1AMHA

Uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKSSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANIONIC TRYPSIN
publication title The three-dimensional structure of Asp189Ser trypsin provides evidence for an inherent structural plasticity of the protease.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Hydrolase
total genus 49
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA02
1DWCH 1GPZA 1HAYB 4OS2A 2SGQE 4ABEA 2OCVB 2V3OH 3LPRA 1P2MA 1OSSA 1CA0B 3GY5A 1SQTA 1GMCG 1ZGVA 4IS5A 2D1JA 1GJBB 1GWAA 4BAOB 1S6HA 1ZHMA 1ORFA 2VWMA 3RXRA 1GI0A 1TNGA 2Z9LA 2BTCE 1KXCA 3TJNA 4JK5A 4CREA 1H8IH 1EB1H 1LVOA 2BVSH 1W13U 1C1MA 1HV7A 2FXRA 4UEHH 2B0FA 1E35B 3ZZ9A 1QGFA 1Y5AT 3ZZAA 1GMDG 1DWEH 3W94A 2PLXA 3KIDU 2ZGJA 3GDVA 3NKKA 1CGJE 1FY1A 1A5GH 2ZU1A 1TNJA 4A7IB 4B74A 2FMJA 1V2JT 3A80A 3V0XA 3PLKA 1PQ8A 4Y8ZA 2QC2A 1T4VH 2ZPQA 4A92A 3SW2B 1UO6A 2IN2A 5FPSA 2BDIA 1NRRH 1O2OA 1SGEE 3T27A 5JB9S 1GHYH 1TX7A 3ZVCA 4AX9H 1ESTA 1VITF 4SGBE 1TB6H 1SGDE 3PROA 4E7NA 2BXTH 2P59A 2RCEA 1C5PA 3NPSA 4NFFA 1P2IA 4ABIA 1KLIH 4X1NU 2BLWA 2CJIA 1C4U2 4AFUA 2ZHFH 2SGFE 2UUYA 1MD8A 1RIWC 2KAIB 1N1LA 1O3AA 1AGJA 1KLTA 1O39A 4FU9A 1HJ8A 1WBGB 3NCLA 3TJVA 4LZ1H 1GDUA 3SUEA 4ESTE 3TU7H 2AMPA 4DIIH 1JXPA 1KTTB 2HPPH 1N8OC 1BMAA 3LGIA 4AYVB 4THNH 1T31A 3MHWU 3RU4E 5GDSH 8LPRA 3LGTA 3URDA 1HAOH 1SL3A 1AB9C 1O3LA 1Y5BT 4O97A 1FPCH 2A5AA 2Q6DA 2VH0A 2B5TB 1DXWA 2YOLA 3PLPA 1LPGB 1HGTH 2ZP0H 4FVDA 1GI1A 4NA7A 1RGQA 4FUFA 1V2VT 3AVZA 1E0FD 1GJDB 3UIRA 5DP3A 4ABBA 1NM6A 3M7QA 5C67A 2XWBI 1EPTC 5A8XA 3KQBA 5J4QA 4D9QA 1VR1H 5LH8A 2VIPA 2ZIQH 1CBWC 1BQYA 1D6RA 4FUCA 1HYLA 2J34A 1GL1A 1QR3E 1BUIA 3BEFB 3GOVB 1AE5A 1RXPA 5FX6A 1Y3XA 5JYIA 3PMBB 2CMYA 1O5BB 1CGHA 4WWYA 5DP4A 1P06A 3K9XB 1AVXA 3MYWA 3BG4C 3W95A 4D8NA 4F4OC 1P05A 1WAYB 1BTHH 2CN0H 1TNLA 2QXIA 2ZU2A 3AW0A 3MFJA 3STJA 1QRZA 5C5OA 3OYPA 1OWKA 1MKWH 2Y7XA 5EG4A 1UTKA 3BTGE 4KTUA 3T62A 1O5FH 1MZDA 2FLRH 1WU1A 2PSXA 5GIBA 4CBNA 1AZZA 1FV9A 1G9IE 2ZDVH 4I8HA 2UUKB 1GI5A 4HGCA 2G00A 2ODQA 1F0RA 2AS9A 1WQVH 5AVDA 1BRUP 2AGIX 1FPHH 2ZEBA 4KKDA 4DY7B 1IQGA 3PTBA 2ZGCA 1BTXA 5DKMA 2W5EA 1O37A 1VJ9U 2FYRA 1O5CB 4K1TA 2A5IA 2VWOA 1WUNH 2HPQH 3D62A 1D3QB 4Y8XA 1AIXH 5C5NA 3R0FA 1MTWA 3TK9A 1SGYE 1PPZA 1VITG 1C5TA 1ZJKA 1O2XA 2PUXB 1GHBF 2BY6X 1BRCE 3A7TA 1LHDH 1BHXB 2XBWA 4AN7A 2BD8A 2F9NA 2F9UA 1O2PA 3TNTA 3M5LA 3QZQA 3A82A 1EJMA 3SU5A 1NROH 1F5KU 3BTTE 2P94A 3O8CA 1TGSZ 2P8OB 1XM1A 1Q31A 3QGNB 3MU8A 1NU7B 1DE7H 1UTMA 1AWFH 2H9TH 1ANDA 2FOEA 2ZFTA 3OTJE 2A4RA 4R0IA 4TPIZ 4DG4A 1DANH 1FN8A 1UTPA 1TOMH 2J2UA 2AIPA 1ZSLA 4TY7A 6CHAC 2R2MB 3I77A 4JYTA 1BTYA 4AFZA 1VGCC 2JH0D 1TX8A 1C5SA 1AWHB 3KHVA 2LPRA 5B6OA 2O8WA 4DW2U 3BSQA 3K6ZA 2F9BH 1HAXB 1L1GA 1O0DH 1P9SA 2GMTB 4INLA 4LXBH 4RKJB 6GCHF 3K6YA 1JMOH 2AMDA 4DVAU 2BQ7B 3SJOA 1XKBC 4Y71A 5DJ7A 2A7HA 5HYOA 3BTEE 1TRMA 1WCZA 5ABWA 3IWMA 3P8NA 4ZUHA 1OOKB 5A8YA 1OWEA 1UJ1A 1B7XB 1CA0C 1C1SA 1DDJA 4Y0YE 2A7JA 2FX6A 3E0PB 2HLCA 3RLYH 2BD7A 5AFYH 1S84A 1V2MT 2ZCHP 1H1BA 1FDPA 2OBQA 1O2VA 4CH8B 2Z9KA 4NWLA 2GZ7A 3B8JA 5CMXH 2GZ8A 4AFQA 1J8AA 1UCYK 4GUXA 1ANBA 4CRGA 3S9CA 4GHQA 4GAWA 1AN1E 3DFJA 1IHTH 1AY6H 3D23A 1C2FA 2ZU5A 2FOFA 1OPHB 2BD9A 1QL7A 3E91A 3DUXH 3KF2A 1C2LA 5DPAA 1F0SA 1C5MD 2ODPA 1SGRE 2ZG0H 1ZPZA 1AO5A 1CT2E 1Z7KA 2BVXH 3S0NA 1XKAC 1O5AB 4LOYH 1IQHA 1GBFA 2VWNA 1FXYA 3ZZ3A 2PTCE 4K69A 3KQCA 4Y0ZE 6LPRA 3PWBA 5A2MH 3GDUA 4KP0A 3RXBA 1D9IA 1ELBA 1SLXB 1TE0A 1PYTD 2ZFQH 1YF4A 1E36B 3M3VA 3GY3A 3UNQA 1QA7A 1NO9H 1MBQA 1TQ0B 3BV9B 1ELFA 4NWKA 3M37A 5T6FA 3KQDA 4WVPE 1CHGA 1J16A 2JKHA 4BAMB 3ATWA 1LO6A 2ANWA 2GV6A 4X1SU 3ZYEA 1O36A 4X6PA 1RJXB 3B9FH 2ESTE 1UHBB 3SJ9A 5AF9H 3QO6A 1QTFA 1NRQH 1O5DH 4MVNA 3RXPA 2QCYA 3EYDA 2BQ6B 3TK5A 3AAUA 3Q3YA 3UQOA 1P10A 1SQAA 2ANKH 1GHBG 8ESTE 2ZHWH 1E37B 3MNCA 1P57B 3TH4H 1H8DH 1C4V2 1QRWA 1K1JA 5F6MA 3L3TA 1ZRBA 4YESB 2W7SA 2OINA 1V2RT 2GT7A 2HNTC 4B76A 1QB1A 2FESH 2VIVA 3U8TH 1ZR0A 1F0TA 4SGAE 2QGRA 3KCGH 3A8AA 4K8BA 1YPMH 1F5LA 4A6LA 5EQQA 4CR5A 2KAIA 3KGPA 1TQ7B 5IDKA 1QHRB 1ZMLA 1C1PA 1Z1JA 3FANA 1ZHPA 7GCHF 1N6YA 1K22H 3UREA 6GCHG 2AERH 4YO9A 2CXVA 1A61H 2XW9A 3SHAH 2A45B 3SV9A 3TH2H 2NU3E 1BJUA 1ZJDA 1P2QA 2R2WU 1C5XB 1GGDB 2FEQH 2FI5E 1S0QA 3MMGA 4ZAEA 4B71A 1MD7A 2OD3B 2TGAA 3A86A 1KXAA 1NU9A 2JETB 1ETSH 1XUHA 3QZRA 1HUTH 4Y11E 1YPJH 1V2KT 2ZFRH 1TABE 1AVWA 1C4Y2 2J38A 3RXOA 1ELGA 4U32A 3V12A 1RFNA 1AKSB 4ISNA 2HVXA 2FI4E 2TGDA 1INCA 3NK8A 1DLKB 4UFGH 1FAXA 1EJAA 1GMDF 5L2YH 1JIMA 1PPFE 2QF0A 3QTVH 5EPNA 2CF9H 2XC0A 3MNBA 3QK1A 3SNDA 5TCCA 2GGVB 2BY8X 2FO9A 1SLUB 2PR3A 2WV4A 1H9LB 2AFQB 3B23B 1KXFA 3FFGA 4NA9H 1XUGA 2AGEX 2B7DH 2ZCKP 1J15A 1G3EA 4I33A 4BNRA 3A7YA 3SU0A 1BB0B 2UUJB 3GY4A 5PTPA 1O3HA 2SGDE 2OC8A 5E8EH 1IQNA 1Y3YA 1BMMH 3S7KB 4YM9A 1QCPA 1HJ9A 1THPB 3U8RH 1XUIA 2P8OC 1GJ6A 1C2JA 1GI2A 4BANB 1FY4A 3UFAA 3MWIU 1K1NA 1PPEE 2H1UA 3K65B 1DUEA 2VGCB 3RXAA 4WXIA 3PYHA 2FYQA 1YPHE 4JZIA 2ZCLP 2I6SA 7LPRA 3A7ZA 4CRBA 1SLVB 4J2YB 2BLVA 3U8OH 4OGYA 1P3EA 2ZTZA 2Q1JA 1CA8B 2H9EH 1JIRA 