4MPVA

Human beta-tryptase co-crystal structure with (2r,4s)-n,n'-bis[3-({4-[3-(aminomethyl)phenyl]piperidin-1-yl}carbonyl)phenyl]-4-hydroxy-2-(2-hydroxypropan-2-yl)-5,5-dimethyl-1,3-dioxolane-2,4-dicarboxamide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
total genus 55
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpvA01
1GDUA 3PM3A 1PJPA 1SQOA 4GAWA 3TK5A 2V0BA 3EA7A 2Z9LA 1SOTA 2QGRA 1TGTA 1EZXC 1NS3A 1J17T 1TX7A 4I8HA 2AERH 2PSXA 1WAYB 1OWKA 4JYUH 4LZ4B 3SW2B 1XVOA 1RTFB 1O2PA 5EQQA 4GPGA 1MH0A 3TITA 2BXTH 1TNKA 2W7SA 5A0CA 2BY9X 2G4TA 1NROH 1UK4A 2OC1A 2FOAA 2ZTXA 4DT7B 1TAWA 1C1VH 4Y10E 1C2IA 3D65E 1DLEA 1IHSH 1K22H 2G52A 1EPTA 1G32B 3GCTF 2SGAA 4XBBA 2BZAA 2A5AA 3T25A 4IMQA 3UPEA 3ATKA 2OC0A 2PR3A 3A83A 4WH6A 1SG8B 2ZFSA 5FXLA 1HYLA 1G36A 2SGEE 3NPSA 3OY5U 1U6QA 1ZZZA 1K1PA 3LH1A 1AE8H 3BEIB 3V3MA 2O8TA 2ZTYA 1P2KA 4IMZA 2HNTE 3MNCA 1DY9A 4HTCH 1S85A 1HAPH 4FU8A 4AX9H 1ELAA 3RMLH 4XE4A 2EI8A 3MNXA 5JDUB 4OGYA 2C8WB 1OS8A 1H9IE 3ZZ4A 1O3CA 2G8TA 3VXFH 4TY7A 1YPHE 3SJIA 4B1TA 2XRCA 3EAJA 3MH6A 1GJ5H 1HAGE 4D9QA 1TPOA 1QURH 1ETSH 1V2UT 3SU4A 2P93A 1YPJH 2Z9KA 3ZZ3A 3S9BA 2J2UA 2A7CA 1Z6EA 2FESH 4O97A 3TH2H 4BXSA 1SGCA 5DP6A 2ZF0H 1TBZH 3ZZAA 1O2RA 1ZMLA 1O5BB 2VVCA 1INCA 1AVWA 1B5GH 1GGDC 2H6MA 2Q6FA 3E3TA 3BTQE 2PKSC 2BX3A 3SUEA 2BD7A 1W8BH 1V2PT 2IPHA 1DLKB 1A1RA 1GG6B 2DE9A 2Y81A 1JOUB 1VCWA 2Q6GA 2ODQA 3F68H 1WOFA 2ZPSA 1O5GH 1FIWA 2AH4X 3GCOA 3SJOA 2A4RA 3M61U 3TVJB 5A09A 2NU4E 3PB1E 4B71A 3CP7A 3GISB 4IN2A 2HPPH 1IQMA 2P8OB 4NZLA 4BAHB 1C5YB 4NIVA 2ZFFH 4AORA 4BXWA 3RDZA 4I8LA 4YO9A 5DP4A 2CHAC 1VITG 2ANWA 4PROA 4ISHH 4KTCA 1B0FA 1LVBA 1GJ6A 1J8AA 1VGCC 3E0PB 3RXOA 2ZP0H 4GUXA 2GP9B 2GD4B 2Y7ZA 4XSKU 5C67A 4IS5A 1T4UH 3AASA 1YC0A 3SNBA 3SV8A 1MAXA 1MD8A 1KTTB 4DVAU 3F9EA 1K1LA 1Q2WA 3BEUA 5C1XA 1TGCA 4JYTA 1Y8TA 1ZR0A 3H7OA 3Q3KA 4GCHF 1HXEH 2R3YA 3P17H 3RXKA 4B75A 3ZZ5A 2BY7X 1BUIA 2Z7FE 1J9CH 1WTHD 4TYDA 4K8YA 4Y8YA 2BDYA 3SNAA 3TK9A 1YPGH 1LPGB 1IQKA 3ZV8A 1IQJA 3HGNA 5DP7A 1GHWH 3GCTG 5HXFA 3JZ2B 1T8NA 1O5CB 1UVSH 2BQ7B 5ESBA 2ZDKA 1AD8H 3F9GA 3OX7U 3QX5H 1CQQA 1S6HA 3SI4H 3STIA 1TA6A 4WMEA 1PPEE 2BY6X 4NWLA 5C1YA 5LH8A 4KTUA 2A4QA 2CXVA 1OYQA 2XNIA 1NC6A 2J92A 2Z3EA 1NU7B 4I7YH 1TE0A 1NT1A 2LPRA 1AE5A 1Y5BT 1DT2A 1EJMA 3GDVA 1EB1H 1KLIH 4TPIZ 5I25A 3TJNA 4F49A 1O3OA 1A0JA 2YOLA 3SQHE 4D7FA 1AZZA 2VVVA 2SGQE 3TH3H 4A1XA 3RXSA 1UTNA 3U69H 4X6NA 9LPRA 1UTPA 2ALPA 1BRUP 2BVXH 1GJAB 1ZJKA 2QCYA 5DP3A 5GWZA 3RU4D 1AVGH 1A5HA 1V2JT 2RDLA 1A7SA 2IN2A 3UQVA 1G3EA 2VIPA 4ZROA 3RXFA 1BZXE 4TY6A 3FANA 2J9NA 2Y5HA 2FLRH 4ZXYH 2FS8A 1GMDF 1BTZA 3E6PH 3P8GA 4WH8A 1F5KU 1O38A 1HJ8A 4X8SH 2A45B 4K60A 2ZGXH 3NUMA 4MVNA 1GDQA 1SGNE 4X1SU 1EQ9A 3M3TA 1XKAC 3PWBA 3MOCA 1AUTC 2WUBA 1P3CA 1QFKH 4XDEA 1O5AB 1FMGA 2BDAA 3NK8A 4LK4A 1TWXB 3P6ZB 2ZZUH 1E0FD 1GVKB 2FS9A 3SO3A 3DD2H 1D3TB 1DICA 2XBWA 1SB1H 2ZA5A 4XFQA 1AU8A 1DSUA 1A61H 2OD3B 3S69A 2FP7B 4WMDA 1GBEA 1ZJDA 3T62A 2FI5E 1EJAA 3OSYA 1V2ST 3SHAH 4D9RA 2BVRH 1ZRBA 1B7XB 4Q2KA 1UTKA 5FPYA 1IQGA 1DX5M 5A8XA 3UR9A 1EP5A 1TBQH 3VEQB 1HV7A 2D2DA 2BDCA 2C8YB 3U1JB 1P06A 4Y7BA 1ZPBA 5C3NA 3TLOA 5EPNA 2QXJA 1LHFH 3RXBA 1EXFA 2J34A 5C20A 3T27A 5C5NA 2B7DH 2HVXA 5JBTA 5LPFA 1K1IA 4IC6A 1DXPA 3MNBA 4YOJA 2GX4A 3A84A 4CBNA 1NO9H 1O3FA 2ZECA 4E7RG 3I77A 2F9VA 4F4OC 4FUCA 1W14U 2A7HA 2XBXA 2CHAB 1O33A 1YPMH 3LIWA 3VGCB 1L4ZA 1P2IA 1OSSA 5LGOA 3HATH 1YCPK 2ANKH 3HK3B 4SGAE 5BRRE 1C5NH 4X0WU 5A0AE 1ZLRA 1ZTLA 3RXIA 1AGJA 2TGAA 1O2LA 3PMHB 3ATWA 5FX6A 3RXAA 4Z6AH 1N8OB 5DGJA 5FPTA 1QRZA 1HXFH 2GCHF 3I78A 1O2JA 4MNXA 4AYVB 4H6TA 2Z3CA 5A0BA 3U98H 1FXYA 4WXVA 3MO3A 6GCHF 2ZCKP 2CGAA 1DOJA 2ZHEH 1C5WB 3KQDA 3A8AA 3UNRA 4WY3A 1QBOA 3QGNB 1PQ8A 1VCQA 2CF8H 1QJ1B 3KNXA 4BOHA 1SI5H 4U30A 1IQFA 1TABE 5E2OA 2BLQA 1BT7A 5GIBA 4FUDA 1GMDG 1BCUH 2BD4A 4KKDA 2FZZA 3ZVDA 2QV1A 4JMYA 5T6FA 5TCAA 2FMJA 1GL1A 3ODDA 1HFDA 1KXBA 4Y0ZE 5AVDA 1HJAC 2AGGX 1H8DH 2A7JA 4X2WA 4ZKSU 1C2GA 1TA2A 2DUCA 1HAHH 5J4SA 3BIVH 4ISIH 2BX4A 2CN0H 3A8CA 3RUOA 2AMPA 3HKJB 3BIUH 1TGSZ 1W11U 1SGPE 1T8OA 3GDUA 2WYGA 4AOQA 1MBQA 4DY7B 1ANCA 4X6MA 2FLBH 1JRTA 3RMNH 4NA9H 3BTWE 2ZU4A 5AFYH 4ZHAA 3T29A 2FOEA 1E37B 4YESB 1MCVA 3UQOA 5H4IB 1XXFA 2BOKA 1C5TA 2ODYB 2JH0D 4OS7A 3PLBA 4RSPA 3QDZB 3O8BA 4J2YB 1C5RA 3QGJA 2VWNA 1O2UA 1HUTH 2GGVB 2WPKS 3RXJA 4CH8B 3TPIZ 1RD3B 1Z8GA 2F91A 3MTYA 2BZ6H 4U32A 1C5PA 1GG6C 1YGCH 1THRH 1AY6H 1QGFA 2ODPA 5EU8A 3ZZ6A 2ZU2A 1Y3YA 1P01A 3ATIA 4ZKNU 1GMHF 2Z6BD 2FEQH 1TX8A 1YPKH 3QTOH 5EXMA 1CA0C 1HCGA 2P8OC 4KELA 2EA3A 5F03A 4WMFA 2WPJS 3SU5A 5ABWA 4NGAH 2ZDAH 5IYTA 5SGAE 1E35B 1BMLA 4Y79A 4TWYA 2XBVA 1Y3XA 3QN7A 8ESTE 3E91A 1GBDA 2P3FH 2Y5FA 1ESBA 4AB9A 5AFZH 3MYWA 1GJBB 1O2KA 2PTNA 1YPEH 1BB0B 3V7TA 1LMWB 4UD9H 5ESTE 3BTHE 3UWIA 5AF9H 2ZI2H 3RM2H 3SJKA 2VVUA 1O2SA 1O2ZA 1V2LT 2O8LA 3K6YA 5DPAA 3S9AA 1AMHA 3DA9B 3LC5A 4K3JA 2VIDA 2GCHG 3A7TA 4ABHA 2BLVA 2QA9E 1CSOE 3E0NB 1ABIH 3MO6A 4X8VH 1TNLA 1GI6A 1TLDA 1K1JA 1GPZA 1CHOF 1QRWA 1BMNH 2ZGBH 3K9XB 1TRYA 2G51A 3MH4A 2SGPE 4DIIH 