1GDUA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
total genus 53
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gduA01
3SNAA 1O5FH 2J2UA 1B5GH 3PMJA 1MZDA 5J4SA 1BJUA 1C9TA 3EA8A 1ARBA 3GY7A 1MQ5A 2AGGX 1AWHB 4KELA 4OS7A 2ANMH 5C20A 2OD3B 1SGFA 3ZVEA 1JOUB 1O3NA 1D3QB 1GI6A 1FAKH 1ABJH 1ZLRA 3O8BA 1XUGA 4ISOA 1AFQB 4MNWA 4ABIA 1UTKA 3TIUA 2A2QH 2VIDA 3E1XB 1A7SA 4OS6A 2O9QA 1ORFA 1QB9A 1WSSH 2FTMA 3R0FA 2TPIZ 2C90B 2GCHF 2VWOA 2B9LA 1EB2A 4UDWH 1OP0A 1O2KA 4BAOB 1Q31A 4I7YH 1UJ1A 2EI6A 4ZROA 1VCQA 1TGNA 1SC8U 3W95A 4YOIA 4Y76A 1GPZA 3STJA 1GG6B 4A7IB 5ETXA 1K1NA 3SNEA 1OKXA 3EDXB 2R9PA 4AFSA 3PROA 2ZU3A 2OLGA 4HI3A 4O9VA 4JZEH 4K1EA 3RMMH 2GCTC 1XUIA 1O35A 4ISNA 4R8TB 1QFKH 1CBWB 1HV7A 1BTUA 2OBOA 4FVDA 1ANEA 1RJXB 1GI2A 3VPKA 3MO3A 2D1JA 1AD8H 2QCYA 1A0JA 1W2KH 2BX3A 3Q3YA 2P59A 3FAOA 4J1YA 1S83A 1ETSH 1LHDH 1XKBC 2HNTF 4FUFA 2OC1A 4YESB 5JDUB 3HKIB 4Y8XA 3QGJA 4IBLH 1ZJKA 5C1UA 1W0YH 2BTCE 2H2ZA 1HLTH 4Z0KA 2VVVA 1EPTC 1F0TA 1AE8H 1J17T 2OTVA 1C5RA 1V2LT 1OWHA 1FMGA 1JXPA 1YPHC 2GT8A 2KAIB 3UTUH 3QTVH 2H6MA 2WPLS 1FY8E 4NWLA 2GTBA 1RIWB 1C2MA 1O2LA 3RXMA 1YGCH 2A4RA 1A4WH 2PHBA 1NM6A 3NCLA 4Y0ZE 4DIIH 1DUAA 3SU3A 3M7QA 4K60A 3AASA 1CQQA 2FESH 4X8UH 5EQRA 2G5VA 4CBNA 4KGAA 1G3BA 1OPHB 2O8WA 2ZP0H 1SB1H 2XBXA 1SVPA 2O8UA 1O2IA 2SGQE 3MU4A 4DVAU 1W7GH 2GMTB 2QAAA 1THPB 1UTOA 2YOLA 2J4IA 3TJNA 2UWOA 3UWIA 1NN6A 4B74A 4D7FA 1O2RA 2TGAA 3SI3H 2NWNA 3FVFB 4YLQH 6GCHF 4X2VA 1TNIA 3K6ZA 2AMQA 1SOZA 3M5OA 3VB7A 3A8CA 1BQYA 3V0XA 4BOHA 2ZTXA 2ZU5A 5AVDA 3QK1A 3HGPA 1SGNE 3Q3XA 3EYDA 3SJKA 4QT8C 2PV9B 2BX4A 1EZUC 4NSVA 1GBMA 2GV6A 2BVRH 1Z1JA 3QLPH 1D3PB 1V2VT 2DE9A 1C2DA 3LT3A 4SGAE 3PMAB 2ZG0H 1SLVB 5GWZA 2PFEA 1LKAA 2VH6A 3GICB 1P0SH 2FO9A 1UK3A 3LU9B 4JZFH 1MKXH 3RXPA 1C5ZB 3MNXA 3SZNA 4AZ2B 1AFQC 1HAXB 5DP9A 5T6GA 4H6SB 1W12U 3Q76A 2SGAA 1PPCE 4ASHA 3KQEA 1OWEA 4Y71A 2XBYA 3PMBB 1F7ZA 3BTHE 4ABJA 1IQFA 1B0FA 2A31A 2UUKB 2LNCA 2OBQA 1JWTA 2G55A 1XUKA 2PSXA 3P8NA 1P2MA 3M61U 1KIGH 4XSKU 1K1IA 1GCTB 6CHAC 2GZ9A 4IMZA 3VGCB 2HALA 3QTOH 3ZYEA 3ZZ9A 4BANB 2F9PA 1AU8A 1GG6C 4MLFB 1AUJA 3VB3A 3FZDA 2BDAA 1GI7B 3SQHE 2FYQA 1FZZA 2Y82A 2IPHA 3U8OH 2FZZA 2CF9H 1LCYA 1BRAA 3VFEA 1CBWC 1PYTC 1V2OT 1O32A 3UIRA 2A5KA 2OC7A 2VWNA 3UOUA 2VIPA 3RXGA 1CGJE 4YOGA 3ZZDA 1QGFA 6LPRA 3A7YA 3I78A 1HCGA 1P8VC 2WYGA 3A81A 4GCHF 3SGAE 1W8BH 4K3JA 3Q3KA 1HAYB 3LONA 4TYDA 2FPZA 1ZMLA 4NG9H 3ZZ4A 4Y7BA 4FUGA 1DANH 1P9UA 2XWBI 3BTME 4KTCA 4BAKB 5A8XA 2VB0A 2O8TA 1HIAA 4DGJA 5H4IB 1C1NA 2FS8A 1TABE 1QIXB 1V6DA 4WWYA 1OP8A 4O3UA 1RIWC 4LZ1H 1TPPA 2Z9JA 3GY8A 2TGTA 4D9QA 4X1SU 2ZCKP 1SQOA 1CT2E 3QDZB 3BEFB 5DPAA 2D2DA 5C5NA 1PJPA 4CREA 1ESBA 1EAIA 1A5GH 1LVOA 4YT7H 4KTUA 3LGVA 4CBOA 3OYPA 2CHAB 1SSXA 3E16B 2H5DA 2CF8H 1ZSKA 3B23B 1C5SA 2FOBA 1C1RA 1ZMJA 4TPYA 2F91A 1C2JA 2ZDNA 4HZHA 1ARCA 2G5NA 1AVWA 2BZAA 2W7SA 1EOJA 1XVMA 3BTGE 1D6WA 4XFQA 1O2WA 5ABWA 1C2IA 3RUOA 4BNRA 4JCNA 3SORA 1O2TA 1K1PA 2GX4A 3SV9A 2A0QB 3M3TA 1DXWA 3UR9A 3PYHA 3O8RA 1O3OA 3KN2A 1YPJH 1G32B 1BOQA 1VITG 1K1OA 1KLJH 4Y10E 1O3KA 3LGUA 1T4VH 5EXNA 2V3OH 5IYTA 3F1SB 4JK6A 3B8JA 2QYIA 3GISB 2C8ZB 1A5HA 4AFZA 1QA0A 1C5VA 3O8DA 1C2KA 3U69H 2THFB 3T62A 4Q2KA 1F92A 3NXPA 4MVNA 1Z8JB 2NU0E 3SU1A 2XYAA 1D3DB 1VITF 1S85A 1THRH 4X6NA 5E8EH 5C67A 1GCDA 1YCPH 1RD3B 3VB5A 1QRZA 3RXQA 4WXVA 2GDDA 1DWCH 1SGQE 1NRNH 3K6YA 4LZ4B 1QNJA 1IQKA 3SU6A 1KY9A 4F4OC 3ZZ6A 1FPHH 3PTNA 2VINA 1MBMA 3QN7A 4X0WU 4I33A 4CRGA 4IW4E 1KLIH 4Y7AA 2IJOB 1GCTC 3M36A 5FPYA 1EAUA 3VGCC 1JRSA 4AGJA 1O5AB 2OCVB 2Z7FE 2ZDKA 2R2WU 2Y6TA 3NZIA 1FV9A 1NFWA 3F9FA 4WXIA 3DD2H 3LIWA 1L1JA 1XUFA 4X8VH 2BZ6H 1ZHRA 2J34A 3GY2A 2H9EH 2ILNA 1BA8B 3KQDA 4XBCA 4FUCA 1G36A 1MH0A 1O5CB 3HPTB 1ETRH 2PGBB 3DT0H 5CHAB 2OQ5A 2ZHQH 3P8FA 1NRSH 1INCA 3BN9A 1IQLA 2KAIA 1O31A 2BD3A 2SGFE 5DP6A 4AFQA 2UWPA 3S9AA 5LPRA 8GCHG 4AB9A 2QXHA 4UFEH 1GMDG 1KTTB 1C5UA 3BIUH 3GDVA 1PPZA 5T3HA 1CHOG 1E36B 1EAWA 5C1YA 1CVWH 3PO1B 4NA7A 3EA9A 1QQ4A 1Z1IA 3DHKH 4BXWA 1AWFH 4Q7XA 1BZXE 1QR3E 2ZFTA 1KYNA 5BRRE 1T8LA 2NU4E 4IGDA 1LPKB 3MO6A 3M7UA 5EPNA 3OSYA 4ISLA 3UREA 1DDJA 3M7TA 4MNXA 4O97A 4NCYA 2WPKS 5L30H 1Y5UT 4UONA 1FJSA 5HM2A 1YKTA 2ASUB 1DY9A 1FAXA 3MU5A 1BT7A 4CH8B 1T8OA 1YPHE 3TPIZ 4K1SA 3ZZ7A 1IQHA 1BRUP 3M37A 1UCYK 3K65B 1QL9A 5EW2H 1VITH 3LJOA 1HFDA 3ZVFA 1HNEE 1NC6A 2CHAC 1F0SA 3UPEA 1K22H 2CV3A 2TGDA 1FY5A 1H9LB 1IQEA 1AN1E 2FI5E 7KMEH 3TK9A 1YBWA 1O37A 1Z8GA 1GBBA 3V12A 4Z6AH 1E37B 1C2LA 1TA2A 4ABHA 1ELBA 1V2ST 1YCPM 3RXEA 1EJNA 2AMPA 2BVSH 4CRCA 3GDSA 1MTWA 5DP7A 1E0FD 1T8NA 4B71A 1S82A 3MYWA 3PMHB 5EPYA 3EA7A 4MPXA 1CA0B 2BHGA 3RDZA 4NFFA 2BQWB 1T4UH 1QBVH 1XVOA 5LH8A 1SHYA 1W11U 2BD8A 5GXPA 1KXAA 1TNGA 1D3TB 2BQ6B 4E05H 1GL1A 4MNVA 1FN8A 2O8MA 1F2SE 2ALVA 3KHVA 5FCRA 2ZU1A 4Q80A 1EKBB 3HK3B 3FP8E 2FIRH 3GY3A 2HRVA 3R3GB 1C5NH 3SJ8A 1GHAG 5TJXA 1ELFA 1SBWA 1ID5H 1SR5C 1GDQA 1TGCA 2BLOA 3ATLA 4A6LA 1O3IA 5HGGA 1NFUA 1C1MA 5L2YH 2ZFPH 1A0HB 3PLPA 3S7HB 2UUFB 1SPJA 5A09A 2AEIH 5CE1A 1V2NT 2W3KA 1GMCF 