1GDUA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gduA01
2K1QA 2J38A 2O8UA 1WOFA 3FZDA 1NPMA 2JH6D 1NRSH 1EOJA 1PPCE 2OTVA 2XWBI 1GHYH 3LU9B 1UK4A 4WH8A 1Z1JA 4ISIH 2PTCE 5FCKA 4AGJA 1W10U 4TYDA 2RCEA 1AHTH 1V2TT 2AERH 4UE7H 2QAAA 1QA7A 2FOFA 1TX6A 3GY2A 1EAUA 1IQIA 2P93A 5BPEA 4B2AA 3P6ZB 1LQEA 2AIQA 4THNH 3P8GA 1TBQH 4J2YB 3BTQE 3SU5A 4YOIA 2VNTA 1CE5A 3RDZA 3RXDA 3GY8A 3K65B 2UWLA 3RXRA 1V2ST 2G8TA 4FUHA 3OY5U 3EDXB 3TK6A 1O2NA 1YPHC 4D7GA 3MO9A 4NGAH 3P92A 4TY6A 5AHGH 3S9BA 1P2QA 1BBRK 3NCLA 3OX7U 3H5CB 3QTOH 1H9HE 2HLCA 4F49A 1TOMH 1FUJA 4ZMAH 1CBWC 2SNWA 1LDTT 1T4VH 2W7UA 1FJSA 1HAYB 1TQ0B 3ZZ9A 2PUXB 6ESTA 5A09A 5EOKA 1PQ7A 3K6YA 3JZ2B 2VJ1A 1THRH 1P8VC 5HXFA 2SNVA 3PTNA 1GVZA 3VB3A 2QGRA 5HMAA 2NU1E 2BOHB 1CHOF 1UTKA 4X2YA 1O5AB 3QZRA 1ZSJA 2Y7XA 2XBXA 3TJVA 1HAIH 2CMYA 2GTBA 4IW4E 5E8EH 4WMFA 1GWAA 2FMJA 3E16B 4OS1A 1BTYA 1LVMA 1ZZZA 5DP8A 2CF8H 1GG6C 4X2VA 4BAKB 1F0UA 1QGFA 3NWUA 2DUCA 2AGGX 1UK2A 2Q6FA 4I31A 4ISHH 3A86A 1MD8A 1GHBG 1W11U 3RXIA 3V3MA 1O3OA 3S0NA 1S81A 5C1YA 3KNXA 5EQQA 4AFUA 1FIWA 4QT8C 1GMDG 1JOUB 2WV4A 4A1TA 1AUJA 3FZZA 2BD2A 5EXNA 3ATKA 3F9GA 4DGJA 1TA6A 2DE8A 1NT1A 2ZI2H 1EB1H 4B75A 2ZDNA 2OQUA 4B74A 1AB9C 3WY8A 3E8LA 1FNIA 1SB1H 4BOHA 2AS9A 3RLYH 1C1QA 4X1RU 1NFWA 2HNTE 1LVBA 3UPEA 3E3TA 2O8WA 4ZXYH 2Z3EA 1C5YB 2Z3DA 1TX8A 1TGNA 3U9AH 1ANBA 3UQOA 2GCTC 5EODA 4X8SH 1VCWA 3FP7E 3SUDA 2CV3A 6GCHF 2FS9A 1BA8B 6LPRA 4A6LA 1O2JA 4FUCA 1PYTD 1P2MA 1TONA 4XE4A 3TIUA 1MKWH 1LPZB 1HAHH 5TCAA 4GCHG 1G3CA 4BTIB 1SL3A 3A80A 3QGJA 5JB8S 1VITG 3KF2A 1QNJA 1BITA 5DP4A 1P9SA 1L4ZA 2WPHS 2ILNA 2Z9LA 5JPMH 5K0HA 3K2UA 2EI8A 2ZHQH 1O5BB 1FY8E 2AMQA 1O2TA 3RXLA 1ZMNA 2BD4A 1WQSA 5A0AE 2SGAA 1L2EA 1JWTA 1O2IA 2J94A 1S82A 1ZHMA 5DPAA 1CT4E 1BCUH 2ZU2A 7GCHF 2R0KA 2GD4B 4MQAA 1C5PA 1GVLA 4AORA 4X6PA 2FI3E 1SG8B 2ESTE 1A61H 1D6WA 2TGDA 3NKKA 3G01A 1O2XA 2ZDLA 1BB0B 2THFB 3GOVB 2ZHDA 2R2MB 2OP9A 4YOJA 2A7HA 4ZKRU 5EW2H 2DE9A 1TNGA 1XUKA 1G37A 2Z94A 4FU7A 1MKWK 3MTYA 3ZVGA 4CRGA 2ZGCA 2ODYB 3RM0H 5F8XA 1KDQA 3TLOA 1FPCH 3OU0A 4NIYA 4ASHA 3RXOA 1BTUA 4YM9A 1PPBH 1LTOA 1P04A 2HPQH 2UUYA 3P70B 3R0FA 1GL1A 2HPPH 1VZQH 1GCTB 3A7YA 3SJOA 4U2WA 3GCOA 2WUBA 3TJUA 4WWYA 1O5FH 3VXFH 3KEEA 1T7CA 1J16A 4H6SB 4SGBE 1IQLA 1ZGIA 4OS5A 1C5LH 1WUNH 2CHAC 3ZVFA 1GMHF 4JK5A 2OC0A 1OWDA 2PSYA 4DG4A 3PLBA 5L30H 4DURA 5L2YH 3FFGA 7LPRA 4NIWA 2XTTB 1GPZA 1HJAC 3SI4H 1ZSKA 1TYNA 3A84A 4HI3A 1Y8TA 2ZGJA 5AVDA 1C2FA 1FN6A 3E1XB 3L6PA 3B9FH 1HJ9A 1MKXH 1FZZA 2FESH 2FOMB 1A1RA 1RTKA 1SGCA 4YLQH 2C8YB 4LZ1H 1PPHE 1MTNB 1N1LA 1GJBB 4H6TA 5GJ4B 1DITH 2VWLA 1C1UH 3KIDU 3OTJE 1EPTC 1QJ6B 1GI0A 4ABIA 1OWKA 3BTKE 1C5WB 1FPHH 3ZVCA 3AAUA 1UCYE 3BEUA 4CRAA 5EQSA 3SV9A 2RA0A 2ZDAH 5AFYH 1TNKA 1O2WA 5K7RA 1UTJA 4UFFH 3TJOA 5G4BA 1F0RA 2F91A 4ZKSU 1HJ8A 3EA7A 1AO5A 3FANA 4D8NA 3A83A 4AOQA 3TU7H 2W26A 1FY5A 1OSSA 2PFEA 4FUEA 1P9UA 4X8UH 1SOZA 3BTEE 1LHFH 3SGBE 4ZHLU 1Q3XA 1ZTLA 2QXGA 1O35A 4TWYA 3EAJA 3F9HA 1E38B 3AVZA 1MKXK 1QB1A 2R9PA 1C1RA 4IBLH 5J4QA 1QQUA 3A7WA 1G36A 1GBDA 1O39A 2GCHG 3SU3A 4WMDA 5GDSH 1BMMH 1IOEA 2BD7A 1RTFB 2PV9B 5FX6A 1ETRH 3P8OA 3MH7A 2ZP0H 3BTHE 1XKAC 5EPYA 1TGBA 1GVKB 1C5NH 1GBHA 2BZ6H 1RFNA 1GHZA 1NESE 3ITIA 2ZCKP 3Q76A 1IQFA 1KLIH 1THSH 1HAGE 3BIUH 5HGGA 1SHYA 5JBCS 1IQHA 2GX4A 3NZIA 4K60A 1VR1H 4GSOA 3RXJA 1CO7E 3A87A 1C2IA 2BZAA 3H7TA 1GBMA 1HXEH 1NRRH 4UEHH 4ZHMU 4WXVA 1GBLA 2ZQ2A 2ZHFH 5E2PA 3SHAH 3UY9A 1HXFH 3P8NA 4FXGH 1U6QA 2PKAB 3A88A 1XXDA 5DG6A 1P10A 3DFJA 2BQ6B 3F6UH 1DFPA 3HK3B 3ATMA 4TY7A 1L1NA 5E2OA 4CRBA 1F7ZA 2F9UA 2H5DA 5FPSA 5DO4H 4BTTB 1SQAA 1ZJDA 5FHTA 1T8MA 4HZHA 3RXMA 1Y3WA 1DLKB 3RXAA 3MO6A 5FBEA 2VGCB 1NO9H 2ZWLH 5CHAC 1GBFA 1Y3VA 2HOBA 4F4OC 1LVOA 1SLWB 1LCYA 1GBBA 1HIAB 1W0YH 1IQKA 1ZYOA 3TH4H 1F0TA 3VB4A 3RMMH 1ELGA 1QBVH 2XCFA 9LPRA 1GBAA 4XSKU 2I6QA 4BAHB 4DJZB 1O3IA 3LGIA 3O8DA 1EJNA 2ZZUH 5FBIA 2Y80A 1C9PA 2ZCHP 3ZVDA 3ZVEA 3ZZ6A 1UVOA 1IQMA 1HBTH 2NU4E 4O9VA 5FXLA 1C1NA 1SGPE 1BTHH 2NU2E 1SGNE 1MMJN 3U8RH 3TJNA 2QV1A 3M35A 3GCNA 1N6XA 2WPIS 2PW8H 1WQVH 3FP6E 2GV7A 1KYNA 2OUAA 2GV6A 3VGCB 2H6MA 3ZZ3A 1J15A 2BVSH 1BMLA 1QQ4A 4GHTA 2CN0H 1BQYA 1TRYA 1YCPM 2BX4A 1DOJA 1OWEA 1GHWH 1GJ7B 3PYHA 4I8KA 3P8FA 3RMOH 1HAPH 5C67A 3QTVH 3QZQA 7KMEH 5A8XA 1WYKA 1ZJKA 2R0LA 1PJPA 1Z8IB 2P3UB 4Y8XA 1FI8A 1A2CH 2C3SA 2QIQA 1BTWA 4NIXA 1F5KU 1KXDA 1EZXC 3GY3A 1G2LA 3MWIU 1AWHB 2Y82A 3LH3A 3UOUA 3D23A 4JZ1A 1MBQA 1P2NA 1QB9A 4CBOA 2AGEX 3VPKA 2ZPSA 2J92A 4GUXA 1C1OA 3TVJB 1VITH 1EOLA 3NPSA 3S69A 1TIOA 3GCHC 3IITA 1ETSH 3BEFB 4LXBH 3RU4E 1ZTJA 3SBKA 2WPLS 2XNIA 2ZU5A 1EJMA 2VIVA 1QRXA 2ZECA 4AFSA 1MQ6A 1T31A 3V7TA 4JZFH 1LO6A 2FLBH 1SGDE 3RXQA 2KAIA 2VVUA 1KXBA 1V2PT 2PKSC 2J2UA 1FIZA 1HNEE 1W3CA 3CS7A 3BG8A 3A89A 3F9EA 1ELBA 1C1TA 1P3EA 1DSTA 1S6FA 4B73A 3RXSA 3VGCC 1PPFE 2W3KA 4AX9H 2IOTA 4CR5A 5ESBA 1IQGA 1CA8B 3HGPA 3KGPA 1L1JA 1GJCB 1AY6H 2RG3A 2FWWA 1O3HA 1MD7A 2BY9X 3P95A 3MU5A 1SOTA 3PMHB 2FOEA 1CBWB 3UFAA 1V2RT 2FEQH 2XWAA 1B0EA 1EP5A 1ABJH 5PTPA 2BB4A 