQA 2Z3CA 7KMEH 4ABFA 1HAIH 1GHWH 1GCDA 5AVDA 3ENSB 3UIRA 5L2ZH 1P01A 1P2NA 1LVYA 4TPIZ 4CBOA 3MQKC 1EZXC 3RMMH 1Z6EA 1RGQA 1AKSB 1EAIA 3E3TA 3M3SA 4F49A 1W7XH 4TWYA 2ZEBA 1CA8B 1TGNA 1GGDC 1EZQA 3LKWA 3SNDA 3GY6A 1W3CA 1QJ6B 3HK3B 5J4QA 1P02A 2J94A 2ZFRH 3MNSA 4UFEH 2FOEA 3AW1A 4OS2A 1P11E 1AVWA 2HWLB 4OS5A 4ABIA 1YPEH 2ZF0H 1BMNH 2FI5E 4TY7A 3RDZA 1RTKA 4DW2U 2PGQB 3OYPA 1HIAB 1QB9A 1P3EA 1S85A 4ABEA 2ZPQA 1O0DH 2VBCA 1WAYB 2KR7A 2A4GA 2SGEE 3RXAA 1PQ7A 4DT4A 3M3TA 4K1SA 1MU8B 3UOUA 1G2MA 1ZHPA 4CR5A 2PGBB 3ZZ9A 2VIDA 1EZUC 1DE7H 2QYIA 1O30A 1TWXB 1GMHG 1GJ7B 1NFWA 2PWXA 1LCYA 3ZZCA 4WF8A 2FYQA 1FX0B 3C1KA 1QR3E 3SYJA 4ZKRU 2DUCA 1T7CA 3VB6A 1C1VH 4I86A 3TH2H 5DSFA 4RN6A 2OQ5A 3IWMA 1SGDE 2C8ZB 1W0YH 2GV7A 2KCAA 4BAOB 2P3UB 3SU3A 4UDWH 4I8KA 5BPEA 3KQCA 2A2QH 1WUNH 4K8BA 3WY8A 1A0JA 1BBRK 4Y6DA 1GDUA 2KCPA 1SGRE 1GBEA 5FBEA 3SJIA 1DSTA 3K65B 5GCHG 1FN6A 3DFLA 1XMNB 1SHYA 4Q7YA 1GI4A 1J9CH 1C1NA 1H9LB 2BDAA 2Z3EA 2SGAA 3ZVBA 3TK6A 1QA7A 1K1LA 1MU6B 1NC6A 2V3HH 4JCNA 1ELTA 3LC3A 3A88A 1ZMLA 3DT0H 4Q4LA 3T27A 1P3CA 2ZPRA 4FOUC 1ARCA 3URCA 4X2WA 2FTMA 2A5AA 2ZKSA 1OP0A 1MMJN 1YGCH 1TNJA 3E91A 3T25A 3BTKE 2BOKA 1OP8A 4B74A 1W0JD 1VITF 1OWKA 1DWDH 4WMDA 1CO7E 1H9HE 4IS5A 2UWLA 4AFQA 2WZQA 2XYAA 4X6NA 3PROA 4D9QA 2RDEA 1MCVA 3KYFA 3WWBA 1LKAA 3RXVA 1TQ0B 3SV7A 1MTUA 3U8RH 2GT8A 1GBLA 1GHAG 3H09A 3MU5A 3UR6A 1O2RA 2LPRA 1O3GA 4DOQA 3SHAH 2VB0A 1HGTH 1O3DA 4CR9A 1BBRE 4ZCNA 3BV9B 2P94A 1TNLA 1GHYH 1O2WA 3V13A 5IYTA 1NPMA 3ELAH 1FAXA 3GY8A 4HI3A 1FJSA 4E05H 3M3VA 3V3MA 3M37A 7LPRA 1DXWA 1A61H 2OC7A 1O34A 1WXRA 1A4WH 1A3BH 3SNEA 4ZXXH 1OHHD 3QTVH 2VU8E 1DT2A 1C1RA 1ZPCA 4INKA 3A7XA 2QF3A 2TGDA 3EAJA 1WQVH 2VH6A 5JYIA 1V2VT 3M5LA 4X8TH 1HAPH 4DY7B 2BLQA 5DP9A 3FVFB 3EA7A 3HKIB 4ZHLU 1HJAC 6GCHF 1TPAE 3NCLA 2GKVE 5C1UA 1G3CA 4B71A 2H9TH 2ZFFH 1KTSB 1BT7A 3FZDA 1ESAA 4FUHA 4X6PA 3RXPA 4B6EA 4X0WU 2G5VA 2J92A 2WV4A 2A2XH 1DS2E 4K2YA 4U30A 1AN1E 4JK6A 5HIZA 2D26C 3BIVH 2ZGJA 2G4TA 1CA0B 2A5IA 4ZUHA 2XBXA 3RLWH 4JZFH 1GJ4H 3I29A 3IG6B 1V2MT 2BD8A 2Q6DA 1L1JA 3TITA 1GVLA 3P8GA 2ZTXA 1SGFG 1GI7B 1SC8U 3S9BA 1ZTJA 4GLYA 1B5GH 3BTQE 