2ZGCA 1OWJA 3GYMA 2HPPH 4X6OA 4MDSA 1CE5A 1QJ7B 3ATMA 5HM9A 1GI0A 4I32A 7LPRA 2WUCA 1GHAF 2ZECA 2ZFFH 4Q7YA 3TGIE 4DG4A 1UTQA 4K69A 2PSYA 1DUEA 1SI5H 3UNRA 3SU4A 4YOJA 2Y5FA 1VJ9U 8ESTE 3SOSA 5K0HA 3ATKA 1O30A 1Z6EA 1BBRH 4AGKA 5JB9S 2PKSB 1DT2A 4KP0A 3SQEE 1AFEH 2GCHG 2XBWA 2WV5A 1AIXH 1PPHE 4FUEA 3U98H 1HJ9A 1CGHA 1O3AA 1O3EA 2Q6DA 2V35A 2G51A 2ZU2A 1WAYB 3LJJA 1S81A 3PTBA 1W7XH 2XNIA 1WTGH 3ZZAA 1YPGH 2ODQA 1Z8RA 5DJ7A 4YTAA 1BHXB 3P95A 1ZR0A 1T31A 4Y8YA 1FXYA 4CHAB 1TB6H 2W3IA 1GJ4H 2B5TB 2F3CE 4LK4A 1KLTA 1TRNA 2HNTE 4ZHMU 2B8OH 2PLXA 1TGBA 4MTBA 4U2WA 3RU4E 4Y79A 3LPRA 2JH0D 1BTYA 1MCVA 3GCNA 1P02A 2VVUA 3MU8A 2Z9KA 1GWAA 1RTKA 1L2EA 4IN2A 2ZDLA 3KGPA 1ELVA 3RU4T 4O03A 5A0AE 1O5GH 4X8TH 1E35B 2ZCHP 2PKAB 2W5EA 7GCHF 4U30A 1EZXC 2Q1JA 3TNSA 1P05A 4GVUA 3OU0A 1P09A 1ZHMA 3SUDA 1CT4E 1O2XA 1BTZA 1P12E 1QJ1B 1O3MA 1FLEE 3ELAH 4A5TS 5HMAA 1HJAB 1LO6A 2BMGB 2ZFQH 3GOVB 3GY4A 1MKXK 3T25A 2SGPE 4GPGA 1N1LA 4NFEA 2UWLA 2BY5X 1TALA 2VH0A 4TPIZ 1NTPA 2G8TA 4CR9A 3AAVA 3QO6A 4FUHA 4ZHLU 1JIRA 1SGTA 3ZVDA 1GI9B 4ZXYH 4ZKSU 2NU3E 1XMNB 1V2UT 2SGDE 2FMJA 1DLKB 1FUJA 3JZ1B 3VB4A 1JMOH 2Z3EA 3LC3A 5LGOA 5JBBS 1SGRE 4I31A 4WJG2 1A0LA 4NIXA 2CN0H 3BTTE 5AF9H 3SUFA 1MQ6A 1ZPBA 1C1VH 3IITA 1O36A 1P2NA 4D9RA 3GYLB 4CH2B 6GCHG 3T28A 3H7TA 1MCTA 1M9UA 4D8NA 4KTSA 4ABDA 3U1IB 1HUTH 1DY8A 1HYLA 1HJ8A 2OUAA 1FY4A 5FBEA 1SOTA 1J15A 4MNYA 5LPEA 1VCPA 1XXFA 1NFXA 3UQVA 4E06H 4B2CA 1H9IE 3BTWE 4ISHH 3M3VA 2HPQH 1EAXA 3RXLA 1GI5A 2XC4A 1E38B 3E0NB 5C2ZA 1GBJA 3ODDA 4Q7ZA 5DGJA 2BDIA 2C8XB 5DP3A 1BTWA 1BCUH 2BDBA 2I6SA 1JRTA 9LPRA 4IN1A 3N7OA 3UR6A 2QY0B 3SNCA 1P2IA 3EGKH 3GY5A 3TVJB 2VGCC 4GAWA 4A92A 2P8OC 1KXDA 3L33A 1PPFE 4XOJA 1TPAE 2PWXA 1T32A 1O3FA 5GDSH 3ZZCA 1P2OA 2Y81A 2GDEH 1AVXA 4CR5A 1THSH 4AOQA 1TNKA 1C5MD 1KXCA 3FFGA 4BTTB 4ISIH 2XW9A 1G37A 3G01A 3NWUA 1QURH 2Y7XA 1AKSB 1SMFE 1LKBA 1ELDE 1HAZB 3T26A 1C5TA 3GCTF 3MH7A 8LPRA 4CHAC 5JBTA 1SQTA 3NPSA 2A7JA 1YPEH 4YZUA 1TMBH 5ESTE 5FBIA 1FDPA 1PPBH 1DM4B 3UY9A 2F9NA 1A5IA 3Q00A 1AZ8A 2M5TA 1OOKB 1BJVA 3RMNH 1GI3A 4GCHG 1YLDA 2ZTZA 2NU2E 2Z94A 4UFDH 3I29A 1NU9A 4K1TA 5EQSA 4AFUA 4ZUHA 4AG1A 1BTPA 3HATH 2F83A 1TBRH 1G2MA 4XE4A 5GJ4B 1ELAA 3PLKA 1DPOA 1ACBE 4ZH8A 1GBAA 1LPZB 4AB8A 3F9EA 5JBAS 1GI8B 5FX5A 1SGFG 2VWMA 1HAVB 2ZGHA 2TBSA 1O33A 2ZHEH 1GJ8B 1F5LA 1FY3A 3UNSA 4JYVH 3TH4H 4R0IA 1BRBE 5DO4H 5JYIA 1UVSH 2EC9H 4J2YB 2ZPRA 3RXCA 3OTJE 2IN2A 4IC5A 2J38A 2JKHA 1RS0A 1NT1A 1Y3WA 1O5EH 2QV1A 2FI3E 2A7CA 4M7GA 2P3TB 2R3YA 3S7KB 1O39A 1O3GA 1YLCA 2ZTYA 5L2ZH 1K1LA 1ZSJA 1LMWB 1DSUA 3RXVA 1P2QA 1YYY1 3SN8A 3H7OA 3SGBE 2AERH 3RXOA 1PQ7A 5A2MH 2OC8A 1V3XA 4H6TA 3A82A 1JBUH 1GGDB 4GHTA 3SJOA 2PTCE 3T29A 1P2JA 4OGYA 1K9OE 2GMTC 4NA9H 3SNDA 4OS2A 5AFZH 1AB9B 4B76A 3KEEA 1O34A 2VJ1A 1FN6A 4U32A 3KCGH 1JIMA 1UO6A 2AGIX 5FXLA 3LC5A 1YPKH 1GVZA 1MD7A 3D62A 1FQ3A 4NWKA 3SBKA 1O3LA 1MTVA 3F9GA 2BLVA 2ZHFH 2OXSA 1DWEH 4UEHH 3BTQE 4X6PA 1EATA 1TGTA 4MPVA 3RU4D 1F5RA 1O3HA 2RA3A 3PM3A 4OGXA 1HAIH 4NGAH 1ZGIA 4NIWA 3TK6A 1C5PA 1LHGH 5TCCA 4OS1A 2ZIQH 1V2RT 3AAUA 5F8ZA 1BB0B 4XBBA 1A1RA 4WMDA 2PKAA 1Y59T 5CMXH 2QA9E 1EJMA 1CT0E 1D9IA 1GBKA 1DX5M 1Y5AT 2F9BH 2ZWLH 1HAGE 1TQ7B 4MPUA 1P06A 1OX1A 3EQ0H 3SJIA 3S0NA 1LPGB 3BG4B 1W3CA 2ZQ2A 3RC4A 1HXEH 2QXGA 4UFFH 1BTHH 1EUFA 4A1VA 3SV7A 4H42U 5GIBA 3MU0A 3RXSA 1C9PA 3U8RH 3LH3A 2XXLA 1ELCA 3DFJA 1GJ5H 2HGTH 1C4V2 3A7XA 1UHBB 4ZKNU 5E0JA 2Z9IA 4HGCA 4GSOA 3T27A 3S9CA 2ZZUH 4YLUA 3RXTA 3ATWA 1GDUA 1O2PA 1O3DA 2V3HH 1HAHH 2TGPZ 4ABFA 2FOCA 2BD7A 1VGCB 2BVXH 2ZCLP 4CRAA 2FYRA 2VU8E 5EXLA 1AZZA 1QBNA 3LOXA 1KXFA 3TJUA 2P3UB 1O38A 1C1SA 1BMNH 2ODYB 4RKOB 1GHVH 1O5DH 2ZPQA 1BBRE 1K21H 3AW0A 1N6YA 4D7GA 1UVUH 1TNHA 1TRMA 2BXTH 1G3DA 1PPGE 4RN6A 1AHTH 1QRXA 5E2OA 1TRYA 5PTPA 4MPWA 1TPOA 4ZXXH 1W14U 2BYAX 3TJVA 4DT7B 1UTLM 3TGJE 3DUXH 4FU8A 4FVBA 2FTLE 1D4PB 1Z71A 1XM1A 1QB6A 3NUMA 1OYTH 1N8OB 1O3BA 2STBE 3V7TA 1DICA 2VNTA 2BM2A 1G3EA 2FOEA 1D6RA 1TE0A 2H9TH 1YF4A 1Y3VA 1L1GA 1S5SA 1CO7E 4MQAA 3E3TA 1MKWK 2A1DB 1DFPA 1Q3XA 3WY8A 2XBVA 3A85A 2FOMB 1UK2A 4DW2U 1GVLA 1O3CA 1ZPZA 1TMUH 1ZHPA 2VIWA 3A84A 1EZSC 1V2KT 1BBRK 1GBIA 1BMAA 1A46H 1C5OH 2I6QA 5DK1A 3C1KA 5A0BA 4AORA 1V2MT 2GGVB 1HPGA 4BTIB 1MU6B 1NRQH 2BY6X 1AB9C 3LKWA 2WPIS 2ZEBA 3QWCH 3OY6U 1OWIA 2TIOA 4X1PU 2DUCA 3RMLH 2F9UA 3E6PH 2BLQA 4AYVB 1MAXA 5C3NA 1AKSA 1SGIB 1PQ8A 2B0FA 1H8DH 4GHQA 3QZRA 1IQNA 2A5IA 4YM9A 1TONA 4WH6A 4ABEA 2P95A 1GJ9B 1C5WB 3V13A 1IQIA 2J95A 1QTFA 3MMGA 1CHGA 1UMAH 1TMTH 2CJIA 1UTJA 4KKDA 1O2MA 1Y3XA 1UK4A 1TIOA 3ZZBA 4ZMAH 1GMHF 2AH4X 1GMCG 1XUJA 5EG4A 2W7UA 3H5CB 1FIWA 3GDUA 2AFQB 1TPSA 1TA6A 4CRBA 1O2OA 2QC2A 2J92A 2A4OA 3QGNB 1ELEE 4INKA 3ZV9A 4HFPB 1LQEA 2XC0A 1T8MA 2ZFSA 3ZVBA 3BSQA 3AW1A 1RTFB 5AHGH 5B6OA 2R0LA 2O8LA 1C5YB 1S0RA 1XXDA 2RA0A 1XKAC 2QGRA 4U01A 1O2GH 1CU1A 1ETTH 1C2GA 1LQDB 1SGEE 2FODA 3BG4C 1O2HA 2VVCA 4LXBH 2RDLA 4FU9A 3LH1A 1DVAH 1SG8B 2EEKA 4ABGA 1WU1A 2CGAA 2G52A 4ZHAA 1SGDE 1HAVA 3MO9A 1H4WA 4NIVA 4AX9H 3DFLA 3S69A 4CRDA 1NU7B 