1AMHA

Uncomplexed rat trypsin mutant with asp 189 replaced with ser (d189s)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKSSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ANIONIC TRYPSIN
publication title The three-dimensional structure of Asp189Ser trypsin provides evidence for an inherent structural plasticity of the protease.
pubmed doi rcsb
source organism Rattus rattus
total genus 49
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1amhA02
3GY4A 5J4QA 1SI5H 1W0YH 1K9OE 2J38A 1C2JA 1ZSLA 4FU9A 1TX8A 3LC3A 5EOKA 2R3UA 5GIBA 1HPGA 1XVMA 1EASA 2NU2E 1TBQH 4ISLA 1O30A 1TGCA 1SGCA 1YPHC 2UWPA 1A3EH 1BBRK 2V0BA 1C5MD 1PFXC 3RXMA 1JRSA 2PGBB 2BVSH 1C2FA 1L2EA 1YF4A 3MTYA 3Q3KA 1Z1JA 1EP6A 1TRNA 2EC9H 1A7SA 2PSXA 3RMOH 4A1XA 3U8TH 1BTXA 4DOQA 2AGIX 3O8BA 2WUBA 1BMMH 2XBYA 4CRCA 4NIXA 2GDEH 1A5IA 1YPKH 3EQ0H 2FZZA 1RTFB 4BOHA 1S81A 1JRTA 2ZGCA 1RIWB 4Y10E 3SQEE 3SBKA 3L3TA 3SI4H 2VIQA 2AIPA 2ZFSA 5C20A 1DITH 4AYYB 1INCA 3TJVA 2IPHA 2VIOA 1UTQA 1O32A 2QV1A 1IQIA 2C8XB 1C1MA 2GZ8A 1BTHH 2XC0A 1Z7KA 1EOLA 3LH3A 4YT6H 1DT2A 3GCHC 1O2TA 1OXGA 1ZSJA 1AVGH 3ZZ3A 4Q2KA 1P10A 2VU8E 2RA0A 4DG4A 5E2PA 3SUGA 5A8ZA 4CRGA 3HPTB 1BMAA 1TQ7B 4X8VH 1MBMA 1FN6A 1FY8E 1O3HA 2ZNKH 1FI8A 1W14U 5T6FA 1RRKA 4E7RG 2A7JA 4Y7BA 4A5TS 3KQDA 2OTVA 1GJ9B 4B71A 5FHTA 4KELA 4LK4A 4K60A 4Q7YA 1SBWA 3JZ1B 1K22H 3E1XB 2TGTA 1EAIA 1ZHPA 2ZCLP 1MQ6A 1QB9A 1F5RA 2ZP0H 1K1LA 3BSQA 5E0GA 1K1PA 5FPYA 4INKA 1O5GH 2ALPA 1MCVA 3RXEA 4I8LA 2ZFPH 5SGAE 1TNGA 1V2ST 5E0HA 1DSTA 1P2IA 1SL3A 3I77A 1O3BA 1F0SA 2PUQH 1GI7B 1XXDA 3T2NA 1GHZA 1GBHA 3LU9B 1QRXA 4OGXA 1THPB 4OS2A 3MH5A 4HI3A 4O3TA 1GL0E 5DP9A 5GPIB 3UFAA 2OP9A 3LH1A 4XFQA 5HGGA 3MMGA 3IWMA 4ABBA 1BDAA 1IQNA 1SLVB 4BAQB 3W94A 5C1UA 5EXNA 3TPIZ 1JMOH 3FFGA 1ZZZA 1DE7H 1AB9C 1XXFA 3S69A 2QF3A 3TNTA 1MD8A 4SGAE 1C5UA 1GBLA 1YPGH 2H1UA 5FX5A 2HOBA 2A5AA 1O2SA 3VFEA 2Z3CA 3AVZA 1VZQH 1TNIA 8GCHF 3GCTF 4UFGH 1ELEE 1OWIA 1DS2E 2O9QA 1BQYA 1QL9A 1HJ8A 1GBMA 3ZVEA 2H5DA 3MO3A 1LDTT 2BLWA 1ETSH 1GBTA 1MMJN 1SSXA 1BBRE 1QTFA 3P8NA 2V3HH 4AFSA 1H8IH 3D49H 5EQQA 3ZVFA 1UVPA 3VGCB 2ALVA 2R0LA 4JZ1A 1C5QA 2GT7A 1YPEH 4Y79A 1MU6B 5JB9S 1GJCB 4Y8YA 4B1TA 1GJ8B 1MBQA 1P3EA 4ZKSU 1KLTA 1JOUB 4FUFA 1NFYA 4D7GA 5C3NA 2BDHA 1MTNC 1Y3VA 4WJG2 3AAVA 1BMLA 3F68H 1O3DA 4NG9H 5JDUB 1BMNH 1W0ZU 4IW4E 3F9EA 4AORA 3GCTG 3EGKH 1C2GA 1EPTA 1UTOA 2ULLA 5LPFA 3HATH 2HALA 3T28A 4B74A 2B8OH 1LVYA 3GICB 3RXDA 4X6MA 1GL1A 1ZRKA 1UMAH 1FAKH 3C1KA 1VITG 2JH6D 3HK3B 2PTCE 2QXIA 5EPNA 2CHAB 5HXFA 2G4TA 1K1MA 3ODFA 1W7GH 2HPPH 2EI6A 2BQWB 1HRTH 5JPMH 1TPPA 1C1QA 4TY7A 5FBIA 1RGQA 1QIXB 1O33A 1B0FA 1ZOMA 4CBOA 2Y7ZA 1DX5M 1TWXB 3E90B 2NWNA 4I7YH 3RXPA 3U9AH 3PV4A 1E37B 4A1TA 3M3VA 2STAE 2SNWA 1AKSB 2BDYA 2ODQA 4XBCA 2FESH 4DW2U 1H9IE 4JZFH 1GMCF 3URCA 4GCHF 3U8OH 3K9XB 1GWAA 3D65E 2GCHF 1GHYH 3UUZA 3CS0A 2FLBH 4SGBE 2D8WA 2XWAA 4OS1A 1NT1A 2D2DA 4D9QA 3O8DA 1H4WA 3ZZCA 4JZEH 3ATMA 1T8MA 1ZMLA 3PYHA 4ABJA 3RMLH 1CHGA 2FTLE 3GYMA 2G5VA 3T27A 2Y82A 1HAZB 1Y5UT 1UVUH 2BVXH 4BAMB 3M5OA 3ZVAA 2ODYB 1GJ4H 1L1GA 4FU8A 1JWTA 3AASA 4FU7A 7GCHF 4BAOB 1O0DH 3FZDA 3GDVA 3SU0A 5JBAS 3P95A 3RXLA 2ASUB 2WPJS 1O2RA 1ELCA 2GCHG 1L4ZA 2VH6A 1UHBA 1YCPM 4K1TA 4DURA 3RXJA 3OYPA 1G3EA 1GBCA 1TMBH 1MKXK 1PPGE 1VITH 1V2PT 1HIAB 2H2ZA 1LHFH 4O97A 4GVUA 2B9LA 2FOMB 3QDZB 2ZTXA 1UO6A 1HAGE 1FLEE 1CGJE 2PUXB 5DK1A 2YNBA 3ENSB 3QWCH 3Q3XA 2P59A 4A6LA 3UOUA 1G36A 1Q2WA 4ASHA 4JMYA 2GV7A 5C5OA 4MPXA 3BIUH 4GHQA 3TJOA 3DD2H 1O3AA 3PWBA 2R0KA 1L4DA 4TPYA 3MU8A 1BZXE 4U2WA 2C90B 2A4OA 1DOJA 1AO5A 1KXFA 1O3PB 3GOVB 4KTUA 1HAVA 1O3MA 2WPHS 1HAHH 2RG3A 1Q31A 1LMWB 3K2UA 3A7ZA 4IBLH 4GLYA 5EQSA 3ZZBA 3GDSA 2XWBI 3S7HB 1EZSC 1P3CA 3V7TA 2FYRA 4BAHB 1F0UA 1TGNA 4NFEA 3GY3A 3URDA 3HKJB 7LPRA 1AI8H 1YC0A 3TH3H 3V13A 2Q6DA 1ELFA 3D62A 2J94A 2ZA5A 3NKKA 3P8OA 3DA9B 3MU1A 3MU5A 3NZIA 2Z94A 1YYY1 2A4QA 2CMYA 2OQ5A 3RXGA 1BUIA 4FUGA 4OS4A 1C5SA 3SV8A 4YESB 1TYNA 1QNJA 5CMXH 3LGVA 2Y5HA 2TIOA 4D8NA 1P2MA 3DUXH 1UTLM 2A0QB 4GUXA 4OS7A 1TGTA 1TOMH 3VXFH 3EA7A 4K1EA 2A1DB 4XE4A 1CSOE 3TJNA 2ZFTA 1YCPH 4E05H 4ABFA 2ODPA 2HWLB 3RU4E 2AS9A 1V2WT 3RXSA 3PTBA 2ZIQH 2ZHDA 4ZROA 4H6TA 1NTPA 1YLDA 5AF9H 1DXPA 1O38A 1UK4A 3T29A 4CH8B 4FUJA 3L33A 3FVFB 3A7XA 3GCHB 5H4IB 4U30A 3BTQE 1ZGIA 4Y71A 1SQOA 1FDPA 1P2JA 1C2LA 1NS3A 1Y3XA 4NZLA 2UUKB 2WPKS 2ZZUH 4WMFA 4X2YA 2ZDNA 2FI5E 5K0HA 2VNTA 3RLWH 2BM2A 3EE0B 3W95A 1SG8B 4ABIA 3Q3YA 2FX6A 1NRNH 2HPQH 1BIOA 2FOBA 1NU7B 2FOAA 4DT7B 2KAIB 2P3FH 4YZUA 1C4U2 1D9IA 2A32A 4A7IB 1EOJA 3K65B 4X1QU 2JETC 1ZJKA 3SUDA 3MNXA 1UCYH 4AB9A 4AX9H 2QXGA 3P17H 1WTGH 1P04A 1P02A 2RA3A 1GHVH 2ZDVH 1RD3B 1TPOA 4FUEA 4BANB 3V3MA 3A7YA 1AMHA 2J2UA 1Y3WA 3H5CB 1PQ5A 3MI4A 4IMZA 1ZSKA 1ETTH 4IC6A 3A8BA 1MTWA 3T26A 1SHHB 2CHAC 2P16A 5FCRA 1CGIE 2YNAA 2ZHWH 4FUCA 1C1TA 3RXOA 1O5DH 1J15A 3EAJA 1BTUA 1KXAA 1ELBA 1G3CA 1HAPH 1RTKA 3MH4A 4F4OC 1W8BH 3BG4C 1TIOA 2Y5FA 3UREA 2ZC9H 2TRMA 1O2JA 4CRDA 1TNKA 2BD2A 5C1YA 3F9GA 1Q3XA 3A8DA 1TMTH 2O8TA 2J34A 1IQEA 1ZTLA 1P03A 1GJBB 2G4UA 1EP5A 