1AMHA

Uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKSSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANIONIC TRYPSIN
publication title The three-dimensional structure of Asp189Ser trypsin provides evidence for an inherent structural plasticity of the protease.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Hydrolase
total genus 49
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA02
1GHAG 1WU1A 1A46H 1BMLA 2YNBA 4JZDH 3SOSA 5A09A 1UVPA 2D2DA 2GD4B 3BG8A 1GCDA 4CHAC 5FX5A 3ZYDA 5F6MA 4Q80A 1LTOA 5I46H 1C1VH 3EAJA 1GHXH 5L2ZH 3SV8A 1BTHH 2C3SA 5EQSA 2PHBA 5JB9S 1IQKA 3AAUA 1F7ZA 2STBE 1QL9A 3M3VA 4NCYA 2DE9A 4AYVB 3S7HB 4KELA 3RU4D 2VIOA 4H42U 1O2NA 1LKBA 3OSYA 1NC6A 2ZCLP 1P2OA 4TY7A 3UFAA 3UPEA 1GI9B 3MMGA 1A2CH 2Z7FE 4DCDA 2NU3E 1CA0C 2Z9LA 1AWFH 1H9IE 3FAOA 4YLQH 1GVZA 1WQVH 1LVBA 1G37A 2ZU3A 5EODA 3SV7A 4B73A 1K2I1 2FI5E 1EP5A 1UTMA 3RMOH 2BB4A 3OY6U 1GL1A 1ZPBA 2PWXA 2F9VA 1MQ6A 1O3GA 5A8YA 1O3JA 3BG4C 4K8YA 4JK6A 4I31A 1XUFA 2BLVA 4ISIH 1RS0A 1GPZA 3MO9A 3F9EA 4AGJA 1TRMA 1RTKA 3EYDA 2AH4X 1SGDE 1TPSA 1KSNA 5E0HA 1L1NA 2QYIA 3KN2A 3LH1A 4FUEA 2JH6D 2R0KA 4BTTB 4KKDA 4A6LA 3MTYA 1O2XA 1ZTLA 3PMJA 5GPIB 1AO5A 4NZLA 2BM2A 2OTVA 1UTOA 3M7TA 3RMNH 3LJOA 3GY5A 1QCPA 1QB9A 2ZFTA 3U69H 1E34B 3TIUA 2ZHWH 2GGVB 1ACBE 1AQ7A 1SSXA 1DE7H 1GBAA 1UO6A 4FXGH 3P8GA 1TBQH 3QX5H 3ZZ7A 1LVOA 3HATH 3A80A 3TITA 1BTYA 3VEQB 1C5YB 4TPYA 1BA8B 1BOQA 1O3OA 3T2NA 5TJXA 2QXGA 2WPHS 2OQ5A 1XXFA 2HPQH 1MAYA 3GY3A 4ABIA 2SGPE 1P9SA 3TH3H 4CH2B 4LZ4B 5FBEA 3RXSA 1WV7H 1OP8A 2JETC 1T8NA 2WPLS 1B5GH 2HNTF 1XUGA 2ODYB 3NXPA 1QRXA 3DT0H 4DIHH 1TA6A 1HAVA 3LC5A 2PSYA 2BD2A 2QF0A 2BDBA 1CHOF 1ZSJA 1O3EA 1W12U 3SNDA 1CGIE 1F5RA 1NFXA 1SGYE 1UK2A 1HAGE 4ABFA 1TNKA 1O3NA 1CT0E 1RTFB 1J9CH 1RGQA 1K1PA 1P2IA 3RXIA 4GAWA 1GJAB 1P01A 3UR9A 4K60A 1QBNA 2ANKH 2P3UB 4TY6A 1GHZA 1HV7A 1FMGA 1KLIH 1MU6B 3RXGA 2VVCA 3SI3H 4FUJA 2ZDNA 4AFUA 2VWLA 3PM3A 1ETTH 2YOLA 1HJAB 1ETRH 3LGIA 4KGAA 4BOHA 2VJ1A 1YKTA 2BLWA 4FUIA 5DJ7A 3RUOA 3PO1B 4MNYA 3QGNB 1LHGH 5DGJA 1IOEA 2BYAX 1THSH 1NFUA 2WYGA 3QZRA 1GHBF 1P2NA 4MNXA 2F9OA 1Y5AT 4XBCA 3RXMA 3TGJE 2BZAA 1O2HA 1YCPK 2I6SA 1ZHPA 1O2KA 4BXSA 1MCTA 3EDXB 3ITIA 2F9UA 5C2ZA 1QJ7B 1AKSA 2GDDA 4Y7AA 4O9VA 1HIAB 1P02A 1EAWA 5BRRE 3RMLH 2G52A 4FUDA 4YO9A 5L2YH 1DSUA 3E1XB 2QGRA 5EGMA 2J2UA 4NIVA 3U98H 1TONA 1KDQA 1N6XA 3OTJE 3FANA 2BD5A 1XVOA 3V0XA 4Y10E 5GWZA 2WPMS 2FPZA 1D3DB 2EC9H 1YBWA 2IN2A 1PQ8A 2XC0A 3JZ2B 5FPSA 2RG3A 3QWCH 3PWCA 1EP6A 4JZFH 1AU8A 1N8OB 1XVMA 2ZFSA 3PROA 4CBNA 1L2EA 1BT7A 5A8ZA 1P2KA 4Y7BA 3SN8A 2P94A 4LOYH 3MO6A 3UIRA 1UTKA 1CVWH 3SU0A 3U1IB 4LZ1H 3V12A 3AASA 1SR5C 1A3BH 2AGIX 1Y5BT 2BVSH 1IQFA 1ZPZA 3SBKA 3B8JA 5GCHF 1IHTH 4MPVA 1AHTH 3SGAE 5E0JA 4A1XA 2G5VA 1NTPA 3LC3A 3UUZA 3D65E 2R2MB 4UD9H 4ISNA 4ZROA 3SJOA 4B2CA 1XMNB 2WPJS 1NRNH 3SV9A 1OOKB 5C1YA 4INLA 5GIBA 4IW4E 2QY0B 2BX4A 1SGFA 1C2FA 1Q3XA 3O8CA 4OGXA 3TJUA 4YM9A 1V2JT 1FLEE 3CS7A 1F0SA 1C5OH 1K1JA 5C20A 1EZQA 1HAIH 1DY9A 1BCUH 1CGHA 3M5OA 4I8KA 2QC2A 2GV7A 1O0DH 3Q3KA 5DP6A 3Q00A 4ZHAA 3BSQA 7GCHF 1ANBA 3D62A 1V2ST 2H9TH 1CHGA 1TGTA 1X7AC 2BD3A 2H1UA 2R9PA 2SGEE 1INCA 3SZNA 1BHXB 1WCZA 2A2QH 1P0SH 1OWHA 1AN1E 4MVNA 1ZYOA 4WF8A 2Y81A 3S7KB 4WXIA 3M5NA 3S0NA 6CHAB 1TPAE 2SGDE 1SGPE 2OXSA 2ZTZA 3MWIU 1QGFA 1RD3B 1Q2WA 3BV9B 2FLRH 1PPZA 4ZHMU 3DUXH 2SGAA 1SQAA 3F9FA 1C5UA 3GY4A 5BPEA 1TNGA 3NK8A 1ZHMA 5DP8A 4ZKOU 1OYTH 1CA8B 4X2VA 2P95A 2W3IA 1TPPA 3H7TA 1QRWA 4YT7H 1HJAC 1BTWA 2P93A 1ELCA 4D7GA 1FY5A 4Y8ZA 5F03A 1F0RA 1OX1A 1C1NA 3D23A 3MU5A 1FJSA 3MU1A 2FOCA 2HNTC 1GJ6A 2G00A 3RLWH 5CE1A 1ZTKA 4WY3A 1AFQB 3UOPA 1O5EH 1P2JA 3AAVA 2OC7A 3OY5U 1Y3YA 1MKWH 2YNAA 5DP4A 1BJVA 1GBMA 1L4ZA 2SGFE 1O3BA 1NN6A 1CT2E 2GCHG 4A92A 1A3EH 4ABJA 2ASUB 4X2WA 1TX7A 1C5WB 4Q2KA 4MNWA 5EXNA 2AMPA 4A1TA 3RXKA 1P04A 1ELDE 3H7OA 2BQ6B 2OC1A 3TGIE 1C5XB 2B9LA 1C2EA 5CHAB 4X8SH 2WV5A 1FDPA 2XXLA 1MTWA 3GY8A 5DKMA 1KXCA 2W26A 3LH3A 1W8BH 1Y5UT 3ESTA 3A85A 2XCFA 1AE5A 1TBZH 1T7CA 1C1RA 4KTUA 1KXEA 2UWOA 1HIAA 1C1QA 3RC4A 4OS4A 1O3PB 4U2WA 1FY4A 5EW2H 3AVZA 2ZHQH 1N8OC 4B75A 2XBYA 1NRPH 1AUJA 1EZXC 1TX8A 2PV9B 3LONA 2UUFB 3P6ZB 2Z9JA 1MAXA 4IGDA 1BMNH 4X6OA 2HNTE 2R3UA 1YPEH 1IQGA 3MU8A 4CRGA 2A7JA 1WUNH 2VVVA 4B2BA 3RP2A 1UTPA 1SPJA 4BAOB 1C5TA 1C1WH 5C67A 4GVUA 2VINA 3BTFE 1AUTC 1TFXA 2ODQA 2HOBA 4OS2A 2ZU1A 4SGBE 1O3MA 1A0JA 1EOJA 3RXJA 1V2KT 3FFGA 5T6FA 4DURA 1FNIA 2FOFA 2VIDA 4VGCB 4RN6A 2O8WA 5E2OA 1EQ9A 1V2UT 4OS1A 2H9EH 4J1YA 1C2KA 1P10A 1VGCB 1SB1H 2A1DB 5B6OA 1A5GH 3GDUA 4FUBA 4SGAE 3K2UA 3T29A 1C5VA 1HAXB 2W3KA 3M37A 3U8TH 4X6NA 4RKOB 4MG3A 3SU2A 1BRUP 2A4OA 3EQ0H 5EPYA 3VGCB 3ZZAA 3PTBA 3RM0H 3QDZB 2VGCB 3RDZA 1H1BA 2NU0E 3ATMA 1VITG 3N7OA 3LJJA 4RSPA 1SGEE 2PKSC 4X8TH 2XYAA 1YC0A 2CF9H 4MDSA 4ZH8A 1VJAU 4TPIZ 4ZUHA 1W10U 3RXBA 3NZIA 6CHAC 3A7YA 1C2LA 3ZV8A 2W7SA 1J8AA 1IQNA 1LMWB 1O38A 5JBAS 3DFLA 3UR6A 5C1XA 4E7NA 1EAXA 3SU3A 1WTGH 3LU9B 1Y59T 3T5FH 1TQ7B 3MU4A 1NS3A 2HGTH 1G3EA 4Y8XA 1GI0A 1O3IA 1D3TB 3MH5A 5LGOA 1FY3A 1M9UA 1C2HA 