1AMHA

Uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKSSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of Asp189Ser trypsin provides evidence for an inherent structural plasticity of the protease.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Hydrolase
molecule keywords ANIONIC TRYPSIN
total genus 49
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA02
2V0BA 4XE4A 1RJXB 1MZDA 5LGOA 2ZU2A 1GDNA 3MH7A 1AFQB 5JBBS 3F9GA 3UNSA 1WTGH 4GSOA 1UVSH 5FXLA 2B5TB 4K8BA 1C4V2 4OS5A 1ZMLA 4JZIA 2ZDNA 1ABJH 3OSYA 1YP9A 2ZGBH 3LU9B 5JBAS 2BY5X 4AB9A 2GD4B 1ZHRA 1BCUH 3R0FA 1RFNA 4F4OC 5A09A 3BTHE 2XBVA 1UVTH 2PTNA 1O2UA 5FHTA 1EKBB 2EC9H 1EASA 2OBQA 4ZHAA 4J2YB 1C5MD 1CA0B 4Q7YA 2BY7X 1Y3VA 3SJKA 1DANH 1WBGB 2CMYA 3ZVDA 1GCTC 2PFEA 3CENA 1BTUA 2ZA5A 2VIPA 3GCOA 4I7YH 3VXFH 3GY7A 4NA9H 1GHVH 1DWCH 2XC5A 1W7XH 2FOEA 2RCEA 4ISHH 1ZHPA 1AKSA 1HAGE 3M5MA 4ZKSU 5EW1H 1ZSKA 3MU5A 2AGEX 1TWXB 1GBFA 1C4U2 2C90B 2HNTE 3P8NA 1MTNB 3TJVA 2GCHG 4R0IA 4TPIZ 1F0UA 1V2UT 1ZGVA 1ZRKA 3LDXH 2GCTB 3U8OH 2BQ6B 4MQAA 1O2TA 2XCFA 5TJXA 2ZDKA 1MU8B 2BLOA 2FOGA 1IHSH 2ZDLA 2O8WA 1LVMA 3U9AH 4A1XA 2G8TA 3PMJA 1QA7A 1UVUH 1DX5M 4YTAA 4K5ZA 2ESTE 5CE1A 1BMMH 1MKXK 1PPCE 3LH3A 1SOTA 2BOKA 1B7XB 1F92A 1ZHMA 2OD3B 2CGAA 1SGEE 4XSKU 1A0HB 3MYWA 4ZKNU 4TWWA 3EE0B 4UD9H 1BHXF 5TCCA 1V2WT 1GL0E 1KDQA 3ZVFA 3D49H 4GCHF 3TJOA 3KF2A 5C5OA 1D3DB 2J34A 2J9NA 2OC1A 3ZZ9A 3SGQE 5DP8A 4R8TB 4AFZA 3GDUA 1BBRE 1OWIA 2XRCA 4PROA 4JZ1A 2ZHDA 3U69H 2ZNKH 2BD2A 1PPEE 3GDVA 3TITA 1YCPK 2PWXA 4AYVB 1KLTA 2RA3A 3PMBB 3T5FH 2BVRH 2SGAA 1XUKA 2ZU4A 1LMWB 1EJNA 2PW8H 2VGCB 2VVVA 1HPGA 5BRRE 1DWEH 3CS7A 4IC5A 1F0TA 2VIVA 3P8FA 5DO4H 4AGJA 4IN2A 2Q6GA 2QV1A 4VGCB 5DP4A 3GY5A 3QLPH 3NKKA 5A0AE 5PTPA 3KIDU 1C4Y2 1AZ8A 1IQGA 2ILNA 3M61U 1TYNA 1P2IA 2ZDVH 1TABE 2R9PA 4BANB 2QAAA 1JRTA 1K1MA 2VWLA 1FLEE 1KDQB 3F9FA 2P8OC 2Q6DA 3EQ0H 2IOTA 3RXVA 2H1UA 3CS0A 4X0WU 1P01A 4K69A 4CH2B 3SU6A 1LHEH 3SNCA 5GCHG 1XM1A 1Y5UT 3RXQA 4ISNA 1FQ3A 1FMGA 5DKMA 4FU7A 4CRGA 5F03A 3BIVH 3M35A 4E06H 2PKAA 3SU4A 2W5EA 1ZTJA 1GI7B 1K28D 2ANKH 1O38A 8GCHG 5GXPA 2FS8A 1AVGH 1SR5C 5EODA 3V0XA 1XX9A 2VJ1A 1Z8GA 4K1SA 2HOBA 5FPTA 2IJOB 1NY22 1KY9A 1CE5A 1SMFE 3Q76A 1F5KU 1PFXC 2K1QA 2BMGB 2VGCC 4O3TA 1HIAA 4X1PU 1EJMA 2J94A 4OS2A 4CBNA 2GKVE 4NCYA 4Y7AA 4JCNA 4BNRA 3UOPA 5T3HA 2ZTXA 1QJ1B 2Z7FE 1BB0B 2H5DA 1NPMA 3PROA 3BTGE 3D23A 4MPWA 2R0KA 1EB2A 4NIXA 3EDXB 5J4SA 3RXSA 1TAWA 2BZ6H 3TNTA 7GCHG 2SNVA 1DT2A 1DLEA 1P12E 2FI5E 2P94A 2PKAB 1YCPM 4CREA 5DP3A 4D9RA 1SGQE 2VU8E 2ZP0H 1K1PA 1L0ZA 2AMPA 2FI4E 1P9UA 1Q3XA 2J2UA 4XFQA 3QN7A 1GJ9B 1TNJA 2HALA 5HM2A 1TGNA 1J15A 1ELEE 3A8AA 2PUXB 4GCHG 4FUCA 3PWBA 3W95A 2QF0A 1NFUA 1SGDE 3SV2H 1Q31A 1AWFH 3U1JB 3A81A 3URCA 2ZU1A 1N6YA 1TPPA 5AFYH 1HJAC 2ZQ1A 2DE8A 3GY6A 3VB3A 1O5CB 4X1NU 3Q3XA 1PQAA 1TA6A 3S0NA 3EA7A 2HWLB 2W7UA 1CBWC 4QT8C 1IQMA 3VPKA 3VXEH 1MKWK 1AVWA 5H4IB 2P16A 3A8DA 3UWIA 1JBUH 1O2NA 4ABDA 3RP2A 1B0EA 1C1UH 5B6OA 1FY8E 2ZCHP 2BDHA 3A8CA 2OC8A 3AW0A 3TU7H 4I31A 4LXBH 4YLUA 1BTWA 1ETTH 3SW2B 2BDGA 3AASA 4X8SH 4KP0A 2BQ7B 3M3TA 3VB5A 3PB1E 1FXYA 1MBMA 1AI8H 3BTME 3TNSA 1MTUA 1YC0A 2P95A 3WY8A 2BDIA 1V2LT 1Y59T 1EOJA 4FU8A 2GGVB 1DSTA 4Y71A 1S82A 4ZROA 3SU2A 1KIGH 1V3XA 3Q3YA 4AOQA 1C9PA 2PGBB 3HGNA 1O0DH 2AGGX 4CHAC 1F7ZA 2A5KA 1F0SA 4DW2U 1UHBA 2BXTH 2BD5A 2BHGA 1HLTH 3SI3H 1LVBA 2W7SA 1ZOMA 1GI3A 2ZTYA 2BOHB 3M37A 2ODYB 1SGPE 1OSSA 1CGHA 1D4PB 1BZXE 1O2YA 2BLWA 3ZV8A 4U30A 3SJ8A 2H9EH 2FI3E 3UQVA 1QB1A 1WQSA 2WPIS 2OC7A 3RMOH 1QA0A 3LC3A 1THPB 2GCHF 1SB1H 3LH1A 3ZZ3A 1ACBE 1EXFA 3A7ZA 1MMJN 3ZZ6A 2PLXA 5A8XA 4BTUB 4BTIB 3LJJA 1ZR0A 2ZO3H 1EZSC 1LDTT 5DPAA 1IQLA 4A1TA 1WQVH 4YT7H 4UFEH 1HUTH 3NWUA 3TK5A 2ANMH 2TGTA 1PPBH 1EB1H 3M5LA 1C2HA 4F49A 1FPHH 1W12U 3MHWU 2NU4E 3PYHA 1EATA 3O8DA 1KLJH 4GAWA 3EA8A 2BYAX 2NU1E 1GDQA 2QF3A 1TB6H 1YPGH 1O2MA 3ESTA 1PYTC 2Z6BD 2V35A 1S0RA 1TX7A 1UTJA 2XW9A 1TBQH 4Y0ZE 1AZZA 4Q80A 4DVAU 1QNJA 3A89A 1MKWH 2F9PA 2C8YB 4K60A 1BTYA 4E7NA 1TMBH 1GJDB 3SN8A 2F91A 3RXIA 1W2KH 1HAIH 3RXRA 2V6NA 2P3FH 2Z9JA 3AAVA 3ELAH 4JZDH 1CVWH 2I6SA 2SNWA 2FESH 1TMTH 5HYOA 2ZTZA 3ODFA 3SHCH 3OU0A 3QWCH 1ZLRA 2BVXH 2Z9GA 3DFJA 1SSXA 2ZKSA 1TIOA 3SNBA 3FP6E 1BBRH 2D1JA 3CP7A 2A7CA 3U1IB 2FODA 5JB9S 4MVNA 3F6UH 2Z94A 1OP8A 1HXFH 1SOZA 3BTTE 3GCHB 1TFXA 3GOVB 3F1SB 1A5GH 1JOUB 2P3TB 3O8RA 1HNEE 3B9FH 3KQCA 2FTMA 1NFXA 5F8TA 1GJ4H 3DHKH 1VITH 2Y82A 1MQ5A 4IN1A 1NFYA 3KNXA 1O5AB 3FVFB 4INKA 3F9HA 3V3MA 4K2YA 2ZFPH 2Z9LA 3NK8A 4I8JA 4ABBA 3GY2A 2EI8A 2FOBA 1L2EA 3NUMA 5F8XA 4XDEA 2VWNA 3ZZBA 4CR5A 1G3BA 1CA0C 1FNIA 2PV9B 2ZDAH 2AEIH 3UQOA 1KLIH 2DE9A 3GICB 1ZMJA 2PGQB 1SGTA 6CHAB 1GDUA 2SGPE 1TPAE 4FVDA 3Q00A 2ZU5A 3RMLH 3T27A 2OCVB 2ZFTA 1U6QA 1C9TA 3K6ZA 3MO6A 1D6RA 4Y8YA 1C5TA 1GPZA 2FS9A 1F2SE 3ATMA 1Z8RA 3E91A 1SGFG 2QIQA 5A2MH 1YLCA 1LPKB 1OWDA 1G30B 2J92A 4NGAH 1D3TB 4MPVA 4U01A 1BJUA 2BB4A 3K65B 1Y3XA 1MCVA 1FJSA 1PPZA 2FYRA 1S0QA 2ZIQH 1M9UA 2GZ8A 1C5WB 3ZZ8A 2PSYA 1NFWA 2VIDA 3LOXA 1EOLA 1SHHB 1SFQB 2ZHFH 3DD2H 3F9EA 