2O9QA 1SQOA 4YESB 1ZHRA 1S85A 1CHOG 2UUFB 4UDWH 3QLPH 1NU9A 3MO3A 2FI5E 4MPVA 4ZKOU 3UR6A 1AGJA 4XDEA 1C2KA 1V2QT 1KXFA 2A31A 1DICA 2FDAA 1C1SA 2PWXA 1TPSA 1GJ9B 5F6MA 4IC5A 2ZCLP 3S9AA 3SV2H 3GISB 4U32A 1HAVB 1GG6B 2XW9A 1SGYE 4O97A 2Z9IA 3PMBB 1SGTA 3I77A 5T6GA 1ELAA 1KLJH 2P16A 1TMUH 3AASA 3UUZA 3U98H 1BTXA 2CGAA 1P01A 3ZZBA 3ZVAA 3ELAH 3RXTA 1YPKH 2GDDA 1V2WT 1EQ9A 1NRNH 1QB6A 3VXEH 1ANCA 2TRMA 1AFQC 1D3PB 1LHGH 2C4FH 3M3VA 1QBNA 3UOPA 5F8TA 3SORA 1TBRH 2ZGHA 2ZTZA 3GY7A 1QURH 3W94A 1ELVA 2FOAA 3MI4A 3A8DA 3SV6A 1ELEE 1ID5H 1AB9B 1QFKH 2A32A 4SGAE 1W7XH 1V6DA 4ZAEA 6GCHG 2VIDA 1OYTH 1AZ8A 2GCTB 5E0JA 3HPTB 1XXFA 1G2MA 1ZR0A 1NY22 4A92A 2VH6A 4B2BA 1DT2A 3C27B 5T6DA 3D49H 3ZZDA 1S83A 3A82A 4KTUA 2PTNA 3NK8A 1TWXB 2B9LA 1DPOA 1X7AC 1C5XB 1S0RA 1OKXA 3LONA 2XBWA 1Y5AT 4KELA 1SGQE 2XRCA 2V3HH 1ANDA 4IN2A 1GI3A 1HRTH 1GJDB 2FTLE 2WYJA 2BY7X 2WYGA 1BTZA 1HCGA 4HFPB 2ZU3A 2Z6BD 4TPIZ 3ATIA 3SJ8A 3URDA 1UVUH 2HNTC 3BTTE 2D2DA 1O3JA 3LGYA 4Y7BA 2G4TA 2Y7ZA 2XC5A 3TH2H 1K1JA 4BAQB 1SMFE 3I29A 4DVAU 1D4PB 4MTBA 3V12A 3MOCA 5GIBA 7GCHG 3LKWA 1AKSB 4WJG2 3RLWH 3U1IB 1EX3A 2HRVA 4DOQA 5JBBS 4MPUA 4OS7A 5GCHF 4MNYA 3MU8A 4A7IB 1IHSH 1Y59T 2LPRA 4ZHAA 1F2SE 4FUJA 2XXLA 1DLEA 1ELTA 2JH5D 5TCCA 6CHAC 2QY0B 3SW2B 1GGDC 1ELFA 1HAXB 3E90B 2EC9H 4Y0ZE 1P0SH 1YYY1 4I7YH 4X0WU 4VGCC 2ZDKA 1CGJE 1O2VA 4FVBA 5F03A 4FU9A 4NWKA 1ZLRA 2HWLB 1J14A 1YLDA 2VB0A 2ZG0H 5A0CA 4ABJA 3Q77A 1V3XA 2WV5A 1V2NT 1ESBA 5A0BA 2PGBB 3SQHE 1P2JA 3M36A 1P2KA 2GZ9A 2ZEBA 2O8LA 4X8TH 2BY5X 2ANKH 4Y7AA 1C2MA 1SI5H 5DK1A 1EP6A 3MU0A 1V2VT 4X1NU 1GMHG 1NROH 4CBNA 2F9NA 2GZ7A 2OINA 2SFAA 1A4WH 4D9RA 3S7KB 4B71A 2W7SA 1TNHA 3E0NB 3NUMA 2CHAB 1OYQA 3ZZAA 1GDQA 4XOJA 3SV7A 8ESTE 1KXAA 1DM4B 1O3GA 4TPYA 3MFJA 4NA7A 3BG4B 1HJAB 1THPB 4ISOA 1UTOA 2FM2A 1O3PB 5EGMA 4CHAC 2GMTC 2AIPA 1XUJA 3SNBA 3ZZ5A 2FYQA 3EYDA 1KXEA 2GT7A 4M7GA 1QRWA 2OC8A 2Y5FA 1NRPH 1ZPBA 2D1JA 2G4UA 5DGJA 5C1UA 1O38A 3M5MA 2BM2A 2VVCA 1EPTB 1ZHPA 1SGEE 2V3OH 3U69H 1GJ4H 1K2I1 4I8LA 3GDUA 1A5GH 1C5ZB 1NZQH 1SBWA 2BDIA 3LJJA 2Y81A 3QDZB 1CT0E 3QGNB 4WVPE 4X2XA 1K21H 2STBE 1ZMLA 4CREA 1EUFA 1OP0A 2FOCA 2H9TH 1E37B 2BVRH 4A1XA 3DT0H 2SGPE 4Y71A 3RXVA 2JETC 2BY8X 2ZFPH 1GHAF 1OP2A 2TBSA 4Q7ZA 4AFZA 1ANEA 2FODA 1Y5BT 1SLXB 1RJXB 5GWZA 4Z0KA 1M9UA 3PLPA 1PQAA 2ZGBH 4I32A 2ZFTA 3UQVA 1FY4A 1G3BA 4MNWA 3KHVA 1SHHB 3T29A 3SQEE 3GYMA 4WH6A 1GCDA 1CGHA 5ABWA 1ZTKA 4BANB 2GKVE 3LT3A 1XM1A 1O2HA 1Z71A 1C1PA 4ABEA 3BG4C 1O5DH 1QJ7B 2AFQB 3QO6A 1OWJA 1OPHB 4IMZA 2A5KA 1JRSA 2WPJS 5DKMA 4I8JA 1C2DA 2FYRA 2OCVB 1ARBA 3C1KA 3UNQA 4X6NA 3SGQE 1PQ8A 4U30A 1UVPA 3SHCH 1V2JT 2W3IA 1DX5M 1NU7B 1INCA 5A2MH 1V2OT 2OBQA 4INKA 2F3CE 1MU6B 1UCYH 4MPXA 4Y0YE 4K69A 2QF0A 1DS2E 3GY6A 4AYVB 1UTNA 1RXPA 5GPIB 4LK4A 4XFQA 5DP5A 1O2RA 4Y10E 1K1IA 4Q2KA 4K1EA 1PYTC 3SUEA 1A3EH 2ZQ1A 3QWCH 4AB8A 3M3TA 4FUDA 2EI6A 4AZ2B 4ISLA 1FMGA 3V0XA 3RC6A 3V13A 2FX4A 4UFDH 1AD8H 3HATH 4UFGH 1ARCA 4NA8A 1K28D 1YCPH 4E05H 1OWIA 3IWMA 3MHWU 3TK5A 1O31A 3RXCA 1BUIA 1SR5C 3RP2A 1FY3A 3PTBA 3RU4D 2SGDE 5CHAB 1MCTA 1AE5A 1TFXA 1QJ1B 2C90B 1BTPA 1OP8A 1DY8A 1MAYA 1YPJH 3RXFA 1OOKB 4I8HA 1DWBH 2PHBA 3F9FA 1EASA 4XBDA 5JBTA 2G5NA 1QL7A 2UWPA 1DE7H 2BXTH 1ABIH 1UCYK 1MTSA 4E7RG 3A7VA 3CP7A 1XUFA 3PV4A 3P17H 1G9IE 1P12E 1YKTA 2VINA 3M5NA 1TOCB 2CJIA 3KL6A 1XVOA 1C9TA 3RC4A 4DT7B 1TPOA 2PGQB 1S0QA 7ESTE 2BDYA 1GI8B 1ESAA 2ZGXH 1CT2E 1SPJA 3GCTF 1FN8A 4RN6A 4LOYH 1AWFH 1TRNA 4ISNA 3U8OH 1A0LA 4BTUB 1TNJA 1YCPK 1F0SA 3ZV9A 3M5LA 3DUXH 2ANMH 2AMDA 3QUMP 1KIGH 2Y5HA 3FAOA 2ZTXA 3LGUA 4DW2U 5T3HA 1IQJA 4ZH8A 1UTLM 3M3SA 3H7OA 3MMGA 1NFXA 4H4FA 1SGIB 1UJ1A 3MNSA 5C2ZA 1W12U 1UMAH 3SJIA 1HFDA 2A4OA 3DD2H 2EEKA 1O5CB 1TMTH 4Q7XA 1TA2A 1SGFG 5C5NA 1MU8B 1L1GA 3K9XB 5C5OA 2NU3E 1KTTB 1UHBA 1HGTH 4DCDA 1O36A 2OQ5A 2ZA5A 4X1SU 1GDUA 1JIMA 1NFYA 1PPGE 2Z9JA 2BDAA 3MH6A 3Q3KA 2F9PA 2ZKSA 4FVDA 1GI7B 4WMEA 2BQWB 1O2QA 2BLWA 2FX6A 1K9OE 2B7DH 1DSUA 4CH8B 5ESTE 2IJOB 2C8XB 4ABGA 5HM9A 3U1JB 1HV7A 1LPKB 5TJXA 3OY6U 4JYVH 1SFQB 1WBGB 1TPAE 1XVMA 3GCHB 2BLOA 2HALA 4IN1A 5DJ7A 2ZC9H 3FVFB 1MAXA 1QCPA 3OSYA 3UR9A 1EZQA 1GMCF 4Z6AH 1N8OC 5H4IB 1EAIA 1GI2A 1GHVH 3B23B 2BHGA 4XBCA 1KTSB 2BQ7B 3A8BA 2OC1A 1W7GH 2SGQE 2IPHA 2RA3A 1C2GA 1FQ3A 2ASUB 2C8WB 2PKSB 3CS0A 5E0HA 4H42U 3BTDE 4IC6A 2A7JA 1K22H 3L33A 3SNDA 1QBOA 2A4RA 1P02A 2AH4X 1JBUH 1O2LA 1NRQH 3T26A 1MQ5A 1J9CH 3ODFA 1L0ZA 5F8ZA 3PO1B 1BRCE 3ZV8A 2FI4E 4DIIH 3PWCA 4BXWA 1O3CA 3PLKA 2YNAA 3UREA 1L4DA 2QN5T 1XKBC 5EQRA 2HNTF 3S9CA 1D3QB 1OXGA 2FLRH 3LGWA 1V2UT 4ABDA 3S7HB 1DDJA 1GJ6A 1C5UA 3OYPA 4I33A 4JZEH 2LNCA 1TGSZ 4ESTE 2P8OC 1Y5UT 1V2LT 2H5CA 2ZDMA 4CRFA 3STIA 1Y3UA 1EKBB 2B0FA 2ZFFH 1C5OH 4ABHA 1T4UH 1ELDE 1TNLA 2C8ZB 4B2CA 1D9IA 3K6ZA 3SJKA 3BTME 4PROA 3ATLA 1FAKH 2Z9KA 2STAE 8KME2 1AFEH 1MBMA 2OLGA 3EE0B 1C5VA 4JK6A 2A4QA 2VIWA 3NXPA 2BX3A 1QY6A 4YZUA 1MZDA 1T32A 1UVTH 1GI4A 5IYTA 3GICB 1ZSLA 2J95A 1AFQB 1IAUA 2VWOA 1Z1IA 4OGYA 1O3AA 1O2OA 1SC8U 2D8WA 1AIXH 3TGKE 5LH8A 3GDVA 3PO1C 