1OXGA 2BYAX 4NSYA 1GDNA 2GMTC 4TWWA 4BXWA 5EXLA 2VVUA 4CR9A 3M7TA 2SGPE 1BHXF 2TPIZ 2GX4A 1ABIH 1AQ7A 4NSVA 3SV8A 4IGDA 3SN8A 4LZ4B 2XCNA 5EGMA 5LPFA 1SQOA 1MUEB 3T26A 5DP7A 3ITIA 2JH6D 1OP2A 1MCVA 4AG1A 3VB3A 1DXPA 4B2CA 1BBRH 3E1XB 3ZVBA 4LK4A 1FZZA 4I31A 1AFEH 5C1XA 1ESAA 3CENA 4FUGA 2I6QA 1DWBH 1OS8A 3MH4A 4BTUB 1B0EA 3A7XA 2R0LA 2ZHEH 1BRAA 4CBOA 4M7GA 3LU9B 2CHAB 3GYMA 1O3EA 3SNCA 4ISLA 1OP0A 4I32A 2TGPZ 1LPKB 1Z6JH 2Z9JA 5G4BA 3PLBA 5DO4H 1GHWH 3RXMA 4OS4A 3A88A 3KQEA 1ZSJA 3SOSA 7GCHG 1T7CA 4Y76A 3U69H 1XXFA 1TWXB 2WPKS 2WPJS 1HAZB 1K1PA 3PTNA 1DSUA 2W3KA 1GJ4H 3T28A 1K28D 1VCQA 3VXFH 1GJ8B 2H5CA 1IQKA 3ZZ4A 1NY22 3NZIA 2D26C 3CS7A 4ABHA 1TA2A 4JMYA 1UCYE 1ARCA 1CGIE 4ZHAA 2BDAA 4OGXA 5F8XA 1O3BA 2UWPA 1FI8A 3SJKA 1B5GH 5GPIB 1TNKA 4ZKOU 3P8OA 1NTPA 1SGFG 1V2LT 1DY9A 1AUJA 1PYTC 2VIQA 4U2WA 3SU6A 2BDYA 1TAWA 1O2WA 1HLTH 3MH7A 5TJXA 2WUCA 1QQUA 4MNWA 1THSH 1NPMA 1GJ5H 1H9HE 1TBRH 2FDAA 2W3IA 1ZTJA 3MO9A 2UUFB 1YLDA 1Z8IB 2OC7A 1FY3A 3P17H 1QIXB 5BRRE 2OUAA 1CHOF 1KIGH 2ZFPH 3SV2H 3ZV9A 4XDEA 2ZNKH 3EA7A 1S5SA 2AMQA 2FTMA 4GCHF 1CO7E 3SNBA 3RLWH 1ELCA 1EATA 2C93B 1LKBA 1YLCA 2AIQA 3SGBE 3RU4D 4MQAA 1F92A 4NCYA 2AYWA 4YOIA 1CSOE 2WPHS 2BY9X 3RM2H 2BQWB 4DOQA 1GBJA 1UVTH 1HAIH 1QRXA 3A89A 3UTUH 3EGKH 5L6NH 5EQSA 4GPGA 4CRAA 5J4SA 1G30B 1OWJA 3RC6A 5FAHA 1DICA 1V2PT 3SUDA 3GYLB 3RM0H 1GGDC 3A81A 1ZYOA 4CRFA 1Z8RA 2DE9A 2VVCA 5E2PA 1C1TA 2JETC 5JBCS 2O8UA 2M5TA 2Z3EA 1B0FA 1SGNE 2FODA 1C5VA 1AZ8A 4IN2A 4KTCA 1Y3WA 4HFPB 4H42U 3URCA 2V35A 5FBEA 4O3TA 1YBWA 3PO1B 4CRCA 3ZVGA 4FUEA 2IJOB 1LMWB 5FPYA 1AMHA 2QXJA 2P93A 1P2KA 2Z9GA 4FVBA 4RN6A 4ASHA 8GCHF 2BOKA 1ZZZA 4IMQA 3RXEA 1HPGA 3SU1A 1DWDH 5I46H 2G5VA 4D7GA 1DM4B 5DP8A 4CH2B 1EOJA 1UTQA 1C5ZB 1FUJA 1ABJH 4CHAB 4ABAA 3WY8A 4NGAH 1GJ7B 4JYUH 4K60A 2PWXA 1O3NA 1NT1A 1GJ9B 1Q3XA 4FXGH 3DFLA 5JBAS 3T29A 3BTDE 4A1VA 1NRPH 5F8ZA 2D8WA 1ZLRA 1W0YH 4X0WU 5HM9A 5LPRA 1P04A 1V2ST 2OP9A 4U30A 4WXVA 3AAVA 3Q00A 1S0RA 1GG6B 1HB0B 3MNXA 3QDZB 1HDTH 1E38B 3QGJA 4I8GA 1O2YA 2VGCC 4ABDA 4Z6AH 3VB6A 4KELA 1C5UA 1E34B 3UWJH 1EZSC 1XUFA 4Y10E 3ZYDA 1T8MA 3SV6A 5JPMH 5GWZA 1G3BA 2ANMH 2PKSC 4NIVA 4I7YH 1ACBE 1W0ZU 2EA3A 2ZDNA 3HPTB 4ZH8A 3U98H 1T8LA 4MPUA 2ZGXH 3AASA 4Z0KA 7ESTE 1TMUH 1GBIA 1AD8H 1WTHD 2K1QA 1SSXA 2BDGA 1DFPA 1T32A 2FIRH 1TPAE 1W7XH 4X8TH 4H6TA 2V0BA 3BIVH 1V3XA 1CHOG 2ZQ1A 3BEIB 3M3TA 4MNVA 5EODA 4AGJA 5SGAE 4DJZB 2ZZUH 2A7CA 1HIAB 1YM0A 1UTLM 1ELEE 1Z8JB 4KTSA 1LHEH 4GCHG 2ZKSA 4BAKB 4QT8C 2F9OA 1PPCE 4NG9H 1KDQB 1K1LA 2Y82A 3O8DA 1L1NA 1OKXA 4WMFA 4ISOA 2CHAC 4H4FA 1P01A 1BMNH 3LC3A 2DUCA 2BDBA 2TIOA 3P8GA 3EAJA 1HBTH 1PPGE 1EB2A 4YOJA 2WYGA 1C5OH 1Y5UT 1J14A 4O03A 1O2QA 1C5NH 1PFXC 2BD4A 2SGEE 2Z6BD 3P95A 1CQQA 3PV4A 3Q77A 2H5DA 1K21H 5AHGH 1Y3VA 3RDZA 3SU4A 4K1EA 4X8VH 3SI3H 3ZVEA 3TK6A 5T6GA 2P95A 2F91A 4AGKA 4DCDA 5DP6A 1UTJA 4CRDA 3F6UH 1P8VC 4Y6DA 2XWAA 4BXSA 1A0LA 1OP8A 4ZROA 2YNBA 5C1YA 2G81E 3GCOA 2OBOA 1A3BH 3PWCA 3LONA 4XOJA 4ZMAH 3VFEA 3V3MA 1MTUA 3OU0A 1FAKH 3MU0A 1G36A 2A1DB 1DSTA 1C5YB 5DP9A 3MU1A 3G01A 1OX1A 1YPEH 3BIUH 3RMNH 2PKAB 3FZZA 2RDLA 3LC5A 2WYJA 4ABGA 8GCHG 1HAHH 2FOCA 3BF6H 4NZQA 3L33A 4YTAA 1C9PA 1JWTA 2O8LA 1L4ZA 1GI4A 2C8YB 1KXEA 5HXFA 1Z71A 1NFYA 2NU0E 4HTCH 1WTGH 5A0AE 3RXDA 1G2MA 1EX3A 1W8BH 1OYTH 4NIXA 1VCWA 1TX6A 2ZU4A 4MNXA 3PMJA 1H9IE 2BLQA 3TH3H 1V2UT 4D7FA 4IMZA 2HRVA 3OY6U 1JRSA 1O3FA 2FOHA 4X6NA 1FQ3A 1GJAB 2GDEH 3CP7A 3RXIA 2ZDLA 3SO3A 1FY5A 1LHFH 3A7WA 1CT4E 2SGAA 1MAXA 4JK6A 1MMJN 1C5QA 1TBZH 4PROA 1W11U 1P02A 3GCHB 1IQEA 4ABJA 1BOQA 3ODDA 2J4IA 2SFAA 5EQRA 3K2UA 3M5NA 1EZQA 1NS3A 2XC5A 1C1RA 2BHGA 2WPLS 1O3GA 3P92A 1KLJH 1C2DA 1GVKB 1BT7A 2D2DA 1O2IA 1ZPCA 2ZHDA 4IW4E 1VJAU 3RXSA 1ZOMA 1ELDE 3LT3A 1C1QA 3RMMH 4NZLA 5GXPA 1Q2WA 2O8MA 3A83A 2V3HH 3E8LA 4YZUA 3BTQE 3A8CA 1QURH 3BG8A 3RXGA 4AB9A 4Y79A 3UOPA 1DVAH 2GT8A 4NFEA 1DX5M 3PO1C 4Q2KA 1P2NA 3F9EA 3GY2A 3ZV8A 1AHTH 1P3CA 4JZDH 5DGJA 3F9GA 1G2LA 2R3YA 4DIHH 3S7HB 1O3IA 4BAHB 3A85A 1OWIA 3EA8A 2PV9B 1Z6EA 2VH6A 3GDSA 2OC1A 1GBEA 2P16A 4XFQA 1YGCH 1VITH 5EPYA 4CHAC 4UFFH 1MTNB 3M5OA 4RSPA 4ZKNU 2BDHA 4E05H 1QA0A 4WH6A 2ULLA 1MTVA 1MKWK 1UVSH 3TGJE 4ZHLU 3NUMA 1XMNB 1S6FA 2HNTF 1C1NA 4X2WA 2A2QH 2B9LA 2XBVA 1GG6C 3TPIZ 2GD4B 3FZDA 4JCNA 4A1TA 1MZAA 5CHAB 2FX4A 4B2BA 3UWIA 4X2VA 1GI3A 5EXNA 3ESTA 1K1IA 1NN6A 1GVZA 3SHCH 1YP9A 3STIA 3OSYA 5T3HA 2XTTB 2VVVA 5AFZH 5BPEA 2J95A 2BB4A 2C8WB 1EPTB 3O8RA 3TNSA 4ABFA 3TIUA 3VXEH 3ZVDA 4X1QU 3ZZ5A 1V2OT 3SJIA 1K1MA 3BTKE 3CS0A 5L2ZH 2ZFFH 2BD2A 3FP6E 1OWHA 1EOLA 1G32B 3MU5A 4I8JA 2WV5A 1GBDA 3NXPA 2XBYA 1LHCH 5H4IB 1BTUA 3M35A 3P70B 2RA0A 1BDAA 1BJVA 2BZAA 3SNEA 1EUFA 2Q6FA 1SVPA 4K2YA 3Q76A 2CGAA 1TMTH 2Y6TA 4FUBA 5DK1A 4BOHA 1MAYA 1FN6A 2ODYB 1FMGA 1BZXE 4MDSA 3D65E 1IQLA 4AORA 2HWLB 1HFDA 1RRKA 1TBQH 3HGPA 2H9HA 6ESTA 3TITA 4X1RU 1O3OA 2BLOA 5A0CA 3U1IB 5FXLA 5A8ZA 2CF8H 1O31A 3RXQA 3P6ZB 2V6NA 1A2CH 2YNAA 4ZXXH 3RU4T 3E16B 1J17T 3ZZ7A 3L6PA 2ILNA 3PMAB 1LQDB 4BAQB 1LVMA 1YCPK 2VWLA 1MKXK 4NA8A 2FOBA 2FWWA 1O2JA 4KGAA 4YT6H 