1IQLA 4D9RA 1P57B 2W6ID 1WQSA 1UVSH 3U8OH 1ESBA 4M7GA 5DPAA 3T2NA 3MI4A 2ANMH 1F5RA 1T8OA 3W94A 4Z1MD 2FX6A 1DANH 2F9PA 2J38A 2ZDAH 2CN0H 2QXGA 1WU1A 1YCPH 3E0PB 1ANCA 2BM2A 2ASUB 3A85A 4AYVB 4Q80A 1C1WH 2XBVA 1O3AA 1KXAA 3BSQA 1C5RA 1UTLM 2K1QA 2P8OC 1O3MA 2THFB 4R0IA 1ELFA 4YESB 5HIYA 4Y8XA 3UB0A 5C17A 1QIXB 1GBDA 4YOIA 2BVSH 1ANBA 2CHAB 3FP7E 4CBNA 2FODA 2OC0A 1GDNA 2WPKS 2TPIZ 4ABBA 4Z0KA 2ILNA 2QXHA 2TIOA 1QBVH 3K9XB 1ELVA 1GJCB 1TBRH 4IW4E 2CXVA 3SJ9A 1TA2A 2H5DA 1YLCA 3RXOA 3ZVFA 1A0HB 1CA0C 1C5NH 1P2OA 1UTNA 2PSYA 1OS8A 1SLVB 2QF5A 1HAYB 4NA7A 2QV1A 1FUJA 1DY8A 1ELGA 1BQYA 3BEUA 4WH8A 1BTYA 3HK6B 1INCA 3KHVA 1O38A 2OC8A 4ZMAH 4HFPB 3QK1A 2P3FH 1O33A 4CRGA 1W11U 4NIXA 1O5EH 2J95A 1FIWA 2WPDD 5G4BA 2XBYA 1YF4A 2PUQH 2XNIA 2Q1JA 1Y5UT 3AW0A 1W14U 3E1XB 2BQ7B 1PPBH 1DVAH 2V7QD 4ISLA 4YLUA 3K2UA 1KDQB 2I6QA 1QQ4A 5JDUB 1O3HA 1PYTD 1VCQA 3SJ8A 2VWNA 1VITG 3LIWA 2LNCA 4YZUA 4JZIA 2BD5A 1P2JA 1SBWA 1SMFE 1K9OE 1XUIA 2ZU3A 1EASA 1N6YA 1Y3VA 3VGCB 2EEKA 3QUMP 1RTFB 2FWWA 1TX6A 1MCTA 3L33A 1DXPA 1BMLA 2XBWA 1DSUA 1O2IA 9ESTA 3IITA 1YPHE 1F7ZA 1L4ZA 2VIVA 4I8LA 3SN8A 1UTJA 2ZIQH 3FANA 3OTJE 1FZZA 1Z8RA 3ZZAA 4NZQA 1TBQH 2WPHS 2B7DH 3I77A 1ESTA 1JBUH 1FLEE 1JRSA 1O37A 3MNBA 3SU4A 3FOAA 1ETTH 1DWBH 1C1OA 2OD3B 3K6YA 2Y80A 3MH4A 3NPSA 4K8YA 4E7RG 2FOHA 4XFQA 1LHGH 3PYHA 5A0CA 2C3SA 3T62A 2ALVA 3PV5A 3O8BA 2GMTC 3P92A 4MPVA 1LQEA 5JB9S 2FESH 1P09A 5DO4H 2V3MA 2Q6GA 4FUIA 1HJ8A 5EJ1A 1Z8IB 4YM9A 3SU2A 3TJOA 1LTOA 1BITA 6GCHG 2W6JD 5EOKA 1EJAA 1TNHA 3QZRA 2Z9JA 1HBTH 4INLA 1ELCA 1ZGIA 3ESTA 1O3EA 1HXEH 1TNIA 1HLTH 1E1QD 3M5NA 1YCPM 2G52A 1VJAU 3TJNA 1P04A 1TABE 4KELA 3HGNA 1IHTH 1EOLA 3BTME 2ZO3H 4BOHA 1AE8H 1UVOA 3I78A 5CHAB 4Y7BA 3WW7A 1ZMNA 2P16A 1OP2A 1C1TA 5E0HA 1V2WT 1JXPA 1O36A 4KTCA 2BD3A 1BTZA 2VNTA 5FXLA 5LPFA 2BDYA 3QGJA 1D3TB 4ZHMU 1NM6A 5CE1A 1HDTH 4NGAH 4A1VA 1DUAA 4K1TA 3M7TA 2ZU2A 5K0HA 2IN2A 2EI6A 2BQWB 2ANKH 4AYYB 2VINA 2ZA5A 3RXIA 2OQUA 1TYNA 3CENA 3RC6A 1ZSJA 1GVZA 2AFQB 4U2WA 2ZFTA 2VGCB 3GDVA 3BG4B 2J2UA 4NWKA 1CQQA 1QA0A 1ARBA 1BBRH 1C2LA 1FAKH 3M36A 1BRAA 5F6MA 1H8IH 4X6OA 1HNEE 3SHCH 1Y5AT 3AASA 