4I8GA 1UCYK 1DE7H 1P02A 1QB1A 1BTPA 1P2QA 1ZPCA 1UO6A 1XM1A 1BIOA 1WU1A 1SGDE 1CGJE 2FTMA 1GI7B 5TJXA 2BD5A 2D1JA 2ZGJA 1O5FH 1OWDA 1HRTH 4SGBE 5JPMH 3HGPA 2RG3A 4UFEH 1DWDH 1K9OE 1BHXF 1W12U 2BY5X 1L0ZA 3DFLA 3ZZ9A 1NU9A 1OX1A 4ABIA 2ZCLP 2J94A 3LGWA 4YZUA 2K1QA 1MQ6A 3F1SB 3OTJE 1P2OA 1V2QT 4ABAA 3S7KB 4Y11E 3FP8E 1LHDH 1O36A 3P70B 3SHCH 2ZPRA 1K1MA 1JMOH 1DXWA 1KXCA 2PKAB 1Y5UT 1TMBH 1LHEH 5C2ZA 2ZO3H 5E0JA 2ZDMA 4K5ZA 2G5VA 3LC3A 3MWIU 3W94A 3FZDA 3SNDA 3PMAB 1QNJA 1HAIH 1S83A 4Y0YE 1WTGH 1EATA 1MAYA 1IQHA 4K1SA 4UFFH 4E05H 3ZZ8A 4TWWA 4CHAC 3SNEA 3PLKA 3PYHA 1SLXB 1Z71A 4JZFH 2R0KA 1UMAH 2G81E 3ATMA 1EZQA 4NIXA 4OGXA 5DK1A 1TIOA 4OS1A 1EAWA 1ESTA 3QZQA 2XWBI 1T8MA 1O35A 1GHVH 2Y7XA 4OS2A 1HAZB 1O39A 2NU0E 1GCTC 1BBRH 1QA7A 1E38B 1HJAB 3ELAH 1C5LH 4ZHMU 4DURA 2GZ8A 1O3BA 2BQWB 1F7ZA 1BTXA 3Q00A 3SZNA 3JZ1B 1PPHE 5EG4A 1BOQA 1FZZA 5C5OA 2ZQ2A 1KY9A 1OWEA 5LPEA 1EX3A 2XTTB 2ILNA 2G4UA 2XBYA 3L33A 1ORFA 2ZEBA 1KIGH 4HFPB 2GCTB 3BSQA 5A8ZA 3VFEA 3SJ8A 2R2WU 3SV6A 4ABEA 4Y6DA 3GICB 3UFAA 5E0HA 4B74A 2ESTE 1AVXA 1FY5A 5I46H 4ABBA 3H7TA 1G30B 3KL6A 2C8ZB 1C4U2 2ANYA 2PKAA 1O5DH 1HDTH 1ZTJA 1PPZA 4X6PA 3SV2H 3BG8A 1MKXK 3M5LA 2EI6A 1TPAE 1T4VH 2QAAA 2A2XH 3UOPA 1CHOG 3DT0H 3RXDA 1HJ9A 2OTVA 4K2YA 4BTUB 1CA0B 2H5DA 4AG1A 3BTDE 1H4WA 4X8TH 5FCKA 2GT8A 3DFJA 3ATLA 4OS6A 5E8EH 3Q77A 4XOJA 3VGCC 3L3TA 2SNWA 5EQRA 2JETC 1H9HE 4IBLH 4YLUA 2HGTH 2WV4A 1MCTA 2M5TA 3RXHA 5DO4H 3QO6A 1FPCH 1RTKA 1K2I1 4UFDH 4ESTE 1LPKB 4AFSA 4R0IA 1H1BA 1EZSC 1N8OC 4ISNA 3SGQE 1LKBA 4HZHA 4WWYA 1H9LB 2BQ6B 3FP7E 3MH5A 3M36A 3M35A 2VH6A 1Z6JH 1XUJA 2JH6D 5K7RA 1LKAA 2H9EH 2VGCC 1FONA 2XCFA 2Z9IA 4MDSA 1A3BH 1ELEE 2KAIB 2Y82A 1UTQA 3M5MA 2QF0A 3M7QA 2STAE 2ZHQH 2W7UA 3VB3A 3M5OA 3BG4C 1TRNA 5JBAS 1C1WH 5A2MH 3IWMA 1DVAH 1EJNA 1LQEA 1O2XA 1P11E 1HNEE 1QY6A 5JB9S 1P04A 1O37A 1K28D 2TPIZ 2FM2A 1GL0E 1GJ9B 1QBVH 4QT8C 2F9PA 4DJZB 5J4QA 1O3NA 3TJUA 1AO5A 1GBJA 1C1MA 3BEFB 3NWUA 1SOZA 2OINA 3BTME 4ASHA 2STBE 2W3KA 1UVOA 1QJ7B 4CREA 1BBRK 1A0HB 3IG6B 1B0EA 2HNTC 4A6LA 1RXPA 1YCPH 2FOCA 2BLOA 3M37A 5GXPA 2ZHDA 1OP0A 3ZZ7A 4D8NA 3SU3A 1GVZA 2AYWA 4FUBA 5F8ZA 3O8RA 2Y5GA 1SFQB 1C1RA 1NTPA 2Q6DA 1D3PB 1NRRH 1YPHC 1GJ8B 4CBOA 2O8WA 3RXUA 2QYIA 3KIDU 1GVLA 1D9IA 1NY22 3TJVA 3RM0H 1JWTA 1AFEH 1C1UH 1VJ9U 1ZSKA 2F83A 3ENSB 4AN7A 1L1JA 1C1QA 1MTNB 4CRDA 4E06H 1BTHH 2FOBA 4A5TS 3DHKH 4ZKRU 2BTCE 1OXGA 2A4OA 1Y3WA 1D4PB 1C5VA 1ARCA 3AVZA 4XBDA 4CHAB 2G5NA 2BVSH 2PFEA 4UONA 4VGCB 1F2SE 1KXFA 1Z1JA 1NZQH 1G3CA 4ZAEA 3T26A 7KMEH 1D6RA 3VPKA 3LT3A 1JBUH 4CR5A 4Y8ZA 1XUHA 3P8FA 1E36B 2KAIA 3QK1A 3ODFA 3ZVEA 1D3DB 2B9LA 1V2VT 4R8TB 3MH7A 3EA8A 1GCTB 1A5GH 1W3CA 3MHWU 4Q7YA 3D49H 2QXGA 4A1TA 2H9TH 1AIXH 7LPRA 1MTUA 2ULLA 3RLWH 1C2MA 2OQ5A 1MTVA 1V2NT 3SUDA 5F8XA 2VWLA 5DP9A 2H9HA 1C5XB 3E90B 1RGQA 1SGFG 2BOHB 3CS0A 1O2YA 4H4FA 4BAOB 2Z9JA 1SC8U 3ZV9A 2FPZA 1OP8A 1RTLA 4INLA 1WQVH 4NG9H 1KLTA 2A31A 2F9OA 2ZFPH 3SQEE 2QIQA 1CT0E 1ZPZA 1FN6A 2VIOA 3B23B 3TK6A 3SJ9A 1V2KT 1TPSA 1G9IE 2TIOA 1EUFA 4X1NU 1EOJA 4A92A 1TMUH 7GCHF 1ZGIA 4O3UA 4GCHG 3A7VA 3L6PA 1BTUA 1N1LA 2H2ZA 3KEEA 3S0NA 1G37A 1W13U 2V3HH 4ABFA 4CH2B 1O2NA 2C93B 2W5EA 5GCHF 1EKBB 1GI1A 3P8NA 1TQ0B 1GBLA 2G00A 4Q7XA 4UE7H 2AGEX 2XC4A 2XC0A 2ZFTA 1ELDE 3SV9A 4K69A 1GHBF 1LVMA 1GI4A 1C9TA 1K1NA 2ZGHA 2JETB 2J4IA 1F0UA 3PMBB 2SNVA 2PGQB 3PV4A 4YOIA 2C4FH 1SLUB 2ZPQA 2XWAA 1QL9A 8GCHF 3RMOH 1MZAA 1C1OA 1FPHH 3SNCA 2P3UB 3UR6A 1FAXA 1V2OT 4BAQB 5JB8S 1PQ7A 3PLPA 1FY4A 1MTSA 4FUIA 5EW2H 1VR1H 1QL8A 1BMMH 1HAXB 1OYTH 2THFB 3KGPA 2VGCB 4FUFA 3RC5A 2VJ1A 1KLJH 8KME2 1A46H 2GV6A 3RP2A 2XXLA 2Z3DA 1BRAA 2Q1JA 1O3KA 1VITH 3BG4B 3MI4A 3GDSA 2F9UA 1CU1A 4IW4E 1YP9A 1GBAA 2ZU5A 1S84A 3P92A 4UDWH 1C2EA 2HLCA 1UCYH 1THPB 1CGHA 3UY9A 3URDA 3QZRA 4LZ1H 1AHTH 4FU7A 3CS7A 3TGIE 1RJXB 1JIRA 1XX9A 4FUHA 2QXIA 5B6OA 1FV9A 5FPSA 1O2OA 1P9SA 1S6FA 1X7AC 2Z9GA 2OP9A 1SPJA 4D76A 1ZOMA 1PYTD 2ALVA 2H1UA 4B73A 2VH0A 1O0DH 3MU5A 3A89A 1LVOA 2TRMA 3LGTA 2GTBA 2F3CE 2VB0A 4AFZA 1G3DA 3FFGA 4FUGA 4O03A 1AQ7A 1W10U 5L2ZH 1MU8B 1DWEH 1SL3A 3ZVAA 1EB2A 1O3EA 1TB6H 2NU1E 1O3AA 1DS2E 3AAUA 1GHAF 4JK5A 2BDBA 2WV5A 2VWOA 1F0RA 1BRCE 4JZIA 4X1QU 1BJUA 4NA8A 2GCTC 3E8LA 2D8WA 1SLVB 4Y71A 1SQAA 2J38A 4CRFA 4FVDA 5DKMA 4I32A 3GCHC 1FY3A 2A32A 5EGMA 1TX6A 2B8OH 3GYMA 2QY0B 3A86A 1SMFE 4OS5A 2A5KA 5BPEA 3UOUA 2P95A 4JZDH 1SHHB 1NRNH 1GI0A 3SU2A 3FVFB 7ESTE 2EEKA 1TFXA 1A5IA 1QRXA 3A82A 2BYAX 3K65B 1GI2A 7GCHG 1AN1E 4ABJA 4CRGA 1QTFA 5EODA 5HMAA 4YLQH 1DM4B 4ZMAH 5L30H 1WYKA 2A0QB 2A5IA 2C3SA 1BDAA 2ZWLH 3A85A 3TGJE 4AYYB 2EC9H 2C8XB 4X1RU 3RXTA 1ZRKA 1FN8A 1AZ8A 1YKTA 1C5UA 2NWNA 1O32A 2HOBA 1ELBA 1Y3UA 1FAKH 1C9PA 3SU6A 1VZQH 1GHBG 2FO9A 1WCZA 4HI3A 1ETRH 2ZU3A 2VIWA 4AG2A 4BANB 3GOVB 3KCGH 1CVWH 1QB9A 1TNJA 2GKVE 1C4V2 2Y80A 3R3GB 3TH4H 3TIUA 1TQ7B 1P09A 3A8BA 1OWHA 2F9NA 2A1DB 2WUCA 2ZDNA 2TBSA 4AFUA 5E2PA 4I31A 1L1NA 2O8MA 1BTYA 1P57B 5CHAC 3GY3A 2FOFA 1DUEA 4NSVA 3SORA 1MKXH 1UJ1A 2QC2A 6GCHG 1SGFA 3LGVA 3KN2A 1GHZA 2AIPA 3IITA 1UTLM 1C2DA 2ZU1A 