3RXIA 3PMHB 5F6MA 2QAAA 2AEIH 2GMTC 2W7UA 1P05A 3E0PB 3A87A 2ILNA 5HYOA 2PLXA 3UY9A 1GDNA 4PROA 1DWDH 1QRZA 2BD7A 4CBNA 1PPBH 3OX7U 1N1LA 5C1XA 1GVZA 1MTVA 2A4GA 2VJ1A 5C67A 3ZVCA 4I33A 2W3KA 1A2CH 3R0FA 1GBFA 1Z1IA 3AW1A 2QXJA 3PLBA 3BTDE 1KLJH 1O2GH 3LC5A 1MTNB 4ISHH 2XCFA 4X8UH 2QGRA 2IN2A 1AVWA 1SLXB 1FIWA 5DPAA 5L6NH 1DY9A 1DICA 1KDQA 3DFJA 4MTBA 3S9CA 2SFAA 4INLA 4ABGA 1C1UH 4I8GA 1HV7A 1H9LB 2Z9JA 2ZHEH 3E3TA 1GGDC 3SNAA 1TABE 2BLQA 1WAYB 1SQTA 3M7UA 1WUNH 2BDCA 1C5ZB 3FP6E 1F7ZA 3Q00A 2BXTH 2GDDA 3SHAH 3B23B 2BY5X 3GY2A 1V2UT 1FXYA 2H9HA 3DT0H 4THNH 5GWZA 2FLRH 1WQVH 3NXPA 1CO7E 1EB1H 3RXHA 1PYTC 3BF6H 1ELTA 1CU1A 3GY5A 5F8TA 1EPTB 1V2OT 3V12A 3CENA 4OS5A 1SGFG 3A8CA 2OC1A 4BNRA 1K1IA 4X8SH 3TLOA 3ZYDA 2SGPE 1V2NT 3VB5A 5AHGH 1GMDG 4BXWA 1A0HB 1YPLH 4NIYA 1P2KA 2BOKA 1Z8JB 3ATKA 3IG6B 4RKJB 3BTHE 1C5VA 1NY22 1O3CA 1GBBA 4FXGH 4AGJA 3T62A 4MPVA 2IJOB 1THRH 1PQAA 3AAUA 1MKWH 3ATWA 3QGJA 1KSNA 3DHKH 3MU4A 4HGCA 4FVDA 1TBRH 1HLTH 1HUTH 1QJ7B 3TH2H 1SGYE 1BT7A 1YLCA 2CJIA 4FUDA 3ZV9A 1TLDA 3CS7A 4UD9H 3VB6A 4R8TB 2F91A 1AY6H 2F9BH 4JYUH 3LGYA 1EXFA 3F9FA 1SPJA 4J1YA 1AFQC 1NROH 1TPAE 3UTUH 1C5WB 3A8AA 5AVDA 1RS0A 5A0BA 1VCPA 4MPUA 1GI8B 2ZU2A 3ELAH 1PPCE 2AH4X 1GJ6A 5JB8S 1K21H 2PKAA 1P2OA 1Y5BT 1F5KU 1GHBF 4I8JA 2ZDMA 2F9VA 1DUEA 2ZPRA 3M7QA 1AN1E 4K1SA 2FM2A 5AFZH 2FYQA 4O9VA 2XW9A 2F83A 1NRRH 3UNQA 1AE5A 1OYQA 2P93A 3ZZ4A 2NU3E 2Z9LA 1EKBB 7ESTE 1B5GH 2Z3EA 3SU2A 4B2AA 3SUEA 1Z8GA 2XC5A 5F03A 2ZFRH 1QR3E 3RC5A 1S5SA 4AOQA 1T32A 3KQBA 1G3DA 1EATA 3UR9A 1ZMJA 6ESTA 1S83A 4X2WA 2GP9B 1EQ9A 1GHBG 2OINA 2UUYA 5EG4A 2EI8A 5GJ4B 5IDKA 4YO9A 1SHYA 2ZHFH 2W26A 1TAWA 4NA9H 3PLKA 2HNTF 2Q6FA 3TJUA 4ISOA 3MNBA 2A7CA 1W2KH 2O8MA 4INHA 1SMFE 1FY4A 4ABHA 1BB0B 2WUCA 1LQDB 1SFQB 2PV9B 4CRFA 3OTJE 1UVOA 1G30B 4H6SB 1ZR0A 1AD8H 3PWCA 1C5RA 3UIRA 2Y80A 1AZ8A 4I8HA 3VPKA 1M9UA 1G2LA 2AMDA 2HGTH 2WYGA 1GHAF 5T6GA 3LT3A 1QJ1B 1XVOA 1EAWA 1J14A 2THFB 2AGGX 2FOHA 1CGHA 4MNYA 1EAXA 3LOXA 3FP7E 1C1SA 1P11E 4UE7H 2CF9H 1AUJA 1GBAA 3TGJE 1VCQA 1O2MA 4AZ2B 1O3KA 1LCYA 3KF2A 1ID5H 3VEQB 3N7OA 4WF8A 1T8NA 2JETB 1D6RA 2XNIA 5HMAA 1C5XB 2STBE 9ESTA 1P06A 1O5FH 4XDEA 2BX4A 8GCHG 3E6PH 1H8DH 1O3GA 3QK1A 1AGJA 2DE9A 3LJOA 1PYTD 3U8RH 1IQKA 4DVAU 1G32B 1D3TB 3HK6B 1MZAA 1HJAC 4YM9A 3E91A 3PLPA 3QZRA 3ESTA 3GYLB 5DP6A 1C5OH 2SGFE 3SNBA 3NPSA 4ZXYH 1G37A 3CP7A 2OBOA 2C8YB 2FTMA 3RXKA 1E35B 4ISNA 2NU4E 1Y3YA 3ZZDA 2FWWA 4UEHH 3RDZA 4BXSA 1KXEA 2HNTC 1V2MT 1C1OA 7KMEH 1OPHB 1KLIH 1J16A 3LGIA 3MYWA 4U01A 5AFYH 3EYDA 4Y11E 2BYAX 1KTSB 2BY7X 1EPTC 3ZZAA 3BG4B 4NA8A 4BTTB 4YOIA 4O3UA 2Z7FE 3PTNA 3RXBA 1A61H 5BPEA 1O5EH 3KHVA 3UNRA 2B7DH 2C4FH 1TGSZ 1YP9A 4DY7B 2FDAA 1IQFA 2VIPA 1MU8B 4WVPE 1QBNA 1O2PA 1XKBC 2ZHQH 1JIRA 1ZMNA 4NWLA 2GMTB 4JCNA 3PM3A 1SOZA 1J9CH 3ZZ7A 4D76A 3A85A 3P8FA 1SC8U 1AHTH 2WYJA 1LHDH 2ZGXH 2TPIZ 1BTWA 1FY5A 3A89A 4ZMAH 1LVBA 1NRSH 1A0JA 3SGQE 1AUTC 2FMJA 1E34B 1V2JT 1RJXB 1ZLRA 2HVXA 4CHAC 3U1JB 1Z6JH 3S0NA 1LKBA 4Q80A 3MWIU 1OP0A 4MNVA 2QA9E 1W12U 1QQUA 2OXSA 1XUFA 3GY8A 1DFPA 2O8LA 1ANCA 3ITIA 1THSH 3TVJB 1GI0A 4X8TH 5IYTA 3HGPA 4WY3A 1YM0A 1O2WA 1VR1H 4Y8ZA 2BDBA 3RC6A 3NWUA 4Q7XA 1D3PB 2BD8A 1EB2A 1GGDB 1GMCG 3H7OA 1SOTA 4GCHG 1G2MA 3SV7A 4NSVA 2ZPSA 1FJSA 2Y7XA 1S6FA 2QC2A 1A46H 1AU8A 1O2QA 2GVFA 3RP2A 3K6YA 2AYWA 1TNJA 2ZU5A 2QN5T 2XXLA 1MD7A 1CVWH 4K8BA 3ZVGA 1T4UH 4DIHH 2ZKSA 4DJZB 3NCLA 1SGNE 1KDQB 4K8YA 1EZQA 1E0FD 4MNXA 4HZHA 4X6OA 5EU8A 3LPRA 2FOCA 3LIWA 1A4WH 1ZRBA 4U32A 3BEFB 4ZAEA 7GCHG 3SU3A 4AFQA 3B9FH 1SQAA 5LPRA 1PQ7A 2VWMA 1Z6EA 1AE8H 3RU4T 1AWFH 3IITA 3SJOA 3RXFA 1YBWA 1V2TT 5HM2A 1PPFE 5A8XA 3M5LA 1XUKA 3BV9B 2CF8H 3GY7A 2EI7A 2R9PA 2H9TH 1TB6H 1ANDA 1XUIA 2H9EH 2VWOA 5CE1A 5ETXA 5TCAA 4NIVA 1B0EA 2J92A 4GHTA 4DIIH 3TH4H 2ZO3H 1WU1A 1SGIB 1SGQE 3SZNA 5JYIA 2C3SA 1TE0A 3A82A 1LO6A 1ELDE 3ZV8A 1KIGH 1W10U 2AMPA 1E38B 1UJ1A 2I6QA 3TIUA 3SUFA 2FS8A 1NESE 4NFFA 2Q1JA 2C8ZB 1QCPA 1F2SE 4IN2A 1L0ZA 2XBVA 3ZZ6A 1O3EA 1NO9H 3MHWU 2ZDKA 3HKIB 3TU7H 2A4RA 5EQRA 4HTCH 1V2LT 2CN0H 1AFQB 2ZI2H 4DGJA 3P92A 1IQHA 5DKMA 5T6DA 3UWJH 4MPWA 4B73A 1HJ9A 1MKXH 1GI1A 4JYVH 4WH8A 3ATLA 4Y8XA 3UR6A 3A86A 3FP8E 5LPEA 1GCTC 3I29A 3QTVH 1GMHF 1T31A 5LH8A 1KTTB 1DLKB 1LTOA 1TNLA 2SGEE 1HXEH 2FOGA 2WV4A 1O3FA 2ZFQH 1O31A 2H6MA 1AFEH 1C2EA 1P01A 2DUCA 2ZG0H 4YLQH 1GI4A 1FPHH 1GJDB 2BMGB 3GDUA 2AERH 2PWXA 3SV6A 4CH2B 1C9TA 1DWEH 5EXMA 1W13U 1GJ7B 1TPSA 3RM2H 1N8OC 1OWDA 5DP3A 3MNSA 1FIZA 2ANMH 3MH6A 3SO3A 5A8YA 1K1JA 3TGIE 5A0CA 1SGRE 1C2HA 3SJKA 2WPLS 1V6DA 4AFZA 3F9HA 1JBUH 1F92A 1ABJH 1BHXF 1SGTA 1BJUA 2Y81A 1ZHMA 1D3QB 3OY5U 1BOQA 1CBWB 2ZQ2A 2PKSC 1H1BA 5A2MH 1HXFH 3BTKE 5A0AE 1SR5C 3E8LA 2GZ7A 4NGAH 1S0RA 3A7VA 4ZHAA 2V3OH 5FPTA 6LPRA 1VGCC 2FOEA 1IQMA 1C2IA 1OWHA 3M37A 1QY6A 2Z9IA 3K6ZA 2P8OC 2A5KA 4ZH8A 3UNSA 2BQ6B 1C1PA 1QBOA 1MZDA 2BXUH 4CREA 3V0XA 2BDIA 2YOLA 2ZEBA 1PPZA 1AKSA 5FX6A 2FX4A 2P3TB 1EX3A 4A1VA 1GJ5H 1OS8A 2G55A 2Z9KA 4MG3A 1OWEA 5A09A 2J4IA 1FONA 1MAYA 3S9AA 1SLWB 1TX7A 2VWLA 3BTEE 3U98H 3FZZA 4B75A 1DM4B 1AQ7A 1A3BH 