1AMHA

Uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKSSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANIONIC TRYPSIN
molecule tags Hydrolase
source organism Rattus rattus
publication title The three-dimensional structure of Asp189Ser trypsin provides evidence for an inherent structural plasticity of the protease.
pubmed doi rcsb
total genus 49
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA02
1CBWB 2Z9JA 1S81A 3RXTA 1H1BA 4UFGH 3QGNB 1TWXB 2VH0A 3RXHA 4KTCA 1O3AA 2B0FA 1ZRBA 4BAKB 5A0BA 2ZU5A 3VB4A 3KCGH 1P3EA 2C8XB 2OLGA 4CHAC 2VNTA 4O3UA 4MPUA 3LGYA 1NFWA 2V6NA 1C5YB 4A92A 1YCPH 1GI8B 1EPTA 1VITH 2BXTH 2ODYB 4B2CA 3FP8E 1Y8TA 3UNRA 1JBUH 4IW4E 4WF8A 1AKSB 1TRYA 4O97A 3UQVA 3MNCA 1HUTH 3RMMH 1UTNA 1NC6A 3UWJH 4X0WU 3V7TA 2GMTB 1DPOA 1GHBF 1ZOMA 5EOKA 1IQEA 4I8LA 5TJXA 2Z6BD 2GZ9A 1GL1A 2H5DA 1QURH 5C3NA 1AWHB 3P95A 1TX8A 1HAGE 6CHAB 1Z7KA 1Z6JH 3GY4A 4AB8A 1DS2E 5I46H 1TNLA 1FIWA 4VGCC 4UFFH 2P3TB 3GCHC 4WXIA 1O3FA 4X1SU 1UMAH 2BHGA 4ESTE 3RXAA 3K6ZA 1QBVH 1SQTA 4B73A 3PLPA 3CP7A 1OWJA 1TA2A 1O5DH 1CHOF 1K28D 1A5IA 2FOCA 2GZ8A 4GCHF 1GI4A 4XBCA 1MBQA 2VH6A 4A7IB 4DW2U 1S83A 1EATA 1SOZA 5DP5A 4NA7A 4YT6H 3RXVA 1A46H 1NT1A 1O30A 2HLCA 5H4IB 1K21H 1D6RA 3K2UA 1FN6A 2UUJB 1NROH 4MQAA 4I7YH 4TWWA 1IQNA 5F8XA 3T25A 1UVOA 4J2YB 1WTHD 2HALA 2XCNA 1KXEA 4X1QU 2BYAX 3RXFA 4H6TA 3Q00A 1AVGH 1O3PB 2VIOA 4DURA 1Y3WA 2P59A 4GCHG 4YLQH 1B0EA 1T8LA 4D8NA 3FZZA 3TGJE 4AB9A 1C5PA 1A4WH 2PGQB 1SHHB 1DM4B 4ZROA 1TMUH 4X6PA 1HPGA 2BLQA 1EAIA 1LPGB 1IAUA 4NZLA 1QY6A 1SBWA 2A32A 1DE7H 4I32A 4RSPA 3QTOH 2TGPZ 1V2PT 4ISNA 3UY9A 3CS0A 1DWBH 2FX4A 2NU1E 3ZVFA 1FNIA 2EI8A 3GCTF 4YO9A 1T7CA 3TU7H 5GIBA 1EP6A 1AHTH 3RLWH 1DY8A 3BTKE 4X1RU 1E35B 1AMHA 1TNGA 4K5ZA 1OWEA 2R9PA 4IS5A 1TPSA 1PQ8A 1UTLM 2Q1JA 2J2UA 4F4OC 3TGKE 4AG1A 3TPIZ 3P6ZB 2XCFA 5K0HA 5TCCA 4FUBA 1BIOA 3S69A 4FVBA 1S82A 1CA0C 2QAAA 4JYUH 2R0LA 2BX4A 1NS3A 1ETTH 1ARCA 1P02A 3MOCA 1TQ7B 4GUXA 1NFXA 3PTBA 3HK3B 1FQ3A 1C1MA 2JKHA 4X2WA 1BTUA 1ZZZA 4NG9H 3A7XA 3BTME 1L4ZA 2NU0E 1GVKB 1G30B 1MH0A 2ZHQH 3OY6U 1HCGA 4DY7B 3E8LA 1RRKA 1K1JA 2ZFRH 4FUJA 3STJA 4DJZB 1HV7A 1UHBA 1MKXH 1P04A 2BVSH 1JOUB 3EDXB 1IOEA 2BD2A 3FAOA 1V2LT 3SI3H 1NU9A 3SNEA 2HNTE 2NU4E 2SGFE 3U98H 3SU1A 1FLEE 4TWYA 2ZO3H 2P93A 1C2JA 1F2SE 3NK8A 1EB1H 5EGMA 1TGTA 3RU4T 3RXSA 1S6HA 1C5QA 4CRAA 3D23A 1CO7E 2VB0A 1OP0A 1SVPA 1EB2A 3F9FA 3U9AH 1LVYA 2GDDA 5EQQA 1O2VA 4CRCA 1PPGE 3KEEA 1IQJA 4TPIZ 4X8VH 1A0JA 1V2QT 4XSKU 4K1EA 5DKMA 1GBHA 1O2HA 1MTWA 2EEKA 1N8OB 1RFNA 8KME2 2VIQA 1GCTC 3MI4A 2PTNA 2PUXB 1ZHPA 3NZIA 2ZU1A 3TGIE 5HXFA 4ZMAH 1K1OA 1QJ1B 3RXEA 4AG2A 1BQYA 3MWIU 1AFQC 3RXDA 1P11E 2FI5E 1O35A 2AGIX 2BQ7B 1N6XA 1OWHA 1HYLA 3GCHB 1O34A 1GDNA 4VGCB 3L3TA 3ZVAA 1O3NA 2ZEBA 2ZHEH 3MFJA 1O3EA 4LOYH 1UHBB 2AEIH 1TBZH 3HKJB 1P57B 1P2NA 4JYVH 3AAUA 3U8RH 1CT4E 2FYRA 3SUDA 1CGIE 4OS2A 1QA0A 5J4QA 1BTYA 3LOXA 4BNRA 3EA9A 3QN7A 4BOHA 2HPPH 1Y5UT 2STAE 1J14A 3MO6A 2A4RA 1QNJA 2QIQA 2EI7A 1IQIA 1MKWK 1SHYA 5FPSA 1QL7A 2V3OH 2DE9A 3SGBE 5A8XA 4AGJA 3A7VA 3EA8A 1NRSH 3RU4D 1BHXB 1D3PB 3RXUA 4FVDA 4JYTA 3RXBA 4AOQA 4K69A 1P09A 1LVMA 2PGBB 2PTCE 1ARBA 1EASA 2ANMH 3A88A 1IQLA 3TK6A 1AB9B 5EG4A 4Y6DA 1T32A 4CRFA 4ISIH 1T31A 3HKIB 1P2JA 4Y0YE 2ZGXH 1ZJKA 2AMQA 1O32A 3R0FA 1CA8B 1F5RA 5C5OA 2ZA5A 4NSYA 3SU4A 1LHDH 2Z3EA 1V2OT 5DO4H 3Q76A 3A8DA 4OS6A 4FUFA 1GI6A 1O2WA 2ZTYA 3T2NA 3GICB 2VWNA 2FYQA 1OSSA 1MD8A 1OP2A 2C8YB 1D6WA 2Y80A 1SSXA 4JZFH 4ABGA 1LTOA 1O2UA 1KDQA 3M7QA 4Z6AH 2BD9A 3SU2A 2PHBA 2ZF0H 8GCHG 1YP9A 3IITA 4ZKNU 2FOHA 2VIVA 3BTDE 1BRBE 1SLUB 1GHZA 1KYNA 2A1DB 2J34A 2IN2A 3P8GA 4NWKA 2VWLA 2BY7X 3E3TA 2VIPA 1ELCA 5GDSH 3BV9B 1ZGVA 4ZXXH 1F0UA 1V2UT 2RCEA 4BTIB 3BG4C 1Q3XA 1XUJA 5AFZH 2VWMA 1VJ9U 3A84A 1GWAA 2O8MA 3ZZ6A 2Q6DA 5T6FA 1KIGH 2H6MA 5A0AE 1AZ8A 4E05H 1GBBA 1XX9A 3A7ZA 2R3UA 3BIUH 3TNSA 3GY3A 1VR1H 1Z8RA 2CF9H 3GDVA 1G9IE 4AYYB 1EX3A 1O2MA 2BVRH 1KTSB 1KXAA 2FM2A 5LPRA 4YOJA 4H6SB 1GBIA 4JZDH 9ESTA 5GCHG 1LHGH 1CT2E 1GJ5H 3OSYA 4KP0A 3W95A 3SQEE 3O8BA 4TY6A 1HJ8A 1AUTC 1GBEA 5FPTA 2GKVE 5ETXA 4KELA 3RXMA 2PWXA 1TBRH 3I29A 3ZZBA 3SUFA 1HGTH 1ANCA 5DG6A 1WQVH 2ZFFH 4Y71A 1GJ7B 1GJ9B 3M3VA 2A7CA 5E0GA 1O3HA 3ESTA 1ZMJA 1BITA 2R2MB 3BEFB 4X8SH 1M9UA 3LJJA 2CJIA 1SFIA 3ZZ7A 2XWBI 4IN1A 1GJ6A 3RXCA 1GJCB 2ZDKA 1MCTA 2ZGCA 3GY7A 2XTTB 4E7RG 2Y5HA 1O39A 1O5CB 2JH5D 1VCWA 5G4BA 2FMJA 3TVJB 1RD3B 4JK6A 3QZQA 4TY7A 1OXGA 3UR9A 2HWLB 2C4FH 1DOJA 4JZ1A 2P8OC 1SGNE 1OWDA 3MH4A 3VB3A 3LT3A 1ELEE 1BBRK 4Q2KA 2ODPA 1SQOA 2QYIA 1JRTA 3RC5A 1LHFH 1TE0A 3UIRA 5JBTA 1V2MT 5C67A 4DG4A 3TLOA 3GOVB 1MTNB 3MU1A 4GHTA 4O03A 3FZDA 1BRUP 1DITH 4MPXA 4DOQA 4Y8ZA 2ILNA 3SI4H 3F9HA 4DVAU 4B76A 3ZZ3A 4ABFA 1Q2WA 1PFXC 3A8AA 3SUGA 1EJNA 3QZRA 4HI3A 1A5HA 2SGPE 2H9EH 1TOMH 2OBOA 4ZHAA 1Y3XA 1GGDC 1L0ZA 1AIXH 1FMGA 3BTWE 1P05A 1P2IA 1C1TA 3LDXH 1V2TT 3VB6A 1YKTA 2GT7A 2ZCHP 3MU4A 4CH2B 1UTPA 1SGFG 1F92A 1F0SA 1BOQA 3O8RA 1BJUA 3UPEA 4MG3A 4NFFA 1TBQH 2W26A 1NFUA 4I8KA 1XM1A 1ELGA 1A2CH 1U6QA 1GJAB 4ABHA 1O2SA 3LC5A 3PMAB 