5DK1A 2FOAA 1GMHF 4JZIA 1HAVB 3A81A 2FS9A 3KGPA 2H5DA 2ZCHP 2CGAA 1BIOA 3PMBB 1GI5A 1ANCA 4D9QA 1LO6A 4NGAH 3CENA 1QB1A 1HB0B 1SGRE 1AFQC 3U1JB 3KQCA 3TPIZ 1MU8B 5ABWA 4AX9H 4WJG2 3GDVA 5GJ4B 1P2QA 2ZWLH 1HUTH 1GMCG 1W2KH 1EB1H 2J94A 3SGBE 1D6WA 1GBIA 1FN8A 3IWMA 5JBCS 2OC8A 3LGVA 1UMAH 2A0QB 4X2XA 1QTFA 2VB0A 2VWNA 2P8OB 2BXTH 1THPB 1SGNE 3RMMH 2EI7A 1G2MA 2W5EA 1CGJE 4AG1A 1TGCA 2QXHA 3MNSA 1ZSLA 2ZIQH 3MHWU 1MKXH 4NA8A 1HRTH 2PFEA 2ZCKP 4AFQA 1FN6A 1BTZA 4THNH 2PUQH 3K9XB 1OS8A 5LPEA 1ZSKA 2ZZUH 3L3TA 5FX6A 2FYQA 2K1QA 1Z1IA 4GCHG 2WUBA 1B0EA 4CR5A 1TMUH 3E16B 4MLFB 2O8MA 1AKSB 5JYIA 3DHKH 4B74A 3UREA 1HAYB 1DLKB 4WVPE 1NROH 1SG8B 1F5KU 2J92A 2BY5X 1CU1A 1BRCE 3LT3A 3R3GB 3A82A 3SO3A 5T3HA 1UTNA 1A0LA 2VIWA 2Z9KA 1SVPA 4CREA 4CRAA 4HTCH 4BTIB 1KDQB 1MKWK 2GT8A 1K22H 1O35A 2THFB 4AFZA 5FCRA 5FCKA 3Q3XA 1O2PA 4O03A 4IC5A 1DWDH 2A2XH 2JH5D 2A4QA 1C9PA 5T6GA 1Y3XA 1QQ4A 1SOZA 4F49A 3KIDU 4VGCC 3I29A 1O2LA 3M36A 3PWBA 4ZXXH 1C4V2 4CBOA 1VGCC 1WQSA 1MD8A 3A7ZA 1GI3A 9ESTA 1A5HA 1UK4A 5EG4A 3SQEE 2Z6BD 3NUMA 1O37A 1Y3WA 2FEQH 1DANH 3S9BA 3GCTF 5GXPA 3VGCC 1BBRH 4FU8A 1BDAA 2F9BH 2VIVA 3ATIA 2VGCC 2V3HH 3ZZ6A 3A7TA 2Q6DA 3A84A 4MNVA 3BIUH 5DP5A 3LGYA 3SNAA 1AVXA 4ABBA 3ATWA 3RXPA 2XC4A 2A7CA 4MPWA 2BDGA 4HGCA 4R8TB 3RXFA 1C5NH 3M61U 1W0YH 3TH4H 3K6YA 4NSVA 1DY8A 2ODPA 3ZVBA 3GCHB 1TWXB 3A83A 6ESTA 2ZGBH 2NU2E 1GBJA 2ESTE 1S82A 3P8OA 2OQUA 2PR3A 1RJXB 4MQAA 3U8OH 1GBTA 1AB9B 1O5BB 2Y7XA 1PYTC 2A45B 3T27A 1IQLA 1TPOA 3RXOA 1SFIA 5GDSH 4Y0YE 4K1TA 3VB5A 5JBTA 2BDAA 2NWNA 3A7XA 4BANB 8GCHF 1TMTH 3NWUA 4U01A 1C4Y2 2ILNA 1LKAA 1GBFA 2TIOA 1JIRA 4ASHA 1FY1A 3T26A 1QJ6B 5A0AE 2GKVE 1DOJA 2AYWA 3RM2H 1HGTH 1TNJA 2ZNKH 1GMDG 1O2ZA 3UNSA 4B76A 2P8OC 1T4UH 2JKHA 2R3YA 2AFQB 1SC8U 3SUEA 1O2WA 5IYTA 2QA9E 2FP7B 1GMCF 2FLBH 1O39A 3E8LA 2ZDLA 1H9LB 1ZHRA 1UTLM 4B1TA 4ABEA 4A5TS 2V3OH 2O8UA 3SORA 3O8DA 1PPFE 1OSSA 5ESBA 4AN7A 2FX6A 1ESBA 1IQHA 1DM4B 1O5DH 4Y79A 2A5KA 1YF4A 3M7QA 1C1TA 2GP9B 2A4GA 1FONA 2FS8A 3VXFH 2ZU5A 4Y6DA 4X0WU 1ZRBA 5A0CA 2BY7X 1BBRE 1SMFE 5AHGH 1XUIA 1BITA 3MH6A 1GHAF 3MNCA 2XBWA 3PB1E 2FX4A 3SJ8A 1KTTB 1TB6H 1ELFA 1GJ5H 1EOLA 1FI8A 1XX9A 4I32A 3ZZ5A 3STJA 3TH2H 1FXYA 1H9HE 3F6UH 1T8LA 1ZOMA 2Z3DA 4X8VH 1TNHA 2D26C 5EQQA 2BD4A 1YPLH 1ZZZA 2CN0H 2GMTB 8LPRA 2CMYA 3M5MA 1U6QA 2ZTXA 1HYLA 2CF8H 2ZC9H 5F8ZA 3VXEH 3B23B 1FIWA 3RXHA 1MBQA 3O8BA 1V2TT 4ABDA 1TA2A 3ENSB 2A31A 1LVMA 1AIXH 1TRYA 1MKXK 3SJKA 4TWWA 1O5CB 5JBBS 1K1IA 1F0UA 3ZZCA 4D76A 5C5OA 1O2QA 4NIYA 5I25A 1TGBA 1C5MD 5DP7A 1AZ8A 1GJ9B 3STIA 2BXUH 1IQIA 1AWHB 2KAIB 2XWAA 2ZDMA 2BOHB 1Z71A 3BTDE 3KCGH 4UFGH 1XUKA 5L6NH 2BTCE 3SU4A 1QJ1B 3P17H 1ZMNA 2J9NA 3M35A 1NRSH 1FPCH 1E38B 3RXUA 3GCHC 3UWIA 4D7FA 1VITH 1YPKH 1TRNA 1FQ3A 2ZQ2A 2QXIA 1CBWB 1PYTD 2FODA 1MTSA 4R0IA 1A1RA 1MH0A 1GBEA 1TOCB 2XBVA 1TQ0B 5EQRA 2EEKA 1SQTA 3LKWA 1MUEB 1IQJA 3ZYEA 2ZHDA 2GV6A 2HWLB 1AB9C 3SGQE 1HAZB 2CV3A 2RA0A 1GJDB 4OS7A 2BVXH 1AVGH 5C3NA 3LOXA 5EOKA 4NIXA 4ZAEA 2IOTA 3SU5A 1EJAA 1YM0A 3GDSA 1KXAA 1W3CA 5C5NA 1OP0A 1ELEE 2TGAA 1IQMA 4X1SU 1EPTA 1BBRK 1V2MT 2CHAB 4I7YH 4INHA 1UHBA 2PKSB 4CRBA 1BTUA 1C1UH 1ZGVA 3PMAB 2Q6FA 1C1OA 4TWYA 1G32B 1NFWA 3E90B 1D6RA 2PLXA 1LVYA 4JMYA 2BZ6H 1YLDA 2C8WB 2QIQA 4O3TA 3VB6A 2A5AA 2LPRA 2F9NA 2J38A 3T62A 1VCPA 2WPIS 2TGPZ 5AF9H 2XRCA 1G9IE 1V2NT 3WY8A 3W95A 1CSOE 4NIWA 2ZDAH 4I33A 1C2IA 3M3SA 4B2AA 1O2UA 4E06H 3TJVA 1W14U 1GCTB 1S0QA 1J17T 1E0FD 2FIRH 1S81A 1JIMA 2G8TA 3MOCA 1QL8A 3LIWA 4AB9A 1AY6H 4H6TA 1V2WT 4UFFH 3BN9A 1O3LA 1MZAA 4XBDA 1GI1A 1YYY1 1ORFA 1FZZA 2F3CE 1ANEA 3A86A 1UTJA 2Z9IA 6GCHG 1HJ8A 1RIWB 2ANWA 3SQHE 1C2GA 1YPHE 4WMDA 1V3XA 4GSOA 3E0NB 4XE4A 1P8VC 1O2VA 3ZZBA 3AW1A 3HKJB 2GTBA 2A4RA 3C1KA 1PQ7A 1O2IA 3LPRA 2BD7A 4D9RA 5LPFA 2GMTC 1C1PA 2XCNA 1ABJH 3KNXA 1C5PA 3LGTA 4BAKB 4K1EA 4JZ1A 5DPAA 2WUCA 4O3UA 3JZ1B 4OGYA 1ESTA 1GHVH 1GI4A 1DFPA 1P3CA 3Q77A 3TK6A 4WMEA 3E6PH 2I6QA 3ZZ4A 1EATA 5AVDA 1SLWB 1BRAA 1P9UA 2ULLA 1NRRH 3SNEA 4X1RU 2ZKSA 3PLKA 2NU1E 1EUFA 1ESAA 4WMFA 3VPKA 3LGWA 2C8XB 4MPXA 3ZZ9A 1SI5H 1D9IA 1O32A 1LPKB 4M7GA 3SU6A 3BTME 1F0TA 1GJBB 1C1SA 1TBRH 4I8HA 5DP3A 1DWCH 1TMBH 1G3BA 4CRFA 2SNVA 2VVUA 2CJIA 1GDUA 2SFAA 3L33A 1KXFA 2B8OH 1BTXA 1OKXA 2OUAA 5J4SA 3G01A 1BMAA 1O33A 1P57B 1KLJH 1SGFG 2R2WU 2FXRA 2KAIA 2G51A 3VFEA 4WH8A 2OP9A 1CBWC 2ZECA 2FZZA 3RU4T 1JXPA 2BY6X 3BTGE 2ZFRH 1QA7A 1PQAA 1AVWA 2D1JA 2FI4E 3NKKA 5FPYA 3D49H 4ABAA 3UY9A 5AFYH 2HRVA 4WWYA 4AGKA 5HM9A 1K1NA 1TABE 1XKBC 2O8TA 3T28A 2AGEX 1H8IH 1DVAH 4BAHB 1JOUB 2AEIH 2H5CA 2XNIA 1C5LH 1HNEE 3QTVH 4XFQA 1O2MA 1NU7B 1AMHA 1SHHB 2TRMA 2GDEH 1TYNA 1NRQH 2XTTB 4J2YB 4Q7YA 2F91A 2WPKS 3GYMA 4CRDA 2CHAC 2O9QA 4OS6A 3FVFB 1GHWH 1XXDA 3E3TA 2ANYA 4DG4A 1MD7A 3MH7A 4FUFA 1S83A 4H4FA 3A8BA 1PJPA 4CRCA 4U30A 1WYKA 2BY9X 2ZU2A 2ZGCA 1Y3UA 4AOQA 3ODDA 4XOJA 1SLUB 2Z3CA 1O2SA 2SGQE 1S84A 2BHGA 3A7VA 1LHCH 5F8XA 1OP2A 2C8ZB 3R0FA 5SGAE 1MTUA 1O3AA 1J15A 1ZGIA 3E91A 2GVFA 3ATKA 4YESB 2VH0A 4YOJA 3RXRA 1YGCH 5PTPA 1GCTC 2Y80A 5E8EH 3W94A 1GBKA 2WV4A 2AS9A 4K3JA 