1BRBE 3TVJB 2ZA5A 4B1TA 1SBWA 5IYTA 2TGTA 4D76A 2RG3A 4WY3A 5K0HA 1QNJA 3SBKA 2QF3A 1BIOA 2LNCA 2R0KA 3DT0H 1IQJA 1WV7H 3IITA 4IC6A 3MI4A 1O5GH 4DGJA 1D3PB 1F0UA 3BTME 2FPZA 5C2ZA 2PSYA 4U01A 1M9UA 3LGUA 2OQ5A 3S9BA 1NFUA 1HIAA 1CU1A 4INKA 3RXCA 3VPKA 4NIYA 4X1PU 2BD5A 2QV1A 2IOTA 1KDQA 1TGTA 1C1OA 4TPYA 1L1JA 2C8ZB 2GCHF 1A7SA 1YKTA 1LDTT 3RMOH 3LJOA 1GHAF 1JRTA 2ZI2H 1MU8B 1C9TA 3QWCH 4ZXYH 1ZMJA 3UOUA 1GCTB 1TPPA 1O35A 2WPIS 1EP6A 5EW1H 1O3DA 1QJ1B 2ASUB 1EAWA 1T8OA 3UPEA 1C2GA 1Y59T 3OY5U 1LVBA 1G3CA 1GI9B 2SNWA 3U9AH 1TGBA 2GP9B 3HKJB 1BTZA 3QN7A 3T2NA 3UR9A 1SHHB 1C5WB 4OS1A 1EQ9A 1GBLA 1G3DA 1GBAA 3VB4A 2H6MA 1C2HA 1RTLA 3GCNA 1SFIA 5ETXA 4ZKSU 1P9UA 3SQEE 3SI4H 2W26A 2ZPSA 5FCKA 2XBXA 3D49H 2W7UA 3HATH 2PW8H 1YCPM 1AUTC 2C8XB 2FOGA 3DA9B 4K3JA 1IQFA 3EA9A 2ZU3A 3MTYA 2PGBB 3Q3XA 5GCHF 1A4WH 2HGTH 1P11E 1GI8B 4WJG2 2F3CE 2NU1E 4INHA 3SUGA 2Y5HA 3A7VA 1MBMA 2NU2E 2PKAA 3ELAH 4FUJA 2QA9E 4A5TS 3ZZ6A 4AYYB 1O2HA 3GY8A 3HGNA 2ZTYA 1GVLA 5T6DA 3ATKA 1QL9A 3DD2H 2A31A 1LVYA 2VJ1A 2G51A 1A46H 2BX3A 1X7AC 3M3SA 1K1OA 4OS5A 2C3SA 4D9RA 3LIWA 3RXUA 4YLQH 1YYY1 1W14U 2ZDMA 5A0BA 2TBSA 1GBTA 2ZQ2A 1YC0A 3ATLA 3VB5A 1ID5H 1NESE 2VIDA 1QFKH 1S81A 3M5MA 1TRYA 4MG3A 1UCYH 4Q7YA 1RD3B 5C20A 1H4WA 3RC5A 4UD9H 1UVOA 2UWLA 2C4FH 2PUQH 5HM2A 2R3UA 2FLBH 1VZQH 1O33A 3FP7E 2EI6A 1GMHF 2ZTXA 3F68H 4XBBA 1P2JA 4A1XA 1MU6B 4MPWA 1DLEA 1XX9A 4Y7AA 4E06H 3M7UA 2BOHB 1MTNC 3RXTA 3PB1E 4XSKU 1TMBH 2FI3E 3GISB 5HGGA 1W10U 2ZDAH 1UHBA 1MCTA 1OWDA 1SHYA 1O2UA 1XXDA 3RXJA 1GBKA 1JBUH 2H2ZA 2NWNA 5CHAC 1SGIB 2ZGBH 4BTIB 2THFB 4AB8A 1PQ5A 1SG8B 4H6SB 2J9NA 5E0HA 1EKBB 3LH1A 1ZSKA 2GCHG 2XYAA 1P0SH 1AVGH 3SQHE 1GBHA 1AU8A 3MOCA 5L30H 3QLPH 1K2I1 1C5LH 2A32A 1GHAG 1MQ5A 1W12U 1DITH 3GY6A 2VB0A 3BTWE 2A5KA 4XBCA 3RUOA 1QB6A 1GCDA 1V2WT 2HNTE 1WSSH 3F9HA 1UTNA 4JYVH 1GI7B 4MTBA 5F03A 1O38A 1UVUH 1Z8GA 4AG2A 1THRH 3E3TA 1FJSA 2BM2A 4NIWA 1C2IA 1SGTA 1NFWA 2FTLE 1O30A 3SJ8A 2G55A 5E2OA 5I25A 2QY0B 1O2GH 1FIWA 3T5FH 1ZTKA 3LH3A 2GVFA 3H5CB 5DG6A 1IOEA 3N7OA 1O2SA 1W2KH 1O3KA 4WF8A 3U1JB 4XE4A 1JOUB 1T8NA 2OLGA 1YPGH 1NFXA 2FS8A 1FIZA 5GCHG 3MH5A 1O2KA 2B8OH 3RXVA 2XXLA 2Z3DA 1YPHC 3HK3B 4FUDA 3ENSB 2PHBA 1WYKA 4B75A 1P12E 1AKSA 3MU4A 5F8TA 1PQ7A 2A0QB 2STBE 1GDQA 3JZ2B 1BCUH 1D3TB 2UWOA 2BZ6H 1TPSA 1O3MA 3LKWA 4Y8YA 1XVMA 3QX5H 2Q6GA 4X6OA 5K7RA 1EPTA 2GCTB 2G52A 5EW2H 2BY7X 1BBRK 3QUMP 3TJOA 1QQ4A 1HJAB 1AFQB 1CVWH 1BMLA 2Z9IA 1EASA 1N6XA 1ANCA 3UUZA 2FS9A 4ISHH 3R3GB 4R8TB 4Y7BA 1CE5A 2VIOA 1A5IA 2QAAA 2O8TA 2BXUH 2RA3A 1DY8A 5JBBS 1LQEA 4J1YA 1UMAH 2GTBA 1QBNA 3V7TA 2BX4A 3M36A 1KYNA 1GMHG 1GL0E 4X2XA 4Q80A 7KMEH 3FP8E 1TA6A 3E90B 5EOKA 3SORA 2J92A 1XUJA 4VGCB 1C1WH 3ZZBA 1GCTC 1PPHE 2STAE 4FUHA 1PPBH 1GHVH 3FVFB 3O8BA 4AFSA 1PJPA 3S69A 1J9CH 1DS2E 1FLEE 5E0JA 2QXGA 3TJUA 1UVPA 2CV3A 5CE1A 1ZPBA 8KME2 2O9QA 1A3EH 3BTHE 2ZC9H 4K5ZA 3PM3A 4I8KA 1C1VH 1O2TA 4Q7ZA 3C27B 1TGCA 3OX7U 1C1UH 4X8SH 2Y7ZA 4DT7B 1SB1H 1VCPA 1HAVB 1P09A 3VGCB 1NZQH 2SNVA 2ZGHA 3UR6A 1O2ZA 1HAPH 1MTSA 3UQVA 1F2SE 3QTOH 1IQMA 1U6QA 1IQIA 3UY9A 1YCPH 1MKXH 2GV7A 2GZ9A 2F83A 5LPEA 3M61U 4E7RG 5ESBA 3KL6A 1V2QT 4RKOB 2J94A 1NRNH 3AW1A 1FY8E 1O2MA 3IG6B 2QYIA 3VB7A 2Y81A 3SZNA 2AH4X 3P8FA 2Z94A 2QXHA 1BTWA 2R9PA 1RS0A 5FBIA 5TCAA 2P3FH 1C5RA 1ARBA 3SU3A 1TONA 1KSNA 1LKAA 1F7ZA 3EE0B 1K9OE 4JZ1A 2FOMB 1EZUC 4DURA 1KTSB 1LHGH 1BTPA 1TOCB 3A84A 3T25A 1P03A 3EDXB 3GCTF 3F9FA 3RMLH 3SNAA 1LCYA 1IAUA 4AOQA 1A0JA 1UK2A 3LOXA 1ESBA 3MH6A 1O3JA 1SGPE 2BMGB 1SFQB 1V2NT 1WQSA 3BTFE 4X2YA 2A4GA 5ESTE 1UK4A 4TY6A 2EI7A 1GBMA 1TLDA 3MO3A 3KEEA 2ZPRA 5A09A 1C2EA 1ZRKA 1AI8H 1SPJA 2C90B 2HOBA 2G4TA 1DPOA 1UTOA 3SU2A 3UNRA 5HMAA 1GBCA 1GHXH 2AEIH 2IPHA 2NU4E 2GDDA 1YPKH 1T4UH 2XRCA 1GJCB 1D6WA 1O32A 5EXMA 4YOGA 1SOTA 1EZXC 1ELVA 2PFEA 3KN2A 2EEKA 2Y80A 1S83A 2GKVE 1SMFE 4GHTA 1QJ7B 4HI3A 3RXFA 2ZFSA 2VU8E 1HXFH 4K8YA 4O3UA 1O2RA 1TPOA 5LGOA 5JDUB 3LDXH 2P3UB 1TALA 1V6DA 2FP7B 4GVUA 3DHKH 9LPRA 1O34A 2FZZA 1SR5C 1D3DB 5GJ4B 1MQ6A 3MO6A 3PMHB 3UNSA 4ZKRU 2ZDKA 5FPTA 1O5EH 1XUKA 1LTOA 4UONA 4B2AA 1L2EA 5DP5A 3Q3KA 3A87A 2A4OA 4ZHMU 4TWYA 4UFDH 2WINI 3BN9A 1HCGA 1ETTH 2FOAA 2WPMS 2ZHQH 3I29A 3ZZDA 1QY6A 4FU7A 2AGGX 1RIWB 1FONA 3I78A 2WUBA 5FHTA 1SGCA 1MH0A 2ALVA 1TRNA 9ESTA 1HXEH 1QBOA 4XBDA 4K1SA 4WH8A 3E6PH 1N8OB 2G5NA 2A2XH 1QB9A 2EI8A 1ZTLA 2Z3CA 1RTFB 4MNYA 1C2KA 1EAIA 3ZVFA 1AB9B 3BEUA 1DUAA 3ZZCA 4IBLH 2JH5D 1F5RA 3H7OA 1ZGIA 1GBBA 1A5HA 4TYDA 1HNEE 4YLUA 1W7GH 2ZO3H 1AE8H 1S82A 1GMCF 1ANEA 1L4DA 5E0GA 3TLOA 2G8TA 3F1SB 3LJJA 1CT0E 2F9VA 1TFXA 1O2NA 1BITA 2GCTC 3TGIE 4O9VA 1YPLH 1KXDA 2OQUA 1CBWB 2VINA 4X6MA 2XCFA 3ZVAA 1WOFA 1HJAC 1AFQC 3NWUA 3H7TA 2EC9H 4IN1A 3SGAE 4YT7H 3LGYA 2ZECA 1A1RA 5EU8A 1ETRH 3FAOA 3RXKA 3ZZ8A 1S85A 4OS7A 3KNXA 3E0NB 2G4UA 5JB8S 3SGQE 3GCTG 3LGWA 3RXLA 1SGFA 4Q7XA 1SOZA 2ZWLH 4UDWH 3BG4B 2QIQA 2TRMA 2XNIA 1FNIA 2P3TB 2PTNA 1RTKA 4JZEH 1PQAA 1BBRE 4MPXA 3TGKE 1KXBA 4VGCC 4FUIA 1DOJA 1O2LA 3SV7A 3A8DA 4GLYA 1G37A 4IC5A 1HRTH 1UK3A 3S9AA 1EAXA 1QJ6B 3C1KA 1Y8TA 2OC0A 1LPZB 3ODFA 1TYNA 1Y3UA 4HZHA 4WMDA 2Y5GA 3LGVA 1ELAA 1EJNA 1TNHA 2ALPA 1A0HB 1HAGE 1EXFA 2PKSB 2DE8A 1Z1IA 1XVOA 3V13A 1TNIA 1DT2A 3MNSA 3VGCC 3ATIA 1QL8A 3GY7A 2BDCA 1IHSH 4MPVA 2F9PA 1SC8U 4UFEH 4WMEA 4MLFB 4AZ2B 2BD3A 5JBTA 1EAUA 1GI6A 1OYQA 2XC4A 1ELTA 1SI5H 2OTVA 2VNTA 2A4QA 3RXHA 1BA8B 1W3CA 3VEQB 5C1UA 3A8BA 1TGNA 3JZ1B 4GSOA 2ANYA 1SGQE 3EQ0H 4I8LA 3GICB 3RC4A 1V2TT 1ZMNA 2OXSA 1NRSH 3HK6B 3RP2A 4JZFH 1EP5A 1SLWB 2BVRH 2BY5X 1NC6A 1GHZA 1C2MA 1TIOA 1ZHRA 4OS6A 1D4PB 1O3CA 2Z7FE 6CHAB 1O3PB 2HALA 4FU8A 5C3NA 1VGCB 4BTTB 4X8UH 3SUFA 1L0ZA 5FCRA 4F49A 2PGQB 2QN5T 4ISIH 3ATMA 4UE7H 2Y5FA 5FX5A 1P2OA 2FM2A 3HKIB 2VIWA 1QBVH 1HAVA 2ZF0H 4B73A 1KY9A 3GCHC