2ZDVH 3U8TH 4ZAEA 1A3BH 2VIWA 3KGPA 1FV9A 3F68H 1L4DA 1Y3YA 3ZZAA 1MAXA 2ZKSA 3KQBA 4B71A 1O3DA 2QV1A 1C5ZB 3SQHE 4YT7H 2GZ7A 1EZXC 5JPMH 2OD3B 2XWAA 2BM2A 1EJAA 3BG8A 3UUZA 2WPLS 2QXJA 2GP9B 3QTVH 4Q7YA 3S9AA 1O5EH 3ATMA 3RXIA 3UTUH 2O8TA 1FONA 1Y3VA 4NIWA 1Z8IB 2EI6A 1C2EA 1FY8E 1UTKA 2UUKB 4Q80A 2O8WA 1JMOH 1PPEE 1XUIA 2ZDAH 1H9HE 1K1LA 1P12E 2OQ5A 3W94A 1O33A 1TNJA 2CV3A 1AVXA 1GHAF 1UJ1A 1SGTA 3BTHE 1KXBA 4GLYA 1G3BA 1QJ7B 4WMEA 1ABJH 1D3QB 2BD5A 1TABE 3QGJA 1V3XA 1QR3E 1O2ZA 2P16A 1DICA 5GJ4B 4IBLH 1P2OA 4ZHMU 3OU0A 2BQ6B 2W7SA 1AY6H 3DD2H 1YPHE 1O0DH 1TGSZ 4XBDA 4ASHA 1LHEH 1LVBA 2O8UA 1ABIH 1B5GH 5A0CA 1LVOA 5ABWA 4GSOA 1JIMA 2BMGB 1KLIH 5ESTE 2IPHA 1FPHH 2VVVA 1RGQA 3KQEA 5DGJA 4UFEH 2C93B 3LGVA 4O9VA 4MNVA 1C2GA 2JETB 2ZHFH 3FP7E 3QDZB 1FUJA 3CS7A 4FUIA 1LPKB 2FI3E 2AGEX 3Q3YA 1FZZA 2ANKH 4INHA 4BAOB 1N8OC 2ZGJA 4OS5A 1SLVB 4TYDA 2D8WA 1VJAU 1AFEH 4CR9A 5JBCS 5EODA 1SR5C 2FOEA 3R3GB 1QHRB 1C2MA 1UCYK 1C5MD 2JH0D 2GV7A 3ITIA 1O3LA 3SNBA 4NIXA 1C1RA 4NZQA 3OTJE 3T62A 4ZXYH 5HM9A 4ABIA 1SMFE 2ZFTA 1ZTJA 1XXFA 1TYNA 1B7XB 1GCDA 1CGJE 1WTGH 4THNH 5E2PA 3AASA 1ESTA 3A7YA 1JWTA 1C2DA 4H4FA 4AYVB 1SLWB 2JH6D 2PKSB 1F5KU 1ANDA 2M5TA 4X1PU 1MU8B 2B8OH 1WV7H 4NSVA 2P95A 4Y79A 4B2BA 1FN8A 1FJSA 3BF6H 3RMOH 1NY22 5AHGH 1C2FA 2A5IA 5AF9H 3EA7A 1EAUA 3E0PB 4OS1A 3O8DA 3BTTE 4CRGA 2FESH 4F49A 4YM9A 4CRBA 1EAXA 3LC3A 1GI7B 2CHAC 1TLDA 3M35A 4Z0KA 1DXWA 1VCPA 1C5TA 3UR6A 4MNXA 3I77A 5E8EH 2PLXA 1GDUA 2H9TH 3C1KA 1IQKA 2BOKA 4ZUHA 3FFGA 1P2QA 4FU9A 2PKSC 3SJIA 1QB1A 1BRAA 8GCHF 2Q6GA 1YM0A 2XC5A 1K1PA 2FOMB 1C1NA 3ATKA 1BMMH 1W12U 4A6LA 1GI0A 1YPEH 3DUXH 2FI4E 1SLXB 4AX9H 1QIXB 1EZUC 2FO9A 1DLKB 4BXSA 1D3TB 1LKAA 1O5BB 1XXDA 2V0BA 3AW0A 1F0TA 6LPRA 5DP3A 1HBTH 3JZ2B 2BY5X 1ZMNA 2BZAA 1RTKA 2FOGA 3U8OH 2Y7XA 1C1VH 1HAZB 1S0QA 4ZKOU 1PQ5A 1Z71A 1OS8A 4NCYA 1ZSLA 1A0HB 2F9NA 2FXRA 2J4IA 1FY1A 2W3IA 3ZVCA 3RMLH 1TB6H 3OY5U 1HJ9A 1DSTA 2XBYA 3UQOA 3ATIA 3M3SA 1SL3A 2WV4A 1XMNB 4X2VA 1C5XB 1NRNH 2P3FH 1XUKA 3UOUA 3T26A 4K8YA 1C2HA 3URDA 4J1YA 4NA9H 2FWWA 3SV8A 1FY3A 4AGKA 4ZH8A 2A45B 4Y10E 4ZKRU 1LQEA 3VXEH 1O2YA 1SGEE 1W0ZU 1DT2A 1IHTH 1O2GH 2FTLE 1XVOA 1DFPA 5JB8S 3ZVGA 2A4OA 3M7UA 4K1TA 4WXVA 1QA7A 2J95A 5JB9S 1KDQB 5HMAA 1BTHH 4XFQA 4A1TA 1GI3A 2BOHB 1ESAA 1LPZB 1FXYA 1WYKA 3DA9B 1C4V2 2OQUA 3ZZ4A 4OS7A 3MHWU 4YOIA 2ZDNA 2ESTE 5F8ZA 3STIA 1CE5A 3KNXA 2A2QH 1GHBG 2F9OA 1EOJA 3SJKA 1C5UA 3ATWA 3M7TA 1UVPA 4R8TB 1A5GH 4H42U 5EPYA 1TRNA 3VPKA 3S9CA 5HM2A 5LH8A 1F0RA 2DE8A 2G52A 1SGPE 4I31A 2OC8A 3PWCA 2A0QB 2TGTA 1BB0B 1DLEA 1GHVH 3Q77A 2HPQH 2IJOB 5L30H 3PWBA 1KTTB 3KHVA 2OC1A 1J8AA 5L6NH 5B6OA 2O9QA 2OCVB 2HNTC 4A1XA 3A80A 1SFQB 1OWKA 1P3CA 1N1LA 4HTCH 3T28A 3LU9B 3ZVEA 2BDBA 1MTSA 1YYY1 3RUOA 1MMJN 3SGQE 3SU3A 1SGRE 1HAXB 5T6DA 1UTMA 1BBRE 3PROA 4MTBA 2WPHS 3FANA 3NXPA 1YPLH 1IQHA 1KXFA 2FZZA 2GMTC 3SJOA 4B2AA 3EE0B 1INCA 1QL9A 1YLCA 2BTCE 2TRMA 1KY9A 3BTEE 2XBXA 4NA8A 4X6MA 1LO6A 2ZFPH 3BEIB 3ZZ8A 5GCHF 1C1UH 1N6YA 2NU3E 4YZUA 2XW9A 1E38B 1NPMA 1T8NA 3GCOA 3SUEA 3SZNA 2QXGA 2B5TB 4IC5A 2VJ1A 1TOCB 1QFKH 4KTUA 4CHAB 5FBIA 4ABDA 2P3UB 1GJBB 4YESB 5LPEA 2F9BH 1QRZA 3RXRA 4R0IA 4FXGH 1HAYB 1VITF 4K2YA 1C4U2 2ZPQA 1DWCH 5BPEA 1ZGIA 1GI1A 1QRXA 4FUGA 5JBBS 2J9NA 1CVWH 4MNYA 2SGDE 1HFDA 3QLPH 3EGKH 2CHAB 2ZQ2A 3A82A 3RM0H 3V3MA 1V2NT 1UVTH 3BSQA 3UFAA 2VU8E 3MTYA 1C1PA 1C2IA 3PO1C 1ELVA 1VGCB 4AFSA 1ZSKA 2ZU2A 1TRMA 1ANBA 1FY4A 3LJOA 1HAIH 4BTTB 2SGQE 4OGYA 2B9LA 3SU5A 4I8JA 1QCPA 1G37A 3PM3A 1HAHH 1P06A 1QL8A 1O3JA 2QN5T 3LH1A 1CQQA 5JDUB 5EQRA 1CSOE 2OTVA 1FY5A 3D65E 4RKJB 2Z3CA 2ASUB 1GBCA 2V35A 3ODDA 4O3TA 1Q31A 2KAIA 3PTNA 1HJAC 1DY9A 2BDIA 1BTWA 3S7KB 2ALVA 1PPBH 2G5NA 4UFDH 1TQ0B 2H1UA 2BLOA 3M5OA 3ZVDA 2HGTH 2DUCA 1XKBC 2ZGBH 4IMQA 5SGAE 1XUHA 3MU0A 4X1NU 1C5LH 2UWOA 1O38A 5C1YA 3TITA 2RDLA 1GBTA 1MD7A 1C5RA 1XUGA 1HDTH 1T8OA 4I33A 1G32B 7ESTE 2A7HA 1TGNA 8LPRA 5EW1H 1AWFH 4CREA 4ZHLU 3TJNA 1FAKH 2PR3A 1CT0E 5K7RA 3URCA 4Y76A 1GI9B 3JZ1B 1PYTD 3DHKH 2J92A 1C5WB 2ZG0H 3E91A 1EUFA 1A1RA 3KF2A 1PPCE 3MH7A 3PMHB 1ID5H 2BD7A 1GBJA 3A85A 2WPJS 2BZ6H 4PROA 1TONA 4K8BA 1GPZA 1K9OE 2GV6A 2XNIA 1O2NA 2BDHA 1GVLA 3BTGE 2YNAA 3E6PH 1FI8A 2OXSA 1QJ6B 4DIIH 2JETC 5GPIB 3KIDU 6GCHF 2F9VA 7GCHG 2GTBA 3VFEA 4MPVA 3UNQA 2G00A 3TK9A 3MO3A 3A83A 2BD8A 2CN0H 4UDWH 2XXLA 3G01A 1C1SA 1G36A 1O2PA 1W3CA 1YLDA 2AH4X 2V3HH 2FLBH 3AAVA 4B1TA 4D7FA 7LPRA 2SGAA 5EXMA 1PPZA 2FTMA 4ZKSU 1W13U 4K1SA 4AN7A 2LNCA 3IWMA 4QT8C 2P94A 2QXHA 1UTOA 1MTUA 1AE8H 3U1JB 1C5OH 2AFQB 1YCPK 3TJUA 3L6PA 2GGVB 1ACBE 3BN9A 3BIVH 4OS4A 5BRRE 1GBFA 4UONA 1BZXE 1W10U 3A87A 2GCHF 1O37A 3P8OA 5C20A 5C1XA 3ZZDA 1AB9C 3M5LA 2O8LA 3ZZ5A 2C90B 2FX6A 1GBAA 2A4QA 1MTNC 1W8BH 4WMDA 4BANB 3GDUA 2VIDA 1ELAA 4FUEA 2R0KA 2ZU4A 5F6MA 3RM2H 2ZHDA 2ANWA 4DGJA 2ZCKP 1MUEB 3B8JA 4LZ4B 3K6YA 1EJMA 5F03A 1UTJA 3KL6A 1ZTKA 2WINI 2HVXA 3SU0A 5JYIA 2AERH 4FUHA 4IMZA 2UUFB 5FBEA 3D62A 1W0YH 3PV4A 1V2JT 1FDPA 9LPRA 2HNTF 2GCHG 1GL0E 1Y59T 1QQUA 1DVAH 3N7OA 2G4UA 1QQ4A 3NKKA 1EXFA 1V2WT 4ISOA 1HAPH 