3I29A 1T7CA 7LPRA 4IS5A 1G3EA 2XXLA 4X2YA 5BPEA 4WF8A 5L2YH 4X6OA 1W14U 5E0GA 1ELVA 5JDUB 2A5IA 3LGIA 2R2MB 1W0ZU 1LHCH 1A1RA 1VITF 2ANWA 2G81E 2PUQH 1DVAH 4MNXA 3MNCA 2A31A 1GVKB 2UUFB 3LGUA 1GG6B 1N8OB 4H6TA 4IGDA 1P2MA 1ANDA 2OTVA 3RM2H 5T6GA 3QX5H 1RGQA 1IQIA 1P02A 1S83A 2O8MA 1O3AA 8LPRA 1P8VC 4KTSA 4LZ1H 1SLWB 4OGYA 1WOFA 4K8YA 1CO7E 1FIZA 2QXIA 4CRCA 2GDDA 2ZCLP 2A1DB 2FOMB 2G00A 4UEHH 5GDSH 4Y6DA 1N1LA 4FUIA 1T4VH 5F6MA 1GCTB 2EI7A 1GHAG 1VZQH 3PWCA 9ESTA 1G9IE 1EPTB 2KAIB 5CHAC 1ZPCA 2P3UB 2FX6A 5JYIA 1IQNA 1GI0A 4NZLA 1C5NH 3RXEA 3QGNB 3QZQA 4O03A 1EUFA 1KXBA 1SLVB 2NU3E 3IG6B 1O2PA 1XMNB 1TRNA 3NPSA 3HPTB 3KL6A 1MAXA 1GJ8B 3Q3KA 4BAMB 1V2MT 1PQ7A 3RXPA 4CRDA 4FUJA 3RUOA 3P92A 1SGYE 1T8NA 3RXLA 2R3UA 5EXNA 3UUZA 2Y5HA 4KTUA 3RXGA 3TGJE 1FN8A 1UK2A 2ODPA 3ATWA 1TBRH 4B76A 1HJAB 1TONA 1XUFA 2NWNA 2XNIA 3B8JA 3JZ1B 2LNCA 3SBKA 2GTBA 1O30A 3FZDA 3MH4A 1EZQA 4X6PA 5AHGH 3S7HB 4J1YA 2FDAA 4Z0KA 1B0FA 4WJG2 4Y10E 1O2VA 1NTPA 2TRMA 2ULLA 3OY6U 4U32A 1F0RA 4BXSA 2A4RA 1O37A 2BD8A 2D26C 1C5SA 1ZGIA 1QHRB 1EPTC 5CHAB 1HCGA 1AMHA 1Z6EA 1C1VH 4FUDA 1IAUA 2BZAA 1TMUH 2F3CE 1QURH 1S84A 5EXLA 1O34A 4IMZA 1WAYB 5L30H 2GVFA 2AYWA 3UY9A 1O39A 4FU9A 1SI5H 1O5EH 1GBMA 1C2GA 1O2LA 3E3TA 4TPYA 5IYTA 1A0JA 5FBEA 1YF4A 3I77A 1ETSH 1P3CA 3D65E 4M7GA 5FX5A 3RLWH 3M7TA 1QTFA 2B8OH 1CSOE 2XYAA 5C1YA 3OY5U 4DY7B 1CU1A 1QCPA 1BQYA 4D9QA 2CJIA 2VH6A 2A32A 1P04A 2WPJS 3ZZ7A 2VH0A 5TCAA 3C1KA 3FAOA 3SGAE 1P2OA 4U2WA 1C5OH 2UWOA 4Y11E 2GX4A 1SVPA 1C2MA 2G51A 1A5IA 1KXEA 3GYLB 1G2LA 5F8ZA 3TVJB 1DITH 2ZFSA 3LKWA 2OBOA 2HGTH 1GJ6A 2XC0A 2H9TH 5LPRA 1AO5A 1E35B 1TNHA 2WINI 3OYPA 4X1QU 5AF9H 2SGFE 2WUBA 4DURA 3T29A 1NRQH 2G5NA 3A7VA 2TPIZ 1GHZA 3AAUA 3D62A 4UFGH 1VCPA 2A2XH 1WUNH 3L3TA 1NT1A 3SQEE 2VWOA 4WH6A 4XBBA 3L33A 1O2SA 2PHBA 1JRSA 3ODDA 1MU6B 3K6YA 3PMAB 4CR9A 3BTWE 1CBWB 2VIOA 1H8DH 1YBWA 2A5AA 4SGBE 2CHAC 3HK6B 3BSQA 5G4BA 1GL1A 1DSUA 1VR1H 1L1GA 1CA8B 3A84A 1QB6A 1RTLA 5C5NA 1SGCA 1YPLH 2ALVA 4KGAA 1C5VA 1CT2E 1XKBC 2OC0A 1O5DH 1SQOA 1EAWA 1QRZA 1MUEB 5A8ZA 1K9OE 4HZHA 2B0FA 4TWYA 1GJAB 3TPIZ 2ZGJA 1UCYH 1GBEA 3ZVCA 4AFQA 3G01A 1ESTA 1OX1A 1XUHA 1SGRE 2ANYA 2G52A 1MD8A 3MNSA 2Y7XA 1LKBA 2UWLA 6GCHG 1BJVA 2ODQA 1XUIA 4I8LA 3F68H 3P17H 4FUBA 1FONA 2ZZUH 1GBTA 1SBWA 2HNTF 2WUCA 1K21H 3QTVH 4DIHH 4X2XA 4ABIA 4HFPB 4X1RU 1AIXH 4X2WA 1YPKH 3Q77A 1BMAA 1Z7KA 1O3DA 4X1SU 5T6FA 4YM9A 1GBKA 1ANBA 2BX4A 2ZPRA 4O97A 2HVXA 2PKSC 4YO9A 4VGCC 3MH5A 1GHWH 3RXOA 4INHA 1FAKH 1C1NA 3EYDA 1QB9A 1D6WA 3H5CB 5I46H 1QBVH 2UWPA 1RD3B 2ZC9H 5DP6A 4WMFA 1QQUA 2R0LA 4ZHLU 1TX8A 1EAUA 3TIUA 4NSYA 2FTLE 3V13A 2FLBH 4BTTB 1P10A 1PQ8A 2AMDA 2XBWA 4MTBA 1Q2WA 3VGCB 3FANA 5LH8A 1GWAA 3HATH 3TH3H 1SGFA 2RA0A 2F9NA 2ZGCA 4JYVH 3VGCC 2A7JA 1T8LA 1GGDB 1BA8B 4GLYA 1DWBH 5EW2H 4RSPA 3RXHA 1JIRA 2WPLS 7ESTE 3KEEA 5HMAA 2J4IA 1A7SA 2LPRA 2B9LA 2H2ZA 4ABJA 1XVOA 4INLA 1C2JA 1Y3YA 2BTCE 4B73A 4NWLA 1WSSH 3UTUH 4UFFH 6LPRA 1EZXC 1FY4A 4YOIA 1GJBB 1E36B 2Z9IA 2O9QA 1MBQA 1QBNA 5EPYA 4ZKOU 4BOHA 2H6MA 5DG6A 3QUMP 1J16A 2Z3EA 1SPJA 3ZVEA 3A82A 1GJ7B 3A7YA 1TGCA 3BTKE 2A7HA 2Z9KA 2GV7A 1NS3A 1NRPH 3RXAA 1YM0A 1Z1IA 2GP9B 3LGYA 1C2EA 3E1XB 1BDAA 4X6MA 1VCWA 3QTOH 5GPIB 3GCHC 1RRKA 2IN2A 2UUKB 2HPQH 2VVUA 1GMHG 1IHTH 2G55A 1O35A 1ZMNA 4ABGA 1N8OC 1K1IA 4NSVA 1GVZA 1RS0A 6ESTA 1K2I1 1VJAU 4I33A 2EI6A 1TOCB 3VB4A 3A8BA 3T2NA 8KME2 3SU5A 2BD4A 5DJ7A 1H9LB 2H5CA 1ESAA 2A2QH 2UUJB 3GCTG 1OS8A 1HGTH 3E8LA 1DDJA 3EGKH 1C2FA 4DGJA 3M3VA 4DCDA 5FX6A 4B75A 2FOAA 1O2JA 3SJ9A 1BTZA 1GMHF 5EPNA 1O2WA 3A7TA 1DE7H 1GI9B 4JK5A 3RXMA 1FPCH 3HKJB 4ZXYH 1KTTB 1K1LA 2BD7A 1GVLA 2XWBI 3OTJE 1O3NA 4DIIH 1YCPH 1ORFA 4X2VA 3T28A 3E0PB 1ARBA 1GBLA 1QL8A 5LPEA 2HNTC 4KKDA 1O5GH 1S81A 3SV6A 4WVPE 1A3EH 2YNBA 4YLQH 1EQ9A 2GCTC 4WH8A 4UDWH 1AKSB 3DUXH 1KXAA 5DP7A 1UK3A 1UO6A 1G3DA 1C1MA 4FXGH 4AFSA 3EA9A 3BIUH 4KTCA 5FBIA 1HDTH 1XUGA 1T8MA 1O5BB 1J9CH 2TBSA 2W26A 4BAKB 1LHGH 1NN6A 3MI4A 3QO6A 3TJNA 1ZJDA 1HBTH 1TBZH 1QFKH 2O8LA 1H8IH 3ATLA 1O3MA 4YT6H 2XTTB 4LK4A 3T26A 1THRH 1GHXH 2SGDE 1QR3E 2SFAA 3NZIA 3RXBA 1SL3A 1O2KA 1EPTA 2KAIA 5E0HA 4O3UA 1O2HA 1DXWA 2C93B 1YLDA 1YPMH 1NESE 2QXJA 3MFJA 1LQDB 3UPEA 5FPSA 4AYYB 2BDCA 1NZQH 3MU8A 5JBTA 1MTSA 4H6SB 4DOQA 1AN1E 3O8BA 1BT7A 1GI8B 3FP8E 1QIXB 1INCA 2XCNA 4TY6A 1J14A 1H4WA 1TNKA 3QDZB 2W3IA 1B5GH 1RTFB 1RIWB 4A5TS 1BTHH 2TIOA 3MO9A 2G5VA 4MNVA 1QGFA 2A4GA 1PQ5A 1K1JA 1TGBA 1Y3WA 1BTXA 3LT3A 1SQTA 1IOEA 1UTQA 3E6PH 4Q2KA 2JETC 4AG2A 3ITIA 1GCDA 2BDAA 4CRBA 2O8UA 1EX3A 1BRAA 1GBIA 1NC6A 1TGTA 1H9HE 3BG4B 4ZMAH 2ZHQH 2FLRH 3SV7A 5HXFA 1AWHB 1KXDA 4Y7BA 2RDLA 1J8AA 3ZYEA 4NA8A 3BV9B 1CGJE 1GJCB 3BN9A 5SGAE 3T62A 2BLQA 3AVZA 1C1SA 1GBCA 1CT4E 5C3NA 1E38B 3SU3A 2AMQA 4YESB 1K1OA 1KXFA 3A87A 4MPUA 4D7GA 4MG3A 1VCQA 4BAOB 2IPHA 1TNGA 3R3GB 4Y79A 1C2KA 1TLDA 2HPPH 1KXCA 1P0SH 4NFEA 5DP5A 1P05A 1DY9A 2Y6TA 2JH5D 1P2QA 4MNYA 3A88A 1BHXB 3UNRA 2BM2A 2STBE 2V3HH 1UTPA 1Y5BT 1S5SA 1C5PA 2BDBA 4ZHMU 1IQHA 3RXFA 6CHAC 4HI3A 3VFEA 1ELGA 4A6LA 1ELDE 1HYLA 1BBRK 1ZPZA 1W0YH 