chains in the Genus database with same CATH superfamily
1DWCH 1GPZA 1HAYB 4OS2A 2SGQE 4ABEA 2OCVB 2V3OH 3LPRA 1P2MA 1OSSA 5C0TA 1CA0B 3GY5A 1SQTA 1GMCG 1ZGVA 4IS5A 2D1JA 1GJBB 1GWAA 4BAOB 1S6HA 1ZHMA 1ORFA 2VWMA 3RXRA 1GI0A 1TNGA 2Z9LA 2BTCE 1KXCA 3TJNA 4JK5A 4CREA 1H8IH 1EB1H 1LVOA 2BVSH 1W13U 1C1MA 1HV7A 2FXRA 4UEHH 2B0FA 2KCYA 1E35B 3ZZ9A 1QGFA 1Y5AT 3ZZAA 1GMDG 1DWEH 3W94A 2PLXA 3KIDU 2ZGJA 3GDVA 3NKKA 1CGJE 1FY1A 1A5GH 2ZU1A 1TNJA 4A7IB 4B74A 2FMJA 1V2JT 3A80A 3V0XA 3PLKA 1PQ8A 4Y8ZA 1QZ8A 1T4VH 2QC2A 2ZPQA 4TSFD 4A92A 3SW2B 1UO6A 2IN2A 5FPSA 2BDIA 1NRRH 1O2OA 1SGEE 3T27A 5JB9S 1GHYH 1TX7A 3ZVCA 4AX9H 1ESTA 1VITF 4SGBE 1TB6H 1SGDE 3PRBA 3PROA 4E7NA 2BXTH 2P59A 2RCEA 1C5PA 3NPSA 3UB0A 4NFFA 1P2IA 4ABIA 1KLIH 4X1NU 2BLWA 2CJIA 1C4U2 4AFUA 2ZHFH 2SGFE 2UUYA 1MD8A 1RIWC 2KAIB 1N1LA 1O3AA 1AGJA 1KLTA 1O39A 4FU9A 1HJ8A 1WBGB 3NCLA 3TJVA 4LZ1H 1GDUA 3SUEA 4ESTE 3TU7H 2AMPA 4DIIH 1JXPA 1KTTB 2HPPH 1N8OC 1BMAA 1VKYA 3LGIA 4AYVB 1E1RD 4THNH 1T31A 3MHWU 3RU4E 5GDSH 8LPRA 3LGTA 3URDA 1HAOH 1SL3A 1AB9C 1O3LA 1Y5BT 4O97A 1FPCH 2A5AA 2Q6DA 2VH0A 2B5TB 1DXWA 2YOLA 2AHME 3PLPA 1LPGB 5IK2D 1HGTH 2ZP0H 4FVDA 1GI1A 4NA7A 1RGQA 4FUFA 1V2VT 3OEED 3AVZA 3PV5A 1E0FD 1GJDB 3UIRA 5DP3A 4ABBA 1NM6A 3M7QA 4ASUD 5C67A 2XWBI 1EPTC 5A8XA 3KQBA 5J4QA 4D9QA 1VR1H 5LH8A 2VIPA 2ZIQH 1CBWC 1BQYA 1D6RA 4FUCA 2YMSD 1HYLA 2J34A 1GL1A 1QR3E 1BUIA 3BEFB 3GOVB 1AE5A 1RXPA 5FX6A 1Y3XA 3SZEA 2QF5A 5JYIA 3PMBB 2CMYA 1O5BB 1CGHA 4WWYA 2YMSB 5DP4A 1P06A 3K9XB 1AVXA 3MYWA 3BG4C 3W95A 5HIZA 4D8NA 2KCAA 4F4OC 2VBCA 1P05A 5CDFE 1WAYB 1BTHH 3ZIAD 2CN0H 1TNLA 2QXIA 2ZU2A 3AW0A 3MFJA 3STJA 1QRZA 5C5OA 3OYPA 1OWKA 1MKWH 2Y7XA 5EG4A 1UTKA 3BTGE 4KTUA 3T62A 1O5FH 1MZDA 2FLRH 1WU1A 2PSXA 5GIBA 4CBNA 5EJ1A 1AZZA 1FV9A 1G9IE 2JIZD 2ZDVH 4I8HA 2UUKB 1GI5A 4HGCA 2G00A 2ODQA 1F0RA 2AS9A 1WQVH 5AVDA 1BRUP 2AGIX 1W0JD 1FPHH 2ZEBA 4KKDA 4DY7B 1IQGA 3PTBA 2ZGCA 1BTXA 5DKMA 2W5EA 1O37A 1VJ9U 2FYRA 1O5CB 4K1TA 2A5IA 2VWOA 1WUNH 2HPQH 3D62A 1D3QB 4Y8XA 1AIXH 5C5NA 3R0FA 1MTWA 3TK9A 1SGYE 1PPZA 1VITG 2JDID 1C5TA 1ZJKA 1O2XA 2PUXB 4FETA 1GHBF 2BY6X 1BRCE 3A7TA 1LHDH 1BHXB 3DCLA 2XBWA 4AN7A 2BD8A 2F9NA 2F9UA 1O2PA 3TNTA 3M5LA 3QZQA 3A82A 1EJMA 2F43B 1NROH 1F5KU 3BTTE 2P94A 3SU5A 3O8CA 1TGSZ 2P8OB 4YXWD 1XM1A 1Q31A 3QGNB 3MU8A 1NU7B 1DE7H 1UTMA 1AWFH 2H9TH 1ANDA 2FOEA 2ZFTA 3OTJE 2A4RA 4R0IA 4TPIZ 4DG4A 1DANH 1FN8A 1UTPA 1TOMH 2J2UA 2AIPA 1ZSLA 4TY7A 6CHAC 2R2MB 3I77A 4JYTA 1BTYA 4TT3D 4AFZA 1VGCC 2JH0D 1TX8A 1C5SA 1AWHB 3KHVA 2LPRA 5B6OA 2O8WA 4DW2U 3BSQA 3K6ZA 2F9BH 1HAXB 1L1GA 1O0DH 1P9SA 2GMTB 4INLA 4LXBH 4RKJB 6GCHF 3K6YA 1JMOH 2AMDA 4DVAU 2BQ7B 3SJOA 1XKBC 4Y71A 5DJ7A 2A7HA 5HYOA 3BTEE 1TRMA 1WCZA 5ABWA 3IWMA 2JJ1D 3P8NA 4ZUHA 1OOKB 5A8YA 1OWEA 1UJ1A 1B7XB 1CA0C 1C1SA 1DDJA 4Y0YE 4RI0A 2A7JA 2FX6A 3E0PB 2HLCA 3RLYH 2BD7A 5AFYH 1S84A 1V2MT 2ZCHP 1H1BA 1FDPA 2OBQA 1O2VA 4CH8B 2Z9KA 4NWLA 2GZ7A 3B8JA 5CMXH 2GZ8A 4AFQA 1J8AA 1UCYK 4GUXA 5KGOA 3PV2A 1ANBA 4CRGA 3S9CA 2LELA 4GHQA 4GAWA 2WHXA 1AN1E 3DFJA 1IHTH 1AY6H 3D23A 1C2FA 2ZU5A 2FOFA 1OPHB 3DSGA 2BD9A 1QL7A 3E91A 3DUXH 3KF2A 1C2LA 2W6JD 5DPAA 1F0SA 1C5MD 2ODPA 1SGRE 2ZG0H 1ZPZA 1AO5A 3CNRA 1CT2E 1Z7KA 2BVXH 3S0NA 1XKAC 1O5AB 4LOYH 1IQHA 1GBFA 2VWNA 1FXYA 3ZZ3A 2PTCE 4K69A 3KQCA 4Y0ZE 6LPRA 3PWBA 5A2MH 3GDUA 4KP0A 3RXBA 1D9IA 1ELBA 1SLXB 1TE0A 1PYTD 2ZFQH 1YF4A 1E36B 3M3VA 3GY3A 3UNQA 3DSOA 3VG8A 1QA7A 1NO9H 1UW7A 1MBQA 1TQ0B 3BV9B 1ELFA 4NWKA 3M37A 5T6FA 3KQDA 4WVPE 1CHGA 1J16A 2JKHA 4BAMB 3ATWA 1LO6A 2ANWA 2GV6A 4X1SU 3ZYEA 1O36A 4X6PA 1RJXB 3B9FH 2ESTE 1UHBB 3SJ9A 5AF9H 3QO6A 1QTFA 1NRQH 1O5DH 4MVNA 3RXPA 2QCYA 3EYDA 2BQ6B 2KFWA 3TK5A 3AAUA 3Q3YA 3UQOA 1P10A 1SQAA 2ANKH 1GHBG 8ESTE 2ZHWH 1E37B 3MNCA 1P57B 3TH4H 1H8DH 1C4V2 1QRWA 1K1JA 5F6MA 3L3TA 1ZRBA 4YESB 2W7SA 2WSSD 2OINA 1V2RT 2GT7A 2HNTC 4B76A 1QB1A 2FESH 2VIVA 3U8TH 1ZR0A 1F0TA 4SGAE 2QGRA 3KCGH 3A8AA 2L74A 4K8BA 1YPMH 1F5LA 4A6LA 5EQQA 4CR5A 2KAIA 3KGPA 1TQ7B 5IDKA 1QHRB 1ZMLA 1C1PA 1Z1JA 3FANA 1ZHPA 7GCHF 1N6YA 4P02A 1K22H 3UREA 6GCHG 2AERH 4YO9A 2CXVA 1A61H 2XW9A 3SHAH 2A45B 3SV9A 3TH2H 2NU3E 1BJUA 1ZJDA 1P2QA 2R2WU 1C5XB 1GGDB 2FEQH 1YY3A 2FI5E 1S0QA 3MMGA 4ZAEA 4B71A 1MD7A 2OD3B 2TGAA 3A86A 1KXAA 1NU9A 2JETB 1ETSH 1XUHA 3QZRA 1HUTH 4Y11E 1YPJH 1V2KT 3KYGA 3WW7A 2ZFRH 1H8HD 1TABE 1AVWA 1C4Y2 2J38A 3RXOA 1ELGA 4U32A 