3RP2A 2JETB 1SGPE 2BQ7B 2P3FH 1W10U 1KXEA 2H1UA 4NZLA 1Y3YA 4ESTE 2WYJA 1N6XA 2ANWA 5CHAC 3ZVGA 2AIQA 3SUGA 3VEQB 5E0GA 2G4TA 2PGQB 3RXFA 3L3TA 3MNBA 1GBLA 1VGCC 1EP5A 5DP5A 3F6UH 4JZ1A 2WPJS 1FIZA 3DA9B 4O3TA 3TH3H 1A3BH 1VR1H 4IC6A 2XRCA 4FXGH 3IWMA 5F6MA 2H9HA 3PO1C 4NZQA 1IQMA 3KF2A 3MH5A 4PROA 5GCHF 4X2YA 4A1XA 1GHWH 1CA8B 1P3EA 4ZKRU 1EP6A 7GCHG 1BHXF 3RXKA 1WOFA 1QJ6B 3VXEH 3RLYH 4BAQB 5J4QA 3KNXA 1AQ7A 1J9CH 1S6FA 5DP8A 2BDCA 1RRKA 1Y3UA 1C1PA 1PQ5A 4F49A 2A4GA 1EX3A 1TOCB 1ZGVA 4JMYA 1N8OC 3E0PB 1GBTA 1ELGA 1O2VA 2FLRH 3E90B 3KQCA 4WVPE 3O8CA 3Q77A 4FU7A 1EZQA 2PUXB 3MFJA 3M3SA 2JH6D 1C2FA 3U8TH 1GBDA 2C93B 2VIOA 2FS9A 3EE0B 1C1WH 2XC5A 3A8AA 3HGNA 3ODFA 2BD9A 1WTHD 1OSSA 4GLYA 1YPMH 3LGWA 2BLWA 1W0ZU 3M5NA 3ITIA 5K7RA 2AGEX 2C3SA 3B9FH 1DWBH 1LDTT 2Y7ZA 1HAOH 1ABIH 1AO5A 2ODPA 4UFGH 1K2I1 2C8WB 3SUEA 6CHAB 1C4Y2 4FUBA 1LHFH 3K2UA 1DS2E 2WPMS 2Q6FA 1P57B 2NU1E 1T7CA 2P93A 3MNSA 2SGEE 5ESBA 5FX6A 4WY3A 2ZDVH 4X1NU 1KXBA 1B0EA 3D65E 3SV2H 2OQUA 2P16A 2WV4A 1CA0C 1SHHB 3PWBA 2ZI2H 2UUJB 1NESE 1C5LH 2PUQH 3BIVH 1S6HA 3FP7E 1K1MA 1FONA 2GV7A 1QY6A 2WINI 1TX6A 3ZVAA 3RXAA 1GVKB 1OS8A 2AS9A 5IDKA 1GI4A 1ESTA 1SFQB 1WCZA 1QCPA 1HBTH 1TWXB 4Y6DA 1J8AA 1ZPCA 2J94A 4X8SH 2TRMA 1TYNA 1UVTH 3KIDU 4DJZB 5JPMH 3A89A 5C5OA 3UQOA 1RTLA 3BTEE 1UHBA 2FEQH 4K5ZA 3SO3A 3ENSB 3QZQA 3URDA 1J14A 4BAHB 1EXFA 2DE8A 2ZO3H 3VXFH 2FOAA 1HXFH 5LPFA 1ANDA 4RSPA 3A80A 1NY22 1O3PB 1P01A 1TNLA 4B73A 3L6PA 1NRPH 3RLWH 1HRTH 1QL7A 1A3EH 2RCEA 5FAHA 4VGCB 4AN7A 5DG6A 1V2JT 2R0KA 1V2TT 5F8TA 1O5BB 5JB8S 1GJAB 2W26A 1Z6JH 3U1JB 3W94A 2JETC 3RXJA 1C1OA 2FXRA 1ZRBA 3A7VA 4B75A 3URCA 3GCTG 2PW8H 1DITH 2FLBH 1O2NA 1IOEA 3A88A 1Z7KA 2P94A 1P3CA 1GJCB 4I8KA 3ZVCA 2ZDAH 1MU8B 2PKSC 3S9BA 2FOGA 2OINA 3SGQE 3BEIB 4K2YA 1K1JA 4B2AA 1BITA 3A8BA 2BDYA 1DSTA 3U9AH 5FCKA 4ABAA 4UE7H 5GPIB 3ZV8A 1ANBA 2K1QA 1FNIA 4FUDA 2BD4A 1ZYOA 4WH8A 3SV8A 1WUNH 3A86A 1GHYH 1EOLA 2A2XH 4SGBE 4OS4A 3V3MA 3QX5H 1VJAU 4AYYB 3STIA 2BY9X 1BMMH 1SGCA 3D23A 4Y11E 2BD5A 1ELTA 2EI7A 2FP7B 2HVXA 2ZA5A 3P8OA 1NROH 4JZDH 2JH5D 1OWDA 1FI8A 1B7XB 3E8LA 1GJDB 1WV7H 2CXVA 5EU8A 1GJ7B 1BMLA 5HXFA 1QBOA 3HK6B 1AMHA 1AUTC 3MWIU 2WPHS 2Y5GA 1U6QA 1BDAA 5E2PA 1KDQB 1ZMNA 3LDXH 3HKJB 3C27B 1RFNA 3MHWU 3EAJA 2FX4A 1S84A 4IMQA 4GUXA 3SU5A 1QL8A 4OS5A 3PV4A 2XCNA 1O2YA 2BXUH 4HTCH 2QXIA 3A83A 1C1QA 3K9XB 4INHA 3RXIA 1PFXC 1LHCH 1LVMA 2G4UA 1RGQA 3P6ZB 2QF3A 4X6MA 5HYOA 3F68H 3MH4A 2ZGXH 2EI8A 2ZFRH 7ESTE 1Z8IB 1F0UA 2ZGJA 5JBCS 1MTSA 2GT7A 2Z6BD 2PR3A 1HJAC 1UTPA 3OX7U 3RXRA 3PWCA 3UWJH 1Q2WA 3NK8A 3MU1A 2HLCA 3UUZA 3GY6A 1P9SA 2AMDA 1OXGA 2HOBA 3GCHB 2PTNA 1YCPK 5L6NH 2SNWA 1V2PT 5EOKA 1ZTLA 3SJ9A 3RC5A 3LGIA 1EPTA 5EGMA 1BIOA 1H9HE 4BXSA 3P70B 1IQJA 5EODA 4BAMB 1TLDA 1IHTH 3BEUA 3SNBA 4JYUH 1QRWA 1C4U2 4TY7A 1WBGB 6ESTA 3MNCA 1WQVH 4UD9H 1XX9A 3E91A 4DURA 2A45B 3CP7A 2V6NA 2HNTC 4YT6H 2BD2A 3FZZA 5A0CA 1TGSZ 4RKJB 2Z3CA 1SLXB 2HWLB 1ANCA 3A7WA 1NPMA 5C1XA 1SGYE 1QB1A 2QIQA 4IS5A 1NS3A 1ZZZA 3SHCH 3T5FH 2BY7X 3MH6A 5A8ZA 2FX6A 1AGJA 1YPLH 1GHZA 1MTUA 1AY6H 1AE5A 1LVBA 3SW2B 3CENA 4B1TA 3KL6A 4YO9A 5I25A 3BTDE 1H8IH 1O2UA 1ZOMA 4VGCC 1HAPH 9ESTA 3JZ2B 1NFYA 1PYTD 3TU7H 3TJOA 2Q6GA 1F0RA 4DY7B 2FWWA 1GHBG 2QN5T 1OP2A 3BV9B 1V2WT 3F9HA 3BTFE 3MTYA 1WQSA 1GBFA 1GI1A 1TNJA 1SLUB 2STAE 4FUJA 1GBCA 1UVPA 2FM2A 2Z9GA 2Z3DA 1ZSLA 2FOHA 3RM0H 1P04A 4NIYA 1O2QA 4X2WA 2G81E 2Z9LA 3CS0A 3ESTA 1P10A 5DKMA 5FPSA 3I77A 2ULLA 1EJAA 4BTUB 1DWDH 1G2LA 3D49H 1GHBF 1QHRB 4WMEA 2FDAA 4ZKOU 1Y5BT 2Y80A 3RM2H 4FUIA 4MG3A 3ZZ5A 1OWKA 2GVFA 1MZAA 1ZJDA 4I8HA 1C2HA 5I46H 1Y8TA 2BB4A 1C5QA 3UOPA 3LGTA 2CMYA 2ANKH 3RXHA 1H1BA 2BOHB 3PLBA 1NO9H 1C5XB 2ZHDA 1FPCH 3IG6B 1TQ0B 3OY5U 4K8YA 1TOMH 2G00A 1YP9A 3BG8A 3PB1E 1TAWA 1TX8A 2GZ8A 1IAUA 1PQAA 1L0ZA 1UVOA 2D8WA 1SQAA 2IOTA 2WUBA 1AVGH 1HB0B 2FI4E 1GHXH 3A7TA 1O2JA 1C1UH 4CRFA 3UNQA 3RC6A 4D76A 4A1TA 1DE7H 5TCAA 3M5MA 1MTNB 4ZAEA 4B2BA 1HDTH 3ZYDA 2ZDMA 1QQUA 2Y5HA 1GJBB 5EXMA 1BUIA 4TWWA 1O3JA 1LTOA 4AG2A 1WYKA 3GCHC 3A8DA 1ESAA 2ZPSA 3T2NA 1RXPA 3ZZ3A 2GP9B 1HGTH 1P11E 1YM0A 3TNTA 1GJ6A 5AFYH 1DXPA 1DLEA 1C1TA 3ATIA 3MI4A 5FPTA 4Y8ZA 4E7NA 1L4ZA 1TFXA 2XWAA 3A87A 4X2XA 2ALPA 1UCYE 5BPEA 3TLOA 3VB6A 1XUHA 3SHAH 2B7DH 3SU0A 2ZKSA 3AVZA 1FY1A 4TWYA 3KQBA 5DP4A 2A7HA 5F03A 5F8XA 1EASA 1GDNA 2XCFA 2D26C 4TY6A 1P2KA 4DOQA 2V0BA 4ABBA 1O2ZA 2GKVE 1DOJA 1GGDC 3TH2H 1SL3A 1SLWB 1GBEA 2F9VA 1L1NA 3A7ZA 1EQ9A 1SFIA 2ZC9H 1CGIE 4Y0YE 4INLA 2H5CA 2SFAA 8GCHF 2C4FH 2A32A 3FANA 3RXDA 1LHEH 1GMDF 2EA3A 3P92A 1CHOF 2RG3A 2ZGBH 1GMHG 4NA8A 3NKKA 4XBDA 4DCDA 3MOCA 1TBQH 4I8LA 2R2MB 2YNBA 2VIVA 1S0QA 1X7AC 1CSOE 2F9OA 3ZZ8A 1MD8A 1G3CA 1OYQA 1F5KU 3RMOH 2GCTB 5G4BA 1TBZH 3BTKE 3FP6E 1BRCE 2FOFA 2C8YB 1VZQH 1MAYA 1TX7A 1AI8H 8KME2 2LPRA 1GBHA 1G9IE 1C2EA 1PPEE 1KDQA 2XTTB 4WMFA 2ZF0H 1UTMA 1J16A 1ZTJA 3SV6A 3TK5A 1VCWA 1EPTB 2YNAA 1L4DA 2ZHWH 5EQQA 1MMJN 3SI4H 1P03A 1NZQH 3UFAA 2GD4B 4NSYA 4WF8A 1QA7A 1G30B 1KSNA 1IQGA 1A61H 2ANYA 2ESTE 2AYWA 3M35A 1KTSB 1K28D 2VWLA 2ZQ1A 2BDGA 3SU2A 1MUEB 2BY8X 2A5AA 1YC0A 1IHSH 1O0DH 2ZNKH 4JZIA 4X1RU 5A8YA 3P8GA 1EB1H 4K8BA 1ZTKA 3TITA 4H4FA 2QF0A 3TGKE 5SGAE 2SNVA 5T6DA 5GCHG 2J9NA 3CS7A 1HIAB 1LVYA 1V2QT 3LGYA 4THNH 2QXJA 2OC0A 2BOKA 2UUYA 1MTNC 2ZU4A 4JK5A 4XDEA 5FHTA 4E7RG 2AIPA 5E0HA 1MBQA 2A4QA 2R3UA 3M5LA 4I8JA 3RXBA 1W13U 3GCOA 3QUMP 1A2CH 4X1QU 3P17H 1NRRH 3RXUA 2VIQA 4DIHH 1UTNA 1O2SA 4I8GA 2GZ7A 4JYTA 4LOYH 1UCYH 3BF6H 1ZRKA 1GL0E 1MKWH 1E34B 2BDHA 2VGCB 5EW1H 1BTXA 2P8OB 2OP9A 5T6FA