1O5AB 2QN5T 2BLOA 2BD8A 2Y5FA 3KQDA 3SNCA 2Z9GA 5L30H 1QR3E 3NCLA 4B71A 3OU0A 4X1NU 3UQOA 1V2PT 1CQQA 4NG9H 1XUJA 1OWEA 3C27B 3DFJA 1O2RA 2ZPRA 1MZDA 1KXBA 7LPRA 4ABHA 1GBDA 1FIZA 1P09A 1RIWC 3CS0A 3RU4E 3U9AH 4XSKU 1SOTA 1QURH 2ZI2H 1CHOG 4JCNA 1YP9A 4IMZA 1K1LA 4JYVH 1XKAC 2Y6TA 2CXVA 1K21H 1YPJH 1G2LA 2ZA5A 3TGKE 1S5SA 1ZJDA 3TJOA 1GDNA 2G55A 1QFKH 1HLTH 1DDJA 2BLQA 2GCHF 3PLBA 1YLCA 1DWEH 1AE8H 4ZXYH 1BMMH 1K1OA 4FU7A 3V7TA 4UONA 3BIVH 3SW2B 1L0ZA 1SGCA 1V6DA 3BEIB 3ATLA 1A7SA 1SQOA 1VR1H 1TE0A 3MNXA 5AFZH 4BAMB 1OWJA 3TNTA 1CE5A 3LGUA 3BF6H 1TALA 2C8YB 4X6MA 3A7WA 5E0GA 2PGQB 4INKA 1F5LA 1GHBG 9LPRA 1UVSH 2OBOA 1DPOA 2ZGHA 3TK9A 2OLGA 1GJ4H 2Y7ZA 1PPEE 4GHQA 2TGTA 4JYUH 3HGNA 2IPHA 1C5SA 3RXDA 5A0BA 1KY9A 2BOKA 5CMXH 2BQ7B 3PYHA 3RC6A 4DIIH 3PLPA 1P05A 1OXGA 2NU4E 3RXQA 1H4WA 2XBXA 4YOGA 5HYOA 2J4IA 1B7XB 1DITH 3MU0A 3K65B 4KTCA 1NESE 2ZO3H 2F9PA 3V13A 1O36A 2P16A 1O3DA 1CO7E 1C2JA 2AERH 1J14A 1J16A 1NZQH 5EPNA 1O30A 2G5NA 2VWOA 2UWLA 1SHYA 3QGJA 1GBBA 4NWKA 1Z8IB 3ZV9A 1L4DA 2BX3A 1ZJKA 2OBQA 2F83A 5EU8A 2O8LA 3M7UA 2W7UA 1SGTA 4A7IB 2Y5GA 2HVXA 2ZU4A 4BXWA 3S9AA 1W11U 4FUGA 1ARCA 1JMOH 2AMQA 2QV1A 4NA9H 3SJIA 2VIPA 3S9CA 3UNQA 4FVDA 1ELVA 1QL7A 4CH8B 3SNBA 1QBVH 5JB8S 1UCYH 3HPTB 3A8DA 1T8OA 4I8GA 3GY6A 3O8RA 1UJ1A 1H8DH 1O2GH 1VITF 5GCHG 1VZQH 3QK1A 1FY8E 4AB8A 1EZUC 4UDWH 3ZVFA 1DUEA 1EASA 3HKIB 4F4OC 4UFDH 3IITA 5LH8A 1Z8RA 1BB0B 1GJ8B 4Y0ZE 4ESTE 3HGPA 4K5ZA 1EPTB 2IJOB 1EJMA 1UHBB 1GDQA 2FWWA 1QY6A 3VB4A 1TNIA 1Q31A 2HALA 1OWIA 2B0FA 7ESTE 5K7RA 3Q76A 3GOVB 2AIQA 4UEHH 2QF3A 1DX5M 1QQUA 1GGDC 1S6HA 4JZEH 3F9GA 4X6PA 1K28D 2ZFFH 2FTLE 2RDLA 1NFYA 7GCHG 3V3MA 2ZHEH 3SV6A 1FPHH 3TLOA 4I8LA 2H9HA 3TJNA 2G81E 1RTLA 1W7XH 1MTVA 1WBGB 2DE8A 3KL6A 3ZVEA 4X8UH 3GCNA 3GY7A 3KHVA 4IN2A 1FAKH 4BTUB 3P92A 1VJ9U 3MNBA 1WTHD 2A5IA 2PGBB 3DD2H 4GUXA 2STAE 4CR9A 3S69A 1QNJA 1SBWA 3BTEE 3RXTA 2A32A 3A89A 1KIGH 4AORA 2BD9A 3I77A 1C9TA 3IG6B 5A2MH 1IHSH 3EE0B 4XBBA 1ID5H 3TU7H 1UK3A 2G4TA 1TOMH 4AG2A 3MH4A 2ZPSA 1O31A 2QAAA 1GJCB 3GICB 3SUGA 1THRH 3UWJH 3FP6E 2VIQA 1IAUA 1P3EA 4YT6H 2V6NA 1PQ5A 1G3DA 1JWTA 3LDXH 3ZVDA 4NSYA 5DP9A 4ZKRU 3ZZ8A 1DXPA 1MCVA 2FMJA 3HK3B 1NT1A 1HJ9A 4KTSA 4HI3A 4H6SB 2HLCA 3BEUA 1TGSZ 4Y76A 4GCHF 1C2DA 1DICA 1S6FA 1Z6JH 1BJUA 2UUKB 3PTNA 5C1UA 3BTKE 1T31A 1UCYE 1FAXA 1QBOA 1S0RA 2EI6A 1LQDB 1MBMA 1ABIH 2XWBI 3QUMP 1OWKA 2ZDVH 2JH0D 3P8NA 2ZHFH 2PW8H 4Y71A 2FYRA 2Y5HA 4O97A 2FOGA 2GZ8A 2UUYA 4K1SA 3KQBA 1O5FH 3A88A 2FM2A 2P3TB 2AIPA 4IN1A 5IDKA 4Z6AH 1AI8H 1FUJA 1JRTA 1O3HA 1PPGE 2BDHA 4QT8C 3KQEA 2WINI 1PPCE 7KMEH 1V2VT 3EGKH 3K6ZA 1FV9A 2H2ZA 1MTNB 2G4UA 3P70B 2GCTB 3L6PA 1TGNA 3FZDA 3A8AA 3SJ9A 3F68H 3QN7A 4K2YA 1OYQA 1MQ5A 4PROA 3MYWA 2Q1JA 1ETSH 1TLDA 1LHFH 2QXJA 1ZMJA 3BTHE 3QZQA 4WXVA 1O2OA 3U8RH 1P12E 1Y8TA 4U32A 2ZP0H 2BDCA 1WSSH 1BZXE 4IBLH 1V2QT 1DWBH 4XDEA 3RLYH 2TPIZ 5EXMA 4DOQA 3OYPA 1GI7B 1EAUA 2FO9A 1EXFA 1HXEH 2BMGB 1VCWA 1A4WH 5A8XA 3MFJA 2ZPQA 1BHXF 2PSXA 3ODFA 1C1MA 1EPTC 1AZZA 3H5CB 4FVBA 4DGJA 3ZVAA 4K69A 3MO3A 1PPHE 1ZR0A 4DW2U 2GT7A 3QO6A 3TNSA 5DG6A 1K9OE 1GHYH 4A1VA 1O2TA 5DO4H 2B7DH 1UVOA 1LDTT 2FOBA 1GWAA 1KTSB 1P06A 1YPHC 3QTOH 5K0HA 3TK5A 1A0HB 1NM6A 5JDUB 1D3QB 1ZRKA 1G3CA 2ZGXH 1PPBH 1GBCA 4WH6A 3QLPH 1HBTH 1W13U 1G36A 1UTQA 3GISB 1HCGA 4Y11E 2LNCA 5FAHA 1OWDA 3BTWE 1A61H 2J95A 2OINA 1DLEA 4LK4A 1ELTA 1UCYK 5T6DA 4MPUA 1SLVB 1QRZA 1T8MA 3RXEA 1P2MA 2TGDA 5FBIA 5EXLA 1ZTJA 5HXFA 1ZMLA 4D8NA 4GHTA 1PFXC 1GMDF 1GMHG 4HZHA 5LPRA 2PTNA 1KLTA 4YTAA 1C4U2 1Z1JA 1O3CA 4X1QU 4AZ2B 3HK6B 2PKAB 3GY2A 3P95A 1QB6A 1GG6B 1QHRB 2VNTA 3VB7A 2ALVA 2ZFQH 4ZHLU 2OD3B 2ZTYA 1O3KA 3VB3A 2ZG0H 1O2YA 4IMQA 1NPMA 4FU9A 1DSTA 1ELBA 1GL0E 1SL3A 2A7HA 2OC0A 3URDA 1Z8GA 1E36B 3PO1C 2BDYA 1BUIA 1GVKB 3M5LA 1HFDA 3ELAH 4ISLA 4FUHA 4AYYB 1P11E 2C4FH 3EA8A 1UVTH 1L1JA 1DXWA 2Z3EA 5G4BA 3M3TA 1YPGH 3RXVA 4DJZB 1Z6EA 3RXCA 1ELAA 1O5GH 1LHDH 1OPHB 2EI8A 3PV4A 5HMAA 3GCOA 4ISHH 4RKJB 1NU9A 1ELGA 1EKBB 2WYJA 1SLXB 2XW9A 5H4IB 2EA3A 2M5TA 2UWPA 3T25A 1ARBA 1DUAA 1E35B 4Q7XA 8ESTE 5JPMH 1MTNC 1GBHA 1V2LT 1AD8H 1W7GH 2GCTC 3BEFB 3SUFA 1WAYB 1D4PB 4JK5A 2P59A 2XC5A 1MMJN 1SGIB 1B0FA 1HAPH 2HPPH 3BTTE 1LHEH 1QA0A 2FOEA 4FUCA 4LXBH 1NY22 1EX3A 2C90B 2B5TB 2VH6A 3CP7A 2BQWB 1S85A 1LPZB 2V0BA 4GLYA 3EA7A 5ESTE 4CHAB 1T32A 4NWLA 4ZKNU 1KYNA 1O3FA 3OX7U 4YOIA 4AFSA 2Z94A 3A8CA 2UUJB 1GBLA 4DVAU 1SGQE 1W0ZU 1V2OT 2BY8X 2D8WA 2GX4A 2ZEBA 4TYDA 4BAQB 2ANMH 3Q3YA 2ZGJA 3KEEA 1GI8B 3SHCH 3KF2A 5F8TA 1N1LA 1XUHA 4ZKSU 2RA3A 1K1MA 1ANDA 2Q6GA 1TAWA 3F1SB 1DS2E 3FZZA 3FP7E 1HAHH 4YZUA 3FP8E 5EW1H 2GZ7A 3NPSA 1C5RA 1AFEH 1TNLA 1BTPA 1CA0B 4ISOA 1IQEA 3GCTG 5HM2A 3URCA 2P3FH 3TVJB 4ZMAH 3SU1A 1G30B 4OS5A 2FOHA 1YCPM 1TIOA 3ZZ3A 2PTCE 1RRKA 1Z7KA 2OCVB 1ZPCA 3BG4B 3MI4A 1LQEA 3ZVCA 1GI6A 1HPGA 1RXPA 4IS5A 3UQVA 2ZFPH 1QIXB 1Y3VA 1HDTH 4JYTA 1C2MA 2TBSA 1O34A 1P03A 1NO9H 2DUCA 2J34A 4YLUA 5TCAA 1N6YA 4E7RG 1JRSA 3SUDA 1EB2A 3BTQE 4NFEA 3B9FH 2FESH 2BVRH 4I8JA 1HXFH 1GI2A 1V2RT 1C5QA 2RCEA 4IC6A 1D3PB 1F92A 3RXLA 1O2JA 1XM1A 1F2SE 5J4QA 1VCQA 1YPMH 3SHAH 3UNRA 1GG6C 1AGJA 2C93B 5FPTA 4BNRA 1GGDB 4X2YA 4GPGA 4Q7ZA 1BQYA 1JBUH 4DT7B 1BRBE 1A5IA 4UE7H 4NFFA 2H6MA 3F9HA 2V35A 2FDAA 8GCHG 5HGGA 1SFQB 1GVLA 4X1PU 2AMDA 2QCYA 2PKAA 1Z8JB 1YCPH 1WOFA 2Y82A 4HFPB 3I78A 3ZVGA 6LPRA 1EAIA 2FTMA 3UOUA 2JETB 5FHTA 1GJ7B 1EJNA 1L1GA 2ZF0H 2BDIA 4UFEH 3SI4H 6GCHF 3GYLB 5E2PA 3RXAA 1LPGB 4Y8YA 3SV2H 3RC5A 2PUXB 1DT2A 3A87A 4NZQA 2ZDKA 3DA9B 4K8BA 4KP0A 2GZ9A 2VU8E 1ZLRA 5TCCA 3PMHB 4MTBA 1CT4E 4NA7A 5CHAC 3ZZDA 4Z0KA 2FI3E 2R0LA 3EA9A 2VWMA 1KXDA 5ETXA 1HAOH 1C5ZB 3AW0A 5FXLA 2FOMB 1UVUH 4ABGA 2ZQ1A 3E0PB 1T4VH 1EZSC 1LCYA 8KME2 4DY7B 2AGGX 1RFNA 3P8FA 1E37B 2ALPA 1TX6A 4E05H 3UTUH 2SNWA