3V12A 1RFNA 1AKSB 4ISNA 2HVXA 2FI4E 2TGDA 1INCA 3NK8A 1DLKB 4UFGH 1FAXA 1EJAA 1GMDF 5L2YH 1JIMA 1PPFE 2QF0A 3QTVH 5EPNA 2CF9H 2XC0A 2K8IA 3MNBA 3QK1A 3SNDA 5TCCA 2GGVB 2BY8X 2FO9A 5GNDA 1SLUB 2PR3A 2WV4A 1H9LB 2AFQB 5DSFA 3B23B 1KXFA 3FFGA 4NA9H 1XUGA 2AGEX 2B7DH 2ZCKP 1J15A 1G3EA 4I33A 4BNRA 3A7YA 3SU0A 1BB0B 2UUJB 3GY4A 5PTPA 1O3HA 2SGDE 2OC8A 5E8EH 1IQNA 1Y3YA 4XD7D 1BMMH 3S7KB 4YM9A 1QCPA 1HJ9A 1THPB 2KX4A 3U8RH 1XUIA 2P8OC 1GJ6A 1C2JA 1GI2A 2RDEA 4BANB 1FY4A 3UFAA 3MWIU 1K1NA 1PPEE 2H1UA 3K65B 1DUEA 2VGCB 3RXAA 4WXIA 3PYHA 2FYQA 1YPHE 4JZIA 2ZCLP 2I6SA 7LPRA 3A7ZA 3OTPA 4CRBA 1SLVB 4J2YB 2BLVA 3U8OH 4OGYA 1P3EA 2ZTZA 2Q1JA 1CA8B 2H9EH 1JIRA 1OXGA 2BYAX 4NSYA 1GDNA 2GMTC 4TWWA 4BXWA 5EXLA 2VVUA 4CR9A 3M7TA 2SGPE 1BHXF 2TPIZ 2GX4A 1ABIH 1AQ7A 4NSVA 3SV8A 4IGDA 2KM0A 3SN8A 4LZ4B 2XCNA 5EGMA 5LPFA 1SQOA 1MUEB 3T26A 5DP7A 3ITIA 2JH6D 1OP2A 1MCVA 4AG1A 3VB3A 1DXPA 4B2CA 1BBRH 3E1XB 3ZVBA 4LK4A 1FZZA 4I31A 1AFEH 5C1XA 1ESAA 3CENA 4FUGA 2I6QA 1DWBH 1OS8A 3MH4A 4BTUB 1B0EA 3A7XA 2R0LA 3F3BA 2ZHEH 1BRAA 4CBOA 4M7GA 1E79D 3LU9B 2CHAB 3GYMA 1O3EA 3SNCA 4ISLA 1OP0A 4I32A 2TGPZ 1LPKB 1Z6JH 2Z9JA 5G4BA 3PLBA 5DO4H 1FX0B 1GHWH 3RXMA 4OS4A 3A88A 3KQEA 1ZSJA 3SOSA 7GCHG 1T7CA 4Y76A 3W1EA 3U69H 1XXFA 1TWXB 2WPKS 2WPJS 1HAZB 1K1PA 3PTNA 3AK5A 1DSUA 2W3KA 1GJ4H 3T28A 1K28D 1VCQA 3VXFH 1GJ8B 2H5CA 1IQKA 3ZZ4A 1NY22 1NBME 3NZIA 2D26C 3CS7A 4ABHA 1E1QD 1TA2A 4JMYA 1UCYE 1ARCA 1CGIE 4ZHAA 2BDAA 4OGXA 5F8XA 1O3BA 4FOUC 1MABB 2UWPA 1FI8A 3SJKA 1B5GH 5GPIB 1TNKA 2J98B 4ZKOU 3P8OA 1NTPA 1SGFG 1V2LT 1DY9A 1AUJA 1PYTC 2VIQA 4U2WA 3SU6A 2BDYA 2EQNA 1TAWA 1O2WA 1HLTH 3MH7A 5TJXA 2WUCA 1QQUA 4MNWA 1THSH 1NPMA 1GJ5H 1H9HE 1TBRH 2FDAA 2W3IA 1ZTJA 3MO9A 2UUFB 1YLDA 1Z8IB 2OC7A 1FY3A 3P17H 1QIXB 5BRRE 2OUAA 1CHOF 1KIGH 2ZFPH 3SV2H 3ZV9A 4XDEA 2ZNKH 3EA7A 1S5SA 2AMQA 2FTMA 4GCHF 1CO7E 3SNBA 3RLWH 1ELCA 1EATA 2C93B 1LKBA 1YLCA 2AIQA 3SGBE 3RU4D 4MQAA 1F92A 4NCYA 2AYWA 4YOIA 1CSOE 2WPHS 2BY9X 3RM2H 2BQWB 4DOQA 1GBJA 1UVTH 1HAIH 1QRXA 3A89A 3UTUH 3EGKH 5L6NH 4M9FA 5EQSA 4GPGA 4CRAA 5J4SA 1G30B 1OWJA 3RC6A 5FAHA 1DICA 1V2PT 3SUDA 3GYLB 3RM0H 1GGDC 3A81A 1ZYOA 4CRFA 1Z8RA 2DE9A 2VVCA 5E2PA 1C1TA 2JETC 5JBCS 3PRDA 2O8UA 2M5TA 2Z3EA 1B0FA 1SGNE 2FODA 1C5VA 1AZ8A 4IN2A 4KTCA 1Y3WA 4HFPB 4H42U 5CHBA 3URCA 2V35A 5FBEA 4O3TA 1YBWA 3PO1B 4CRCA 3ZVGA 4FUEA 2IJOB 1LMWB 5FPYA 3GS9A 1AMHA 2IJD1 2QXJA 2P93A 1P2KA 2Z9GA 4FVBA 4RN6A 4ASHA 8GCHF 2BOKA 1ZZZA 4IMQA 3RXEA 1HPGA 3SU1A 1DWDH 5I46H 3FKSD 2G5VA 4D7GA 1DM4B 5DP8A 4CH2B 1EOJA 1UTQA 1C5ZB 1FUJA 1ABJH 4CHAB 4ABAA 3WY8A 4NGAH 1GJ7B 4JYUH 4K60A 2PWXA 1O3NA 1NT1A 1GJ9B 1Q3XA 4FXGH 3DFLA 5JBAS 3T29A 3BTDE 3F2GA 4A1VA 1NRPH 5F8ZA 2D8WA 1ZLRA 1W0YH 4X0WU 5HM9A 5LPRA 1P04A 1V2ST 2OP9A 4U30A 4WXVA 3OAAD 3AAVA 3Q00A 1S0RA 1GG6B 1HB0B 3MNXA 3QDZB 1HDTH 1E38B 3QGJA 4I8GA 1O2YA 2VGCC 4ABDA 4Z6AH 3VB6A 4KELA 1C5UA 1E34B 3UWJH 1EZSC 1XUFA 4Y10E 3ZYDA 1T8MA 3SV6A 5JPMH 5GWZA 1G3BA 2ANMH 2PKSC 4NIVA 4I7YH 1ACBE 1W0ZU 2EA3A 2ZDNA 3HPTB 4ZH8A 3U98H 1T8LA 4MPUA 2ZGXH 3AASA 4Z0KA 7ESTE 1TMUH 1GBIA 1AD8H 1WTHD 2K1QA 1SSXA 2BDGA 1DFPA 1T32A 2FIRH 1TPAE 1W7XH 4X8TH 4H6TA 2V0BA 3BIVH 1V3XA 1CHOG 2ZQ1A 3BEIB 3M3TA 4MNVA 5EODA 4AGJA 5SGAE 4DJZB 2ZZUH 2A7CA 1HIAB 1YM0A 1UTLM 1ELEE 1Z8JB 4KTSA 1LHEH 4GCHG 2ZKSA 4BAKB 4QT8C 2F9OA 1PPCE 4NG9H 1KDQB 1K1LA 2Y82A 3O8DA 1L1NA 1OKXA 4WMFA 4ISOA 2CHAC 4H4FA 1P01A 1BMNH 5T1VA 3LC3A 2DUCA 2BDBA 2TIOA 3P8GA 3EAJA 1HBTH 1PPGE 1EB2A 4YOJA 2WYGA 1C5OH 1Y5UT 1J14A 4O03A 1O2QA 1C5NH 1PFXC 2BD4A 2SGEE 2Z6BD 3P95A 1CQQA 3PV4A 3Q77A 2H5DA 1K21H 5AHGH 1Y3VA 3RDZA 3SU4A 4K1EA 4X8VH 3SI3H 3ZVEA 3TK6A 5T6GA 2P95A 2F91A 4AGKA 4DCDA 5DP6A 4AC9A 1UTJA 4CRDA 3F6UH 1P8VC 4Y6DA 2XWAA 4BXSA 1A0LA 1OP8A 3OFND 4ZROA 2YNBA 5C1YA 2G81E 3GCOA 5C94A 2OBOA 1A3BH 2KCPA 3PWCA 3LONA 4XOJA 4ZMAH 3VFEA 5FL7D 3V3MA 4Q4LA 1MTUA 3OU0A 1FAKH 3MU0A 1G36A 2A1DB 1DSTA 1C5YB 5DP9A 3MU1A 3G01A 1OX1A 1YPEH 3BIUH 3RMNH 2PKAB 3FZZA 2RDLA 3LC5A 2WYJA 4ABGA 8GCHG 1HAHH 2FOCA 3BF6H 4NZQA 3FO8D 3L33A 4YTAA 1C9PA 1JWTA 2O8LA 1L4ZA 1GI4A 2C8YB 1KXEA 4F55A 5HXFA 1Z71A 3U28C 1NFYA 2NU0E 4HTCH 1WTGH 5A0AE 3RXDA 1G2MA 1EX3A 1W8BH 3N99A 3NRLA 5HIYA 1OYTH 4NIXA 1VCWA 1TX6A 2ZU4A 4MNXA 3PMJA 1H9IE 2BLQA 3TH3H 4B6FA 1V2UT 4D7FA 4IMZA 2HRVA 3OY6U 1JRSA 1O3FA 2FOHA 4X6NA 1FQ3A 1GJAB 2GDEH 3CP7A 3RXIA 2ZDLA 5KEDA 3SO3A 1FY5A 1LHFH 3A7WA 1CT4E 2SGAA 1MAXA 4JK6A 1MMJN 1C5QA 1TBZH 4PROA 1W11U 1P02A 3GCHB 1IQEA 1KMHB 2J98A 4ABJA 1BOQA 3ODDA 2J4IA 2SFAA 5EQRA 3K2UA 3M5NA 1EZQA 1NS3A 2XC5A 1C1RA 2BHGA 5C0UA 2WPLS 1O3GA 3P92A 1KLJH 1C2DA 1GVKB 1BT7A 2D2DA 1O2IA 1ZPCA 2ZHDA 4IW4E 1VJAU 3RXSA 1ZOMA 1ELDE 3LT3A 1C1QA 1SKYE 4NZLA 3RMMH 5GXPA 1Q2WA 2O8MA 3A83A 2V3HH 3E8LA 4YZUA 2XOKD 3BTQE 3A8CA 1QURH 3BG8A 3RXGA 4AB9A 4Y79A 3UOPA 1DVAH 2GT8A 4NFEA 1DX5M 3PO1C 4Q2KA 1P2NA 3F9EA 3GY2A 3ZV8A 1AHTH 1P3CA 4JZDH 5DGJA 3F9GA 1G2LA 2R3YA 4DIHH 3S7HB 1O3IA 4BAHB 2WV9A 3A85A 1OWIA 3EA8A 2PV9B 1Z6EA 2VH6A 2YMSC 3GDSA 2OC1A 1GBEA 2P16A 4XFQA 1YGCH 1VITH 5EPYA 4CHAC 4UFFH 5EIYA 