chains in the Genus database with same CATH superfamily
3SNAA 1O5FH 2J2UA 1B5GH 3PMJA 1MZDA 5J4SA 1BJUA 1C9TA 3EA8A 1ARBA 3GY7A 1MQ5A 3ZIAD 2AGGX 2KZ4A 1AWHB 4KELA 4OS7A 2ANMH 5C20A 2OD3B 1SGFA 3PRDA 3ZVEA 1JOUB 1O3NA 1D3QB 1GI6A 1FAKH 1ABJH 2KCPA 1YWUA 1ZLRA 3O8BA 1XUGA 4ISOA 1AFQB 4MNWA 4ABIA 1UTKA 3TIUA 2A2QH 2VIDA 4ASUD 3E1XB 1A7SA 4OS6A 2O9QA 1ORFA 1QB9A 1WSSH 2FTMA 3R0FA 2TPIZ 2C90B 2GCHF 2VWOA 2B9LA 1EB2A 4UDWH 1OP0A 1O2KA 4BAOB 1Q31A 4I7YH 1UJ1A 2EI6A 4ZROA 1VCQA 1TGNA 1SC8U 3W95A 4YOIA 4Y76A 1GPZA 3STJA 1GG6B 4A7IB 5ETXA 1K1NA 3SNEA 1OKXA 3EDXB 5FL7D 2R9PA 4AFSA 4Z1MD 3PROA 2ZU3A 2OLGA 4HI3A 2IPQX 4JZEH 4K1EA 4O9VA 3RMMH 2GCTC 1XUIA 1O35A 4ISNA 4R8TB 1QFKH 3F2HA 1CBWB 1HV7A 1BTUA 2OBOA 4FVDA 2GJGA 1ANEA 1RJXB 1GI2A 3VPKA 3MO3A 2D1JA 1YY3A 1AD8H 2QCYA 1A0JA 1W2KH 2BX3A 3Q3YA 2P59A 3FAOA 4J1YA 1S83A 2F4LA 1ETSH 1LHDH 1XKBC 2HNTF 4FUFA 2OC1A 4YESB 5JDUB 3HKIB 4Y8XA 3QGJA 4IBLH 1ZJKA 5C1UA 3KYGA 1W0YH 2BTCE 3N99A 2H2ZA 1HLTH 4Z0KA 2VVVA 1EPTC 1F0TA 1AE8H 1J17T 2OTVA 1C5RA 1V2LT 1OWHA 1FMGA 1JXPA 3FKSD 1YPHC 2GT8A 2KAIB 3UTUH 3QTVH 2H6MA 2WPLS 1FY8E 4NWLA 4ACAA 2GTBA 1RIWB 1C2MA 1O2LA 3RXMA 1YGCH 2A4RA 1A4WH 2PHBA 1NM6A 3NCLA 4Y0ZE 4DIIH 1DUAA 3SU3A 3M7QA 4K60A 3AASA 1CQQA 2FESH 1OHHD 4X8UH 5EQRA 2G5VA 4CBNA 4KGAA 1G3BA 1OPHB 2O8WA 2ZP0H 1COWD 1SB1H 2XBXA 1SVPA 2O8UA 1O2IA 2SGQE 3MU4A 4DVAU 2WHXA 1W7GH 2GMTB 2QAAA 1THPB 1UTOA 2YOLA 2J4IA 5KGOA 3TJNA 2UWOA 3UWIA 1NN6A 4B74A 4D7FA 1O2RA 2TGAA 3SI3H 2QE7D 2NWNA 3FVFB 4YLQH 6GCHF 4X2VA 1TNIA 3K6ZA 2AMQA 1SOZA 3M5OA 3VB7A 3A8CA 1BQYA 3V0XA 4BOHA 2ZTXA 2ZU5A 5AVDA 3QK1A 3HGPA 1SGNE 3Q3XA 3EYDA 3SJKA 1EFRD 4QT8C 2PV9B 2BX4A 1EZUC 4NSVA 1GBMA 2GV6A 2BVRH 1Z1JA 3QLPH 1D3PB 1V2VT 2DE9A 1C2DA 3LT3A 4SGAE 3PMAB 2ZG0H 1SLVB 5GWZA 2PFEA 1LKAA 2VH6A 3GICB 1P0SH 2FO9A 1UK3A 3LU9B 4JZFH 1MKXH 3RXPA 1C5ZB 3MNXA 3SZNA 4AZ2B 2KCAA 1AFQC 2CK3D 1HAXB 5DP9A 3OEED 5T6GA 4H6SB 1W12U 3Q76A 2SGAA 1PPCE 4ASHA 3KQEA 1OWEA 4Y71A 2XBYA 3PMBB 5CDFE 1F7ZA 3BTHE 4ABJA 1IQFA 1B0FA 2A31A 2UUKB 2LNCA 2OBQA 1JWTA 2G55A 1XUKA 2PSXA 3P8NA 1P2MA 3M61U 1H8HD 1KIGH 4XSKU 1K1IA 1GCTB 6CHAC 2GZ9A 4IMZA 3VGCB 2HALA 3QTOH 3ZYEA 3ZZ9A 4BANB 2F9PA 1AU8A 1GG6C 4MLFB 1AUJA 3VB3A 3FZDA 2BDAA 4B6FA 1GI7B 3SQHE 2FYQA 1FZZA 2Y82A 2IPHA 3U8OH 2FZZA 2CF9H 2YMSC 1LCYA 1W0JD 1BRAA 3VFEA 1CBWC 1PYTC 1V2OT 1O32A 3UIRA 2A5KA 2OC7A 2VWNA 3UOUA 2VIPA 3RXGA 1CGJE 4YOGA 3ZZDA 1QGFA 6LPRA 3A7YA 3I78A 1HCGA 1P8VC 2WYGA 3A81A 4GCHF 3SGAE 1W8BH 4K3JA 3Q3KA 1HAYB 3LONA 4TYDA 2FPZA 1ZMLA 4NG9H 3ZZ4A 4Y7BA 4FUGA 1DANH 1P9UA 2XWBI 3BTME 4KTCA 4BAKB 5A8XA 4FETA 2VB0A 2O8TA 1HIAA 4DGJA 5GNDA 5H4IB 1C1NA 2FS8A 1TABE 1QIXB 1V6DA 4WWYA 1OP8A 4O3UA 5KECA 1RIWC 4LZ1H 1TPPA 2Z9JA 3GY8A 2TGTA 4D9QA 4X1SU 2ZCKP 1SQOA 1CT2E 3QDZB 3BEFB 5DPAA 2D2DA 1UW7A 5C5NA 1PJPA 4CREA 1ESBA 1EAIA 1A5GH 1LVOA 4YT7H 4KTUA 3LGVA 4CBOA 3OYPA 2CHAB 1SSXA 3E16B 2H5DA 2CF8H 1ZSKA 3B23B 1C5SA 2FOBA 1C1RA 1ZMJA 4TPYA 4ZCNA 2J5UA 2F91A 1C2JA 2ZDNA 4HZHA 1ARCA 2G5NA 1AVWA 2BZAA 2W7SA 1EOJA 1XVMA 3BTGE 1D6WA 4XFQA 1O2WA 5ABWA 1C2IA 3WWFA 3KQ5A 3RUOA 4BNRA 4JCNA 3SORA 1O2TA 1K1PA 2GX4A 4XRNA 2A0QB 3SV9A 3M3TA 1DXWA 3UR9A 3PYHA 3O8RA 1O3OA 3KN2A 1YPJH 1G32B 1BOQA 1VITG 1K1OA 1KLJH 4Y10E 1O3KA 3LGUA 1T4VH 5EXNA 2V3OH 5IYTA 3F1SB 4JK6A 3B8JA 2QYIA 3GISB 2C8ZB 1A5HA 4AFZA 1QA0A 1C5VA 3O8DA 1C2KA 3U69H 2THFB 3T62A 4Q2KA 1F92A 3NXPA 4MVNA 1Z8JB 2NU0E 3SU1A 2XYAA 1D3DB 1VITF 1S85A 1THRH 4X6NA 5E8EH 5C67A 1GCDA 1YCPH 1RD3B 3VB5A 1QRZA 3RXQA 4WXVA 2GDDA 1DWCH 1SGQE 1NRNH 3K6YA 4LZ4B 1QNJA 1IQKA 3SU6A 1KY9A 4F4OC 3ZZ6A 1FPHH 3PTNA 2VINA 1MBMA 2KR7A 3QN7A 4X0WU 4I33A 4CRGA 4IW4E 1KLIH 3N7EA 4Y7AA 2IJOB 1GCTC 3M36A 5FPYA 1EAUA 3VGCC 1JRSA 4AGJA 1O5AB 2OCVB 2Z7FE 2ZDKA 2R2WU 2Y6TA 3NZIA 1FV9A 1NFWA 3F9FA 4WXIA 3DD2H 3LIWA 1L1JA 1XUFA 4X8VH 2BZ6H 1ZHRA 2J34A 3GY2A 2H9EH 2ILNA 1BA8B 3KQDA 4XBCA 4FUCA 1G36A 1MH0A 1O5CB 3HPTB 1ETRH 2PGBB 3DT0H 5CHAB 2OQ5A 2ZHQH 3P8FA 1NRSH 1INCA 3BN9A 1IQLA 2KAIA 1O31A 2BD3A 2SGFE 5DP6A 5HIYA 4AFQA 2UWPA 3S9AA 5LPRA 8GCHG 4AB9A 2QXHA 4UFEH 1GMDG 1KTTB 1C5UA 3BIUH 3GDVA 1PPZA 5T3HA 1CHOG 1E36B 1EAWA 5C1YA 1CVWH 3PO1B 4NA7A 3EA9A 1QQ4A 1Z1IA 3DHKH 4BXWA 1AWFH 4Q7XA 1BZXE 1QR3E 2ZFTA 1KYNA 5BRRE 1T8LA 2NU4E 4IGDA 1LPKB 3MO6A 3M7UA 5EPNA 3OSYA 3VG8A 4ISLA 3UREA 1DDJA 3M7TA 4MNXA 4O97A 4NCYA 2WPKS 5L30H 1Y5UT 4UONA 1FJSA 5HM2A 1YKTA 2ASUB 1DY9A 1FAXA 3MU5A 2VBCA 1BT7A 4CH8B 1T8OA 1YPHE 3TPIZ 4HG6A 4K1SA 3ZZ7A 1IQHA 1BRUP 3M37A 1UCYK 3K65B 1QL9A 5EW2H 1VITH 3LJOA 