5EW1H 2ZTZA 1W0KD 1EB2A 1YP9A 4NFFA 1FXYA 2TRMA 1HAXB 2GX4A 3LGYA 3PTNA 2AMPA 3RMOH 1O2MA 1T8LA 1W0ZU 3SW2B 4WXVA 4X2XA 2FP7B 1XVOA 4O9VA 5CHAC 4Q63A 1AZ8A 1GI6A 5C67A 4M9FA 3D49H 4MTBA 3MO6A 2BMGB 4HG6A 2QIQA 3FFGA 1XUJA 1QHRB 1HUTH 4WY3A 3SV6A 2ZGXH 2LP6A 1TPPA 1WBGB 1AHTH 1IQJA 1U6QA 3S7KB 2VVUA 2H5CA 1ZHMA 1BB0B 1QGFA 1O2HA 3KGPA 1D3PB 1UVPA 3EE0B 2AIPA 2ZHWH 1GBFA 1VJ9U 4CHAB 1O2SA 1ZPZA 1G2LA 1QBOA 3F9FA 4DGJA 2H6MA 1PPCE 3BG4C 2F43B 4BTUB 4AZ2B 1C1UH 3P6ZB 3LDXH 4A1XA 2Z3DA 2PKAA 1EJMA 2W3IA 3GISB 4WVPE 6LPRA 4GCHF 3F3BA 5F8XA 2CK3D 4D8NA 1XX9A 1G3DA 1HFDA 2A4QA 1O5AB 2VJ1A 3ATLA 4F55A 4BTTB 1AQ7A 1LO6A 3SUEA 2HNTE 3KQ5A 1GJAB 2RA0A 4RI0A 4CRDA 2KAIA 1FNIA 2BDHA 1FY4A 1EAUA 1QRZA 2D1JA 1C5QA 1UHBA 2XOKD 2Y5GA 3KL6A 3V0XA 1SLXB 3ZIAD 4JZDH 4UFFH 3RXSA 4AFUA 1KLTA 4ZKSU 1K1OA 1ZR0A 2FOBA 1SPJA 4U32A 1NRSH 4Y11E 5C2ZA 2H1UA 3PMHB 1QFKH 1XUFA 3SU0A 1W7GH 3TK9A 2XC0A 2H9HA 3MU1A 4WH6A 1C5VA 1QJ7B 3F9GA 3GY4A 5E0JA 1TE0A 4CH2B 4Z6AH 1A3EH 2WV9A 1GI5A 1UJ1A 5FCKA 3MNXA 2JETB 1SKYE 1DITH 3UREA 2FLRH 4K3JA 1O2LA 2BD9A 4P00A 5LH8A 3LGTA 1CU1A 2D2DA 2IJOB 1GJ9B 5AFYH 3GDUA 2Y7ZA 4I8JA 2C90B 2R3YA 5B6OA 2FZZA 2FPZA 5TCAA 1H9IE 1O3PB 2PP6A 5CMXH 4ZXYH 2BY8X 1IQKA 3RXRA 2PKAB 2F9VA 4IC5A 2GT7A 8GCHF 2LELA 1TONA 1QY6A 2YNAA 4X1NU 2HVYB 1C5UA 1GI8B 1Z1JA 2EI8A 2HRVA 1WSSH 1SOZA 3LGWA 1O2JA 2B9LA 2ZECA 1NY22 4I8GA 3ATWA 1PPGE 3S9AA 5FPYA 5A8YA 3LGVA 1P05A 1LPKB 1G3EA 1YWUA 1S0QA 4H42U 2PV9B 1UTKA 4X8SH 1VCPA 3JZ2B 1HXFH 2KAIB 2HLCA 5JPMH 4Y79A 3GYLB 3UFAA 2A7JA 1UHBB 2AGEX 4FUDA 2ZQ2A 1GWAA 1V2KT 1SHHB 4AC9A 3OSYA 1Y3YA 3RXBA 1TFXA 4A92A 3DSPA 1ZRBA 2A4RA 2JETC 1GG6B 1TRYA 3Q3YA 1L0ZA 8LPRA 4I33A 5EQSA 2OXSA 3PMBB 1GPZA 3SUDA 2ZTYA 1SLWB 1ABIH 2M5TA 1V2OT 5IDKA 2BLVA 5GNDA 5C3NA 4INHA 2WYGA 3E0NB 2C8YB 1O5FH 2A31A 5C94A 1D3DB 4GHQA 1FPHH 2BZ6H 1PFXC 5DJ7A 3OU0A 3OTPA 1PPEE 1C2KA 3QX5H 1C1PA 2AEIH 5KGOA 3AK5A 2IPQX 5C0TA 1SOTA 2BZAA 1E34B 3TPIZ 3EDXB 4A1TA 1G37A 4YLQH 1GJ6A 7ESTE 1O2UA 3AAVA 1K1IA 2FDAA 3MOCA 1BZXE 3KYGA 1MD8A 4IN1A 3F2FA 4DT7B 1AMHA 1YPHC 5EGMA 1E37B 4BAQB 7GCHF 1B7XB 1GVKB 4RKOB 1TAWA 3MU0A 2O8LA 1ZOMA 