2WPKS 1ZSLA 4MNWA 1O32A 2FYQA 2WYGA 2ZGHA 1NO9H 1V2RT 4IMQA 4AFUA 4OS1A 2C4FH 2VNTA 1W8BH 2C8ZB 4A92A 1MQ6A 1GBJA 4FUEA 2VIWA 4AZ2B 1OP0A 2C3SA 1AUTC 4MDSA 1S6FA 3RXDA 2FO9A 1MH0A 2ZFRH 4Y8XA 5FCRA 3LIWA 1ELAA 3GYMA 4Q7XA 2GDEH 1ZYOA 1E34B 1OWEA 2RG3A 3RXUA 3TJUA 3M5OA 2BVSH 2QC2A 1V2QT 5GJ4B 3STJA 1FAXA 2WPMS 3TH2H 3SU0A 2F9UA 2CV3A 3BEIB 3SJIA 4NG9H 1ZTLA 2H9HA 2P93A 1LCYA 5C2ZA 2YOLA 1SGIB 5DK1A 1O36A 1HIAB 3SV9A 1OYTH 2FZZA 1BMLA 5FAHA 4X8UH 1O2IA 1GI2A 1CGIE 1G2MA 1SGNE 1VJ9U 3HKIB 2XWAA 3BG8A 3BEFB 1D3PB 3LJOA 3MH6A 2AGIX 1HRTH 3MU1A 1C5QA 5IDKA 4FUGA 4AGKA 3ATKA 1THSH 1LHFH 2CHAB 1VITG 1GMCG 4CRFA 1ZSJA 4ABHA 3MOCA 2AS9A 3RM0H 2HLCA 1VGCB 1HAHH 5C1XA 1MZAA 3MO3A 3A80A 4NA7A 4JMYA 3GY8A 3E16B 4ABEA 4ISOA 1VGCC 4BXWA 3HK3B 3PLPA 3U8RH 1O31A 1D3QB 2CF9H 4GUXA 3ZYDA 2BY8X 2OP9A 1C1TA 3ZZ4A 2JKHA 2HRVA 3SORA 2VWMA 1AU8A 1W11U 3ZZDA 3JZ2B 3N7OA 1Z6JH 4OS6A 1OWJA 2DUCA 1C5XB 3UREA 2CXVA 2V3OH 9LPRA 1AB9C 1FN6A 3BTQE 3FZZA 1O3EA 3SNDA 4AORA 2NU2E 3OX7U 5K7RA 1G36A 4RKJB 1A5HA 1QL7A 3QZRA 4K3JA 2ZPSA 1ZJKA 2Z3CA 4RN6A 5ESTE 1SHYA 1LPZB 1GBDA 1V2NT 1F5LA 3RC6A 1DM4B 1T31A 4ABAA 4AN7A 3BTEE 1NU9A 3SQHE 3QK1A 2D8WA 1MTNC 4ABFA 1YPJH 1BRCE 3SUDA 2OUAA 2BD9A 3SUEA 1KSNA 3VB6A 1C5RA 1IQJA 1GBAA 1H1BA 1AHTH 1C1QA 1MTVA 1TPOA 1Y3UA 1V2OT 4CRAA 3TGKE 2ZHWH 3S7KB 4NFFA 5L2ZH 2XBXA 2D2DA 5EXMA 5E8EH 1P2KA 1WU1A 4UONA 2OINA 1EAIA 4WWYA 4K1TA 1GI5A 1HAVB 3U8TH 2ZCKP 2J38A 4AB8A 3V12A 1O3KA 4B1TA 1FY1A 4OGXA 2VIQA 2B7DH 5EQQA 3SZNA 1O3PB 2WV4A 1ID5H 3M36A 3ZVGA 1UVOA 1YGCH 2OXSA 5GCHF 1SLUB 4I8HA 3FP7E 1WV7H 1O3IA 4THNH 4ZH8A 1LKAA 3ZZ5A 1ZZZA 3A86A 3LC5A 1HAVA 3MMGA 3TH4H 3A85A 3UR9A 1ETRH 4LOYH 1ARCA 4ZUHA 4UFDH 3W94A 2FM2A 2Z3DA 1C2DA 3UOUA 4B2CA 1C5LH 2GT7A 1K22H 3A7XA 1FUJA 1K1NA 1QRWA 1QJ6B 1FZZA 2FP7B 2TGAA 1OPHB 4E05H 1GJ5H 1ELTA 2VINA 2FIRH 3URDA 2AERH 2CF8H 1HXEH 4CH8B 3B23B 7KMEH 3FFGA 2AH4X 1GI4A 1EJAA 2BLVA 1ANCA 1ZTKA 1G3CA 5C67A 1QJ7B 3BG4C 3M7UA 1UTMA 2ZQ2A 2O8TA 3PMHB 3BF6H 4SGAE 1GI6A 4AG1A 4WXVA 1FIWA 2Y81A 2TGDA 4DT7B 1MCTA 4TYDA 4ESTE 3UFAA 1DS2E 1HV7A 4YOGA 2F9VA 3K9XB 4JZFH 2JETB 1Z1JA 4D76A 1SFIA 2A4OA 1DUEA 4ZXXH 1QQ4A 1MTWA 1AUJA 2FOHA 3SO3A 4FUFA 4ISLA 4I32A 1GG6C 1E37B 3MNBA 2EEKA 1HAOH 1D9IA 3LPRA 1PPHE 4E7RG 1AQ7A 1GHBF 4H4FA 4NIVA 3UNQA 2QXGA 1C1WH 2BDYA 2R3YA 1C2LA 1GHAF 1O2XA 1UJ1A 1YPHC 3PTNA 5ABWA 3I78A 2WYJA 4NWKA 3SV8A 1LQEA 2ZG0H 3T25A 3RU4E 2PR3A 5HM9A 4Y76A 3RC4A 2W3KA 2WPHS 4YOJA 1FY5A 3P8OA 1HAZB 3L6PA 1W7GH 1QRXA 1RXPA 1TQ0B 4A1VA 3S9CA 1LO6A 1AGJA 4UE7H 3LGVA 2GMTC 4ZKRU 2SGEE 6GCHF 4OS4A 3LONA 1O2ZA 1JWTA 1GGDC 4XOJA 3AW1A 2Y5GA 2G4TA 2GMTB 3M5NA 4IBLH 1TPSA 1XKAC 2QXHA 1XUJA 3SJOA 4WY3A 5DP9A 3SU1A 3C27B 3ZVAA 1OWHA 4CHAB 4WMEA 8ESTE 2WV5A 2M5TA 2QN5T 3TK9A 4K1EA 1O3BA 1UCYK 2ZDMA 1NRRH 1P06A 2FMJA 1FV9A 2C8XB 2P59A 1V2PT 1O2GH 1TRYA 1V2ST 1UTKA 3KQBA 1O5FH 2UUYA 1XXFA 1SC8U 1EP5A 2ZI2H 3MU0A 2OLGA 3RC5A 1V2KT 2VVCA 4MPXA 2PTCE 4XBCA 1DFPA 2SGQE 5C20A 3GCNA 1FI8A 2FOCA 1A0LA 1AVXA 2QCYA 1A61H 2AIPA 4GHTA 1O33A 1DPOA 2BD3A 1CHOF 5FPYA 5EU8A 2PKSB 1SG8B 1Z71A 2BY6X 2FWWA 4BAHB 3PO1B 5E2PA 1C5YB 1H9IE 3IITA 1C2IA 1TOMH 2A4QA 1BRUP 4X6NA 1A3BH 1ELBA 5ETXA 4RKOB 5AVDA 3ATIA 4O9VA 3MWIU 2FX4A 1UTOA 1T8OA 1AFQC 1CHOG 4Y8ZA 1YPEH 1P57B 7GCHF 1DUAA 1PYTD 3P6ZB 5A0CA 2AIQA 1HFDA 1ABIH 1DLKB 4NZQA 2Y5FA 1O2QA 5AFZH 4NIYA 1V6DA 1TQ7B 1W13U 1DOJA 1GBBA 3V7TA 1P09A 2P8OB 2A45B 2ZECA 8GCHF 2ZHEH 5A0BA 1DY8A 2ZPQA 1OYQA 2JH0D 5EG4A 1J17T 3SOSA 1LVYA 2BX3A 1UTLM 4GHQA 2QYIA 5C1UA 1WYKA 2FEQH 1O3CA 3ZV9A 3RDZA 1T32A 3P95A 5JPMH 1W10U 1P2JA 1NRNH 2FOFA 3RXCA 2PSXA 1OWKA 4CBOA 2OQ5A 5E0JA 3SNAA 4I8KA 2F83A 1C1OA 1PPGE 1BTPA 1O3OA 1KTSB 3VB7A 4ZAEA 3MNXA 4WXIA 3UWJH 1BIOA 3DFLA 1HJ8A 3IWMA 3P8GA 2Q1JA 3U98H 1SQAA 4HGCA 1UCYE 2QY0B 1P03A 3TGIE 2F9BH 1TALA 1G32B 3GY3A 1TE0A 3TK6A 1P11E 4A7IB 3P70B 5I25A 4GVUA 5JBCS 2ZF0H 1XVMA 1P3EA 3HGPA 1OP2A 4JYTA 1CT0E 1BITA 1DICA 4D8NA 2TGPZ 2EA3A 2R2WU 1JXPA 3STIA 4B71A 3QGJA 3RLYH 2THFB 3ZZAA 1QL9A 1W3CA 1O3HA 4Z6AH 2ZFFH 4I8GA 3K2UA 3BEUA 4FUHA 2J95A 1HAYB 1A4WH 3A83A 1NU7B 4H42U 3GISB 2BQWB 1CQQA 1O2OA 2ZU3A 5K0HA 1S6HA 1AD8H 4Y0YE 3RXJA 2ZWLH 3TLOA 4FVBA 4AX9H 1DWDH 5EOKA 1C1RA 4WMDA 3H7OA 3NXPA 1ELCA 3PTBA 5GWZA 1O3FA 1GI1A 4X8VH 1T4UH 1BUIA 3SHAH 1IQKA 1HAXB 1A2CH 1TX6A 2A0QB 1EZUC 1HJ9A 1PJPA 2GZ7A 4Q7ZA 3PLBA 1BRBE 4D7FA 1YPHE 1TRMA 3RU4D 1IQEA 1JIMA 2ALPA 4ASHA 3E0NB 2VB0A 1OKXA 2C8WB 1GHYH 1LHDH 3GDSA 3KGPA 4YZUA 3SI4H 1GMCF 2CN0H 1NROH 1HAPH 4IC6A 5A8YA 1EP6A 1NM6A 4JZEH 1C1PA 1S85A 2XBYA 1HB0B 3S9BA 1BOQA 1G37A 2XC4A 1RIWC 1Y5AT 1AE8H 1AFEH 5J4QA 3O8CA 3RXTA 1XXDA 1E0FD 2FXRA 2BXUH 1O3LA 3SGBE 1O3GA 5E2OA 4GPGA 4OS7A 1GMDF 1UHBB 1L4ZA 5EQRA 3PM3A 1TGSZ 2Y80A 1QY6A 3PLKA 5DGJA 1IQFA 3M7QA 4IW4E 1EAXA 5L6NH 1GBHA 1Y8TA 1TA2A 1AY6H 2Y7ZA 2JH6D 4MLFB 5ESBA 1QBOA 5CMXH 2YNAA 2Q6FA 1FDPA 1A46H 3RMMH 1WTHD 1RTKA 4B74A 2ZEBA 3S69A 1ESBA 4TY7A 3UR6A 2ZFQH 1ZPBA 1V2JT 2G4UA 1TNIA 2AFQB 2ZGXH 4DG4A 1UK4A 3H7TA 1L1NA 1LVOA 1TNLA 3SUGA 1NRSH 1AE5A 3EAJA 2GZ9A 2STAE 1SLXB 4DJZB 3GY4A 3UIRA 3VEQB 3DT0H 1Z8IB 1N6XA 1PPFE 4B2BA 4HTCH 3RU4T 2NU0E 3KHVA 1WCZA 3ZZCA 4X8TH 3RXKA 1DXPA 2ASUB 2F9OA 3RMNH 1L4DA 1C5ZB 3KN2A 1GHBG 2QA9E 3NCLA 4XBDA 1OOKB 3KQEA 3KQDA 3GCTF 3S9AA 3DA9B 3A7WA 1JMOH 1P2NA 1UTNA 4JYUH 2GV6A 5EGMA 1Z8JB 1V2VT 2BY9X 3LGTA 1LPGB 1P9SA 3MTYA 3ENSB 5EQSA 5GIBA 1OXGA 2FPZA 4JK6A 4KELA 3LGWA 3BTDE 1BMNH 1X7AC 4BAQB 3KCGH 4B2AA 1ZRBA 2QGRA 3SUFA 1ELFA 2GT8A 3MU4A 1MAYA 1KYNA 3BTFE 1C5UA 5HGGA 1F5RA 4LZ4B 5FCKA 3E90B 2OQUA 1O2RA 1ANEA 5LPFA 2I6QA 3PV4A 1MKXH 5JB8S 1MD7A 1O3JA 1UVPA 3ZVBA 1CHGA 5T6DA 1UMAH 1V2TT 3M3SA 1AB9B 1YKTA 3PO1C 1GMDG 1YYY1 1L1JA 1FY3A 1LTOA 4ISIH 3SNEA 4NIWA