1GBCA 1ESAA 5FCRA 1C2KA 2QXHA 3RXMA 1GMCF 1Y59T 3BTKE 3KHVA 1ZSLA 2UUYA 3WY8A 2FIRH 3V0XA 1EAUA 1W0ZU 4IGDA 3EGKH 1A2CH 4B2AA 2V3OH 3MFJA 4MNVA 1BA8B 1XMNB 3H5CB 4ISLA 4MTBA 1PPBH 4IC5A 1WBGB 4INHA 1UVPA 3PTNA 3UUZA 1UVTH 1P10A 1C5SA 2PGBB 3EQ0H 3OYPA 5JYIA 1KYNA 3PTBA 1SBWA 4NZQA 1GHAG 1PYTC 4DGJA 1A3EH 1RFNA 1BQYA 1G3BA 1TRMA 1K21H 2XC5A 1MTNC 3U8TH 2FI4E 4FXGH 2Z94A 1C5ZB 3KF2A 1YLCA 3T5FH 1JRSA 1LTOA 1Z8IB 2BD8A 3A7ZA 4JK6A 4CR9A 4VGCC 3D62A 4Z0KA 1EP6A 2VIVA 3ITIA 3TGKE 1UVUH 1MD7A 3M3VA 3UWJH 3HKIB 1LDTT 1C2JA 4NWKA 1A0LA 1F5RA 1VCPA 1ZHMA 5IDKA 3C27B 1O3PB 3BF6H 4U2WA 5A8YA 1LQDB 1BITA 3SUGA 3MU1A 1FDPA 1GCDA 3FZZA 2P3TB 3BTTE 3ZZBA 4AGJA 4YT6H 2V6NA 1GMHG 1TNHA 2FODA 3A7WA 2GMTC 1ABJH 1ZTKA 2P16A 2VNTA 1O3JA 3RXGA 3D23A 2O9QA 2FYQA 2J95A 5T6GA 5EXNA 1ELFA 9ESTA 1MQ5A 1NRSH 2ZIQH 4H42U 1UTOA 5EOKA 4K8BA 1N6XA 1ELTA 4DIHH 3NKKA 2PLXA 4J1YA 2FI3E 1PPCE 3F6UH 2OC8A 2G55A 3K6ZA 1TNGA 1GWAA 4GSOA 1IQNA 1C5OH 1IQLA 3GCHB 2QN5T 4LXBH 5L2YH 1V2RT 1RIWB 4GHQA 4CRBA 1QJ6B 2YNBA 4Q80A 3AW1A 3ZZDA 1HAVB 1XUKA 3K2UA 3MU0A 4INKA 1GJ4H 1MTWA 2A2QH 3G01A 3OU0A 1L1GA 1GBFA 1BJVA 4O9VA 3NZIA 3LH3A 3BTEE 1UTMA 1THSH 1XKBC 4JYVH 5DJ7A 3KQBA 3N7OA 1YCPM 3GY5A 2GV7A 5F6MA 5FX5A 3PWCA 2VIQA 1GBKA 1GMCG 2PUXB 1DANH 2WYJA 4TPYA 1EOLA 1W7GH 1W2KH 2WPHS 2UUKB 1O2QA 2ZHFH 1C1PA 2W26A 4BAKB 2HNTF 3B8JA 1L2EA 1QCPA 3LU9B 1F5LA 3UREA 3LOXA 1GHYH 3RU4T 1BBRE 2ZCHP 4GLYA 1YM0A 3Q3XA 4IN1A 1SR5C 1ID5H 3W95A 1O2MA 2H5CA 3EA9A 1V2MT 1AB9C 2BDHA 1PFXC 2B5TB 3A8DA 4B2BA 2D26C 3TNTA 4NIWA 5CHAB 3ESTA 3U9AH 2P94A 1DUAA 5JBCS 1WQSA 3TU7H 1QIXB 1EAIA 1C5MD 4MPVA 3HK6B 4E7NA 2BB4A 2CV3A 3SGBE 4ZUHA 2OUAA 1FLEE 3PMJA 1YBWA 4RKJB 1P8VC 2UWOA 1IHTH 1O3GA 2FX6A 1P9UA 4D7GA 1LCYA 1Q31A 2VINA 2ZC9H 4JCNA 2FYRA 1J16A 3T28A 2FDAA 2VU8E 2IOTA 4ABGA 4MNYA 3M3SA 4FUEA 5AHGH 5GJ4B 4MPXA 1LO6A 1Y5AT 2GZ7A 4JZ1A 4GVUA 2TGDA 3SOSA 3SU0A 1HAVA 1T31A 4X8UH 5F8TA 3RC4A 3TJOA 1AFQC 2ZTZA 1P12E 1SVPA 1QQUA 3GYLB 4BTTB 2QF3A 2BHGA 2GDEH 1S81A 1P2NA 1PQ5A 2BXUH 4WF8A 4Q7ZA 2ASUB 3VB6A 1LPZB 3UNSA 1SGEE 3FP6E 2HPQH 2FX4A 3M7TA 2AMDA 1TOCB 3QLPH 4UFGH 1FNIA 1OWIA 1MKWH 1O30A 1Y3VA 1GBMA 2R0LA 1MBMA 1FUJA 1OP2A 2AFQB 1Z7KA 5LPRA 3LGIA 3RLYH 1DITH 1HBTH 1QBNA 1N6YA 1TOMH 1SHYA 2OBQA 1V3XA 3EDXB 2R3UA 3LJJA 3U1IB 2BDGA 1GBTA 1CE5A 2TGTA 3QUMP 1C1NA 1GBIA 3MU8A 3EYDA 3PO1C 1J15A 5CE1A 4MPWA 3SBKA 3VB4A 1ANBA 1CT2E 1BMAA 2ZDLA 3KQCA 2OQUA 3A7YA 4NA7A 4A1VA 1YPLH 2PHBA 6CHAC 1V2WT 1FIZA 3BTFE 3RU4E 1SFIA 2C90B 2GMTB 2ZKSA 1BHXB 1P2MA 4DCDA 1JIMA 1SQTA 2UWPA 2W3IA 3R0FA 2I6QA 1OPHB 3S9CA 2WPIS 3QWCH 5FAHA 2TGPZ 1F0SA 2FXRA 4ZH8A 1CT4E 2WINI 3VB5A 1HIAB 3NCLA 1ZGVA 1KDQB 6LPRA 2BM2A 1NFYA 2A4GA 1DPOA 1CA8B 3SN8A 1AKSB 1EZUC 4A7IB 5T6DA 1QA0A 1DWCH 3GCNA 2UUFB 2AS9A 1F92A 5C1UA 3PROA 1TYNA 3M7UA 4FUJA 2BMGB 2B0FA 1O3HA 1C2HA 1EPTC 2UWLA 1JXPA 5ETXA 3BTGE 4RN6A 3E1XB 3Q76A 5DP5A 1IAUA 1D6WA 2GDDA 2PTCE 4ZKOU 3LPRA 2GZ9A 1HAOH 3RXEA 1E34B 1SGQE 2PUQH 3LGYA 4O3TA 1QQ4A 4XBCA 4MQAA 5K0HA 1XUGA 1GHXH 5HGGA 3GY4A 3Q3YA 1CBWC 3RXRA 4KGAA 1IQIA 1SGYE 1TBRH 3S7HB 5DG6A 4AB8A 2HALA 1P05A 1G2LA 1AWHB 3FAOA 1KXAA 1O2VA 1ANDA 2I6SA 1K1OA 1GGDB 4X1PU 2WPMS 3C1KA 2PKSB 4BAMB 1C2LA 3LKWA 3RXVA 3RXCA 1AUJA 1O2TA 4RKOB 4X2YA 3O8CA 1SLWB 4FVBA 4I8JA 1O3IA 1TGNA 4KP0A 4OS4A 3GY2A 2ZFRH 1C5QA 4THNH 1DY8A 3GY6A 4K1EA 2FOGA 1XVMA 1UK3A 3SUFA 2WPLS 4YTAA 4GHTA 1OKXA 2ZDVH 3ZVBA 1IOEA 2CF9H 1GBBA 1ZSJA 2ZFQH 2HWLB 1MU6B 3V13A 1IQEA 3F9HA 1OOKB 4HGCA 1YYY1 4UEHH 2VWMA 4WXIA 4Y8XA 1P2JA 1NPMA 1HGTH 2FTLE 1DDJA 3BV9B 1VGCB 4Y76A 1EASA 3ZZCA 1MKWK 1PQAA 3AAVA 3ZYEA 3RXQA 1AI8H 1FY8E 1GJCB 4YM9A 1O2WA 4BTIB 1FY1A 4MG3A 3RXPA 5EW1H 3LDXH 1AB9B 3T2NA 4LOYH 3SU1A 3M5NA 2O8UA 1HIAA 5FBEA 2XW9A 1UHBB 1KDQA 3MU4A 3ZVGA 1Z8RA 3E16B 1AKSA 1T32A 3MMGA 4YOGA 1MZDA 2FWWA 1QB6A 3P95A 2ZNKH 3A80A 5DP8A 2RA3A 1C1SA 1V2TT 1D3QB 1TGBA 1KSNA 1KXDA 1S0QA 3URCA 5HM9A 1TNIA 5FBIA 1J14A 1GI8B 1W0YH 3O8DA 5T3HA 1S0RA 3ZYDA 2BD9A 1DSTA 1AWFH 1BRBE 3OY6U 1PPGE 1Q3XA 4B2CA 4ZXXH 4CRAA 2P59A 8LPRA 3A88A 4Y7AA 4WVPE 1KXEA 5EXLA 1V6DA 3A7XA 3I29A 3GY8A 1AFQB 1ETTH 1RS0A 5EQSA 1GI3A 3P8OA 3V12A 3CENA 3LGUA 1GDNA 2GT7A 2GVFA 3VB7A 3SGAE 1BTWA 1NRPH 3SI3H 1HAYB 1DFPA 1UK2A 3A87A 1RRKA 1O2GH 3RMMH 4X2XA 2OXSA 1XUIA 4FU9A 3QTVH 1YF4A 2FOHA 3RC6A 1FQ3A 2XCNA 1CGIE 1KTSB 1O3LA 4K1TA 5PTPA 2F9BH 1F0TA 1GI5A 2UUJB 3KQEA 1ARBA 2PW8H 1RIWC 1TPPA 2FOMB 2PWXA 1Z1IA 1O5EH 4NCYA 5FHTA 4NFFA 3A81A 1CO7E 3RXLA 1DWBH 5E0GA 2CJIA 2OBOA 2BY8X 4I33A 4MPUA 2BLWA 1NFXA 2AEIH 1LHCH 3PO1B 5EPYA 2CMYA 1QHRB 1PPFE 2SGFE 1ZHPA 1ELCA 2LNCA 1MMJN 1VJAU 2BD3A 2JKHA 1C2FA 5GDSH 2R2MB 1TALA 2OLGA 2SGDE 1GJDB 1ZMNA 2BD2A 1NRQH 5CMXH 1LVYA 3GY7A 4NSYA 6CHAB 1P3EA 4WJG2 5GCHG 1QR3E 1NESE 1NFUA 3SV7A 1W7XH 1WUNH 1FJSA 3MNSA 2HRVA 2SFAA 4BNRA 2OCVB 1L4DA 1Z8JB 3F9FA 3NXPA 4DG4A 1UCYE 3ZVFA 4JZEH 1S5SA 1UHBA 4X6OA 3VXEH 1GI9B 4X2VA 1GJ7B 1NN6A 1LHGH 2ZHWH 2R9PA 2V35A 5HYOA 1H8IH 1M9UA 2EI7A 2PSYA 4ISOA 1UTJA 4MNWA 1C4Y2 1O2IA 3STJA 4M7GA 2PV9B 2Y6TA 4B76A 3UIRA 2AGIX 2RCEA 1FI8A 1EPTB 1ZHRA 1O3MA 8GCHG 1HB0B 4ABDA 1TMTH 1T7CA 2RA0A 4AGKA 1P03A 1TONA 1WV7H 4NFEA 3TNSA 5GPIB 3ZVCA 1C1TA 1CBWB 5JBBS 1S82A 4DOQA 3LONA 4U01A 4CRCA 1A4WH 2ZGCA 1SGRE 1XXDA 1O3DA 1GBHA 6ESTA 1ACBE 1NM6A 4DW2U 2DE8A 2YNAA 4I8KA 1ELVA 1O31A 3U8OH 3DUXH 1SGIB 1YLDA 1ANEA 2ANMH 5TCCA 2JH5D 3UNQA 1EAXA 3LJOA 4H6SB 4MLFB 4YT7H 4AFQA 1MUEB 1NFWA 1QL7A 1XUFA 2XYAA 4ZHLU 2ZQ1A 2AIQA 2IJOB 3MO9A 2ZG0H 1VITF 1CHGA 1WSSH 1ELGA 1G2MA 4NIYA 2NU2E 4AZ2B 1ZMJA 1OWJA 3BN9A 1O34A 2BDIA 2AMQA 1P0SH 1SSXA 3UTUH 1T8LA 3AW0A 1HLTH 3U8RH 3HPTB 2NU3E 1ZYOA 5HM2A 1HPGA 1O2HA 4KTSA 3EE0B 5G4BA 2OC7A 3B9FH 1SGTA 5L6NH