1AGJA 1WBGB 3P8NA 1GMDG 1SGYE 1THSH 1ZMLA 3K65B 5FHTA 1ZYOA 1P9UA 3B23B 1C5VA 1O2QA 1MU6B 3P70B 4UEHH 5CHAB 1MQ6A 4U2WA 3UREA 1GHYH 1DUAA 2R2WU 4DIHH 2FS9A 1V2KT 5DJ7A 4GVUA 1TGCA 2WUCA 2BXUH 1C2KA 4D9QA 1AO5A 1MBMA 1O3KA 1WAYB 3RXKA 4CR5A 3DT0H 4JCNA 1DSUA 1HIAB 2ZTXA 4KGAA 4SGBE 4AORA 4MVNA 2TIOA 1EPTC 3ZVBA 5AVDA 2Y7ZA 1DX5M 1C2LA 3ATLA 2ZNKH 3E1XB 4WH6A 5A8YA 3RP2A 1E34B 1THPB 5FPYA 1QB6A 3U1IB 1GJ8B 4Y8YA 2FS8A 2D1JA 2Y5GA 4Q7ZA 1O2LA 1O5AB 1LKBA 4MLFB 3GY5A 1A0LA 3S0NA 1W7GH 3V13A 3HGPA 1BUIA 4ABJA 2BY9X 4WVPE 4ABBA 5A2MH 1HJAB 2W7UA 2TGDA 1SGIB 2VGCB 2LPRA 5FAHA 2SNWA 1BTPA 1UCYE 2CF8H 1G2LA 1UK3A 1YPKH 2BDGA 2OUAA 5F8TA 2AGGX 1MKWH 3QO6A 1O3OA 1CBWC 3LGIA 1TMTH 2BDAA 3RMNH 1GHWH 2EA3A 3NWUA 3QWCH 1J9CH 2XBWA 2ZC9H 3F9EA 2OC7A 4OGXA 3ELAH 4Y0ZE 5FX6A 2ZCLP 1P8VC 1TX6A 3BTFE 1EOLA 3VGCC 3PO1B 4D7GA 4Y7BA 1TPAE 1FAXA 1EZQA 1DANH 5EPNA 2TBSA 5LGOA 4E06H 1AQ7A 2BQWB 5C1UA 2Y6TA 2ZIQH 3TIUA 3F6UH 3H7OA 2IOTA 4MPWA 2J38A 2BD3A 2WYGA 2FIRH 4GAWA 1QBNA 1XVMA 2BD4A 3SOSA 3T27A 1UO6A 3NPSA 2VGCC 4XOJA 1GHAG 1H9LB 1V2RT 3GCNA 1O2RA 5IYTA 3SU6A 3P8FA 2BY8X 1ELDE 1LMWB 2AIPA 2WYJA 3H5CB 1WSSH 2PUQH 1OX1A 2Y82A 2SFAA 1E37B 4HFPB 1WCZA 1C9TA 4XE4A 1GMCG 5HGGA 2CMYA 1T4UH 1L1JA 3O8CA 1NM6A 1UTQA 4WWYA 2SGEE 1O2IA 3SV9A 4NIVA 2QCYA 3Q3XA 1YF4A 1PPHE 1T4VH 2F91A 4ABAA 2F83A 2ZDLA 1DWEH 5CMXH 2FODA 2ZECA 1CU1A 4CBNA 1RTFB 1HAVA 4UD9H 4U30A 3ZV8A 3OX7U 4X8UH 2W3KA 1ORFA 2AIQA 2G51A 4LZ1H 2RA0A 5CHAC 3A7WA 3Q3KA 2ZI2H 1ELTA 1T8MA 1O31A 4U32A 1QB9A 2ZQ1A 1BBRH 1MKXK 2FPZA 1O2KA 1AVWA 1D4PB 4Y11E 4YLUA 4XBBA 5PTPA 2RA3A 1ZLRA 1G3DA 3ENSB 1NO9H 1GG6B 4AFUA 1GBLA 4BAHB 4E7NA 1BHXF 1AN1E 2UUYA 4IGDA 3M36A 3TH2H 2BX3A 3MMGA 3RC4A 1O2XA 1AI8H 1YGCH 1BMAA 1E0FD 1S5SA 1W14U 1SGFA 3H7TA 5ESBA 2Z3DA 5EXNA 3GYMA 1E36B 1SC8U 4IC6A 1XUFA 4X2XA 2HOBA 3HATH 4BXWA 3MU8A 4ISLA 5T3HA 3UNSA 4JMYA 2ZDMA 1UCYH 2F9UA 2STBE 2B7DH 2TPIZ 3TK5A 1TNHA 4MNWA 1K1NA 3ZZ9A 1FIZA 2K1QA 2FEQH 3PMJA 2THFB 3M5MA 1G3CA 1P10A 1GBDA 2XC0A 3AW1A 2RG3A 3GY6A 3SHAH 7KMEH 1NU7B 5L2ZH 2A31A 2GD4B 2ZGHA 1NTPA 5E0HA 2ZTZA 2PV9B 7GCHF 1TA6A 1Z8GA 2QA9E 3TH4H 3DFJA 1L1NA 3FP6E 2ZPSA 5FCKA 1PYTC 4INKA 3NUMA 1GBKA 1TPPA 1Y5AT 5DP9A 1ZTLA 3HK6B 2A5KA 4CRDA 1HXFH 4I8GA 1NESE 1RJXB 1ZJDA 1F5LA 3EQ0H 2UWPA 1J15A 1HAOH 1V2ST 1OWIA 4NFEA 2J94A 3KQDA 5A09A 3VGCB 1DWDH 2GVFA 1VCQA 1KLJH 1GJDB 3A86A 2H9HA 5E0JA 1V2VT 3M3TA 2GT8A 4NIYA 1SGDE 5DK1A 2AMDA 2PW8H 2Q6FA 2G8TA 1RS0A 2WPMS 1GHXH 1KLTA 3PYHA 3S7HB 1NFYA 1GCTB 2ZFQH 1AD8H 1QGFA 5C2ZA 1UK4A 1CHGA 1EQ9A 2FLRH 1K22H 2G5VA 1PQAA 4LXBH 1TNKA 2Z9LA 4WJG2 1EAWA 1UK2A 3E90B 2BLVA 3MNSA 1B0FA 1ZHRA 3SORA 4DCDA 3SNDA 4Q7XA 1ELBA 1P2KA 3M61U 1DUEA 1X7AC 1GDQA 1SI5H 1VGCC 4MDSA 3MO9A 5FCRA 4D76A 1J16A 1ZSJA 1BCUH 1BTZA 1G2MA 2KAIB 5JBAS 1ZRKA 3MH6A 5L2YH 4I8HA 1NN6A 1EZSC 1PQ7A 2A5AA 4Y8XA 3TNTA 5E2OA 1W11U 1QRWA 2SNVA 5DP8A 1SGCA 3SHCH 3ZYDA 4B75A 1HLTH 4SGAE 3BTQE 5CE1A 1BJVA 1P03A 2BDYA 1HIAA 2ZU3A 1SQAA 1QBOA 5GWZA 2F9PA 5DPAA 1TNIA 2Z94A 1ETRH 1UVUH 5EU8A 3LPRA 1NRQH 1TAWA 2BDCA 2G55A 3RXJA 3SW2B 5EXLA 1GMCF 2GCTB 8ESTE 1LCYA 1ETSH 2XC4A 3KQCA 2UWLA 2BY6X 3LIWA 3M37A 1AUJA 1OOKB 1YPHC 2FOBA 2D2DA 2AMPA 1ELFA 1P9SA 2CXVA 1SG8B 2XRCA 2QF0A 2GCTC 1O5FH 1KXDA 3LGUA 1BTXA 1YPJH 4UE7H 1TMBH 5DP7A 2FOFA 3MU5A 3A7TA 3AVZA 4X2YA 2A4GA 3GY8A 1O2OA 1P2MA 1S0RA 2PFEA 3LGWA 2VVCA 3S9BA 4TPYA 1SPJA 1GMHF 1ZR0A 4CBOA 3ZYEA 2NWNA 2YOLA 1HXEH 1O36A 1BDAA 4AFQA 1GMDF 3LGTA 4FUCA 4ABEA 2G81E 5EQSA 2Z7FE 3ZV9A 3PLKA 4BAQB 1SGQE 1K1IA 3VXFH 2PKAA 1W7XH 1PJPA 3GY2A 3PMBB 1D3DB 3VB7A 1Y5BT 1DDJA 2D26C 5A8ZA 2Z9GA 2BVXH 2Y81A 1C9PA 1YC0A 3A8CA 2H2ZA 3I78A 1CHOG 1Z8JB 2YNBA 4K3JA 4JZIA 4KTSA 4NGAH 1NRRH 6GCHG 1F7ZA 3VEQB 4RKOB 1PPFE 1LHCH 4YTAA 3BEUA 1THRH 3C27B 1MTVA 5LPFA 3SJ8A 2NU2E 3P92A 3LKWA 3F1SB 2VWOA 1IHSH 3GCTG 4HZHA 1D9IA 5FX5A 3RXLA 5TCAA 2C8ZB 1OPHB 2CGAA 2GDEH 3UWIA 1H4WA 1OP8A 4GPGA 1C1QA 1ZHMA 2GX4A 2ODQA 1TGBA 1LQDB 1ZPBA 3A8BA 1NRPH 4Y7AA 3SJ9A 3A81A 4INLA 1TFXA 5DP6A 1L2EA 2PKAB 3D49H 3PLBA 2BLWA 2QF3A 3RU4E 1RIWB 1YBWA 2C3SA 1RTLA 1C1OA 5EW2H 1O2JA 1MAYA 2ZP0H 5T6GA 2WV5A 1KSNA 1YPMH 3MH5A 4RN6A 2ALPA 3OYPA 3SGAE 1G3EA 1HB0B 1Y3UA 2ZPRA 3U69H 1BMNH 4DT7B 3LH3A 3HGNA 2OC0A 1HAVB 4X6OA 4FUDA 4B74A 1VZQH 5AFYH 1H8IH 1Z1IA 4FU7A 1WOFA 2OINA 1P01A 3VB5A 2QY0B 2WPKS 1JIRA 1WUNH 3RLYH 1HRTH 2H5CA 1ZPCA 1AFQB 1H8DH 3SBKA 1A61H 1BMLA 1O3IA 1TIOA 2XBVA 1MQ5A 1TALA 3QK1A 4GHQA 1GI5A 3T5FH 1QTFA 4AFZA 1OYQA 4IN2A 6CHAC 4D9RA 3MYWA 3RXQA 2ANYA 4NWLA 3TJVA 1RIWC 1TX7A 1GMHG 1K2I1 6ESTA 3TJOA 2ZHWH 3DFLA 3MNBA 4X8TH 4X6NA 3RXOA 4HGCA 1JXPA 3SO3A 1C5SA 1C5NH 2TGAA 2C8WB 4CH8B 1BT7A 1OKXA 2WPIS 1S84A 4FU8A 1SB1H 3KN2A 4YOGA 2Y5FA 1GG6C 5HYOA 2QGRA 3SNCA 4A1VA 2OBQA 2VINA 2EC9H 1V6DA 1BRCE 4WY3A 2A2XH 1AU8A 3UOPA 3RXGA 1Z1JA 1NZQH 2FOAA 1ESBA 1K1MA 1GGDB 2AYWA 2XYAA 3GISB 3TH3H 1LDTT 1O3BA 3MNXA 2AS9A 3E0NB 2ULLA 1SOTA 2ZZUH 1DXPA 2F3CE 3T29A 1MZDA 1MZAA 3E16B 1EP5A 1HNEE 1ANEA 4XDEA 1S85A 5GXPA 3QUMP 2QXIA 3EAJA 1O3MA 1WU1A 3PB1E 1Z6EA 3IG6B 3ZZCA 1A7SA 2HRVA 4AZ2B 3GYLB 1P0SH 1FPCH 4KKDA 1O3GA 5J4SA 1KXCA 3SV6A 1L1GA 4JZEH 2ZWLH 3ODFA 3EYDA 4LK4A 2G4TA 1CA0B 2P8OB 1S6FA 3RXPA 1WQSA 1EPTB 2Z9KA 2PSYA 1EKBB 1O2TA 3B9FH 5DP4A 3M5NA 3L33A 1GBMA 3P17H 4ISHH 3CENA 1IQGA 2A7JA 1MCVA 3FVFB 1C1WH 4WH8A 4A5TS 1AKSA 1CGHA 3LONA 3RC6A 4WMFA 4BTUB 1O3CA 1IQMA 3GDSA 3V0XA 2WUBA 1GI2A 3K9XB 1ZPZA 4U01A 1GVZA 2Z9IA 2QC2A 1C4Y2 2R3YA 1RXPA 2FP7B 1OYTH 3BG4B 1GJ4H 1YPGH 1O5GH 1H9IE 3F9GA 1AE5A 3SV2H 3SV7A 5I25A 2ZFSA 2W5EA 1W2KH 2PSXA 4JK5A 2VVUA 1AZZA 1J17T 2FDAA 1UVSH 5C5NA 2I6QA 3HPTB 4BAMB 1YCPM 1IQFA 5FXLA 1XKAC 3SN8A 5IDKA 3NCLA 3SNAA 1VITG 1JRSA 3V12A 2BB4A 3A89A 1TPOA 4K60A 1A3EH 2I6SA 3QX5H 2OP9A 1BA8B 3WY8A 3RDZA 4M7GA