3QDZB 2GDDA 4E7NA 3EQ0H 1O2GH 3UTUH 1KXBA 2QXIA 1GBAA 4B2CA 5AFZH 1OWDA 1K22H 3CNRA 1GDQA 1UK2A 1RIWB 2OK5A 1G30B 4YXWD 3ATMA 2JH5D 4ZKNU 1LVBA 1KTTB 5JBBS 1WOFA 3D65E 1MZDA 1C5XB 1NN6A 4B76A 2WSSD 1XKAC 1HCGA 1GMDF 1BHXB 2BX4A 2CV3A 1W8BH 2FX4A 2ODPA 3A7WA 1CT4E 3RMNH 2ZZUH 5DGJA 2F9UA 2C8WB 3TU7H 1MTVA 3LH1A 3SU5A 1SQRA 2Z94A 1MD7A 4KTSA 3DSOA 3SU1A 1ZRKA 4DVAU 1WV7H 3TGKE 1EFRD 4Q7XA 4BAKB 2FM2A 3EYDA 1A46H 3DFJA 2JH0D 2FOAA 2XC5A 1GHZA 2HGTH 4AB9A 1IQEA 4D7FA 1XUKA 2XRCA 2QXJA 3RXQA 4OGYA 2OUAA 2RG3A 2XC4A 5GJ4B 1P2MA 3QTOH 1V2TT 2JJ2D 1RJXB 3TJUA 6ESTA 1NFUA 1SB1H 1RFNA 4B2AA 6CHAB 2AGIX 5C5NA 1P8VC 1QRWA 2XWBI 1SL3A 2JH6D 1OWHA 1NROH 2RFKC 2RCEA 2PFEA 5FL7D 5DK1A 4DG4A 1C5YB 1RIWC 1GJDB 1KSNA 3NRLA 1XUHA 2BDCA 2OCVB 2ZU4A 4DJZB 3GYMA 4MPUA 1P03A 5T6FA 3ODFA 4E06H 4I7YH 3BN9A 4ACBA 5KECA 1RS0A 5HKKD 4K69A 3RXDA 4XBBA 2VWOA 2EA3A 3PMAB 4MDSA 3U1JB 1JMOH 1H4WA 1SG8B 2F9OA 2STBE 3S0NA 1HAZB 1Z1IA 4BNRA 3P8NA 1EAWA 1VZQH 1DX5M 1ETSH 1TALA 3W95A 1D6WA 4IBLH 4KTUA 3R3GB 1BHXF 1KLJH 5HYOA 8GCHG 5DP7A 3EE7A 3SORA 2K8IA 4I31A 3ZYDA 1TLDA 5EG4A 1O5GH 1P06A 2NU3E 2O8MA 3P8OA 3Q3XA 1GI9B 1O2OA 4BXWA 3SNBA 3VXFH 1KXDA 1B0FA 9LPRA 1IQNA 3ZV8A 5LPEA 1B0EA 5EQQA 2BD7A 4FUBA 5ETXA 1D6RA 3SGAE 3Q00A 1P2IA 1QRXA 4CRFA 3PWCA 5I46H 5FX5A 2VH0A 1SGIB 3O8DA 4F4OC 1G3BA 3ZVEA 3LGUA 4KKDA 1BJUA 1MABB 2KFWA 4FVDA 3ITIA 3ZZ7A 4JYTA 1S84A 4UD9H 1GI2A 1YLNA 1RTLA 2PR3A 2YMSD 5DN6D 5C20A 4NIYA 1CVWH 1SFIA 2GCHF 4YOGA 1KXCA 3A8BA 3V7TA 3ZZDA 1GCTB 2WUBA 1NT1A 2V35A 2ZWLH 4AFSA 2NU2E 3GCTF 1TPOA 5FHTA 4NA8A 1QB1A 1CSOE 3OY5U 1C2FA 1UCYK 1EPTA 1V2QT 3OFND 1BJVA 1HYLA 2FOMB 3OAAD 2XNDD 2SGQE 3DUXH 1GBHA 2IJD1 3KIDU 3A80A 1LVOA 1THSH 3SQEE 2HALA 2WUCA 3RXCA 4Y0YE 4ISOA 1RD3B 1WTGH 4K5ZA 2GCTB 1LHDH 1J16A 1Q2WA 1GBBA 1CBWB 5ABWA 5EIYA 3TNTA 1SGYE 4AB8A 2YMSB 1XKBC 1E0FD 7GCHG 2SGPE 4FU8A 1EKBB 2ZHEH 1G36A 3MH7A 2BY5X 1Z8JB 1THRH 3PMJA 2CHAC 1EX3A 1OOKB 1PPHE 1O2XA 1O32A 2ZGBH 1YPKH 5PTPA 2WPJS 2Y81A 3LJJA 2CJIA 1ZJKA 4XOJA 5DP8A 4AX9H 1JRTA 2PKSB 2ZFSA 2FYRA 1QL7A 1Y3XA 1T4UH 1ZTKA 3HGPA 1FMGA 2Y82A 4GHTA 4NFEA 2W7UA 2YNBA 3GCHB 2AH4X 1K1JA 