5I25A 1GJAB 3VB3A 1P0SH 1FZZA 2GCTB 1TA6A 1U6QA 3P70B 1SFIA 3ODDA 1O2KA 1WYKA 1S84A 2ANYA 1HAOH 2FPZA 1AWHB 1O39A 2PW8H 4K2YA 4MQAA 3SN8A 5ESTE 1PQ8A 1TMUH 1NRQH 2A7HA 1F0RA 4X2XA 1A5GH 1D6WA 3RXRA 3PB1E 3STIA 2FOFA 3SU1A 3SOSA 1AZZA 1HCGA 1UCYE 4BTIB 2ANWA 1OP8A 1HJAB 1ESAA 2QF0A 5L30H 1HIAA 3SGBE 2FEQH 4J2YB 4TY6A 1G9IE 1C4V2 3RXCA 4ABEA 1YGCH 2FI4E 2QCYA 5DGJA 1C1NA 1ZHRA 2ZDAH 1V2VT 3RXVA 1GDUA 1ACBE 2SGDE 1P8VC 1LPZB 3QGNB 2GV6A 3MO6A 3EA8A 3GCNA 4F49A 1CE5A 2SGQE 1O3LA 1GCDA 4JZDH 1ARCA 1EZXC 1LQEA 3A7TA 3O8RA 2FP7B 2PFEA 2ESTE 1OX1A 2IOTA 1XUHA 1QGFA 3UWIA 3BN9A 1C1RA 1OYTH 3MOCA 4XOJA 1HYLA 1IHTH 2B0FA 3E16B 4OGYA 1YPMH 1HAIH 2BY8X 1DSUA 3GCOA 4MNWA 1LHGH 2OUAA 2ZGHA 2VINA 4WH6A 3KEEA 1GHWH 4FVBA 2V6NA 4Y76A 1ABIH 3SGAE 4NCYA 2OLGA 3ATIA 2GGVB 2G52A 2Q6GA 3OSYA 4CHAB 2FO9A 1SGDE 1TRYA 2VIDA 4CR5A 1Z8RA 1SGEE 2TGAA 2Z3DA 4ZKOU 2JH5D 4NA7A 4LZ4B 1O2XA 4TWYA 1NPMA 1ZJDA 1C2KA 1QBVH 1EAUA 1DY8A 1SGFA 8ESTE 2LNCA 1DXWA 2OD3B 2P95A 4ZHMU 4AGKA 4ZHLU 3PMAB 1O5BB 2BZ6H 3QLPH 1ZTJA 5CHAC 5JBBS 5L2ZH 3RM0H 2NU0E 3UPEA 1HFDA 1FUJA 1BRAA 4Q7ZA 3SORA 4ZUHA 4X1RU 1C1WH 2QXHA 5F8ZA 3RXUA 4GSOA 4LZ1H 2KAIA 2R3YA 3KNXA 5ABWA 4X1NU 4AG2A 2CGAA 4CR9A 5E2OA 3KCGH 1AIXH 5DP7A 5FAHA 2V35A 3TITA 2C8WB 1BBRH 5JBCS 1TGBA 4X1PU 1ANEA 1V2QT 1UHBB 4JZIA 2FXRA 4X6NA 3BTWE 1NFWA 2QY0B 5GDSH 1BRBE 1C5LH 1K2I1 1T8OA 1IQJA 4XBBA 4B76A 3PROA 2I6SA 1YPJH 1HB0B 3TNSA 3C27B 1G3BA 1Y3UA 3M7TA 5DO4H 4NZQA 1EJNA 2DE8A 4VGCB 2BDAA 1IAUA 1BTPA 9LPRA 1FY3A 3M3TA 1TA2A 4CRBA 5DP4A 2ZECA 1YPHE 1CBWC 2ZU3A 4IC5A 3A80A 4E06H 2CV3A 1CT2E 1TQ0B 1HAVB 6GCHF 1GVLA 2UUJB 1OWKA 1UVSH 1DUAA 1K1OA 2F3CE 3M36A 2F9NA 5EGMA 2B5TB 3VXEH 4BAKB 1P57B 1XMNB 4WWYA 2ZDLA 3SHCH 3SJIA 5EPYA 4K5ZA 1GBIA 1W3CA 3F6UH 4H42U 1O35A 1XUGA 2VGCC 3SNEA 1DWBH 1XKAC 1P09A 4D7FA 1SLUB 3M5NA 2XC4A 5HM9A 3A83A 4XBDA 4K3JA 4BTUB 1O36A 1GCTB 3HGNA 1O2OA 2BY6X 4IMQA 2W7SA 3M5MA 5TJXA 1WOFA 6GCHG 2CXVA 3ZVDA 1GHXH 2GCTC 1ZTKA 3RXQA 1ZPZA 1Y59T 4X0WU 3TK9A 5L2YH 1WCZA 2SGAA 1PPEE 4M7GA 1N6YA 1O2ZA 1OKXA 2J95A 2PR3A 1RXPA 1GBKA 1MQ5A 3STJA 3SI3H 3MU0A 3A7WA 1GI6A 1T8LA 3BIVH 3NUMA 2F9UA 1C5NH 1N8OB 1DVAH 1GHAG 2R2MB 1IHSH 4YTAA 2BQ7B 3FANA 2WPMS 3RXTA 1GG6C 2W5EA 1VITF 4JK5A 3BEUA 1TNHA 1MAXA 1C5PA 1ETRH 3SJ8A 2TBSA 2BD3A 1GBEA 2JKHA 3A88A 1A1RA 3LGTA 4A92A 2GX4A 1TBZH 4WXIA 2HRVA 2RDLA 2PKSB 3QX5H 1O3JA 1DLEA 1O34A 1A0LA 2UUFB 1W11U 2SNVA 4Y7AA 2C93B 1B7XB 1CA0C 1K28D 8KME2 1O2IA 1KXBA 3T5FH 2K1QA 1IQLA 3F1SB 1TX6A 1MTSA 3MH7A 6CHAC 2EA3A 1VGCB 3ZVBA 1LPGB 2TGDA 3PO1C 2P8OB 5FPSA 2G5NA 5K7RA 1GBDA 2XBXA 4Z0KA 1PPHE 3SV2H 3LDXH 1TFXA 2FI3E 1HAYB 4FUBA 5DP8A 2PGQB 1IOEA 1VJAU 1QJ6B 2BLOA 1TOCB 1ARBA 2H5CA 1QRWA 4NWKA 4UFFH 1C2DA 1Z8IB 1BRCE 3EDXB 1ZGVA 2UWOA 3SNDA 3BTFE 2FIRH 2BVRH 1CT0E 3L6PA 1Y5AT 1UTNA 3H7TA 2WPIS 3EA9A 2G8TA 5EODA 2WINI 2G00A 1QL7A 1C4Y2 2VWNA 2OBQA 1QQ4A 2G51A 2UWLA 1LVMA 3M3SA 5GCHF 1O2NA 1ELAA 2ZCHP 2VH0A 5BRRE 2AGEX 1T7CA 3SQHE 3S7KB 2ZGJA 2A45B 2BZAA 5FBEA 1E36B 2ZQ1A 3SJ9A 3BG8A 3P6ZB 4RN6A 1WSSH 2BLVA 4OS6A 2W3IA 3BTME 3B8JA 4B2BA 2OC7A 2NU1E 3A81A 4E7NA 4KGAA 1RIWC 3NK8A 1FY1A 2AIQA 1GI9B 3DFLA 1KYNA 1VJ9U 2VB0A 3RC4A 5DG6A 4TYDA 3ZYEA 4HFPB 1GVKB 2VVCA 3I78A 2ANKH 1J8AA 4Y0ZE 5GCHG 1QA0A 1Y8TA 1L1NA 1BHXB 1UTJA 3G01A 1ANBA 1DDJA 2ZGBH 3U69H 1YCPK 3BEIB 3Q76A 3PMJA 2BOHB 5FCKA 2P3UB 2QYIA 1GBJA 3KQCA 2R2WU 1UTMA 2BTCE 5PTPA 2XRCA 4KKDA 4R0IA 4IS5A 5F8XA 2ZPQA 1F5LA 1OOKB 1C1VH 2ZTZA 4H4FA 4I31A 2A5IA 5DJ7A 4B2CA 1QA7A 1HNEE 2BX3A 2Y5GA 4KTSA 1K1NA 3ZZ5A 4ZXXH 3T25A 3SU5A 4IGDA 4YOGA 1EJAA 1BCUH 3QO6A 1GI3A 3KQEA 3RMMH 1QURH 2FODA 2XCNA 3KN2A 2F9PA 3UQVA 1UTKA 2GTBA 2OQUA 3VB4A 4I32A 4O03A 1OWJA 2VVVA 2HNTE 5E0JA 3LKWA 3QUMP 3RLYH 1BTYA 5C5NA 4VGCC 1D3DB 3QN7A 5JBTA 2PSYA 1DWCH 1WBGB 2ZWLH 4XSKU 1L1JA 2D26C 5FXLA 1EUFA 2GT8A 1UCYK 1QB6A 1NRPH 2GKVE 2AMQA 1JIMA 1S6HA 2Z9GA 4WMEA 2ZU1A 4RSPA 4AG1A 4FUHA 4UONA 4X2VA 2LPRA 3AW0A 3D23A 3SU4A 4K69A 4KTCA 3S9BA 3MNCA 4IN1A 2OCVB 1ZYOA 1S85A 1AVXA 1HBTH 3KL6A 3LGUA 2Y6TA 3M61U 1DANH 1W7XH 1GPZA 1Z71A 4DCDA 2A2QH 1N6XA 1QB1A 1GI2A 1S82A 1ORFA 1IQGA 1LPKB 1O37A 1ZPBA 5LGOA 1TRMA 1BTZA 5CHAB 2RCEA 1CHOF 2GZ9A 3QZQA 4MVNA 1NU9A 3SNCA 2XYAA 1HGTH 1XUJA 4UFDH 1QHRB 4TPIZ 1C5YB 1NC6A 4YOJA 2BHGA 2WV5A 1O5AB 1BA8B 1QL8A 1XX9A 4ISIH 3SU6A 5EW2H 1WTHD 5DP5A 4ZKNU 4CRAA 4ESTE 4UFEH 5EW1H 1NZQH 3FAOA 1C9PA 1OSSA 1P9UA 2P94A 1XM1A 4QT8C 3ZZ9A 1S0QA 2ZF0H 4AN7A 2BY9X 5B6OA 4ZKRU 4AYVB 2JH0D 2VIVA 3OY6U 1TONA 1LHCH 1MCTA 4JK6A 3VGCC 3O8CA 1CHOG 1X7AC 1SGPE 1ELGA 1O2UA 2BD5A 1F0TA 5E8EH 2PKAB 4NIWA 3BTTE 3KIDU 1CT4E 4GAWA 2PTNA 4MDSA 1NFXA 1GMHG 1OP2A 5ESBA 2PHBA 5T3HA 1PJPA 3SW2B 1KXDA 3RXAA 1MUEB 1V3XA 5I46H 1UK3A 3P8GA 1J17T 3KGPA 1BRUP 1HAXB 2VVUA 2O8UA 4GPGA 1KY9A 3LONA 3SV9A 4KP0A 1O3OA 4RKOB 2OC0A 1O5CB 2Z6BD 4LXBH 2A31A 1YKTA 1C5TA 1RTLA 1NN6A 1JXPA 2F9OA 2VGCB 4D9RA 2HLCA 2OC8A 1FV9A 1LHEH 1GDQA 3UQOA 3MFJA 1O3NA 1NM6A 1QFKH 1UTPA 1MH0A 2VIWA 1P2NA 1FN8A 2XTTB 1AB9B 1SVPA 3ZZ8A 3RU4D 4YT7H 1V2RT 2BB4A 1NFUA 1FPCH 2XBWA 3Q77A 3GISB 1BITA 1O2LA 5EXLA 3RUOA 4LOYH 1A5HA 3LGWA 4Y0YE 3LJJA 4X6PA 1FMGA 2QIQA 1T4VH 1P12E 1EZUC 4Y6DA 3MO9A 1ESBA 1UK2A 1CQQA 4UDWH 1LKAA 1LVOA 3TGKE 1MTUA 1V2KT 1BJVA 1FNIA 3UOPA 1WQSA 1WV7H 3OU0A 1GG6B 1O3IA 4YLUA 1H9HE 1HDTH 2EEKA 1GI5A 2FS9A 3U1IB 1VCWA 2BD4A 2A2XH 2M5TA 1MKWK 4Z6AH 1UVTH 3JZ2B 1TALA 3A84A 1FQ3A 4JYTA 3WY8A 1ELVA 4WMDA 1D4PB 3E0NB 8LPRA 1O2YA 1KXCA 4I8KA 5C2ZA 1C2MA 4FUIA 4WXVA 2BDGA 5J4SA 5GXPA 2G81E 3TK6A 2ZCKP 1P9SA 4NSYA 1CA0B 2J9NA 4X1SU 6CHAB 4ABDA 2AFQB 4AFUA 1EJMA 2ZFFH 3M35A 2GD4B 3BTGE 1ESTA 1GMDF 4ABAA 5TCCA 1DPOA 3PO1B 1P2QA 3QTOH 1FAXA 4MLFB 2ZTYA 3PMBB 1ZPCA 1O2HA 2O8WA 3R3GB 4TWWA 2D1JA 3GY6A 5G4BA 1SB1H 1RFNA 1O2VA 1CA8B 3VB7A 3RMNH 4AB8A 2ZU4A 2TGPZ 2BD9A 3TK5A