chains in the Genus database with same CATH superfamily
2V0BA 1YWUA 4XE4A 1RJXB 1MZDA 5LGOA 2ZU2A 1GDNA 3MH7A 1AFQB 5JBBS 3F9GA 3UNSA 1WTGH 4GSOA 1UVSH 5FXLA 2B5TB 4K8BA 1C4V2 4OS5A 1ZMLA 4JZIA 2ZDNA 1ABJH 3OSYA 1YP9A 2ZGBH 3LU9B 5JBAS 2BY5X 4AB9A 2GD4B 1ZHRA 1BCUH 3R0FA 2HVYB 1RFNA 4Z1MD 4F4OC 5A09A 3BTHE 2XBVA 4RI0A 1UVTH 2PTNA 1O2UA 5FHTA 1EKBB 2EC9H 1EASA 2OBQA 4ZHAA 4J2YB 1C5MD 1CA0B 4Q7YA 2BY7X 1Y3VA 3SJKA 1DANH 1WBGB 2CMYA 3ZVDA 3AK5A 1GCTC 2PFEA 3CENA 1BTUA 2ZA5A 2VIPA 3GCOA 4I7YH 3VXFH 3GY7A 4NA9H 1GHVH 1DWCH 3WW7A 2XC5A 1W7XH 2FOEA 2RCEA 4ISHH 1ZHPA 1AKSA 1HAGE 3M5MA 4B6EA 4ZKSU 5EW1H 1ZSKA 3MU5A 2AGEX 1TWXB 1GBFA 1C4U2 2C90B 2HNTE 3P8NA 1MTNB 3TJVA 2GCHG 4R0IA 4TPIZ 3DSGA 1F0UA 1V2UT 1ZGVA 1ZRKA 3LDXH 2GCTB 3U8OH 2BQ6B 4MQAA 1O2TA 2XCFA 5TJXA 2ZDKA 1MU8B 2BLOA 2FOGA 1IHSH 2ZDLA 2O8WA 1LVMA 3U9AH 4A1XA 2G8TA 3PMJA 1QA7A 1UVUH 1DX5M 4YTAA 4K5ZA 1BMFD 1H8ED 2ESTE 5CE1A 1BMMH 1MKXK 1PPCE 3LH3A 1SOTA 2BOKA 1B7XB 1F92A 1ZHMA 2OD3B 3W1EA 2CGAA 1SGEE 4XSKU 1A0HB 3MYWA 4ZKNU 4TWWA 3EE0B 4UD9H 1BHXF 5TCCA 1V2WT 1GL0E 1KDQA 3ZVFA 3D49H 4GCHF 3TJOA 3KF2A 5C5OA 1D3DB 2J34A 2J9NA 2OC1A 3ZZ9A 3SGQE 5DP8A 4M9FA 4R8TB 4AFZA 3MQKC 3GDUA 1BBRE 1OWIA 2XRCA 4PROA 4JZ1A 2ZHDA 3U69H 2ZNKH 2BD2A 1PPEE 3GDVA 3TITA 1YCPK 2PWXA 2RDEA 4AYVB 1KLTA 2RA3A 3PMBB 3T5FH 2BVRH 2SGAA 1XUKA 5EIYA 2ZU4A 1LMWB 1EJNA 2PW8H 2VGCB 2VVVA 1HPGA 5BRRE 1DWEH 3CS7A 4IC5A 1F0TA 2VIVA 3P8FA 5DO4H 4AGJA 1COWD 4IN2A 2Q6GA 2QV1A 4VGCB 5DP4A 3GY5A 3QLPH 3NKKA 5A0AE 5PTPA 3KIDU 1C4Y2 1AZ8A 1IQGA 2ILNA 3M61U 1TYNA 1P2IA 2ZDVH 1TABE 2R9PA 4BANB 2QAAA 1JRTA 1MABB 1K1MA 2VWLA 1FLEE 1KDQB 3F9FA 2P8OC 1SKYE 2Q6DA 3EQ0H 2IOTA 3RXVA 2H1UA 3CS0A 4X0WU 1P01A 4K69A 4CH2B 3SU6A 1LHEH 3SNCA 5GCHG 1XM1A 1Y5UT 3RXQA 5T1VA 4ISNA 1FQ3A 1FMGA 5DKMA 4FU7A 4RT1A 4CRGA 5F03A 3BIVH 3M35A 4E06H 2PKAA 3SU4A 2W5EA 1ZTJA 1GI7B 1K28D 2ANKH 1O38A 8GCHG 5GXPA 2FS8A 1AVGH 1SR5C 5EODA 3V0XA 1XX9A 2VJ1A 1Z8GA 4K1SA 2HOBA 5FPTA 2IJOB 1NY22 1KY9A 1CE5A 1SMFE 3Q76A 1F5KU 1PFXC 2K1QA 2BMGB 2VGCC 4O3TA 1HIAA 4X1PU 3SYJA 5HKKD 1EJMA 2J94A 4OS2A 4CBNA 2GKVE 4NCYA 4Y7AA 4JCNA 4BNRA 3UOPA 2PP6A 5T3HA 4P02A 2ZTXA 1QJ1B 2Z7FE 1BB0B 2H5DA 1NPMA 3PROA 3BTGE 3D23A 4MPWA 2R0KA 1EB2A 4NIXA 3EDXB 5J4SA 3RXSA 1TAWA 2BZ6H 3TNTA 7GCHG 2SNVA 1DT2A 1DLEA 1P12E 2FI5E 2P94A 2PKAB 1YCPM 4CREA 5DP3A 4D9RA 4XRNA 1SGQE 2VU8E 2ZP0H 1K1PA 1L0ZA 2AMPA 2FI4E 1P9UA 1Q3XA 2J2UA 4XFQA 2IJD1 3QN7A 1GJ9B 1TNJA 2HALA 5HM2A 1TGNA 1J15A 2F43B 1ELEE 3A8AA 2PUXB 4GCHG 4FUCA 3PWBA 3W95A 2QF0A 1NFUA 1SGDE 3SV2H 1Q31A 4ACBA 1AWFH 3U1JB 3A81A 3URCA 2QF5A 2ZU1A 1N6YA 1TPPA 5AFYH 1HJAC 2ZQ1A 2DE8A 3GY6A 3VB3A 1O5CB 3F2GA 3Q3XA 4X1NU 1PQAA 1TA6A 3S0NA 3EA7A 2HWLB 2W7UA 1CBWC 4QT8C 1IQMA 3EE7A 3VPKA 4F55A 3VXEH 2LELA 1MKWK 1AVWA 5H4IB 2P16A 3A8DA 3UWIA 1JBUH 1O2NA 4ABDA 3RP2A 1B0EA 1C1UH 5B6OA 1FY8E 2KCYA 2ZCHP 2BDHA 3A8CA 2OC8A 3AW0A 3TU7H 4I31A 2XOKD 4LXBH 4YLUA 1BTWA 1ETTH 3SW2B 2BDGA 3AASA 4X8SH 4KP0A 2BQ7B 3M3TA 3VB5A 3PB1E 1FXYA 1MBMA 1AI8H 3BTME 3TNSA 1MTUA 1YC0A 2P95A 3WY8A 2BDIA 4Q4LA 1V2LT 1Y59T 1EOJA 4FU8A 2GGVB 1DSTA 4Y71A 1S82A 4ZROA 3SU2A 1KIGH 1V3XA 3Q3YA 4AOQA 5EJ1A 1C9PA 2PGBB 3HGNA 1O0DH 2AGGX 4CHAC 1F7ZA 2A5KA 1F0SA 4DW2U 1UHBA 2F4LA 2BXTH 2BD5A 2BHGA 1HLTH 3SI3H 1LVBA 2W7SA 1ZOMA 1GI3A 2ZTYA 2BOHB 3M37A 2ODYB 1SGPE 1OSSA 1CGHA 1D4PB 1BZXE 1O2YA 2BLWA 3ZV8A 4U30A 3SJ8A 2H9EH 2FI3E 3UQVA 1QB1A 1WQSA 2WPIS 2OC7A 3RMOH 3OAAD 1QA0A 3LC3A 1THPB 2GCHF 1SB1H 3LH1A 3ZZ3A 1ACBE 1EXFA 3A7ZA 1MMJN 3ZZ6A 2PLXA 5A8XA 4BTUB 4BTIB 3LJJA 1ZR0A 2ZO3H 1EZSC 1LDTT 5DPAA 1IQLA 4A1TA 1WQVH 4YT7H 2J98B 4UFEH 1HUTH 3NWUA 3TK5A 2ANMH 2TGTA 1PPBH 1EB1H 3M5LA 1C2HA 2J97A 1FPHH 4F49A 1W12U 3MHWU 2NU4E 3PYHA 1EATA 3O8DA 1KLJH 4GAWA 3EA8A 2BYAX 2NU1E 1W0JD 1GDQA 2QF3A 1TB6H 1YPGH 1O2MA 3ESTA 1PYTC 2Z6BD 2V35A 1S0RA 1TX7A 1UTJA 2XW9A 1TBQH 4Y0ZE 1AZZA 4Q80A 2CK3D 4DVAU 1QNJA 3A89A 1MKWH 2F9PA 2C8YB 4K60A 1BTYA 4E7NA 1TMBH 1GJDB 4AC9A 3SN8A 2F91A 3RXIA 1W2KH 1HAIH 3RXRA 2V6NA 3KQ5A 2P3FH 2Z9JA 3AAVA 3ELAH 4JZDH 1CVWH 2I6SA 2SNWA 2FESH 1TMTH 5HYOA 2ZTZA 3ODFA 3SHCH 3OU0A 3QWCH 3F2HA 1ZLRA 2BVXH 2Z9GA 3DFJA 1SSXA 2ZKSA 1TIOA 3SNBA 3FP6E 1BBRH 2D1JA 3CP7A 2A7CA 3U1IB 2FODA 5JB9S 4MVNA 3F6UH 2Z94A 1OP8A 1HXFH 1SOZA 3BTTE 2VBCA 3GCHB 3FN8A 1TFXA 3GOVB 3F1SB 1A5GH 1JOUB 2P3TB 3O8RA 1HNEE 2HLDD 3B9FH 3KQCA 2FTMA 3F2FA 1NFXA 