chains in the Genus database with same CATH superfamily
1CBWB 2Z9JA 1S81A 3RXTA 1H1BA 4UFGH 2KZ4A 3QGNB 1TWXB 2VH0A 3RXHA 2HLDD 4KTCA 1O3AA 2B0FA 1ZRBA 4BAKB 5A0BA 2ZU5A 3VB4A 3KCGH 1P3EA 2C8XB 2OLGA 2OK5A 4CHAC 2VNTA 4O3UA 4MPUA 3LGYA 1NFWA 2V6NA 1C5YB 4A92A 1YCPH 4ASUD 1GI8B 1EPTA 1VITH 2BXTH 2ODYB 3U28C 4B2CA 3FP8E 1Y8TA 3UNRA 1JBUH 4IW4E 4WF8A 1AKSB 1TRYA 4O97A 3UQVA 3MNCA 3OTPA 3RMMH 1HUTH 1UTNA 1NC6A 3UWJH 4X0WU 3V7TA 2GMTB 1DPOA 1GHBF 1ZOMA 2K8IA 5EOKA 1IQEA 4I8LA 5TJXA 2Z6BD 2LP6A 2KFWA 5HKKD 2GZ9A 1GL1A 2H5DA 1QURH 5C3NA 1AWHB 3P95A 1TX8A 2QF5A 1HAGE 6CHAB 1Z7KA 1Z6JH 3GY4A 4AB8A 1DS2E 5I46H 1TNLA 1FIWA 4VGCC 4UFFH 2P3TB 3GCHC 4WXIA 1O3FA 4X1SU 1UMAH 2BHGA 4ESTE 3RXAA 3K6ZA 1QBVH 1SQTA 4B73A 3PLPA 3CP7A 1OWJA 1COWD 1TA2A 1O5DH 1CHOF 1W0KD 1K28D 1A5IA 2FOCA 2GZ8A 4GCHF 1GI4A 4XBCA 1MBQA 2VH6A 4A7IB 4DW2U 1S83A 1EATA 1SOZA 5DP5A 4NA7A 4YT6H 3RXVA 5KECA 1A46H 1MABB 1NT1A 1O30A 2HLCA 5EJ1A 5H4IB 1K21H 1D6RA 3K2UA 1FN6A 2UUJB 1NROH 2KCPA 4MQAA 4I7YH 4TWWA 1IQNA 5F8XA 3T25A 1UVOA 4J2YB 1WTHD 5C0UA 2HALA 2XCNA 1KXEA 4X1QU 2BYAX 3RXFA 4H6TA 3Q00A 4B6EA 1AVGH 1O3PB 2VIOA 4DURA 1Y3WA 2P59A 3WW7A 4FOUC 4GCHG 4YLQH 1B0EA 1T8LA 1QZ8A 4D8NA 3FZZA 3TGJE 4AB9A 3PV5A 1C5PA 1A4WH 2PGQB 1SHHB 1DM4B 4ZROA 1TMUH 4X6PA 1HPGA 2BLQA 1EAIA 1LPGB 1IAUA 4NZLA 1QY6A 1SBWA 2A32A 1DE7H 4I32A 4RSPA 3QTOH 5EJZA 2TGPZ 1V2PT 4ISNA 3F2HA 3UY9A 3CS0A 1DWBH 4Q4LA 2FX4A 2NU1E 3ZVFA 1FNIA 2EI8A 3GCTF 4YO9A 1T7CA 3TU7H 5GIBA 1EP6A 1AHTH 3RLWH 1DY8A 3BTKE 4X1RU 1E35B 1AMHA 1TNGA 4K5ZA 1OWEA 2R9PA 2KM0A 4IS5A 1TPSA 1PQ8A 1UTLM 2Q1JA 2J2UA 4F4OC 3TGKE 4AG1A 3TPIZ 3P6ZB 2XCFA 5K0HA 5TCCA 4M9FA 4FUBA 1BIOA 3S69A 4FVBA 1S82A 1CA0C 2QAAA 4JYUH 2R0LA 2J98B 2BX4A 1NS3A 1ETTH 1ARCA 1P02A 3MOCA 1TQ7B 4GUXA 1NFXA 3PTBA 3HK3B 1FQ3A 1C1MA 2JKHA 4X2WA 4XRNA 2EQNA 1BTUA 1ZZZA 4NG9H 2V7QD 3A7XA 3BTME 1L4ZA 2NU0E 1GVKB 1G30B 1MH0A 2ZHQH 3OY6U 1HCGA 4DY7B 3E8LA 3PV2A 1RRKA 3OFND 1K1JA 2ZFRH 4FUJA 3STJA 4DJZB 1HV7A 1UHBA 1MKXH 1P04A 2BVSH 1JOUB 3EDXB 1IOEA 2BD2A 3FAOA 1V2LT 3SI3H 1NU9A 3SNEA 2HNTE 2NU4E 2SGFE 3U98H 3SU1A 1FLEE 4TWYA 2ZO3H 2P93A 1C2JA 1F2SE 3NK8A 1EB1H 5EGMA 1TGTA 3RU4T 3RXSA 1S6HA 4ZCNA 1C5QA 4CRAA 3D23A 1CO7E 2VB0A 1OP0A 1SVPA 1EB2A 3F9FA 3U9AH 4XD7D 1LVYA 2GDDA 5EQQA 1O2VA 4CRCA 1PPGE 3KEEA 1IQJA 4TPIZ 4X8VH 1A0JA 1V2QT 4XSKU 4K1EA 5DKMA 1GBHA 1O2HA 1MTWA 2EEKA 1N8OB 1RFNA 8KME2 2VIQA 1GCTC 3MI4A 2PTNA 2PUXB 1ZHPA 3NZIA 2ZU1A 3TGIE 5HXFA 1VKYA 4ZMAH 1K1OA 1QJ1B 3RXEA 4AG2A 1BQYA 3MWIU 1AFQC 3RXDA 1P11E 2FI5E 1O35A 2W6JD 2AGIX 2BQ7B 1N6XA 1OWHA 2WPDD 1HYLA 3GCHB 1O34A 1GDNA 4VGCB 3L3TA 3ZVAA 1O3NA 2ZEBA 2ZHEH 3MFJA 1O3EA 4LOYH 3PRDA 1UHBB 2AEIH 1TBZH 3HKJB 1P57B 1P2NA 4JYVH 3AAUA 3U8RH 1CT4E 2FYRA 3SUDA 1CGIE 4OS2A 1QA0A 5J4QA 1NBME 1BTYA 3LOXA 4BNRA 2WV9A 3EA9A 3QN7A 4BOHA 2HPPH 1Y5UT 2STAE 1J14A 3MO6A 2A4RA 1QNJA 2QIQA 2EI7A 1IQIA 1MKWK 1SHYA 5FPSA 1QL7A 2V3OH 2DE9A 3SGBE 5A8XA 4AGJA 3A7VA 3EA8A 1NRSH 3RU4D 1BHXB 1D3PB 5KGOA 4FVDA 4JYTA 3RXUA 3RXBA 4K69A 4AOQA 1P09A 1LVMA 2PGBB 2PTCE 1ARBA 1EASA 2ANMH 3A88A 1IQLA 2EY4C 3TK6A 1AB9B 5EG4A 4Y6DA 1T32A 3N7DA 5C0TA 4CRFA 4ISIH 1T31A 3HKIB 1P2JA 4Y0YE 2ZGXH 1ZJKA 2AMQA 1O32A 3R0FA 1CA8B 1F5RA 5C5OA 2ZA5A 4NSYA 3SU4A 1LHDH 2Z3EA 1V2OT 5DO4H 3Q76A 3A8DA 4OS6A 4P00A 4FUFA 4TT3D 1GI6A 1O2WA 2ZTYA 3T2NA 3GICB 1YWUA 2VWNA 2FYQA 1OSSA 1MD8A 1OP2A 2C8YB 1D6WA 2Y80A 1SSXA 4JZFH 4ABGA 1LTOA 1O2UA 1KDQA 3M7QA 4Z6AH 2BD9A 3SU2A 2PHBA 2ZF0H 8GCHG 1YP9A 3IITA 4ZKNU 2FOHA 2JJ2D 2VIVA 3BTDE 1BRBE 1SLUB 1GHZA 1KYNA 2A1DB 1WXRA 2J34A 2IN2A 3P8GA 4NWKA 2VWLA 2BY7X 3E3TA 2VIPA 3SZEA 1ELCA 5GDSH 3BV9B 1ZGVA 4ZXXH 1F0UA 1V2UT 2RCEA 4BTIB 3FO8D 3BG4C 1Q3XA 1XUJA 5AFZH 2VWMA 1VJ9U 3A84A 1GWAA 2O8MA 3ZZ6A 2Q6DA 5T6FA 1KIGH 2H6MA 5A0AE 1AZ8A 4E05H 1GBBA 1XX9A 3A7ZA 2R3UA 3BIUH 3TNSA 3F2FA 3GY3A 1VR1H 1Z8RA 2CF9H 3GDVA 1G9IE 4AYYB 1EX3A 1O2MA 2BVRH 1KTSB 1KXAA 2FM2A 5LPRA 4YOJA 4H6SB 1GBIA 4JZDH 9ESTA 5GCHG 1LHGH 1CT2E 1GJ5H 3OSYA 4KP0A 3W95A 3SQEE 3O8BA 4TY6A 1HJ8A 1AUTC 1GBEA 5FPTA 2GKVE 5ETXA 4KELA 3RXMA 2PWXA 1TBRH 2IPQX 3I29A 3ZZBA 3SUFA 1HGTH 1ANCA 5DG6A 1WQVH 2ZFFH 4Y71A 1GJ7B 1GJ9B 3M3VA 2A7CA 5E0GA 1O3HA 3ESTA 1ZMJA 1BITA 2R2MB 3BEFB 4X8SH 1M9UA 4RI0A 3LJJA 2CJIA 1SFIA 3ZZ7A 2XWBI 4IN1A 1GJ6A 3RXCA 1GJCB 2ZDKA 1MCTA 2ZGCA 3GY7A 2XTTB 4E7RG 2Y5HA 1O39A 1O5CB 2JH5D 