4RKJB 3M7QA 1AU8A 8LPRA 4D9QA 1C1WH 3TGIE 1SLVB 2G51A 3BEIB 3QX5H 1K1PA 2FIRH 2F9OA 1RRKA 3SNAA 1XX9A 4AG2A 2C93B 3UNSA 1AMHA 1TE0A 4INHA 4Y8YA 5T6FA 3RXGA 4LZ4B 3PM3A 3RXEA 2W5EA 3A8AA 4NZQA 1HIAA 2R3UA 1MH0A 1ZGVA 1LMWB 3IG6B 2G55A 9ESTA 1O0DH 4WY3A 4AG1A 4BAOB 3QK1A 4FUBA 2ZFRH 3LOXA 1LHEH 4KP0A 3GDSA 2ZF0H 3PB1E 2Q6GA 3LGVA 3VB5A 4RSPA 1RIWC 1PFXC 1EATA 1K1LA 1WTGH 1ZRBA 2SGEE 3VB6A 3SU0A 1BHXF 1BBRE 3LIWA 1EAWA 1TB6H 1V2MT 2Z7FE 1B5GH 4Y11E 5GXPA 5EXMA 4Y79A 3A8CA 4K3JA 1RD3B 3AAVA 3LPRA 3STJA 5GCHG 2GDEH 2QF3A 1Z8RA 3TPIZ 3LGTA 1O3KA 1P57B 1P05A 1BRAA 5LGOA 1WAYB 3T5FH 1TPPA 1SSXA 4A5TS 2QYIA 2HGTH 1P3CA 3ENSB 2ZFSA 1T8NA 3M37A 1BDAA 1YM0A 3PMAB 1MUEB 3L3TA 4YLUA 1JXPA 1P09A 1H9LB 4FUGA 1G3DA 3DA9B 2B5TB 3HGNA 6CHAB 2CXVA 1GGDB 2BD9A 5DP6A 1TGTA 1UK3A 2UUJB 1W0ZU 3DHKH 1AE8H 2BOKA 4D76A 4VGCB 2XBVA 3CENA 1LHDH 2ODQA 1YPMH 5C1XA 5DP3A 5JB9S 3TNSA 4ZUHA 1VCQA 3E91A 5FAHA 1P2IA 2TGPZ 4AGKA 5EPNA 2J34A 2FPZA 2GGVB 4NG9H 4ABBA 1C4Y2 1DWEH 1AVWA 1UTMA 4ZKNU 1MCVA 2ZFQH 1JMOH 1MTUA 1RGQA 1FV9A 1KDQB 3EA8A 5JBAS 2XBYA 2AYWA 5C20A 2ZO3H 3I78A 2A4GA 4O3UA 4X8VH 1H9IE 3F68H 5LPRA 1DANH 2V0BA 2VVVA 1TRMA 5C3NA 1S5SA 4O3TA 3ZZ4A 1O2GH 1SFIA 3RMLH 2OC7A 3TK9A 8GCHF 1YPHE 1ZRKA 1BOQA 1RS0A 5DP9A 2BDGA 5FX5A 5L6NH 3SU6A 2AGIX 3MH5A 4BNRA 1YPEH 1E34B 2XCNA 2QA9E 4CHAB 2GMTB 1C2EA 5EU8A 2ZDVH 5L2ZH 4YOGA 1ZPCA 4Y8ZA 1GI9B 4X6OA 2BD5A 4R8TB 1HAOH 2G52A 3O8BA 1E0FD 1HB0B 4K1SA 3O8RA 1O30A 1O3LA 1CSOE 5FPYA 1BHXB 2QXJA 3LJOA 1TAWA 2RDLA 2B8OH 5SGAE 3RU4T 4DIHH 1EAXA 2BVXH 1NM6A 2BDCA 5EG4A 1AVXA 1O2PA 1Q31A 1GHAG 1SVPA 1TABE 2A2QH 1ZMJA 1UTQA 1VJ9U 2A45B 2BYAX 3HKIB 4CRDA 2FP7B 2F83A 2ZHEH 1XMNB 1QA0A 2O8MA 1UTPA 1D3DB 1CA0B 1FXYA 1O3DA 2JETB 3MYWA 1OX1A 3BN9A 5IDKA 3MNCA 1MZAA 1P11E 4YO9A 4FUFA 4OS6A 5BRRE 2JH0D 4YT7H 1E35B 1Y3XA 2JKHA 1QRZA 1WCZA 1K1OA 5CE1A 1ZPZA 4YT6H 1O2KA 3BF6H 5ETXA 3D62A 3SU4A 3D65E 1HAVA 3KQDA 4MDSA 3MNXA 1TMBH 4E06H 3DFLA 1SQTA 1SGFA 4NSYA 3ZYDA 4XBBA 2D26C 4RKOB 2ZU1A 1W13U 1A5IA 1QHRB 4NFEA 2Y5GA 4D7FA 3N7OA 3E6PH 3ZZ7A 2FOBA 5HM2A 3UWJH 1C5MD 2UUKB 2BDBA 2TPIZ 4JYTA 4MVNA 4B76A 5EXLA 1CU1A 2SGFE 3M7UA 2FXRA 2VIQA 3ZVBA 1A46H 1O2MA 1ORFA 2AEIH 1EZSC 2R3YA 3UWIA 3AW1A 1NTPA 2PSXA 1B0FA 4AB9A 4X2WA 4R0IA 1GHBF 4MLFB 4TWWA 1W2KH 4Y76A 1O3MA 1AQ7A 3TNTA 2ALVA 1RTLA 1TNIA 3Q3YA 1GMDF 1HYLA 1SLUB 1CA0C 1FAXA 1VGCB 1O2ZA 3LC3A 1JIRA 3SGAE 3VFEA 3QN7A 2VIPA 3KQEA 1DXWA 2QXIA 3KN2A 3SNEA 3VB7A 2QCYA 3ZYEA 4IGDA 2GP9B 4X1PU 1OS8A 1H8IH 3SI3H 5J4SA 2BTCE 1GI1A 5LPEA 2M5TA 1TALA 2G5VA 4IMQA 3AW0A 2F9BH 3SZNA 1DVAH 1DWDH 1D3TB 1F5RA 1PPZA 4OS4A 3GYLB 4UONA 2ZTYA 2P95A 3SJ9A 1AKSA 2R2WU 2ZU4A 4NZLA 1UHBB 1EXFA 4NSVA 1FDPA 4JMYA 1NN6A 4BAMB 1PPEE 1F92A 4GCHF 3M7TA 3GCTG 3KQCA 1VITF 2OBOA 1AN1E 1O3BA 1GBJA 1BMNH 1C5SA 2BD3A 3GY4A 1Z6EA 3Q3XA 4DY7B 1C5RA 3EGKH 4FUIA 1YBWA 3T25A 1J8AA 1O2UA 2Q6DA 3SO3A 1EJAA 2FOHA 1O3EA 2A1DB 2ODPA 1O3NA 2QXHA 4CH2B 2Q1JA 1GBTA 2AMPA 3KCGH 1C4V2 4GAWA 2CF9H 2NWNA 1MTWA 1QR3E 1CHGA 4J1YA 1VGCC 5LPFA 1O34A 4MNVA 1C4U2 1PQ5A 2G00A 3W95A 2WUCA 3JZ1B 1TLDA 1H4WA 1LKBA 1AI8H 1G32B 2ANWA 1IQNA 3RMNH 4B1TA 2PR3A 4BXSA 5JDUB 3URCA 2IN2A 1JRTA 4MPWA 1BZXE 1O5GH 4K2YA 3A81A 1B7XB 1FONA 4JYUH 2YOLA 3LC5A 1S6HA 1O2SA 1Z7KA 2P94A 1GCTC 1QTFA 4FU8A 4U01A 1O5EH 2QC2A 1GBCA 1XUHA 2J9NA 4JZDH 2WINI 4Y6DA 3RXPA 2OD3B 3BTWE 1GJ5H 2VWNA 4NCYA 1NC6A 4JZIA 2H2ZA 3PROA 4K8BA 5JYIA 2YNBA 1GMCG 1H1BA 1DUEA 3KQBA 2VIOA 1C5TA 1V2KT 2Z9GA 3RXUA 5I46H 1YLCA 3A85A 3LDXH 1E36B 2EI7A 1ETTH 1P06A 3RXHA 1CGIE 1Z8JB 3VEQB 3MNBA 1EPTA 1O37A 1N8OB 2A7CA 4GPGA 4GHQA 1A5HA 1GDNA 2Z3CA 1YPLH 2XC4A 2FZZA 2ZPRA 3MH4A 3HK6B 1CQQA 3SOSA 1IQEA 1O33A 3BV9B 3T27A 2EA3A 2V35A 4K1TA 1AVGH 1O2YA 4HGCA 3SNCA 1MTNC 1FY1A 1UVSH 1BT7A 4X1QU 1XUGA 1C1VH 5E0GA 1C1MA 1T8LA 1OWHA 5FPTA 2ANYA 1HLTH 1QIXB 2V6NA 4KKDA 1UO6A 2VU8E 2KAIB 1LQDB 4INLA 2BDHA 1ESTA 1QL9A 5DP7A 1BJUA 1QL8A 3A7ZA 1N6YA 2XC0A 2GVFA 5AFZH 4KTCA 3SUGA 2TGTA 4CR9A 1Z6JH 1BJVA 1TGCA 2ZHWH 2TIOA 2P8OB 4ZXXH 2OXSA 1HUTH 1D6RA 1DY9A 1C2JA 3RXBA 1H8DH 1YP9A 2BLVA 4NA9H 2NU0E 1XUIA 3E0PB 3TITA 1KSNA 2ZNKH 3Q00A 3T2NA 3SUFA 4CRCA 4MG3A 3LH1A 2BMGB 1C2LA 1CVWH 1MTVA 3B8JA 1FLEE 5I25A 2FS8A 3PWBA 1DUAA 2GCHF 4O03A 4KGAA 4NWLA 3PMJA 1O3FA 3EQ0H 4K8YA 1A3BH 1KXCA 2VH0A 1NFUA 3EA9A 3T28A 1DWCH 4NIVA 2GZ8A 2J4IA 2ZPQA 3MU1A 2UWOA 1WV7H 2P59A 2WPKS 3T62A 2BY6X 1S84A 1VCPA 3SV8A 1P03A 3HKJB 3M5OA 2A2XH 1T8OA 4Q7YA 1K1NA 1WSSH 4E7NA 2P3FH 1G30B 3RXKA 4ABFA 2VWMA 2Y6TA 2FOGA 5FCRA 4GLYA 4ABAA 1TQ7B 1ACBE 1BRUP 3A7XA 4NFFA 1WTHD 3UIRA 1YPGH 2BLQA 3ZZ8A 1EZUC 1AUTC 1ELCA 4HTCH 1EB2A 2A0QB 4KTSA 2PLXA 3F1SB 2VGCC 5AF9H 4GVUA 2WPMS 3U8TH 2BD8A 4UFEH 3RM2H 1TBZH 3BSQA 1LKAA 3O8CA 1GI5A 2PUQH 1RIWB 4IS5A 1P2OA 2BXUH 1A0HB 1TX7A 2H9HA 2ZIQH 4WF8A 4AFQA 1LHCH 1YF4A 2TGAA 1G3EA 1A7SA 1W14U 1IHTH 2G81E 3MU4A 1BRBE 3M61U 3R3GB 2ULLA 4OS2A 5HYOA 4WXIA 1KLTA 1BIOA 2GT8A 3TGJE 1SGRE 1W8BH 1HDTH 1WU1A 3SU1A 3ATWA 2PKAA 2H9EH 3ZZCA 2HVXA 1O32A 3SN8A 4X6MA 1HPGA 4K5ZA 5EW1H 1GI6A 1GBIA 4A1VA 1KY9A 3RC5A 1GBKA 2F9VA 4I8GA 2I6SA 1Z8GA 4JCNA 2P3TB 3RUOA 2FTMA 1DXPA 1AZZA 1NS3A 4OGXA 1C5QA 3A7TA 3ESTA 3UNRA 1GBEA 1GJ8B 2FO9A 3BTFE 1A0JA 3FP8E 3BIVH 5B6OA 5A8ZA 1LVYA 4YTAA 2A5AA 1C2HA 3TH3H 1GHXH 1YC0A 2XYAA 1J17T 4AN7A 2O8TA 1GJAB 2ALPA 3ODDA 4Q80A 1K1MA 4ZROA 1VJAU 3GY5A 3SU2A 4MNXA 3BTGE 1HAZB 2A5IA 5A8YA 1F5LA 1Y3YA 1BMAA 5CMXH 1LPGB 3UTUH 1ZOMA 1GL0E 1Q2WA 4UD9H 4AYYB 1YGCH 1BBRH 8GCHG 2H1UA