1MTNB 3M5OA 4RSPA 1SQRA 4ZKNU 2BDHA 4E05H 1QA0A 4P00A 4WH6A 2ULLA 1MTVA 1WXRA 1MKWK 1UVSH 3TGJE 4ZHLU 3NUMA 1XMNB 1S6FA 2HNTF 1C1NA 4X2WA 2A2QH 2B9LA 2XBVA 1GG6C 3TPIZ 2GD4B 3FZDA 4JCNA 4A1TA 1MZAA 5CHAB 3MQKC 2FX4A 4B2BA 3UWIA 4X2VA 1GI3A 5EXNA 3ESTA 1K1IA 1NN6A 1GVZA 3SHCH 1YP9A 3STIA 2WZQA 3OSYA 5T3HA 2XTTB 2VVVA 5AFZH 5BPEA 2J95A 2BB4A 2C8WB 1EPTB 3O8RA 3TNSA 4ABFA 3TIUA 3VXEH 3ZVDA 4X1QU 3ZZ5A 1V2OT 2M2AA 4Q63A 3SJIA 1K1MA 3BTKE 3CS0A 5L2ZH 3F0PA 2ZFFH 2BD2A 1S6LA 3FP6E 1OWHA 1EOLA 1G32B 3MU5A 4HG6A 4I8JA 2WV5A 1GBDA 3NXPA 2XBYA 1LHCH 5H4IB 1BTUA 3M35A 3P70B 2RA0A 1BDAA 1BJVA 2BZAA 3SNEA 1EUFA 2Q6FA 1SVPA 4K2YA 3Q76A 2CGAA 1TMTH 2Y6TA 4FUBA 5DK1A 4BOHA 1MAYA 1FN6A 2ODYB 1FMGA 1BZXE 4MDSA 3D65E 1IQLA 4AORA 2HWLB 1HFDA 1RRKA 1TBQH 3HGPA 2H9HA 6ESTA 3TITA 4X1RU 1O3OA 2BLOA 5A0CA 1H8ED 3U1IB 5FXLA 5A8ZA 2CF8H 1O31A 3RXQA 3P6ZB 2V6NA 1A2CH 2YNAA 4ZXXH 3RU4T 3E16B 1J17T 3ZZ7A 3L6PA 2ILNA 3PMAB 1LQDB 4BAQB 1LVMA 1YCPK 2VWLA 1MKXK 4NA8A 2FOBA 2FWWA 1O2JA 4KGAA 1COWD 4YT6H 4ACAA 1BRBE 3TVJB 2IPQX 2ZA5A 4B1TA 1SBWA 5IYTA 2TGTA 4D76A 2RG3A 4WY3A 5K0HA 1QNJA 3SBKA 2QF3A 1BIOA 2LNCA 2R0KA 3DT0H 1IQJA 1WV7H 3IITA 4IC6A 3MI4A 1O5GH 2KCOA 4DGJA 1D3PB 1F0UA 3BTME 5F53A 2FPZA 5C2ZA 2PSYA 4U01A 1M9UA 4ACBA 3LGUA 2OQ5A 3S9BA 1NFUA 1HIAA 1CU1A 4INKA 3RXCA 3VPKA 4NIYA 4X1PU 2BD5A 2QV1A 2IOTA 5KECA 1KDQA 1TGTA 1C1OA 4TPYA 1L1JA 2C8ZB 2GCHF 1A7SA 1YKTA 1YWUA 1LDTT 3RMOH 3LJOA 1GHAF 1JRTA 2ZI2H 1MU8B 1C9TA 3QWCH 4ZXYH 1ZMJA 3UOUA 2OK5A 1GCTB 1TPPA 1NBMD 1O35A 2WPIS 1EP6A 5EW1H 1O3DA 1QJ1B 2ASUB 1EAWA 1T8OA 2XNDD 3UPEA 1C2GA 1Y59T 3OY5U 1LVBA 1G3CA 1GI9B 2SNWA 3U9AH 1TGBA 2GP9B 3HKJB 1BTZA 3QN7A 3T2NA 3UR9A 1SHHB 1BMFD 1C5WB 4OS1A 1EQ9A 1GBLA 1OHHD 1G3DA 1GBAA 3VB4A 2H6MA 1C2HA 1RTLA 3GCNA 1SFIA 5ETXA 4ZKSU 1P9UA 3SQEE 3SI4H 2W26A 2ZPSA 5FCKA 2XBXA 3D49H 2W7UA 3HATH 2PW8H 1YCPM 1AUTC 2C8XB 2FOGA 3DA9B 4K3JA 1IQFA 3EA9A 2ZU3A 3MTYA 2PGBB 3Q3XA 4I86A 5GCHF 1A4WH 2HGTH 1P11E 3FOAA 4F48B 1GI8B 4WJG2 2F3CE 2NU1E 4INHA 3SUGA 2Y5HA 3A7VA 1MBMA 2NU2E 2PKAA 3ELAH 4FUJA 2QA9E 4A5TS 3ZZ6A 4AYYB 1O2HA 3GY8A 3HGNA 2ZTYA 1GVLA 5T6DA 3ATKA 5EJLA 1QL9A 3DD2H 2A31A 1LVYA 2K0QA 2VJ1A 2G51A 1A46H 3H09A 2BX3A 1X7AC 3M3SA 1K1OA 4OS5A 2C3SA 4D9RA 2RFKC 3LIWA 1EFRD 3RXUA 2KR7A 4YLQH 1YYY1 1W14U 2ZDMA 5A0BA 3DSPA 2TBSA 1GBTA 2ZQ2A 1YC0A 3ATLA 3VB5A 1ID5H 1NESE 2VIDA 1QFKH 1S81A 3M5MA 1TRYA 4MG3A 1UCYH 4Q7YA 1RD3B 5C20A 1H4WA 3RC5A 4UD9H 1UVOA 2UWLA 2C4FH 2PUQH 5HM2A 2R3UA 2FLBH 1VZQH 1O33A 3FP7E 2EI6A 1GMHF 2ZTXA 3F68H 4XBBA 1P2JA 4A1XA 1MU6B 4MPWA 1DLEA 1XX9A 4Y7AA 4E06H 3M7UA 2BOHB 1MTNC 3RXTA 3PB1E 4XSKU 1TMBH 2FI3E 3GISB 5HGGA 1W10U 2ZDAH 1UHBA 1MCTA 1OWDA 1SHYA 1O2UA 1XXDA 3F2HA 3RXJA 1GBKA 1JBUH 2H2ZA 2NWNA 5CHAC 1SGIB 2ZGBH 4BTIB 2THFB 4AB8A 1PQ5A 1SG8B 4H6SB 2J9NA 5E0HA 1EKBB 3LH1A 3F0OA 1ZSKA 2GCHG 2XYAA 3UAIC 1P0SH 1AVGH 3SQHE 4ZCNA 1GBHA 1AU8A 3MOCA 5L30H 3QLPH 1K2I1 1C5LH 2A32A 1GHAG 1MQ5A 1W12U 1DITH 3GY6A 2VB0A 3BTWE 2A5KA 4XBCA 3RUOA 1QB6A 1GCDA 2JJ2D 1V2WT 2HNTE 1WSSH 3F9HA 1UTNA 4JYVH 1GI7B 2HVYB 4MTBA 5F03A 1O38A 1UVUH 1Z8GA 4AG2A 1THRH 3E3TA 1FJSA 2BM2A 4NIWA 1C2IA 1SGTA 1NFWA 2FTLE 1O30A 3SJ8A 2G55A 5E2OA 5I25A 2QY0B 1O2GH 1FIWA 3T5FH 1ZTKA 2F4LA 3LH3A 2V3MA 2GVFA 3H5CB 5DG6A 1IOEA 3N7OA 1O2SA 1W2KH 1O3KA 4WF8A 3U1JB 4XE4A 1JOUB 1T8NA 2OLGA 1YPGH 1NFXA 2FS8A 1FIZA 5GCHG 3MH5A 1O2KA 2B8OH 3RXVA 2XXLA 3WWBA 2Z3DA 1YPHC 3HK3B 4FUDA 2KZ4A 3KYFA 3OE7D 3ENSB 2PHBA 1WYKA 4B75A 1P12E 5C17A 1AKSA 3MU4A 5F8TA 1PQ7A 2A0QB 2STBE 1GDQA 3JZ2B 1BCUH 1D3TB 2UWOA 2BZ6H 1TPSA 1O3MA 3LKWA 4Y8YA 1XVMA 3QX5H 2Q6GA 4X6OA 5K7RA 1EPTA 2GCTB 2G52A 5EW2H 2BY7X 1BBRK 3QUMP 3TJOA 1QQ4A 1HJAB 1AFQB 1CVWH 1BMLA 2Z9IA 1EASA 1N6XA 1ANCA 3UUZA 2FS9A 4ISHH 3R3GB 4R8TB 4Y7BA 1CE5A 2VIOA 1A5IA 2QAAA 2O8TA 1K0HA 2BXUH 2RA3A 1DY8A 2CK3D 5JBBS 1LQEA 4J1YA 1UMAH 2GTBA 1QBNA 3V7TA 2BX4A 3M36A 1KYNA 3WWFA 2GJGA 1GMHG 1GL0E 2HLDD 4X2XA 4Q80A 7KMEH 3FP8E 1TA6A 3E90B 5EOKA 3SORA 2J92A 1XUJA 4VGCB 1C1WH 4Z1MD 3ZZBA 1GCTC 1PPHE 2STAE 4FUHA 4XRNA 1PPBH 1GHVH 3FVFB 3O8BA 4AFSA 1PJPA 3S69A 1J9CH 1DS2E 1FLEE 5E0JA 2QXGA 3TJUA 1W0KD 1UVPA 2CV3A 5CE1A 1ZPBA 8KME2 2O9QA 1A3EH 3BTHE 2ZC9H 4K5ZA 2LP6A 3PM3A 4I8KA 1C1VH 1O2TA 4Q7ZA 3C27B 1TGCA 3OX7U 1C1UH 4X8SH 2Y7ZA 4DT7B 1SB1H 1VCPA 1HAVB 1P09A 3VGCB 1NZQH 2EY4C 2SNVA 2ZGHA 3UR6A 1O2ZA 1HAPH 1MTSA 3UQVA 1F2SE 3QTOH 1IQMA 1U6QA 1IQIA 3UY9A 1YCPH 1MKXH 2GV7A 2GZ9A 2F83A 5LPEA 3M61U 4E7RG 5ESBA 1YLNA 3KL6A 1V2QT 4RKOB 2J94A 1NRNH 3AW1A 1FY8E 1O2MA 3IG6B 2QYIA 3VB7A 2Y81A 3SZNA 2AH4X 3P8FA 2Z94A 2QXHA 1BTWA 2R9PA 1RS0A 5FBIA 2W6ID 5TCAA 2P3FH 1C5RA 1ARBA 3F2FA 3SU3A 1TONA 1KSNA 1LKAA 1F7ZA 2V7QD 3EE0B 1K9OE 4JZ1A 2FOMB 1EZUC 4DURA 1KTSB 3SYJA 1LHGH 1BTPA 1TOCB 3A84A 3T25A 1P03A 3EDXB 3GCTF 3F9FA 3RMLH 3SNAA 1LCYA 1IAUA 4AOQA 1A0JA 1UK2A 3LOXA 1ESBA 3MH6A 1O3JA 1SGPE 2BMGB 1SFQB 1V2NT 1WQSA 3BTFE 4X2YA 2A4GA 5ESTE 1UK4A 4TY6A 2EI7A 1GBMA 1TLDA 3MO3A 3KEEA 2ZPRA 5A09A 1C2EA 1ZRKA 1AI8H 1SPJA 4RT1A 4DT4A 2C90B 2HOBA 3N7EA 2G4TA 1DPOA 1UTOA 2PP6A 3SU2A 