4ACBA 1VCWA 5G4BA 2FMJA 3TVJB 2YMSD 1RD3B 4JK6A 3QZQA 4TY7A 1OXGA 3UR9A 2HWLB 2C4FH 1DOJA 4JZ1A 2P8OC 1SGNE 1OWDA 3MH4A 3VB3A 3LT3A 1ELEE 1BBRK 4Q2KA 3N7EA 2ODPA 1SQOA 2QYIA 1YY3A 1JRTA 3RC5A 1LHFH 1TE0A 3UIRA 5JBTA 1V2MT 5C67A 4DG4A 3TLOA 3GOVB 1MTNB 3MU1A 4GHTA 4O03A 3FZDA 1BRUP 1DITH 4MPXA 4DOQA 4Y8ZA 2ILNA 3SI4H 3F9HA 4DVAU 4B76A 3ZZ3A 4ABFA 1Q2WA 1PFXC 1H8ED 3A8AA 2KCYA 3SUGA 1EJNA 3QZRA 4HI3A 1A5HA 2SGPE 2H9EH 1TOMH 2OBOA 4ZHAA 1Y3XA 1GGDC 1L0ZA 1AIXH 1FMGA 3BTWE 1P05A 1P2IA 1C1TA 3LDXH 3KQ5A 1V2TT 3VB6A 1YKTA 2GT7A 1NBMD 2ZCHP 3MU4A 4CH2B 1UTPA 5CHBA 1SGFG 1F92A 1F0SA 1BOQA 3O8RA 1BJUA 3UPEA 4MG3A 3DSPA 4NFFA 1TBQH 2W26A 1NFUA 3KYFA 1XM1A 1ELGA 1A2CH 1U6QA 2KX4A 1GJAB 4I8KA 1O2SA 4ABHA 3LC5A 3PMAB 2ZDVH 3U8TH 4ZAEA 1A3BH 2VIWA 3KGPA 5C17A 1FV9A 3F68H 3N99A 1L4DA 1Y3YA 3ZZAA 1MAXA 2ZKSA 3KQBA 4B71A 1O3DA 2QV1A 1C5ZB 3SQHE 4YT7H 2GZ7A 1EZXC 5JPMH 2OD3B 2XWAA 2BM2A 1EJAA 3BG8A 5KEDA 3UUZA 2WPLS 2QXJA 2GP9B 3QTVH 4Q7YA 3S9AA 1O5EH 3ATMA 3RXIA 3UTUH 2O8TA 1FONA 3F2GA 1Y3VA 4NIWA 1Z8IB 2EI6A 1C2EA 1FY8E 1UTKA 2UUKB 4Q80A 2O8WA 1JMOH 1PPEE 1XUIA 2ZDAH 4P02A 1H9HE 1K1LA 1P12E 2OQ5A 3W94A 1O33A 1TNJA 2CV3A 1AVXA 1GHAF 1UJ1A 1SGTA 3BTHE 1KXBA 4GLYA 1G3BA 1QJ7B 4WMEA 1ABJH 1D3QB 2BD5A 1W0JD 1TABE 3QGJA 1V3XA 1QR3E 2GJGA 1O2ZA 2P16A 1DICA 5GJ4B 4IBLH 1P2OA 4ZHMU 3OU0A 2BQ6B 2W7SA 1AY6H 3DD2H 1YPHE 1O0DH 1TGSZ 4XBDA 4ASHA 1LHEH 1LVBA 2O8UA 1ABIH 1B5GH 5A0CA 1LVOA 5ABWA 4GSOA 1JIMA 2BMGB 1KLIH 5ESTE 2IPHA 1FPHH 1RGQA 2VVVA 3KQEA 5DGJA 4UFEH 4F48B 2C93B 3LGVA 4O9VA 4MNVA 1C2GA 2JETB 2ZHFH 3FP7E 3QDZB 1FUJA 3CS7A 4FUIA 1LPKB 2FI3E 2AGEX 3Q3YA 1FZZA 2ANKH 4INHA 4BAOB 1N8OC 2ZGJA 4OS5A 1SLVB 4TYDA 5EIYA 2D8WA 1VJAU 1AFEH 4CR9A 5JBCS 5EODA 1SR5C 2FOEA 3R3GB 5HIYA 1QHRB 1C2MA 5T1VA 1UCYK 1C5MD 2JH0D 3VG8A 2GV7A 3ITIA 1O3LA 3SNBA 4NIXA 1C1RA 4NZQA 3OTJE 3T62A 4ZXYH 5HM9A 4ABIA 1SMFE 2ZFTA 1ZTJA 4OM9A 1XXFA 1TYNA 1B7XB 1GCDA 1CGJE 1WTGH 4Q63A 4THNH 5E2PA 3AASA 1ESTA 3A7YA 1JWTA 1C2DA 2KR7A 4H4FA 4AYVB 1SLWB 2JH6D 2PKSB 1F5KU 1ANDA 2M5TA 4X1PU 1MU8B 2B8OH 1WV7H 4NSVA 2P95A 2JJ1D 4Y79A 4B2BA 1FN8A 1FJSA 3BF6H 3RMOH 1NY22 5AHGH 1C2FA 2A5IA 5AF9H 2YMSB 3EA7A 1EAUA 3FOAA 3E0PB 4OS1A 3O8DA 3BTTE 4CRGA 2FESH 1FX0B 4F49A 4YM9A 4CRBA 1EAXA 3LC3A 1GI7B 2CHAC 1TLDA 3M35A 4Z0KA 1DXWA 1VCPA 1C5TA 3UR6A 4MNXA 3I77A 2XOKD 5E8EH 3MQKC 2PLXA 1GDUA 5EJLA 2H9TH 3C1KA 1IQKA 4RT0A 2BOKA 4ZUHA 3FFGA 1P2QA 4FU9A 2PKSC 3SJIA 1QB1A 1BRAA 8GCHF 3DSGA 2Q6GA 1YM0A 2XC5A 1K1PA 2FOMB 1C1NA 3ATKA 1BMMH 1W12U 4A6LA 1GI0A 1YPEH 3DUXH 2FI4E 2QE7D 1SLXB 4AX9H 1QIXB 1EZUC 2FO9A 1DLKB 2IJD1 1D3TB 1LKAA 1O5BB 1XXDA 2V0BA 3AW0A 1F0TA 6LPRA 5DP3A 1HBTH 3JZ2B 2BY5X 1ZMNA 2BZAA 1RTKA 2FOGA 2KCOA 2Y7XA 5FL7D 3U8OH 1C1VH 1HAZB 1S0QA 4ZKOU 1PQ5A 2J98A 1Z71A 1OS8A 4NCYA 1ZSLA 1A0HB 2F9NA 2FXRA 2J4IA 1FY1A 2W3IA 3ZVCA 3RMLH 1TB6H 3OY5U 1HJ9A 1DSTA 3UB0A 2XBYA 3UQOA 3ATIA 3M3SA 1SL3A 2WV4A 1XMNB 4X2VA 1C5XB 1NRNH 2P3FH 1XUKA 3UOUA 3T26A 4K8YA 1C2HA 3URDA 4J1YA 4NA9H 2FWWA 3SV8A 1FY3A 4AGKA 4ZH8A 2A45B 4Y10E 4ZKRU 1LQEA 3VXEH 1O2YA 1SGEE 1W0ZU 1DT2A 1IHTH 3OE7D 1O2GH 2FTLE 1XVOA 1DFPA 5JB8S 3ZVGA 2A4OA 3M7UA 4K1TA 4WXVA 1QA7A 2J95A 5JB9S 1KDQB 5HMAA 1BTHH 4XFQA 4A1TA 1GI3A 2BOHB 1ESAA 1LPZB 1FXYA 1WYKA 3DA9B 1C4V2 2OQUA 3ZZ4A 4OS7A 3MHWU 4YOIA 2ZDNA 2ESTE 5F8ZA 3STIA 1CE5A 3KNXA 2A2QH 1GHBG 2F9OA 1EOJA 3SJKA 1C5UA 3ATWA 3M7TA 1UVPA 4R8TB 1A5GH 4H42U 5EPYA 1TRNA 1UW7A 3VPKA 3S9CA 5HM2A 5LH8A 1F0RA 2DE8A 3WWFA 2G52A 1SGPE 4I31A 2OC8A 3PWCA 2A0QB 2TGTA 2VBCA 3DSOA 1BB0B 1DLEA 1GHVH 3Q77A 2HPQH 2IJOB 5L30H 3PWBA 1KTTB 3KHVA 2OC1A 1J8AA 5L6NH 5B6OA 2O9QA 2OCVB 2HNTC 4A1XA 3A80A 1SFQB 1OWKA 1P3CA 1N1LA 2WHXA 4HTCH 3T28A 3LU9B 3ZVEA 2BDBA 1MTSA 1YYY1 3RUOA 1MMJN 3SGQE 3SU3A 1SGRE 1HAXB 5T6DA 1UTMA 1BBRE 3PROA 4MTBA 2WPHS 2V3MA 3FANA 3NXPA 1YPLH 1IQHA 1KXFA 2FZZA 2GMTC 3SJOA 4B2AA 3EE0B 1INCA 1QL9A 1YLCA 2BTCE 3F0OA 4I86A 1SKYE 1KY9A 2TRMA 3BTEE 1E79D 2XBXA 4NA8A 4X6MA 1LO6A 2ZFPH 3BEIB 3ZZ8A 5GCHF 1C1UH 4HG6A 1N6YA 2NU3E 4YZUA 2XW9A 1E38B 1NPMA 1T8NA 3GCOA 3SUEA 3SZNA 2QXGA 4FETA 2B5TB 4IC5A 2VJ1A 1TOCB 2HVYB 1QFKH 4KTUA 4CHAB 5FBIA 4ABDA 2P3UB 1GJBB 4YESB 5LPEA 2F9BH 1QRZA 3RXRA 4R0IA 4FXGH 1HAYB 1VITF 4K2YA 2L6OA 1C4U2 2ZPQA 1DWCH 5BPEA 1ZGIA 1GI1A 1QRXA 4FUGA 5JBBS 2J9NA 2WZQA 1CVWH 4MNYA 2SGDE 1HFDA 3QLPH 3EGKH 2CHAB 2ZQ2A 3A82A 3RM0H 3V3MA 1V2NT 1UVTH 3BSQA 3UFAA 2VU8E 3MTYA 1C1PA 1C2IA 3PO1C 1ELVA 1VGCB 4AFSA 1ZSKA 2ZU2A 1TRMA 1ANBA 1FY4A 2QF4A 3LJOA 1HAIH 4BTTB 2SGQE 4OGYA 2B9LA 3SU5A 4I8JA 1QCPA 1G37A 3PM3A 1HAHH 1P06A 1QL8A 1O3JA 2QN5T 3LH1A 1CQQA 5JDUB 5EQRA 1CSOE 2OTVA 1FY5A 3D65E 4RKJB 2Z3CA 2ASUB 1GBCA 2V35A 3ODDA 4O3TA 1Q31A 3AK5A 2KAIA 3PTNA 1HJAC 1DY9A 2BDIA 1BTWA 3S7KB 2ALVA 1PPBH 2G5NA 4UFDH 1TQ0B 2H1UA 2BLOA 3M5OA 3ZVDA 2HGTH 2DUCA 1XKBC 2ZGBH 4IMQA 5SGAE 1XUHA 3MU0A 4X1NU 1C5LH 2UWOA 1O38A 5C1YA 3TITA 2RDLA 1GBTA 1MD7A 1C5RA 1XUGA 1HDTH 1T8OA 4I33A 3F0PA 1G32B 7ESTE 2A7HA 1TGNA 8LPRA 5EW1H 1AWFH 4CREA 4ZHLU 3TJNA 1FAKH 2PR3A 1CT0E 5K7RA 3URCA 4Y76A 1GI9B 3JZ1B 1PYTD 