3LGIA 1EP6A 1MTSA 1GBIA 1SGCA 4IMZA 5C1YA 3ZZ3A 1SR5C 2OTVA 1G9IE 2J4IA 3A8AA 5JBAS 5EU8A 5C5OA 4NG9H 2FIRH 3UAIC 1UCYE 2OP9A 3U8TH 3NWUA 1SGEE 5T6GA 4UEHH 1GHBF 3A87A 1ELDE 2OBOA 2A4OA 1NFYA 5F03A 3EA9A 4BTIB 5EXNA 2WHXA 1UVTH 4I32A 3E6PH 1TGTA 1MZAA 3KQEA 4A6LA 3S9CA 2W5EA 1CGIE 2GCTC 1CBWC 1WCZA 3S69A 2O8WA 2YMSC 5A8XA 4AN7A 1EPTB 1LPGB 2VIPA 1P2QA 2OINA 2ZCLP 2NU1E 2XW9A 3LJOA 3SNCA 2Z9LA 1TB6H 4ISIH 3VGCC 3A89A 1O31A 1AO5A 1PPFE 1XM1A 4BXSA 3ZZ6A 1V6DA 5EQRA 1H8ED 4LK4A 1LHCH 3G01A 4ISNA 1YYY1 4SGAE 3D23A 1OYQA 1NU9A 5DP6A 3PO1B 4AG1A 1C5WB 3F0OA 2AMDA 1UW7A 1EXFA 3N7EA 2P93A 3BTDE 3LONA 1OSSA 3FKSD 2EC9H 1O3LA 2KCYA 1O35A 1TRNA 3DCLA 3PM3A
chains in the Genus database with same CATH topology
3GCHC 1C5PA 5K7RA 1MKWK 1NTPA 3A81A 2FI3E 3E8LA 1AD8H 3P70B 4FU7A 1MUEB 5JBCS 1O5CB 1ZPBA 2BYAX 1PYTC 2QF0A 1ZHRA 1FI8A 3TJVA 3H7OA 3L3TA 1TA6A 3BTGE 1ZYOA 3DHKH 5TJXA 1BCUH 1OWEA 3GCNA 3SUFA 1J17T 2PHBA 2F3CE 4JK5A 1PQAA 3ZYEA 4DURA 4JYUH 1D4PB 4X8UH 5J4SA 3U9AH 1TPSA 1EPTC 3PV4A 4LZ1H 1ZZZA 1GI3A 3MWIU 1SGFA 2BY6X 1VGCB 1O3IA 2FOCA 1QNJA 2ZDVH 3SNAA 1W10U 2ZDMA 1OYTH 2DE8A 1HV7A 1IQGA 4RKJB 5DG6A 3PO1C 3RMLH 4H4FA 4MNXA 3RM0H 1SGTA 4JMYA 1K21H 5JB8S 1V2PT 2A7CA 3A7ZA 2C93B 3D62A 1OPHB 1TNKA 2PLXA 2ZI2H 1NRNH 3O8CA 1E35B 4FUEA 1C5TA 2ZDLA 1NS3A 2G55A 4UFGH 2BY7X 4X1RU 2HPQH 1C4U2 5E0GA 3STIA 4FVBA 1DWEH 1DDJA 1Q31A 3GCTG 2DE9A 1BMMH 3RXFA 1J14A 1BMAA 3GY3A 1VCWA 4TYDA 2ZNKH 1OWIA 5JBTA 5FPTA 1EOJA 5FCRA 1AZZA 1SFQB 1ANDA 1WTHD 4UONA 2G4UA 4NCYA 2BX3A 4A7IB 3HKJB 2VVCA 3BTEE 3P17H 3K6ZA 3VB5A 5ESBA 5GDSH 1W13U 2TGTA 5LPRA 2VGCC 2NU4E 1JIRA 1TGBA 2RDLA 3ZV9A 2O8UA 3F9HA 1EQ9A 3GY2A 2WINI 2B5TB 2Z9IA 1BUIA 1AWHB 1MTNB 1UTPA 4YT6H 1S6FA 2FEQH 3ODDA 3MO9A 1NO9H 4MPXA 3BTFE 1NRRH 4X2YA 1VGCC 3A82A 3AVZA 1ZSLA 3QN7A 3ZVAA 1ETRH 1P0SH 1Y3UA 5HXFA 1AFQB 3M7UA 4BAHB 2D8WA 1GBMA 4OS7A 1F0UA 3MNCA 1P12E 4Y7AA 4HGCA 3T26A 1C2JA 3S7HB 4FU9A 1YC0A 4FUFA 1XXFA 4XDEA 4OGXA 3PB1E 1FY1A 3M35A 2GP9B 1VR1H 3RXHA 1C5MD 2QY0B 4ZHAA 4O03A 3MU8A 3ZVGA 1CHOF 1HIAA 1YPGH 1ZGVA 3LU9B 2FOFA 3ZVDA 4CH8B 1YM0A 2H9EH 1C1MA 3RXEA 1P9SA 1SGQE 1YPLH 