1GDUA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 53
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gduA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gduA01
1XX9A 4X6MA 4FVDA 2AEIH 3E0PB 2J4IA 3O8BA 4ZMAH 1RS0A 3RXVA 2XTTB 1YCPK 3QN7A 5ESBA 3SGQE 1FI8A 1GJ9B 4FUBA 3F1SB 1P03A 4GCHG 3RLYH 2ANYA 4ISIH 2ZDMA 3VB4A 2O8UA 3AAUA 4BANB 2ZQ2A 1FAXA 2BLOA 2D8WA 3PLPA 2ZHFH 3P70B 2BDYA 5GXPA 1PPBH 1S81A 2FI5E 1O2KA 2FXRA 4CRBA 4YOGA 2GX4A 3UTUH 2M5TA 4UD9H 3T29A 2GZ8A 1BQYA 1ZTKA 2VVCA 2BD2A 3FZZA 1EPTB 1LVMA 1V3XA 2BOKA 2Z6BD 2ZFTA 5ESTE 3P17H 4ZKSU 2BDAA 3T27A 2CMYA 1HAVA 2BY8X 1P2MA 2VIDA 1SOZA 3O8DA 1ANCA 3IG6B 4OS1A 1HYLA 2ZGHA 2BY5X 4MNYA 4U32A 1LKAA 1A0HB 3N7OA 4ZKNU 4DW2U 1OP2A 1JWTA 1WQVH 2ZGJA 2GD4B 2G81E 2ZHWH 1O5GH 1O3FA 1DS2E 1XVMA 3SUEA 1C9TA 2R0LA 3H7OA 1DPOA 1AKSB 1EZUC 4Y7BA 3PWBA 4A1XA 2XC0A 3RXGA 1RTLA 4KGAA 1TMUH 1PPEE 3TNTA 2XC4A 3ZZ5A 5BPEA 1CGIE 1O3GA 5L30H 1O2GH 3MOCA 2WV4A 1YYY1 3OX7U 4FU8A 2BYAX 8ESTE 2GCHG 3LH3A 4K8BA 1MTSA 3MU4A 1TAWA 1C1PA 1NROH 1A4WH 1IQJA 1TGCA 2G51A 2GMTB 3QTVH 1BJVA 1BTXA 1YPJH 5JYIA 5K7RA 4K3JA 2EC9H 1QHRB 2J92A 1NN6A 1XUGA 1P09A 1J14A 1UHBA 2BLWA 2ALPA 4X6NA 2RCEA 1O30A 1S82A 1O38A 1IQGA 3RXBA 1CT4E 1O2OA 4X1PU 1C5WB 1TA6A 2W7UA 2ULLA 1FZZA 1AI8H 1C2DA 1K1NA 1QRWA 9LPRA 5EQQA 1SL3A 4FU7A 1WBGB 3E3TA 1QJ1B 1K2I1 5HM2A 1RFNA 1ELBA 1CT2E 3MYWA 1GVLA 3TIUA 1ARBA 4NIVA 3O8CA 1C5XB 2H1UA 1DWEH 3PO1C 1DUEA 1SLXB 4R8TB 1O2ZA 5EXMA 5ETXA 3A8DA 3BTME 1SQAA 1PQAA 1AHTH 1AWHB 1IQMA 4DCDA 1BTWA 2HLCA 3TGIE 4KP0A 1W12U 1ABJH 1MKXK 3RC4A 1GVKB 5E0GA 1ZZZA 2ZCHP 1Z1IA 3IITA 3C1KA 4OS5A 1AVXA 1QRXA 4X8UH 2BZAA 1FXYA 1SGIB 4FUHA 3V7TA 4A7IB 1VJAU 1MU6B 1WQSA 5FBEA 1ARCA 1FDPA 1ZLRA 4I8JA 1F5KU 4ISHH 4K2YA 3OSYA 1P3EA 4WF8A 4B2CA 3TK5A 4SGBE 5FAHA 1Y3VA 2EI6A 1HLTH 3UNSA 2JH6D 