1HFDA 3ZVFA 1HNEE 1NC6A 2CHAC 1F0SA 3UPEA 3F3BA 1K22H 2CV3A 2TGDA 1FY5A 1H9LB 1IQEA 1AN1E 2FI5E 7KMEH 3TK9A 1WXRA 1YBWA 1O37A 1Z8GA 2XNDD 1GBBA 3V12A 4Z6AH 1E37B 1C2LA 1TA2A 4ABHA 1ELBA 2KX4A 1V2ST 1YCPM 3RXEA 1EJNA 2AMPA 2BVSH 4CRCA 3GDSA 3FN8A 1MTWA 5DP7A 2JIZD 1E0FD 1T8NA 4B71A 1S82A 3MYWA 3FO8D 3PMHB 5EPYA 3EA7A 4MPXA 1CA0B 2BHGA 3RDZA 4NFFA 2BQWB 1T4UH 1QBVH 1XVOA 5LH8A 1SHYA 1W11U 2BD8A 5GXPA 1KXAA 1TNGA 1D3TB 2BQ6B 4Q4LA 4E05H 1GL1A 4MNVA 1FN8A 2O8MA 1F2SE 2ALVA 3KHVA 5FCRA 2ZU1A 4Q80A 1EKBB 3HK3B 3FP8E 2FIRH 3GY3A 2HRVA 3R3GB 1C5NH 3SJ8A 1GHAG 5TJXA 1ELFA 1SBWA 1ID5H 1SR5C 1GDQA 1TGCA 2BLOA 3ATLA 4A6LA 5HKKD 1O3IA 5HGGA 1NFUA 1C1MA 5L2YH 2ZFPH 1A0HB 3PLPA 3S7HB 2UUFB 1SPJA 5A09A 2AEIH 5CE1A 1V2NT 2W3KA 1GMCF 2ZGCA 1OWJA 3GYMA 2HPPH 3DSPA 4X6OA 4MDSA 1CE5A 1QJ7B 3ATMA 3PRBA 5HM9A 1GI0A 4I32A 7LPRA 2WUCA 1GHAF 2ZECA 2ZFFH 4Q7YA 3TGIE 3WWBA 4DG4A 1UTQA 4K69A 2PSYA 1DUEA 1SI5H 3UNRA 3SU4A 4YOJA 2Y5FA 1VJ9U 8ESTE 3SOSA 2OK5A 5K0HA 3ATKA 1O30A 1Z6EA 1BBRH 4AGKA 5JB9S 2PKSB 1DT2A 4KP0A 3SQEE 4I86A 1W0KD 1AFEH 2GCHG 2LP6A 2XBWA 2WV5A 1AIXH 1PPHE 4FUEA 3U98H 1HJ9A 1CGHA 1O3AA 1O3EA 2Q6DA 2V35A 2G51A 2ZU2A 1WAYB 3LJJA 1S81A 3PTBA 1W7XH 2XNIA 1WTGH 3ZZAA 1YPGH 2ODQA 1Z8RA 5DJ7A 4YTAA 1BHXB 3P95A 1ZR0A 1T31A 4Y8YA 1FXYA 4CHAB 1TB6H 2W3IA 1GJ4H 2B5TB 2F3CE 4LK4A 2HVYB 1KLTA 5C94A 1TRNA 2HNTE 4ZHMU 2B8OH 2PLXA 1TGBA 2L6OA 4MTBA 4U2WA 3RU4E 4Y79A 3LPRA 2JH0D 3UB0A 1BTYA 1MCVA 3GCNA 1P02A 2VVUA 3MU8A 3SZEA 2Z9KA 1GWAA 1RTKA 1L2EA 4IN2A 2ZDLA 3KGPA 1ELVA 3RU4T 4O03A 5A0AE 1O5GH 4X8TH 1E35B 2ZCHP 2PKAB 2W5EA 7GCHF 4U30A 1EZXC 2Q1JA 3TNSA 2RDEA 1P05A 4GVUA 3OU0A 1P09A 1ZHMA 3SUDA 1CT4E 1O2XA 1BTZA 1P12E 1QJ1B 1O3MA 1FLEE 3ELAH 4A5TS 5DN6D 5HMAA 1HJAB 1LO6A 2BMGB 2ZFQH 3GOVB 3GY4A 1MKXK 3T25A 2SGPE 4GPGA 1N1LA 4NFEA 2UWLA 2PP6A 2BY5X 1TALA 2VH0A 4TPIZ 1NTPA 2G8TA 4CR9A 3AAVA 3QO6A 4FUHA 4ZHLU 1JIRA 1SGTA 3ZVDA 1GI9B 4ZXYH 4ZKSU 2NU3E 1XMNB 1V2UT 2SGDE 2FMJA 1DLKB 1FUJA 3JZ1B 3VB4A 1JMOH 2Z3EA 3LC3A 5LGOA 5JBBS 1SGRE 4I31A 4WJG2 1A0LA 4NIXA 2CN0H 3BTTE 5AF9H 3SUFA 1MQ6A 1ZPBA 1C1VH 3IITA 1O36A 1P2NA 4D9RA 3GYLB 4CH2B 6GCHG 3T28A 3H7TA 1MCTA 1M9UA 4D8NA 4KTSA 4ABDA 3U1IB 1HUTH 1DY8A 1HYLA 1HJ8A 2OUAA 1H8ED 1FY4A 5FBEA 1SOTA 1J15A 4MNYA 5LPEA 1VCPA 1XXFA 1NFXA 5F53A 4E06H 4B2CA 1H9IE 3UQVA 3BTWE 4ISHH 3M3VA 2HPQH 1EAXA 5DSFA 3RXLA 1GI5A 2XC4A 1E38B 3E0NB 5C2ZA 1GBJA 3ODDA 4Q7ZA 5DGJA 2BDIA 2C8XB 5DP3A 1BTWA 3F0OA 1BCUH 2BDBA 2I6SA 1JRTA 9LPRA 4IN1A 3N7OA 3UR6A 2QY0B 3SNCA 1P2IA 3EGKH 3GY5A 3TVJB 2VGCC 4GAWA 4A92A 2P8OC 1KXDA 3L33A 1PPFE 4XOJA 3FOAA 3OAAD 1TPAE 2IJD1 2PWXA 2JDID 1T32A 1O3FA 3F2GA 3N7DA 5GDSH 3ZZCA 1P2OA 2Y81A 5C0UA 2GDEH 1AVXA 4CR5A 1THSH 4AOQA 1TNKA 1C5MD 1KXCA 3FFGA 4BTTB 4ISIH 2XW9A 1G37A 3G01A 3NWUA 1QURH 2Y7XA 1AKSB 1SMFE 1LKBA 1ELDE 1YLNA 2WV9A 1HAZB 3T26A 1C5TA 2AHME 3GCTF 3MH7A 8LPRA 4CHAC 5JBTA 1SQTA 3NPSA 2A7JA 1YPEH 4YZUA 1TMBH 5ESTE 5FBIA 1FDPA 1PPBH 1DM4B 3UY9A 2F9NA 1A5IA 3Q00A 1AZ8A 2M5TA 1OOKB 2V7QD 1BJVA 2KCYA 3RMNH 1GI3A 4GCHG 1YLDA 2ZTZA 2NU2E 2Z94A 4UFDH 3I29A 1NU9A 4K1TA 5EQSA 4AFUA 4ZUHA 4AG1A 1BTPA 1FX0B 3HATH 2F83A 1TBRH 1G2MA 4XE4A 5GJ4B 1ELAA 3PLKA 1DPOA 1ACBE 4ZH8A 1GBAA 1LPZB 4AB8A 3F9EA 5JBAS 1GI8B 5FX5A 1SGFG 3NRLA 2VWMA 1HAVB 2ZGHA 2TBSA 1O33A 2ZHEH 1GJ8B 1F5LA 1FY3A 3UNSA 4JYVH 3TH4H 4R0IA 1BRBE 5DO4H 5JYIA 1UVSH 2EC9H 4J2YB 2ZPRA 3RXCA 3OTJE 5EJLA 2IN2A 4IC5A 2J38A 2J98B 2JKHA 1RS0A 1NT1A 1Y3WA 1O5EH 2QV1A 2FI3E 2A7CA 4M7GA 2P3TB 2R3YA 3S7KB 1O39A 1O3GA 1YLCA 2ZTYA 5L2ZH 1K1LA 1ZSJA 1E1QD 1LMWB 1DSUA 3RXVA 1P2QA 1YYY1 3SN8A 3H7OA 3SGBE 3OE7D 2AERH 3RXOA 1PQ7A 5A2MH 2OC8A 1V3XA 4H6TA 3A82A 1JBUH 1GGDB 4GHTA 3SJOA 2PTCE 3T29A 1P2JA 4OGYA 2L74A 1K9OE 2GMTC 4NA9H 3SNDA 4OS2A 5AFZH 1AB9B 4B76A 3KEEA 1O34A 2VJ1A 1FN6A 4U32A 3KCGH 1JIMA 1UO6A 2AGIX 5FXLA 3LC5A 1YPKH 1GVZA 1MD7A 3D62A 1FQ3A 4NWKA 3SBKA 1O3LA 3F0PA 1MTVA 3F9GA 2BLVA 2ZHFH 2OXSA 1DWEH 4UEHH 3BTQE 4X6PA 1EATA 1TGTA 4MPVA 3RU4D 1F5RA 1O3HA 2RA3A 3PM3A 4OGXA 1HAIH 4NGAH 1ZGIA 4NIWA 3TK6A 1C5PA 1LHGH 5TCCA 4OS1A 2ZIQH 1V2RT 3AAUA 5F8ZA 1BB0B 4XBBA 1A1RA 4WMDA 2PKAA 1Y59T 5CMXH 2QA9E 1EJMA 1CT0E 1D9IA 1GBKA 1DX5M 1Y5AT 2F9BH 2ZWLH 1HAGE 5EIYA 2QF4A 1TQ7B 4MPUA 1P06A 4RT0A 1OX1A 5C17A 3EQ0H 3SJIA 3S0NA 1LPGB 3BG4B 4F48B 1BMFD 1W3CA 2ZQ2A 3RC4A 1HXEH 2QXGA 4UFFH 1BTHH 1EUFA 4M9FA 4A1VA 3SV7A 4H42U 5GIBA 3MU0A 3RXSA 1C9PA 3U8RH 3LH3A 2XXLA 1ELCA 3DFJA 3AK5A 4FOUC 1GJ5H 2HGTH 1C4V2 3A7XA 2KM0A 1UHBB 4ZKNU 5E0JA 2Z9IA 4HGCA 4GSOA 3T27A 3S9CA 2ZZUH 4YLUA 5HIZA 3RXTA 3ATWA 1GDUA 1O2PA 1O3DA 2V3HH 1HAHH 2TGPZ 4ABFA 2FOCA 2BD7A 1VGCB 2BVXH 2ZCLP 3PV2A 4CRAA 2FYRA 2VU8E 5EXLA 1AZZA 1QBNA 3LOXA 1KXFA 3TJUA 2P3UB 1O38A 1C1SA 1BMNH 2ODYB 4RKOB 1GHVH 1O5DH 2ZPQA 1BBRE 1K21H 2KCOA 3AW0A 1N6YA 4D7GA 1UVUH 1TNHA 1TRMA 2BXTH 1G3DA 1PPGE 4RN6A 1AHTH 1QRXA 3DSOA 5E2OA 1TRYA 5PTPA 4MPWA 1TPOA 4ZXXH 1W14U 2BYAX 3TJVA 4DT7B 1UTLM 3TGJE 3DUXH 4FU8A 4FVBA 2FTLE 1D4PB 1Z71A 1XM1A 1QB6A 3NUMA 1OYTH 1N8OB 1O3BA 2STBE 3V7TA 