1HAOH 2A32A 4CHAC 4LXBH 3LOXA 4CRCA 5A0BA 5H4IB 3QZQA 5C1XA 2AIQA 3MFJA 1MH0A 1FDPA 1MBMA 1V2UT 2V6NA 4XBDA 3F9EA 3GY5A 1SGPE 1YKTA 1DLKB 2BVRH 1MTNC 4X2VA 2IOTA 3TLOA 3VB3A 2UWOA 3RXKA 1ABJH 4OS4A 1P9UA 1GBTA 4B75A 1QCPA 4YTAA 4OS6A 4D7GA 1V2JT 4ABHA 2QAAA 4Y76A 1M9UA 4AG2A 3CS0A 3NUMA 4IMQA 2FS9A 1TGCA 2F9BH 4WWYA 4X1QU 1KLIH 1BDAA 2ULLA 1BRUP 2BXTH 1S81A 3JZ1B 1L4DA 1LKBA 1O3CA 4OS1A 2FLBH 3UQVA 1DPOA 3NZIA 1H1BA 1E38B 2EI7A 3RLYH 2R9PA 4ESTE 1ID5H 5DP4A 3T28A 5AF9H 2P95A 4O3TA 4FUJA 1V2LT 3TK5A 1ELBA 2UUJB 2C4FH 3PLPA 5AHGH 3KEEA 2IPHA 1V2RT 1N6XA 2BDGA 1GBKA 1C1SA 3FZZA 4Y0ZE 2ZCHP 1VITH 3PTBA 2QCYA 4MNYA 2FS8A 5GWZA 8ESTE 1QL9A 4KGAA 5EPNA 3F1SB 3UR9A 1Q3XA 3LH3A 2ODQA 1BIOA 2FOGA 4FXGH 4JZEH 3VB4A 1UCYH 1ZMJA 4SGBE 1GBCA 2A45B 2UUKB 4J1YA 1MQ5A 1A1RA 1O3FA 4ABDA 1QL8A 1YPJH 1GI1A 1F92A 3RU4E 1FY5A 1BTXA 1KYNA 1QURH 1T4VH 1V2NT 4H6TA 4NSYA 3A8CA 2A1DB 3VPKA 3SGBE 3F6UH 5L6NH 1F0RA 2O9QA 2OC1A 2VIQA 3H7TA 4XBCA 3O8RA 3ZZ5A 4AGJA 4GUXA 1SLUB 1HAVA 1J8AA 4TWWA 1DLEA 2ZFPH 1SVPA 2F91A 1NRPH 1C9TA 5DKMA 1UK3A 1A5IA 1F0SA 1IQMA 4O3UA 2B0FA 4X1SU 1QQUA 2WPMS 3GDSA 5BRRE 1PPZA 1GG6C 1MKXK 1IHSH 4YO9A 1C4Y2 4LOYH 1O3BA 2HPPH 2G5NA 4GSOA 3T5FH 5F8TA 3OY6U 1V3XA 4DIIH 3M61U 5ESTE 1HJAB 1LHFH 2BXUH 2VVVA 2TGAA 2QN5T 2FXRA 1O3JA 2B8OH 1GI0A 2FO9A 4GCHG 5F8ZA 2SGDE 5HGGA 2W3KA 1H8DH 1Y5BT 2F9NA 2W26A 5E2OA 3E90B 4GPGA 2Z9KA 2C8XB 1QTFA 5GIBA 3U69H 3TGJE 1TQ7B 2R2MB 5FX6A 1OWJA 3MU4A 1AVGH 1L1NA 1NU7B 2V3OH 1NZQH 3B9FH 1GHXH 1JOUB 2XCNA 5A0AE 2WV5A 3EGKH 1GJBB 3VB7A 1DY9A 3VEQB 4X8VH 1O5BB 1MQ6A 3VFEA 1O2ZA 1CHOG 1PQ8A 1ORFA 3A86A 1SQTA 4THNH 3TVJB 1Y59T 1IQIA 2Y5HA 1WYKA 1GL1A 1UK4A 3GOVB 3KQBA 1O3NA 3FP8E 1HAVB 3SJKA 4D76A 5LGOA 1LQDB 1BA8B 4Q7ZA 1E36B 4R8TB 3U1IB 1C5ZB 1F0TA 4I8HA 4B73A 1MKWH 1TGSZ 5GPIB 2A7HA 2XTTB 1AFEH 2ZP0H 1LHEH 3GICB 2P8OB 1K28D 3M5OA 1O2NA 3TH4H 1TMUH 1CT0E 4XE4A 2J34A 1GJ8B 5E8EH 1O2PA 2UUYA 3SI3H 1TX7A 1QB6A 3H5CB 1J15A 1BRBE 3A7TA 4K60A 4NIVA 4NWLA 5A09A 2UWPA 2SGFE 3TNSA 4CREA 5A2MH 5T6DA 5HMAA 1TOCB 2ZFQH 1FV9A 1SQOA 3FAOA 1CE5A 4MVNA 2Y6TA 3MH6A 2BD2A 6CHAC 2A0QB 3BTHE 3BTWE 1KDQA 1MBQA 1EUFA 