5DO4H 1ELFA 5LH8A 1A5IA 1C5PA 3VGCB 4CBNA 4DY7B 2HNTE 2ZFQH 2A4QA 3OYPA 2QXGA 3BTDE 5GPIB 3ZVEA 1O2WA 2TBSA 3K9XB 4X1QU 1O36A 1O2RA 1ETTH 1HIAB 1L4ZA 4UFGH 3SQEE 4CH2B 2O9QA 2FOHA 1GHXH 1LTOA 1XUHA 2YNAA 3V12A 2VVVA 1JXPA 2ZGBH 1TPAE 2ASUB 1UVOA 4MTBA 3B9FH 4K8YA 3A8BA 3ODDA 1A5HA 4OS2A 1GHBG 4ESTE 1TMBH 1ZHPA 1Z8RA 1QB6A 4X2YA 3L33A 4MPXA 3UUZA 1N8OB 1P06A 2BDBA 1SSXA 2LPRA 3RP2A 3TK6A 2Y5HA 1P2QA 4JK5A 2W3KA 2BDGA 4KTSA 2NU0E 1TGNA 1UK2A 2AFQB 1DICA 2ZFFH 5G4BA 2Y5FA 1O37A 1D6RA 1DVAH 5GJ4B 2WPJS 4ZROA 2FX4A 2WUCA 4TY6A 5FHTA 3RLWH 5AHGH 4B74A 1MZDA 3GY5A 2XBXA 4ABEA 3U1JB 1UTJA 4NWKA 3GCHC 1MKXH 1QL9A 4NA9H 3FZDA 2BTCE 1NM6A 3QO6A 3VB7A 1MTVA 3FAOA 1N6YA 1SLWB 4INKA 1SGQE 1KTTB 2KAIA 2PGBB 5FX6A 1MCVA 1TE0A 1L4DA 5A2MH 1RIWB 1AWFH 3LKWA 3M5OA 1P9UA 3TVJB 1TWXB 1W7GH 4IBLH 1IHTH 1OPHB 4WH6A 3HKJB 4DIHH 1C5MD 1K1PA 1ZJDA 4JCNA 3LU9B 1BRBE 4TWWA 2WPHS 1SGNE 1EQ9A 1TBQH 1ELCA 2PWXA 1P11E 4HFPB 1ANDA 2AIPA 3BIUH 2HNTC 1Q3XA 2JH5D 2WPKS 1GHBF 3SU3A 3RU4E 1RTFB 4ZH8A 4ABFA 2A5IA 2ZGCA 1O3DA 1O5CB 3TJNA 3ZV8A 3M3VA 4DGJA 3RC6A 3BN9A 1CE5A 4Q7ZA 5T3HA 2G00A 2WPLS 1V2MT 2FOMB 4Y8ZA 3LC3A 3UWJH 2PR3A 4I33A 1NC6A 1GJ8B 1HJAB 1C2JA 1VGCB 1C5TA 1AKSA 1YKTA 3STJA 2BD3A 2HALA 2OC7A 4D9QA 3E1XB 1O32A 1T8OA 4BAHB 1LKBA 3A7ZA 1PPZA 3HGPA 1YBWA 3HPTB 1T8MA 4AORA 2HVXA 4ZUHA 1C5OH 5DP3A 2Y82A 3LGYA 3BF6H 1JRTA 2WYJA 2WYGA 2XW9A 4JZIA 2BD8A 1ZTJA 1W0ZU 1B5GH 2PV9B 1OYQA 3SGAE 1H4WA 2K1QA 1T4UH 1HAYB 1KY9A 2I6SA 4WXIA 3ZZ8A 1FPCH 3ZZ6A 4YZUA 2QV1A 1SGYE 3PLKA 2A45B 1ORFA 4Y0YE 1TRNA 1WOFA 3ATIA 4TPIZ 1LVYA 1Y5BT 3HKIB 6LPRA 2FODA 1DE7H 1EOLA 2Q6DA 3BTHE 5F6MA 3M36A 4UDWH 3T25A 3ZVFA 4RN6A 3FP7E 2BOHB 1O5FH 1P01A 3P6ZB 1AQ7A 1A3EH 3T62A 2EA3A 3M37A 3KL6A 4O97A 1ZHRA 1XVOA 5FX5A 1S83A 1C2EA 1O3CA 1P10A 1EJNA 4X2XA 1OKXA 5HXFA 4BNRA 4MPVA 3KQDA 