chains in the Genus database with same CATH superfamily
1GHAG 1WU1A 1A46H 1BMLA 2YNBA 4JZDH 3SOSA 5A09A 1UVPA 2D2DA 2GD4B 3BG8A 1GCDA 3KQ5A 4CHAC 5FX5A 3ZYDA 5F6MA 4Q80A 1LTOA 5I46H 1C1VH 3EAJA 1GHXH 5L2ZH 3SV8A 1BTHH 2C3SA 5EQSA 2PHBA 5JB9S 1IQKA 3AAUA 1F7ZA 2STBE 2W6ID 1QL9A 3M3VA 4NCYA 2DE9A 4AYVB 3S7HB 4KELA 3RU4D 4F48B 2VIOA 4H42U 1O2NA 3F3BA 1LKBA 3OSYA 1NC6A 2ZCLP 1P2OA 4TY7A 3UFAA 3UPEA 1GI9B 3MMGA 1A2CH 2Z7FE 4DCDA 2NU3E 1CA0C 2Z9LA 1AWFH 1H9IE 3FAOA 4YLQH 1GVZA 1WQVH 1LVBA 1G37A 2ZU3A 5EODA 3SV7A 4B73A 1K2I1 2FI5E 1EP5A 1UTMA 3RMOH 2BB4A 3OY6U 1GL1A 1ZPBA 2PWXA 2F9VA 1MQ6A 1O3GA 5A8YA 1O3JA 2JJ1D 3BG4C 4K8YA 4JK6A 2HVYB 4I31A 1XUFA 2BLVA 4ISIH 1RS0A 1GPZA 3MO9A 5F53A 3F9EA 4AGJA 1TRMA 1FX0B 1BMFD 5C0UA 1RTKA 4OM9A 3EYDA 2AH4X 1SGDE 1TPSA 1KSNA 5E0HA 1KMHB 1L1NA 2QYIA 3KN2A 3LH1A 4FUEA 2JH6D 2R0KA 4BTTB 4KKDA 4A6LA 3MTYA 1O2XA 1ZTLA 3PMJA 5GPIB 1AO5A 1E1RD 4NZLA 2BM2A 2OTVA 1UTOA 3M7TA 3RMNH 3LJOA 3GY5A 1QCPA 1QB9A 2ZFTA 3U69H 1E34B 3TIUA 2ZHWH 2GGVB 1ACBE 1AQ7A 1SSXA 1DE7H 1GBAA 1UO6A 4FXGH 3P8GA 1TBQH 3QX5H 3ZZ7A 1LVOA 3HATH 5DSFA 3A80A 3TITA 1BTYA 3VEQB 1C5YB 4TPYA 1BA8B 5EJZA 5C0TA 1BOQA 1O3OA 3T2NA 5TJXA 1OHHD 2QXGA 2WPHS 2OQ5A 1XXFA 2HPQH 1MAYA 3GY3A 4ABIA 2SGPE 1P9SA 3TH3H 4CH2B 4LZ4B 4TT3D 3PRDA 5FBEA 3RXSA 1WV7H 1OP8A 2JETC 1T8NA 2WPLS 1B5GH 2HNTF 1XUGA 2ODYB 3NXPA 1QRXA 3DT0H 4DIHH 1TA6A 1HAVA 3LC5A 2PSYA 2BD2A 2QF0A 2BDBA 1CHOF 1ZSJA 1O3EA 1W12U 3SNDA 1CGIE 1F5RA 1NFXA 1SGYE 1UK2A 1HAGE 4ABFA 1TNKA 3F0PA 1O3NA 1CT0E 1RTFB 4AC9A 1J9CH 1RGQA 1K1PA 1P2IA 3RXIA 4GAWA 1GJAB 1P01A 3UR9A 4K60A 1QBNA 2ANKH 2P3UB 4TY6A 2KX4A 1GHZA 1HV7A 1FMGA 1KLIH 1MU6B 3RXGA 2VVCA 3SI3H 4FUJA 2ZDNA 4AFUA 2VWLA 3PM3A 1ETTH 2YOLA 1HJAB 1ETRH 3LGIA 4KGAA 4BOHA 2VJ1A 1YKTA 2BLWA 4FUIA 5DJ7A 3RUOA 3PO1B 4MNYA 3QGNB 1LHGH 5DGJA 1IOEA 2BYAX 1THSH 1NFUA 2WYGA 3QZRA 1GHBF 1P2NA 4MNXA 2F9OA 1Y5AT 4XBCA 3RXMA 3TGJE 2BZAA 1O2HA 1YCPK 2I6SA 2J97A 1ZHPA 1O2KA 4BXSA 3OEHD 1MCTA 3EDXB 2QF4A 3ITIA 2F9UA 2KCPA 5C2ZA 1QJ7B 1AKSA 2GDDA 4Y7AA 4O9VA 1HIAB 5C94A 1P02A 1EAWA 5BRRE 3RMLH 2G52A 4FUDA 4YO9A 5L2YH 1DSUA 3E1XB 2QGRA 5EGMA 2J2UA 2WV9A 4NIVA 3U98H 1TONA 1KDQA 1N6XA 3F0OA 3OTJE 3FANA 2BD5A 1XVOA 3V0XA 4Y10E 5GWZA 2WPMS 2FPZA 1D3DB 2EC9H 1YBWA 2IN2A 1PQ8A 2XC0A 3JZ2B 5FPSA 2RG3A 3QWCH 3PWCA 1EP6A 4JZFH 1AU8A 1N8OB 1XVMA 2ZFSA 3PROA 2IJD1 4CBNA 1L2EA 1BT7A 5A8ZA 1P2KA 4Y7BA 3SN8A 2P94A 4LOYH 3MO6A 3UIRA 1UTKA 5KEDA 1CVWH 3SU0A 3U1IB 3F2GA 4LZ1H 3V12A 3AASA 1SR5C 1A3BH 2AGIX 1Y5BT 2BVSH 1IQFA 1ZPZA 3SBKA 3B8JA 5GCHF 1IHTH 4MPVA 1AHTH 3SGAE 5E0JA 2KCOA 4A1XA 2G5VA 1NTPA 3LC3A 3UUZA 3D65E 2R2MB 4UD9H 4ISNA 4ZROA 3SJOA 4B2CA 1XMNB 2WPJS 1NRNH 3SV9A 1OOKB 5C1YA 4INLA 5GIBA 4IW4E 2QY0B 2BX4A 1SGFA 1C2FA 1Q3XA 3O8CA 4OGXA 3TJUA 4YM9A 1V2JT 1FLEE 3CS7A 1F0SA 1C5OH 1K1JA 5C20A 1EZQA 1HAIH 1DY9A 1BCUH 1CGHA 3M5OA 4I8KA 2OK5A 2QC2A 2GV7A 1O0DH 3Q3KA 5DP6A 3Q00A 4ZHAA 3BSQA 7GCHF 1ANBA 4RT1A 3D62A 1V2ST 2H9TH 1CHGA 1TGTA 1X7AC 2BD3A 2H1UA 2R9PA 2SGEE 1INCA 3SZNA 1BHXB 1WCZA 2A2QH 1P0SH 1OWHA 1AN1E 4MVNA 1ZYOA 4WF8A 2Y81A 3S7KB 4WXIA 3M5NA 3S0NA 6CHAB 1TPAE 2SGDE 1SGPE 2OXSA 2ZTZA 3MWIU 1QGFA 1RD3B 1Q2WA 3BV9B 2FLRH 1PPZA 4ZHMU 3DUXH 2SGAA 1SQAA 3F9FA 1C5UA 3GY4A 5BPEA 1TNGA 3NK8A 5HIZA 1ZHMA 5DP8A 4ZKOU 1OYTH 1CA8B 4X2VA 2P95A 2W3IA 1TPPA 3H7TA 1QRWA 4YT7H 1HJAC 1BTWA 2P93A 1ELCA 4D7GA 1FY5A 4Y8ZA 3FOAA 5F03A 1F0RA 1OX1A 1C1NA 3D23A 3MU5A 1FJSA 2WHXA 3MU1A 2FOCA 2HNTC 1GJ6A 2G00A 3RLWH 5CE1A 1ZTKA 4WY3A 1AFQB 3UOPA 1O5EH 1P2JA 3AAVA 2OC7A 3OY5U 1Y3YA 1MKWH 2YNAA 5DP4A 1BJVA 1GBMA 1L4ZA 2SGFE 1O3BA 1NN6A 1CT2E 2GCHG 4A92A 1A3EH 4ABJA 2ASUB 4X2WA 1TX7A 1C5WB 4Q2KA 4MNWA 5EXNA 2AMPA 4A1TA 3RXKA 1P04A 1ELDE 3H7OA 2BQ6B 2OC1A 3TGIE 3VG8A 1C5XB 2B9LA 1C2EA 3CNRA 4X8SH 5CHAB 2WV5A 1FDPA 2XXLA 1MTWA 3GY8A 5DKMA 1KXCA 2W26A 3LH3A 1W8BH 1Y5UT 3ESTA 3A85A 2XCFA 1AE5A 1TBZH 1T7CA 1C1RA 4KTUA 2XOKD 1KXEA 2UWOA 1HIAA 1C1QA 3RC4A 4OS4A 1O3PB 4U2WA 1FY4A 5EW2H 3AVZA 2ZHQH 1N8OC 4B75A 2XBYA 1NRPH 1AUJA 1EZXC 1TX8A 2PV9B 3LONA 2UUFB 3P6ZB 2Z9JA 1MAXA 4IGDA 1BMNH 4X6OA 2HNTE 3F2FA 2R3UA 1YPEH 1IQGA 3MU8A 4CRGA 2A7JA 1WUNH 2VVVA 4B2BA 3RP2A 1UTPA 1SPJA 4BAOB 1C5TA 1C1WH 5C67A 4GVUA 2VINA 3BTFE 1AUTC 1TFXA 2ODQA 2HOBA 4OS2A 2ZU1A 4SGBE 1O3MA 2WSSD 1A0JA 1EOJA 3RXJA 1V2KT 3FFGA 5T6FA 4DURA 1FNIA 2FOFA 2VIDA 4VGCB 4RN6A 