chains in the Genus database with same CATH superfamily
2K1QA 2J38A 2O8UA 1WOFA 3FZDA 1NPMA 2JH6D 1NRSH 1EOJA 1PPCE 2OTVA 2XWBI 1GHYH 3LU9B 1UK4A 4WH8A 1Z1JA 4ISIH 2PTCE 5FCKA 4AGJA 1W10U 4TYDA 2RCEA 1AHTH 1V2TT 2AERH 4UE7H 3AK5A 2QAAA 1QA7A 2FOFA 1TX6A 3GY2A 1EAUA 1IQIA 3F2FA 2P93A 5BPEA 4B2AA 3P6ZB 1LQEA 2AIQA 4THNH 3P8GA 1TBQH 4J2YB 3BTQE 3SU5A 2KX4A 4YOIA 2VNTA 1CE5A 3RDZA 3RXDA 3GY8A 3K65B 2UWLA 3RXRA 1V2ST 2G8TA 4FUHA 3OY5U 3EDXB 3TK6A 1O2NA 4P00A 5T1VA 1YPHC 4D7GA 3MO9A 4NGAH 3P92A 4TY6A 5AHGH 3S9BA 1P2QA 1BBRK 3NCLA 3OX7U 3H5CB 3QTOH 1H9HE 2HLCA 4F49A 1H8HD 1TOMH 1FUJA 4ZMAH 1CBWC 2SNWA 1LDTT 1T4VH 2W7UA 1FJSA 1HAYB 2V7QD 1TQ0B 3ZZ9A 2PUXB 6ESTA 5A09A 5EOKA 1PQ7A 2V3MA 3K6YA 3JZ2B 2VJ1A 1THRH 1P8VC 5HXFA 2SNVA 3PTNA 1GVZA 3VB3A 2QGRA 5HMAA 2NU1E 2BOHB 3FKSD 1CHOF 1UTKA 4X2YA 1O5AB 3QZRA 1ZSJA 2Y7XA 2XBXA 3TJVA 1HAIH 2CMYA 2GTBA 4IW4E 5E8EH 4WMFA 1GWAA 2FMJA 3E16B 4OS1A 1BTYA 1LVMA 1ZZZA 5DP8A 2CF8H 1GG6C 4X2VA 4BAKB 1F0UA 1QGFA 3NWUA 2DUCA 2AGGX 1UK2A 2Q6FA 4I31A 4ISHH 3A86A 1MD8A 1GHBG 1W11U 3RXIA 3V3MA 1O3OA 3S0NA 1S81A 5C1YA 3KNXA 1W0KD 3F2HA 5EQQA 4AFUA 1FIWA 4QT8C 1GMDG 1JOUB 2WV4A 4A1TA 1AUJA 3FZZA 2BD2A 5EXNA 3ATKA 3F9GA 4DGJA 2AHME 1TA6A 2DE8A 1NT1A 2ZI2H 1EB1H 4B75A 2ZDNA 2OQUA 4B74A 3WWBA 1AB9C 3WY8A 3E8LA 1FNIA 1SB1H 4BOHA 2AS9A 3RLYH 1C1QA 4X1RU 1NFWA 2HNTE 1LVBA 3UPEA 3E3TA 2O8WA 2KR7A 4ZXYH 2Z3EA 1C5YB 2Z3DA 1TX8A 1TGNA 3U9AH 1ANBA 2JJ1D 2GCTC 3UQOA 5EODA 4X8SH 1VCWA 3FP7E 3SUDA 2CV3A 6GCHF 2FS9A 1BA8B 6LPRA 2F4LA 4A6LA 1O2JA 4FUCA 1PYTD 1P2MA 1TONA 4XE4A 2K0QA 3TIUA 1MKWH 1LPZB 1HAHH 5TCAA 4GCHG 1G3CA 4BTIB 1SL3A 3A80A 2K8IA 3QGJA 5JB8S 1VITG 3KF2A 1QNJA 1BITA 5DP4A 1P9SA 1L4ZA 2WPHS 2ILNA 2Z9LA 5JPMH 5K0HA 3K2UA 2EI8A 2ZHQH 1O5BB 1FY8E 2AMQA 1O2TA 3RXLA 1ZMNA 2BD4A 4TT3D 1WQSA 5A0AE 2SGAA 1L2EA 2RDEA 3PRDA 1JWTA 1O2IA 2J94A 1S82A 1ZHMA 5DPAA 1CT4E 1BCUH 2ZU2A 7GCHF 2R0KA 2GD4B 4MQAA 1C5PA 1GVLA 4AORA 4X6PA 1KMHB 2FI3E 1SG8B 2ESTE 1A61H 1D6WA 2TGDA 3NKKA 3G01A 1O2XA 2ZDLA 1BB0B 2THFB 3GOVB 2ZHDA 2R2MB 2OP9A 5GNDA 4YOJA 2A7HA 4ZKRU 5EW2H 2DE9A 1TNGA 1XUKA 1G37A 2Z94A 3FO8D 1MKWK 4FU7A 3MTYA 3ZVGA 4CRGA 2ZGCA 2ODYB 3RM0H 5F8XA 1KDQA 3TLOA 1FPCH 3OU0A 4NIYA 4ASHA 3N7DA 3RXOA 1BTUA 4YM9A 1PPBH 1LTOA 1P04A 2HPQH 2UUYA 3P70B 3R0FA 1GL1A 2HPPH 1VZQH 1GCTB 3A7YA 5EJLA 3SJOA 4U2WA 3GCOA 2WUBA 3TJUA 4WWYA 1O5FH 3VXFH 3KEEA 1T7CA 1J16A 4H6SB 4SGBE 1IQLA 1ZGIA 2F43B 4OS5A 1C5LH 1WUNH 3OEHD 2CHAC 3ZVFA 1GMHF 2QF5A 4JK5A 2OC0A 1OWDA 2PSYA 4DG4A 3PLBA 5L30H 4DURA 5L2YH 2J98B 3FFGA 4NIWA 7LPRA 2XTTB 1GPZA 1HJAC 3SI4H 1ZSKA 1TYNA 3A84A 3OE7D 4HI3A 1Y8TA 2ZGJA 5AVDA 1C2FA 1FN6A 3E1XB 3L6PA 3B9FH 4YXWD 1HJ9A 1MKXH 1FZZA 2FESH 2FOMB 1A1RA 2KCAA 1RTKA 1SGCA 2JDID 4YLQH 2C8YB 4LZ1H 1PPHE 1MTNB 1N1LA 1GJBB 4H6TA 5GJ4B 1DITH 2VWLA 1C1UH 3KIDU 3OTJE 1EPTC 1QJ6B 1GI0A 4ABIA 1OWKA 3BTKE 1C5WB 1FPHH 3ZVCA 3AAUA 1UCYE 3BEUA 4CRAA 5EQSA 3SV9A 2RA0A 2ZDAH 5AFYH 1TNKA 1O2WA 5K7RA 1UTJA 4UFFH 3TJOA 5G4BA 1YY3A 1F0RA 2F91A 4ZKSU 1HJ8A 3EA7A 1AO5A 3FANA 4D8NA 3A83A 4AOQA 3TU7H 2W26A 3KQ5A 1FY5A 1OSSA 2PFEA 4FUEA 1P9UA 4X8UH 1SOZA 3BTEE 1LHFH 3SGBE 4ZHLU 1Q3XA 1ZTLA 2QXGA 1O35A 4TWYA 2QE7D 3EAJA 3F9HA 1E38B 3AVZA 1MKXK 1QB1A 2R9PA 1C1RA 4IBLH 5J4QA 1QQUA 3A7WA 1G36A 1GBDA 1O39A 2GCHG 3SU3A 2J5UA 4WMDA 5GDSH 1BMMH 1IOEA 2BD7A 2KM0A 1RTFB 1H8ED 2PV9B 5FX6A 1ETRH 3P8OA 3MH7A 2ZP0H 3BTHE 5C94A 1XKAC 5EPYA 1TGBA 1GVKB 1C5NH 1GBHA 2BZ6H 1RFNA 1GHZA 1NESE 3ITIA 2ZCKP 3Q76A 1IQFA 1KLIH 1THSH 1HAGE 3BIUH 5HGGA 4ACAA 1SHYA 5JBCS 1IQHA 2GX4A 3NZIA 4K60A 1VR1H 4GSOA 3RXJA 1CO7E 3A87A 1C2IA 3PRBA 2BZAA 3H7TA 4XD7D 1GBMA 1HXEH 1NRRH 4UEHH 4ZHMU 4WXVA 1GBLA 2ZQ2A 2ZHFH 5E2PA 3SHAH 3UY9A 1HXFH 3P8NA 4FXGH 1U6QA 2PKAB 3A88A 1SKYE 1XXDA 5DG6A 1P10A 3DFJA 2BQ6B 3F6UH 1DFPA 3HK3B 3ATMA 4TY7A 1L1NA 5E2OA 4CRBA 1F7ZA 2F9UA 2H5DA 5FPSA 5DO4H 4BTTB 1SQAA 1ZJDA 5FHTA 1T8MA 1WXRA 4HZHA 3RXMA 1Y3WA 1DLKB 3RXAA 3MO6A 5FBEA 2VGCB 1NO9H 2ZWLH 5CHAC 2WSSD 1FX0B 1GBFA 1Y3VA 2HOBA 4F4OC 1LVOA 1SLWB 1LCYA 1GBBA 1HIAB 1W0YH 1IQKA 5EIYA 1ZYOA 3TH4H 1F0TA 3VB4A 3RMMH 1ELGA 1QBVH 2XCFA 4Q4LA 9LPRA 1GBAA 4XSKU 2I6QA 4BAHB 4DJZB 1O3IA 3LGIA 3O8DA 1EJNA 2ZZUH 5FBIA 3KYGA 2Y80A 1C9PA 2ZCHP 3ZVDA 3ZVEA 3ZZ6A 1UVOA 1IQMA 1HBTH 1YWUA 2NU4E 4O9VA 5FXLA 1C1NA 1SGPE 1BTHH 2NU2E 1SGNE 1MMJN 3U8RH 3TJNA 2QV1A 3M35A 3GCNA 1N6XA 2WPIS 2PW8H 4AC9A 1WQVH 3FP6E 2GV7A 1KYNA 2OUAA 2GV6A 3FOAA 3VGCB 2H6MA 3F3BA 3ZZ3A 1J15A 2BVSH 1BMLA 1QQ4A 4GHTA 2W6ID 2CN0H 1BQYA 1TRYA 1YCPM 2BX4A 1DOJA 1OWEA 1GHWH 1GJ7B 3PYHA 4I8KA 3P8FA 