chains in the Genus database with same CATH superfamily
1GDUA 3PM3A 1PJPA 1SQOA 4GAWA 3TK5A 2V0BA 3EA7A 2Z9LA 1SOTA 2QGRA 1TGTA 1EZXC 1NS3A 4DT4A 1J17T 1TX7A 3AK5A 4I8HA 2AERH 2PSXA 1WAYB 1OWKA 4JYUH 4LZ4B 3SW2B 1XVOA 1RTFB 1O2PA 5EQQA 4GPGA 1MH0A 3TITA 2BXTH 1TNKA 2W7SA 5A0CA 2BY9X 2G4TA 1NROH 1UK4A 2OC1A 2FOAA 2ZTXA 4DT7B 1TAWA 1C1VH 4Y10E 1C2IA 3D65E 1DLEA 1IHSH 1K22H 2G52A 1EPTA 1G32B 3GCTF 2SGAA 4XBBA 2BZAA 4AC9A 2A5AA 3T25A 4IMQA 3UPEA 3ATKA 2OC0A 2PR3A 3A83A 4WH6A 1SG8B 2ZFSA 5FXLA 1HYLA 1G36A 2SGEE 3NPSA 3OY5U 1U6QA 1ZZZA 1K1PA 3LH1A 1AE8H 3BEIB 3V3MA 2O8TA 2ZTYA 1P2KA 4IMZA 2HNTE 3MNCA 1DY9A 4HTCH 1S85A 1HAPH 4FU8A 4AX9H 1ELAA 3RMLH 4XE4A 2EI8A 2EQNA 3MNXA 5JDUB 4OGYA 2C8WB 1OS8A 5KEDA 1H9IE 3ZZ4A 1O3CA 3PRBA 2G8TA 3VXFH 4TY7A 1YPHE 3SJIA 4B1TA 2XRCA 3EAJA 3MH6A 1GJ5H 1HAGE 4D9QA 1TPOA 1QURH 1ETSH 1V2UT 3SU4A 2P93A 1YPJH 2Z9KA 3ZZ3A 3S9BA 2KM0A 2J2UA 2A7CA 1Z6EA 2FESH 4O97A 4XRNA 3TH2H 4BXSA 1SGCA 5DP6A 2ZF0H 1TBZH 3ZZAA 1O2RA 1ZMLA 1O5BB 2VVCA 1INCA 1AVWA 1B5GH 1GGDC 2H6MA 2Q6FA 3OAAD 3E3TA 3BTQE 2PKSC 2BX3A 3SUEA 5B6LA 2BD7A 1W8BH 1V2PT 2IPHA 1DLKB 1A1RA 1GG6B 2DE9A 2Y81A 1JOUB 1VCWA 2Q6GA 2LP6A 2ODQA 3F68H 1WOFA 2KR7A 2ZPSA 1O5GH 1FIWA 2AH4X 3GCOA 3SJOA 2A4RA 3M61U 3TVJB 5A09A 2NU4E 3PB1E 4B71A 3CP7A 3GISB 4IN2A 2HPPH 1IQMA 2P8OB 4NZLA 4BAHB 1C5YB 4NIVA 2ZFFH 4AORA 1YY3A 2JIZD 4BXWA 3RDZA 4I8LA 4YO9A 5DP4A 2CHAC 1VITG 2ANWA 4PROA 5GNDA 4ISHH 4KTCA 1B0FA 1LVBA 1GJ6A 1J8AA 1VGCC 3E0PB 3RXOA 2ZP0H 4GUXA 2GP9B 2GD4B 2Y7ZA 4XSKU 2L74A 5C67A 4IS5A 1T4UH 3AASA 1YC0A 3SNBA 3SV8A 1MAXA 1MD8A 1KTTB 4DVAU 3F9EA 1K1LA 1Q2WA 3BEUA 5C1XA 1TGCA 4JYTA 1Y8TA 1ZR0A 3H7OA 3Q3KA 4GCHF 2XNDD 1HXEH 2R3YA 3P17H 3RXKA 4B75A 3KQ5A 3ZZ5A 2BY7X 1BUIA 2Z7FE 1J9CH 1WTHD 4TYDA 5KECA 4K8YA 4Y8YA 2BDYA 3SNAA 3TK9A 1YPGH 1LPGB 1IQKA 3ZV8A 3FO8D 2OK5A 1IQJA 3HGNA 5DP7A 1GHWH 3GCTG 5HXFA 4FETA 3JZ2B 1T8NA 3GS9A 1O5CB 1UVSH 2BQ7B 5ESBA 2ZDKA 1AD8H 3F9GA 3OX7U 3QX5H 1CQQA 1S6HA 3SI4H 3STIA 1TA6A 4WMEA 1PPEE 2BY6X 4NWLA 5C1YA 5LH8A 4KTUA 2A4QA 2CXVA 1OYQA 2XNIA 1NC6A 2J92A 2Z3EA 1NU7B 4I7YH 1TE0A 1NT1A 2LPRA 1AE5A 1Y5BT 1DT2A 1EJMA 3GDVA 1EB1H 1KLIH 4TPIZ 5I25A 3TJNA 4F49A 1O3OA 1A0JA 2YOLA 3SQHE 4D7FA 1AZZA 4TT3D 2VVVA 2SGQE 3TH3H 4A1XA 3RXSA 1UTNA 3U69H 4X6NA 9LPRA 1UTPA 2ALPA 1BRUP 2IJD1 2BVXH 1GJAB 1ZJKA 2QCYA 5DP3A 5GWZA 3RU4D 1AVGH 1A5HA 1V2JT 2RDLA 1A7SA 2IN2A 3UQVA 1G3EA 2VIPA 4ZROA 3RXFA 1BZXE 4TY6A 3FANA 2J9NA 2Y5HA 2FLRH 4ZXYH 2FS8A 1GMDF 2PP6A 1BTZA 3E6PH 3P8GA 4WH8A 1F5KU 1O38A 1HJ8A 4X8SH 2A45B 4K60A 2ZGXH 3NUMA 4MVNA 1GDQA 1SGNE 4X1SU 1EQ9A 3M3TA 1XKAC 2VBCA 3PWBA 3MOCA 1YLNA 1AUTC 2WUBA 1P3CA 1QFKH 4XDEA 1O5AB 1FMGA 2BDAA 3NK8A 4LK4A 1TWXB 3P6ZB 2ZZUH 1E0FD 1GVKB 2FS9A 3SO3A 3DD2H 1D3TB 1DICA 2XBWA 1SB1H 2ZA5A 4XFQA 1AU8A 1DSUA 1A61H 2OD3B 3S69A 2FP7B 4WMDA 1GBEA 1ZJDA 3T62A 2FI5E 1EJAA 3OSYA 1V2ST 5C94A 3SHAH 4D9RA 2BVRH 1ZRBA 1B7XB 4Q2KA 1UTKA 5FPYA 3CNRA 3UAIC 1IQGA 1DX5M 5A8XA 3UR9A 1EP5A 1TBQH 3VEQB 1HV7A 2D2DA 2BDCA 2C8YB 3U1JB 1P06A 4Y7BA 1ZPBA 5C3NA 3TLOA 5EPNA 2QXJA 1LHFH 3RXBA 1EXFA 2J34A 5C20A 3T27A 5C5NA 2B7DH 2HVXA 5JBTA 5LPFA 1K1IA 4IC6A 1DXPA 3MNBA 4YOJA 3KYFA 2GX4A 3A84A 4CBNA 1NO9H 1O3FA 2ZECA 4E7RG 3I77A 2F9VA 4F4OC 5CHBA 4FUCA 1W14U 2A7HA 2XBXA 2CHAB 1O33A 1YPMH 1NBME 3LIWA 3VGCB 1L4ZA 1P2IA 1OSSA 5LGOA 3HATH 1YCPK 2ANKH 3HK3B 4SGAE 5BRRE 1C5NH 4X0WU 3VG8A 5A0AE 1ZLRA 1ZTLA 3RXIA 1AGJA 2TGAA 1O2LA 3PMHB 3ATWA 5FX6A 3RXAA 4Z6AH 1N8OB 5DGJA 5FPTA 1QRZA 1HXFH 2GCHF 3I78A 5EJ1A 1O2JA 4MNXA 4AYVB 4H6TA 2Z3CA 5A0BA 3U98H 1FXYA 4WXVA 3MO3A 6GCHF 3DSGA 2ZCKP 2CGAA 1DOJA 2ZHEH 1C5WB 3KQDA 3A8AA 3UNRA 4WY3A 1QBOA 3QGNB 1PQ8A 1VCQA 2CF8H 2QE7D 1QJ1B 3KNXA 4BOHA 1SI5H 2YMSD 4U30A 3EE7A 1IQFA 1TABE 5E2OA 2BLQA 1BT7A 5GIBA 4FUDA 1GMDG 1BCUH 2BD4A 4KKDA 2FZZA 3ZVDA 2QV1A 4JMYA 5T6FA 5TCAA 2FMJA 1GL1A 3ODDA 1HFDA 1KXBA 4Y0ZE 5AVDA 1HJAC 2AGGX 1H8DH 2A7JA 4X2WA 4ZKSU 1C2GA 1TA2A 2DUCA 1HAHH 5J4SA 3BIVH 4ISIH 2BX4A 2CN0H 3A8CA 3RUOA 2AMPA 3HKJB 3BIUH 1TGSZ 1W11U 1SGPE 2WHXA 1T8OA 3GDUA 2WYGA 3WW7A 4AOQA 1MBQA 4DY7B 1ANCA 4X6MA 2FLBH 1JRTA 3RMNH 4NA9H 3BTWE 2ZU4A 5AFYH 4ZHAA 3T29A 2FOEA 1E37B 4YESB 1MCVA 3UQOA 5H4IB 1XXFA 2BOKA 1C5TA 2ODYB 2JH0D 4P02A 4OS7A 5F53A 3PLBA 3N99A 4RSPA 3QDZB 3O8BA 4J2YB 1C5RA 3QGJA 2VWNA 1O2UA 1HUTH 2GGVB 2WPKS 3RXJA 4CH8B 3TPIZ 1RD3B 1Z8GA 2F91A 3MTYA 2BZ6H 4U32A 1C5PA 1GG6C 1YGCH 1THRH 