5F8TA 1GJ4H 3DHKH 1VITH 2Y82A 1MQ5A 4IN1A 1NFYA 3KNXA 1O5AB 3FVFB 4ASUD 4INKA 3F9HA 3V3MA 4K2YA 2ZFPH 3SZEA 2Z9LA 3NK8A 4I8JA 4ABBA 3GY2A 2EI8A 2FOBA 1L2EA 3NUMA 5F8XA 4XDEA 2VWNA 3ZZBA 4CR5A 1G3BA 1CA0C 4FOUC 1FNIA 2PV9B 2QF4A 2ZDAH 2AEIH 3UQOA 1KLIH 2DE9A 3GICB 1ZMJA 2PGQB 1SGTA 6CHAB 1GDUA 2SGPE 1TPAE 4FVDA 3Q00A 2ZU5A 3RMLH 4FETA 3T27A 2OCVB 2ZFTA 1U6QA 2KR7A 1C9TA 3K6ZA 3MO6A 1D6RA 4Y8YA 1C5TA 1GPZA 2FS9A 1F2SE 3ATMA 1Z8RA 3E91A 1SGFG 2QIQA 5A2MH 1YLCA 1LPKB 1OWDA 5GNDA 1G30B 2J92A 4NGAH 1D3TB 4MPVA 4U01A 1BJUA 2BB4A 3K65B 1Y3XA 1MCVA 1FJSA 1PPZA 2FYRA 1S0QA 2ZIQH 1M9UA 3PRDA 2GZ8A 1C5WB 3ZZ8A 2PSYA 1NFWA 2VIDA 3DCLA 3LOXA 1EOLA 1SHHB 1SFQB 2ZHFH 3DD2H 3F9EA 3I29A 1T7CA 7LPRA 4IS5A 1G3EA 2XXLA 2EQNA 4X2YA 5BPEA 4WF8A 5L2YH 4X6OA 1W14U 5E0GA 1ELVA 5JDUB 2A5IA 3LGIA 2R2MB 1W0ZU 1LHCH 1A1RA 1VITF 5FL7D 2ANWA 2G81E 2PUQH 1DVAH 3H09A 4MNXA 3MNCA 2A31A 1GVKB 2UUFB 3LGUA 1GG6B 1N8OB 4H6TA 4IGDA 1P2MA 1ANDA 2OTVA 3RM2H 4XD7D 5T6GA 3QX5H 1RGQA 1IQIA 1P02A 1S83A 2O8MA 1O3AA 8LPRA 1P8VC 4KTSA 4LZ1H 1H8HD 1SLWB 4OGYA 3ZIAD 1WOFA 4K8YA 1CO7E 1FIZA 2QXIA 4CRCA 2GDDA 2ZCLP 2A1DB 2FOMB 2G00A 4UEHH 5GDSH 2KZ4A 4Y6DA 1N1LA 4FUIA 1T4VH 5F6MA 1GCTB 2EI7A 1GHAG 1VZQH 3PWCA 9ESTA 1G9IE 1EPTB 2KAIB 5CHAC 1ZPCA 2P3UB 2FX6A 5JYIA 1IQNA 3OEED 1GI0A 4NZLA 4F48B 1C5NH 3RXEA 3QGNB 3QZQA 4O03A 2WSSD 1EUFA 1KXBA 1SLVB 2NU3E 3IG6B 1O2PA 1XMNB 1TRNA 3NPSA 3HPTB 3KL6A 1MAXA 1GJ8B 3Q3KA 4BAMB 1V2MT 1PQ7A 3RXPA 4CRDA 4FUJA 3RUOA 3P92A 1SGYE 1T8NA 3RXLA 2R3UA 5EXNA 3UUZA 2Y5HA 4KTUA 3RXGA 3TGJE 1FN8A 1UK2A 2ODPA 3ATWA 1TBRH 1UW7A 4B76A 1HJAB 1TONA 1XUFA 5C94A 2NWNA 2XNIA 3B8JA 3JZ1B 2LNCA 3SBKA 2GTBA 1O30A 3FZDA 3MH4A 1EZQA 4X6PA 2JJ2D 5AHGH 3S7HB 4J1YA 2FDAA 4Z0KA 1B0FA 4WJG2 4Y10E 1O2VA 1NTPA 2TRMA 2ULLA 3OY6U 4U32A 1F0RA 4BXSA 2A4RA 1O37A 2BD8A 2D26C 1C5SA 1ZGIA 1QHRB 1EPTC 5CHAB 1HCGA 1AMHA 1Z6EA 1C1VH 4FUDA 1IAUA 2BZAA 1TMUH 2F3CE 1QURH 1S84A 5EXLA 1O34A 4IMZA 1WAYB 5L30H 2GVFA 2AYWA 3UY9A 1O39A 4FU9A 1SI5H 1O5EH 1GBMA 1C2GA 1O2LA 3E3TA 4TPYA 5IYTA 1A0JA 4Q63A 3GS9A 5FBEA 4ZCNA 1YF4A 3I77A 1ETSH 1P3CA 3D65E 4M7GA 5FX5A 3RLWH 3M7TA 1QTFA 2B8OH 1CSOE 2XYAA 5C1YA 3OY5U 4DY7B 1CU1A 1QCPA 1BQYA 4D9QA 2CJIA 3NRLA 2VH6A 2A32A 1P04A 2WPJS 3ZZ7A 2VH0A 5TCAA 3C1KA 3FAOA 3SGAE 1P2OA 4U2WA 1C5OH 2UWOA 4Y11E 2GX4A 1SVPA 1WXRA 1C2MA 2G51A 1A5IA 1KXEA 3GYLB 1G2LA 5F8ZA 3TVJB 1DITH 2ZFSA 3LKWA 2OBOA 2HGTH 1GJ6A 2XC0A 2H9TH 1FX0B 3PRBA 5LPRA 1AO5A 1E35B 1TNHA 2WINI 3OYPA 4X1QU 5AF9H 2SGFE 2WUBA 4DURA 3T29A 1NRQH 2G5NA 3A7VA 2TPIZ 1GHZA 3AAUA 3D62A 4UFGH 1VCPA 2A2XH 1WUNH 3L3TA 1NT1A 3SQEE 2VWOA 4WH6A 4XBBA 3L33A 1O2SA 2PHBA 1JRSA 3ODDA 1MU6B 3K6YA 3PMAB 4CR9A 3BTWE 1CBWB 2VIOA 1H8DH 1OHHD 1YBWA 2A5AA 4SGBE 2CHAC 3HK6B 3BSQA 5G4BA 1GL1A 1DSUA 1VR1H 1L1GA 1CA8B 3A84A 2WPDD 1QB6A 1RTLA 5C5NA 1SGCA 1YPLH 2ALVA 4KGAA 5DN6D 1C5VA 1CT2E 1XKBC 2OC0A 1O5DH 1SQOA 1EAWA 1QRZA 1MUEB 5HIYA 5A8ZA 1K9OE 4HZHA 2B0FA 4TWYA 1GJAB 3TPIZ 2ZGJA 1UCYH 1GBEA 3ZVCA 5C17A 4AFQA 3G01A 1ESTA 1OX1A 1XUHA 2GJGA 1SGRE 2ANYA 2G52A 1MD8A 3MNSA 2Y7XA 1LKBA 2UWLA 6GCHG 1BJVA 2ODQA 1XUIA 4I8LA 3F68H 3P17H 4FUBA 1FONA 2ZZUH 1GBTA 1SBWA 2HNTF 2WUCA 1K21H 3QTVH 4DIHH 4X2XA 4ABIA 4HFPB 4X1RU 1AIXH 3FKSD 2J98A 2WHXA 4X2WA 1YPKH 3Q77A 1BMAA 1Z7KA 1O3DA 4X1SU 5T6FA 2LP6A 4YM9A 1GBKA 1ANBA 2BX4A 2ZPRA 4O97A 2HVXA 2PKSC 4YO9A 4VGCC 3MH5A 1GHWH 3RXOA 4INHA 1FAKH 1C1NA 3EYDA 1QB9A 1D6WA 3H5CB 5I46H 1QBVH 2UWPA 1RD3B 2ZC9H 5DP6A 4WMFA 1QQUA 2R0LA 4ZHLU 1TX8A 1EAUA 3TIUA 4NSYA 2FTLE 3N99A 3V13A 2FLBH 4OM9A 4BTTB 1P10A 1PQ8A 2AMDA 2XBWA 4MTBA 1Q2WA 3VGCB 3FANA 5LH8A 1GWAA 3HATH 3TH3H 3WWFA 1SGFA 2KCAA 2RA0A 2F9NA 2ZGCA 4JYVH 3VGCC 2A7JA 4TSFD 1T8LA 1GGDB 1BA8B 4RT0A 4GLYA 1DWBH 5EW2H 4RSPA 3RXHA 1JIRA 2WPLS 7ESTE 3KEEA 5HMAA 2J4IA 1A7SA 2LPRA 2B9LA 2H2ZA 4ABJA 1XVOA 4INLA 1C2JA 1Y3YA 2BTCE 4B73A 4NWLA 1WSSH 3UTUH 4UFFH 5KEDA 6LPRA 1EZXC 1FY4A 4YOIA 1GJBB 1E36B 2Z9IA 2O9QA 1MBQA 1QBNA 5EPYA 4ZKOU 4BOHA 2H6MA 5DG6A 3QUMP 1J16A 2V3MA 2Z3EA 1SPJA 3ZVEA 1YY3A 3A82A 1GJ7B 2YMSB 3A7YA 1TGCA 3BTKE 4P00A 2A7HA 2Z9KA 2GV7A 1NS3A 3KYFA 1NRPH 3RXAA 1YM0A 1Z1IA 2XNDD 2GP9B 3LGYA 1C2EA 3E1XB 1BDAA 4X6MA 1VCWA 3QTOH 5GPIB 3GCHC 1RRKA 2IN2A 2UUKB 2HPQH 2VVUA 1GMHG 1IHTH 2G55A 1O35A 1ZMNA 4ABGA 1N8OC 1K1IA 4NSVA 5KECA 1GVZA 1RS0A 3PV2A 1K2I1 6ESTA 1VJAU 4I33A 2EI6A 1TOCB 3VB4A 3A8BA 3T2NA 8KME2 3SU5A 2BD4A 5DJ7A 1H9LB 2H5CA 1ESAA 2A2QH 2UUJB 3GCTG 1OS8A 1HGTH 3E8LA 1DDJA 3EGKH 1C2FA 1W0KD 4DGJA 3M3VA 4DCDA 5FX6A 4B75A 2FOAA 1O2JA 3SJ9A 1BTZA 1GMHF 5EPNA 1O2WA 3A7TA 1DE7H 1GI9B 4JK5A 3RXMA 1FPCH 3HKJB 4ZXYH 1KTTB 1K1LA 2BD7A 1GVLA 2XWBI 3OTJE 1O3NA 4DIIH 1YCPH 1ORFA 4X2VA 3T28A 3E0PB 1ARBA 1GBLA 1QL8A 5LPEA 2HNTC 4KKDA 1O5GH 1S81A 3SV6A 4WVPE 1A3EH 2YNBA 4YLQH 1EQ9A 2GCTC 4WH8A 4UDWH 1AKSB 3DUXH 1KXAA 5DP7A 1UK3A 1UO6A 1G3DA 2KX4A 1C1MA 4FXGH 4AFSA 2JJ1D 3EA9A 3BIUH 4KTCA 5FBIA 1HDTH 2L6OA 1XUGA 1T8MA 1O5BB 1J9CH 2TBSA 2W26A 4BAKB 1LHGH 1NN6A 3MI4A 3QO6A 3TJNA 1ZJDA 1HBTH 1TBZH 1QFKH 2O8LA 1H8IH 3ATLA 1O3MA 4YT6H 2XTTB 