3RMOH 1HAPH 5C67A 3QTVH 3QZQA 7KMEH 5A8XA 1WYKA 1ZJKA 1W0JD 2R0LA 1PJPA 1Z8IB 2P3UB 4Y8XA 1FI8A 1A2CH 2C3SA 2QIQA 1BTWA 4NIXA 1F5KU 1KXDA 1EZXC 3GY3A 1G2LA 3MWIU 1AWHB 2Y82A 3LH3A 3UOUA 2LP6A 3D23A 4JZ1A 1MBQA 1P2NA 1QB9A 4CBOA 2AGEX 3VPKA 2ZPSA 2J92A 4GUXA 1C1OA 3TVJB 1VITH 1EOLA 3NPSA 2RFKC 3S69A 1TIOA 3GCHC 3IITA 5KECA 1ETSH 3BEFB 4LXBH 3RU4E 5CHBA 1ZTJA 3SBKA 2KCOA 2WPLS 3NRLA 2XNIA 3CNRA 2ZU5A 1EJMA 4P02A 2VIVA 1QRXA 2ZECA 4AFSA 1MQ6A 1T31A 3V7TA 4JZFH 5C0TA 1LO6A 2FLBH 1SGDE 3RXQA 2KAIA 2VVUA 1KXBA 1V2PT 2PKSC 2J2UA 1FIZA 1HNEE 3UB0A 1W3CA 3CS7A 3BG8A 3A89A 3F9EA 1ELBA 1C1TA 1P3EA 1DSTA 1S6FA 4B73A 3RXSA 3VGCC 2HVYB 1PPFE 2W3KA 4AX9H 2IOTA 4CR5A 5ESBA 1IQGA 1CA8B 3HGPA 3KGPA 1L1JA 1GJCB 1AY6H 2RG3A 2FWWA 1O3HA 1MD7A 2BY9X 3P95A 3MU5A 1SOTA 3PMHB 3MQKC 2FOEA 1CBWB 3UFAA 1V2RT 2FEQH 2XWAA 1B0EA 1EP5A 1ABJH 5PTPA 2BB4A 2O9QA 1SQOA 4YESB 1ZHRA 4Q63A 1S85A 1CHOG 2UUFB 4UDWH 3QLPH 1NU9A 3MO3A 2FI5E 4MPVA 4ZKOU 3UR6A 1AGJA 4XDEA 1C2KA 1V2QT 1KXFA 2A31A 1DICA 2FDAA 1C1SA 2PWXA 1TPSA 1GJ9B 5F6MA 4IC5A 2ZCLP 3S9AA 3SV2H 3GISB 2HLDD 4U32A 1HAVB 1GG6B 2XW9A 1SGYE 4O97A 2Z9IA 3PMBB 1SGTA 3I77A 5T6GA 1ELAA 1KLJH 1TMUH 2P16A 3AASA 3UUZA 2YMSC 3U98H 1BTXA 2CGAA 1P01A 3ZZBA 3ZVAA 3ELAH 3RXTA 1YPKH 2GDDA 1V2WT 1EQ9A 1NRNH 1QB6A 3VXEH 1ANCA 2TRMA 1AFQC 1D3PB 1LHGH 2C4FH 3M3VA 1QBNA 3UOPA 5F8TA 3SORA 3UAIC 1TBRH 2ZGHA 2ZTZA 3GY7A 1QURH 3W94A 1ELVA 2FOAA 3MI4A 3A8DA 3SV6A 1ELEE 1ID5H 1AB9B 1QFKH 2A32A 4SGAE 1W7XH 1V6DA 4ZAEA 6GCHG 2VIDA 2QF4A 1OYTH 1AZ8A 2GCTB 5E0JA 3HPTB 1XXFA 1G2MA 3EE7A 1ZR0A 1NY22 4A92A 2VH6A 4B2BA 1DT2A 3C27B 5T6DA 3D49H 3ZZDA 1S83A 3A82A 4KTUA 2PTNA 3NK8A 1TWXB 2B9LA 1DPOA 1X7AC 1C5XB 1S0RA 1OKXA 3LONA 2XBWA 1Y5AT 4KELA 1SGQE 2XRCA 2V3HH 1ANDA 4IN2A 1GI3A 1HRTH 1GJDB 2FTLE 2WYJA 2BY7X 2WYGA 1BTZA 1HCGA 4HFPB 2ZU3A 2Z6BD 4TPIZ 3ATIA 3SJ8A 3URDA 1UVUH 2HNTC 3BTTE 2D2DA 1O3JA 3LGYA 4Y7BA 2G4TA 2Y7ZA 2XC5A 3TH2H 1K1JA 4BAQB 1SMFE 3I29A 4DVAU 1D4PB 4MTBA 3V12A 3MOCA 5GIBA 7GCHG 3LKWA 1AKSB 4WJG2 3RLWH 3U1IB 1EX3A 2HRVA 4DOQA 5JBBS 4MPUA 4OS7A 5GCHF 4MNYA 3MU8A 4A7IB 1IHSH 1Y59T 2LPRA 4ZHAA 1F2SE 4FUJA 2XXLA 1DLEA 1ELTA 2JH5D 5TCCA 3OEED 3PV5A 6CHAC 5IK2D 2QY0B 3SW2B 1GGDC 1ELFA 1HAXB 3E90B 2EC9H 4Y0ZE 1P0SH 1YYY1 4I7YH 4X0WU 4VGCC 2ZDKA 1CGJE 1O2VA 4FVBA 5F03A 4FU9A 4NWKA 1ZLRA 2HWLB 1J14A 1YLDA 2VB0A 2ZG0H 5A0CA 5F53A 4ABJA 2EQNA 1V3XA 3Q77A 2WV5A 1V2NT 1ESBA 5A0BA 2PGBB 3SQHE 1P2JA 3M36A 1P2KA 1NBMD 2GZ9A 2ZEBA 2O8LA 4X8TH 2BY5X 2ANKH 4Y7AA 1C2MA 1SI5H 5DK1A 1EP6A 3MU0A 1V2VT 4X1NU 1GMHG 1NROH 4CBNA 2F9NA 2GZ7A 2OINA 2SFAA 1BMFD 1A4WH 2XNDD 3S7KB 4B71A 4D9RA 2W7SA 1TNHA 3E0NB 3NUMA 2CHAB 1OYQA 3ZZAA 1GDQA 4XOJA 3SV7A 8ESTE 1KXAA 1DM4B 1O3GA 4TPYA 3MFJA 4NA7A 3BG4B 1HJAB 1THPB 4ISOA 1UTOA 2FM2A 4HG6A 1O3PB 3SYJA 5EGMA 4CHAC 2GMTC 2AIPA 1XUJA 3SNBA 3ZZ5A 2FYQA 3EYDA 1KXEA 2GT7A 4M7GA 1QRWA 2OC8A 2Y5FA 1NRPH 1ZPBA 2D1JA 2G4UA 5DGJA 5C1UA 1O38A 3M5MA 2BM2A 2VVCA 1EPTB 1ZHPA 2CK3D 1SGEE 2V3OH 3U69H 1GJ4H 1K2I1 4I8LA 3GDUA 1A5GH 1C5ZB 1NZQH 1SBWA 2BDIA 3LJJA 2Y81A 3QDZB 1CT0E 3QGNB 4WVPE 4X2XA 1K21H 2STBE 1ZMLA 4CREA 1EUFA 1OP0A 2FOCA 2H9TH 1E37B 2BVRH 4A1XA 3DT0H 2SGPE 4Y71A 3RXVA 2JETC 2BY8X 2ZFPH 1GHAF 1OP2A 2TBSA 4Q7ZA 4AFZA 1ANEA 5FL7D 2FODA 1Y5BT 1SLXB 1RJXB 5GWZA 4Z0KA 1M9UA 3PLPA 1PQAA 2ZGBH 4I32A 2ZFTA 3UQVA 1FY4A 1G3BA 4ZCNA 4MNWA 3KHVA 1SHHB 3T29A 3SQEE 3GYMA 4WH6A 1GCDA 1CGHA 5ABWA 1ZTKA 4BANB 2GKVE 3LT3A 1XM1A 1O2HA 1Z71A 1C1PA 4ABEA 3BG4C 1O5DH 1QJ7B 2AFQB 3QO6A 1OWJA 1OPHB 4IMZA 2A5KA 1JRSA 2WPJS 5DKMA 4I8JA 1C2DA 2FYRA 2OCVB 1ARBA 3C1KA 3UNQA 4X6NA 3SGQE 1PQ8A 4U30A 1UVPA 3SHCH 1V2JT 2EY4C 2W3IA 1DX5M 1NU7B 1INCA 5A2MH 1V2OT 2OBQA 3N99A 4INKA 2F3CE 1MU6B 1UCYH 4MPXA 4Y0YE 4K69A 2QF0A 1DS2E 3N7EA 3GY6A 4AYVB 1UTNA 1RXPA 5GPIB 4LK4A 4XFQA 5DP5A 3OFND 1O2RA 4Y10E 1K1IA 4Q2KA 4K1EA 1PYTC 1S6LA 3FN8A 3SUEA 1A3EH 2ZQ1A 3QWCH 4AB8A 3M3TA 4FUDA 2EI6A 2W6JD 4AZ2B 5HKKD 4ISLA 1FMGA 3V0XA 3RC6A 3V13A 2FX4A 4UFDH 1AD8H 3HATH 4UFGH 1ARCA 4NA8A 1K28D 1YCPH 4E05H 1OWIA 3IWMA 3MHWU 3TK5A 1O31A 3RXCA 1BUIA 1SR5C 3RP2A 1FY3A 3PTBA 3RU4D 2SGDE 5CHAB 1MCTA 1AE5A 1TFXA 1QJ1B 2LELA 2C90B 1BTPA 1OP8A 1DY8A 1MAYA 1YPJH 3RXFA 1OOKB 4I8HA 1DWBH 2PHBA 3F9FA 1EASA 4XBDA 5JBTA 2G5NA 1QL7A 2UWPA 1DE7H 1NBME 2BXTH 1ABIH 1UCYK 1MTSA 4E7RG 3A7VA 3CP7A 1XUFA 3PV4A 2OK5A 3P17H 1MABB 1G9IE 1P12E 3F2GA 1YKTA 2VINA 3M5NA 1TOCB 2CJIA 3KL6A 1XVOA 1C9TA 3RC4A 4DT7B 1TPOA 2PGQB 1S0QA 7ESTE 2BDYA 1GI8B 1ESAA 2ZGXH 1CT2E 1SPJA 3GCTF 1FN8A 4RN6A 4LOYH 1AWFH 1TRNA 4ISNA 3U8OH 1A0LA 4BTUB 1TNJA 1YCPK 1F0SA 3ZV9A 3M5LA 3DUXH 2ANMH 1COWD 2AMDA 3QUMP 1KIGH 2L74A 2Y5HA 3FAOA 2ZTXA 3LGUA 4DW2U 5T3HA 1IQJA 4ZH8A 1UTLM 3M3SA 3H7OA 3MMGA 1NFXA 4H4FA 1SGIB 1UJ1A 3MNSA 5C2ZA 1W12U 1UMAH 3SJIA 1HFDA 2A4OA 3DD2H 3VG8A 2EEKA 1O5CB 1TMTH 4Q7XA 1TA2A 1SGFG 5C5NA 1MU8B 1L1GA 3K9XB 5C5OA 2NU3E 1KTTB 1UHBA 1HGTH 4DCDA 1O36A 2OQ5A 2ZA5A 4X1SU 1GDUA 1JIMA 1NFYA 1PPGE 2Z9JA 2BDAA 3MH6A 3Q3KA 4ACBA 4M9FA 2F9PA 2ZKSA 4FVDA 4FETA 