1AY6H 1QGFA 2ODPA 5EU8A 3ZZ6A 2ZU2A 1Y3YA 1P01A 5DN6D 3ATIA 4ZKNU 1GMHF 2Z6BD 2KZ4A 2FEQH 1TX8A 1YPKH 3QTOH 5EXMA 1CA0C 1HCGA 2P8OC 4KELA 2EA3A 5F03A 4WMFA 2WPJS 3SU5A 5ABWA 5EJZA 4NGAH 2ZDAH 5IYTA 5SGAE 1E35B 1BMLA 5DSFA 4Y79A 4TWYA 2XBVA 1Y3XA 3QN7A 8ESTE 3E91A 1GBDA 2P3FH 2Y5FA 1ESBA 4AB9A 5AFZH 3MYWA 1GJBB 1O2KA 2PTNA 1YPEH 1BB0B 3V7TA 1LMWB 4UD9H 5ESTE 3BTHE 3UWIA 5AF9H 2ZI2H 3RM2H 3SJKA 2VVUA 1O2SA 1O2ZA 1V2LT 2O8LA 3K6YA 5DPAA 3S9AA 1AMHA 3DA9B 3LC5A 4K3JA 2VIDA 2GCHG 3A7TA 4ABHA 2BLVA 2QA9E 1CSOE 3E0NB 1ABIH 3MO6A 4X8VH 1TNLA 1GI6A 1TLDA 1K1JA 1GPZA 1CHOF 1QRWA 1BMNH 2ZGBH 3K9XB 1TRYA 2G51A 3MH4A 2SGPE 4DIIH 4I8GA 1UCYK 1DE7H 1P02A 1QB1A 1BTPA 1P2QA 1ZPCA 1UO6A 1XM1A 1BIOA 1WU1A 1SGDE 1CGJE 2FTMA 1GI7B 3F2GA 5TJXA 2BD5A 2D1JA 2ZGJA 1O5FH 1OWDA 3KYGA 1HRTH 4SGBE 5JPMH 3HGPA 2RG3A 4UFEH 1DWDH 1K9OE 1BHXF 1W12U 2BY5X 1L0ZA 3DFLA 3ZZ9A 1NU9A 1OX1A 4ABIA 2ZCLP 2J94A 3LGWA 4YZUA 2K1QA 1MQ6A 3F1SB 3OTJE 1P2OA 1V2QT 4ABAA 3S7KB 4Y11E 3FP8E 1LHDH 1O36A 3P70B 3SHCH 2ZPRA 1K1MA 3UB0A 1JMOH 1DXWA 1KXCA 2PKAB 1Y5UT 1TMBH 2YMSC 1LHEH 5C2ZA 2ZO3H 5E0JA 2ZDMA 4K5ZA 2G5VA 3LC3A 3MWIU 3W94A 3FZDA 3SNDA 3PMAB 1QNJA 2JDID 1HAIH 1S83A 4Y0YE 1WTGH 1EATA 1MAYA 5KGOA 1IQHA 4RI0A 4K1SA 4UFFH 4E05H 3ZZ8A 4TWWA 4CHAC 3SNEA 3PLKA 3PYHA 1SLXB 1Z71A 2V3MA 4JZFH 2R0KA 1UMAH 2G81E 3ATMA 1EZQA 4NIXA 2KX4A 4OGXA 5DK1A 1TIOA 4OS1A 1EAWA 1ESTA 3QZQA 1S6LA 2XWBI 1T8MA 1O35A 1GHVH 2Y7XA 4OS2A 1HAZB 1O39A 2NU0E 1GCTC 1BBRH 1QA7A 1E38B 1HJAB 3ELAH 1C5LH 4ZHMU 2XOKD 4DURA 2GZ8A 1O3BA 2BQWB 1F7ZA 1BTXA 3Q00A 3SZNA 3JZ1B 1PPHE 5EG4A 1BOQA 1FZZA 5C5OA 2ZQ2A 1KY9A 1OWEA 1WDIA 5LPEA 1EX3A 2XTTB 4ACAA 2ILNA 2G4UA 2XBYA 3L33A 1ORFA 2ZEBA 1KIGH 4HFPB 2GCTB 3BSQA 5A8ZA 3VFEA 3SJ8A 2R2WU 3SV6A 4ABEA 4Y6DA 3GICB 3UFAA 5E0HA 4B74A 2ESTE 1AVXA 1FY5A 5I46H 4ABBA 3H7TA 1G30B 3KL6A 2C8ZB 1C4U2 3F2HA 2ANYA 1O5DH 1HDTH 1ZTJA 2PKAA 1PPZA 4X6PA 3SV2H 3BG8A 1MKXK 3M5LA 2EI6A 1TPAE 1T4VH 2QAAA 2A2XH 4Q4LA 3UOPA 1CHOG 3DT0H 3RXDA 1HJ9A 2OTVA 4K2YA 4B6EA 4BTUB 1CA0B 2H5DA 4AG1A 3BTDE 1H4WA 4X8TH 5FCKA 2GT8A 3DFJA 3ATLA 4OS6A 5E8EH 4Z1MD 3Q77A 2KCPA 4XOJA 3VGCC 3L3TA 2SNWA 5EQRA 2JETC 1H9HE 4IBLH 4YLUA 2HGTH 4B6FA 2WV4A 1MCTA 2M5TA 3RXHA 5DO4H 3QO6A 1FPCH 1RTKA 1K2I1 4UFDH 4ESTE 1LPKB 4AFSA 4R0IA 1H1BA 1WXRA 1EZSC 1N8OC 4ISNA 3SGQE 1LKBA 4HZHA 4WWYA 2EY4C 1H9LB 2BQ6B 3FP7E 3MH5A 3M36A 3M35A 2VH6A 1Z6JH 1XUJA 2JH6D 5K7RA 1LKAA 2H9EH 2VGCC 1FONA 2XCFA 2Z9IA 4MDSA 1A3BH 1ELEE 2KAIB 2Y82A 1UTQA 3M5MA 2QF0A 3M7QA 2STAE 2ZHQH 2W7UA 3VB3A 3M5OA 3BG4C 1TRNA 5JBAS 1C1WH 5A2MH 3IWMA 1DVAH 1EJNA 1LQEA 1O2XA 1P11E 1HNEE 1QY6A 2QF4A 5JB9S 1P04A 3SYJA 1O37A 1K28D 2TPIZ 2FM2A 1GL0E 1GJ9B 1QBVH 4QT8C 2F9PA 4DJZB 5J4QA 1O3NA 3TJUA 1AO5A 1GBJA 1C1MA 3BEFB 3NWUA 1SOZA 2OINA 3BTME 4ASHA 1E79D 2STBE 2W3KA 1UVOA 1QJ7B 4CREA 1BBRK 1A0HB 2J97A 3IG6B 4F48B 1B0EA 2HNTC 4A6LA 1RXPA 1YCPH 2FOCA 2BLOA 3M37A 5GXPA 2ZHDA 1OP0A 3ZZ7A 4D8NA 3SU3A 1GVZA 2AYWA 4FUBA 5F8ZA 3O8RA 2Y5GA 1SFQB 3FOAA 1C1RA 2YMSB 1NTPA 2Q6DA 1D3PB 1NRRH 1YPHC 1GJ8B 1W0KD 4CBOA 2O8WA 3RXUA 2QYIA 3KIDU 1GVLA 1D9IA 1NY22 3TJVA 3RM0H 1JWTA 1AFEH 1C1UH 1VJ9U 1ZSKA 2F83A 3ENSB 4AN7A 1L1JA 1K0HA 1C1QA 1MTNB 4CRDA 4E06H 1BTHH 2FOBA 4A5TS 3DHKH 4ZKRU 2BTCE 1OXGA 4ZCNA 2A4OA 1Y3WA 1D4PB 1C5VA 1ARCA 3AVZA 4XBDA 4CHAB 3F3BA 2G5NA 2BVSH 2PFEA 4UONA 4VGCB 1F2SE 1KXFA 1Z1JA 1NZQH 1G3CA 4ZAEA 3T26A 7KMEH 1D6RA 3VPKA 3LT3A 1JBUH 4CR5A 4Y8ZA 1XUHA 3P8FA 1E36B 2KAIA 3QK1A 3ODFA 3ZVEA 3OTPA 1D3DB 2B9LA 1V2VT 4R8TB 3MH7A 3EA8A 1GCTB 1A5GH 1W3CA 3MHWU 4Q7YA 3D49H 2QXGA 3OFND 2H9TH 4A1TA 4I86A 1AIXH 7LPRA 1MTUA 1W0JD 2ULLA 3RLWH 1C2MA 2OQ5A 1MTVA 1V2NT 3SUDA 5F8XA 2VWLA 5DP9A 2H9HA 1C5XB 3E90B 1RGQA 1SGFG 2BOHB 3CS0A 1O2YA 1QZ8A 4H4FA 4BAOB 2Z9JA 1SC8U 3ZV9A 2FPZA 1OP8A 1RTLA 2QF5A 4INLA 1WQVH 4NG9H 1KLTA 2A31A 2F9OA 2ZFPH 3SQEE 2QIQA 1CT0E 1ZPZA 2F4LA 1FN6A 2VIOA 3B23B 3TK6A 3SJ9A 1V2KT 1TPSA 1G9IE 2TIOA 1EUFA 4X1NU 1EOJA 4A92A 1TMUH 7GCHF 1ZGIA 4O3UA 4GCHG 3A7VA 4FOUC 3L6PA 1BTUA 1N1LA 2H2ZA 3KEEA 3S0NA 1G37A 1W13U 2V3HH 4ABFA 4CH2B 1O2NA 2C93B 2W5EA 5GCHF 1EKBB 1GI1A 3P8NA 3MQKC 1TQ0B 1GBLA 2G00A 4Q7XA 4UE7H 3F0PA 2AGEX 2XC4A 2XC0A 2ZFTA 1ELDE 3SV9A 4K69A 1VKYA 1GHBF 1LVMA 1GI4A 2WPDD 1SQRA 1C9TA 1K1NA 2ZGHA 2JETB 2J4IA 2KCYA 1F0UA 3PMBB 2SNVA 2PGQB 3PV4A 4YOIA 2C4FH 5HIZA 1SLUB 2ZPQA 5C0UA 2XWAA 1QL9A 8GCHF 3RMOH 1MZAA 1C1OA 1FPHH 3SNCA 2P3UB 3UR6A 1FAXA 1V2OT 4BAQB 5JB8S 1PQ7A 3PLPA 1FY4A 1MTSA 4FUIA 5EW2H 1VR1H 1QL8A 1OHHD 3DSPA 1BMMH 1HAXB 1OYTH 2THFB 3KGPA 2VGCB 4FUFA 3RC5A 2VJ1A 1KLJH 8KME2 1A46H 2GV6A 3RP2A 2XXLA 2Z3DA 1BRAA 2Q1JA 1O3KA 1VITH 3BG4B 3MI4A 3GDSA 2F9UA 1CU1A 4IW4E 1YP9A 1GBAA 2ZU5A 1S84A 3P92A 4UDWH 1C2EA 2HLCA 1UCYH 1THPB 2KCAA 1CGHA 3UY9A 3URDA 3QZRA 4LZ1H 1AHTH 4FU7A 3CS7A 3TGIE 1RJXB 1JIRA 1XX9A 2GJGA 2QXIA 4FUHA 5B6OA 1FV9A 5FPSA 1O2OA 1P9SA 1S6FA 1X7AC 2Z9GA 2OP9A 1SPJA 4D76A 1ZOMA 1PYTD 2ALVA 2H1UA 4B73A 2VH0A 3N7DA 1O0DH 3MU5A 3A89A 1LVOA 2TRMA 3LGTA 2GTBA 2F3CE 2VB0A 4AFZA 1G3DA 3FFGA 4FUGA 4O03A 1AQ7A 1W10U 