chains in the Genus database with same CATH superfamily
3GY4A 5J4QA 1SI5H 1W0YH 3F2GA 1K9OE 2J38A 1C2JA 1ZSLA 4FU9A 1TX8A 1YLNA 3LC3A 5EOKA 2R3UA 5GIBA 1HPGA 1XVMA 1EASA 2NU2E 1TBQH 4ISLA 1O30A 1TGCA 1SGCA 1YPHC 2UWPA 1A3EH 1BBRK 2V0BA 1C5MD 1PFXC 3RXMA 1JRSA 2PGBB 2BVSH 1C2FA 1L2EA 1YF4A 3MTYA 3Q3KA 1Z1JA 1EP6A 1TRNA 2EC9H 1A7SA 4ZCNA 2PSXA 3RMOH 4A1XA 3U8TH 1BTXA 4DOQA 2AGIX 3O8BA 2WUBA 1BMMH 2XBYA 4CRCA 4NIXA 2GDEH 1A5IA 1YPKH 3EQ0H 2FZZA 1RTFB 4BOHA 1S81A 1JRTA 2ZGCA 1RIWB 4Y10E 3SQEE 3SBKA 3L3TA 3SI4H 5DSFA 2VIQA 2AIPA 2ZFSA 5C20A 1DITH 4AYYB 1INCA 3TJVA 2IPHA 2VIOA 1UTQA 1O32A 2QV1A 1IQIA 2C8XB 1C1MA 2GZ8A 1BTHH 2XC0A 1Z7KA 1EOLA 2JDID 3LH3A 3SYJA 4YT6H 1DT2A 3GCHC 1O2TA 1OXGA 1ZSJA 1AVGH 3ZZ3A 4Q2KA 1P10A 2VU8E 2L74A 2RA0A 4DG4A 5E2PA 3SUGA 5A8ZA 4CRGA 3HPTB 1BMAA 1TQ7B 4X8VH 1MBMA 1FN6A 1FY8E 1O3HA 2ZNKH 1FI8A 1W14U 5T6FA 1RRKA 4E7RG 2A7JA 4Y7BA 4A5TS 3KQDA 2OTVA 1GJ9B 4B71A 5FHTA 4KELA 4LK4A 4K60A 4Q7YA 1SBWA 3JZ1B 1K22H 3E1XB 2TGTA 1EFRD 1EAIA 1ZHPA 2ZCLP 1MQ6A 1QB9A 1F5RA 2ZP0H 1K1LA 3BSQA 5E0GA 1K1PA 5FPYA 4INKA 1O5GH 2ALPA 1MCVA 3RXEA 4I8LA 2ZFPH 5SGAE 1TNGA 1V2ST 5E0HA 1DSTA 1P2IA 1SL3A 3I77A 1O3BA 1F0SA 2PUQH 1GI7B 1XXDA 3T2NA 1GHZA 1GBHA 3LU9B 1QRXA 4OGXA 1THPB 4OS2A 5FL7D 3MH5A 4HI3A 4O3TA 1GL0E 5DP9A 5GPIB 3UFAA 2OP9A 3LH1A 4XFQA 5HGGA 3MMGA 3IWMA 4ABBA 1BDAA 2WPDD 1IQNA 1SLVB 4BAQB 3W94A 2KCPA 5C1UA 2F43B 5EXNA 3TPIZ 1JMOH 3WWBA 3FFGA 1ZZZA 1DE7H 1AB9C 1XXFA 3GS9A 3S69A 2QF3A 3TNTA 1MD8A 4SGAE 1C5UA 1GBLA 1YPGH 2H1UA 1YWUA 5FX5A 2HOBA 2A5AA 1O2SA 3VFEA 2Z3CA 3AVZA 1VZQH 1TNIA 8GCHF 3GCTF 4UFGH 2J98B 1ELEE 1OWIA 1DS2E 2O9QA 1BQYA 1QL9A 1HJ8A 1GBMA 3ZVEA 2H5DA 3MO3A 1LDTT 2BLWA 1ETSH 1GBTA 4YXWD 1MMJN 1SSXA 1BBRE 1QTFA 3P8NA 2V3HH 4AFSA 1H8IH 3D49H 5EQQA 3ZVFA 1UVPA 5CHBA 3VGCB 2ALVA 2R0LA 4JZ1A 1C5QA 2GT7A 1YPEH 4Y79A 1MU6B 5JB9S 2L6OA 1GJCB 4Y8YA 4B1TA 1GJ8B 1MBQA 1P3EA 4ZKSU 1KLTA 1JOUB 4FUFA 1NFYA 4D7GA 5C3NA 2BDHA 1MTNC 1Y3VA 4WJG2 3AAVA 1BMLA 3F68H 1O3DA 4NG9H 5JDUB 1BMNH 1W0ZU 4IW4E 3F9EA 4AORA 3GCTG 3EGKH 2VBCA 1C2GA 1EPTA 1UTOA 2ULLA 5LPFA 3HATH 2HALA 3T28A 4B74A 2B8OH 3SZEA 1LVYA 3GICB 3RXDA 4X6MA 1BMFD 1GL1A 1ZRKA 1UMAH 1FAKH 4XD7D 3C1KA 1VITG 2JH6D 3HK3B 2PTCE 2QXIA 5EPNA 2CHAB 5HXFA 2G4TA 1K1MA 3ODFA 1W7GH 4RT1A 2HPPH 2EI6A 2BQWB 1HRTH 5JPMH 1TPPA 1C1QA 4AC9A 4F55A 4TY7A 5FBIA 1RGQA 1QIXB 2K8IA 1O33A 1B0FA 1ZOMA 4CBOA 2Y7ZA 1DX5M 1TWXB 3E90B 2NWNA 4I7YH 3RXPA 3U9AH 3PV4A 1E37B 4A1TA 3M3VA 3F3BA 2STAE 2SNWA 1AKSB 2BDYA 2ODQA 4XBCA 2FESH 4DW2U 1H9IE 4JZFH 1WDIA 1GMCF 3URCA 4GCHF 3U8OH 3K9XB 1GWAA 3D65E 2GCHF 1GHYH 3UUZA 3CS0A 2FLBH 4SGBE 2D8WA 2XWAA 4OS1A 1NT1A 2D2DA 4D9QA 3O8DA 1H4WA 3ZZCA 4JZEH 5F53A 5IK2D 3ATMA 1T8MA 1ZMLA 3PYHA 4ABJA 3RMLH 1CHGA 2FTLE 3GYMA 2G5VA 3PV5A 3T27A 2Y82A 1HAZB 1Y5UT 1UVUH 2BVXH 4BAMB 3M5OA 3ZVAA 2ODYB 1GJ4H 1L1GA 4FU8A 1JWTA 3AASA 4FU7A 7GCHF 4BAOB 1O0DH 3FZDA 3GDVA 3SU0A 5JBAS 3P95A 3F0PA 3RXLA 2ASUB 2WPJS 1O2RA 1ELCA 2KCYA 2GCHG 1L4ZA 2VH6A 1UHBA 1YCPM 4K1TA 4DURA 3RXJA 3OYPA 1G3EA 1GBCA 1TMBH 1MKXK 1PPGE 1VITH 1V2PT 1HIAB 2H2ZA 1VKYA 2IPQX 1LHFH 4O97A 4GVUA 2B9LA 2FOMB 3QDZB 2ZTXA 1UO6A 1HAGE 5C94A 1FLEE 1CGJE 2PUXB 5DK1A 2YNBA 3ENSB 3QWCH 3Q3XA 2P59A 4A6LA 3UOUA 1G36A 1Q2WA 4ASHA 4JMYA 2GV7A 5C5OA 4MPXA 3BIUH 4GHQA 3TJOA 3DD2H 2HVYB 1O3AA 3PRBA 3PWBA 2R0KA 1L4DA 4TPYA 3MU8A 1BZXE 4U2WA 2C90B 2A4OA 1DOJA 1AO5A 1KXFA 1O3PB 3GOVB 4KTUA 1HAVA 1O3MA 2WPHS 1HAHH 2RG3A 1Q31A 2CK3D 1LMWB 3K2UA 3A7ZA 4IBLH 4GLYA 5EQSA 3ZZBA 3GDSA 2XWBI 3S7HB 1EZSC 1P3CA 3V7TA 2FYRA 4BAHB 1F0UA 1TGNA 4NFEA 3GY3A 2LP6A 3URDA 3HKJB 7LPRA 1AI8H 1YC0A 3TH3H 3V13A 2Q6DA 1ELFA 3D62A 2J94A 2ZA5A 3NKKA 3P8OA 3DA9B 3MU1A 3MU5A 3NZIA 2Z94A 1YYY1 2A4QA 2CMYA 2OQ5A 3RXGA 1BUIA 4FUGA 4OS4A 1C5SA 3SV8A 4YESB 1TYNA 1QNJA 5CMXH 3LGVA 2Y5HA 2TIOA 4D8NA 1P2MA 3PRDA 3DUXH 1UTLM 2A0QB 4GUXA 4OS7A 1TGTA 1TOMH 3VXFH 3EA7A 4K1EA 3DCLA 2A1DB 4XE4A 2KFWA 1CSOE 3TJNA 2ZFTA 1YCPH 4E05H 4ABFA 2ODPA 2HWLB 3RU4E 2AS9A 1V2WT 3RXSA 3PTBA 2ZIQH 2ZHDA 4ZROA 4H6TA 1NTPA 1YLDA 5AF9H 1DXPA 1O38A 1UK4A 3T29A 4CH8B 4FUJA 3L33A 3FVFB 3A7XA 3GCHB 5H4IB 4U30A 1QZ8A 3BTQE 1ZGIA 4Y71A 1SQOA 1FDPA 1P2JA 1C2LA 1NS3A 4Q4LA 1Y3XA 4NZLA 2UUKB 2WPKS 3OEHD 2ZZUH 4WMFA 4X2YA 2ZDNA 2FI5E 5K0HA 2VNTA 3RLWH 2BM2A 3EE0B 3W95A 1SG8B 4ABIA 3Q3YA 2FX6A 1NRNH 