2WHXA 1GI7B 2J98A 2BQWB 4WMEA 1O2QA 2BLWA 2FX6A 1K9OE 2B7DH 1DSUA 3SZEA 4CH8B 5ESTE 2IJOB 2C8XB 4ABGA 5HM9A 3U1JB 1HV7A 1UW7A 1LPKB 5TJXA 3OY6U 4JYVH 1SFQB 3DSOA 1WBGB 1TPAE 1XVMA 3GCHB 2BLOA 2HALA 2KZ4A 2PP6A 4IN1A 5DJ7A 2ZC9H 3FVFB 1MAXA 1QCPA 3OSYA 3UR9A 1EZQA 1GMCF 4Z6AH 1N8OC 5H4IB 1EAIA 1GI2A 1GHVH 3B23B 2BHGA 4XBCA 4OM9A 1KTSB 2BQ7B 3A8BA 2OC1A 1W7GH 2SGQE 2IPHA 2RA3A 1C2GA 1FQ3A 2ASUB 2C8WB 2PKSB 3CS0A 5E0HA 4H42U 3BTDE 4IC6A 2A7JA 1K22H 3L33A 3SNDA 1QBOA 2A4RA 1P02A 2AH4X 1JBUH 1O2LA 1NRQH 3T26A 1MQ5A 1J9CH 3ODFA 1L0ZA 5F8ZA 3PO1B 1BRCE 3ZV8A 2FI4E 4DIIH 3PWCA 4BXWA 1O3CA 3W1EA 3PLKA 2YNAA 3UREA 1L4DA 2QN5T 1XKBC 5EQRA 2HNTF 3S9CA 1D3QB 1OXGA 2FLRH 3LGWA 1V2UT 4ABDA 3S7HB 1DDJA 1GJ6A 1C5UA 3OYPA 4I33A 4JZEH 2LNCA 1TGSZ 4ESTE 2P8OC 1Y5UT 1V2LT 2H5CA 2ZDMA 4CRFA 3STIA 1Y3UA 1EKBB 2B0FA 2ZFFH 3KYFA 1E1QD 1C5OH 3DCLA 4ABHA 1T4UH 1ELDE 1TNLA 2C8ZB 4B2CA 1D9IA 3K6ZA 3SJKA 3BTME 4PROA 3ATLA 1FAKH 4RT1A 2Z9KA 2STAE 8KME2 1AFEH 1MBMA 2OLGA 3EE0B 1C5VA 4JK6A 2A4QA 2VIWA 2YMSB 3NXPA 2BX3A 1QY6A 4YZUA 1MZDA 1T32A 1UVTH 1GI4A 2KFWA 5IYTA 3GICB 1ZSLA 2J95A 1AFQB 1IAUA 2VWOA 1Z1IA 4OGYA 1O3AA 1O2OA 1SC8U 2D8WA 1AIXH 3TGKE 5LH8A 3GDVA 3PO1C 4RKJB 3M7QA 1AU8A 8LPRA 4D9QA 1C1WH 2L6OA 3TGIE 1SLVB 2G51A 3BEIB 3QX5H 1K1PA 2FIRH 2F9OA 1RRKA 3SNAA 1XX9A 4AG2A 2C93B 2KCPA 3UNSA 1AMHA 1TE0A 4INHA 4Y8YA 5T6FA 3RXGA 4LZ4B 3PM3A 3RXEA 2W5EA 3A8AA 4NZQA 1HIAA 2R3UA 5EJZA 1MH0A 1ZGVA 1LMWB 3IG6B 2G55A 9ESTA 1O0DH 4WY3A 4AG1A 4BAOB 3QK1A 4FUBA 2ZFRH 3LOXA 1LHEH 5C0UA 4KP0A 3GDSA 2ZF0H 3PB1E 2Q6GA 3LGVA 3VB5A 4RSPA 1RIWC 1PFXC 1EATA 1K1LA 1WDIA 1WTGH 1ZRBA 2SGEE 3VB6A 3SU0A 1BHXF 1BBRE 3LIWA 1EAWA 1TB6H 1V2MT 2Z7FE 1B5GH 4Y11E 5GXPA 5EXMA 4Y79A 3A8CA 4K3JA 1RD3B 3AAVA 3LPRA 3STJA 5GCHG 2GDEH 2QF3A 1Z8RA 3TPIZ 3LGTA 1O3KA 1P57B 1P05A 1BRAA 5LGOA 1WAYB 3T5FH 1TPPA 5DSFA 1SSXA 4A5TS 2QYIA 2HGTH 1P3CA 3ENSB 2ZFSA 1T8NA 3M37A 1BDAA 1YM0A 5B6LA 3PMAB 1MUEB 3L3TA 4YLUA 1JXPA 1P09A 1H9LB 4FUGA 1G3DA 5CDFE 3DA9B 2B5TB 3HGNA 6CHAB 2CXVA 1GGDB 2BD9A 5DP6A 1TGTA 1UK3A 2UUJB 1W0ZU 3DHKH 1AE8H 2BOKA 4D76A 4VGCB 3DSPA 2XBVA 3CENA 1LHDH 2ODQA 1YPMH 5C1XA 5DP3A 5JB9S 3TNSA 4ZUHA 2JIZD 1VCQA 5C17A 3E91A 5FAHA 1P2IA 2TGPZ 4AGKA 5EPNA 2J34A 2FPZA 2GGVB 4NG9H 2WV9A 4ABBA 1C4Y2 1DWEH 1AVWA 1UTMA 4ZKNU 1MCVA 2ZFQH 4B6EA 1JMOH 1MTUA 1RGQA 1FV9A 1KDQB 3EA8A 5JBAS 2XBYA 2AYWA 5C20A 2ZO3H 3I78A 2A4GA 4O3UA 4X8VH 1H9IE 3F68H 5LPRA 1DANH 2V0BA 2VVVA 1TRMA 5C3NA 1S5SA 4O3TA 3ZZ4A 1O2GH 1SFIA 1VKYA 3RMLH 2OC7A 3TK9A 8GCHF 1YPHE 1ZRKA 1BOQA 1RS0A 5DP9A 2WPDD 2BDGA 5FX5A 5L6NH 3SU6A 2AGIX 3MH5A 3PV2A 4BNRA 1YPEH 2WZQA 1E34B 2XCNA 2QA9E 4CHAB 2GMTB 1C2EA 5EU8A 2ZDVH 5L2ZH 4YOGA 1ZPCA 4Y8ZA 1GI9B 4X6OA 2BD5A 4R8TB 1HAOH 2G52A 3O8BA 1E0FD 1HB0B 4K1SA 3O8RA 1O30A 1O3LA 4DT4A 1CSOE 5FPYA 1BHXB 2QXJA 3LJOA 1TAWA 2RDLA 2B8OH 5SGAE 2IJD1 3RU4T 4DIHH 1EAXA 2BVXH 1NM6A 2BDCA 5EG4A 1AVXA 1O2PA 1Q31A 1GHAG 1SVPA 1TABE 2A2QH 1ZMJA 1K0HA 1UTQA 1VJ9U 2A45B 2BYAX 3HKIB 4CRDA 2FP7B 2F83A 2ZHEH 1XMNB 1QA0A 2O8MA 1UTPA 1D3DB 1CA0B 1FXYA 1O3DA 2JETB 3MYWA 1OX1A 3BN9A 5IDKA 3MNCA 1MZAA 1P11E 4YO9A 4FUFA 4I86A 4OS6A 2JH0D 5BRRE 4YT7H 1E35B 1Y3XA 2JKHA 1QRZA 1WCZA 1K1OA 5CE1A 1ZPZA 4YT6H 1O2KA 3BF6H 5ETXA 3D62A 3SU4A 3D65E 1HAVA 3KQDA 4MDSA 3MNXA 1TMBH 4E06H 3DFLA 1SQTA 1SGFA 4NSYA 3ZYDA 4XBBA 2D26C 4RKOB 2ZU1A 1W13U 1A5IA 1QHRB 4NFEA 2Y5GA 4D7FA 3N7OA 3E6PH 3ZZ7A 2FOBA 5HM2A 3UWJH 1C5MD 2UUKB 2BDBA 2TPIZ 4JYTA 4MVNA 4B76A 5EXLA 1CU1A 2SGFE 3M7UA 2FXRA 2VIQA 3ZVBA 5HIZA 1A46H 1O2MA 1ORFA 2AEIH 1EZSC 2R3YA 3UWIA 3AW1A 4Z1MD 1NTPA 2PSXA 1B0FA 4AB9A 4F48B 4X2WA 4R0IA 1GHBF 4MLFB 4TWWA 1W2KH 4Y76A 4TSFD 1O3MA 1AQ7A 3TNTA 2ALVA 1RTLA 3GS9A 1TNIA 3Q3YA 1GMDF 1HYLA 1SLUB 4F55A 5KEDA 1CA0C 1FAXA 1VGCB 1O2ZA 3LC3A 1JIRA 3SGAE 3VFEA 3QN7A 2VIPA 3KQEA 1DXWA 2QXIA 3KN2A 3SNEA 3VB7A 2QCYA 3ZYEA 4IGDA 2GP9B 4X1PU 1OS8A 1H8IH 3SI3H 5J4SA 2BTCE 1GI1A 5LPEA 2M5TA 1TALA 2G5VA 4IMQA 3AW0A 2F9BH 3SZNA 1DVAH 1DWDH 1D3TB 3F0OA 1F5RA 1PPZA 4OS4A 3GYLB 4UONA 2ZTYA 2P95A 3SJ9A 1AKSA 2R2WU 2ZU4A 4NZLA 1UHBB 2JJ2D 1EXFA 4NSVA 1FDPA 4JMYA 1NN6A 4BAMB 1PPEE 1F92A 4GCHF 3M7TA 3GCTG 1EFRD 1VITF 2OBOA 1AN1E 3KQCA 1O3BA 1GBJA 1BMNH 1C5SA 2BD3A 3GY4A 1Z6EA 3Q3XA 4DY7B 1C5RA 3EGKH 4FUIA 1YBWA 3T25A 1J8AA 1O2UA 2Q6DA 3SO3A 1EJAA 2FOHA 1O3EA 2A1DB 2ODPA 1O3NA 2QXHA 4CH2B 2Q1JA 1GBTA 2AMPA 3KCGH 1C4V2 4GAWA 2CF9H 2NWNA 1MTWA 5EJ1A 1QR3E 1CHGA 4J1YA 1VGCC 5LPFA 1O34A 4MNVA 1C4U2 1PQ5A 2G00A 3W95A 2WUCA 3JZ1B 1TLDA 1H4WA 1LKBA 1AI8H 1G32B 2ANWA 1IQNA 3RMNH 4B1TA 2PR3A 4BXSA 5JDUB 3URCA 2IN2A 1JRTA 4MPWA 1BZXE 1O5GH 4K2YA 3A81A 1B7XB 1FONA 4JYUH 2YOLA 3LC5A 1S6HA 1O2SA 1Z7KA 2P94A 1GCTC 1QTFA 4FU8A 4U01A 1O5EH 2QC2A 1GBCA 1OHHD 1XUHA 2J9NA 4JZDH 4RI0A 2WINI 4Y6DA 3RXPA 2OD3B 3BTWE 1GJ5H 2VWNA 4NCYA 1NC6A 5KGOA 4JZIA 2H2ZA 3PROA 4K8BA 5JYIA 2YNBA 1GMCG 1H1BA 1DUEA 3KQBA 2VIOA 1C5TA 1V2KT 2Z9GA 3RXUA 5I46H 1YLCA 3A85A 3LDXH 1E36B 3U28C 2EI7A 1ETTH 1P06A 2J97A 3RXHA 1CGIE 1Z8JB 3VEQB 3MNBA 1EPTA 