5L2ZH 1MU8B 1DWEH 1SL3A 3ZVAA 1EB2A 1O3EA 1TB6H 2NU1E 1O3AA 1DS2E 3AAUA 1GHAF 4JK5A 2BDBA 2WV5A 2VWOA 1F0RA 3NRLA 1BMFD 1BRCE 4JZIA 4X1QU 1BJUA 4NA8A 2GCTC 3E8LA 2D8WA 1SLVB 4Y71A 1SQAA 2J38A 4CRFA 4FVDA 5DKMA 4I32A 3GCHC 1FY3A 2A32A 5EGMA 2F43B 2KCOA 1TX6A 2B8OH 3GYMA 2QY0B 3A86A 1SMFE 4OS5A 2A5KA 5BPEA 3UOUA 2P95A 4JZDH 4M9FA 1SHHB 1NRNH 1GI0A 3SU2A 3FVFB 7ESTE 4P00A 2EEKA 1TFXA 1A5IA 1QRXA 3A82A 2BYAX 3K65B 1GI2A 7GCHG 1AN1E 4ABJA 4CRGA 1QTFA 5EODA 5HMAA 4YLQH 1DM4B 4ZMAH 5L30H 1WYKA 2A0QB 2A5IA 2C3SA 1BDAA 2ZWLH 4F55A 3A85A 3TGJE 2IPQX 4AYYB 2EC9H 2C8XB 4X1RU 3RXTA 1ZRKA 1YWUA 1FN8A 2K8IA 1AZ8A 1YKTA 1C5UA 2NWNA 1O32A 2HOBA 1ELBA 1Y3UA 1FAKH 1C9PA 3SU6A 1VZQH 1GHBG 2FO9A 1WCZA 4HI3A 1ETRH 2ZU3A 2VIWA 4AG2A 4BANB 3GOVB 3KCGH 1CVWH 1QB9A 1TNJA 2GKVE 1C4V2 2Y80A 3R3GB 3TH4H 3TIUA 1TQ7B 1P09A 3A8BA 3DSOA 1OWHA 2F9NA 2A1DB 1UW7A 2WUCA 2ZDNA 2TBSA 4AFUA 5E2PA 4I31A 1L1NA 2O8MA 1BTYA 1P57B 5CHAC 3GY3A 2FOFA 1DUEA 4NSVA 3SORA 1MKXH 1UJ1A 2QC2A 6GCHG 1SGFA 3LGVA 3KN2A 1GHZA 2AIPA 3IITA 1UTLM 1C2DA 2ZU1A 1GBCA 2JJ2D 1ESAA 5FCRA 1C2KA 2QXHA 3RXMA 1GMCF 1Y59T 3BTKE 3KHVA 1ZSLA 2UUYA 3WY8A 2FIRH 3V0XA 1EAUA 1W0ZU 4IGDA 3EGKH 1A2CH 4B2AA 2V3OH 3MFJA 4MNVA 1BA8B 1XMNB 3H5CB 4ISLA 4MTBA 1PPBH 4IC5A 1WBGB 4INHA 1UVPA 3PTNA 3UUZA 1UVTH 2W6JD 1P10A 1C5SA 3PV5A 2PGBB 3EQ0H 3OYPA 5JYIA 4RT1A 1KYNA 3PTBA 1SBWA 4NZQA 1GHAG 1PYTC 4DGJA 1A3EH 1RFNA 3OE7D 1BQYA 1G3BA 1TRMA 1K21H 2XC5A 1MTNC 3U8TH 2FI4E 4FXGH 2Z94A 1C5ZB 3KF2A 1YLCA 3T5FH 1JRSA 1LTOA 1Z8IB 2BD8A 3A7ZA 4JK6A 4CR9A 4VGCC 3D62A 4Z0KA 1EP6A 2VIVA 3ITIA 3TGKE 1UVUH 1MD7A 2WV9A 3M3VA 3UWJH 3HKIB 1LDTT 1C2JA 4NWKA 4RT0A 1A0LA 1F5RA 1VCPA 1ZHMA 5IDKA 3C27B 1O3PB 3BF6H 4U2WA 3OEHD 1LQDB 5A8YA 1BITA 3SUGA 3MU1A 1FDPA 1GCDA 3FZZA 2P3TB 3BTTE 3ZZBA 4AGJA 4YT6H 2V6NA 1GMHG 1TNHA 2FODA 3A7WA 2GMTC 1ABJH 1ZTKA 2P16A 2VNTA 1O3JA 3RXGA 3D23A 1MABB 2O9QA 2FYQA 2J95A 5T6GA 5EXNA 1ELFA 2RDEA 9ESTA 1MQ5A 1NRSH 2ZIQH 4H42U 1UTOA 5EOKA 4K8BA 5EIYA 1N6XA 1ELTA 4DIHH 3NKKA 2PLXA 4J1YA 2FI3E 1PPCE 3F6UH 2OC8A 2G55A 3K6ZA 1TNGA 1GWAA 4GSOA 1IQNA 1C5OH 1IQLA 3GCHB 2QN5T 4Q63A 4LXBH 2L6OA 5L2YH 1V2RT 1RIWB 4GHQA 4CRBA 1QJ6B 2YNBA 4Q80A 3AW1A 3ZZDA 1HAVB 1XUKA 3K2UA 3MU0A 4INKA 1GJ4H 1MTWA 2A2QH 3G01A 3OU0A 1L1GA 1GBFA 2HLDD 1BJVA 4O9VA 3NZIA 3LH3A 3BTEE 1UTMA 1THSH 1XKBC 4JYVH 5DJ7A 3KQBA 2J5UA 3N7OA 1YCPM 3GY5A 2GV7A 5F6MA 5FX5A 3PWCA 2VIQA 1GBKA 2LELA 1GMCG 2PUXB 1DANH 2WYJA 4TPYA 3WWFA 1EOLA 1W7GH 1W2KH 2WPHS 2UUKB 1O2QA 2ZHFH 5C17A 1C1PA 2W26A 4BAKB 2HNTF 3B8JA 1KMHB 1L2EA 5CDFE 1QCPA 3LU9B 1F5LA 3UREA 3LOXA 1GHYH 3RU4T 1BBRE 2ZCHP 4GLYA 1YM0A 3Q3XA 4IN1A 1SR5C 1ID5H 3W95A 1O2MA 2H5CA 3EA9A 1V2MT 1AB9C 2BDHA 1PFXC 2B5TB 3A8DA 3F2FA 2D26C 3TNTA 4B2BA 4NIWA 5CHAB 3ESTA 3U9AH 2P94A 1DUAA 5JBCS 1WQSA 3TU7H 1QIXB 1EAIA 1C5MD 4MPVA 3HK6B 4E7NA 2BB4A 2CV3A 3SGBE 4ZUHA 3PV2A 2M2AA 2OUAA 1FLEE 3PMJA 1YBWA 2V7QD 4RKJB 1P8VC 2UWOA 1IHTH 1O3GA 2FX6A 1P9UA 4D7GA 1LCYA 1Q31A 2VINA 2ZC9H 4JCNA 2FYRA 1J16A 3T28A 2FDAA 2VU8E 2IOTA 4ABGA 4MNYA 3M3SA 4FUEA 5AHGH 5GJ4B 4MPXA 3N7EA 1LO6A 1Y5AT 2GZ7A 4JZ1A 4GVUA 2TGDA 3SOSA 3SU0A 1HAVA 1T31A 4X8UH 5F8TA 3RC4A 3TJOA 1AFQC 2ZTZA 1P12E 1SVPA 1QQUA 3GYLB 3F0OA 4BTTB 2QF3A 2BHGA 2GDEH 1S81A 1P2NA 1PQ5A 2BXUH 4WF8A 4Q7ZA 2ASUB 3VB6A 1LPZB 3UNSA 1SGEE 3FP6E 2HPQH 2FX4A 3M7TA 2AMDA 1TOCB 3QLPH 4UFGH 1FNIA 1OWIA 1MKWH 1O30A 1Y3VA 1GBMA 2R0LA 1MBMA 1FUJA 1OP2A 2AFQB 1Z7KA 5LPRA 3LGIA 3RLYH 1DITH 1HBTH 1QBNA 1N6YA 3H09A 1TOMH 1SHYA 2OBQA 1V3XA 3EDXB 2R3UA 3LJJA 3U1IB 2BDGA 1GBTA 1CE5A 2TGTA 3QUMP 2WSSD 3W1EA 1C1NA 3PRDA 1GBIA 3MU8A 3EYDA 3PO1C 1J15A 5CE1A 4MPWA 3SBKA 3VB4A 1ANBA 1CT2E 1BMAA 2ZDLA 3KQCA 5EJLA 2OQUA 2JJ1D 3A7YA 4NA7A 4A1VA 1YPLH 4OM9A 2PHBA 6CHAC 1V2WT 1FIZA 3BTFE 3RU4E 1SFIA 2C90B 2GMTB 2ZKSA 1BHXB 1P2MA 4DCDA 1JIMA 1SQTA 2UWPA 2W3IA 3R0FA 2I6QA 1OPHB 3S9CA 2WPIS 3QWCH 3SZEA 5FAHA 2TGPZ 1F0SA 2FXRA 4ZH8A 1CT4E 2WINI 3VB5A 1HIAB 3NCLA 1ZGVA 1KDQB 4ASUD 6LPRA 2BM2A 1NFYA 2A4GA 1DPOA 1CA8B 3SN8A 1AKSB 1EZUC 4A7IB 5T6DA 1QA0A 1DWCH 3GCNA 2UUFB 2AS9A 1F92A 5C1UA 3PROA 1TYNA 3M7UA 4FUJA 2BMGB 2B0FA 1O3HA 1C2HA 1EPTC 2UWLA 1JXPA 5ETXA 3BTGE 4RN6A 3E1XB 3Q76A 5DP5A 1IAUA 1D6WA 2GDDA 2PTCE 3OEED 4ZKOU 3LPRA 2GZ9A 1HAOH 3RXEA 1E34B 1SGQE 2PUQH 3LGYA 4O3TA 1QQ4A 4XBCA 4MQAA 5K0HA 1XUGA 1GHXH 5HGGA 3GY4A 3Q3YA 1CBWC 3RXRA 4KGAA 1IQIA 1SGYE 1TBRH 4TSFD 3S7HB 5DG6A 4AB8A 1NBMD 2HALA 1P05A 1G2LA 1AWHB 3FAOA 1KXAA 1O2VA 1ANDA 2I6SA 1K1OA 1GGDB 4X1PU 2WPMS 3C1KA 2PKSB 4BAMB 1C2LA 3LKWA 3RXVA 3RXCA 1AUJA 1O2TA 4RKOB 4X2YA 3O8CA 1SLWB 4FVBA 4I8JA 1O3IA 1TGNA 4KP0A 4OS4A 2AHME 3GY2A 2ZFRH 1C5QA 4THNH 1DY8A 3GY6A 4K1EA 2FOGA 1XVMA 1UK3A 3SUFA 2WPLS 4YTAA 4GHTA 1OKXA 2ZDVH 3ZVBA 1IOEA 2CF9H 1GBBA 1ZSJA 2ZFQH 5IK2D 2HWLB 1MU6B 3V13A 1IQEA 3F9HA 1OOKB 4HGCA 1YYY1 4UEHH 2VWMA 4WXIA 4Y8XA 1P2JA 1NPMA 1HGTH 2FTLE 1DDJA 3BV9B 1VGCB 4Y76A 1EASA 3ZZCA 1MKWK 1PQAA 3AAVA 3ZYEA 3RXQA 1AI8H 1FY8E 1GJCB 4YM9A 1O2WA 4BTIB 1FY1A 4MG3A 2CK3D 5FL7D 3RXPA 5EW1H 3LDXH 1AB9B 3T2NA 4LOYH 3SU1A 