2O8WA 5E2OA 1EQ9A 1V2UT 4OS1A 2H9EH 4J1YA 1C2KA 1P10A 1VGCB 1SB1H 2A1DB 5B6OA 1A5GH 3GDUA 4FUBA 4SGAE 3K2UA 3T29A 1C5VA 1HAXB 2W3KA 3M37A 3U8TH 4X6NA 4RKOB 4MG3A 3SU2A 1BRUP 2A4OA 3EQ0H 5EPYA 3VGCB 3ZZAA 3PTBA 3RM0H 3QDZB 2VGCB 3RDZA 1H1BA 2NU0E 3ATMA 1VITG 3N7OA 3LJJA 4RSPA 1SGEE 2PKSC 3OTPA 4X8TH 2XYAA 1YC0A 2CF9H 4MDSA 4ZH8A 1VJAU 3OE7D 4TPIZ 4ZUHA 1W10U 3RXBA 3NZIA 6CHAC 3A7YA 1C2LA 2M2AA 3ZV8A 2W7SA 1J8AA 2F4LA 1IQNA 1LMWB 1O38A 5JBAS 3DFLA 3UR6A 5C1XA 4E7NA 1EAXA 3SU3A 1WTGH 3LU9B 1Y59T 3T5FH 1TQ7B 3MU4A 1NS3A 2HGTH 1G3EA 4Y8XA 1GI0A 1O3IA 1D3TB 3MH5A 5LGOA 1FY3A 1M9UA 1C2HA 5DK1A 2FOAA 1GMHF 4JZIA 1HAVB 3SZEA 5KECA 3KYGA 3A81A 2FS9A 3KGPA 2H5DA 2ZCHP 2CGAA 1BIOA 3PMBB 1GI5A 1ANCA 4D9QA 1LO6A 4NGAH 3CENA 1QB1A 1HB0B 1SGRE 1AFQC 3U1JB 3KQCA 3TPIZ 1MU8B 5ABWA 4AX9H 4WJG2 3GDVA 5GJ4B 1P2QA 2ZWLH 1HUTH 1GMCG 1W2KH 1EB1H 2J94A 3SGBE 1D6WA 1GBIA 1FN8A 3IWMA 5JBCS 2OC8A 3LGVA 1UMAH 2A0QB 4X2XA 1QTFA 2VB0A 2VWNA 2P8OB 2BXTH 1THPB 1SGNE 5IK2D 3RMMH 2EI7A 1G2MA 2W5EA 1CGJE 4AG1A 1TGCA 1K0HA 2QXHA 3MNSA 1ZSLA 2ZIQH 3MHWU 3WW7A 1MKXH 4NA8A 1HRTH 2PFEA 2ZCKP 4AFQA 1FN6A 1BTZA 4THNH 2PUQH 3K9XB 1OS8A 5LPEA 1ZSKA 2ZZUH 3L3TA 5FX6A 2FYQA 2K1QA 1Z1IA 4GCHG 2WUBA 1B0EA 4CR5A 1TMUH 3E16B 4MLFB 2O8MA 1AKSB 5JYIA 3DHKH 4B74A 3UREA 1HAYB 1DLKB 4WVPE 1NROH 1SG8B 1F5KU 2J92A 2BY5X 1CU1A 1BRCE 3LT3A 3R3GB 3A82A 3SO3A 5T3HA 1UTNA 1A0LA 2VIWA 2Z9KA 1SVPA 4CREA 4CRAA 4HTCH 4BTIB 3AK5A 1KDQB 1MKWK 2GT8A 1K22H 1O35A 2THFB 4AFZA 5FCRA 5FCKA 3Q3XA 1O2PA 4O03A 4IC5A 1DWDH 2A2XH 2JH5D 2A4QA 1C9PA 5T6GA 1Y3XA 1QQ4A 1SOZA 4F49A 3KIDU 4VGCC 3I29A 1O2LA 3M36A 3PWBA 4ASUD 4ZXXH 1C4V2 3DSOA 4CBOA 1VGCC 1WQSA 1MD8A 3A7ZA 1GI3A 9ESTA 1A5HA 1UK4A 5EG4A 3SQEE 2Z6BD 3NUMA 1O37A 1Y3WA 2FEQH 1DANH 3S9BA 3GCTF 5GXPA 3VGCC 1BBRH 4FU8A 1BDAA 2F9BH 2VIVA 3ATIA 2VGCC 2V3HH 3ZZ6A 3A7TA 2Q6DA 3A84A 4MNVA 3BIUH 5DP5A 3LGYA 3SNAA 1AVXA 4ABBA 3ATWA 3RXPA 2XC4A 2A7CA 4MPWA 2BDGA 4HGCA 4R8TB 3RXFA 1C5NH 3M61U 1W0YH 3TH4H 3DCLA 3K6YA 2W6JD 4NSVA 1DY8A 2ODPA 3ZVBA 3GCHB 5EJLA 1TWXB 1H8HD 3A83A 6ESTA 2ZGBH 2NU2E 1GBJA 2ESTE 1S82A 3P8OA 2OQUA 2PR3A 2RFKC 1YLNA 1RJXB 4MQAA 3U8OH 1GBTA 1AB9B 4FOUC 1O5BB 2Y7XA 1PYTC 2A45B 2LP6A 3T27A 1IQLA 1TPOA 3RXOA 1SFIA 5GDSH 4Y0YE 4K1TA 3VB5A 5JBTA 2BDAA 2NWNA 3A7XA 4BANB 8GCHF 1WDIA 1TMTH 3NWUA 4U01A 1C4Y2 2ILNA 1LKAA 1GBFA 2TIOA 2V7QD 1JIRA 4ASHA 1FY1A 3T26A 1QJ6B 5A0AE 2GKVE 1DOJA 2AYWA 3RM2H 1HGTH 1TNJA 2ZNKH 1GMDG 1O2ZA 3UNSA 4B76A 2P8OC 1T4UH 2JKHA 2R3YA 2AFQB 1SC8U 3SUEA 1O2WA 5IYTA 2QA9E 2FP7B 1GMCF 2FLBH 1O39A 3E8LA 2ZDLA 1H9LB 1ZHRA 1UTLM 4B1TA 4ABEA 4A5TS 2V3OH 2O8UA 3SORA 3O8DA 1PPFE 3U28C 1OSSA 5ESBA 4AN7A 2FX6A 1ESBA 1IQHA 1DM4B 1O5DH 3PV5A 4Y79A 2A5KA 1YF4A 3M7QA 1C1TA 2GP9B 2A4GA 1FONA 2FS8A 3VXFH 2ZU5A 4Y6DA 4X0WU 1ZRBA 5A0CA 2BY7X 1BBRE 1SMFE 5AHGH 1XUIA 1BITA 3MH6A 1GHAF 3MNCA 2XBWA 3PB1E 2FX4A 3SJ8A 1KTTB 1TB6H 1ELFA 1GJ5H 1EOLA 1FI8A 1XX9A 4I32A 3ZZ5A 3STJA 3TH2H 1FXYA 1H9HE 3F6UH 1T8LA 1ZOMA 2Z3DA 4X8VH 1TNHA 2D26C 2J98B 5EQQA 2BD4A 1YPLH 1ZZZA 2CN0H 2GMTB 8LPRA 2CMYA 3M5MA 1U6QA 2ZTXA 1HYLA 2CF8H 2ZC9H 5F8ZA 2JIZD 3VXEH 3MQKC 3B23B 1FIWA 3RXHA 2AHME 1VKYA 1MBQA 3O8BA 1V2TT 4ABDA 1TA2A 3ENSB 2A31A 1LVMA 3GS9A 1AIXH 5B6LA 1TRYA 1MKXK 3SJKA 4TWWA 1O5CB 5JBBS 1K1IA 1F0UA 3ZZCA 4D76A 5C5OA 1O2QA 4NIYA 5I25A 1WXRA 1TGBA 1C5MD 5DP7A 1AZ8A 1GJ9B 3STIA 2BXUH 1IQIA 1AWHB 2KAIB 2XWAA 2ZDMA 2BOHB 1Z71A 3BTDE 3KCGH 4UFGH 1YWUA 1XUKA 5L6NH 2F43B 5EJ1A 2BTCE 2LELA 3SU4A 1QJ1B 3P17H 1ZMNA 2J9NA 3WWBA 3M35A 1NRSH 1FPCH 1E38B 3RXUA 3GCHC 3UWIA 4D7FA 1VITH 1YPKH 1TRNA 1FQ3A 2ZQ2A 2QXIA 1CBWB 1PYTD 2FODA 1MTSA 1SQRA 4R0IA 3UAIC 1A1RA 1MH0A 1GBEA 5C17A 1TOCB 2XBVA 1TQ0B 5EQRA 2EEKA 1SQTA 3LKWA 1MUEB 1IQJA 3ZYEA 2ZHDA 2GV6A 2HWLB 1AB9C 3PV2A 3SGQE 1HAZB 2CV3A 2RA0A 1GJDB 4OS7A 2BVXH 1AVGH 5C3NA 2YMSB 1E1QD 3LOXA 5EOKA 4NIXA 4ZAEA 2IOTA 3SU5A 1EJAA 1YM0A 3GDSA 1KXAA 1W3CA 5C5NA 1OP0A 1ELEE 4F55A 2TGAA 1IQMA 4X1SU 1EPTA 1BBRK 1V2MT 2CHAB 4I7YH 4INHA 1UHBA 2PKSB 4CRBA 1BTUA 1C1UH 1ZGVA 3PMAB 2Q6FA 1C1OA 4TWYA 1G32B 1NFWA 3E90B 1D6RA 2PLXA 1LVYA 4JMYA 1S6LA 2BZ6H 1YLDA 2C8WB 2QIQA 4O3TA 3VB6A 3EE7A 2A5AA 2LPRA 2F9NA 2J38A 3T62A 1VCPA 2WPIS 2TGPZ 5AF9H 2XRCA 1G9IE 1V2NT 3WY8A 3W95A 1CSOE 4NIWA 2ZDAH 4I33A 1C2IA 3M3SA 4B2AA 1O2UA 3OFND 5FL7D 4E06H 3TJVA 1W14U 1GCTB 1S0QA 1J17T 1E0FD 2FIRH 1S81A 1JIMA 1UW7A 2G8TA 1QL8A 3MOCA 3LIWA 4AB9A 1AY6H 4H6TA 1V2WT 3UB0A 4UFFH 2KZ4A 3BN9A 1O3LA 1MZAA 4XBDA 1GI1A 1YYY1 1ORFA 1FZZA 2F3CE 1ANEA 3A86A 1UTJA 2Z9IA 6GCHG 1HJ8A 1RIWB 2ANWA 3SQHE 1C2GA 1YPHE 4WMDA 1V3XA 4GSOA 3E0NB 4XE4A 1P8VC 1O2VA 3ZZBA 3AW1A 3HKJB 2GTBA 2A4RA 3C1KA 1PQ7A 1O2IA 3LPRA 2BD7A 4D9RA 5LPFA 2GMTC 1C1PA 2XCNA 1ABJH 3KNXA 1C5PA 2V3MA 3LGTA 4BAKB 4K1EA 4JZ1A 2JDID 5DPAA 2WUCA 4O3UA 3JZ1B 4OGYA 1ESTA 1GHVH 1GI4A 1DFPA 2EY4C 1P3CA 3Q77A 3TK6A 4WMEA 3E6PH 2I6QA 2J98A 3ZZ4A 1EATA 5AVDA 1SLWB 1BRAA 1P9UA 2ULLA 1NRRH 3SNEA 4X1RU 2ZKSA 3PLKA 2NU1E 1EUFA 1ESAA 4WMFA 3VPKA 3LGWA 2C8XB 4MPXA 3ZZ9A 1SI5H 1D9IA 1O32A 1LPKB 4M7GA 3SU6A 3BTME 