2ZU1A 3MMGA 2Z6BD 2AYWA 1UTOA 1NESE 3KN2A 2BY9X 4J2YB 2PTCE 3M7QA 4AOQA 1FY8E 2GZ9A 2GGVB 3ZZ4A 2BQ6B 2GZ8A 3B8JA 4Y71A 1D3QB 3NXPA 1JIMA 1F5KU 1P10A 2GVFA 2PUXB 2UUFB 3SV2H 5HM2A 2W7SA 1N8OB 1THPB 3RXGA 3KQDA 2ALPA 1AB9B 1DICA 1GMCF 1C2IA 1GJ5H 4BAMB 2G51A 2GD4B 4AFZA 3RP2A 1EATA 5FAHA 1RXPA 1MAYA 3EA8A 5EXLA 3DD2H 3VXEH 4NA9H 4DCDA 3R0FA 4MG3A 4HTCH 1V2ST 2GDEH 3CS7A 5EPYA 4YT7H 2GTBA 5DP5A 2GZ7A 3ZZ8A 5L2YH 2ZGCA 5T3HA 8KME2 1AUJA 1C1QA 1Z6JH 2I6SA 4GAWA 1EJNA 2JKHA 4CRBA 1CGHA 3QLPH 3RXLA 4FUGA 3OX7U 1SQAA 1YLDA 4MPWA 1FPCH 2FI4E 2Z7FE 1HB0B 1K1MA 2HNTC 3MO3A 4MLFB 1NFXA 2ZU5A 2XCFA 3BEFB 1UTMA 1EZSC 4UE7H 3SBKA 4NIWA 3UWIA 2SFAA 2ZQ1A 2SNWA 2TBSA 2GMTB 1GL0E 5GXPA 2HNTF 2G8TA 1AUTC 1TBZH 3BTTE 2Y7XA 3UNRA 2STAE 3Q76A 3A84A 1HJ9A 2QC2A 3RU4D 3DA9B 3LT3A 1TX8A 2G00A 3AAUA 1N8OC 2XWAA 4NZLA 4ABJA 4H6SB 1GMDG 1GCTC 1FONA 1AB9C 1O3KA 5DP3A 1C5LH 1O2YA 4A5TS 4Y10E 1T8MA 2ZC9H 4O97A 5A8ZA 3Q3KA 3PWBA 1FIZA 1TRMA 3ATIA 3UNSA 1TMBH 3UUZA 1C4V2 2BB4A 3SQHE 3SO3A 1IQFA 3SZNA 3N7OA 3RXJA 4ASHA 1X7AC 3A8DA 3CP7A 1O2KA 1T32A 1ZTLA 1A5HA 2BOHB 1DFPA 2ZPSA 3ZVCA 4TPYA 1C2GA 1A2CH 2HVXA 2ZHQH 5HM9A 1K1NA 3P8FA 3SUGA 1OKXA 1TNGA 1D9IA 3MYWA 2ZCKP 3QO6A 1Z71A 2H2ZA 2Q6FA 1ZSKA 3LPRA 4FUCA 2VWLA 2A5KA 3UPEA 2CGAA 2QA9E 4WMFA 3C27B 3GCOA 3BEIB 2BLWA 3KF2A 4U01A 1CHGA 1ZJDA 3RM2H 3V12A 2PKSC 1S0RA 1O2VA 2ESTE 4KP0A 2TGPZ 1GHVH 1L1GA 1RRKA 2PTNA 2R0KA 4B1TA 1W12U 1BTHH 2XXLA 1K2I1 1S83A 3BIUH 2YOLA 4X6MA 3SV8A 4VGCB 1UMAH 1C2EA 4HZHA 3A7YA 1AY6H 4UFDH 1KXFA 1C2MA 4Q2KA 1NRQH 1IOEA 1MAXA 2ZG0H 1ACBE 2WYJA 1S82A 4YOJA 3E16B 1SGNE 4X1PU 1HRTH 4ABGA 1AIXH 1T31A 3RXTA 3NKKA 2VWMA 1C5SA 2OBQA 1EAXA 1LMWB 1PJPA 1C2DA 5TCCA 2AS9A 4IN2A 4ISHH 3B23B 1LDTT 2ANWA 3URDA 3BG8A 3MHWU 3QGNB 1SI5H 1XXDA 4MNWA 2CF8H 2BVXH 4WXIA 2J9NA 4Y8YA 4Y8ZA 1AGJA 3T29A 1GMHF 4XSKU 2BDBA 2VIOA 3UQOA 2BDIA 1ELAA 3SI4H 2GV6A 1DUEA 1TMTH 3RUOA 2AGGX 4MNVA 1OXGA 1XUGA 2HOBA 3Q77A 3RU4T 1A0LA 1YPMH 3A83A 2CF9H 1T8NA 1O5DH 2R0LA 2GCHG 2BLOA 1YCPK 2ZHFH 1TOMH 3ATKA 5EW2H 1JWTA 1GMCG 1HAHH 1Y3WA 1AE5A 4VGCC 1EB1H 4ZKOU 3UNQA 4QT8C 2RA3A 1AWFH 3RC5A 1BTUA 1F5LA 5GCHF 