3LGIA 3EDXB 1WUNH 5DP6A 4A92A 3MWIU 1A0LA 3BEIB 1DWCH 1O2MA 2BDIA 2ESTE 3MI4A 5J4QA 3BTQE 1LO6A 3GCHB 1ACBE 1OWEA 1GI2A 1BDAA 1EOJA 1GDNA 3VFEA 1W13U 1SFQB 1P57B 2F9OA 4CREA 4NA8A 1C4Y2 5DK1A 3GY2A 3MH5A 1MBQA 3ZVGA 1BMMH 1F5RA 2AYWA 4MG3A 1V2LT 4Y7AA 1V2OT 3ZVBA 2ZFRH 1FAKH 2ZU3A 1GHWH 2ZU4A 4NCYA 1OX1A 2BD5A 4IN2A 1TGBA 1EJAA 1EB2A 1MTNC 1CA0C 2ZFSA 4XFQA 2PFEA 3UNQA 4AFUA 4D8NA 1KXCA 1KIGH 3ZYDA 3A81A 2ZDNA 3LGWA 2BVRH 4AN7A 1LHGH 3FP8E 1QNJA 3I29A 4ZHMU 1HFDA 1UCYK 2JETB 1AFEH 1ELAA 1C1MA 1FQ3A 4XE4A 5EPYA 1Y8TA 1GMHG 2XCFA 2D26C 2BLQA 4D7FA 3IWMA 1K9OE 1YPHE 1GHYH 1Q2WA 4FUDA 4IMQA 2UWOA 1P05A 1RJXB 1TX7A 4YM9A 1QBOA 1O3HA 5DP7A 4XBBA 3MO3A 5CE1A 1UVSH 1Z1JA 4KTUA 3BEUA 4H6SB 1EZQA 2ODPA 1H1BA 3TH2H 3SOSA 4NG9H 5A0CA 1DLEA 4Z0KA 2FIRH 1O3JA 5JBCS 1J16A 1KTSB 4X2VA 1SGFG 1GI4A 1S0RA 1WSSH 3KQBA 3E0NB 5C1XA 3RXHA 3B8JA 2CV3A 5EPNA 1Y3XA 3NK8A 6GCHG 4JK6A 3SZNA 2AMQA 1GBTA 4X2WA 1GBAA 1T8LA 2BX3A 1Y3UA 3A87A 1DX5M 3DFJA 1V2KT 2SFAA 1BBRE 2Q1JA 3R3GB 3RC5A 1FIZA 4FUGA 7GCHG 5DGJA 1D4PB 2Z9GA 1UTQA 4GPGA 1O2PA 2VIVA 1TNLA 2OQUA 2YNBA 1W10U 3EYDA 1UVUH 1AFQB 1PQ7A 1YLCA 3SU5A 4IW4E 3WY8A 1AD8H 4CRCA 1S84A 3ZZ7A 2HWLB 1OWKA 2B9LA 3QZRA 1F0RA 1JBUH 3SBKA 1O2IA 1QQ4A 2PKSC 1GJAB 4JZ1A 4LXBH 4DIIH 3GY7A 2V3HH 5LPRA 3ZZCA 4B2BA 4DOQA 1CA8B 1GBKA 4B76A 3Q77A 3SW2B 2W7SA 4B1TA 1DXPA 1UVPA 3D62A 4NSVA 3BG8A 1SVPA 4LZ1H 2CXVA 3QZQA 4DURA 1LCYA 3VXFH 2AGEX 1F5LA 2ZDKA 3BTFE 1EP5A 2DUCA 1NT1A 1YP9A 1ZJKA 2PKSB 4JYTA 1U6QA 4UFFH 2P3UB 1DT2A 1CSOE 1P3CA 4X1NU 1J17T 3UR6A 3ESTA 1SB1H 2P95A 2GGVB 3FVFB 3RMNH 3UFAA 4WMEA 1WTGH 1QBNA 2OQ5A 4NZQA 5GCHG 4AG2A 3BTTE 2G4TA 3LPRA 2FYRA 1XMNB 3RM2H 1HB0B 1DSTA 2A5AA 1C1SA 2QCYA 4H42U 1D3DB 1SGFA 1ZRBA 1F92A 1AB9C 2D2DA 2XC5A 3M5MA 1ZSLA 1CT0E 1C5NH 3A80A 3PYHA 2TIOA 1C2HA 1SLUB 1GG6C 1OS8A 2P8OC 2A5KA 