2HPQH 1BIOA 2FOBA 1NU7B 2FOAA 4DT7B 2KAIB 2P3FH 4YZUA 1C4U2 1D9IA 2A32A 2WHXA 1EOJA 3K65B 4A7IB 4X1QU 2JETC 2XOKD 1ZJKA 3SUDA 3MNXA 1UCYH 4AB9A 4AX9H 2QXGA 3P17H 1WTGH 1P04A 1P02A 2RA3A 1GHVH 2ZDVH 1RD3B 1TPOA 4FUEA 4BANB 3V3MA 3KYGA 3A7YA 1AMHA 5HIZA 2J2UA 1Y3WA 3H5CB 1PQ5A 3MI4A 4IMZA 1ZSKA 1ETTH 2EY4C 4IC6A 3OAAD 3A8BA 1MTWA 3T26A 1SHHB 3N99A 2CHAC 2P16A 5FCRA 1CGIE 2YNAA 2ZHWH 4FUCA 1C1TA 3RXOA 1O5DH 1J15A 3EAJA 1BTUA 1KXAA 1ELBA 1G3CA 1HAPH 1RTKA 3MH4A 4F4OC 1W8BH 3BG4C 1TIOA 2Y5FA 3UREA 2ZC9H 2TRMA 1O2JA 4TT3D 4CRDA 1TNKA 2RDEA 2BD2A 5C1YA 3F9GA 1Q3XA 3A8DA 1TMTH 2O8TA 2J34A 1IQEA 1ZTLA 1P03A 1GJBB 2G4UA 1EP5A 3RXIA 3PMHB 5F6MA 2QAAA 2AEIH 2GMTC 2W7UA 1P05A 3E0PB 2PP6A 3A87A 2ILNA 5HYOA 2PLXA 2W6JD 1GDNA 3UY9A 4PROA 1DWDH 1QRZA 2BD7A 4CBNA 1PPBH 3OX7U 1N1LA 5C1XA 1GVZA 1MTVA 2A4GA 2VJ1A 5C67A 3ZVCA 4I33A 2W3KA 1A2CH 3R0FA 1GBFA 1Z1IA 3AW1A 2QXJA 3PLBA 3BTDE 1KLJH 1O2GH 3LC5A 1MTNB 4ISHH 2XCFA 4X8UH 2QGRA 2IN2A 1AVWA 1SLXB 1FIWA 5DPAA 5L6NH 1DY9A 1DICA 1KDQA 3DFJA 4Z1MD 4MTBA 3S9CA 2SFAA 3FN8A 4INLA 4ABGA 1C1UH 4I8GA 1HV7A 1H9LB 2Z9JA 2ZHEH 3E3TA 1GGDC 3SNAA 1TABE 2BLQA 1WAYB 1SQTA 3M7UA 1WUNH 2BDCA 1C5ZB 3FP6E 1F7ZA 3Q00A 4DT4A 2BXTH 2GDDA 3SHAH 3B23B 2BY5X 4FOUC 3GY2A 1V2UT 2M2AA 1FXYA 2H9HA 3DT0H 4THNH 5GWZA 2FLRH 1WQVH 3NXPA 1CO7E 1EB1H 3RXHA 1PYTC 3BF6H 1ELTA 1CU1A 3GY5A 5F8TA 1EPTB 1V2OT 3V12A 3CENA 4OS5A 3NRLA 1SGFG 3A8CA 2OC1A 4BNRA 1K1IA 4X8SH 3TLOA 3ZYDA 2SGPE 1V2NT 3VB5A 5AHGH 1GMDG 3H09A 4BXWA 1A0HB 1YPLH 4NIYA 1P2KA 2BOKA 1Z8JB 3ATKA 3IG6B 3UB0A 4RKJB 3BTHE 1C5VA 1NY22 1O3CA 1GBBA 4FXGH 4AGJA 3T62A 4MPVA 2IJOB 1THRH 3EE7A 1PQAA 3AAUA 1MKWH 3ATWA 2RFKC 3QGJA 1KSNA 3DHKH 3MU4A 4HGCA 4FVDA 1TBRH 1HLTH 1HUTH 1QJ7B 3TH2H 1SGYE 1BT7A 1YLCA 2CJIA 4FUDA 3ZV9A 1TLDA 3CS7A 4UD9H 3VB6A 4R8TB 2F91A 1AY6H 2F9BH 4JYUH 3LGYA 1EXFA 4M9FA 3F9FA 1SPJA 4J1YA 1AFQC 1NROH 2KX4A 1TPAE 3UTUH 1C5WB 3A8AA 5AVDA 1RS0A 5A0BA 1VCPA 4MPUA 1GI8B 2ZU2A 3ELAH 1PPCE 2AH4X 1GJ6A 5JB8S 1K21H 2PKAA 1P2OA 1Y5BT 2XNDD 1F5KU 1GHBF 4I8JA 2ZDMA 2F9VA 3FO8D 1DUEA 2ZPRA 3M7QA 1AN1E 4K1SA 2FM2A 5AFZH 2FYQA 4O9VA 2JIZD 2XW9A 2F83A 1NRRH 3UNQA 1AE5A 3OTPA 4ACAA 1OYQA 2P93A 3ZZ4A 2NU3E 2Z9LA 1EKBB 5T1VA 7ESTE 1B5GH 2Z3EA 3SU2A 4B2AA 3SUEA 1Z8GA 2XC5A 5F03A 2ZFRH 1QR3E 3RC5A 1S5SA 1MABB 4AOQA 1T32A 3KQBA 1G3DA 1EATA 3UR9A 1ZMJA 6ESTA 1S83A 4X2WA 2GP9B 1EQ9A 1GHBG 2OINA 2UUYA 5EG4A 2EI8A 5GJ4B 5IDKA 4YO9A 1SHYA 2ZHFH 2W26A 1TAWA 4NA9H 3PLKA 2HNTF 2Q6FA 3TJUA 4ISOA 3MNBA 2F4LA 1S6LA 2A7CA 1W2KH 2O8MA 4INHA 1SMFE 1FY4A 4ABHA 1BB0B 2WUCA 1LQDB 1SFQB 2PV9B 2V7QD 3OTJE 4CRFA 1UVOA 5HIYA 1G30B 4H6SB 1ZR0A 1AD8H 2YMSC 3PWCA 1C5RA 3UIRA 2Y80A 1AZ8A 4I8HA 3VPKA 1M9UA 1G2LA 2AMDA 2HGTH 2WYGA 1GHAF 5T6GA 3LT3A 1QJ1B 1XVOA 1EAWA 1J14A 2THFB 5EIYA 2AGGX 2FOHA 1CGHA 4MNYA 1EAXA 3LOXA 3FP7E 1C1SA 1P11E 4UE7H 2CF9H 1AUJA 1GBAA 3TGJE 1VCQA 1O2MA 3W1EA 4AZ2B 3WW7A 1O3KA 1LCYA 3KF2A 1ID5H 3VEQB 3N7OA 4WF8A 1T8NA 3CNRA 2JETB 1D6RA 2XNIA 5HMAA 1C5XB 2STBE 9ESTA 1P06A 1O5FH 4XDEA 2BX4A 8GCHG 3E6PH 1H8DH 1O3GA 3QK1A 1AGJA 2DE9A 3LJOA 1PYTD 3U8RH 1IQKA 4DVAU 1G32B 1D3TB 3HK6B 1MZAA 1HJAC 4YM9A 3E91A 3PLPA 3QZRA 3ESTA 3GYLB 5DP6A 1C5OH 2SGFE 3SNBA 3NPSA 4ZXYH 1G37A 2HLDD 3CP7A 2OBOA 2C8YB 2FTMA 3RXKA 1E35B 4ISNA 2NU4E 1Y3YA 3ZZDA 2FWWA 4UEHH 3RDZA 4BXSA 1KXEA 2HNTC 1K0HA 2WZQA 1V2MT 1C1OA 7KMEH 1OPHB 1KLIH 1J16A 3LGIA 3MYWA 4U01A 5AFYH 3EYDA 4Y11E 2BYAX 1KTSB 2BY7X 1EPTC 3ZZAA 3BG4B 4NA8A 4BTTB 4YOIA 4O3UA 2Z7FE 3PTNA 3RXBA 1A61H 5BPEA 2LELA 1O5EH 1SQRA 3KHVA 2B7DH 3UNRA 2C4FH 1TGSZ 1YP9A 4DY7B 2FDAA 1IQFA 2VIPA 1MU8B 4WVPE 1QBNA 1O2PA 1XKBC 2ZHQH 1JIRA 1ZMNA 4NWLA 2GMTB 4JCNA 3PM3A 1SOZA 1J9CH 1H8HD 3ZZ7A 4D76A 3A85A 3P8FA 1SC8U 1AHTH 2WYJA 1LHDH 2ZGXH 2TPIZ 1BTWA 1FY5A 3A89A 4ZMAH 2KR7A 1LVBA 1NRSH 1A0JA 3SGQE 1AUTC 2FMJA 1E34B 1V2JT 1RJXB 1ZLRA 2HVXA 4CHAC 3U1JB 1Z6JH 3S0NA 1LKBA 4B6FA 4Q80A 3MWIU 1OP0A 4MNVA 2QA9E 1W12U 1QQUA 2OXSA 1XUFA 3GY8A 1DFPA 2O8LA 1ANCA 3ITIA 1THSH 3TVJB 1GI0A 4X8TH 5IYTA 3HGPA 4WY3A 1YM0A 1O2WA 1VR1H 4Y8ZA 2BDBA 3RC6A 3NWUA 4Q7XA 1D3PB 2BD8A 1EB2A 1GGDB 1GMCG 3H7OA 1SOTA 4GCHG 1G2MA 3SV7A 4NSVA 2ZPSA 1FJSA 2Y7XA 1S6FA 2QC2A 1A46H 1AU8A 1O2QA 2GVFA 3RP2A 3K6YA 2AYWA 1TNJA 2ZU5A 4ASUD 2QN5T 2XXLA 1MD7A 1CVWH 4K8BA 3ZVGA 1T4UH 4DIHH 2ZKSA 4DJZB 3NCLA 1SGNE 1KDQB 4K8YA 1EZQA 1E0FD 4MNXA 4HZHA 4X6OA 5EU8A 3LPRA 2FOCA 3LIWA 1A4WH 1ZRBA 4U32A 3BEFB 4ZAEA 7GCHG 2W6ID 3SU3A 3F0OA 4AFQA 3B9FH 1SQAA 5LPRA 1PQ7A 2VWMA 1Z6EA 1AE8H 3RU4T 1AWFH 3IITA 3SJOA 3RXFA 1YBWA 3UAIC 1V2TT 5HM2A 1PPFE 5A8XA 3M5LA 1XUKA 3BV9B 2CF8H 3GY7A 2EI7A 2R9PA 2H9TH 4FETA 1TB6H 1ANDA 3FOAA 1XUIA 2H9EH 2VWOA 5CE1A 5ETXA 5TCAA 4NIVA 1B0EA 2J92A 5EJLA 4GHTA 4DIIH 3TH4H 2ZO3H 1WU1A 1SGIB 1SGQE 3SZNA 5JYIA 2C3SA 1TE0A 3A82A 1LO6A 1ELDE 3ZV8A 1KIGH 1W10U 2AMPA 1E38B 1UJ1A 2I6QA 3TIUA 3SUFA 2FS8A 1NESE 4NFFA 2Q1JA 2C8ZB 1QCPA 1F2SE 4IN2A 1L0ZA 2XBVA 2J98A 3ZZ6A 1O3EA 1NO9H 3MHWU 2ZDKA 3HKIB 3TU7H 2A4RA 5EQRA 4HTCH 1V2LT 2CN0H 1AFQB 2ZI2H 4DGJA 3P92A 1IQHA 1WXRA 5DKMA 5T6DA 3UWJH 4MPWA 4B73A 