3N7EA 1F0TA 1GJBB 1C1SA 1TBRH 4I8HA 5DP3A 1DWCH 1TMBH 1G3BA 4CRFA 2SNVA 2VVUA 2CJIA 1GDUA 2SFAA 3L33A 1KXFA 2B8OH 1BTXA 1OKXA 2OUAA 5J4SA 3G01A 1BMAA 1O33A 1P57B 1KLJH 1SGFG 2R2WU 2FXRA 2KAIA 2G51A 3VFEA 4WH8A 2OP9A 1CBWC 2ZECA 2FZZA 3RU4T 1JXPA 2BY6X 3BTGE 2ZFRH 1QA7A 1PQAA 4I86A 1AVWA 2D1JA 2FI4E 3NKKA 5FPYA 3D49H 4ABAA 3UY9A 5AFYH 2HRVA 4WWYA 4AGKA 5HM9A 1K1NA 1TABE 1XKBC 2O8TA 3T28A 2AGEX 1H8IH 1DVAH 4BAHB 1JOUB 2AEIH 2H5CA 2XNIA 2YMSC 1C5LH 1HNEE 3QTVH 4XFQA 1O2MA 1NU7B 1AMHA 1SHHB 2TRMA 2GDEH 1TYNA 1NRQH 2XTTB 4J2YB 4Q7YA 2F91A 2WPKS 3GYMA 4CRDA 2CHAC 2O9QA 4OS6A 3FVFB 1GHWH 1XXDA 3E3TA 2ANYA 4DG4A 1MD7A 3MH7A 4FUFA 1S83A 4H4FA 3A8BA 1PJPA 5CHBA 4CRCA 4U30A 1WYKA 2BY9X 2ZU2A 2ZGCA 1Y3UA 4AOQA 3ODDA 4XOJA 1SLUB 2Z3CA 1O2SA 2SGQE 1S84A 2BHGA 3A7VA 1LHCH 5F8XA 1OP2A 2C8ZB 3R0FA 5SGAE 1MTUA 1O3AA 4FETA 1J15A 1ZGIA 3E91A 3FN8A 2GVFA 3ATKA 4YESB 2VH0A 4YOJA 2EQNA 3RXRA 1YGCH 5PTPA 1GCTC 2Y80A 5E8EH 3W94A 1GBKA 2WV4A 2AS9A 4K3JA 1O5AB 2QN5T 2BLOA 2BD8A 2Y5FA 3N99A 3KQDA 3SNCA 2Z9GA 5L30H 1QR3E 3NCLA 2XNDD 4B71A 3OU0A 4X1NU 3UQOA 1V2PT 1CQQA 4NG9H 4ACBA 1XUJA 1OWEA 3C27B 3DFJA 1O2RA 2ZPRA 1MZDA 1KXBA 7LPRA 4ABHA 1GBDA 1FIZA 1P09A 1RIWC 3CS0A 4XRNA 3RU4E 3U9AH 4XSKU 1SOTA 1QURH 2ZI2H 1CHOG 4JCNA 1YP9A 4RI0A 2KM0A 4IMZA 1K1LA 4JYVH 1XKAC 2Y6TA 2CXVA 1K21H 1YPJH 1G2LA 2ZA5A 3TGKE 1S5SA 1ZJDA 3TJOA 1GDNA 2G55A 1QFKH 1HLTH 1DDJA 2BLQA 2GCHF 3PLBA 1YLCA 1DWEH 1AE8H 4ZXYH 2QE7D 1BMMH 1K1OA 4FU7A 3V7TA 4UONA 3BIVH 3SW2B 1L0ZA 1SGCA 1V6DA 3BEIB 3ATLA 1A7SA 1SQOA 1VR1H 1TE0A 3MNXA 5AFZH 4BAMB 2J5UA 1OWJA 3TNTA 1CE5A 3LGUA 4ACAA 3BF6H 1TALA 2C8YB 4X6MA 3A7WA 5E0GA 2PGQB 3DSPA 4INKA 1F5LA 1GHBG 9LPRA 1UVSH 2OBOA 1DPOA 2ZGHA 3TK9A 2OLGA 1GJ4H 2Y7ZA 1PPEE 4GHQA 4Q4LA 2TGTA 4JYUH 3HGNA 2IPHA 1C5SA 3RXDA 5A0BA 1KY9A 2BOKA 5CMXH 2BQ7B 3PYHA 3RC6A 4DIIH 3WWFA 3PLPA 1P05A 1OXGA 2NU4E 3RXQA 1H4WA 2XBXA 4YOGA 5HYOA 2YMSD 2J4IA 1B7XB 1DITH 3MU0A 3K65B 4KTCA 1NESE 2ZO3H 2F9PA 3V13A 1O36A 2P16A 1O3DA 1CO7E 1C2JA 2AERH 5T1VA 1J14A 1J16A 1NZQH 3FKSD 5EPNA 1O30A 2G5NA 2VWOA 2UWLA 3PRBA 1SHYA 3QGJA 2K8IA 1GBBA 2PP6A 4NWKA 1Z8IB 3ZV9A 1L4DA 2BX3A 1ZJKA 2OBQA 2F83A 5EU8A 2O8LA 3M7UA 2W7UA 1SGTA 4A7IB 2Y5GA 2HVXA 2ZU4A 4BXWA 3S9AA 1W11U 4FUGA 1ARCA 1JMOH 2AMQA 2QV1A 4NA9H 3SJIA 3OAAD 4P02A 2KR7A 2VIPA 3S9CA 3UNQA 2K0QA 4FVDA 1ELVA 1QL7A 4CH8B 3SNBA 2WPDD 1QBVH 2WZQA 5JB8S 1UCYH 3HPTB 3A8DA 1T8OA 2KCAA 4I8GA 3GY6A 3O8RA 1UJ1A 1H8DH 1O2GH 1VITF 5GCHG 1VZQH 3QK1A 1FY8E 2KCYA 4AB8A 1EZUC 4UDWH 3ZVFA 1DUEA 1EASA 3HKIB 4F4OC 4UFDH 1SKYE 4YXWD 3IITA 5LH8A 1Z8RA 1BB0B 1GJ8B 4Y0ZE 4ESTE 3HGPA 4K5ZA 1EPTB 2IJOB 1EJMA 1UHBB 1GDQA 2FWWA 1QY6A 3VB4A 1TNIA 1Q31A 2HALA 1OWIA 2B0FA 7ESTE 5K7RA 3Q76A 3GOVB 2AIQA 4UEHH 2QF3A 1DX5M 1QQUA 1GGDC 1S6HA 4JZEH 3F9GA 4X6PA 5EIYA 1K28D 2ZFFH 2FTLE 2RDLA 1NFYA 7GCHG 3V3MA 2ZHEH 3SV6A 1FPHH 3TLOA 4I8LA 1W0KD 2H9HA 4ZCNA 3TJNA 2G81E 1RTLA 1W7XH 1MTVA 1WBGB 2DE8A 3KL6A 3ZVEA 4X8UH 3GCNA 3GY7A 3KHVA 1NBME 4IN2A 1EFRD 1FAKH 4BTUB 3P92A 1VJ9U 3MNBA 1WTHD 2A5IA 2PGBB 3DD2H 4GUXA 2STAE 4CR9A 3S69A 1QNJA 1SBWA 3BTEE 3RXTA 2A32A 3A89A 1KIGH 4AORA 2BD9A 3I77A 1C9TA 3IG6B 5A2MH 1IHSH 3EE0B 4XBBA 1ID5H 3TU7H 1UK3A 2G4TA 1TOMH 4AG2A 3MH4A 2ZPSA 1O31A 2QAAA 1GJCB 3GICB 3SUGA 1THRH 3N7DA 3UWJH 3FP6E 2VIQA 1IAUA 1P3EA 4YT6H 4B6EA 2V6NA 1PQ5A 1G3DA 1JWTA 2QF5A 3LDXH 3ZVDA 4NSYA 3DSGA 5DP9A 4ZKRU 3ZZ8A 1DXPA 1MCVA 2FMJA 1E79D 3HK3B 1NT1A 1HJ9A 4KTSA 4HI3A 4H6SB 3W1EA 2HLCA 3BEUA 1TGSZ 4Y76A 4GCHF 1C2DA 1DICA 1S6FA 1Z6JH 2HLDD 3OEED 1BJUA 2UUKB 3PTNA 5C1UA 2L74A 3BTKE 1T31A 1UCYE 1FAXA 1QBOA 1S0RA 2EI6A 4HG6A 1LQDB 1MBMA 1ABIH 2XWBI 3QUMP 1OWKA 2ZDVH 2JH0D 3P8NA 2ZHFH 2PW8H 4Y71A 2FYRA 2Y5HA 4O97A 2FOGA 2GZ8A 2UUYA 4K1SA 3KQBA 1O5FH 3A88A 2FM2A 1NBMD 2P3TB 2AIPA 4IN1A 5IDKA 4Z6AH 1AI8H 1FUJA 1JRTA 1O3HA 1PPGE 2BDHA 4QT8C 3KQEA 2WINI 1PPCE 7KMEH 1V2VT 3EGKH 3K6ZA 1FV9A 2H2ZA 1MTNB 2G4UA 3P70B 3ZIAD 2GCTB 3L6PA 1TGNA 3FZDA 3A8AA 3SJ9A 3F68H 3QN7A 4K2YA 1OYQA 1MQ5A 4XD7D 5HKKD 4PROA 3MYWA 2Q1JA 1ETSH 1TLDA 1LHFH 2JJ2D 2QXJA 1ZMJA 3BTHE 3QZQA 4WXVA 1O2OA 3U8RH 1P12E 1Y8TA 4U32A 5GNDA 2ZP0H 2BDCA 1WSSH 1BZXE 4IBLH 1V2QT 1DWBH 4XDEA 3RLYH 2TPIZ 5EXMA 4DOQA 3OYPA 1GI7B 1EAUA 2FO9A 1EXFA 1HXEH 2BMGB 1VCWA 1A4WH 5A8XA 3MFJA 2ZPQA 1BHXF 2PSXA 3ODFA 1C1MA 1EPTC 1AZZA 3H5CB 4FVBA 4DGJA 3ZVAA 4K69A 3MO3A 1PPHE 1ZR0A 4DW2U 2GT7A 3QO6A 3TNSA 5DG6A 1K9OE 1GHYH 4A1VA 1O2TA 5DO4H 2B7DH 1MABB 1UVOA 1LDTT 2FOBA 1H8ED 1GWAA 1KTSB 3H09A 1P06A 1YPHC 3QTOH 5K0HA 3TK5A 1A0HB 1NM6A 5JDUB 1D3QB 1ZRKA 1G3CA 2ZGXH 5KGOA 1PPBH 1GBCA 4WH6A 3QLPH 1HBTH 1W13U 1G36A 1UTQA 3GISB 1HCGA 4Y11E 5HIYA 2LNCA 5FAHA 1OWDA 3BTWE 1A61H 2J95A 2OINA 1DLEA 4LK4A 1ELTA 1UCYK 5T6DA 4MPUA 1SLVB 1QRZA 1T8MA 3RXEA 1P2MA 2TGDA 5FBIA 5EXLA 4Q63A 1ZTJA 5HXFA 1ZMLA 4D8NA 1COWD 4GHTA 1PFXC 1GMDF 5CDFE 1GMHG 4HZHA 5LPRA 2PTNA 1KLTA 4YTAA 1C4U2 1Z1JA 1O3CA 4X1QU 4AZ2B 3HK6B 2PKAB 2IPQX 3GY2A 3P95A 1QB6A 1GG6B 1QHRB 2VNTA 3VB7A 2ALVA 2ZFQH 4ZHLU 2OD3B 2ZTYA 1O3KA 3KYFA 3VB3A 4B6FA 2ZG0H 1O2YA 4IMQA 1NPMA 