3UNRA 5HMAA 1GBCA 1GHXH 2AEIH 2IPHA 2NU4E 2GDDA 1YPKH 1T4UH 2XRCA 1GJCB 1D6WA 1O32A 5EXMA 4YOGA 1SOTA 1EZXC 1ELVA 2PFEA 3KN2A 2EEKA 2Y80A 1S83A 2GKVE 1SMFE 4GHTA 1QJ7B 4HI3A 3RXFA 2ZFSA 2VU8E 1HXFH 4K8YA 4O3UA 1O2RA 1TPOA 5LGOA 5JDUB 3LDXH 2P3UB 1TALA 1V6DA 2FP7B 4GVUA 3DHKH 9LPRA 1O34A 2FZZA 1SR5C 1D3DB 5GJ4B 1MQ6A 3MO6A 3PMHB 3UNSA 4ZKRU 2ZDKA 5HKKD 5FPTA 1O5EH 1XUKA 1LTOA 2J5UA 4UONA 4B2AA 1L2EA 5DP5A 3Q3KA 3A87A 2A4OA 4ZHMU 4TWYA 4UFDH 2WINI 3BN9A 1HCGA 1ETTH 2FOAA 2WPMS 2ZHQH 3I29A 3ZZDA 1QY6A 4FU7A 2AGGX 1RIWB 1FONA 3I78A 2WUBA 5FHTA 1SGCA 1MH0A 2ALVA 1TRNA 9ESTA 1HXEH 1QBOA 4XBDA 1WDIA 2QF4A 4K1SA 4WH8A 3E6PH 1N8OB 2G5NA 2A2XH 1QB9A 2EI8A 1ZTLA 2Z3CA 1RTFB 4B6EA 2QE7D 4MNYA 1C2KA 1EAIA 3ZVFA 1AB9B 3BEUA 1DUAA 3ZZCA 4IBLH 2JH5D 1F5RA 3H7OA 1ZGIA 1GBBA 1A5HA 4TYDA 1HNEE 4YLUA 3N7DA 1W7GH 2ZO3H 1AE8H 1S82A 1GMCF 1ANEA 1L4DA 5E0GA 3TLOA 2G8TA 2WPDD 3F1SB 3LJJA 1CT0E 2F9VA 1TFXA 1O2NA 1BITA 2GCTC 3TGIE 4O9VA 1YPLH 1KXDA 2OQUA 1CBWB 2VINA 4X6MA 2XCFA 3ZVAA 1WOFA 1HJAC 1AFQC 3NWUA 3H7TA 2EC9H 4IN1A 3SGAE 4YT7H 3LGYA 5B6LA 2ZECA 1A1RA 5EU8A 1ETRH 3FAOA 3RXKA 3ZZ8A 1S85A 3OEHD 4OS7A 3KNXA 3E0NB 2G4UA 5JB8S 3SGQE 3GCTG 3LGWA 3RXLA 1SGFA 4Q7XA 1SOZA 2ZWLH 4UDWH 3BG4B 2QIQA 2TRMA 2XNIA 4OM9A 1FNIA 2P3TB 2PTNA 1RTKA 4JZEH 1PQAA 1BBRE 4MPXA 3TGKE 1KXBA 4VGCC 4FUIA 4RT0A 1DOJA 1O2LA 3SV7A 3A8DA 4GLYA 1G37A 4IC5A 1HRTH 1UK3A 2L6OA 3S9AA 1EAXA 1QJ6B 3C1KA 1Y8TA 2OC0A 1LPZB 3ODFA 1TYNA 1Y3UA 4HZHA 4WMDA 2Y5GA 3LGVA 1ELAA 1EJNA 1TNHA 2ALPA 1A0HB 1HAGE 1EXFA 2PKSB 2DE8A 1Z1IA 1XVOA 3V13A 1TNIA 1DT2A 3MNSA 3VGCC 3ATIA 1QL8A 3GY7A 2BDCA 1IHSH 4MPVA 2F9PA 1SC8U 4UFEH 4WMEA 4MLFB 4AZ2B 2BD3A 5JBTA 1EAUA 1GI6A 1OYQA 2XC4A 1ELTA 1SI5H 3FN8A 2OTVA 2VNTA 2A4QA 3RXHA 1BA8B 1W3CA 3VEQB 5C1UA 3A8BA 1TGNA 3JZ1B 4GSOA 2ANYA 1SGQE 3EQ0H 3EE7A 4I8LA 3GICB 3RC4A 1V2TT 1ZMNA 2OXSA 1NRSH 3HK6B 3RP2A 5DN6D 4JZFH 1EP5A 1SLWB 2BVRH 2BY5X 3KQ5A 1NC6A 1GHZA 1C2MA 1TIOA 1ZHRA 4OS6A 1D4PB 1O3CA 2Z7FE 6CHAB 1O3PB 2HALA 4FU8A 5C3NA 1VGCB 4BTTB 4X8UH 3SUFA 1L0ZA 5FCRA 5EJZA 4F49A 2PGQB 2QN5T 4ISIH 3ATMA 4UE7H 2Y5FA 5FX5A 1P2OA 2FM2A 3HKIB 2J97A 2VIWA 1QBVH 1HAVA 2ZF0H 4B73A 1KY9A 3GCHC
chains in the Genus database with same CATH topology
1DWCH 1GPZA 1HAYB 4OS2A 2SGQE 4ABEA 2OCVB 2V3OH 3LPRA 1P2MA 1OSSA 1CA0B 3GY5A 1SQTA 1GMCG 1ZGVA 4IS5A 2D1JA 1GJBB 1GWAA 4BAOB 1S6HA 1ZHMA 1ORFA 2VWMA 3RXRA 1GI0A 1TNGA 2Z9LA 2BTCE 1KXCA 3TJNA 4JK5A 4CREA 1H8IH 1EB1H 1LVOA 2BVSH 1W13U 1C1MA 1HV7A 2FXRA 4UEHH 2B0FA 1E35B 3ZZ9A 1QGFA 1Y5AT 3ZZAA 1GMDG 1DWEH 3W94A 2PLXA 3KIDU 2ZGJA 3GDVA 3NKKA 1CGJE 1FY1A 1A5GH 2ZU1A 1TNJA 4A7IB 4B74A 2FMJA 1V2JT 3A80A 3V0XA 3PLKA 1PQ8A 4Y8ZA 2QC2A 1T4VH 2ZPQA 4A92A 3SW2B 1UO6A 2IN2A 5FPSA 2BDIA 1NRRH 1O2OA 1SGEE 3T27A 5JB9S 1GHYH 1TX7A 3ZVCA 4AX9H 1ESTA 1VITF 4SGBE 1TB6H 1SGDE 3PROA 4E7NA 2BXTH 2P59A 2RCEA 1C5PA 3NPSA 4NFFA 1P2IA 4ABIA 1KLIH 4X1NU 2BLWA 2CJIA 1C4U2 4AFUA 2ZHFH 2SGFE 2UUYA 1MD8A 1RIWC 2KAIB 1N1LA 1O3AA 1AGJA 1KLTA 1O39A 4FU9A 1HJ8A 1WBGB 3NCLA 3TJVA 4LZ1H 1GDUA 3SUEA 4ESTE 3TU7H 2AMPA 4DIIH 1JXPA 1KTTB 2HPPH 1N8OC 1BMAA 3LGIA 4AYVB 4THNH 1T31A 3MHWU 3RU4E 5GDSH 8LPRA 3LGTA 3URDA 1HAOH 1SL3A 1AB9C 1O3LA 1Y5BT 4O97A 1FPCH 2A5AA 2Q6DA 2VH0A 2B5TB 1DXWA 2YOLA 3PLPA 1LPGB 1HGTH 2ZP0H 4FVDA 1GI1A 4NA7A 1RGQA 4FUFA 1V2VT 3AVZA 1E0FD 1GJDB 3UIRA 5DP3A 4ABBA 1NM6A 3M7QA 5C67A 2XWBI 1EPTC 5A8XA 3KQBA 5J4QA 4D9QA 1VR1H 5LH8A 2VIPA 2ZIQH 1CBWC 1BQYA 1D6RA 4FUCA 1HYLA 2J34A 1GL1A 1QR3E 1BUIA 3BEFB 3GOVB 1AE5A 1RXPA 5FX6A 1Y3XA 5JYIA 3PMBB 2CMYA 1O5BB 1CGHA 4WWYA 5DP4A 1P06A 3K9XB 1AVXA 3MYWA 3BG4C 3W95A 4D8NA 4F4OC 1P05A 1WAYB 1BTHH 2CN0H 1TNLA 2QXIA 2ZU2A 3AW0A 3MFJA 3STJA 1QRZA 5C5OA 3OYPA 1OWKA 1MKWH 2Y7XA 5EG4A 1UTKA 3BTGE 4KTUA 3T62A 1O5FH 1MZDA 2FLRH 1WU1A 2PSXA 5GIBA 4CBNA 1AZZA 1FV9A 1G9IE 2ZDVH 4I8HA 2UUKB 1GI5A 4HGCA 2G00A 2ODQA 1F0RA 2AS9A 1WQVH 5AVDA 1BRUP 2AGIX 1FPHH 2ZEBA 4KKDA 4DY7B 1IQGA 3PTBA 2ZGCA 1BTXA 5DKMA 2W5EA 1O37A 1VJ9U 2FYRA 1O5CB 4K1TA 2A5IA 2VWOA 1WUNH 2HPQH 3D62A 1D3QB 4Y8XA 1AIXH 5C5NA 3R0FA 1MTWA 3TK9A 1SGYE 1PPZA 1VITG 1C5TA 1ZJKA 1O2XA 2PUXB 1GHBF 2BY6X 1BRCE 3A7TA 1LHDH 1BHXB 2XBWA 4AN7A 2BD8A 2F9NA 2F9UA 1O2PA 3TNTA 3M5LA 3QZQA 3A82A 1EJMA 3SU5A 1NROH 1F5KU 3BTTE 2P94A 3O8CA 1TGSZ 2P8OB 1XM1A 1Q31A 3QGNB 3MU8A 1NU7B 1DE7H 1UTMA 1AWFH 2H9TH 1ANDA 2FOEA 2ZFTA 3OTJE 2A4RA 4R0IA 4TPIZ 4DG4A 1DANH 1FN8A 1UTPA 1TOMH 2J2UA 2AIPA 1ZSLA 4TY7A 6CHAC 2R2MB 3I77A 4JYTA 1BTYA 4AFZA 1VGCC 2JH0D 1TX8A 1C5SA 1AWHB 3KHVA 2LPRA 5B6OA 2O8WA 4DW2U 3BSQA 3K6ZA 2F9BH 1HAXB 1L1GA 1O0DH 1P9SA 2GMTB 4INLA 4LXBH 4RKJB 6GCHF 3K6YA 1JMOH 2AMDA 4DVAU 2BQ7B 3SJOA 1XKBC 4Y71A 5DJ7A 2A7HA 5HYOA 3BTEE 1TRMA 1WCZA 5ABWA 3IWMA 3P8NA 4ZUHA 1OOKB 5A8YA 1OWEA 1UJ1A 1B7XB 1CA0C 1C1SA 1DDJA 4Y0YE 2A7JA 2FX6A 3E0PB 2HLCA 3RLYH 2BD7A 5AFYH 1S84A 1V2MT 2ZCHP 1H1BA 1FDPA 2OBQA 1O2VA 4CH8B 2Z9KA 4NWLA 2GZ7A 3B8JA 5CMXH 2GZ8A 4AFQA 1J8AA 1UCYK 4GUXA 1ANBA 4CRGA 3S9CA 4GHQA 4GAWA 1AN1E 3DFJA 1IHTH 1AY6H 3D23A 1C2FA 2ZU5A 2FOFA 1OPHB 2BD9A 1QL7A 