3DHKH 2J92A 1C5WB 2ZG0H 2JIZD 3E91A 1EUFA 1A1RA 3KF2A 1PPCE 3MH7A 3PMHB 1ID5H 2BD7A 1GBJA 3A85A 2WPJS 2BZ6H 4PROA 1TONA 4K8BA 1GPZA 1K9OE 2GV6A 1O2NA 2BDHA 2XNIA 1GVLA 3BTGE 2YNAA 3E6PH 1FI8A 2OXSA 1QJ6B 4DIIH 2JETC 3ZIAD 5DN6D 5GPIB 3KIDU 6GCHF 2F9VA 7GCHG 2GTBA 3VFEA 4MPVA 3UNQA 2G00A 3TK9A 3MO3A 3A83A 2BD8A 2CN0H 3W1EA 4UDWH 2XXLA 3G01A 1C1SA 1G36A 1O2PA 1W3CA 1YLDA 2AH4X 2V3HH 2FLBH 3AAVA 4B1TA 4D7FA 7LPRA 2SGAA 5EXMA 1PPZA 2FTMA 4ZKSU 2XNDD 1W13U 4K1SA 4AN7A 2LNCA 3IWMA 4QT8C 2P94A 2QXHA 1UTOA 1MTUA 1AE8H 3U1JB 1C5OH 2AFQB 1YCPK 3TJUA 3L6PA 2GGVB 1ACBE 3BN9A 3BIVH 4OS4A 5BRRE 1GBFA 4UONA 1BZXE 1W10U 3A87A 2GCHF 1O37A 3P8OA 5C20A 5C1XA 3ZZDA 1AB9C 3M5LA 2O8LA 3ZZ5A 2C90B 2FX6A 1GBAA 2A4QA 1MTNC 1W8BH 1WDIA 4WMDA 4BANB 3GDUA 2VIDA 1ELAA 5IK2D 4FUEA 2R0KA 2ZU4A 5F6MA 3RM2H 2ZHDA 2ANWA 4DGJA 2ZCKP 1MUEB 3B8JA 4LZ4B 3K6YA 1EJMA 5F03A 1UTJA 2RFKC 3KL6A 2JDID 1ZTKA 1E1QD 2WINI 2HVXA 3SU0A 5JYIA 2AERH 4FUHA 4IMZA 2UUFB 5FBEA 3D62A 1W0YH 3PV4A 1V2JT 1FDPA 9LPRA 2HNTF 2GCHG 1GL0E 1Y59T 1QQUA 1DVAH 3N7OA 2G4UA 1QQ4A 3NKKA 1EXFA 1V2WT 4ISOA 1HAPH 1AGJA 1WBGB 2K0QA 3P8NA 1GMDG 1SGYE 1THSH 1ZMLA 3K65B 5FHTA 1ZYOA 1P9UA 3B23B 1C5VA 1O2QA 1MU6B 3P70B 4UEHH 5CHAB 1MQ6A 4U2WA 3UREA 1GHYH 1DUAA 2R2WU 4DIHH 2FS9A 1V2KT 5DJ7A 4GVUA 1TGCA 2WUCA 2BXUH 1C2KA 4D9QA 1AO5A 1MBMA 1O3KA 1WAYB 3RXKA 4CR5A 3DT0H 4JCNA 3GS9A 1DSUA 1HIAB 2ZTXA 4KGAA 4SGBE 4AORA 4MVNA 2TIOA 1EPTC 3ZVBA 5AVDA 2LELA 1DX5M 2Y7ZA 1C2LA 2YMSC 2ZNKH 3ATLA 3E1XB 4WH6A 5A8YA 3RP2A 1E34B 1THPB 5FPYA 1QB6A 2AHME 3U1IB 1GJ8B 4Y8YA 2FS8A 2D1JA 2Y5GA 4Q7ZA 1O2LA 1O5AB 1LKBA 4MLFB 3GY5A 1A0LA 3S0NA 1W7GH 3V13A 3HGPA 1BUIA 4ABJA 2BY9X 4WVPE 4ABBA 5A2MH 1HJAB 2W7UA 2TGDA 1SGIB 1K0HA 2VGCB 2LPRA 5FAHA 2SNWA 1BTPA 1UCYE 2CF8H 1G2LA 1UK3A 1YPKH 2BDGA 2OUAA 5F8TA 2AGGX 1MKWH 3QO6A 1O3OA 1CBWC 3LGIA 1TMTH 2BDAA 3RMNH 1GHWH 2EA3A 3NWUA 1E1RD 3QWCH 1H8HD 1J9CH 2XBWA 2ZC9H 3F9EA 2OC7A 4OGXA 3ELAH 4Y0ZE 5FX6A 2ZCLP 1P8VC 1TX6A 3BTFE 1EOLA 1OHHD 3VGCC 3PO1B 4D7GA 4Y7BA 1TPAE 1FAXA 1EZQA 1DANH 5EPNA 2TBSA 5LGOA 4E06H 1AQ7A 2BQWB 5C1UA 5CDFE 2Y6TA 2ZIQH 3TIUA 3F6UH 3H7OA 2IOTA 4MPWA 2J38A 2BD3A 2WYGA 2FIRH 4GAWA 1QBNA 1XVMA 2BD4A 3SOSA 3T27A 1UO6A 3NPSA 2L74A 2VGCC 4XOJA 1GHAG 1H9LB 1V2RT 3GCNA 1O2RA 5IYTA 3SU6A 3P8FA 2BY8X 1ELDE 1LMWB 4AC9A 2AIPA 2WYJA 3H5CB 1WSSH 2PUQH 4YXWD 1OX1A 2Y82A 2SFAA 1E37B 4HFPB 1WCZA 1C9TA 4XE4A 1GMCG 5HGGA 2CMYA 1T4UH 1L1JA 3O8CA 1NM6A 1BMFD 1UTQA 2SGEE 4WWYA 1O2IA 3SV9A 4NIVA 2QCYA 3Q3XA 1YF4A 1PPHE 1T4VH 5F53A 2F91A 4ABAA 2F83A 2ZDLA 1DWEH 5CMXH 2FODA 2ZECA 1CU1A 4CBNA 1RTFB 1HAVA 4UD9H 4U30A 3ZV8A 4F55A 3OX7U 4X8UH 2W3KA 1ORFA 2AIQA 2G51A 4LZ1H 2RA0A 5CHAC 3KYGA 3A7WA 3Q3KA 2ZI2H 1ELTA 1T8MA 1O31A 4U32A 1QB9A 2ZQ1A 1BBRH 1MKXK 2FPZA 1O2KA 1AVWA 1D4PB 4Y11E 4YLUA 4XBBA 5PTPA 2RA3A 1ZLRA 1G3DA 3ENSB 1NO9H 1GG6B 4AFUA 1GBLA 4BAHB 4E7NA 1BHXF 1AN1E 2UUYA 4IGDA 3M36A 3TH2H 2BX3A 3MMGA 3RC4A 1O2XA 1AI8H 1YGCH 1BMAA 1E0FD 1S5SA 1W14U 1SGFA 3H7TA 5ESBA 2Z3DA 5EXNA 3GYMA 1E36B 1SC8U 4IC6A 1XUFA 4X2XA 2HOBA 3HATH 4BXWA 3MU8A 4ISLA 5T3HA 3UNSA 4JMYA 2ZDMA 1UCYH 2F9UA 2STBE 2B7DH 2TPIZ 3TK5A 1TNHA 4MNWA 4TSFD 1S6LA 1K1NA 3ZZ9A 1FIZA 2K1QA 2FEQH 3PMJA 2THFB 3M5MA 3F3BA 1G3CA 1EFRD 1P10A 1GBDA 2XC0A 3AW1A 3UAIC 2RG3A 3GY6A 3SHAH 7KMEH 1NU7B 5L2ZH 2A31A 2GD4B 2ZGHA 1NTPA 5E0HA 2ZTZA 2PV9B 7GCHF 1TA6A 1Z8GA 2QA9E 3TH4H 3DFJA 1L1NA 3EE7A 3FP6E 2ZPSA 5FCKA 3FKSD 1PYTC 4INKA 3NUMA 1GBKA 1TPPA 1Y5AT 5DP9A 1ZTLA 3HK6B 1YLNA 2A5KA 4CRDA 1HXFH 4I8GA 1NESE 1RJXB 1ZJDA 1F5LA 3EQ0H 2UWPA 4Z1MD 1J15A 1HAOH 1V2ST 1OWIA 4NFEA 2J94A 3KQDA 5A09A 3VGCB 1DWDH 2GVFA 1VCQA 1KLJH 1GJDB 3A86A 2H9HA 5E0JA 1V2VT 3M3TA 2GT8A 4NIYA 1SGDE 5DK1A 2AMDA 2Q6FA 2PW8H 2G8TA 1RS0A 2WPMS 1GHXH 1KLTA 3PYHA 3S7HB 3H09A 1NFYA 1GCTB 2ZFQH 1AD8H 1QGFA 5C2ZA 1UK4A 1CHGA 1KMHB 1EQ9A 2FLRH 1K22H 2G5VA 1PQAA 4LXBH 1TNKA 2Z9LA 4WJG2 1EAWA 1UK2A 3E90B 2BLVA 3MNSA 1B0FA 1ZHRA 3SORA 4DCDA 3SNDA 4Q7XA 1ELBA 1P2KA 3M61U 1DUEA 1X7AC 1GDQA 1SI5H 1VGCC 4MDSA 3MO9A 5FCRA 4D76A 1J16A 1ZSJA 3FN8A 3OEED 1BCUH 1BTZA 1G2MA 2KAIB 5JBAS 1ZRKA 3MH6A 5L2YH 4I8HA 1NN6A 3SYJA 1EZSC 1PQ7A 2A5AA 4Y8XA 3TNTA 3WWBA 5E2OA 1W11U 1QRWA 2SNVA 5DP8A 1SGCA 3SHCH 3ZYDA 4B75A 1HLTH 4SGAE 3BTQE 5CE1A 1BJVA 1P03A 2BDYA 1HIAA 2ZU3A 1SQAA 1QBOA 5GWZA 2F9PA 5DPAA 1TNIA 2Z94A 1ETRH 1UVUH 2J5UA 5EU8A 3LPRA 1NRQH 1TAWA 2BDCA 2G55A 3RXJA 3SW2B 5EXLA 1GMCF 2GCTB 5HIZA 8ESTE 1LCYA 1ETSH 2XC4A 3KQCA 2UWLA 2BY6X 3LIWA 3M37A 1AUJA 1OOKB 1YPHC 2FOBA 2D2DA 2AMPA 1ELFA 1P9SA 2CXVA 1SG8B 2XRCA 2QF0A 3DCLA 4RT1A 2GCTC 1O5FH 1KXDA 3LGUA 1BTXA 1YPJH 4UE7H 1TMBH 5DP7A 5DSFA 2FOFA 3MU5A 3A7TA 3AVZA 5GNDA 4X2YA 2A4GA 3GY8A 4BXSA 1O2OA 1P2MA 1S0RA 2PFEA 3LGWA 4DT4A 2VVCA 3S9BA 4TPYA 1SPJA 1GMHF 1ZR0A 4CBOA 3ZYEA 2NWNA 2YOLA 1HXEH 1O36A 1BDAA 4AFQA 1GMDF 3LGTA 4FUCA 4ABEA 2G81E 5EQSA 2Z7FE 3ZV9A 3PLKA 4BAQB 1SGQE 1K1IA 3VXFH 2PKAA 1W7XH 1PJPA 3GY2A 3PMBB 1D3DB 3VB7A 1Y5BT 1DDJA 2D26C 5A8ZA 2Z9GA 2BVXH 2Y81A 1C9PA 1YC0A 3A8CA 2H2ZA 3I78A 1CHOG 1Z8JB 2YNBA 4K3JA 4JZIA 