4LK4A 3T26A 1THRH 1GHXH 2SGDE 1QR3E 2SFAA 3NZIA 3RXBA 1SL3A 1O2KA 1EPTA 2KAIA 5E0HA 4O3UA 1O2HA 1DXWA 2C93B 1YLDA 1YPMH 1NESE 2QXJA 3MFJA 1LQDB 3UPEA 5FPSA 3N7DA 4AYYB 2BDCA 1NZQH 3MU8A 5JBTA 1MTSA 5CDFE 4H6SB 4DOQA 1AN1E 3O8BA 1BT7A 1EFRD 1GI8B 3FP8E 1QIXB 1INCA 2XCNA 4TY6A 1J14A 1H4WA 1TNKA 2W6ID 2W3IA 1B5GH 3QDZB 1RTFB 1RIWB 4A5TS 1BTHH 2TIOA 2OK5A 3MO9A 2G5VA 4MNVA 1QGFA 2A4GA 1PQ5A 1K1JA 1TGBA 1Y3WA 1BTXA 3LT3A 1SQTA 1IOEA 1UTQA 3E6PH 4Q2KA 2JETC 4AG2A 3ITIA 1GCDA 2BDAA 4CRBA 2O8UA 1EX3A 1BRAA 1GBIA 1NC6A 1TGTA 1H9HE 3BG4B 4ZMAH 2ZHQH 2FLRH 2K0QA 3SV7A 5HXFA 1AWHB 1KXDA 4Y7BA 5KGOA 2RDLA 1J8AA 3ZYEA 4NA8A 3BV9B 1CGJE 1GJCB 3BN9A 5SGAE 3T62A 2BLQA 3AVZA 1C1SA 1GBCA 1CT4E 5C3NA 1E38B 3SU3A 2AMQA 4YESB 2QE7D 1K1OA 1KXFA 3A87A 4MPUA 4D7GA 4MG3A 1VCQA 4BAOB 2IPHA 1TNGA 3R3GB 4Y79A 1C2KA 1TLDA 2HPPH 2WV9A 1KXCA 1P0SH 4NFEA 5DP5A 1P05A 1DY9A 2Y6TA 2JH5D 1P2QA 4MNYA 3A88A 1BHXB 3UNRA 2BM2A 2STBE 2V3HH 1UTPA 1Y5BT 1S5SA 1C5PA 2BDBA 4ZHMU 1IQHA 3RXFA 6CHAC 4HI3A 3VFEA 1ELGA 4A6LA 1ELDE 1HYLA 1BBRK 1ZPZA 1W0YH 2WPKS 1ZSLA 4MNWA 1O32A 2JIZD 2FYQA 2WYGA 2ZGHA 1NO9H 1V2RT 2AHME 4IMQA 4AFUA 4OS1A 2C4FH 2VNTA 1W8BH 2C8ZB 4A92A 1NBMD 1MQ6A 1GBJA 4FUEA 2VIWA 4AZ2B 1OP0A 2C3SA 1AUTC 4MDSA 1S6FA 3RXDA 2FO9A 1MH0A 2ZFRH 4Y8XA 5FCRA 3LIWA 1ELAA 3GYMA 4Q7XA 2GDEH 5B6LA 2M2AA 1ZYOA 1E34B 1OWEA 2RG3A 3RXUA 3TJUA 3M5OA 2BVSH 2QC2A 1V2QT 5GJ4B 3STJA 1FAXA 2WPMS 3TH2H 3U28C 3SU0A 2F9UA 2CV3A 3BEIB 3SJIA 4NG9H 2KCPA 1ZTLA 2H9HA 2P93A 3FOAA 3OEHD 1LCYA 5C2ZA 2YOLA 3OE7D 1SGIB 5DK1A 1O36A 1HIAB 3SV9A 1OYTH 2FZZA 1BMLA 5FAHA 4X8UH 1O2IA 1GI2A 1CGIE 1G2MA 1SGNE 1VJ9U 3HKIB 2XWAA 3BG8A 3BEFB 1D3PB 3LJOA 3MH6A 2AGIX 1HRTH 3MU1A 1C5QA 5IDKA 4FUGA 4AGKA 3ATKA 1THSH 1LHFH 3UB0A 2CHAB 1VITG 1GMCG 4CRFA 1ZSJA 4ABHA 3MOCA 2AS9A 3RM0H 2HLCA 1VGCB 1HAHH 5C1XA 3F0PA 1MZAA 3MO3A 3A80A 4NA7A 4JMYA 3GY8A 3E16B 4ABEA 4ISOA 1VGCC 1E1QD 4BXWA 3HK3B 3PLPA 3U8RH 1O31A 1D3QB 2CF9H 4GUXA 3ZYDA 2BY8X 2OP9A 1C1TA 3ZZ4A 2JKHA 2HRVA 3SORA 2VWMA 1AU8A 1W11U 3ZZDA 3JZ2B 3N7OA 1Z6JH 4OS6A 1OWJA 2DUCA 1C5XB 3UREA 2CXVA 2V3OH 9LPRA 1AB9C 1FN6A 3BTQE 2YMSD 3FZZA 1O3EA 3SNDA 4AORA 2NU2E 3OX7U 5K7RA 1G36A 4RKJB 1A5HA 1QL7A 3QZRA 4K3JA 2ZPSA 1ZJKA 2Z3CA 4RN6A 5ESTE 1SHYA 1LPZB 1GBDA 1V2NT 1F5LA 3RC6A 1DM4B 1T31A 4ABAA 4AN7A 3BTEE 1NU9A 3SQHE 3QK1A 2D8WA 1MTNC 4ABFA 1YPJH 1BRCE 3SUDA 2OUAA 2BD9A 3SUEA 1KSNA 3VB6A 1C5RA 1IQJA 1GBAA 1H1BA 1AHTH 1C1QA 1MTVA 1TPOA 1Y3UA 1V2OT 4CRAA 3TGKE 2ZHWH 3S7KB 4NFFA 5L2ZH 2XBXA 2D2DA 5EXMA 5E8EH 1P2KA 1WU1A 4UONA 2OINA 1EAIA 4WWYA 4K1TA 1GI5A 1HAVB 3U8TH 2ZCKP 2J38A 5CHBA 4AB8A 3V12A 1O3KA 4B1TA 1FY1A 4OGXA 2IPQX 2VIQA 2B7DH 5EQQA 3SZNA 1O3PB 2WV4A 1ID5H 3M36A 3ZVGA 1UVOA 1YGCH 2OXSA 5GCHF 1SLUB 4I8HA 3FP7E 1WV7H 1O3IA 4THNH 4ZH8A 1LKAA 3ZZ5A 1ZZZA 3A86A 3LC5A 1HAVA 3MMGA 3TH4H 3A85A 3UR9A 1ETRH 4LOYH 1ARCA 4ZUHA 4UFDH 3W94A 2FM2A 2Z3DA 1C2DA 3UOUA 4B2CA 1C5LH 2GT7A 1K22H 3A7XA 2J5UA 1FUJA 1K1NA 1QRWA 2RFKC 1QJ6B 1FZZA 2FP7B 2TGAA 1OPHB 4E05H 1GJ5H 1ELTA 2VINA 2FIRH 3URDA 2AERH 2CF8H 1HXEH 4CH8B 3B23B 7KMEH 3FFGA 2AH4X 1GI4A 1EJAA 2BLVA 1ANCA 1ZTKA 1G3CA 5C67A 1QJ7B 3BG4C 3M7UA 5EJLA 1UTMA 2ZQ2A 3WWBA 1QZ8A 2O8TA 3PMHB 3BF6H 4SGAE 1GI6A 4AG1A 4WXVA 1FIWA 2Y81A 2TGDA 4DT7B 1MCTA 4TYDA 4ESTE 3UFAA 1DS2E 1HV7A 4YOGA 2F9VA 3K9XB 4JZFH 2JETB 1Z1JA 4D76A 1SFIA 2A4OA 3DSOA 1DUEA 4ZXXH 1QQ4A 1MTWA 1AUJA 2FOHA 3SO3A 4FUFA 4ISLA 4I32A 1GG6C 1E37B 3MNBA 2EEKA 1HAOH 1D9IA 3LPRA 3OFND 1PPHE 4E7RG 1AQ7A 1GHBF 4H4FA 4NIVA 3UNQA 2QXGA 1C1WH 2BDYA 2R3YA 1C2LA 1GHAF 1O2XA 1UJ1A 1YPHC 3PTNA 5ABWA 3I78A 2WYJA 4NWKA 3SV8A 1LQEA 2ZG0H 3T25A 3RU4E 2PR3A 5HM9A 4Y76A 3RC4A 2W3KA 2WPHS 4YOJA 1FY5A 3P8OA 1HAZB 3L6PA 1W7GH 1QRXA 1RXPA 1TQ0B 4A1VA 3S9CA 1LO6A 1AGJA 4UE7H 3LGVA 2GMTC 4ZKRU 2SGEE 6GCHF 4OS4A 3LONA 1O2ZA 1JWTA 1GGDC 4XOJA 3AW1A 2Y5GA 2EY4C 2G4TA 2GMTB 3M5NA 4IBLH 1TPSA 1XKAC 2QXHA 1XUJA 3SJOA 4WY3A 5DP9A 3SU1A 3C27B 3ZVAA 1OWHA 4CHAB 4WMEA 8ESTE 2WV5A 2M5TA 3FO8D 2QN5T 3TK9A 4K1EA 1O3BA 1UCYK 2ZDMA 1NRRH 1P06A 2FMJA 1FV9A 2C8XB 2P59A 1V2PT 1O2GH 1TRYA 1V2ST 1UTKA 3KQBA 1O5FH 2UUYA 1XXFA 1WDIA 1SC8U 1EP5A 2ZI2H 3MU0A 2OLGA 3RC5A 1V2KT 2VVCA 4MPXA 2PTCE 4XBCA 1DFPA 2SGQE 5C20A 3GCNA 1FI8A 2FOCA 1A0LA 1AVXA 2QCYA 1A61H 2AIPA 4GHTA 1O33A 1DPOA 2BD3A 1CHOF 5FPYA 5EU8A 2PKSB 1SG8B 1Z71A 2BY6X 2FWWA 4BAHB 3PO1B 5E2PA 1C5YB 1H9IE 3IITA 1C2IA 1TOMH 2A4QA 1BRUP 4X6NA 1A3BH 1ELBA 5ETXA 4HG6A 4RKOB 5AVDA 2V7QD 3ATIA 4O9VA 3MWIU 2FX4A 1UTOA 1T8OA 1AFQC 1CHOG 4Y8ZA 1YPEH 1P57B 7GCHF 1DUAA 1PYTD 3P6ZB 2K8IA 5A0CA 2AIQA 1HFDA 1ABIH 1DLKB 4NZQA 2Y5FA 1O2QA 5AFZH 4NIYA 1V6DA 3KYGA 1TQ7B 1W13U 1DOJA 1GBBA 3V7TA 1P09A 2P8OB 2A45B 2ZECA 8GCHF 2ZHEH 5A0BA 1DY8A 2ZPQA 2L74A 1OYQA 2JH0D 5EG4A 3F3BA 1J17T 3SOSA 1LVYA 2BX3A 1UTLM 4GHQA 2QYIA 5C1UA 1WYKA 2FEQH 1O3CA 3ZV9A 3RDZA 1T32A 3P95A 1E79D 5JPMH 1W10U 1P2JA 5F53A 1NRNH 2FOFA 3RXCA 2PSXA 1OWKA 4CBOA 2OQ5A 5E0JA 3SNAA 4I8KA 5IK2D 2F83A 1C1OA 1PPGE 1BTPA 2KCOA 1O3OA 1KTSB 4B6FA 3VB7A 4ZAEA 3DSPA 3MNXA 4WXIA 3UWJH 1BIOA 3DFLA 