1DICA 2VNTA 1SQRA 1G3EA 2BM2A 2FOEA 1D6RA 2V3MA 1TE0A 2H9TH 1YF4A 1Y3VA 1L1GA 1S5SA 1CO7E 4MQAA 3E3TA 1MKWK 2A1DB 1DFPA 1Q3XA 3DCLA 2XBVA 3A85A 3WY8A 2FOMB 1UK2A 4DW2U 1GVLA 1O3CA 1ZPZA 1TMUH 1ZHPA 2VIWA 3A84A 1EZSC 1V2KT 1BBRK 1GBIA 1BMAA 1A46H 1C5OH 2I6QA 5DK1A 3C1KA 5A0BA 4AORA 1V2MT 2GGVB 1HPGA 4BTIB 1MU6B 1NRQH 2BY6X 1AB9C 3LKWA 2WPIS 2ZEBA 3QWCH 3OY6U 1OWIA 2TIOA 3EE7A 4X1PU 2DUCA 3RMLH 2F9UA 3E6PH 1QZ8A 2BLQA 4AYVB 1MAXA 5C3NA 1AKSA 1SGIB 1PQ8A 2B0FA 1H8DH 2M2AA 4GHQA 3QZRA 1IQNA 2A5IA 4YM9A 1TONA 4WH6A 4ABEA 2P95A 1GJ9B 1C5WB 3V13A 1IQIA 2J95A 1QTFA 3MMGA 1CHGA 1UMAH 1TMTH 2CJIA 1UTJA 4KKDA 1O2MA 1Y3XA 1UK4A 1TIOA 3ZZBA 4ZMAH 1GMHF 2QF5A 2AH4X 1GMCG 1XUJA 5EG4A 2W7UA 3H5CB 1FIWA 3GDUA 2AFQB 1TPSA 1TA6A 4CRBA 1O2OA 2QC2A 2J92A 2A4OA 3QGNB 1ELEE 4INKA 3ZV9A 4HFPB 4AC9A 1LQEA 2XC0A 1T8MA 1VKYA 2ZFSA 3ZVBA 3BSQA 3AW1A 1RTFB 5AHGH 5B6OA 2K8IA 2R0LA 2O8LA 1C5YB 1S0RA 1XXDA 2RA0A 2K0QA 4P02A 1XKAC 2QGRA 4U01A 1O2GH 1CU1A 1ETTH 1C2GA 1LQDB 1SGEE 2FODA 3BG4C 1O2HA 2VVCA 4LXBH 2RDLA 4FU9A 3LH1A 1DVAH 3H09A 1SG8B 2EEKA 4ABGA 1WU1A 2CGAA 2G52A 4ZHAA 1SGDE 1HAVA 3MO9A 1H4WA 4NIVA 4AX9H 3DFLA 3S69A 4CRDA 1NU7B 3RP2A 2JETB 1SGPE 2BQ7B 1W10U 1KXEA 2H1UA 2P3FH 4NZLA 1Y3YA 4ESTE 2WYJA 1N6XA 2ANWA 5CHBA 5CHAC 2J98A 3ZVGA 2AIQA 3SUGA 3VEQB 5E0GA 2G4TA 2PGQB 3RXFA 3L3TA 3MNBA 1GBLA 1VGCC 1EP5A 5DP5A 3F6UH 4JZ1A 2WPJS 1FIZA 3DA9B 4O3TA 3TH3H 1A3BH 1VR1H 4IC6A 2XRCA 4FXGH 4F55A 3IWMA 5F6MA 2H9HA 3PO1C 4NZQA 1IQMA 3KF2A 3MH5A 4PROA 5GCHF 4X2YA 4A1XA 1GHWH 1CA8B 1P3EA 4ZKRU 1EP6A 7GCHG 1BHXF 3RXKA 1WOFA 1QJ6B 3VXEH 3RLYH 4BAQB 5J4QA 3WW7A 3KNXA 1AQ7A 1J9CH 1S6FA 5DP8A 2BDCA 1RRKA 1Y3UA 1C1PA 1PQ5A 4F49A 2A4GA 1EX3A 1TOCB 1ZGVA 4JMYA 4Q63A 1N8OC 3E0PB 1GBTA 1ELGA 1O2VA 2FLRH 3E90B 3KQCA 4WVPE 3O8CA 3Q77A 4FU7A 1EZQA 2PUXB 3MFJA 3M3SA 2JH6D 1C2FA 3U8TH 1GBDA 2XOKD 2C93B 2VIOA 2FS9A 3EE0B 1C1WH 2XC5A 3A8AA 3HGNA 3ODFA 1NBME 2BD9A 1WTHD 1OSSA 4GLYA 1YPMH 3LGWA 2BLWA 1W0ZU 3M5NA 3ITIA 5K7RA 2AGEX 2C3SA 3B9FH 1DWBH 1LDTT 2Y7ZA 4TT3D 1HAOH 1ABIH 1AO5A 2ODPA 4UFGH 1K2I1 2C8WB 3SUEA 6CHAB 1C4Y2 4FUBA 1LHFH 3K2UA 1DS2E 2WPMS 2Q6FA 1P57B 2NU1E 1T7CA 2P93A 3MNSA 2SGEE 5ESBA 5FX6A 4WY3A 2ZDVH 4X1NU 1KXBA 1B0EA 2YMSB 3D65E 3SV2H 2OQUA 2P16A 2WV4A 1CA0C 1SHHB 3PWBA 2ZI2H 2UUJB 3UAIC 1NESE 1C5LH 2PUQH 3BIVH 1S6HA 3FP7E 1K1MA 1FONA 2GV7A 1QY6A 2WINI 1TX6A 3ZVAA 3RXAA 1GVKB 1OS8A 2AS9A 5IDKA 1GI4A 1ESTA 1SFQB 1WCZA 1QCPA 1HBTH 1TWXB 4Y6DA 1J8AA 1ZPCA 2J94A 4X8SH 2TRMA 1TYNA 1UVTH 3KIDU 4DJZB 5JPMH 3A89A 3CNRA 5C5OA 3UQOA 1RTLA 3BTEE 1UHBA 2FEQH 4K5ZA 3SO3A 3ENSB 2LELA 3QZQA 3URDA 1J14A 3OTPA 1EXFA 4BAHB 2DE8A 2ZO3H 3VXFH 2FOAA 1HXFH 5LPFA 1ANDA 4RSPA 3A80A 1NY22 1O3PB 1P01A 1TNLA 4B73A 3L6PA 1NRPH 3RLWH 1HRTH 1QL7A 1A3EH 2RCEA 5FAHA 4VGCB 4AN7A 5DG6A 1V2JT 2R0KA 1V2TT 5F8TA 1O5BB 5JB8S 1GJAB 2W26A 1Z6JH 5EJ1A 3U1JB 3W94A 2JETC 3RXJA 1C1OA 2FXRA 1ZRBA 3A7VA 4B75A 3URCA 3GCTG 2PW8H 1DITH 4XD7D 2FLBH 1O2NA 1IOEA 3A88A 1Z7KA 2P94A 1P3CA 1GJCB 4I8KA 3ZVCA 2ZDAH 1MU8B 2PKSC 3S9BA 2FOGA 2OINA 3SGQE 2WSSD 3BEIB 4K2YA 1K1JA 4B2AA 1BITA 3A8BA 2BDYA 1DSTA 2EY4C 3U9AH 5FCKA 4ABAA 4UE7H 5GPIB 3ZV8A 1ANBA 2K1QA 1FNIA 1WDIA 4FUDA 2BD4A 1ZYOA 4WH8A 3SV8A 1WUNH 3A86A 1GHYH 1K0HA 1EOLA 2A2XH 4SGBE 4OS4A 3V3MA 3QX5H 1VJAU 4AYYB 3MQKC 3STIA 2BY9X 1BMMH 1SGCA 3D23A 4Y11E 2BD5A 1ELTA 2EI7A 2FP7B 2HVXA 2ZA5A 3P8OA 1NROH 4JZDH 2JH5D 1OWDA 1FI8A 1B7XB 3E8LA 1GJDB 1WV7H 2CXVA 5EU8A 1GJ7B 1BMLA 5HXFA 1QBOA 3HK6B 1AMHA 1AUTC 3MWIU 2WPHS 2Y5GA 1U6QA 1BDAA 5E2PA 1KDQB 1ZMNA 3LDXH 3HKJB 3C27B 1RFNA 3MHWU 3EAJA 2FX4A 1S84A 4IMQA 4GUXA 3SU5A 5C0TA 1QL8A 4OS5A 3PV4A 2XCNA 1O2YA 2BXUH 4HTCH 2QXIA 3A83A 1C1QA 1MABB 3K9XB 4INHA 3RXIA 1PFXC 1LHCH 1LVMA 2G4UA 1RGQA 3P6ZB 2QF3A 4X6MA 4DT4A 5HYOA 3F68H 3MH4A 2ZGXH 2EI8A 2ZFRH 7ESTE 1Z8IB 1F0UA 2ZGJA 5JBCS 1MTSA 2GT7A 2Z6BD 2PR3A 1HJAC 1UTPA 3OX7U 1E1RD 3RXRA 3PWCA 3UWJH 1Q2WA 3NK8A 3MU1A 2HLCA 3UUZA 3GY6A 1P9SA 2AMDA 1OXGA 2HOBA 3GCHB 2RFKC 2PTNA 1YCPK 5L6NH 2SNWA 1V2PT 5EOKA 1ZTLA 3SJ9A 3RC5A 3LGIA 1EPTA 5EGMA 1BIOA 1H9HE 4BXSA 3P70B 1IQJA 5EODA 4BAMB 1TLDA 1IHTH 3BEUA 3SNBA 4JYUH 1QRWA 1C4U2 4TY7A 1WBGB 6ESTA 3MNCA 1WQVH 2JJ1D 4UD9H 1XX9A 3E91A 4DURA 2A45B 3CP7A 2V6NA 2HNTC 4YT6H 2KFWA 2BD2A 2W6JD 3FZZA 1TGSZ 5A0CA 4RKJB 2Z3CA 1SLXB 2HWLB 1ANCA 3A7WA 1NPMA 5C1XA 1SGYE 1QB1A 2QIQA 4IS5A 1NS3A 1ZZZA 3SHCH 3T5FH 2BY7X 3MH6A 5A8ZA 2FX6A 1AGJA 1YPLH 1GHZA 1MTUA 1AY6H 1AE5A 1LVBA 3SW2B 3CENA 4B1TA 3KL6A 4YO9A 5I25A 3BTDE 1H8IH 1O2UA 1ZOMA 4VGCC 2YMSD 1HAPH 9ESTA 3JZ2B 1NFYA 1PYTD 3TU7H 3TJOA 2Q6GA 1F0RA 4DY7B 2FWWA 1GHBG 2QN5T 1OP2A 3BV9B 1V2WT 3F9HA 3BTFE 3MTYA 1WQSA 1GBFA 1GI1A 1TNJA 1SLUB 2STAE 4FUJA 1GBCA 1UVPA 2FM2A 2Z9GA 2Z3DA 3W1EA 1ZSLA 2FOHA 3RM0H 1P04A 4NIYA 1O2QA 4X2WA 2G81E 2Z9LA 3CS0A 3ESTA 1P10A 4RI0A 5DKMA 5FPSA 3I77A 2ULLA 1EJAA 4BTUB 1DWDH 4TSFD 1G2LA 3D49H 1GHBF 1QHRB 4WMEA 2FDAA 1NBMD 4ZKOU 1Y5BT 3OFND 2Y80A 3RM2H 4FUIA 4MG3A 3ZZ5A 1OWKA 2GVFA 1MZAA 1ZJDA 4I8HA 1C2HA 5I46H 1Y8TA 2F43B 2BB4A 1C5QA 