4KTSA 4NGAH 1NRRH 6GCHG 1F7ZA 3VEQB 4RKOB 1PPFE 1LHCH 4YTAA 3BEUA 1THRH 2M2AA 3C27B 1MTVA 5LPFA 3SJ8A 2NU2E 3P92A 3LKWA 3F1SB 2VWOA 1IHSH 3GCTG 4HZHA 1D9IA 5FX5A 3RXLA 5TCAA 2C8ZB 1OPHB 2CGAA 2GDEH 3UWIA 1H4WA 1OP8A 4GPGA 1C1QA 1ZHMA 2GX4A 2ODQA 1TGBA 1LQDB 1ZPBA 3A8BA 1NRPH 4Y7AA 3SJ9A 3A81A 4INLA 5C94A 1TFXA 5DP6A 1L2EA 2PKAB 3D49H 3PLBA 2BLWA 2QF3A 3RU4E 1RIWB 1YBWA 3OAAD 2C3SA 1RTLA 1C1OA 5EW2H 1O2JA 1MAYA 2ZP0H 5T6GA 2WV5A 1KSNA 1YPMH 3MH5A 4RN6A 2ALPA 3OYPA 3SGAE 1G3EA 1HB0B 1Y3UA 2ZPRA 3U69H 1BMNH 2F4LA 4DT7B 3LH3A 3HGNA 2OC0A 1HAVB 4X6OA 4FUDA 4B74A 1VZQH 5AFYH 1H8IH 1Z1IA 4FU7A 1WOFA 2OINA 1P01A 3VB5A 2QY0B 2WPKS 3NRLA 1JIRA 1WUNH 2CK3D 3RLYH 3PRBA 1HRTH 2H5CA 1ZPCA 1AFQB 1H8DH 3SBKA 1A61H 1BMLA 1O3IA 1TIOA 2XBVA 2PP6A 2J97A 1MQ5A 1TALA 3QK1A 4GHQA 1GI5A 3T5FH 1QTFA 3CNRA 4AFZA 1OYQA 4IN2A 6CHAC 4D9RA 3MYWA 3RXQA 2ANYA 2WSSD 4NWLA 3TJVA 1RIWC 1TX7A 1GMHG 1K2I1 6ESTA 3TJOA 2ZHWH 2W6ID 3DFLA 3MNBA 4B6FA 2F43B 4X8TH 4X6NA 3RXOA 4HGCA 1JXPA 3SO3A 1C5SA 1C5NH 2TGAA 2C8WB 4CH8B 1BT7A 1OKXA 2WPIS 1S84A 4FU8A 1SB1H 3KN2A 4YOGA 2Y5FA 1GG6C 5HYOA 2QGRA 3SNCA 4A1VA 2OBQA 2VINA 2EC9H 1V6DA 1BRCE 4WY3A 2A2XH 1AU8A 3UOPA 3RXGA 1Z1JA 1NZQH 2FOAA 1ESBA 1K1MA 1GGDB 2AYWA 2XYAA 3GISB 3TH3H 1LDTT 1O3BA 3MNXA 2AS9A 3E0NB 2ULLA 1SOTA 2ZZUH 1DXPA 2F3CE 3T29A 1MZDA 1MZAA 3E16B 1EP5A 1HNEE 1ANEA 4XDEA 1S85A 5GXPA 3QUMP 2QXIA 3EAJA 1SQRA 1O3MA 1WU1A 3PB1E 1Z6EA 3IG6B 3ZZCA 1A7SA 2HRVA 4ACAA 4AZ2B 3GYLB 1P0SH 1FPCH 4KKDA 1O3GA 2KCAA 5J4SA 1KXCA 3SV6A 1L1GA 4JZEH 2ZWLH 3ODFA 3EYDA 4LK4A 2G4TA 1CA0B 2P8OB 1S6FA 3RXPA 1WQSA 1EPTB 2Z9KA 2PSYA 1EKBB 1O2TA 3B9FH 5DP4A 3M5NA 3L33A 1GBMA 3P17H 4ISHH 3CENA 1IQGA 2A7JA 1MCVA 3FVFB 1C1WH 4WH8A 4A5TS 1AKSA 1CGHA 3LONA 3RC6A 4WMFA 4BTUB 1O3CA 1IQMA 3GDSA 3V0XA 2WUBA 1GI2A 3K9XB 1ZPZA 4U01A 1GVZA 2Z9IA 2QC2A 1C4Y2 2R3YA 1RXPA 2FP7B 1OYTH 3BG4B 1GJ4H 1YPGH 2RDEA 1O5GH 5B6LA 1H9IE 3F9GA 1AE5A 3SV2H 3SV7A 5I25A 2ZFSA 2W5EA 3OEHD 1W2KH 2PSXA 4JK5A 2VVUA 1AZZA 1J17T 2FDAA 1UVSH 5C5NA 2I6QA 3HPTB 4BAMB 1YCPM 1IQFA 5FXLA 1XKAC 3SN8A 5IDKA 3NCLA 3SNAA 1VITG 1JRSA 3V12A 2BB4A 3A89A 1TPOA 4K60A 1A3EH 2I6SA 3QX5H 2OP9A 1BA8B 3WY8A 3RDZA 4M7GA
chains in the Genus database with same CATH topology
1CBWB 2Z9JA 1S81A 3RXTA 1H1BA 4UFGH 3QGNB 1TWXB 2VH0A 3RXHA 4KTCA 1O3AA 2B0FA 1ZRBA 4BAKB 5A0BA 2ZU5A 3VB4A 3KCGH 1P3EA 2C8XB 2OLGA 4CHAC 2VNTA 4O3UA 4MPUA 3LGYA 1NFWA 2V6NA 1C5YB 4A92A 1YCPH 1GI8B 1EPTA 1VITH 2BXTH 2ODYB 4B2CA 3FP8E 1Y8TA 3UNRA 1JBUH 4IW4E 4WF8A 1AKSB 1TRYA 4O97A 3UQVA 3MNCA 1HUTH 3RMMH 1UTNA 1NC6A 3UWJH 4X0WU 3V7TA 2GMTB 1DPOA 1GHBF 1ZOMA 5EOKA 1IQEA 4I8LA 5TJXA 2Z6BD 2GZ9A 1GL1A 2H5DA 1QURH 5C3NA 1AWHB 3P95A 1TX8A 1HAGE 6CHAB 1Z7KA 1Z6JH 3GY4A 4AB8A 1DS2E 5I46H 1TNLA 1FIWA 4VGCC 4UFFH 2P3TB 3GCHC 4WXIA 1O3FA 4X1SU 1UMAH 2BHGA 4ESTE 3RXAA 3K6ZA 1QBVH 1SQTA 4B73A 3PLPA 3CP7A 1OWJA 1TA2A 1O5DH 1CHOF 1K28D 1A5IA 2FOCA 2GZ8A 4GCHF 1GI4A 4XBCA 1MBQA 2VH6A 4A7IB 4DW2U 1S83A 1EATA 1SOZA 5DP5A 4NA7A 4YT6H 3RXVA 1A46H 1NT1A 1O30A 2HLCA 5H4IB 1K21H 1D6RA 3K2UA 1FN6A 2UUJB 1NROH 4MQAA 4I7YH 4TWWA 1IQNA 5F8XA 3T25A 1UVOA 4J2YB 1WTHD 2HALA 2XCNA 1KXEA 4X1QU 2BYAX 3RXFA 4H6TA 3Q00A 1AVGH 1O3PB 2VIOA 4DURA 1Y3WA 2P59A 4GCHG 4YLQH 1B0EA 1T8LA 4D8NA 3FZZA 3TGJE 4AB9A 1C5PA 1A4WH 2PGQB 1SHHB 1DM4B 4ZROA 1TMUH 4X6PA 1HPGA 2BLQA 1EAIA 1LPGB 1IAUA 4NZLA 1QY6A 1SBWA 2A32A 1DE7H 4I32A 4RSPA 3QTOH 2TGPZ 1V2PT 4ISNA 3UY9A 3CS0A 1DWBH 2FX4A 2NU1E 3ZVFA 1FNIA 2EI8A 3GCTF 4YO9A 1T7CA 3TU7H 5GIBA 1EP6A 1AHTH 3RLWH 1DY8A 3BTKE 4X1RU 1E35B 1AMHA 1TNGA 4K5ZA 1OWEA 2R9PA 4IS5A 1TPSA 1PQ8A 1UTLM 2Q1JA 2J2UA 4F4OC 3TGKE 4AG1A 3TPIZ 3P6ZB 2XCFA 5K0HA 5TCCA 4FUBA 1BIOA 3S69A 4FVBA 1S82A 1CA0C 2QAAA 4JYUH 2R0LA 2BX4A 1NS3A 1ETTH 1ARCA 1P02A 3MOCA 1TQ7B 4GUXA 1NFXA 3PTBA 3HK3B 1FQ3A 1C1MA 2JKHA 4X2WA 1BTUA 1ZZZA 4NG9H 3A7XA 3BTME 1L4ZA 2NU0E 1GVKB 1G30B 1MH0A 2ZHQH 3OY6U 1HCGA 4DY7B 3E8LA 1RRKA 1K1JA 2ZFRH 4FUJA 3STJA 4DJZB 1HV7A 1UHBA 1MKXH 1P04A 2BVSH 1JOUB 3EDXB 1IOEA 2BD2A 3FAOA 1V2LT 3SI3H 1NU9A 3SNEA 2HNTE 2NU4E 2SGFE 3U98H 3SU1A 1FLEE 4TWYA 2ZO3H 2P93A 1C2JA 1F2SE 3NK8A 1EB1H 5EGMA 1TGTA 3RU4T 3RXSA 1S6HA 1C5QA 4CRAA 3D23A 1CO7E 2VB0A 1OP0A 1SVPA 1EB2A 3F9FA 3U9AH 1LVYA 2GDDA 5EQQA 1O2VA 4CRCA 1PPGE 3KEEA 1IQJA 4TPIZ 4X8VH 1A0JA 1V2QT 4XSKU 4K1EA 5DKMA 1GBHA 1O2HA 1MTWA 2EEKA 1N8OB 1RFNA 8KME2 2VIQA 1GCTC 3MI4A 2PTNA 2PUXB 1ZHPA 3NZIA 2ZU1A 3TGIE 5HXFA 4ZMAH 1K1OA 1QJ1B 3RXEA 4AG2A 1BQYA 3MWIU 1AFQC 3RXDA 1P11E 2FI5E 1O35A 2AGIX 2BQ7B 1N6XA 1OWHA 1HYLA 3GCHB 1O34A 1GDNA 4VGCB 3L3TA 3ZVAA 1O3NA 2ZEBA 2ZHEH 3MFJA 1O3EA 4LOYH 1UHBB 2AEIH 1TBZH 3HKJB 1P57B 1P2NA 4JYVH 3AAUA 3U8RH 1CT4E 2FYRA 3SUDA 1CGIE 4OS2A 1QA0A 5J4QA 1BTYA 3LOXA 4BNRA 3EA9A 3QN7A 4BOHA 2HPPH 1Y5UT 2STAE 1J14A 3MO6A 2A4RA 1QNJA 2QIQA 2EI7A 1IQIA 1MKWK 1SHYA 5FPSA 1QL7A 2V3OH 2DE9A 3SGBE 5A8XA 4AGJA 3A7VA 3EA8A 1NRSH 3RU4D 1BHXB 1D3PB 3RXUA 4FVDA 4JYTA 3RXBA 4AOQA 4K69A 1P09A 1LVMA 2PGBB 2PTCE 1ARBA 1EASA 2ANMH 3A88A 1IQLA 3TK6A 1AB9B 5EG4A 4Y6DA 1T32A 4CRFA 4ISIH 