1HJ8A 1YLNA 3IWMA 3P8GA 2Q1JA 3U98H 1SQAA 4HGCA 1UCYE 2QY0B 1P03A 3TGIE 2F9BH 1TALA 1G32B 3GY3A 1TE0A 3TK6A 1P11E 4A7IB 3P70B 5I25A 4GVUA 5JBCS 5C0UA 2ZF0H 1XVMA 1P3EA 3HGPA 1OP2A 4JYTA 1CT0E 1BITA 1DICA 4D8NA 2TGPZ 2EA3A 2R2WU 1JXPA 3STIA 4B71A 3F0OA 3QGJA 3RLYH 2THFB 3ZZAA 1QL9A 1W3CA 1O3HA 4Z6AH 2ZFFH 4I8GA 3K2UA 3BEUA 4FUHA 2J95A 1HAYB 1A4WH 1KMHB 1NU7B 3A83A 4H42U 3GISB 2BQWB 1CQQA 1O2OA 2ZU3A 5K0HA 1S6HA 1AD8H 4Y0YE 3RXJA 2ZWLH 3TLOA 4FVBA 4AX9H 1DWDH 5EOKA 1C1RA 3UAIC 4WMDA 3H7OA 3NXPA 1ELCA 1S6LA 3PTBA 5GWZA 1O3FA 1GI1A 4X8VH 1T4UH 1BUIA 3SHAH 1IQKA 1HAXB 1A2CH 1TX6A 2A0QB 1EZUC 1HJ9A 1PJPA 2GZ7A 4Q7ZA 3PLBA 1BRBE 4D7FA 1NBME 1TRMA 1YPHE 3RU4D 1IQEA 1JIMA 2ALPA 4ASHA 3E0NB 2VB0A 1OKXA 2JDID 5EJZA 2C8WB 1GHYH 1LHDH 3GDSA 3KGPA 4YZUA 3SI4H 1GMCF 5C0TA 2CN0H 1NROH 5DSFA 1HAPH 4IC6A 5A8YA 1EP6A 1SQRA 1NM6A 4JZEH 1C1PA 1S85A 1E1RD 2XBYA 1HB0B 3S9BA 1BOQA 1G37A 2XC4A 1RIWC 1Y5AT 1AE8H 1AFEH 5J4QA 3O8CA 3RXTA 1XXDA 1E0FD 2FXRA 4ACAA 2BXUH 1O3LA 3SGBE 1O3GA 3VG8A 5E2OA 4GPGA 4OS7A 1GMDF 1UHBB 1L4ZA 5EQRA 3PM3A 1TGSZ 2Y80A 1QY6A 3PLKA 5DGJA 1IQFA 3M7QA 4IW4E 1EAXA 5L6NH 1GBHA 2KM0A 1Y8TA 3N7EA 1TA2A 1AY6H 2Y7ZA 2JH6D 4MLFB 5ESBA 1QBOA 5CMXH 2YNAA 2Q6FA 1FDPA 1A46H 3RMMH 1WTHD 1RTKA 4B74A 2ZEBA 3S69A 1ESBA 4TY7A 3UR6A 2ZFQH 1ZPBA 1V2JT 2G4UA 1TNIA 2AFQB 2ZGXH 4DG4A 1UK4A 3H7TA 1L1NA 1LVOA 1TNLA 3SUGA 1NRSH 1AE5A 3EAJA 2GZ9A 2STAE 1SLXB 4DJZB 3GY4A 3UIRA 3VEQB 4DT4A 3DT0H 1Z8IB 1N6XA 1PPFE 4B2BA 4YXWD 4HTCH 3RU4T 2NU0E 3KHVA 1WCZA 3ZZCA 4X8TH 3RXKA 2W6JD 1DXPA 2ASUB 2F9OA 3RMNH 1L4DA 1C5ZB 3KN2A 5HIZA 1GHBG 2QA9E 3NCLA 1VKYA 4XBDA 1OOKB 3KQEA 3KQDA 3GCTF 3S9AA 3DA9B 3A7WA 4I86A 1JMOH 1P2NA 1UTNA 4JYUH 2GV6A 5EGMA 1Z8JB 1V2VT 2BY9X 3LGTA 1LPGB 1P9SA 3MTYA 3ENSB 5EQSA 5GIBA 2YMSC 1OXGA 2FPZA 4JK6A 4KELA 3LGWA 3BTDE 1BMNH 1X7AC 4BAQB 4TT3D 1K0HA 3KCGH 4B2AA 1ZRBA 2QGRA 3CNRA 1ELFA 3SUFA 2GT8A 3MU4A 1MAYA 1KYNA 3BTFE 1C5UA 3OTPA 5HGGA 1F5RA 4LZ4B 5FCKA 3E90B 2OQUA 1O2RA 1ANEA 5LPFA 2I6QA 3PV4A 1MKXH 2KFWA 5JB8S 1MD7A 1O3JA 1UVPA 3ZVBA 1CHGA 5T6DA 1UMAH 1V2TT 3M3SA 1AB9B 3PV5A 1YKTA 3PO1C 1GMDG 1YYY1 1L1JA 1FY3A 1LTOA 4ISIH 3SNEA 4NIWA 2WZQA
chains in the Genus database with same CATH topology
2V0BA 4XE4A 1RJXB 1MZDA 5LGOA 2ZU2A 1GDNA 3MH7A 1AFQB 5JBBS 3F9GA 3UNSA 1WTGH 4GSOA 1UVSH 5FXLA 2B5TB 4K8BA 1C4V2 4OS5A 1ZMLA 4JZIA 2ZDNA 1ABJH 3OSYA 1YP9A 2ZGBH 3LU9B 5JBAS 2BY5X 4AB9A 2GD4B 1ZHRA 1BCUH 3R0FA 1RFNA 4F4OC 5A09A 3BTHE 2XBVA 1UVTH 2PTNA 1O2UA 5FHTA 1EKBB 2EC9H 1EASA 2OBQA 4ZHAA 4J2YB 1C5MD 1CA0B 4Q7YA 2BY7X 1Y3VA 3SJKA 1DANH 1WBGB 2CMYA 3ZVDA 1GCTC 2PFEA 3CENA 1BTUA 2ZA5A 2VIPA 3GCOA 4I7YH 3VXFH 3GY7A 4NA9H 1GHVH 1DWCH 2XC5A 1W7XH 2FOEA 2RCEA 4ISHH 1ZHPA 1AKSA 1HAGE 3M5MA 4ZKSU 5EW1H 1ZSKA 3MU5A 2AGEX 1TWXB 1GBFA 1C4U2 2C90B 2HNTE 3P8NA 1MTNB 3TJVA 2GCHG 4R0IA 4TPIZ 1F0UA 1V2UT 1ZGVA 1ZRKA 3LDXH 2GCTB 3U8OH 2BQ6B 4MQAA 1O2TA 2XCFA 5TJXA 2ZDKA 1MU8B 2BLOA 2FOGA 1IHSH 2ZDLA 2O8WA 1LVMA 3U9AH 4A1XA 2G8TA 3PMJA 1QA7A 1UVUH 1DX5M 4YTAA 4K5ZA 2ESTE 5CE1A 1BMMH 1MKXK 1PPCE 3LH3A 1SOTA 2BOKA 1B7XB 1F92A 1ZHMA 2OD3B 2CGAA 1SGEE 4XSKU 1A0HB 3MYWA 4ZKNU 4TWWA 3EE0B 4UD9H 1BHXF 5TCCA 1V2WT 1GL0E 1KDQA 3ZVFA 3D49H 4GCHF 3TJOA 3KF2A 5C5OA 1D3DB 2J34A 2J9NA 2OC1A 3ZZ9A 3SGQE 5DP8A 4R8TB 4AFZA 3GDUA 1BBRE 1OWIA 2XRCA 4PROA 4JZ1A 2ZHDA 3U69H 2ZNKH 2BD2A 1PPEE 3GDVA 3TITA 1YCPK 2PWXA 4AYVB 1KLTA 2RA3A 3PMBB 3T5FH 2BVRH 2SGAA 1XUKA 2ZU4A 1LMWB 1EJNA 2PW8H 2VGCB 2VVVA 1HPGA 5BRRE 1DWEH 3CS7A 4IC5A 1F0TA 2VIVA 3P8FA 5DO4H 4AGJA 4IN2A 2Q6GA 2QV1A 4VGCB 5DP4A 3GY5A 3QLPH 3NKKA 5A0AE 5PTPA 3KIDU 1C4Y2 1AZ8A 1IQGA 2ILNA 3M61U 1TYNA 1P2IA 2ZDVH 1TABE 2R9PA 4BANB 2QAAA 1JRTA 1K1MA 2VWLA 1FLEE 1KDQB 3F9FA 2P8OC 2Q6DA 3EQ0H 2IOTA 3RXVA 2H1UA 3CS0A 4X0WU 1P01A 4K69A 4CH2B 3SU6A 1LHEH 3SNCA 5GCHG 1XM1A 1Y5UT 3RXQA 4ISNA 1FQ3A 1FMGA 5DKMA 4FU7A 4CRGA 5F03A 3BIVH 3M35A 4E06H 2PKAA 3SU4A 2W5EA 1ZTJA 1GI7B 1K28D 2ANKH 1O38A 8GCHG 5GXPA 2FS8A 1AVGH 1SR5C 5EODA 3V0XA 1XX9A 2VJ1A 1Z8GA 4K1SA 2HOBA 5FPTA 2IJOB 1NY22 1KY9A 1CE5A 1SMFE 3Q76A 1F5KU 1PFXC 2K1QA 2BMGB 2VGCC 4O3TA 1HIAA 4X1PU 1EJMA 2J94A 4OS2A 4CBNA 2GKVE 4NCYA 4Y7AA 4JCNA 4BNRA 3UOPA 5T3HA 2ZTXA 1QJ1B 2Z7FE 1BB0B 2H5DA 1NPMA 3PROA 3BTGE 3D23A 4MPWA 2R0KA 1EB2A 4NIXA 3EDXB 5J4SA 3RXSA 1TAWA 2BZ6H 3TNTA 7GCHG 2SNVA 1DT2A 1DLEA 1P12E 2FI5E 2P94A 2PKAB 1YCPM 4CREA 5DP3A 4D9RA 1SGQE 2VU8E 2ZP0H 1K1PA 1L0ZA 2AMPA 2FI4E 1P9UA 1Q3XA 2J2UA 4XFQA 3QN7A 1GJ9B 1TNJA 2HALA 5HM2A 1TGNA 1J15A 1ELEE 3A8AA 2PUXB 4GCHG 4FUCA 3PWBA 3W95A 2QF0A 1NFUA 1SGDE 3SV2H 1Q31A 1AWFH 3U1JB 3A81A 3URCA 2ZU1A 1N6YA 1TPPA 5AFYH 1HJAC 2ZQ1A 2DE8A 3GY6A 3VB3A 1O5CB 4X1NU 3Q3XA 1PQAA 1TA6A 3S0NA 3EA7A 2HWLB 2W7UA 1CBWC 4QT8C 1IQMA 3VPKA 3VXEH 1MKWK 1AVWA 5H4IB 2P16A 3A8DA 3UWIA 1JBUH 1O2NA 4ABDA 3RP2A 1B0EA 1C1UH 5B6OA 1FY8E 2ZCHP 2BDHA 3A8CA 2OC8A 3AW0A 3TU7H 4I31A 4LXBH 4YLUA 1BTWA 1ETTH 3SW2B 2BDGA 3AASA 4X8SH 4KP0A 2BQ7B 3M3TA 3VB5A 3PB1E 1FXYA 1MBMA 1AI8H 3BTME 3TNSA 1MTUA 1YC0A 2P95A 3WY8A 2BDIA 1V2LT 1Y59T 1EOJA 4FU8A 