1HJ9A 1MKXH 1GI1A 4JYVH 4WH8A 3ATLA 4Y8XA 3UR6A 3A86A 3FP8E 5LPEA 1GCTC 1NBMD 3I29A 3QTVH 1GMHF 1T31A 5LH8A 1KTTB 1DLKB 1LTOA 1TNLA 2SGEE 1HXEH 2FOGA 2WV4A 1O3FA 2ZFQH 1O31A 2H6MA 1AFEH 1C2EA 1P01A 2DUCA 2ZG0H 4YLQH 1GI4A 1FPHH 1GJDB 2BMGB 3GDUA 2AERH 4OM9A 2PWXA 3SV6A 4CH2B 1C9TA 1DWEH 5EXMA 1W13U 1GJ7B 1TPSA 3RM2H 1N8OC 1OWDA 5DP3A 3MNSA 1FIZA 2ANMH 3MH6A 3SO3A 5A8YA 1K1JA 2KCAA 3TGIE 5A0CA 5GNDA 1SGRE 1C2HA 3SJKA 2WPLS 1V6DA 4AFZA 3F9HA 1JBUH 1F92A 1ABJH 1BHXF 1SGTA 1BJUA 2Y81A 3VG8A 1ZHMA 1D3QB 3OY5U 1BOQA 1CBWB 2ZQ2A 2PKSC 1H1BA 5A2MH 1HXFH 3F2HA 3BTKE 5A0AE 1SR5C 3E8LA 2GZ7A 4NGAH 1S0RA 3A7VA 4ZHAA 2V3OH 5FPTA 6LPRA 1VGCC 2FOEA 1IQMA 1C2IA 5HKKD 1OWHA 3M37A 1QY6A 2Z9IA 3K6ZA 2P8OC 2A5KA 4ZH8A 3UNSA 2BQ6B 1C1PA 1QBOA 1MZDA 2BXUH 2YMSB 4CREA 3V0XA 2BDIA 2YOLA 2ZEBA 1PPZA 2OK5A 1AKSA 5FX6A 2FX4A 2P3TB 1EX3A 4A1VA 1GJ5H 1OS8A 2G55A 2Z9KA 4MG3A 1OWEA 5A09A 2J4IA 1FONA 1MAYA 3S9AA 1SLWB 1TX7A 2VWLA 3BTEE 3U98H 3FZZA 4B75A 1DM4B 1W0JD 1AQ7A 1A3BH 5I25A 1GJAB 3VB3A 1P0SH 1FZZA 2GCTB 1TA6A 1U6QA 3F2FA 3P70B 1SFIA 3ODDA 1O2KA 1WYKA 5EJ1A 2JJ2D 1S84A 2GJGA 2ANYA 1HAOH 2FPZA 1AWHB 1O39A 2PW8H 4K2YA 4MQAA 3SN8A 5ESTE 1PQ8A 1TMUH 1NRQH 2A7HA 1F0RA 4X2XA 1H8ED 1A5GH 1D6WA 2WSSD 3RXRA 3PB1E 3STIA 2FOFA 3SU1A 3SOSA 1AZZA 1HCGA 1UCYE 4BTIB 2ANWA 1OP8A 1W0KD 1HJAB 1ESAA 2QF0A 5L30H 1HIAA 3SGBE 4P02A 2FEQH 4J2YB 4TY6A 1G9IE 1C4V2 3RXCA 4ABEA 1YGCH 2FI4E 2QCYA 5DGJA 1C1NA 1ZHRA 2ZDAH 3U28C 1V2VT 3RXVA 1GDUA 1ACBE 2SGDE 1P8VC 1LPZB 2WV9A 3QGNB 2GV6A 3MO6A 3EA8A 3GCNA 4F49A 1CE5A 2SGQE 1O3LA 1GCDA 4JZDH 1ARCA 1EZXC 1LQEA 3A7TA 3O8RA 4HG6A 2FP7B 2PFEA 2ESTE 1OX1A 1KMHB 2IOTA 1XUHA 1QGFA 3UWIA 4TSFD 3FKSD 3BN9A 1C1RA 1OYTH 3MOCA 4XOJA 1HYLA 1IHTH 2B0FA 3E16B 4OGYA 1YPMH 1HAIH 2BY8X 1DSUA 3GCOA 4MNWA 1LHGH 2OUAA 2ZGHA 2VINA 4WH6A 3KEEA 1GHWH 4FVBA 2V6NA 4Y76A 1ABIH 3SGAE 4NCYA 2OLGA 3ATIA 2GGVB 2G52A 2Q6GA 3OSYA 4CHAB 3N7DA 2FO9A 1SGDE 1TRYA 2VIDA 4CR5A 1Z8RA 1SGEE 2TGAA 2Z3DA 3DSOA 4ZKOU 2JH5D 4NA7A 4LZ4B 1O2XA 4TWYA 1NPMA 1ZJDA 1C2KA 1QBVH 1EAUA 1DY8A 1SGFA 8ESTE 2LNCA 1DXWA 2OD3B 2P95A 4ZHMU 4AGKA 4ZHLU 3PMAB 1O5BB 2BZ6H 3QLPH 1ZTJA 3OFND 5CHAC 5JBBS 5L2ZH 3RM0H 2NU0E 3UPEA 1HFDA 1FUJA 1BRAA 4Q7ZA 3SORA 4ZUHA 4X1RU 1C1WH 2QXHA 5F8ZA 5KEDA 3RXUA 4GSOA 4LZ1H 2KAIA 2R3YA 4RT0A 3KNXA 5ABWA 4X1NU 4AG2A 2CGAA 4CR9A 5E2OA 3KCGH 1AIXH 5DP7A 5FAHA 2V35A 3TITA 2C8WB 1BBRH 5JBCS 1TGBA 4X1PU 1ANEA 1V2QT 1UHBB 4JZIA 2FXRA 4X6NA 3BTWE 1NFWA 2QY0B 5GDSH 1BRBE 1C5LH 1K2I1 1T8OA 1IQJA 4XBBA 2KZ4A 4B76A 3PROA 2I6SA 1YPJH 1HB0B 3TNSA 3C27B 1G3BA 1Y3UA 3M7TA 5DO4H 4NZQA 1EJNA 2QF4A 2DE8A 4VGCB 2BDAA 1IAUA 1BTPA 9LPRA 1FY3A 3MQKC 3M3TA 1TA2A 4CRBA 5DP4A 2ZECA 1YPHE 1CBWC 2ZU3A 4IC5A 3A80A 4E06H 2CV3A 1CT2E 1TQ0B 1HAVB 6GCHF 1GVLA 2UUJB 1OWKA 1UVSH 1DUAA 1K1OA 2F3CE 3M36A 2F9NA 5EGMA 2B5TB 3VXEH 4BAKB 1P57B 1XMNB 4WWYA 2ZDLA 3SHCH 3SJIA 5EPYA 4K5ZA 1GBIA 1W3CA 3F6UH 4H42U 1O35A 1XUGA 2VGCC 3SNEA 1DWBH 1XKAC 1P09A 4D7FA 1SLUB 3M5NA 2XC4A 5HM9A 3A83A 4XBDA 4K3JA 4BTUB 1O36A 1GCTB 3HGNA 1FX0B 1O2OA 2BY6X 4IMQA 2W7SA 3KYFA 3M5MA 5TJXA 1WOFA 6GCHG 2CXVA 3ZVDA 1GHXH 2GCTC 3OEED 1ZTKA 3RXQA 1ZPZA 1Y59T 4X0WU 3TK9A 5L2YH 1WCZA 2SGAA 1PPEE 4M7GA 1N6YA 1O2ZA 1OKXA 2J95A 2PR3A 4P00A 2AHME 1RXPA 1GBKA 1MQ5A 3STJA 3SI3H 3MU0A 3A7WA 1GI6A 1T8LA 3BIVH 3NUMA 2F9UA 1C5NH 1N8OB 1DVAH 1GHAG 2R2MB 1IHSH 4YTAA 2BQ7B 3FANA 2WPMS 3RXTA 1GG6C 2W5EA 1VITF 4JK5A 3BEUA 1TNHA 1MAXA 1C5PA 1ETRH 3SJ8A 2TBSA 2BD3A 1GBEA 2JKHA 3A88A 1A1RA 3LGTA 4A92A 2GX4A 1TBZH 4WXIA 2HRVA 2RDLA 2PKSB 3QX5H 1O3JA 2IJD1 1SKYE 1DLEA 1O34A 1A0LA 2UUFB 1W11U 2SNVA 4Y7AA 2C93B 1B7XB 1CA0C 1K28D 8KME2 3WWFA 1O2IA 1KXBA 3T5FH 2K1QA 1IQLA 3F1SB 1TX6A 1MTSA 3MH7A 6CHAC 2EA3A 1VGCB 3ZVBA 1LPGB 2TGDA 3PO1C 2P8OB 5FPSA 2G5NA 5K7RA 1GBDA 2XBXA 4Z0KA 1PPHE 3SV2H 3LDXH 1TFXA 2FI3E 1HAYB 4FUBA 5DP8A 2PGQB 1IOEA 1VJAU 3PV2A 1E1QD 1QJ6B 2BLOA 1TOCB 1ARBA 2H5CA 1QRWA 4NWKA 4UFFH 1C2DA 1Z8IB 1BRCE 3EDXB 1ZGVA 2UWOA 3SNDA 3BTFE 2FIRH 2BVRH 1CT0E 3L6PA 1Y5AT 1UTNA 3H7TA 2WPIS 3EA9A 2G8TA 5EODA 2WINI 2G00A 1QL7A 1C4Y2 2VWNA 2OBQA 1QQ4A 2G51A 2UWLA 1LVMA 3M3SA 5GCHF 1O2NA 1ELAA 2EQNA 2ZCHP 2VH0A 5BRRE 2AGEX 1T7CA 3SQHE 3S7KB 2ZGJA 2A45B 2BZAA 5FBEA 1E36B 2ZQ1A 3AK5A 3SJ9A 3BG8A 3P6ZB 4RN6A 1WSSH 5C17A 2BLVA 4OS6A 2W3IA 3BTME 3B8JA 4B2BA 2OC7A 2NU1E 3A81A 4E7NA 4KGAA 4RI0A 1RIWC 3NK8A 1FY1A 2AIQA 1GI9B 3DFLA 1KYNA 2QF5A 1VJ9U 2VB0A 3RC4A 5DG6A 4TYDA 4Q63A 3ZYEA 4HFPB 1COWD 1GVKB 2VVCA 3I78A 2ANKH 1J8AA 4Y0ZE 5GCHG 1QA0A 2J97A 1Y8TA 1L1NA 1BHXB 1UTJA 3G01A 1E79D 1ANBA 1DDJA 2ZGBH 3U69H 1YCPK 3BEIB 3Q76A 3PMJA 2BOHB 5FCKA 2P3UB 2QYIA 1GBJA 3KQCA 1NBME 2R2WU 1UTMA 2BTCE 5PTPA 2XRCA 4KKDA 4R0IA 4IS5A 5F8XA 2ZPQA 1F5LA 1OOKB 1C1VH 2ZTZA 4H4FA 4I31A 2A5IA 5DJ7A 4B2CA 1QA7A 1HNEE 2BX3A 2Y5GA 4KTSA 1K1NA 3ZZ5A 4ZXXH 3T25A 3SU5A 4IGDA 2QE7D 1EJAA 4YOGA 1BCUH 3QO6A 1GI3A 3KQEA 3RMMH 1QURH 2FODA 2XCNA 3KN2A 2F9PA 3UQVA 1UTKA 2GTBA 2OQUA 3VB4A 4I32A 4O03A 1OWJA 5KGOA 2VVVA 2HNTE 5E0JA 3LKWA 3QUMP 3RLYH 1BTYA 2J5UA 3KQ5A 5C5NA 4VGCC 1D3DB 