1C1RA 2ZC9H 2BDHA 4PROA 1FY8E 2FESH 3EAJA 4ABBA 1L1JA 3ATMA 2ZHEH 5JB8S 1BRAA 1GBBA 3K6ZA 1EAIA 3V3MA 1CU1A 4MNVA 1VITF 1AUTC 3GICB 4D76A 3E8LA 3DD2H 1QA0A 1KLIH 4TWYA 1THSH 3SJKA 1AGJA 3A85A 2P94A 4BXSA 3DA9B 1IQEA 4JZDH 2SGEE 3S7HB 3NCLA 3PO1B 2BB4A 4ZXYH 2IOTA 1CHOF 4X6PA 2ZTZA 2C93B 2H2ZA 1AZZA 3MNSA 2FI4E 1VZQH 2J94A 3M5LA 2Q6GA 2VWOA 1C5UA 1QRZA 1GJ7B 4ABDA 1CHOG 3T5FH 1QL7A 4E06H 1LHEH 4NFFA 1M9UA 1NRRH 1MCTA 2P3TB 4HTCH 1SLVB 1YM0A 1G2MA 2QF3A 4ASHA 1MAXA 2GT8A 4MDSA 1BTYA 4Y76A 2OBOA 1L2EA 1C1NA 1ANEA 4WMFA 4IS5A 1TBZH 3TU7H 1EP6A 1ELGA 1O3OA 4I8LA 4XSKU 1SQOA 1O2YA 1HUTH 2STAE 2ZU1A 2ZDVH 5E2PA 3U8TH 3F9HA 2ZPQA 1IQHA 2GTBA 4ABIA 2SGQE 3MMGA 2Y80A 1CO7E 1CA0B 2SNWA 3LOXA 2GCHF 5JBTA 1KXFA 1E37B 4LK4A 4Y0ZE 5DJ7A 2GVFA 1TA2A 2Y6TA 5PTPA 4E7RG 5EW1H 1G32B 1ZMNA 1W3CA 1ZGVA 2Z3DA 3M5NA 1ZOMA 4UE7H 1OWJA 2ZIQH 3RXRA 3SNEA 3KEEA 1TPSA 1O3IA 2GCTC 1FN6A 1GBCA 1TMTH 1D9IA 2J95A 5H4IB 1GJ4H 1O5DH 3A7VA 3PM3A 3SQHE 1HAIH 1TRMA 3MH7A 1EPTA 1TIOA 3GY3A 3E16B 2PHBA 3MH4A 1GDQA 4MPUA 1PJPA 1LHCH 4VGCC 1GMCG 4CRFA 1TX6A 3TGJE 4YT7H 1C4V2 2F9PA 3AW1A 1QQUA 1IQLA 3LJOA 1ZR0A 3STIA 5DP9A 5K0HA 4BOHA 2ZI2H 2XNIA 1VCWA 1O3MA 2RDLA 1C5SA 5EQSA 4WY3A 1SBWA 1FPHH 4ZKOU 2ZU5A 1CGHA 5AFZH 2RA0A 1HJAC 4FUEA 3SNAA 1BCUH 1F7ZA 1G2LA 4I8KA 4INHA 2CHAC 1TNHA 4FXGH 1P8VC 1K1MA 5B6OA 4AOQA 2J38A 1SOTA 2RG3A 1EAXA 1ZPBA 3VB6A 4ISLA 3SV7A 1AO5A 2C4FH 1TOMH 1FNIA 2Z9LA 5T6GA 5FCKA 3A7WA 2ZTXA 2G4UA 1K1LA 1AE5A 3RXJA 2VGCC 1CQQA 5EQRA 3ATWA 1LPKB 1O33A 1GBJA 1XUJA 1EUFA 3PROA 4IC6A 4YTAA 4XBCA 2W26A 3R0FA 1O3EA 2ODYB 3LC5A 3LJJA 5L2YH 4RSPA 1K1IA 3NXPA 1A7SA 3ZZ4A 8KME2 1G3DA 1XUFA 5EGMA 1C1WH 1T7CA 2BZ6H 1OP8A 2FM2A 5I25A 2G5NA 2OBQA 1NRNH 3RXFA 2F91A 2ZWLH 4GHTA 1VITG 2F9VA 1P2NA 3T28A 1SGEE 5TCCA 2HRVA 1EX3A 1Z8IB 4NA7A 4YO9A 2B7DH 3RXEA 3EA9A 