3M5NA 2O8UA 1HIAA 5FBEA 2XW9A 2WZQA 1UHBB 1KDQA 3MU4A 3ZVGA 1Z8RA 3E16B 1AKSA 1T32A 3MMGA 4YOGA 1MZDA 2FWWA 1QB6A 3P95A 2ZNKH 3A80A 5DP8A 2RA3A 1C1SA 1V2TT 1COWD 1D3QB 5HKKD 1TGBA 1KSNA 1KXDA 1S0QA 3URCA 5HM9A 1TNIA 5FBIA 1J14A 1GI8B 1W0YH 3O8DA 5T3HA 1S0RA 3ZYDA 2BD9A 1DSTA 4XD7D 1AWFH 1BRBE 3OY6U 1PPGE 1Q3XA 5T1VA 4B2CA 4ZXXH 4CRAA 2P59A 8LPRA 3A88A 4Y7AA 4WVPE 1KXEA 5EXLA 5C0TA 2J98B 1V6DA 3A7XA 3I29A 3GY8A 4HG6A 1AFQB 1ETTH 3DCLA 1RS0A 5EQSA 1GI3A 3P8OA 3V12A 3CENA 3LGUA 1GDNA 2RFKC 2GT7A 2GVFA 5HIYA 3VB7A 3SGAE 1BTWA 1NRPH 3SI3H 1HAYB 1DFPA 1UK2A 3A87A 1RRKA 1E1QD 1O2GH 3RMMH 4X2XA 2OXSA 1XUIA 4FU9A 3QTVH 1YF4A 2FOHA 3RC6A 1FX0B 1FQ3A 2XCNA 1CGIE 1KTSB 1O3LA 4ACBA 4K1TA 5PTPA 2F9BH 1F0TA 1H8ED 1GI5A 2UUJB 3KQEA 1ARBA 2PW8H 1RIWC 1TPPA 2FOMB 2PWXA 1Z1IA 1O5EH 4NCYA 5FHTA 4NFFA 3A81A 1CO7E 3RXLA 1DWBH 5E0GA 2CJIA 2OBOA 2BY8X 4I33A 3ZIAD 4MPUA 2BLWA 1NFXA 3U28C 2AEIH 1LHCH 3PO1B 5EPYA 2CMYA 1QHRB 1PPFE 2SGFE 1ZHPA 1ELCA 1MMJN 1VJAU 2BD3A 2LNCA 2JKHA 1C2FA 5GDSH 2R2MB 1TALA 2OLGA 2SGDE 1GJDB 1ZMNA 2BD2A 1NRQH 5CMXH 1LVYA 3GY7A 4NSYA 6CHAB 1P3EA 4WJG2 5GCHG 1QR3E 1NESE 1NFUA 3SV7A 1W7XH 1WUNH 1FJSA 3MNSA 2HRVA 2SFAA 4BNRA 2OCVB 1L4DA 1Z8JB 3F9FA 3NXPA 1E1RD 4DG4A 1UCYE 3ZVFA 4JZEH 1S5SA 1UHBA 4X6OA 3VXEH 1GI9B 4X2VA 1GJ7B 1NN6A 1LHGH 2ZHWH 2R9PA 2V35A 5HYOA 1H8IH 1M9UA 2EI7A 2PSYA 4ISOA 1UTJA 4MNWA 1C4Y2 1O2IA 3STJA 1SKYE 4M7GA 2PV9B 2Y6TA 4B76A 3UIRA 2AGIX 2RCEA 1FI8A 1EPTB 1ZHRA 1O3MA 3WWBA 8GCHG 2HVYB 1HB0B 2W6ID 4ABDA 1TMTH 1T7CA 2RA0A 4AGKA 1P03A 1TONA 2J98A 1WV7H 4NFEA 3TNSA 5GPIB 3ZVCA 1C1TA 1CBWB 5JBBS 1S82A 4DOQA 3LONA 4U01A 4CRCA 1A4WH 2KFWA 2ZGCA 1SGRE 1XXDA 1O3DA 1EFRD 1GBHA 6ESTA 1ACBE 1NM6A 4DW2U 2DE8A 2YNAA 3FN8A 4I8KA 1ELVA 1O31A 3U8OH 3DUXH 1SGIB 1YLDA 1ANEA 2ANMH 5TCCA 2JH5D 3UNQA 1EAXA 3LJOA 4H6SB 4MLFB 4YT7H 4AFQA 1MUEB 1NFWA 1QL7A 1XUFA 2XYAA 4ZHLU 2ZQ1A 2AIQA 2IJOB 3MO9A 2ZG0H 1VITF 1CHGA 1WSSH 1ELGA 1G2MA 4NIYA 2NU2E 4AZ2B 1ZMJA 1OWJA 2K0QA 3BN9A 1O34A 2BDIA 2AMQA 1P0SH 1SSXA 4YXWD 1H8HD 3UTUH 1T8LA 3AW0A 1HLTH 3U8RH 3HPTB 2NU3E 1ZYOA 3FKSD 5HM2A 1HPGA 1O2HA 4KTSA 3EE0B 5G4BA 2OC7A 3B9FH 1SGTA 5L6NH
chains in the Genus database with same CATH topology
1GDUA 3PM3A 1PJPA 1SQOA 4GAWA 3TK5A 2V0BA 3EA7A 2Z9LA 1SOTA 2QGRA 1TGTA 1EZXC 1NS3A 1J17T 1TX7A 4I8HA 2AERH 2PSXA 1WAYB 1OWKA 4JYUH 4LZ4B 3SW2B 1XVOA 1RTFB 1O2PA 5EQQA 4GPGA 1MH0A 3TITA 2BXTH 1TNKA 2W7SA 5A0CA 2BY9X 2G4TA 1NROH 1UK4A 2OC1A 2FOAA 2ZTXA 4DT7B 1TAWA 1C1VH 4Y10E 1C2IA 3D65E 1DLEA 1IHSH 1K22H 2G52A 1EPTA 1G32B 3GCTF 2SGAA 4XBBA 2BZAA 2A5AA 3T25A 4IMQA 3UPEA 3ATKA 2OC0A 2PR3A 3A83A 4WH6A 1SG8B 2ZFSA 5FXLA 1HYLA 1G36A 2SGEE 3NPSA 3OY5U 1U6QA 1ZZZA 1K1PA 3LH1A 1AE8H 3BEIB 3V3MA 2O8TA 2ZTYA 1P2KA 4IMZA 2HNTE 3MNCA 1DY9A 4HTCH 1S85A 1HAPH 4FU8A 4AX9H 1ELAA 3RMLH 4XE4A 2EI8A 3MNXA 5JDUB 4OGYA 2C8WB 1OS8A 1H9IE 3ZZ4A 1O3CA 2G8TA 3VXFH 4TY7A 1YPHE 3SJIA 4B1TA 2XRCA 3EAJA 3MH6A 1GJ5H 1HAGE 4D9QA 1TPOA 1QURH 1ETSH 1V2UT 3SU4A 2P93A 1YPJH 2Z9KA 3ZZ3A 3S9BA 2J2UA 2A7CA 1Z6EA 2FESH 4O97A 3TH2H 4BXSA 1SGCA 5DP6A 2ZF0H 1TBZH 3ZZAA 1O2RA 1ZMLA 1O5BB 2VVCA 1INCA 1AVWA 1B5GH 1GGDC 2H6MA 2Q6FA 3E3TA 3BTQE 2PKSC 2BX3A 3SUEA 2BD7A 1W8BH 1V2PT 2IPHA 1DLKB 1A1RA 1GG6B 2DE9A 2Y81A 1JOUB 1VCWA 2Q6GA 2ODQA 3F68H 1WOFA 2ZPSA 1O5GH 1FIWA 2AH4X 3GCOA 3SJOA 2A4RA 3M61U 3TVJB 5A09A 2NU4E 3PB1E 4B71A 3CP7A 3GISB 4IN2A 2HPPH 1IQMA 2P8OB 4NZLA 4BAHB 1C5YB 4NIVA 2ZFFH 4AORA 4BXWA 3RDZA 4I8LA 4YO9A 5DP4A 2CHAC 1VITG 2ANWA 4PROA 4ISHH 4KTCA 1B0FA 1LVBA 1GJ6A 1J8AA 1VGCC 3E0PB 3RXOA 2ZP0H 4GUXA 2GP9B 2GD4B 2Y7ZA 4XSKU 5C67A 4IS5A 1T4UH 3AASA 1YC0A 3SNBA 3SV8A 1MAXA 1MD8A 1KTTB 4DVAU 3F9EA 1K1LA 1Q2WA 3BEUA 5C1XA 1TGCA 4JYTA 1Y8TA 1ZR0A 3H7OA 3Q3KA 4GCHF 1HXEH 2R3YA 3P17H 3RXKA 4B75A 3ZZ5A 2BY7X 1BUIA 2Z7FE 1J9CH 1WTHD 4TYDA 4K8YA 4Y8YA 2BDYA 3SNAA 3TK9A 1YPGH 1LPGB 1IQKA 3ZV8A 1IQJA 3HGNA 5DP7A 1GHWH 3GCTG 5HXFA 3JZ2B 1T8NA 1O5CB 1UVSH 2BQ7B 5ESBA 2ZDKA 1AD8H 3F9GA 3OX7U 3QX5H 1CQQA 1S6HA 3SI4H 3STIA 1TA6A 4WMEA 1PPEE 2BY6X 4NWLA 5C1YA 5LH8A 4KTUA 2A4QA 2CXVA 1OYQA 2XNIA 1NC6A 2J92A 2Z3EA 1NU7B 4I7YH 1TE0A 1NT1A 2LPRA 1AE5A 1Y5BT 1DT2A 1EJMA 3GDVA 1EB1H 1KLIH 4TPIZ 5I25A 3TJNA 4F49A 1O3OA 1A0JA 2YOLA 3SQHE 4D7FA 1AZZA 2VVVA 2SGQE 3TH3H 4A1XA 3RXSA 1UTNA 3U69H 4X6NA 9LPRA 1UTPA 2ALPA 1BRUP 2BVXH 1GJAB 1ZJKA 2QCYA 5DP3A 5GWZA 3RU4D 1AVGH 1A5HA 1V2JT 2RDLA 1A7SA 2IN2A 3UQVA 1G3EA 2VIPA 4ZROA 3RXFA 1BZXE 4TY6A 3FANA 2J9NA 2Y5HA 2FLRH 4ZXYH 2FS8A 1GMDF 1BTZA 3E6PH 3P8GA 4WH8A 1F5KU 1O38A 1HJ8A 4X8SH 2A45B 4K60A 2ZGXH 3NUMA 4MVNA 1GDQA 1SGNE 4X1SU 1EQ9A 3M3TA 1XKAC 3PWBA 3MOCA 1AUTC 2WUBA 1P3CA 1QFKH 4XDEA 1O5AB 1FMGA 2BDAA 3NK8A 4LK4A 1TWXB 3P6ZB 2ZZUH 1E0FD 1GVKB 2FS9A 3SO3A 3DD2H 1D3TB 1DICA 2XBWA 1SB1H 2ZA5A 4XFQA 1AU8A 1DSUA 1A61H 2OD3B 3S69A 2FP7B 4WMDA 1GBEA 1ZJDA 3T62A 2FI5E 1EJAA 3OSYA 1V2ST 3SHAH 4D9RA 2BVRH 1ZRBA 1B7XB 4Q2KA 1UTKA 5FPYA 1IQGA 1DX5M 5A8XA 3UR9A 1EP5A 1TBQH 3VEQB 1HV7A 2D2DA 2BDCA 2C8YB 3U1JB 1P06A 4Y7BA 1ZPBA 5C3NA 3TLOA 5EPNA 2QXJA 1LHFH 3RXBA 