3QN7A 5JBTA 2PSYA 1DWCH 2YMSD 1WBGB 2ZWLH 4XSKU 1L1JA 2D26C 5FXLA 1EUFA 2GT8A 1UCYK 1QB6A 1NRPH 2GKVE 2AMQA 1JIMA 1S6HA 2Z9GA 4WMEA 2ZU1A 4RSPA 4AG1A 4FUHA 3N7EA 4UONA 4X2VA 2LPRA 3AW0A 3D23A 3SU4A 4K69A 4KTCA 3S9BA 3MNCA 4IN1A 2OCVB 1ZYOA 1S85A 1AVXA 1HBTH 3KL6A 3LGUA 2Y6TA 3M61U 1DANH 1W7XH 1GPZA 1Z71A 1UW7A 4DCDA 2A2QH 4I86A 1N6XA 1QB1A 1GI2A 1S82A 1ORFA 1IQGA 1LPKB 1O37A 1ZPBA 5LGOA 1TRMA 1BTZA 5CHAB 2RCEA 1CHOF 2GZ9A 3QZQA 4MVNA 1NU9A 3SNCA 2XYAA 1HGTH 1XUJA 4UFDH 1QHRB 4ACBA 4TPIZ 1C5YB 1NC6A 4YOJA 2BHGA 2WV5A 1O5AB 1BA8B 1QL8A 1XX9A 4ISIH 3SU6A 5EW2H 1WTHD 5DP5A 4ZKNU 4CRAA 4ESTE 4UFEH 5EW1H 1NZQH 3FAOA 1C9PA 1OSSA 1P9UA 2P94A 1XM1A 3DSPA 4QT8C 3ZZ9A 1S0QA 2ZF0H 4AN7A 2BY9X 5B6OA 4ZKRU 4AYVB 2JH0D 2VIVA 3OY6U 1TONA 1LHCH 1MCTA 4JK6A 3VGCC 3O8CA 1CHOG 1X7AC 1SGPE 1ELGA 1O2UA 2BD5A 1F0TA 5E8EH 2PKAB 2V3MA 4NIWA 3BTTE 3KIDU 1CT4E 4GAWA 2PTNA 4MDSA 1NFXA 1GMHG 1OP2A 5ESBA 2PHBA 5T3HA 1PJPA 3SW2B 1KXDA 3RXAA 1MUEB 1V3XA 5I46H 1UK3A 1YY3A 3P8GA 5C0UA 1J17T 3KGPA 1BRUP 1HAXB 2VVUA 2KM0A 2O8UA 5DN6D 4GPGA 1KY9A 3LONA 3SV9A 3ZIAD 4KP0A 1O3OA 4RKOB 2OC0A 1O5CB 2Z6BD 4LXBH 2A31A 1YKTA 1C5TA 1RTLA 1NN6A 1JXPA 2F9OA 2VGCB 4D9RA 2HLCA 2OC8A 1FV9A 1LHEH 5C0TA 1GDQA 3UQOA 3OE7D 3MFJA 1O3NA 1NM6A 1QFKH 1UTPA 1MH0A 2VIWA 2JJ1D 3DSGA 1P2NA 1FN8A 2XTTB 1AB9B 1SVPA 5B6LA 3ZZ8A 3RU4D 1OHHD 4YT7H 1V2RT 2BB4A 1NFUA 5KECA 1FPCH 2XBWA 3Q77A 3GISB 1BITA 1O2LA 5EXLA 3RUOA 4LOYH 1A5HA 3LGWA 4Y0YE 3LJJA 4X6PA 4XRNA 1FMGA 2QIQA 1T4VH 1P12E 1EZUC 4Y6DA 5EJZA 3MO9A 1ESBA 1UK2A 1E1RD 1CQQA 4UDWH 1LKAA 1LVOA 3TGKE 1MTUA 1V2KT 1BJVA 1FNIA 3UOPA 1WQSA 1WV7H 3OU0A 1GG6B 1O3IA 4YLUA 1H9HE 1HDTH 2EEKA 1GI5A 2FS9A 3U1IB 1VCWA 2BD4A 2A2XH 2M5TA 1MKWK 4Z6AH 1UVTH 3JZ2B 1TALA 3A84A 1FQ3A 4JYTA 3WY8A 1ELVA 4WMDA 1D4PB 3E0NB 8LPRA 1O2YA 1KXCA 4I8KA 5C2ZA 1C2MA 4FUIA 4WXVA 2BDGA 2KCOA 5J4SA 5GXPA 2G81E 3TK6A 2ZCKP 1P9SA 4NSYA 1CA0B 4F48B 2J9NA 4X1SU 6CHAB 4ABDA 2AFQB 4AFUA 1EJMA 2ZFFH 3M35A 2GD4B 3BTGE 1ESTA 1GMDF 4ABAA 5TCCA 1DPOA 3PO1B 1P2QA 3QTOH 1FAXA 4MLFB 2ZTYA 3PMBB 1ZPCA 1O2HA 2O8WA 3R3GB 4TWWA 2D1JA 2K0QA 3GY6A 5G4BA 1SB1H 1RFNA 1O2VA 1CA8B 5CDFE 3VB7A 3RMNH 4AB8A 2ZU4A 4B6EA 2TGPZ 2BD9A 3TK5A
chains in the Genus database with same CATH topology
3GY4A 5J4QA 1SI5H 1W0YH 1K9OE 2J38A 1C2JA 1ZSLA 4FU9A 1TX8A 3LC3A 5EOKA 2R3UA 5GIBA 1HPGA 1XVMA 1EASA 2NU2E 1TBQH 4ISLA 1O30A 1TGCA 1SGCA 1YPHC 2UWPA 1A3EH 1BBRK 2V0BA 1C5MD 1PFXC 3RXMA 1JRSA 2PGBB 2BVSH 1C2FA 1L2EA 1YF4A 3MTYA 3Q3KA 1Z1JA 1EP6A 1TRNA 2EC9H 1A7SA 2PSXA 3RMOH 4A1XA 3U8TH 1BTXA 4DOQA 2AGIX 3O8BA 2WUBA 1BMMH 2XBYA 4CRCA 4NIXA 2GDEH 1A5IA 1YPKH 3EQ0H 2FZZA 1RTFB 4BOHA 1S81A 1JRTA 2ZGCA 1RIWB 4Y10E 3SQEE 3SBKA 3L3TA 3SI4H 2VIQA 2AIPA 2ZFSA 5C20A 1DITH 4AYYB 1INCA 3TJVA 2IPHA 2VIOA 1UTQA 1O32A 2QV1A 1IQIA 2C8XB 1C1MA 2GZ8A 1BTHH 2XC0A 1Z7KA 1EOLA 3LH3A 4YT6H 1DT2A 3GCHC 1O2TA 1OXGA 1ZSJA 1AVGH 3ZZ3A 4Q2KA 1P10A 2VU8E 2RA0A 4DG4A 5E2PA 3SUGA 5A8ZA 4CRGA 3HPTB 1BMAA 1TQ7B 4X8VH 1MBMA 1FN6A 1FY8E 1O3HA 2ZNKH 1FI8A 1W14U 5T6FA 1RRKA 4E7RG 2A7JA 4Y7BA 4A5TS 3KQDA 2OTVA 1GJ9B 4B71A 5FHTA 4KELA 4LK4A 4K60A 4Q7YA 1SBWA 3JZ1B 1K22H 3E1XB 2TGTA 1EAIA 1ZHPA 2ZCLP 1MQ6A 1QB9A 1F5RA 2ZP0H 1K1LA 3BSQA 5E0GA 1K1PA 5FPYA 4INKA 1O5GH 2ALPA 1MCVA 3RXEA 4I8LA 2ZFPH 5SGAE 1TNGA 1V2ST 5E0HA 1DSTA 1P2IA 1SL3A 3I77A 1O3BA 1F0SA 2PUQH 1GI7B 1XXDA 3T2NA 1GHZA 1GBHA 3LU9B 1QRXA 4OGXA 1THPB 4OS2A 3MH5A 4HI3A 4O3TA 1GL0E 5DP9A 5GPIB 3UFAA 2OP9A 3LH1A 4XFQA 5HGGA 3MMGA 3IWMA 4ABBA 1BDAA 1IQNA 1SLVB 4BAQB 3W94A 5C1UA 5EXNA 3TPIZ 1JMOH 3FFGA 1ZZZA 1DE7H 1AB9C 1XXFA 3S69A 2QF3A 3TNTA 1MD8A 4SGAE 1C5UA 1GBLA 1YPGH 2H1UA 5FX5A 2HOBA 2A5AA 1O2SA 3VFEA 2Z3CA 3AVZA 1VZQH 1TNIA 8GCHF 3GCTF 4UFGH 1ELEE 1OWIA 1DS2E 2O9QA 1BQYA 1QL9A 1HJ8A 1GBMA 3ZVEA 2H5DA 3MO3A 1LDTT 2BLWA 1ETSH 1GBTA 1MMJN 1SSXA 1BBRE 1QTFA 3P8NA 2V3HH 4AFSA 1H8IH 3D49H 5EQQA 3ZVFA 1UVPA 3VGCB 2ALVA 2R0LA 4JZ1A 1C5QA 2GT7A 1YPEH 4Y79A 1MU6B 5JB9S 1GJCB 4Y8YA 4B1TA 1GJ8B 1MBQA 1P3EA 4ZKSU 1KLTA 1JOUB 4FUFA 1NFYA 4D7GA 5C3NA 2BDHA 1MTNC 1Y3VA 4WJG2 3AAVA 1BMLA 3F68H 1O3DA 4NG9H 5JDUB 1BMNH 1W0ZU 4IW4E 3F9EA 4AORA 3GCTG 3EGKH 1C2GA 1EPTA 1UTOA 2ULLA 5LPFA 3HATH 2HALA 3T28A 4B74A 2B8OH 1LVYA 3GICB 3RXDA 4X6MA 1GL1A 1ZRKA 1UMAH 1FAKH 3C1KA 1VITG 2JH6D 3HK3B 2PTCE 2QXIA 5EPNA 2CHAB 5HXFA 2G4TA 1K1MA 3ODFA 1W7GH 2HPPH 2EI6A 2BQWB 1HRTH 5JPMH 1TPPA 1C1QA 4TY7A 5FBIA 1RGQA 1QIXB 1O33A 1B0FA 1ZOMA 4CBOA 2Y7ZA 1DX5M 1TWXB 3E90B 2NWNA 4I7YH 3RXPA 3U9AH 3PV4A 1E37B 4A1TA 3M3VA 2STAE 2SNWA 1AKSB 2BDYA 2ODQA 4XBCA 2FESH 4DW2U 1H9IE 4JZFH 1GMCF 3URCA 4GCHF 3U8OH 3K9XB 1GWAA 3D65E 2GCHF 1GHYH 3UUZA 3CS0A 2FLBH 4SGBE 2D8WA 2XWAA 4OS1A 1NT1A 2D2DA 4D9QA 3O8DA 1H4WA 3ZZCA 4JZEH 3ATMA 1T8MA 1ZMLA 3PYHA 4ABJA 3RMLH 1CHGA 2FTLE 3GYMA 2G5VA 3T27A 2Y82A 1HAZB 1Y5UT 1UVUH 2BVXH 4BAMB 3M5OA 3ZVAA 2ODYB 1GJ4H 1L1GA 4FU8A 1JWTA 3AASA 4FU7A 7GCHF 4BAOB 1O0DH 3FZDA 3GDVA 3SU0A 5JBAS 3P95A 3RXLA 2ASUB 2WPJS 1O2RA 1ELCA 2GCHG 1L4ZA 2VH6A 1UHBA 1YCPM 4K1TA 4DURA 3RXJA 3OYPA 1G3EA 1GBCA 1TMBH 1MKXK 1PPGE 