3E91A 3DUXH 3KF2A 1C2LA 5DPAA 1F0SA 1C5MD 2ODPA 1SGRE 2ZG0H 1ZPZA 1AO5A 1CT2E 1Z7KA 2BVXH 3S0NA 1XKAC 1O5AB 4LOYH 1IQHA 1GBFA 2VWNA 1FXYA 3ZZ3A 2PTCE 4K69A 3KQCA 4Y0ZE 6LPRA 3PWBA 5A2MH 3GDUA 4KP0A 3RXBA 1D9IA 1ELBA 1SLXB 1TE0A 1PYTD 2ZFQH 1YF4A 1E36B 3M3VA 3GY3A 3UNQA 1QA7A 1NO9H 1MBQA 1TQ0B 3BV9B 1ELFA 4NWKA 3M37A 5T6FA 3KQDA 4WVPE 1CHGA 1J16A 2JKHA 4BAMB 3ATWA 1LO6A 2ANWA 2GV6A 4X1SU 3ZYEA 1O36A 4X6PA 1RJXB 3B9FH 2ESTE 1UHBB 3SJ9A 5AF9H 3QO6A 1QTFA 1NRQH 1O5DH 4MVNA 3RXPA 2QCYA 3EYDA 2BQ6B 3TK5A 3AAUA 3Q3YA 3UQOA 1P10A 1SQAA 2ANKH 1GHBG 8ESTE 2ZHWH 1E37B 3MNCA 1P57B 3TH4H 1H8DH 1C4V2 1QRWA 1K1JA 5F6MA 3L3TA 1ZRBA 4YESB 2W7SA 2OINA 1V2RT 2GT7A 2HNTC 4B76A 1QB1A 2FESH 2VIVA 3U8TH 1ZR0A 1F0TA 4SGAE 2QGRA 3KCGH 3A8AA 4K8BA 1YPMH 1F5LA 4A6LA 5EQQA 4CR5A 2KAIA 3KGPA 1TQ7B 5IDKA 1QHRB 1ZMLA 1C1PA 1Z1JA 3FANA 1ZHPA 7GCHF 1N6YA 1K22H 3UREA 6GCHG 2AERH 4YO9A 2CXVA 1A61H 2XW9A 3SHAH 2A45B 3SV9A 3TH2H 2NU3E 1BJUA 1ZJDA 1P2QA 2R2WU 1C5XB 1GGDB 2FEQH 2FI5E 1S0QA 3MMGA 4ZAEA 4B71A 1MD7A 2OD3B 2TGAA 3A86A 1KXAA 1NU9A 2JETB 1ETSH 1XUHA 3QZRA 1HUTH 4Y11E 1YPJH 1V2KT 2ZFRH 1TABE 1AVWA 1C4Y2 2J38A 3RXOA 1ELGA 4U32A 3V12A 1RFNA 1AKSB 4ISNA 2HVXA 2FI4E 2TGDA 1INCA 3NK8A 1DLKB 4UFGH 1FAXA 1EJAA 1GMDF 5L2YH 1JIMA 1PPFE 2QF0A 3QTVH 5EPNA 2CF9H 2XC0A 3MNBA 3QK1A 3SNDA 5TCCA 2GGVB 2BY8X 2FO9A 1SLUB 2PR3A 2WV4A 1H9LB 2AFQB 3B23B 1KXFA 3FFGA 4NA9H 1XUGA 2AGEX 2B7DH 2ZCKP 1J15A 1G3EA 4I33A 4BNRA 3A7YA 3SU0A 1BB0B 2UUJB 3GY4A 5PTPA 1O3HA 2SGDE 2OC8A 5E8EH 1IQNA 1Y3YA 1BMMH 3S7KB 4YM9A 1QCPA 1HJ9A 1THPB 3U8RH 1XUIA 2P8OC 1GJ6A 1C2JA 1GI2A 4BANB 1FY4A 3UFAA 3MWIU 1K1NA 1PPEE 2H1UA 3K65B 1DUEA 2VGCB 3RXAA 4WXIA 3PYHA 2FYQA 1YPHE 4JZIA 2ZCLP 2I6SA 7LPRA 3A7ZA 4CRBA 1SLVB 4J2YB 2BLVA 3U8OH 4OGYA 1P3EA 2ZTZA 2Q1JA 1CA8B 2H9EH 1JIRA 1OXGA 2BYAX 4NSYA 1GDNA 2GMTC 4TWWA 4BXWA 5EXLA 2VVUA 4CR9A 3M7TA 2SGPE 1BHXF 2TPIZ 2GX4A 1ABIH 1AQ7A 4NSVA 3SV8A 4IGDA 3SN8A 4LZ4B 2XCNA 5EGMA 5LPFA 1SQOA 1MUEB 3T26A 5DP7A 3ITIA 2JH6D 1OP2A 1MCVA 4AG1A 3VB3A 1DXPA 4B2CA 1BBRH 3E1XB 3ZVBA 4LK4A 1FZZA 4I31A 1AFEH 5C1XA 1ESAA 3CENA 4FUGA 2I6QA 1DWBH 1OS8A 3MH4A 4BTUB 1B0EA 3A7XA 2R0LA 2ZHEH 1BRAA 4CBOA 4M7GA 3LU9B 2CHAB 3GYMA 1O3EA 3SNCA 4ISLA 1OP0A 4I32A 2TGPZ 1LPKB 1Z6JH 2Z9JA 5G4BA 3PLBA 5DO4H 1GHWH 3RXMA 4OS4A 3A88A 3KQEA 1ZSJA 3SOSA 7GCHG 1T7CA 4Y76A 3U69H 1XXFA 1TWXB 2WPKS 2WPJS 1HAZB 1K1PA 3PTNA 1DSUA 2W3KA 1GJ4H 3T28A 1K28D 1VCQA 3VXFH 1GJ8B 2H5CA 1IQKA 3ZZ4A 1NY22 3NZIA 2D26C 3CS7A 4ABHA 1TA2A 4JMYA 1UCYE 1ARCA 1CGIE 4ZHAA 2BDAA 4OGXA 5F8XA 1O3BA 2UWPA 1FI8A 3SJKA 1B5GH 5GPIB 1TNKA 4ZKOU 3P8OA 1NTPA 1SGFG 1V2LT 1DY9A 1AUJA 1PYTC 2VIQA 4U2WA 3SU6A 2BDYA 1TAWA 1O2WA 1HLTH 3MH7A 5TJXA 2WUCA 1QQUA 4MNWA 1THSH 1NPMA 1GJ5H 1H9HE 1TBRH 2FDAA 2W3IA 1ZTJA 3MO9A 2UUFB 1YLDA 1Z8IB 2OC7A 1FY3A 3P17H 1QIXB 5BRRE 2OUAA 1CHOF 1KIGH 2ZFPH 3SV2H 3ZV9A 4XDEA 2ZNKH 3EA7A 1S5SA 2AMQA 2FTMA 4GCHF 1CO7E 3SNBA 3RLWH 1ELCA 1EATA 2C93B 1LKBA 1YLCA 2AIQA 3SGBE 3RU4D 4MQAA 1F92A 4NCYA 2AYWA 4YOIA 1CSOE 2WPHS 2BY9X 3RM2H 2BQWB 4DOQA 1GBJA 1UVTH 1HAIH 1QRXA 3A89A 3UTUH 3EGKH 5L6NH 5EQSA 4GPGA 4CRAA 5J4SA 1G30B 1OWJA 3RC6A 5FAHA 1DICA 1V2PT 3SUDA 3GYLB 3RM0H 1GGDC 3A81A 1ZYOA 4CRFA 1Z8RA 2DE9A 2VVCA 5E2PA 1C1TA 2JETC 5JBCS 2O8UA 2M5TA 2Z3EA 1B0FA 1SGNE 2FODA 1C5VA 1AZ8A 4IN2A 4KTCA 1Y3WA 4HFPB 4H42U 3URCA 2V35A 5FBEA 4O3TA 1YBWA 3PO1B 4CRCA 3ZVGA 4FUEA 2IJOB 1LMWB 5FPYA 1AMHA 2QXJA 2P93A 1P2KA 2Z9GA 4FVBA 4RN6A 4ASHA 8GCHF 2BOKA 1ZZZA 4IMQA 3RXEA 1HPGA 3SU1A 1DWDH 5I46H 2G5VA 4D7GA 1DM4B 5DP8A 4CH2B 1EOJA 1UTQA 1C5ZB 1FUJA 1ABJH 4CHAB 4ABAA 3WY8A 4NGAH 1GJ7B 4JYUH 4K60A 2PWXA 1O3NA 1NT1A 1GJ9B 1Q3XA 4FXGH 3DFLA 5JBAS 3T29A 3BTDE 4A1VA 1NRPH 5F8ZA 2D8WA 1ZLRA 1W0YH 4X0WU 5HM9A 5LPRA 1P04A 1V2ST 2OP9A 4U30A 4WXVA 3AAVA 3Q00A 1S0RA 1GG6B 1HB0B 3MNXA 3QDZB 1HDTH 1E38B 3QGJA 4I8GA 1O2YA 2VGCC 4ABDA 4Z6AH 3VB6A 4KELA 1C5UA 1E34B 3UWJH 1EZSC 1XUFA 4Y10E 3ZYDA 1T8MA 3SV6A 5JPMH 5GWZA 1G3BA 2ANMH 2PKSC 4NIVA 4I7YH 1ACBE 1W0ZU 2EA3A 2ZDNA 3HPTB 4ZH8A 3U98H 1T8LA 4MPUA 2ZGXH 3AASA 4Z0KA 7ESTE 1TMUH 1GBIA 1AD8H 1WTHD 2K1QA 1SSXA 2BDGA 1DFPA 1T32A 2FIRH 1TPAE 1W7XH 4X8TH 4H6TA 2V0BA 3BIVH 1V3XA 1CHOG 2ZQ1A 3BEIB 3M3TA 4MNVA 5EODA 4AGJA 5SGAE 4DJZB 2ZZUH 2A7CA 1HIAB 1YM0A 1UTLM 1ELEE 1Z8JB 4KTSA 1LHEH 4GCHG 2ZKSA 4BAKB 4QT8C 2F9OA 1PPCE 4NG9H 1KDQB 1K1LA 2Y82A 3O8DA 1L1NA 1OKXA 4WMFA 4ISOA 2CHAC 4H4FA 1P01A 1BMNH 3LC3A 2DUCA 2BDBA 2TIOA 3P8GA 3EAJA 1HBTH 1PPGE 1EB2A 4YOJA 2WYGA 1C5OH 1Y5UT 1J14A 4O03A 1O2QA 1C5NH 1PFXC 2BD4A 2SGEE 2Z6BD 3P95A 1CQQA 3PV4A 3Q77A 2H5DA 1K21H 5AHGH 1Y3VA 3RDZA 3SU4A 4K1EA 4X8VH 3SI3H 3ZVEA 3TK6A 5T6GA 2P95A 2F91A 4AGKA 4DCDA 5DP6A 1UTJA 4CRDA 3F6UH 1P8VC 4Y6DA 2XWAA 4BXSA 1A0LA 1OP8A 4ZROA 2YNBA 5C1YA 2G81E 3GCOA 2OBOA 1A3BH 3PWCA 3LONA 4XOJA 4ZMAH 3VFEA 3V3MA 1MTUA 3OU0A 1FAKH 3MU0A 1G36A 2A1DB 1DSTA 1C5YB 5DP9A 3MU1A 3G01A 1OX1A 1YPEH 3BIUH 3RMNH 2PKAB 3FZZA 2RDLA 3LC5A 2WYJA 4ABGA 8GCHG 1HAHH 2FOCA 3BF6H 4NZQA 3L33A 4YTAA 1C9PA 1JWTA 2O8LA 1L4ZA 1GI4A 2C8YB 1KXEA 5HXFA 1Z71A