3UOPA 3LGTA 2CMYA 2WPDD 2ANKH 3RXHA 1H1BA 2BOHB 3PLBA 1NO9H 1C5XB 2ZHDA 3SYJA 1FPCH 3IG6B 1TQ0B 3OY5U 4K8YA 1TOMH 2G00A 1YP9A 3BG8A 3PB1E 1TAWA 1TX8A 2GZ8A 1IAUA 1PQAA 1L0ZA 1UVOA 2D8WA 2WZQA 1SQAA 2IOTA 2WUBA 1AVGH 1HB0B 2FI4E 1GHXH 3A7TA 1O2JA 1C1UH 4CRFA 1S6LA 3UNQA 3RC6A 4D76A 4A1TA 1DE7H 3U28C 5TCAA 3M5MA 1MTNB 4ZAEA 4B2BA 1HDTH 3ZYDA 2ZDMA 1QQUA 2Y5HA 1GJBB 5EXMA 1BUIA 4TWWA 1O3JA 1LTOA 4AG2A 1WYKA 3GCHC 3A8DA 1ESAA 2ZPSA 3T2NA 1RXPA 3ZZ3A 2GP9B 1HGTH 1P11E 2W6ID 1YM0A 3TNTA 1GJ6A 5AFYH 1DXPA 4ACBA 1DLEA 1C1TA 3ATIA 3MI4A 5FPTA 4OM9A 4Y8ZA 4E7NA 3PV5A 1L4ZA 1TFXA 2XWAA 3A87A 4X2XA 2JJ2D 2ALPA 1UCYE 5BPEA 3TLOA 3VB6A 1XUHA 3SHAH 2B7DH 3SU0A 2ZKSA 3AVZA 1FY1A 4TWYA 3KQBA 5DP4A 2A7HA 5F03A 5F8XA 1EASA 1GDNA 2XCFA 2D26C 4TY6A 1P2KA 4DOQA 2V0BA 4RT1A 4ABBA 1O2ZA 2GKVE 1DOJA 1GGDC 3TH2H 1SL3A 1SLWB 1GBEA 2F9VA 1L1NA 3A7ZA 1EQ9A 1SFIA 2HLDD 2ZC9H 1CGIE 4Y0YE 4INLA 2H5CA 2SFAA 8GCHF 5EJZA 2C4FH 2A32A 3FANA 3RXDA 1LHEH 1GMDF 2EA3A 3P92A 1CHOF 2RG3A 2ZGBH 1GMHG 4NA8A 3NKKA 4XBDA 4DCDA 1SKYE 3MOCA 1TBQH 4I8LA 2R2MB 2YNBA 2VIVA 1S0QA 1X7AC 1CSOE 2F9OA 3ZZ8A 1MD8A 1G3CA 1OYQA 1F5KU 3RMOH 2GCTB 5G4BA 1TBZH 3BTKE 3FP6E 1BRCE 2FOFA 2C8YB 1VZQH 5T1VA 1MAYA 1TX7A 1AI8H 8KME2 2LPRA 1GBHA 1G9IE 4B6EA 1C2EA 1PPEE 1KDQA 3OEHD 2XTTB 4WMFA 2ZF0H 1UTMA 1J16A 1ZTJA 3SV6A 1KMHB 3TK5A 1VCWA 1EPTB 2YNAA 1L4DA 2ZHWH 5EQQA 1MMJN 3SI4H 1P03A 1NZQH 3UFAA 2GD4B 4NSYA 4WF8A 1QA7A 1G30B 1KSNA 1IQGA 1A61H 2ANYA 2ESTE 4P00A 2AYWA 3M35A 1KTSB 1K28D 2VWLA 2ZQ1A 2BDGA 3SU2A 1MUEB 2BY8X 2A5AA 1YC0A 1IHSH 1O0DH 2ZNKH 3DSGA 4JZIA 2J97A 4X1RU 5A8YA 3P8GA 5B6LA 1EB1H 4K8BA 1ZTKA 3TITA 4H4FA 2QF0A 3TGKE 5SGAE 2SNVA 5T6DA 5GCHG 5IK2D 2J9NA 3CS7A 1HIAB 1LVYA 1V2QT 3LGYA 4THNH 2QXJA 2OC0A 2BOKA 2UUYA 1MTNC 2ZU4A 4JK5A 1E79D 2EQNA 4XDEA 5FHTA 4E7RG 2AIPA 5E0HA 3F2FA 1MBQA 2A4QA 3GS9A 3KYFA 2R3UA 3M5LA 4I8JA 3RXBA 1W13U 3GCOA 3QUMP 1A2CH 4X1QU 3P17H 1NRRH 3RXUA 2VIQA 5KEDA 4DIHH 1UTNA 1O2SA 4I8GA 2GZ7A 4JYTA 4YXWD 4LOYH 1UCYH 3BF6H 1ZRKA 1GL0E 1MKWH 1E34B 2BDHA 2VGCB 5EW1H 1BTXA 2P8OB 2OP9A 5T6FA
chains in the Genus database with same CATH topology
3SNAA 1O5FH 2J2UA 1B5GH 3PMJA 1MZDA 5J4SA 1BJUA 1C9TA 3EA8A 1ARBA 3GY7A 1MQ5A 2AGGX 1AWHB 4KELA 4OS7A 2ANMH 5C20A 2OD3B 1SGFA 3ZVEA 1JOUB 1O3NA 1D3QB 1GI6A 1FAKH 1ABJH 1ZLRA 3O8BA 1XUGA 4ISOA 1AFQB 4MNWA 4ABIA 1UTKA 3TIUA 2A2QH 2VIDA 3E1XB 1A7SA 4OS6A 2O9QA 1ORFA 1QB9A 1WSSH 2FTMA 3R0FA 2TPIZ 2C90B 2GCHF 2VWOA 2B9LA 1EB2A 4UDWH 1OP0A 1O2KA 4BAOB 1Q31A 4I7YH 1UJ1A 2EI6A 4ZROA 1VCQA 1TGNA 1SC8U 3W95A 4YOIA 4Y76A 1GPZA 3STJA 1GG6B 4A7IB 5ETXA 1K1NA 3SNEA 1OKXA 3EDXB 2R9PA 4AFSA 3PROA 2ZU3A 2OLGA 4HI3A 4O9VA 4JZEH 4K1EA 3RMMH 2GCTC 1XUIA 1O35A 4ISNA 4R8TB 1QFKH 1CBWB 1HV7A 1BTUA 2OBOA 4FVDA 1ANEA 1RJXB 1GI2A 3VPKA 3MO3A 2D1JA 1AD8H 2QCYA 1A0JA 1W2KH 2BX3A 3Q3YA 2P59A 3FAOA 4J1YA 1S83A 1ETSH 1LHDH 1XKBC 2HNTF 4FUFA 2OC1A 4YESB 5JDUB 3HKIB 4Y8XA 3QGJA 4IBLH 1ZJKA 5C1UA 1W0YH 2BTCE 2H2ZA 1HLTH 4Z0KA 2VVVA 1EPTC 1F0TA 1AE8H 1J17T 2OTVA 1C5RA 1V2LT 1OWHA 1FMGA 1JXPA 1YPHC 2GT8A 2KAIB 3UTUH 3QTVH 2H6MA 2WPLS 1FY8E 4NWLA 2GTBA 1RIWB 1C2MA 1O2LA 3RXMA 1YGCH 2A4RA 1A4WH 2PHBA 1NM6A 3NCLA 4Y0ZE 4DIIH 1DUAA 3SU3A 3M7QA 4K60A 3AASA 1CQQA 2FESH 4X8UH 5EQRA 2G5VA 4CBNA 4KGAA 1G3BA 1OPHB 2O8WA 2ZP0H 1SB1H 2XBXA 1SVPA 2O8UA 1O2IA 2SGQE 3MU4A 4DVAU 1W7GH 2GMTB 2QAAA 1THPB 1UTOA 2YOLA 2J4IA 3TJNA 2UWOA 3UWIA 1NN6A 4B74A 4D7FA 1O2RA 2TGAA 3SI3H 2NWNA 3FVFB 4YLQH 6GCHF 4X2VA 1TNIA 3K6ZA 2AMQA 1SOZA 3M5OA 3VB7A 3A8CA 1BQYA 3V0XA 4BOHA 2ZTXA 2ZU5A 5AVDA 3QK1A 3HGPA 1SGNE 3Q3XA 3EYDA 3SJKA 4QT8C 2PV9B 2BX4A 1EZUC 4NSVA 1GBMA 2GV6A 2BVRH 1Z1JA 3QLPH 1D3PB 1V2VT 2DE9A 1C2DA 3LT3A 4SGAE 3PMAB 2ZG0H 1SLVB 5GWZA 2PFEA 1LKAA 2VH6A 3GICB 1P0SH 2FO9A 1UK3A 3LU9B 4JZFH 1MKXH 3RXPA 1C5ZB 3MNXA 3SZNA 4AZ2B 1AFQC 1HAXB 5DP9A 5T6GA 4H6SB 1W12U 3Q76A 2SGAA 1PPCE 4ASHA 3KQEA 1OWEA 4Y71A 2XBYA 3PMBB 1F7ZA 3BTHE 4ABJA 1IQFA 1B0FA 2A31A 2UUKB 2LNCA 2OBQA 1JWTA 2G55A 1XUKA 2PSXA 3P8NA 1P2MA 3M61U 1KIGH 4XSKU 1K1IA 1GCTB 6CHAC 2GZ9A 4IMZA 3VGCB 2HALA 3QTOH 3ZYEA 3ZZ9A 4BANB 2F9PA 1AU8A 1GG6C 4MLFB 1AUJA 3VB3A 3FZDA 2BDAA 1GI7B 3SQHE 2FYQA 1FZZA 2Y82A 2IPHA 3U8OH 2FZZA 2CF9H 1LCYA 1BRAA 3VFEA 1CBWC 1PYTC 1V2OT 1O32A 3UIRA 2A5KA 2OC7A 2VWNA 3UOUA 2VIPA 3RXGA 1CGJE 4YOGA 3ZZDA 1QGFA 6LPRA 3A7YA 3I78A 1HCGA 1P8VC 2WYGA 3A81A 4GCHF 3SGAE 1W8BH 4K3JA 3Q3KA 1HAYB 3LONA 4TYDA 2FPZA 1ZMLA 4NG9H 3ZZ4A 4Y7BA 4FUGA 1DANH 1P9UA 2XWBI 3BTME 4KTCA 4BAKB 5A8XA 2VB0A 2O8TA 1HIAA 4DGJA 5H4IB 1C1NA 2FS8A 1TABE 1QIXB 1V6DA 4WWYA 1OP8A 4O3UA 1RIWC 4LZ1H 1TPPA 2Z9JA 3GY8A 2TGTA 4D9QA 4X1SU 2ZCKP 1SQOA 1CT2E 3QDZB 3BEFB 5DPAA 2D2DA 5C5NA 1PJPA 4CREA 1ESBA 1EAIA 1A5GH 1LVOA 4YT7H 4KTUA 3LGVA 4CBOA 3OYPA 2CHAB 1SSXA 3E16B 2H5DA 2CF8H 1ZSKA 3B23B 1C5SA 2FOBA 1C1RA 1ZMJA 4TPYA 2F91A 1C2JA 2ZDNA 4HZHA 1ARCA 2G5NA 1AVWA 2BZAA 2W7SA 1EOJA 1XVMA 3BTGE 1D6WA 4XFQA 1O2WA 5ABWA 1C2IA 3RUOA 4BNRA 4JCNA 3SORA 1O2TA 1K1PA 2GX4A 3SV9A 2A0QB 3M3TA 1DXWA 3UR9A 3PYHA 