1O37A 1N8OB 2A7CA 4GPGA 4GHQA 1A5HA 1GDNA 2Z3CA 1YPLH 2XC4A 2FZZA 2ZPRA 3MH4A 3HK6B 1CQQA 3SOSA 1IQEA 1O33A 3BV9B 3T27A 5DN6D 2EA3A 2V35A 4K1TA 1AVGH 1O2YA 4HGCA 3SNCA 1MTNC 1FY1A 1UVSH 1BT7A 4X1QU 1XUGA 1C1VH 5E0GA 1C1MA 1T8LA 1OWHA 5FPTA 2ANYA 1HLTH 1QIXB 2V6NA 4KKDA 1UO6A 2VU8E 2KAIB 1LQDB 4INLA 2BDHA 1ESTA 1QL9A 5DP7A 1BJUA 1QL8A 3A7ZA 1N6YA 2XC0A 2GVFA 5AFZH 4KTCA 3SUGA 2TGTA 4CR9A 1Z6JH 1BJVA 1TGCA 1YLNA 4B6FA 2ZHWH 2TIOA 2P8OB 4ZXXH 2OXSA 1HUTH 1D6RA 4RT0A 1DY9A 1C2JA 3RXBA 1H8DH 1YP9A 2BLVA 4NA9H 2NU0E 1XUIA 3E0PB 3TITA 1KSNA 2ZNKH 3Q00A 3T2NA 3SUFA 4CRCA 4MG3A 3LH1A 2BMGB 1C2LA 1CVWH 1MTVA 3B8JA 1FLEE 5I25A 2FS8A 3PWBA 1DUAA 2GCHF 2KCYA 3H09A 4O03A 4KGAA 4NWLA 3PMJA 1O3FA 3EQ0H 4K8YA 1A3BH 1KXCA 2VH0A 1NFUA 3EA9A 3T28A 1DWCH 4NIVA 2GZ8A 2J4IA 2ZPQA 3MU1A 1E79D 2UWOA 1WV7H 2XOKD 2P59A 2WPKS 3T62A 2BY6X 1S84A 1VCPA 3SV8A 1P03A 2M2AA 3HKJB 3M5OA 2YMSD 2A2XH 1T8OA 4Q7YA 1K1NA 1WSSH 4E7NA 2P3FH 1G30B 3RXKA 4ABFA 2VWMA 2Y6TA 2FOGA 5FCRA 4GLYA 4ABAA 1TQ7B 2GJGA 1ACBE 1BRUP 3A7XA 1SQRA 4NFFA 1WTHD 3UIRA 1YPGH 2BLQA 3ZZ8A 1EZUC 1AUTC 1ELCA 4HTCH 1EB2A 2A0QB 4KTSA 2PLXA 3F1SB 2VGCC 5AF9H 4GVUA 2WPMS 3DSGA 3U8TH 2BD8A 4UFEH 3RM2H 1TBZH 3BSQA 1LKAA 3O8CA 1GI5A 2PUQH 1RIWB 4IS5A 1P2OA 2BXUH 1A0HB 1TX7A 2H9HA 2ZIQH 4WF8A 4AFQA 1LHCH 1YF4A 2TGAA 3OAAD 1G3EA 1A7SA 1W14U 1IHTH 2G81E 3MU4A 1BRBE 3M61U 3R3GB 2ULLA 4OS2A 5HYOA 4WXIA 1KLTA 1BIOA 2GT8A 3TGJE 1SGRE 1W8BH 1HDTH 1WU1A 3SU1A 3WWFA 3ATWA 2PKAA 2H9EH 3ZZCA 4ASUD 2HVXA 1O32A 3ZIAD 3SN8A 4X6MA 1HPGA 4K5ZA 5EW1H 1GI6A 4XRNA 1GBIA 4A1VA 1KY9A 2VBCA 3RC5A 1GBKA 2F9VA 1QZ8A 2IPQX 4I8GA 2I6SA 5HIYA 1Z8GA 4JCNA 2P3TB 3RUOA 2FTMA 1DXPA 1AZZA 1NS3A 4OGXA 1C5QA 3A7TA 3ESTA 4FOUC 3UNRA 1GBEA 1GJ8B 2FO9A 3BTFE 1A0JA 3FP8E 3BIVH 5B6OA 5A8ZA 1LVYA 3OTPA 3WW7A 4YTAA 2A5AA 1E1RD 1C2HA 3TH3H 1GHXH 1YC0A 2XYAA 1J17T 4AN7A 2O8TA 1GJAB 2ALPA 3ODDA 4Q80A 1K1MA 4ZROA 1VJAU 3GY5A 3SU2A 4MNXA 3BTGE 1HAZB 3F0PA 2A5IA 5A8YA 1F5LA 1Y3YA 1BMAA 5CMXH 1LPGB 3UTUH 1ZOMA 1GL0E 1Q2WA 4UD9H 4AYYB 1YGCH 1BBRH 8GCHG 2H1UA
chains in the Genus database with same CATH topology
2K1QA 2J38A 2O8UA 1WOFA 3FZDA 1NPMA 2JH6D 1NRSH 1EOJA 1PPCE 2OTVA 2XWBI 1GHYH 3LU9B 1UK4A 4WH8A 1Z1JA 4ISIH 2PTCE 5FCKA 4AGJA 1W10U 4TYDA 2RCEA 1AHTH 1V2TT 2AERH 4UE7H 2QAAA 1QA7A 2FOFA 1TX6A 3GY2A 1EAUA 1IQIA 2P93A 5BPEA 4B2AA 3P6ZB 1LQEA 2AIQA 4THNH 3P8GA 1TBQH 4J2YB 3BTQE 3SU5A 4YOIA 2VNTA 1CE5A 3RDZA 3RXDA 3GY8A 3K65B 2UWLA 3RXRA 1V2ST 2G8TA 4FUHA 3OY5U 3EDXB 3TK6A 1O2NA 1YPHC 4D7GA 3MO9A 4NGAH 3P92A 4TY6A 5AHGH 3S9BA 1P2QA 1BBRK 3NCLA 3OX7U 3H5CB 3QTOH 1H9HE 2HLCA 4F49A 1TOMH 1FUJA 4ZMAH 1CBWC 2SNWA 1LDTT 1T4VH 2W7UA 1FJSA 1HAYB 1TQ0B 3ZZ9A 2PUXB 6ESTA 5A09A 5EOKA 1PQ7A 3K6YA 3JZ2B 2VJ1A 1THRH 1P8VC 5HXFA 2SNVA 3PTNA 1GVZA 3VB3A 2QGRA 5HMAA 2NU1E 2BOHB 1CHOF 1UTKA 4X2YA 1O5AB 3QZRA 1ZSJA 2Y7XA 2XBXA 3TJVA 1HAIH 2CMYA 2GTBA 4IW4E 5E8EH 4WMFA 1GWAA 2FMJA 3E16B 4OS1A 1BTYA 1LVMA 1ZZZA 5DP8A 2CF8H 1GG6C 4X2VA 4BAKB 1F0UA 1QGFA 3NWUA 2DUCA 2AGGX 1UK2A 2Q6FA 4I31A 4ISHH 3A86A 1MD8A 1GHBG 1W11U 3RXIA 3V3MA 1O3OA 3S0NA 1S81A 5C1YA 3KNXA 5EQQA 4AFUA 1FIWA 4QT8C 1GMDG 1JOUB 2WV4A 4A1TA 1AUJA 3FZZA 2BD2A 5EXNA 3ATKA 3F9GA 4DGJA 1TA6A 2DE8A 1NT1A 2ZI2H 1EB1H 4B75A 2ZDNA 2OQUA 4B74A 1AB9C 3WY8A 3E8LA 1FNIA 1SB1H 4BOHA 2AS9A 3RLYH 1C1QA 4X1RU 1NFWA 2HNTE 1LVBA 3UPEA 3E3TA 2O8WA 4ZXYH 2Z3EA 1C5YB 2Z3DA 1TX8A 1TGNA 3U9AH 1ANBA 3UQOA 2GCTC 5EODA 4X8SH 1VCWA 3FP7E 3SUDA 2CV3A 6GCHF 2FS9A 1BA8B 6LPRA 4A6LA 1O2JA 4FUCA 1PYTD 1P2MA 1TONA 4XE4A 3TIUA 1MKWH 1LPZB 1HAHH 5TCAA 4GCHG 1G3CA 4BTIB 1SL3A 3A80A 3QGJA 5JB8S 1VITG 3KF2A 1QNJA 1BITA 5DP4A 1P9SA 1L4ZA 2WPHS 2ILNA 2Z9LA 5JPMH 5K0HA 3K2UA 2EI8A 2ZHQH 1O5BB 1FY8E 2AMQA 1O2TA 3RXLA 1ZMNA 2BD4A 1WQSA 5A0AE 2SGAA 1L2EA 1JWTA 1O2IA 2J94A 1S82A 1ZHMA 5DPAA 1CT4E 1BCUH 2ZU2A 7GCHF 2R0KA 2GD4B 4MQAA 1C5PA 1GVLA 4AORA 4X6PA 2FI3E 1SG8B 2ESTE 1A61H 1D6WA 2TGDA 3NKKA 3G01A 1O2XA 2ZDLA 1BB0B 2THFB 3GOVB 2ZHDA 2R2MB 2OP9A 4YOJA 2A7HA 4ZKRU 5EW2H 2DE9A 1TNGA 1XUKA 1G37A 2Z94A 4FU7A 1MKWK 3MTYA 3ZVGA 4CRGA 2ZGCA 2ODYB 3RM0H 5F8XA 1KDQA 3TLOA 1FPCH 3OU0A 4NIYA 4ASHA 3RXOA 1BTUA 4YM9A 1PPBH 1LTOA 1P04A 2HPQH 2UUYA 3P70B 3R0FA 1GL1A 2HPPH 1VZQH 1GCTB 3A7YA 3SJOA 4U2WA 3GCOA 2WUBA 3TJUA 4WWYA 1O5FH 3VXFH 3KEEA 1T7CA 1J16A 4H6SB 4SGBE 1IQLA 1ZGIA 4OS5A 1C5LH 1WUNH 2CHAC 3ZVFA 1GMHF 4JK5A 2OC0A 1OWDA 2PSYA 4DG4A 3PLBA 5L30H 4DURA 5L2YH 3FFGA 7LPRA 4NIWA 2XTTB 1GPZA 1HJAC 3SI4H 1ZSKA 1TYNA 3A84A 4HI3A 1Y8TA 2ZGJA 5AVDA 1C2FA 1FN6A 3E1XB 3L6PA 3B9FH 1HJ9A 1MKXH 1FZZA 2FESH 2FOMB 1A1RA 1RTKA 1SGCA 4YLQH 2C8YB 4LZ1H 1PPHE 1MTNB 1N1LA 1GJBB 4H6TA 5GJ4B 1DITH 2VWLA 1C1UH 3KIDU 3OTJE 1EPTC 1QJ6B 1GI0A 4ABIA 1OWKA 3BTKE 1C5WB 1FPHH 3ZVCA 3AAUA 1UCYE 3BEUA 4CRAA 5EQSA 3SV9A 2RA0A 2ZDAH 5AFYH 1TNKA 1O2WA 5K7RA 1UTJA 4UFFH 3TJOA 5G4BA 1F0RA 2F91A 4ZKSU 1HJ8A 3EA7A 1AO5A 3FANA 4D8NA 3A83A 4AOQA 3TU7H 2W26A 1FY5A 1OSSA 2PFEA 4FUEA 1P9UA 4X8UH 1SOZA 3BTEE 1LHFH 3SGBE 4ZHLU 1Q3XA 1ZTLA 2QXGA 