2GGVB 1DSTA 4Y71A 1S82A 4ZROA 3SU2A 1KIGH 1V3XA 3Q3YA 4AOQA 1C9PA 2PGBB 3HGNA 1O0DH 2AGGX 4CHAC 1F7ZA 2A5KA 1F0SA 4DW2U 1UHBA 2BXTH 2BD5A 2BHGA 1HLTH 3SI3H 1LVBA 2W7SA 1ZOMA 1GI3A 2ZTYA 2BOHB 3M37A 2ODYB 1SGPE 1OSSA 1CGHA 1D4PB 1BZXE 1O2YA 2BLWA 3ZV8A 4U30A 3SJ8A 2H9EH 2FI3E 3UQVA 1QB1A 1WQSA 2WPIS 2OC7A 3RMOH 1QA0A 3LC3A 1THPB 2GCHF 1SB1H 3LH1A 3ZZ3A 1ACBE 1EXFA 3A7ZA 1MMJN 3ZZ6A 2PLXA 5A8XA 4BTUB 4BTIB 3LJJA 1ZR0A 2ZO3H 1EZSC 1LDTT 5DPAA 1IQLA 4A1TA 1WQVH 4YT7H 4UFEH 1HUTH 3NWUA 3TK5A 2ANMH 2TGTA 1PPBH 1EB1H 3M5LA 1C2HA 4F49A 1FPHH 1W12U 3MHWU 2NU4E 3PYHA 1EATA 3O8DA 1KLJH 4GAWA 3EA8A 2BYAX 2NU1E 1GDQA 2QF3A 1TB6H 1YPGH 1O2MA 3ESTA 1PYTC 2Z6BD 2V35A 1S0RA 1TX7A 1UTJA 2XW9A 1TBQH 4Y0ZE 1AZZA 4Q80A 4DVAU 1QNJA 3A89A 1MKWH 2F9PA 2C8YB 4K60A 1BTYA 4E7NA 1TMBH 1GJDB 3SN8A 2F91A 3RXIA 1W2KH 1HAIH 3RXRA 2V6NA 2P3FH 2Z9JA 3AAVA 3ELAH 4JZDH 1CVWH 2I6SA 2SNWA 2FESH 1TMTH 5HYOA 2ZTZA 3ODFA 3SHCH 3OU0A 3QWCH 1ZLRA 2BVXH 2Z9GA 3DFJA 1SSXA 2ZKSA 1TIOA 3SNBA 3FP6E 1BBRH 2D1JA 3CP7A 2A7CA 3U1IB 2FODA 5JB9S 4MVNA 3F6UH 2Z94A 1OP8A 1HXFH 1SOZA 3BTTE 3GCHB 1TFXA 3GOVB 3F1SB 1A5GH 1JOUB 2P3TB 3O8RA 1HNEE 3B9FH 3KQCA 2FTMA 1NFXA 5F8TA 1GJ4H 3DHKH 1VITH 2Y82A 1MQ5A 4IN1A 1NFYA 3KNXA 1O5AB 3FVFB 4INKA 3F9HA 3V3MA 4K2YA 2ZFPH 2Z9LA 3NK8A 4I8JA 4ABBA 3GY2A 2EI8A 2FOBA 1L2EA 3NUMA 5F8XA 4XDEA 2VWNA 3ZZBA 4CR5A 1G3BA 1CA0C 1FNIA 2PV9B 2ZDAH 2AEIH 3UQOA 1KLIH 2DE9A 3GICB 1ZMJA 2PGQB 1SGTA 6CHAB 1GDUA 2SGPE 1TPAE 4FVDA 3Q00A 2ZU5A 3RMLH 3T27A 2OCVB 2ZFTA 1U6QA 1C9TA 3K6ZA 3MO6A 1D6RA 4Y8YA 1C5TA 1GPZA 2FS9A 1F2SE 3ATMA 1Z8RA 3E91A 1SGFG 2QIQA 5A2MH 1YLCA 1LPKB 1OWDA 1G30B 2J92A 4NGAH 1D3TB 4MPVA 4U01A 1BJUA 2BB4A 3K65B 1Y3XA 1MCVA 1FJSA 1PPZA 2FYRA 1S0QA 2ZIQH 1M9UA 2GZ8A 1C5WB 3ZZ8A 2PSYA 1NFWA 2VIDA 3LOXA 1EOLA 1SHHB 1SFQB 2ZHFH 3DD2H 3F9EA 3I29A 1T7CA 7LPRA 4IS5A 1G3EA 2XXLA 4X2YA 5BPEA 4WF8A 5L2YH 4X6OA 1W14U 5E0GA 1ELVA 5JDUB 2A5IA 3LGIA 2R2MB 1W0ZU 1LHCH 1A1RA 1VITF 2ANWA 2G81E 2PUQH 1DVAH 4MNXA 3MNCA 2A31A 1GVKB 2UUFB 3LGUA 1GG6B 1N8OB 4H6TA 4IGDA 1P2MA 1ANDA 2OTVA 3RM2H 5T6GA 3QX5H 1RGQA 1IQIA 1P02A 1S83A 2O8MA 1O3AA 8LPRA 1P8VC 4KTSA 4LZ1H 1SLWB 4OGYA 1WOFA 4K8YA 1CO7E 1FIZA 2QXIA 4CRCA 2GDDA 2ZCLP 2A1DB 2FOMB 2G00A 4UEHH 5GDSH 4Y6DA 1N1LA 4FUIA 1T4VH 5F6MA 1GCTB 2EI7A 1GHAG 1VZQH 3PWCA 9ESTA 1G9IE 1EPTB 2KAIB 5CHAC 1ZPCA 2P3UB 2FX6A 5JYIA 1IQNA 1GI0A 4NZLA 1C5NH 3RXEA 3QGNB 3QZQA 4O03A 1EUFA 1KXBA 1SLVB 2NU3E 3IG6B 1O2PA 1XMNB 1TRNA 3NPSA 3HPTB 3KL6A 1MAXA 1GJ8B 3Q3KA 4BAMB 1V2MT 1PQ7A 3RXPA 4CRDA 4FUJA 3RUOA 3P92A 1SGYE 1T8NA 3RXLA 2R3UA 5EXNA 3UUZA 2Y5HA 4KTUA 3RXGA 3TGJE 1FN8A 1UK2A 2ODPA 3ATWA 1TBRH 4B76A 1HJAB 1TONA 1XUFA 2NWNA 2XNIA 3B8JA 3JZ1B 2LNCA 3SBKA 2GTBA 1O30A 3FZDA 3MH4A 1EZQA 4X6PA 5AHGH 3S7HB 4J1YA 2FDAA 4Z0KA 1B0FA 4WJG2 4Y10E 1O2VA 1NTPA 2TRMA 2ULLA 3OY6U 4U32A 1F0RA 4BXSA 2A4RA 1O37A 2BD8A 2D26C 1C5SA 1ZGIA 1QHRB 1EPTC 5CHAB 1HCGA 1AMHA 1Z6EA 1C1VH 4FUDA 1IAUA 2BZAA 1TMUH 2F3CE 1QURH 1S84A 5EXLA 1O34A 4IMZA 1WAYB 5L30H 2GVFA 2AYWA 3UY9A 1O39A 4FU9A 1SI5H 1O5EH 1GBMA 1C2GA 1O2LA 3E3TA 4TPYA 5IYTA 1A0JA 5FBEA 1YF4A 3I77A 1ETSH 1P3CA 3D65E 4M7GA 5FX5A 3RLWH 3M7TA 1QTFA 2B8OH 1CSOE 2XYAA 5C1YA 3OY5U 4DY7B 1CU1A 1QCPA 1BQYA 4D9QA 2CJIA 2VH6A 2A32A 1P04A 2WPJS 3ZZ7A 2VH0A 5TCAA 3C1KA 3FAOA 3SGAE 1P2OA 4U2WA 1C5OH 2UWOA 4Y11E 2GX4A 1SVPA 1C2MA 2G51A 1A5IA 1KXEA 3GYLB 1G2LA 5F8ZA 3TVJB 1DITH 2ZFSA 3LKWA 2OBOA 2HGTH 1GJ6A 2XC0A 2H9TH 5LPRA 1AO5A 1E35B 1TNHA 2WINI 3OYPA 4X1QU 5AF9H 2SGFE 2WUBA 4DURA 3T29A 1NRQH 2G5NA 3A7VA 2TPIZ 1GHZA 3AAUA 3D62A 4UFGH 1VCPA 2A2XH 1WUNH 3L3TA 1NT1A 3SQEE 2VWOA 4WH6A 4XBBA 3L33A 1O2SA 2PHBA 1JRSA 3ODDA 1MU6B 3K6YA 3PMAB 4CR9A 3BTWE 1CBWB 2VIOA 1H8DH 1YBWA 2A5AA 4SGBE 2CHAC 3HK6B 3BSQA 5G4BA 1GL1A 1DSUA 1VR1H 1L1GA 1CA8B 3A84A 1QB6A 1RTLA 5C5NA 1SGCA 1YPLH 2ALVA 4KGAA 1C5VA 1CT2E 1XKBC 2OC0A 1O5DH 1SQOA 1EAWA 1QRZA 1MUEB 5A8ZA 1K9OE 4HZHA 2B0FA 4TWYA 1GJAB 3TPIZ 2ZGJA 1UCYH 1GBEA 3ZVCA 4AFQA 3G01A 1ESTA 1OX1A 1XUHA 1SGRE 2ANYA 2G52A 1MD8A 3MNSA 2Y7XA 1LKBA 2UWLA 6GCHG 1BJVA 2ODQA 1XUIA 4I8LA 3F68H 3P17H 4FUBA 1FONA 2ZZUH 1GBTA 1SBWA 2HNTF 2WUCA 1K21H 3QTVH 4DIHH 4X2XA 4ABIA 4HFPB 4X1RU 1AIXH 4X2WA 1YPKH 3Q77A 1BMAA 1Z7KA 1O3DA 4X1SU 5T6FA 4YM9A 1GBKA 1ANBA 2BX4A 2ZPRA 4O97A 2HVXA 2PKSC 4YO9A 4VGCC 3MH5A 1GHWH 3RXOA 4INHA 1FAKH 1C1NA 3EYDA 1QB9A 1D6WA 3H5CB 5I46H 1QBVH 2UWPA 1RD3B 2ZC9H 5DP6A 4WMFA 1QQUA 2R0LA 4ZHLU 1TX8A 1EAUA 3TIUA 4NSYA 2FTLE 3V13A 2FLBH 4BTTB 1P10A 1PQ8A 2AMDA 2XBWA 4MTBA 1Q2WA 3VGCB 3FANA 5LH8A 1GWAA 3HATH 3TH3H 1SGFA 2RA0A 2F9NA 2ZGCA 4JYVH 3VGCC 2A7JA 1T8LA 1GGDB 1BA8B 4GLYA 1DWBH 5EW2H 4RSPA 3RXHA 1JIRA 2WPLS 7ESTE 3KEEA 5HMAA 2J4IA 1A7SA 2LPRA 2B9LA 2H2ZA 4ABJA 1XVOA 4INLA 1C2JA 1Y3YA 2BTCE 4B73A 4NWLA 1WSSH 3UTUH 4UFFH 6LPRA 1EZXC 1FY4A 4YOIA 1GJBB 1E36B 2Z9IA 2O9QA 1MBQA 1QBNA 5EPYA 4ZKOU 4BOHA 2H6MA 5DG6A 3QUMP 1J16A 2Z3EA 1SPJA 3ZVEA 3A82A 1GJ7B 3A7YA 1TGCA 3BTKE 2A7HA 2Z9KA 2GV7A 1NS3A 1NRPH 3RXAA 1YM0A 1Z1IA 2GP9B 3LGYA 1C2EA 3E1XB 1BDAA 4X6MA 1VCWA 3QTOH