5FBIA 1IAUA 4CRAA 1TIOA 5L30H 1O2TA 1AI8H 4DIHH 1A7SA 3UOPA 3HATH 1CGJE 1DM4B 4BANB 1HAGE 4MQAA 1MKXH 1Z8GA 2FTLE 2PW8H 2VIWA 1HPGA 2OLGA 4JYVH 1KXEA 2F83A 1OX1A 2FMJA 2CMYA 2Y5FA 3RXUA 2R3UA 3SJOA 3MH5A 1UVUH 4GVUA 1EP5A 3BF6H 4ZH8A 4ZROA 4TY6A 4WJG2 3SV9A 4PROA 1AU8A 1DWCH 1O39A 3SU6A 5FPSA 3TH3H 1BTPA 2P3TB 4ZAEA 1KY9A 1C2HA 5I25A 2SNVA 1ANEA 1Z7KA 3A7VA 3KCGH 2QGRA 2NU0E 3UWJH 1S6HA 1AKSA 1S5SA 2R2WU 2Z9GA 2AERH 1GHAF 1MTWA 4AGKA 1AVXA 2BHGA 1GBJA 3HPTB 2ZHDA 1FN8A 2WPLS 1FQ3A 1W2KH 1KIGH 5EODA 2G81E 4ABAA 1C9PA 1UO6A 1P2KA 3TGIE 3SOSA 1A5GH 3PLKA 4WMEA 1K1PA 1ZLRA 2ODYB 2NWNA 1PQ5A 4AORA 2WPIS 2O8TA 3QWCH 3LC5A 1GGDB 2ZDNA 4IGDA 4JZ1A 1GHBG 3KNXA 2BD4A 3FP6E 3ZZBA 1FY3A 1BTWA 1LPZB 4NSVA 2ZGHA 3TIUA 5SGAE 2P59A 1LVMA 3NK8A 2ZDKA 1UTQA 1L2EA 5EXMA 3SGQE 1QBNA 3P95A 3STJA 1O3OA 1BRCE 3L6PA 3RXMA 4LZ4B 3RC4A 1CT2E 1SSXA 1XVMA 3U98H 2AMQA 1Y8TA 3GY7A 3MTYA 4B2BA 3F68H 2PSXA 1N1LA 5E2PA 2BTCE 2V0BA 1AFQC 1DOJA 1G32B 1QJ1B 1ELEE 3PLBA 3UY9A 1C5OH 1YBWA 4K1EA 3M5MA 1F2SE 4IC6A 1IQHA 2ANYA 4RSPA 1BOQA 2Z3CA 7KMEH 4ABFA 1HAIH 1GHWH 1GCDA 5AVDA 3ENSB 3UIRA 5L2ZH 1P01A 1P2NA 1LVYA 4TPIZ 4CBOA 1EZXC 3RMMH 1Z6EA 1RGQA 1AKSB 1EAIA 3E3TA 3M3SA 4F49A 1W7XH 4TWYA 2ZEBA 1CA8B 1TGNA 1GGDC 1EZQA 3LKWA 3SNDA 3GY6A 1W3CA 1QJ6B 3HK3B 5J4QA 1P02A 2J94A 2ZFRH 3MNSA 4UFEH 2FOEA 3AW1A 4OS2A 1P11E 1AVWA 2HWLB 4OS5A 4ABIA 1YPEH 2ZF0H 1BMNH 2FI5E 4TY7A 3RDZA 1RTKA 4DW2U 2PGQB 3OYPA 1HIAB 1QB9A 1P3EA 1S85A 4ABEA 2ZPQA 1O0DH 1WAYB 2A4GA 2SGEE 3RXAA 1PQ7A 3M3TA 4K1SA 1MU8B 3UOUA 1G2MA 1ZHPA 4CR5A 2PGBB 3ZZ9A 2VIDA 1EZUC 1DE7H 2QYIA 1O30A 1TWXB 1GMHG 1GJ7B 1NFWA 2PWXA 1LCYA 3ZZCA 4WF8A 2FYQA 3C1KA 1QR3E 4ZKRU 2DUCA 1T7CA 3VB6A 1C1VH 3TH2H 4RN6A 2OQ5A 3IWMA 1SGDE 2C8ZB 1W0YH 2GV7A 4BAOB 2P3UB 3SU3A 4UDWH 4I8KA 5BPEA 3KQCA 2A2QH 1WUNH 4K8BA 3WY8A 1A0JA 1BBRK 4Y6DA 1GDUA 1SGRE 1GBEA 5FBEA 3SJIA 1DSTA 3K65B 5GCHG 1FN6A 3DFLA 1XMNB 1SHYA 4Q7YA 1GI4A 1J9CH 1C1NA 1H9LB 2BDAA 2Z3EA 2SGAA 3ZVBA 3TK6A 1QA7A 1K1LA 1MU6B 1NC6A 2V3HH 4JCNA 1ELTA 3LC3A 3A88A 1ZMLA 3DT0H 3T27A 1P3CA 2ZPRA 1ARCA 3URCA 4X2WA 2FTMA 2A5AA 2ZKSA 1OP0A 1MMJN 1YGCH 1TNJA 3E91A