1O35A 4TWYA 3EAJA 3F9HA 1E38B 3AVZA 1MKXK 1QB1A 2R9PA 1C1RA 4IBLH 5J4QA 1QQUA 3A7WA 1G36A 1GBDA 1O39A 2GCHG 3SU3A 4WMDA 5GDSH 1BMMH 1IOEA 2BD7A 1RTFB 2PV9B 5FX6A 1ETRH 3P8OA 3MH7A 2ZP0H 3BTHE 1XKAC 5EPYA 1TGBA 1GVKB 1C5NH 1GBHA 2BZ6H 1RFNA 1GHZA 1NESE 3ITIA 2ZCKP 3Q76A 1IQFA 1KLIH 1THSH 1HAGE 3BIUH 5HGGA 1SHYA 5JBCS 1IQHA 2GX4A 3NZIA 4K60A 1VR1H 4GSOA 3RXJA 1CO7E 3A87A 1C2IA 2BZAA 3H7TA 1GBMA 1HXEH 1NRRH 4UEHH 4ZHMU 4WXVA 1GBLA 2ZQ2A 2ZHFH 5E2PA 3SHAH 3UY9A 1HXFH 3P8NA 4FXGH 1U6QA 2PKAB 3A88A 1XXDA 5DG6A 1P10A 3DFJA 2BQ6B 3F6UH 1DFPA 3HK3B 3ATMA 4TY7A 1L1NA 5E2OA 4CRBA 1F7ZA 2F9UA 2H5DA 5FPSA 5DO4H 4BTTB 1SQAA 1ZJDA 5FHTA 1T8MA 4HZHA 3RXMA 1Y3WA 1DLKB 3RXAA 3MO6A 5FBEA 2VGCB 1NO9H 2ZWLH 5CHAC 1GBFA 1Y3VA 2HOBA 4F4OC 1LVOA 1SLWB 1LCYA 1GBBA 1HIAB 1W0YH 1IQKA 1ZYOA 3TH4H 1F0TA 3VB4A 3RMMH 1ELGA 1QBVH 2XCFA 9LPRA 1GBAA 4XSKU 2I6QA 4BAHB 4DJZB 1O3IA 3LGIA 3O8DA 1EJNA 2ZZUH 5FBIA 2Y80A 1C9PA 2ZCHP 3ZVDA 3ZVEA 3ZZ6A 1UVOA 1IQMA 1HBTH 2NU4E 4O9VA 5FXLA 1C1NA 1SGPE 1BTHH 2NU2E 1SGNE 1MMJN 3U8RH 3TJNA 2QV1A 3M35A 3GCNA 1N6XA 2WPIS 2PW8H 1WQVH 3FP6E 2GV7A 1KYNA 2OUAA 2GV6A 3VGCB 2H6MA 3ZZ3A 1J15A 2BVSH 1BMLA 1QQ4A 4GHTA 2CN0H 1BQYA 1TRYA 1YCPM 2BX4A 1DOJA 1OWEA 1GHWH 1GJ7B 3PYHA 4I8KA 3P8FA 3RMOH 1HAPH 5C67A 3QTVH 3QZQA 7KMEH 5A8XA 1WYKA 1ZJKA 2R0LA 1PJPA 1Z8IB 2P3UB 4Y8XA 1FI8A 1A2CH 2C3SA 2QIQA 1BTWA 4NIXA 1F5KU 1KXDA 1EZXC 3GY3A 1G2LA 3MWIU 1AWHB 2Y82A 3LH3A 3UOUA 3D23A 4JZ1A 1MBQA 1P2NA 1QB9A 4CBOA 2AGEX 3VPKA 2ZPSA 2J92A 4GUXA 1C1OA 3TVJB 1VITH 1EOLA 3NPSA 3S69A 1TIOA 3GCHC 3IITA 1ETSH 3BEFB 4LXBH 3RU4E 1ZTJA 3SBKA 2WPLS 2XNIA 2ZU5A 1EJMA 2VIVA 1QRXA 2ZECA 4AFSA 1MQ6A 1T31A 3V7TA 4JZFH 1LO6A 2FLBH 1SGDE 3RXQA 2KAIA 2VVUA 1KXBA 1V2PT 2PKSC 2J2UA 1FIZA 1HNEE 1W3CA 3CS7A 3BG8A 3A89A 3F9EA 1ELBA 1C1TA 1P3EA 1DSTA 1S6FA 4B73A 3RXSA 3VGCC 1PPFE 2W3KA 4AX9H 2IOTA 4CR5A 5ESBA 1IQGA 1CA8B 3HGPA 3KGPA 1L1JA 1GJCB 1AY6H 2RG3A 2FWWA 1O3HA 1MD7A 2BY9X 3P95A 3MU5A 1SOTA 3PMHB 2FOEA 1CBWB 3UFAA 1V2RT 2FEQH 2XWAA 1B0EA 1EP5A 1ABJH 5PTPA 2BB4A 2O9QA 1SQOA 4YESB 1ZHRA 1S85A 1CHOG 2UUFB 4UDWH 3QLPH 1NU9A 3MO3A 2FI5E 4MPVA 4ZKOU 3UR6A 1AGJA 4XDEA 1C2KA 1V2QT 1KXFA 2A31A 1DICA 2FDAA 1C1SA 2PWXA 1TPSA 1GJ9B 5F6MA 4IC5A 2ZCLP 3S9AA 3SV2H 3GISB 4U32A 1HAVB 1GG6B 2XW9A 1SGYE 4O97A 2Z9IA 3PMBB 1SGTA 3I77A 5T6GA 1ELAA 1KLJH 2P16A 1TMUH 3AASA 3UUZA 3U98H 1BTXA 2CGAA 1P01A 3ZZBA 3ZVAA 3ELAH 3RXTA 1YPKH 2GDDA 1V2WT 1EQ9A 1NRNH 1QB6A 3VXEH 1ANCA 2TRMA 1AFQC 1D3PB 1LHGH 2C4FH 3M3VA 1QBNA 3UOPA 5F8TA 3SORA 1TBRH 2ZGHA 2ZTZA 3GY7A 1QURH 3W94A 1ELVA 2FOAA 3MI4A 3A8DA 3SV6A 1ELEE 1ID5H 1AB9B 1QFKH 2A32A 4SGAE 1W7XH 1V6DA 4ZAEA 6GCHG 2VIDA 1OYTH 1AZ8A 2GCTB 5E0JA 3HPTB 1XXFA 1G2MA 1ZR0A 1NY22 4A92A 2VH6A 4B2BA 1DT2A 3C27B 5T6DA 3D49H 3ZZDA 1S83A 3A82A 4KTUA 2PTNA 3NK8A 1TWXB 2B9LA 1DPOA 1X7AC 1C5XB 1S0RA 1OKXA 3LONA 2XBWA 1Y5AT 4KELA 1SGQE 2XRCA 2V3HH 1ANDA 4IN2A 1GI3A 1HRTH 1GJDB 2FTLE 2WYJA 2BY7X 2WYGA 1BTZA 1HCGA 4HFPB 2ZU3A 2Z6BD 4TPIZ 3ATIA 3SJ8A 3URDA 1UVUH 2HNTC 3BTTE 2D2DA 1O3JA 3LGYA 4Y7BA 2G4TA 2Y7ZA 2XC5A 3TH2H 1K1JA 4BAQB 1SMFE 3I29A 4DVAU 1D4PB 4MTBA 3V12A 3MOCA 5GIBA 7GCHG 3LKWA 1AKSB 4WJG2 3RLWH 3U1IB 1EX3A 2HRVA 4DOQA 5JBBS 4MPUA 4OS7A 5GCHF 4MNYA 3MU8A 4A7IB 1IHSH 1Y59T 2LPRA 4ZHAA 1F2SE 4FUJA 2XXLA 1DLEA 1ELTA 2JH5D 5TCCA 6CHAC 2QY0B 3SW2B 1GGDC 1ELFA 1HAXB 3E90B 2EC9H 4Y0ZE 1P0SH 1YYY1 4I7YH 4X0WU 4VGCC 2ZDKA 1CGJE 1O2VA 4FVBA 5F03A 4FU9A 4NWKA 1ZLRA 2HWLB 1J14A 1YLDA 2VB0A 2ZG0H 5A0CA 4ABJA 3Q77A 1V3XA 2WV5A 1V2NT 1ESBA 5A0BA 2PGBB 3SQHE 1P2JA 3M36A 1P2KA 2GZ9A 2ZEBA 2O8LA 4X8TH 2BY5X 2ANKH 4Y7AA 1C2MA 1SI5H 5DK1A 1EP6A 3MU0A 1V2VT 4X1NU 1GMHG 1NROH 4CBNA 2F9NA 2GZ7A 2OINA 2SFAA 1A4WH 4D9RA 3S7KB 4B71A 2W7SA 1TNHA 3E0NB 3NUMA 2CHAB 1OYQA 3ZZAA 1GDQA 4XOJA 3SV7A 8ESTE 1KXAA 1DM4B 1O3GA 4TPYA 3MFJA 4NA7A 3BG4B 1HJAB 1THPB 4ISOA 1UTOA 2FM2A 1O3PB 5EGMA 4CHAC 2GMTC 2AIPA 1XUJA 3SNBA 3ZZ5A 2FYQA 3EYDA 1KXEA 2GT7A 4M7GA 1QRWA 2OC8A 2Y5FA 1NRPH 1ZPBA 2D1JA 2G4UA 5DGJA 5C1UA 1O38A 3M5MA 2BM2A 2VVCA 1EPTB 1ZHPA 1SGEE 2V3OH 3U69H 1GJ4H 1K2I1 4I8LA 3GDUA 1A5GH 1C5ZB 1NZQH 1SBWA 2BDIA 3LJJA 2Y81A 3QDZB 1CT0E 3QGNB 4WVPE 4X2XA 1K21H 2STBE 1ZMLA 4CREA 1EUFA 1OP0A 2FOCA 2H9TH 1E37B 2BVRH 4A1XA 3DT0H 2SGPE 4Y71A 3RXVA 2JETC 2BY8X 2ZFPH 1GHAF 1OP2A 2TBSA 4Q7ZA 4AFZA 1ANEA 2FODA 1Y5BT 1SLXB 1RJXB 5GWZA 4Z0KA 1M9UA 3PLPA 1PQAA 2ZGBH 4I32A 2ZFTA 3UQVA 1FY4A 1G3BA 4MNWA 3KHVA 1SHHB 3T29A 3SQEE 3GYMA 4WH6A 1GCDA 1CGHA 5ABWA 1ZTKA 4BANB 2GKVE 3LT3A 1XM1A 1O2HA 1Z71A 1C1PA 4ABEA 3BG4C 1O5DH 1QJ7B 2AFQB 3QO6A 1OWJA 1OPHB 4IMZA 2A5KA 1JRSA 2WPJS 5DKMA 4I8JA 1C2DA 2FYRA 2OCVB 1ARBA 3C1KA 3UNQA 4X6NA 3SGQE 1PQ8A 4U30A 1UVPA 3SHCH 1V2JT 2W3IA 1DX5M 1NU7B 1INCA 5A2MH 1V2OT 2OBQA 4INKA 2F3CE 1MU6B 1UCYH 4MPXA 4Y0YE 4K69A 2QF0A 1DS2E 3GY6A 4AYVB 1UTNA 1RXPA 5GPIB 4LK4A 4XFQA 5DP5A 1O2RA 4Y10E 1K1IA 4Q2KA 4K1EA 1PYTC 3SUEA 1A3EH 2ZQ1A 3QWCH 4AB8A 3M3TA 4FUDA 2EI6A 4AZ2B 4ISLA 1FMGA 3V0XA 3RC6A 3V13A 2FX4A 4UFDH 1AD8H 3HATH 4UFGH