4FU9A 1DSTA 1ELBA 1GL0E 1SL3A 2A7HA 2OC0A 3URDA 1Z8GA 1E36B 3PO1C 2BDYA 1BUIA 1GVKB 3M5LA 1HFDA 3ELAH 4ISLA 4FUHA 4AYYB 1P11E 2C4FH 3EA8A 1UVTH 1L1JA 1DXWA 2Z3EA 5G4BA 3M3TA 1YPGH 3RXVA 4DJZB 1Z6EA 3F2HA 3RXCA 1ELAA 1O5GH 1LHDH 1OPHB 4Z1MD 2EI8A 3PV4A 5HMAA 3GCOA 4ISHH 4RKJB 1NU9A 1ELGA 1EKBB 2WYJA 1SLXB 2XW9A 5H4IB 2EA3A 2M5TA 2UWPA 4RT0A 3T25A 1ARBA 1DUAA 1E35B 4Q7XA 8ESTE 5JPMH 2KFWA 1MTNC 1GBHA 1V2LT 1AD8H 1W7GH 2GCTC 3BEFB 3SUFA 1WAYB 1D4PB 4JK5A 2P59A 2XC5A 1MMJN 1SGIB 1B0FA 1HAPH 2HPPH 3BTTE 1LHEH 1QA0A 2FOEA 4FUCA 4LXBH 1NY22 1EX3A 2C90B 2B5TB 2VH6A 3CP7A 4TSFD 2BQWB 1S85A 1LPZB 2V0BA 4GLYA 3EA7A 5ESTE 4CHAB 1T32A 4M9FA 4NWLA 4ZKNU 1KYNA 1O3FA 3OX7U 4YOIA 4AFSA 2Z94A 3A8CA 2UUJB 1GBLA 4DVAU 1SGQE 1W0ZU 1V2OT 2BY8X 2D8WA 2GX4A 2ZEBA 4TYDA 4BAQB 2ANMH 3Q3YA 2ZGJA 3KEEA 1GI8B 3SHCH 3KF2A 5F8TA 1N1LA 1XUHA 4ZKSU 2RA3A 1K1MA 1ANDA 2Q6GA 1TAWA 3F1SB 1DS2E 3FZZA 3FP7E 1HAHH 4YZUA 3FP8E 5EW1H 2GZ7A 3NPSA 1C5RA 4DT4A 1AFEH 1TNLA 1BTPA 1CA0B 4ISOA 1IQEA 3GCTG 5HM2A 3URCA 2P3FH 3TVJB 4ZMAH 3SU1A 1G30B 4OS5A 2FOHA 1YCPM 1TIOA 3ZZ3A 2PTCE 1RRKA 1Z7KA 2OCVB 1ZPCA 3BG4B 3MI4A 1LQEA 3SYJA 3ZVCA 1W0JD 1GI6A 1HPGA 1RXPA 4IS5A 3UQVA 2ZFPH 1QIXB 1Y3VA 1HDTH 4JYTA 1C2MA 2TBSA 1O34A 1P03A 1NO9H 2DUCA 2J34A 4YLUA 5TCAA 1N6YA 4E7RG 1JRSA 3SUDA 1EB2A 3BTQE 4NFEA 3B9FH 4P00A 2FESH 2BVRH 4I8JA 1HXFH 1GI2A 1V2RT 1C5QA 2GJGA 2RCEA 4IC6A 1D3PB 1F92A 3RXLA 1O2JA 1XM1A 2CK3D 1F2SE 5J4QA 1VCQA 1YPMH 3SHAH 3UNRA 5DN6D 1GG6C 1AGJA 2C93B 3FO8D 5FPTA 2L6OA 4BNRA 1GGDB 4X2YA 4GPGA 4Q7ZA 1BQYA 1JBUH 4DT7B 1BRBE 1A5IA 4UE7H 4NFFA 2H6MA 3F9HA 2V35A 2FDAA 8GCHG 5HGGA 1SFQB 1GVLA 3NRLA 4X1PU 2AMDA 2QCYA 2PKAA 1Z8JB 1YCPH 1WOFA 2Y82A 4HFPB 3I78A 3ZVGA 6LPRA 1EAIA 2FTMA 3UOUA 2JETB 5FHTA 1GJ7B 1EJNA 1L1GA 2ZF0H 2BDIA 4UFEH 3SI4H 6GCHF 1QZ8A 3GYLB 5E2PA 3RXAA 1LPGB 4Y8YA 3SV2H 3RC5A 2PUXB 1DT2A 3A87A 4NZQA 2ZDKA 3DA9B 4K8BA 4KP0A 2GZ9A 2VU8E 1ZLRA 5TCCA 3PMHB 4MTBA 1CT4E 4NA7A 5CHAC 3ZZDA 4Z0KA 2FI3E 2R0LA 3EA9A 2VWMA 1KXDA 5ETXA 1HAOH 1C5ZB 3AW0A 1YY3A 5FXLA 2FOMB 1UVUH 4ABGA 2ZQ1A 2RDEA 3E0PB 1T4VH 2VBCA 1EZSC 1LCYA 8KME2 4DY7B 2AGGX 1RFNA 3P8FA 1E37B 2ALPA 1TX6A 4E05H 3UTUH 2SNWA
chains in the Genus database with same CATH topology
1GHAG 1WU1A 1A46H 1BMLA 2YNBA 4JZDH 3SOSA 5A09A 1UVPA 2D2DA 2GD4B 3BG8A 1GCDA 4CHAC 5FX5A 3ZYDA 5F6MA 4Q80A 1LTOA 5I46H 1C1VH 3EAJA 1GHXH 5L2ZH 3SV8A 1BTHH 2C3SA 5EQSA 2PHBA 5JB9S 1IQKA 3AAUA 1F7ZA 2STBE 1QL9A 3M3VA 4NCYA 2DE9A 4AYVB 3S7HB 4KELA 3RU4D 2VIOA 4H42U 1O2NA 1LKBA 3OSYA 1NC6A 2ZCLP 1P2OA 4TY7A 3UFAA 3UPEA 1GI9B 3MMGA 1A2CH 2Z7FE 4DCDA 2NU3E 1CA0C 2Z9LA 1AWFH 1H9IE 3FAOA 4YLQH 1GVZA 1WQVH 1LVBA 1G37A 2ZU3A 5EODA 3SV7A 4B73A 1K2I1 2FI5E 1EP5A 1UTMA 3RMOH 2BB4A 3OY6U 1GL1A 1ZPBA 2PWXA 2F9VA 1MQ6A 1O3GA 5A8YA 1O3JA 3BG4C 4K8YA 4JK6A 4I31A 1XUFA 2BLVA 4ISIH 1RS0A 1GPZA 3MO9A 3F9EA 4AGJA 1TRMA 1RTKA 3EYDA 2AH4X 1SGDE 1TPSA 1KSNA 5E0HA 1L1NA 2QYIA 3KN2A 3LH1A 4FUEA 2JH6D 2R0KA 4BTTB 4KKDA 4A6LA 3MTYA 1O2XA 1ZTLA 3PMJA 5GPIB 1AO5A 4NZLA 2BM2A 2OTVA 1UTOA 3M7TA 3RMNH 3LJOA 3GY5A 1QCPA 1QB9A 2ZFTA 3U69H 1E34B 3TIUA 2ZHWH 2GGVB 1ACBE 1AQ7A 1SSXA 1DE7H 1GBAA 1UO6A 4FXGH 3P8GA 1TBQH 3QX5H 3ZZ7A 1LVOA 3HATH 3A80A 3TITA 1BTYA 3VEQB 1C5YB 4TPYA 1BA8B 1BOQA 1O3OA 3T2NA 5TJXA 2QXGA 2WPHS 2OQ5A 1XXFA 2HPQH 1MAYA 3GY3A 4ABIA 2SGPE 1P9SA 3TH3H 4CH2B 4LZ4B 5FBEA 3RXSA 1WV7H 1OP8A 2JETC 1T8NA 2WPLS 1B5GH 2HNTF 1XUGA 2ODYB 3NXPA 1QRXA 3DT0H 4DIHH 1TA6A 1HAVA 3LC5A 2PSYA 2BD2A 2QF0A 2BDBA 1CHOF 1ZSJA 1O3EA 1W12U 3SNDA 1CGIE 1F5RA 1NFXA 1SGYE 1UK2A 1HAGE 4ABFA 1TNKA 1O3NA 1CT0E 1RTFB 1J9CH 1RGQA 1K1PA 1P2IA 3RXIA 4GAWA 1GJAB 1P01A 3UR9A 4K60A 1QBNA 2ANKH 2P3UB 4TY6A 1GHZA 1HV7A 1FMGA 1KLIH 1MU6B 3RXGA 2VVCA 3SI3H 4FUJA 2ZDNA 4AFUA 2VWLA 3PM3A 1ETTH 2YOLA 1HJAB 1ETRH 3LGIA 4KGAA 4BOHA 2VJ1A 1YKTA 2BLWA 4FUIA 5DJ7A 3RUOA 3PO1B 4MNYA 3QGNB 1LHGH 5DGJA 1IOEA 2BYAX 1THSH 1NFUA 2WYGA 3QZRA 1GHBF 1P2NA 4MNXA 2F9OA 1Y5AT 4XBCA 3RXMA 3TGJE 2BZAA 1O2HA 1YCPK 2I6SA 1ZHPA 1O2KA 4BXSA 1MCTA 3EDXB 3ITIA 2F9UA 5C2ZA 1QJ7B 1AKSA 2GDDA 4Y7AA 4O9VA 1HIAB 1P02A 1EAWA 5BRRE 3RMLH 2G52A 4FUDA 4YO9A 5L2YH 1DSUA 3E1XB 2QGRA 5EGMA 2J2UA 4NIVA 3U98H 1TONA 1KDQA 1N6XA 3OTJE 3FANA 2BD5A 1XVOA 3V0XA 4Y10E 5GWZA 2WPMS 2FPZA 1D3DB 2EC9H 1YBWA 2IN2A 1PQ8A 2XC0A 3JZ2B 5FPSA 2RG3A 3QWCH 3PWCA 1EP6A 4JZFH 1AU8A 1N8OB 1XVMA 2ZFSA 3PROA 4CBNA 1L2EA 1BT7A 5A8ZA 1P2KA 4Y7BA 3SN8A 2P94A 4LOYH 3MO6A 3UIRA 1UTKA 1CVWH 3SU0A 3U1IB 4LZ1H 3V12A 3AASA 1SR5C 1A3BH 2AGIX 1Y5BT 2BVSH 1IQFA 1ZPZA 3SBKA 3B8JA 5GCHF 1IHTH 4MPVA 1AHTH 3SGAE 5E0JA 4A1XA 2G5VA 1NTPA 3LC3A 3UUZA 3D65E 2R2MB 4UD9H 4ISNA 4ZROA 3SJOA 4B2CA 1XMNB 2WPJS 1NRNH 3SV9A 1OOKB 5C1YA 4INLA 5GIBA 4IW4E 2QY0B 2BX4A 1SGFA 1C2FA 1Q3XA 3O8CA 4OGXA 3TJUA 4YM9A 1V2JT 1FLEE 3CS7A 1F0SA 1C5OH 1K1JA 5C20A 1EZQA 1HAIH 1DY9A 1BCUH 1CGHA 3M5OA 4I8KA 2QC2A 2GV7A 1O0DH 3Q3KA 5DP6A 3Q00A 4ZHAA 3BSQA 7GCHF 1ANBA 3D62A 1V2ST 2H9TH 1CHGA 1TGTA 1X7AC 2BD3A 2H1UA 2R9PA 2SGEE 1INCA 3SZNA 1BHXB 1WCZA 2A2QH 1P0SH 1OWHA 1AN1E 4MVNA 1ZYOA 