3O8RA 1O3OA 3KN2A 1YPJH 1G32B 1BOQA 1VITG 1K1OA 1KLJH 4Y10E 1O3KA 3LGUA 1T4VH 5EXNA 2V3OH 5IYTA 3F1SB 4JK6A 3B8JA 2QYIA 3GISB 2C8ZB 1A5HA 4AFZA 1QA0A 1C5VA 3O8DA 1C2KA 3U69H 2THFB 3T62A 4Q2KA 1F92A 3NXPA 4MVNA 1Z8JB 2NU0E 3SU1A 2XYAA 1D3DB 1VITF 1S85A 1THRH 4X6NA 5E8EH 5C67A 1GCDA 1YCPH 1RD3B 3VB5A 1QRZA 3RXQA 4WXVA 2GDDA 1DWCH 1SGQE 1NRNH 3K6YA 4LZ4B 1QNJA 1IQKA 3SU6A 1KY9A 4F4OC 3ZZ6A 1FPHH 3PTNA 2VINA 1MBMA 3QN7A 4X0WU 4I33A 4CRGA 4IW4E 1KLIH 4Y7AA 2IJOB 1GCTC 3M36A 5FPYA 1EAUA 3VGCC 1JRSA 4AGJA 1O5AB 2OCVB 2Z7FE 2ZDKA 2R2WU 2Y6TA 3NZIA 1FV9A 1NFWA 3F9FA 4WXIA 3DD2H 3LIWA 1L1JA 1XUFA 4X8VH 2BZ6H 1ZHRA 2J34A 3GY2A 2H9EH 2ILNA 1BA8B 3KQDA 4XBCA 4FUCA 1G36A 1MH0A 1O5CB 3HPTB 1ETRH 2PGBB 3DT0H 5CHAB 2OQ5A 2ZHQH 3P8FA 1NRSH 1INCA 3BN9A 1IQLA 2KAIA 1O31A 2BD3A 2SGFE 5DP6A 4AFQA 2UWPA 3S9AA 5LPRA 8GCHG 4AB9A 2QXHA 4UFEH 1GMDG 1KTTB 1C5UA 3BIUH 3GDVA 1PPZA 5T3HA 1CHOG 1E36B 1EAWA 5C1YA 1CVWH 3PO1B 4NA7A 3EA9A 1QQ4A 1Z1IA 3DHKH 4BXWA 1AWFH 4Q7XA 1BZXE 1QR3E 2ZFTA 1KYNA 5BRRE 1T8LA 2NU4E 4IGDA 1LPKB 3MO6A 3M7UA 5EPNA 3OSYA 4ISLA 3UREA 1DDJA 3M7TA 4MNXA 4O97A 4NCYA 2WPKS 5L30H 1Y5UT 4UONA 1FJSA 5HM2A 1YKTA 2ASUB 1DY9A 1FAXA 3MU5A 1BT7A 4CH8B 1T8OA 1YPHE 3TPIZ 4K1SA 3ZZ7A 1IQHA 1BRUP 3M37A 1UCYK 3K65B 1QL9A 5EW2H 1VITH 3LJOA 1HFDA 3ZVFA 1HNEE 1NC6A 2CHAC 1F0SA 3UPEA 1K22H 2CV3A 2TGDA 1FY5A 1H9LB 1IQEA 1AN1E 2FI5E 7KMEH 3TK9A 1YBWA 1O37A 1Z8GA 1GBBA 3V12A 4Z6AH 1E37B 1C2LA 1TA2A 4ABHA 1ELBA 1V2ST 1YCPM 3RXEA 1EJNA 2AMPA 2BVSH 4CRCA 3GDSA 1MTWA 5DP7A 1E0FD 1T8NA 4B71A 1S82A 3MYWA 3PMHB 5EPYA 3EA7A 4MPXA 1CA0B 2BHGA 3RDZA 4NFFA 2BQWB 1T4UH 1QBVH 1XVOA 5LH8A 1SHYA 1W11U 2BD8A 5GXPA 1KXAA 1TNGA 1D3TB 2BQ6B 4E05H 1GL1A 4MNVA 1FN8A 2O8MA 1F2SE 2ALVA 3KHVA 5FCRA 2ZU1A 4Q80A 1EKBB 3HK3B 3FP8E 2FIRH 3GY3A 2HRVA 3R3GB 1C5NH 3SJ8A 1GHAG 5TJXA 1ELFA 1SBWA 1ID5H 1SR5C 1GDQA 1TGCA 2BLOA 3ATLA 4A6LA 1O3IA 5HGGA 1NFUA 1C1MA 5L2YH 2ZFPH 1A0HB 3PLPA 3S7HB 2UUFB 1SPJA 5A09A 2AEIH 5CE1A 1V2NT 2W3KA 1GMCF 2ZGCA 1OWJA 3GYMA 2HPPH 4X6OA 4MDSA 1CE5A 1QJ7B 3ATMA 5HM9A 1GI0A 4I32A 7LPRA 2WUCA 1GHAF 2ZECA 2ZFFH 4Q7YA 3TGIE 4DG4A 1UTQA 4K69A 2PSYA 1DUEA 1SI5H 3UNRA 3SU4A 4YOJA 2Y5FA 1VJ9U 8ESTE 3SOSA 5K0HA 3ATKA 1O30A 1Z6EA 1BBRH 4AGKA 5JB9S 2PKSB 1DT2A 4KP0A 3SQEE 1AFEH 2GCHG 2XBWA 2WV5A 1AIXH 1PPHE 4FUEA 3U98H 1HJ9A 1CGHA 1O3AA 1O3EA 2Q6DA 2V35A 2G51A 2ZU2A 1WAYB 3LJJA 1S81A 3PTBA 1W7XH 2XNIA 1WTGH 3ZZAA 1YPGH 2ODQA 1Z8RA 5DJ7A 4YTAA 1BHXB 3P95A 1ZR0A 1T31A 4Y8YA 1FXYA 4CHAB 1TB6H 2W3IA 1GJ4H 2B5TB 2F3CE 4LK4A 1KLTA 1TRNA 2HNTE 4ZHMU 2B8OH 2PLXA 1TGBA 4MTBA 4U2WA 3RU4E 4Y79A 3LPRA 2JH0D 1BTYA 1MCVA 3GCNA 1P02A 2VVUA 3MU8A 2Z9KA 1GWAA 1RTKA 1L2EA 4IN2A 2ZDLA 3KGPA 1ELVA 3RU4T 4O03A 5A0AE 1O5GH 4X8TH 1E35B 2ZCHP 2PKAB 2W5EA 7GCHF 4U30A 1EZXC 2Q1JA 3TNSA 1P05A 4GVUA 3OU0A 1P09A 1ZHMA 3SUDA 1CT4E 1O2XA 1BTZA 1P12E 1QJ1B 1O3MA 1FLEE 3ELAH 4A5TS 5HMAA 1HJAB 1LO6A 2BMGB 2ZFQH 3GOVB 3GY4A 1MKXK 3T25A 2SGPE 4GPGA 1N1LA 4NFEA 2UWLA 2BY5X 1TALA 2VH0A 4TPIZ 1NTPA 2G8TA 4CR9A 3AAVA 3QO6A 4FUHA 4ZHLU 1JIRA 1SGTA 3ZVDA 1GI9B 4ZXYH 4ZKSU 2NU3E 1XMNB 1V2UT 2SGDE 2FMJA 1DLKB 1FUJA 3JZ1B 3VB4A 1JMOH 2Z3EA 3LC3A 5LGOA 5JBBS 1SGRE 4I31A 4WJG2 1A0LA 4NIXA 2CN0H 3BTTE 5AF9H 3SUFA 1MQ6A 1ZPBA 1C1VH 3IITA 1O36A 1P2NA 4D9RA 3GYLB 4CH2B 6GCHG 3T28A 3H7TA 1MCTA 1M9UA 4D8NA 4KTSA 4ABDA 3U1IB 1HUTH 1DY8A 1HYLA 1HJ8A 2OUAA 1FY4A 5FBEA 1SOTA 1J15A 4MNYA 5LPEA 1VCPA 1XXFA 1NFXA 3UQVA 4E06H 4B2CA 1H9IE 3BTWE 4ISHH 3M3VA 2HPQH 1EAXA 3RXLA 1GI5A 2XC4A 1E38B 3E0NB 5C2ZA 1GBJA 3ODDA 4Q7ZA 5DGJA 2BDIA 2C8XB 5DP3A 1BTWA 1BCUH 2BDBA 2I6SA 1JRTA 9LPRA 4IN1A 3N7OA 3UR6A 2QY0B 3SNCA 1P2IA 3EGKH 3GY5A 3TVJB 2VGCC 4GAWA 4A92A 2P8OC 1KXDA 3L33A 1PPFE 4XOJA 1TPAE 2PWXA 1T32A 1O3FA 5GDSH 3ZZCA 1P2OA 2Y81A 2GDEH 1AVXA 4CR5A 1THSH 4AOQA 1TNKA 1C5MD 1KXCA 3FFGA 4BTTB 4ISIH 2XW9A 1G37A 3G01A 3NWUA 1QURH 2Y7XA 1AKSB 1SMFE 1LKBA 1ELDE 1HAZB 3T26A 1C5TA 3GCTF 3MH7A 8LPRA 4CHAC 5JBTA 1SQTA 3NPSA 2A7JA 1YPEH 4YZUA 1TMBH 5ESTE 5FBIA 1FDPA 1PPBH 1DM4B 3UY9A 2F9NA 1A5IA 3Q00A 1AZ8A 2M5TA 1OOKB 1BJVA 3RMNH 1GI3A 4GCHG 1YLDA 2ZTZA 2NU2E 2Z94A 4UFDH 3I29A 1NU9A 4K1TA 5EQSA 4AFUA 4ZUHA 4AG1A 1BTPA 3HATH 2F83A 1TBRH 1G2MA 4XE4A 5GJ4B 1ELAA 3PLKA 1DPOA 1ACBE 4ZH8A 1GBAA 1LPZB 4AB8A 3F9EA 5JBAS 1GI8B 5FX5A 1SGFG 2VWMA 1HAVB 2ZGHA 2TBSA 1O33A 2ZHEH 1GJ8B 1F5LA 1FY3A 3UNSA 4JYVH 3TH4H 4R0IA 1BRBE 5DO4H 5JYIA 1UVSH 2EC9H 4J2YB 2ZPRA 3RXCA 3OTJE 2IN2A 4IC5A 2J38A 2JKHA 1RS0A 1NT1A 1Y3WA 1O5EH 2QV1A 2FI3E 2A7CA 4M7GA 2P3TB 2R3YA 3S7KB 1O39A 1O3GA 1YLCA 2ZTYA 5L2ZH 1K1LA 1ZSJA 1LMWB 1DSUA 3RXVA 1P2QA 1YYY1 3SN8A 3H7OA 3SGBE 2AERH 3RXOA 1PQ7A 5A2MH 2OC8A 1V3XA 4H6TA 3A82A 1JBUH 1GGDB 4GHTA 3SJOA 2PTCE 3T29A 1P2JA 4OGYA 1K9OE 2GMTC 4NA9H 3SNDA 4OS2A 5AFZH 1AB9B 4B76A 3KEEA 1O34A 2VJ1A 1FN6A 4U32A 3KCGH 1JIMA 1UO6A 2AGIX 5FXLA 3LC5A 1YPKH 1GVZA 1MD7A 3D62A 1FQ3A 4NWKA 3SBKA 1O3LA 1MTVA 3F9GA 2BLVA 2ZHFH 2OXSA 1DWEH 4UEHH 3BTQE 4X6PA 1EATA 1TGTA 4MPVA 3RU4D 1F5RA 1O3HA 2RA3A 3PM3A 4OGXA 1HAIH 4NGAH