1EXFA 2J34A 5C20A 3T27A 5C5NA 2B7DH 2HVXA 5JBTA 5LPFA 1K1IA 4IC6A 1DXPA 3MNBA 4YOJA 2GX4A 3A84A 4CBNA 1NO9H 1O3FA 2ZECA 4E7RG 3I77A 2F9VA 4F4OC 4FUCA 1W14U 2A7HA 2XBXA 2CHAB 1O33A 1YPMH 3LIWA 3VGCB 1L4ZA 1P2IA 1OSSA 5LGOA 3HATH 1YCPK 2ANKH 3HK3B 4SGAE 5BRRE 1C5NH 4X0WU 5A0AE 1ZLRA 1ZTLA 3RXIA 1AGJA 2TGAA 1O2LA 3PMHB 3ATWA 5FX6A 3RXAA 4Z6AH 1N8OB 5DGJA 5FPTA 1QRZA 1HXFH 2GCHF 3I78A 1O2JA 4MNXA 4AYVB 4H6TA 2Z3CA 5A0BA 3U98H 1FXYA 4WXVA 3MO3A 6GCHF 2ZCKP 2CGAA 1DOJA 2ZHEH 1C5WB 3KQDA 3A8AA 3UNRA 4WY3A 1QBOA 3QGNB 1PQ8A 1VCQA 2CF8H 1QJ1B 3KNXA 4BOHA 1SI5H 4U30A 1IQFA 1TABE 5E2OA 2BLQA 1BT7A 5GIBA 4FUDA 1GMDG 1BCUH 2BD4A 4KKDA 2FZZA 3ZVDA 2QV1A 4JMYA 5T6FA 5TCAA 2FMJA 1GL1A 3ODDA 1HFDA 1KXBA 4Y0ZE 5AVDA 1HJAC 2AGGX 1H8DH 2A7JA 4X2WA 4ZKSU 1C2GA 1TA2A 2DUCA 1HAHH 5J4SA 3BIVH 4ISIH 2BX4A 2CN0H 3A8CA 3RUOA 2AMPA 3HKJB 3BIUH 1TGSZ 1W11U 1SGPE 1T8OA 3GDUA 2WYGA 4AOQA 1MBQA 4DY7B 1ANCA 4X6MA 2FLBH 1JRTA 3RMNH 4NA9H 3BTWE 2ZU4A 5AFYH 4ZHAA 3T29A 2FOEA 1E37B 4YESB 1MCVA 3UQOA 5H4IB 1XXFA 2BOKA 1C5TA 2ODYB 2JH0D 4OS7A 3PLBA 4RSPA 3QDZB 3O8BA 4J2YB 1C5RA 3QGJA 2VWNA 1O2UA 1HUTH 2GGVB 2WPKS 3RXJA 4CH8B 3TPIZ 1RD3B 1Z8GA 2F91A 3MTYA 2BZ6H 4U32A 1C5PA 1GG6C 1YGCH 1THRH 1AY6H 1QGFA 2ODPA 5EU8A 3ZZ6A 2ZU2A 1Y3YA 1P01A 3ATIA 4ZKNU 1GMHF 2Z6BD 2FEQH 1TX8A 1YPKH 3QTOH 5EXMA 1CA0C 1HCGA 2P8OC 4KELA 2EA3A 5F03A 4WMFA 2WPJS 3SU5A 5ABWA 4NGAH 2ZDAH 5IYTA 5SGAE 1E35B 1BMLA 4Y79A 4TWYA 2XBVA 1Y3XA 3QN7A 8ESTE 3E91A 1GBDA 2P3FH 2Y5FA 1ESBA 4AB9A 5AFZH 3MYWA 1GJBB 1O2KA 2PTNA 1YPEH 1BB0B 3V7TA 1LMWB 4UD9H 5ESTE 3BTHE 3UWIA 5AF9H 2ZI2H 3RM2H 3SJKA 2VVUA 1O2SA 1O2ZA 1V2LT 2O8LA 3K6YA 5DPAA 3S9AA 1AMHA 3DA9B 3LC5A 4K3JA 2VIDA 2GCHG 3A7TA 4ABHA 2BLVA 2QA9E 1CSOE 3E0NB 1ABIH 3MO6A 4X8VH 1TNLA 1GI6A 1TLDA 1K1JA 1GPZA 1CHOF 1QRWA 1BMNH 2ZGBH 3K9XB 1TRYA 2G51A 3MH4A 2SGPE 4DIIH 4I8GA 1UCYK 1DE7H 1P02A 1QB1A 1BTPA 1P2QA 1ZPCA 1UO6A 1XM1A 1BIOA 1WU1A 1SGDE 1CGJE 2FTMA 1GI7B 5TJXA 2BD5A 2D1JA 2ZGJA 1O5FH 1OWDA 1HRTH 4SGBE 5JPMH 3HGPA 2RG3A 4UFEH 1DWDH 1K9OE 1BHXF 1W12U 2BY5X 1L0ZA 3DFLA 3ZZ9A 1NU9A 1OX1A 4ABIA 2ZCLP 2J94A 3LGWA 4YZUA 2K1QA 1MQ6A 3F1SB 3OTJE 1P2OA 1V2QT 4ABAA 3S7KB 4Y11E 3FP8E 1LHDH 1O36A 3P70B 3SHCH 2ZPRA 1K1MA 1JMOH 1DXWA 1KXCA 2PKAB 1Y5UT 1TMBH 1LHEH 5C2ZA 2ZO3H 5E0JA 2ZDMA 4K5ZA 2G5VA 3LC3A 3MWIU 3W94A 3FZDA 3SNDA 3PMAB 1QNJA 1HAIH 1S83A 4Y0YE 1WTGH 1EATA 1MAYA 1IQHA 4K1SA 4UFFH 4E05H 3ZZ8A 4TWWA 4CHAC 3SNEA 3PLKA 3PYHA 1SLXB 1Z71A 4JZFH 2R0KA 1UMAH 2G81E 3ATMA 1EZQA 4NIXA 4OGXA 5DK1A 1TIOA 4OS1A 1EAWA 1ESTA 3QZQA 2XWBI 1T8MA 1O35A 1GHVH 2Y7XA 4OS2A 1HAZB 1O39A 2NU0E 1GCTC 1BBRH 1QA7A 1E38B 1HJAB 3ELAH 1C5LH 4ZHMU 4DURA 2GZ8A 1O3BA 2BQWB 1F7ZA 1BTXA 3Q00A 3SZNA 3JZ1B 1PPHE 5EG4A 1BOQA 1FZZA 5C5OA 2ZQ2A 1KY9A 1OWEA 5LPEA 1EX3A 2XTTB 2ILNA 2G4UA 2XBYA 3L33A 1ORFA 2ZEBA 1KIGH 4HFPB 2GCTB 3BSQA 5A8ZA 3VFEA 3SJ8A 2R2WU 3SV6A 4ABEA 4Y6DA 3GICB 3UFAA 5E0HA 4B74A 2ESTE 1AVXA 1FY5A 5I46H 4ABBA 3H7TA 1G30B 3KL6A 2C8ZB 1C4U2 2ANYA 2PKAA 1O5DH 1HDTH 1ZTJA 1PPZA 4X6PA 3SV2H 3BG8A 1MKXK 3M5LA 2EI6A 1TPAE 1T4VH 2QAAA 2A2XH 3UOPA 1CHOG 3DT0H 3RXDA 1HJ9A 2OTVA 4K2YA 4BTUB 1CA0B 2H5DA 4AG1A 3BTDE 1H4WA 4X8TH 5FCKA 2GT8A 3DFJA 3ATLA 4OS6A 5E8EH 3Q77A 4XOJA 3VGCC 3L3TA 2SNWA 5EQRA 2JETC 1H9HE 4IBLH 4YLUA 2HGTH 2WV4A 1MCTA 2M5TA 3RXHA 5DO4H 3QO6A 1FPCH 1RTKA 1K2I1 4UFDH 4ESTE 1LPKB 4AFSA 4R0IA 1H1BA 1EZSC 1N8OC 4ISNA 3SGQE 1LKBA 4HZHA 4WWYA 1H9LB 2BQ6B 3FP7E 3MH5A 3M36A 3M35A 2VH6A 1Z6JH 1XUJA 2JH6D 5K7RA 1LKAA 2H9EH 2VGCC 1FONA 2XCFA 2Z9IA 4MDSA 1A3BH 1ELEE 2KAIB 2Y82A 1UTQA 3M5MA 2QF0A 3M7QA 2STAE 2ZHQH 2W7UA 3VB3A 3M5OA 3BG4C 1TRNA 5JBAS 1C1WH 5A2MH 3IWMA 1DVAH 1EJNA 1LQEA 1O2XA 1P11E 1HNEE 1QY6A 5JB9S 1P04A 1O37A 1K28D 2TPIZ 2FM2A 1GL0E 1GJ9B 1QBVH 4QT8C 2F9PA 4DJZB 5J4QA 1O3NA 3TJUA 1AO5A 1GBJA 1C1MA 3BEFB 3NWUA 1SOZA 2OINA 3BTME 4ASHA 2STBE 2W3KA 1UVOA 1QJ7B 4CREA 1BBRK 1A0HB 3IG6B 1B0EA 2HNTC 4A6LA 1RXPA 1YCPH 2FOCA 2BLOA 3M37A 5GXPA 2ZHDA 1OP0A 3ZZ7A 4D8NA 3SU3A 1GVZA 2AYWA 4FUBA 5F8ZA 3O8RA 2Y5GA 1SFQB 1C1RA 1NTPA 2Q6DA 1D3PB 1NRRH 1YPHC 1GJ8B 4CBOA 2O8WA 3RXUA 2QYIA 3KIDU 1GVLA 1D9IA 1NY22 3TJVA 3RM0H 1JWTA 1AFEH 1C1UH 1VJ9U 1ZSKA 2F83A 3ENSB 4AN7A 1L1JA 1C1QA 1MTNB 4CRDA 4E06H 1BTHH 2FOBA 4A5TS 3DHKH 4ZKRU 2BTCE 1OXGA 2A4OA 1Y3WA 1D4PB 1C5VA 1ARCA 3AVZA 4XBDA 4CHAB 2G5NA 2BVSH 2PFEA 4UONA 4VGCB 1F2SE 1KXFA 1Z1JA 1NZQH 1G3CA 4ZAEA 3T26A 7KMEH 1D6RA 3VPKA 3LT3A 1JBUH 4CR5A 4Y8ZA 1XUHA 3P8FA 1E36B 2KAIA 3QK1A 3ODFA 3ZVEA 1D3DB 2B9LA 1V2VT 4R8TB 3MH7A 3EA8A 1GCTB 1A5GH 1W3CA 3MHWU 4Q7YA 3D49H 2QXGA 4A1TA 2H9TH 1AIXH 7LPRA 1MTUA 2ULLA 3RLWH 1C2MA 2OQ5A 1MTVA 1V2NT 3SUDA 5F8XA 2VWLA 5DP9A 2H9HA 1C5XB 3E90B 1RGQA 1SGFG 2BOHB 3CS0A 1O2YA 4H4FA 4BAOB 2Z9JA 1SC8U 3ZV9A 2FPZA 1OP8A 1RTLA 4INLA 1WQVH 4NG9H 1KLTA 2A31A 2F9OA 2ZFPH 3SQEE 2QIQA 1CT0E 1ZPZA 1FN6A 2VIOA 3B23B 3TK6A 3SJ9A 1V2KT 1TPSA 1G9IE 2TIOA 1EUFA 4X1NU 1EOJA 4A92A 1TMUH 7GCHF 1ZGIA 4O3UA 4GCHG 3A7VA 3L6PA 1BTUA 1N1LA 2H2ZA 3KEEA 3S0NA 1G37A 1W13U 2V3HH 4ABFA 4CH2B 1O2NA 2C93B 2W5EA