1VITH 1V2PT 1HIAB 2H2ZA 1LHFH 4O97A 4GVUA 2B9LA 2FOMB 3QDZB 2ZTXA 1UO6A 1HAGE 1FLEE 1CGJE 2PUXB 5DK1A 2YNBA 3ENSB 3QWCH 3Q3XA 2P59A 4A6LA 3UOUA 1G36A 1Q2WA 4ASHA 4JMYA 2GV7A 5C5OA 4MPXA 3BIUH 4GHQA 3TJOA 3DD2H 1O3AA 3PWBA 2R0KA 1L4DA 4TPYA 3MU8A 1BZXE 4U2WA 2C90B 2A4OA 1DOJA 1AO5A 1KXFA 1O3PB 3GOVB 4KTUA 1HAVA 1O3MA 2WPHS 1HAHH 2RG3A 1Q31A 1LMWB 3K2UA 3A7ZA 4IBLH 4GLYA 5EQSA 3ZZBA 3GDSA 2XWBI 3S7HB 1EZSC 1P3CA 3V7TA 2FYRA 4BAHB 1F0UA 1TGNA 4NFEA 3GY3A 3URDA 3HKJB 7LPRA 1AI8H 1YC0A 3TH3H 3V13A 2Q6DA 1ELFA 3D62A 2J94A 2ZA5A 3NKKA 3P8OA 3DA9B 3MU1A 3MU5A 3NZIA 2Z94A 1YYY1 2A4QA 2CMYA 2OQ5A 3RXGA 1BUIA 4FUGA 4OS4A 1C5SA 3SV8A 4YESB 1TYNA 1QNJA 5CMXH 3LGVA 2Y5HA 2TIOA 4D8NA 1P2MA 3DUXH 1UTLM 2A0QB 4GUXA 4OS7A 1TGTA 1TOMH 3VXFH 3EA7A 4K1EA 2A1DB 4XE4A 1CSOE 3TJNA 2ZFTA 1YCPH 4E05H 4ABFA 2ODPA 2HWLB 3RU4E 2AS9A 1V2WT 3RXSA 3PTBA 2ZIQH 2ZHDA 4ZROA 4H6TA 1NTPA 1YLDA 5AF9H 1DXPA 1O38A 1UK4A 3T29A 4CH8B 4FUJA 3L33A 3FVFB 3A7XA 3GCHB 5H4IB 4U30A 3BTQE 1ZGIA 4Y71A 1SQOA 1FDPA 1P2JA 1C2LA 1NS3A 1Y3XA 4NZLA 2UUKB 2WPKS 2ZZUH 4WMFA 4X2YA 2ZDNA 2FI5E 5K0HA 2VNTA 3RLWH 2BM2A 3EE0B 3W95A 1SG8B 4ABIA 3Q3YA 2FX6A 1NRNH 2HPQH 1BIOA 2FOBA 1NU7B 2FOAA 4DT7B 2KAIB 2P3FH 4YZUA 1C4U2 1D9IA 2A32A 4A7IB 1EOJA 3K65B 4X1QU 2JETC 1ZJKA 3SUDA 3MNXA 1UCYH 4AB9A 4AX9H 2QXGA 3P17H 1WTGH 1P04A 1P02A 2RA3A 1GHVH 2ZDVH 1RD3B 1TPOA 4FUEA 4BANB 3V3MA 3A7YA 1AMHA 2J2UA 1Y3WA 3H5CB 1PQ5A 3MI4A 4IMZA 1ZSKA 1ETTH 4IC6A 3A8BA 1MTWA 3T26A 1SHHB 2CHAC 2P16A 5FCRA 1CGIE 2YNAA 2ZHWH 4FUCA 1C1TA 3RXOA 1O5DH 1J15A 3EAJA 1BTUA 1KXAA 1ELBA 1G3CA 1HAPH 1RTKA 3MH4A 4F4OC 1W8BH 3BG4C 1TIOA 2Y5FA 3UREA 2ZC9H 2TRMA 1O2JA 4CRDA 1TNKA 2BD2A 5C1YA 3F9GA 1Q3XA 3A8DA 1TMTH 2O8TA 2J34A 1IQEA 1ZTLA 1P03A 1GJBB 2G4UA 1EP5A 3RXIA 3PMHB 5F6MA 2QAAA 2AEIH 2GMTC 2W7UA 1P05A 3E0PB 3A87A 2ILNA 5HYOA 2PLXA 3UY9A 1GDNA 4PROA 1DWDH 1QRZA 2BD7A 4CBNA 1PPBH 3OX7U 1N1LA 5C1XA 1GVZA 1MTVA 2A4GA 2VJ1A 5C67A 3ZVCA 4I33A 2W3KA 1A2CH 3R0FA 1GBFA 1Z1IA 3AW1A 2QXJA 3PLBA 3BTDE 1KLJH 1O2GH 3LC5A 1MTNB 4ISHH 2XCFA 4X8UH 2QGRA 2IN2A 1AVWA 1SLXB 1FIWA 5DPAA 5L6NH 1DY9A 1DICA 1KDQA 3DFJA 4MTBA 3S9CA 2SFAA 4INLA 4ABGA 1C1UH 4I8GA 1HV7A 1H9LB 2Z9JA 2ZHEH 3E3TA 1GGDC 3SNAA 1TABE 2BLQA 1WAYB 1SQTA 3M7UA 1WUNH 2BDCA 1C5ZB 3FP6E 1F7ZA 3Q00A 2BXTH 2GDDA 3SHAH 3B23B 2BY5X 3GY2A 1V2UT 1FXYA 2H9HA 3DT0H 4THNH 5GWZA 2FLRH 1WQVH 3NXPA 1CO7E 1EB1H 3RXHA 1PYTC 3BF6H 1ELTA 1CU1A 3GY5A 5F8TA 1EPTB 1V2OT 3V12A 3CENA 4OS5A 1SGFG 3A8CA 2OC1A 4BNRA 1K1IA 4X8SH 3TLOA 3ZYDA 2SGPE 1V2NT 3VB5A 5AHGH 1GMDG 4BXWA 1A0HB 1YPLH 4NIYA 1P2KA 2BOKA 1Z8JB 3ATKA 3IG6B 4RKJB 3BTHE 1C5VA 1NY22 1O3CA 1GBBA 4FXGH 4AGJA 3T62A 4MPVA 2IJOB 1THRH 1PQAA 3AAUA 1MKWH 3ATWA 3QGJA 1KSNA 3DHKH 3MU4A 4HGCA 4FVDA 1TBRH 1HLTH 1HUTH 1QJ7B 3TH2H 1SGYE 1BT7A 1YLCA 2CJIA 4FUDA 3ZV9A 1TLDA 3CS7A 4UD9H 3VB6A 4R8TB 2F91A 1AY6H 2F9BH 4JYUH 3LGYA 1EXFA 3F9FA 1SPJA 4J1YA 1AFQC 1NROH 1TPAE 3UTUH 1C5WB 3A8AA 5AVDA 1RS0A 5A0BA 1VCPA 4MPUA 1GI8B 2ZU2A 3ELAH 1PPCE 2AH4X 1GJ6A 5JB8S 1K21H 2PKAA 1P2OA 1Y5BT 1F5KU 1GHBF 4I8JA 2ZDMA 2F9VA 1DUEA 2ZPRA 3M7QA 1AN1E 4K1SA 2FM2A 5AFZH 2FYQA 4O9VA 2XW9A 2F83A 1NRRH 3UNQA 1AE5A 1OYQA 2P93A 3ZZ4A 2NU3E 2Z9LA 1EKBB 7ESTE 1B5GH 2Z3EA 3SU2A 4B2AA 3SUEA 1Z8GA 2XC5A 5F03A 2ZFRH 1QR3E 3RC5A 1S5SA 4AOQA 1T32A 3KQBA 1G3DA 1EATA 3UR9A 1ZMJA 6ESTA 1S83A 4X2WA 2GP9B 1EQ9A 1GHBG 2OINA 2UUYA 5EG4A 2EI8A 5GJ4B 5IDKA 4YO9A 1SHYA 2ZHFH 2W26A 1TAWA 4NA9H 3PLKA 2HNTF 2Q6FA 3TJUA 4ISOA 3MNBA 2A7CA 1W2KH 2O8MA 4INHA 1SMFE 1FY4A 4ABHA 1BB0B 2WUCA 1LQDB 1SFQB 2PV9B 4CRFA 3OTJE 1UVOA 1G30B 4H6SB 1ZR0A 1AD8H 3PWCA 1C5RA 3UIRA 2Y80A 1AZ8A 4I8HA 3VPKA 1M9UA 1G2LA 2AMDA 2HGTH 2WYGA 1GHAF 5T6GA 3LT3A 1QJ1B 1XVOA 1EAWA 1J14A 2THFB 2AGGX 2FOHA 1CGHA 4MNYA 1EAXA 3LOXA 3FP7E 1C1SA 1P11E 4UE7H 2CF9H 1AUJA 1GBAA 3TGJE 1VCQA 1O2MA 4AZ2B 1O3KA 1LCYA 3KF2A 1ID5H 3VEQB 3N7OA 4WF8A 1T8NA 2JETB 1D6RA 2XNIA 5HMAA 1C5XB 2STBE 9ESTA 1P06A 1O5FH 4XDEA 2BX4A 8GCHG 3E6PH 1H8DH 1O3GA 3QK1A 1AGJA 2DE9A 3LJOA 1PYTD 3U8RH 1IQKA 4DVAU 1G32B 1D3TB 3HK6B 1MZAA 1HJAC 4YM9A 3E91A 3PLPA 3QZRA 3ESTA 3GYLB 5DP6A 1C5OH 2SGFE 3SNBA 3NPSA 4ZXYH 1G37A 3CP7A 2OBOA 2C8YB 2FTMA 3RXKA 1E35B 4ISNA 2NU4E 1Y3YA 3ZZDA 2FWWA 4UEHH 3RDZA 4BXSA 1KXEA 2HNTC 1V2MT 1C1OA 7KMEH 1OPHB 1KLIH 1J16A 3LGIA 3MYWA 4U01A 5AFYH 3EYDA 4Y11E 2BYAX 1KTSB 2BY7X 1EPTC 3ZZAA 3BG4B 4NA8A 4BTTB 4YOIA 4O3UA 2Z7FE 3PTNA 3RXBA 1A61H 5BPEA 1O5EH 3KHVA 3UNRA 2B7DH 2C4FH 1TGSZ 1YP9A 4DY7B 2FDAA 1IQFA 2VIPA 1MU8B 4WVPE 1QBNA 1O2PA 1XKBC 2ZHQH 1JIRA 1ZMNA 4NWLA 2GMTB 4JCNA 3PM3A 1SOZA 1J9CH 3ZZ7A 4D76A 3A85A 3P8FA 1SC8U 1AHTH 2WYJA 1LHDH 2ZGXH 2TPIZ 1BTWA 1FY5A 3A89A 4ZMAH 1LVBA 1NRSH 1A0JA 3SGQE 1AUTC 2FMJA 1E34B 1V2JT 1RJXB 1ZLRA 2HVXA 4CHAC 3U1JB 1Z6JH 3S0NA 1LKBA 4Q80A 3MWIU 1OP0A 4MNVA 2QA9E 1W12U 1QQUA 2OXSA 1XUFA 3GY8A 1DFPA 2O8LA 1ANCA 3ITIA 1THSH 3TVJB 1GI0A 4X8TH 5IYTA 3HGPA 4WY3A 1YM0A 1O2WA 1VR1H 4Y8ZA 2BDBA 3RC6A 3NWUA 4Q7XA 1D3PB 2BD8A 1EB2A 1GGDB 1GMCG 3H7OA 1SOTA 4GCHG 1G2MA 3SV7A 4NSVA 2ZPSA 1FJSA 2Y7XA 1S6FA 2QC2A 1A46H