1T31A 3HKIB 1P2JA 4Y0YE 2ZGXH 1ZJKA 2AMQA 1O32A 3R0FA 1CA8B 1F5RA 5C5OA 2ZA5A 4NSYA 3SU4A 1LHDH 2Z3EA 1V2OT 5DO4H 3Q76A 3A8DA 4OS6A 4FUFA 1GI6A 1O2WA 2ZTYA 3T2NA 3GICB 2VWNA 2FYQA 1OSSA 1MD8A 1OP2A 2C8YB 1D6WA 2Y80A 1SSXA 4JZFH 4ABGA 1LTOA 1O2UA 1KDQA 3M7QA 4Z6AH 2BD9A 3SU2A 2PHBA 2ZF0H 8GCHG 1YP9A 3IITA 4ZKNU 2FOHA 2VIVA 3BTDE 1BRBE 1SLUB 1GHZA 1KYNA 2A1DB 2J34A 2IN2A 3P8GA 4NWKA 2VWLA 2BY7X 3E3TA 2VIPA 1ELCA 5GDSH 3BV9B 1ZGVA 4ZXXH 1F0UA 1V2UT 2RCEA 4BTIB 3BG4C 1Q3XA 1XUJA 5AFZH 2VWMA 1VJ9U 3A84A 1GWAA 2O8MA 3ZZ6A 2Q6DA 5T6FA 1KIGH 2H6MA 5A0AE 1AZ8A 4E05H 1GBBA 1XX9A 3A7ZA 2R3UA 3BIUH 3TNSA 3GY3A 1VR1H 1Z8RA 2CF9H 3GDVA 1G9IE 4AYYB 1EX3A 1O2MA 2BVRH 1KTSB 1KXAA 2FM2A 5LPRA 4YOJA 4H6SB 1GBIA 4JZDH 9ESTA 5GCHG 1LHGH 1CT2E 1GJ5H 3OSYA 4KP0A 3W95A 3SQEE 3O8BA 4TY6A 1HJ8A 1AUTC 1GBEA 5FPTA 2GKVE 5ETXA 4KELA 3RXMA 2PWXA 1TBRH 3I29A 3ZZBA 3SUFA 1HGTH 1ANCA 5DG6A 1WQVH 2ZFFH 4Y71A 1GJ7B 1GJ9B 3M3VA 2A7CA 5E0GA 1O3HA 3ESTA 1ZMJA 1BITA 2R2MB 3BEFB 4X8SH 1M9UA 3LJJA 2CJIA 1SFIA 3ZZ7A 2XWBI 4IN1A 1GJ6A 3RXCA 1GJCB 2ZDKA 1MCTA 2ZGCA 3GY7A 2XTTB 4E7RG 2Y5HA 1O39A 1O5CB 2JH5D 1VCWA 5G4BA 2FMJA 3TVJB 1RD3B 4JK6A 3QZQA 4TY7A 1OXGA 3UR9A 2HWLB 2C4FH 1DOJA 4JZ1A 2P8OC 1SGNE 1OWDA 3MH4A 3VB3A 3LT3A 1ELEE 1BBRK 4Q2KA 2ODPA 1SQOA 2QYIA 1JRTA 3RC5A 1LHFH 1TE0A 3UIRA 5JBTA 1V2MT 5C67A 4DG4A 3TLOA 3GOVB 1MTNB 3MU1A 4GHTA 4O03A 3FZDA 1BRUP 1DITH 4MPXA 4DOQA 4Y8ZA 2ILNA 3SI4H 3F9HA 4DVAU 4B76A 3ZZ3A 4ABFA 1Q2WA 1PFXC 3A8AA 3SUGA 1EJNA 3QZRA 4HI3A 1A5HA 2SGPE 2H9EH 1TOMH 2OBOA 4ZHAA 1Y3XA 1GGDC 1L0ZA 1AIXH 1FMGA 3BTWE 1P05A 1P2IA 1C1TA 3LDXH 1V2TT 3VB6A 1YKTA 2GT7A 2ZCHP 3MU4A 4CH2B 1UTPA 1SGFG 1F92A 1F0SA 1BOQA 3O8RA 1BJUA 3UPEA 4MG3A 4NFFA 1TBQH 2W26A 1NFUA 4I8KA 1XM1A 1ELGA 1A2CH 1U6QA 1GJAB 4ABHA 1O2SA 3LC5A 3PMAB 2ZDVH 3U8TH 4ZAEA 1A3BH 2VIWA 3KGPA 1FV9A 3F68H 1L4DA 1Y3YA 3ZZAA 1MAXA 2ZKSA 3KQBA 4B71A 1O3DA 2QV1A 1C5ZB 3SQHE 4YT7H 2GZ7A 1EZXC 5JPMH 2OD3B 2XWAA 2BM2A 1EJAA 3BG8A 3UUZA 2WPLS 2QXJA 2GP9B 3QTVH 4Q7YA 3S9AA 1O5EH 3ATMA 3RXIA 3UTUH 2O8TA 1FONA 1Y3VA 4NIWA 1Z8IB 2EI6A 1C2EA 1FY8E 1UTKA 2UUKB 4Q80A 2O8WA 1JMOH 1PPEE 1XUIA 2ZDAH 1H9HE 1K1LA 1P12E 2OQ5A 3W94A 1O33A 1TNJA 2CV3A 1AVXA 1GHAF 1UJ1A 1SGTA 3BTHE 1KXBA 4GLYA 1G3BA 1QJ7B 4WMEA 1ABJH 1D3QB 2BD5A 1TABE 3QGJA 1V3XA 1QR3E 1O2ZA 2P16A 1DICA 5GJ4B 4IBLH 1P2OA 4ZHMU 3OU0A 2BQ6B 2W7SA 1AY6H 3DD2H 1YPHE 1O0DH 1TGSZ 4XBDA 4ASHA 1LHEH 1LVBA 2O8UA 1ABIH 1B5GH 5A0CA 1LVOA 5ABWA 4GSOA 1JIMA 2BMGB 1KLIH 5ESTE 2IPHA 1FPHH 2VVVA 1RGQA 3KQEA 5DGJA 4UFEH 2C93B 3LGVA 4O9VA 4MNVA 1C2GA 2JETB 2ZHFH 3FP7E 3QDZB 1FUJA 3CS7A 4FUIA 1LPKB 2FI3E 2AGEX 3Q3YA 1FZZA 2ANKH 4INHA 4BAOB 1N8OC 2ZGJA 4OS5A 1SLVB 4TYDA 2D8WA 1VJAU 1AFEH 4CR9A 5JBCS 5EODA 1SR5C 2FOEA 3R3GB 1QHRB 1C2MA 1UCYK 1C5MD 2JH0D 2GV7A 3ITIA 1O3LA 3SNBA 4NIXA 1C1RA 4NZQA 3OTJE 3T62A 4ZXYH 5HM9A 4ABIA 1SMFE 2ZFTA 1ZTJA 1XXFA 1TYNA 1B7XB 1GCDA 1CGJE 1WTGH 4THNH 5E2PA 3AASA 1ESTA 3A7YA 1JWTA 1C2DA 4H4FA 4AYVB 1SLWB 2JH6D 2PKSB 1F5KU 1ANDA 2M5TA 4X1PU 1MU8B 2B8OH 1WV7H 4NSVA 2P95A 4Y79A 4B2BA 1FN8A 1FJSA 3BF6H 3RMOH 1NY22 5AHGH 1C2FA 2A5IA 5AF9H 3EA7A 1EAUA 3E0PB 4OS1A 3O8DA 3BTTE 4CRGA 2FESH 4F49A 4YM9A 4CRBA 1EAXA 3LC3A 1GI7B 2CHAC 1TLDA 3M35A 4Z0KA 1DXWA 1VCPA 1C5TA 3UR6A 4MNXA 3I77A 5E8EH 2PLXA 1GDUA 2H9TH 3C1KA 1IQKA 2BOKA 4ZUHA 3FFGA 1P2QA 4FU9A 2PKSC 3SJIA 1QB1A 1BRAA 8GCHF 2Q6GA 1YM0A 2XC5A 1K1PA 2FOMB 1C1NA 3ATKA 1BMMH 1W12U 4A6LA 1GI0A 1YPEH 3DUXH 2FI4E 1SLXB 4AX9H 1QIXB 1EZUC 2FO9A 1DLKB 4BXSA 1D3TB 1LKAA 1O5BB 1XXDA 2V0BA 3AW0A 1F0TA 6LPRA 5DP3A 1HBTH 3JZ2B 2BY5X 1ZMNA 2BZAA 1RTKA 2FOGA 3U8OH 2Y7XA 1C1VH 1HAZB 1S0QA 4ZKOU 1PQ5A 1Z71A 1OS8A 4NCYA 1ZSLA 1A0HB 2F9NA 2FXRA 2J4IA 1FY1A 2W3IA 3ZVCA 3RMLH 1TB6H 3OY5U 1HJ9A 1DSTA 2XBYA 3UQOA 3ATIA 3M3SA 1SL3A 2WV4A 1XMNB 4X2VA 1C5XB 1NRNH 2P3FH 1XUKA 3UOUA 3T26A 4K8YA 1C2HA 3URDA 4J1YA 4NA9H 2FWWA 3SV8A 1FY3A 4AGKA 4ZH8A 2A45B 4Y10E 4ZKRU 1LQEA 3VXEH 1O2YA 1SGEE 1W0ZU 1DT2A 1IHTH 1O2GH 2FTLE 1XVOA 1DFPA 5JB8S 3ZVGA 2A4OA 3M7UA 4K1TA 4WXVA 1QA7A 2J95A 5JB9S 1KDQB 5HMAA 1BTHH 4XFQA 4A1TA 1GI3A 2BOHB 1ESAA 1LPZB 1FXYA 1WYKA 3DA9B 1C4V2 2OQUA 3ZZ4A 4OS7A 3MHWU 4YOIA 2ZDNA 2ESTE 5F8ZA 3STIA 1CE5A 3KNXA 2A2QH 1GHBG 2F9OA 1EOJA 3SJKA 1C5UA 3ATWA 3M7TA 1UVPA 4R8TB 1A5GH 4H42U 5EPYA 1TRNA 3VPKA 3S9CA 5HM2A 5LH8A 1F0RA 2DE8A 2G52A 1SGPE 4I31A 2OC8A 3PWCA 2A0QB 2TGTA 1BB0B 1DLEA 1GHVH 3Q77A 2HPQH 2IJOB 5L30H 3PWBA 1KTTB 3KHVA 2OC1A 1J8AA 5L6NH 5B6OA 2O9QA 2OCVB 2HNTC 4A1XA 3A80A 1SFQB 1OWKA 1P3CA 1N1LA 4HTCH 3T28A 3LU9B 3ZVEA 2BDBA 1MTSA 1YYY1 3RUOA 1MMJN 3SGQE 3SU3A 1SGRE 1HAXB 5T6DA 1UTMA 1BBRE 3PROA 4MTBA 2WPHS 3FANA 3NXPA 1YPLH 1IQHA 1KXFA 2FZZA 2GMTC 3SJOA 4B2AA 3EE0B 1INCA 1QL9A 1YLCA 2BTCE 2TRMA 1KY9A 3BTEE 2XBXA 4NA8A 4X6MA 1LO6A 2ZFPH 3BEIB 3ZZ8A 5GCHF 1C1UH 1N6YA 2NU3E 4YZUA 2XW9A 1E38B 1NPMA 1T8NA 3GCOA 3SUEA 3SZNA 2QXGA 2B5TB 4IC5A 2VJ1A 1TOCB 1QFKH 4KTUA 4CHAB 5FBIA 4ABDA 2P3UB 1GJBB 4YESB 5LPEA 2F9BH 1QRZA 3RXRA 4R0IA 4FXGH 1HAYB 1VITF 4K2YA 1C4U2 2ZPQA 1DWCH 5BPEA 1ZGIA 1GI1A 1QRXA