4WF8A 2Y81A 3S7KB 4WXIA 3M5NA 3S0NA 6CHAB 1TPAE 2SGDE 1SGPE 2OXSA 2ZTZA 3MWIU 1QGFA 1RD3B 1Q2WA 3BV9B 2FLRH 1PPZA 4ZHMU 3DUXH 2SGAA 1SQAA 3F9FA 1C5UA 3GY4A 5BPEA 1TNGA 3NK8A 1ZHMA 5DP8A 4ZKOU 1OYTH 1CA8B 4X2VA 2P95A 2W3IA 1TPPA 3H7TA 1QRWA 4YT7H 1HJAC 1BTWA 2P93A 1ELCA 4D7GA 1FY5A 4Y8ZA 5F03A 1F0RA 1OX1A 1C1NA 3D23A 3MU5A 1FJSA 3MU1A 2FOCA 2HNTC 1GJ6A 2G00A 3RLWH 5CE1A 1ZTKA 4WY3A 1AFQB 3UOPA 1O5EH 1P2JA 3AAVA 2OC7A 3OY5U 1Y3YA 1MKWH 2YNAA 5DP4A 1BJVA 1GBMA 1L4ZA 2SGFE 1O3BA 1NN6A 1CT2E 2GCHG 4A92A 1A3EH 4ABJA 2ASUB 4X2WA 1TX7A 1C5WB 4Q2KA 4MNWA 5EXNA 2AMPA 4A1TA 3RXKA 1P04A 1ELDE 3H7OA 2BQ6B 2OC1A 3TGIE 1C5XB 2B9LA 1C2EA 5CHAB 4X8SH 2WV5A 1FDPA 2XXLA 1MTWA 3GY8A 5DKMA 1KXCA 2W26A 3LH3A 1W8BH 1Y5UT 3ESTA 3A85A 2XCFA 1AE5A 1TBZH 1T7CA 1C1RA 4KTUA 1KXEA 2UWOA 1HIAA 1C1QA 3RC4A 4OS4A 1O3PB 4U2WA 1FY4A 5EW2H 3AVZA 2ZHQH 1N8OC 4B75A 2XBYA 1NRPH 1AUJA 1EZXC 1TX8A 2PV9B 3LONA 2UUFB 3P6ZB 2Z9JA 1MAXA 4IGDA 1BMNH 4X6OA 2HNTE 2R3UA 1YPEH 1IQGA 3MU8A 4CRGA 2A7JA 1WUNH 2VVVA 4B2BA 3RP2A 1UTPA 1SPJA 4BAOB 1C5TA 1C1WH 5C67A 4GVUA 2VINA 3BTFE 1AUTC 1TFXA 2ODQA 2HOBA 4OS2A 2ZU1A 4SGBE 1O3MA 1A0JA 1EOJA 3RXJA 1V2KT 3FFGA 5T6FA 4DURA 1FNIA 2FOFA 2VIDA 4VGCB 4RN6A 2O8WA 5E2OA 1EQ9A 1V2UT 4OS1A 2H9EH 4J1YA 1C2KA 1P10A 1VGCB 1SB1H 2A1DB 5B6OA 1A5GH 3GDUA 4FUBA 4SGAE 3K2UA 3T29A 1C5VA 1HAXB 2W3KA 3M37A 3U8TH 4X6NA 4RKOB 4MG3A 3SU2A 1BRUP 2A4OA 3EQ0H 5EPYA 3VGCB 3ZZAA 3PTBA 3RM0H 3QDZB 2VGCB 3RDZA 1H1BA 2NU0E 3ATMA 1VITG 3N7OA 3LJJA 4RSPA 1SGEE 2PKSC 4X8TH 2XYAA 1YC0A 2CF9H 4MDSA 4ZH8A 1VJAU 4TPIZ 4ZUHA 1W10U 3RXBA 3NZIA 6CHAC 3A7YA 1C2LA 3ZV8A 2W7SA 1J8AA 1IQNA 1LMWB 1O38A 5JBAS 3DFLA 3UR6A 5C1XA 4E7NA 1EAXA 3SU3A 1WTGH 3LU9B 1Y59T 3T5FH 1TQ7B 3MU4A 1NS3A 2HGTH 1G3EA 4Y8XA 1GI0A 1O3IA 1D3TB 3MH5A 5LGOA 1FY3A 1M9UA 1C2HA 5DK1A 2FOAA 1GMHF 4JZIA 1HAVB 3A81A 2FS9A 3KGPA 2H5DA 2ZCHP 2CGAA 1BIOA 3PMBB 1GI5A 1ANCA 4D9QA 1LO6A 4NGAH 3CENA 1QB1A 1HB0B 1SGRE 1AFQC 3U1JB 3KQCA 3TPIZ 1MU8B 5ABWA 4AX9H 4WJG2 3GDVA 5GJ4B 1P2QA 2ZWLH 1HUTH 1GMCG 1W2KH 1EB1H 2J94A 3SGBE 1D6WA 1GBIA 1FN8A 3IWMA 5JBCS 2OC8A 3LGVA 1UMAH 2A0QB 4X2XA 1QTFA 2VB0A 2VWNA 2P8OB 2BXTH 1THPB 1SGNE 3RMMH 2EI7A 1G2MA 2W5EA 1CGJE 4AG1A 1TGCA 2QXHA 3MNSA 1ZSLA 2ZIQH 3MHWU 1MKXH 4NA8A 1HRTH 2PFEA 2ZCKP 4AFQA 1FN6A 1BTZA 4THNH 2PUQH 3K9XB 1OS8A 5LPEA 1ZSKA 2ZZUH 3L3TA 5FX6A 2FYQA 2K1QA 1Z1IA 4GCHG 2WUBA 1B0EA 4CR5A 1TMUH 3E16B 4MLFB 2O8MA 1AKSB 5JYIA 3DHKH 4B74A 3UREA 1HAYB 1DLKB 4WVPE 1NROH 1SG8B 1F5KU 2J92A 2BY5X 1CU1A 1BRCE 3LT3A 3R3GB 3A82A 3SO3A 5T3HA 1UTNA 1A0LA 2VIWA 2Z9KA 1SVPA 4CREA 4CRAA 4HTCH 4BTIB 1KDQB 1MKWK 2GT8A 1K22H 1O35A 2THFB 4AFZA 5FCRA 5FCKA 3Q3XA 1O2PA 4O03A 4IC5A 1DWDH 2A2XH 2JH5D 2A4QA 1C9PA 5T6GA 1Y3XA 1QQ4A 1SOZA 4F49A 3KIDU 4VGCC 3I29A 1O2LA 3M36A 3PWBA 4ZXXH 1C4V2 4CBOA 1VGCC 1WQSA 1MD8A 3A7ZA 1GI3A 9ESTA 1A5HA 1UK4A 5EG4A 3SQEE 2Z6BD 3NUMA 1O37A 1Y3WA 2FEQH 1DANH 3S9BA 3GCTF 5GXPA 3VGCC 1BBRH 4FU8A 1BDAA 2F9BH 2VIVA 3ATIA 2VGCC 2V3HH 3ZZ6A 3A7TA 2Q6DA 3A84A 4MNVA 3BIUH 5DP5A 3LGYA 3SNAA 1AVXA 4ABBA 3ATWA 3RXPA 2XC4A 2A7CA 4MPWA 2BDGA 4HGCA 4R8TB 3RXFA 1C5NH 3M61U 1W0YH 3TH4H 3K6YA 4NSVA 1DY8A 2ODPA 3ZVBA 3GCHB 1TWXB 3A83A 6ESTA 2ZGBH 2NU2E 1GBJA 2ESTE 1S82A 3P8OA 2OQUA 2PR3A 1RJXB 4MQAA 3U8OH 1GBTA 1AB9B 1O5BB 2Y7XA 1PYTC 2A45B 3T27A 1IQLA 1TPOA 3RXOA 1SFIA 5GDSH 4Y0YE 4K1TA 3VB5A 5JBTA 2BDAA 2NWNA 3A7XA 4BANB 8GCHF 1TMTH 3NWUA 4U01A 1C4Y2 2ILNA 1LKAA 1GBFA 2TIOA 1JIRA 4ASHA 1FY1A 3T26A 1QJ6B 5A0AE 2GKVE 1DOJA 2AYWA 3RM2H 1HGTH 1TNJA 2ZNKH 1GMDG 1O2ZA 3UNSA 4B76A 2P8OC 1T4UH 2JKHA 2R3YA 2AFQB 1SC8U 3SUEA 1O2WA 5IYTA 2QA9E 2FP7B 1GMCF 2FLBH 1O39A 3E8LA 2ZDLA 1H9LB 1ZHRA 1UTLM 4B1TA 4ABEA 4A5TS 2V3OH 2O8UA 3SORA 3O8DA 1PPFE 1OSSA 5ESBA 4AN7A 2FX6A 1ESBA 1IQHA 1DM4B 1O5DH 4Y79A 2A5KA 1YF4A 3M7QA 1C1TA 2GP9B 2A4GA 1FONA 2FS8A 3VXFH 2ZU5A 4Y6DA 4X0WU 1ZRBA 5A0CA 2BY7X 1BBRE 1SMFE 5AHGH 1XUIA 1BITA 3MH6A 1GHAF 3MNCA 2XBWA 3PB1E 2FX4A 3SJ8A 1KTTB 1TB6H 1ELFA 1GJ5H 1EOLA 1FI8A 1XX9A 4I32A 3ZZ5A 3STJA 3TH2H 1FXYA 1H9HE 3F6UH 1T8LA 1ZOMA 2Z3DA 4X8VH 1TNHA 2D26C 5EQQA 2BD4A 1YPLH 1ZZZA 2CN0H 2GMTB 8LPRA 2CMYA 3M5MA 1U6QA 2ZTXA 1HYLA 2CF8H 2ZC9H 5F8ZA 3VXEH 3B23B 1FIWA 3RXHA 1MBQA 3O8BA 1V2TT 4ABDA 1TA2A 3ENSB 2A31A 1LVMA 1AIXH 1TRYA 1MKXK 3SJKA 4TWWA 1O5CB 5JBBS 1K1IA 1F0UA 3ZZCA 4D76A 5C5OA 1O2QA 4NIYA 5I25A 1TGBA 1C5MD 5DP7A 1AZ8A 1GJ9B 3STIA 2BXUH 1IQIA 1AWHB 2KAIB 2XWAA 2ZDMA 2BOHB 1Z71A 3BTDE 3KCGH 4UFGH 1XUKA 5L6NH 2BTCE 3SU4A 1QJ1B 3P17H 1ZMNA 2J9NA 3M35A 1NRSH 1FPCH 1E38B 3RXUA 3GCHC 3UWIA 4D7FA 1VITH 1YPKH 1TRNA 1FQ3A 2ZQ2A 2QXIA 1CBWB 1PYTD 2FODA 1MTSA 4R0IA 1A1RA 1MH0A 1GBEA 1TOCB 2XBVA 1TQ0B 5EQRA 2EEKA 1SQTA 3LKWA 1MUEB 1IQJA 3ZYEA 2ZHDA 2GV6A 2HWLB 1AB9C 3SGQE 1HAZB 2CV3A 2RA0A 1GJDB 4OS7A 2BVXH 1AVGH 5C3NA 3LOXA 5EOKA 4NIXA 4ZAEA 2IOTA 3SU5A 1EJAA 1YM0A 3GDSA 1KXAA 1W3CA 5C5NA 1OP0A 1ELEE 2TGAA 1IQMA 4X1SU 1EPTA 1BBRK 1V2MT 2CHAB 4I7YH 4INHA 1UHBA 2PKSB 4CRBA 1BTUA 1C1UH 1ZGVA 3PMAB 2Q6FA 1C1OA 4TWYA 1G32B 1NFWA 3E90B 1D6RA 2PLXA 1LVYA 4JMYA 2BZ6H 1YLDA