1P2IA 3UWIA 1BMLA 1IQNA 2QIQA 3ZZDA 4GSOA 3LT3A 3QDZB 2ZA5A 4I8HA 1FN8A 4WJG2 3M7QA 3BG4C 4Y71A 2DE8A 3CP7A 5GDSH 3P92A 1ETSH 3A7XA 4BAMB 1BA8B 1RRKA 1F0UA 1ZGIA 4ZXXH 4CHAB 1S0QA 2OCVB 2HGTH 1MZAA 4ZAEA 3TH4H 4AFQA 3VB5A 1EJMA 4XDEA 1QTFA 1YPKH 1ANBA 1WV7H 4D7GA 5FPSA 3MU0A 1TB6H 3U8OH 3RXPA 1V2RT 5E2OA 4J1YA 1D3TB 2A2XH 3QUMP 1GI9B 4LOYH 3MNXA 1IQFA 1DUAA 1WYKA 4AG1A 1GI3A 5DG6A 1MMJN 2D1JA 2NWNA 3SNCA 1MTNB 3UQOA 3SNBA 4DT7B 1EATA 1O2HA 3PB1E 4WWYA 3F68H 3LGUA 4VGCB 1CVWH 4MVNA 1AUJA 1P2JA 1KXBA 4CR5A 1ELDE 1T32A 1VJ9U 1SGTA 3KGPA 1TX8A 2R9PA 3K65B 3TK9A 4U30A 4BAQB 1BT7A 2A31A 1BOQA 2GDDA 3AVZA 1LVBA 5ABWA 2QF0A 4ABGA 4XOJA 1O3BA 2ZGXH 1UTOA 3LGTA 1GL0E 1V2WT 3GCTG 1C2FA 5C1UA 2Q6FA 3BV9B 4GVUA 4CH8B 3H7TA 1QCPA 1ETRH 2BLVA 1NRQH 3L3TA 2C8ZB 1OYTH 1ZMJA 2QYIA 2EI8A 1BTUA 3SI4H 1KXDA 2CGAA 3O8RA 2CJIA 1SHYA 4JZEH 1SR5C 1HAPH 3ATKA 3PMAB 1QGFA 2BY6X 3TJUA 2QXIA 2SGAA 2J9NA 2G5VA 5EODA 4BTUB 3HK6B 4A5TS 3P8OA 2TGAA 1O2QA 1FLEE 2BHGA 2FO9A 4JYVH 2BX4A 3Q3YA 3SU4A 1EZSC 3QK1A 2IN2A 2PLXA 2PTCE 4A6LA 4FUIA 2FDAA 3GY6A 2NU2E 1H8DH 1TYNA 2C8YB 4FVBA 3W95A 1V2VT 2A0QB 1S5SA 3RMOH 1CBWB 4B73A 1RD3B 1QJ6B 2VB0A 3ZV9A 1Q31A 2XRCA 3ZVAA 1A61H 3QGNB 1H9HE 2V0BA 2GV7A 1OXGA 2B0FA 5C5NA 2O8TA 1B7XB 1ZRKA 2TGDA 3A83A 4ABJA 2A32A 1BB0B 3SUFA 1TBRH 2VINA 1EZXC 2FOEA 4HI3A 2PKAB 1PFXC 1HPGA 2ZCLP 4KKDA 4TPYA 1Z8GA 4CRAA 2NU3E 5FPYA 3LDXH 2FOBA 1SMFE 2YOLA 4MNXA 4THNH 1W2KH 1O2JA 1O2VA 3S7KB 1T31A 5CMXH 1G36A 1LDTT 2Y81A 1C2KA 1HAVB 3TITA 4A1TA 2UWPA 4MNWA 3F9EA 5EW2H 1WAYB 2GZ9A 3SU0A 1GJCB 2F9NA 3U1IB 1C1UH 1QB9A 2FOGA 1O2SA 4AFSA 1XUIA 2FWWA 2OC0A 1W11U 1H9LB 2FLBH 4HZHA 2AGIX 4H6TA 3NWUA 4K69A 5JPMH 1YPHC 5DKMA 1GBDA 2BY9X 1O3NA 2VH6A 1K1JA 4TYDA 2PSYA 9ESTA 4GHQA 2WV5A 1VGCC 3UIRA 1SQTA 4OS6A 4E7NA 3M35A 1OOKB 2ZEBA 3U9AH 1KYNA 2VGCB 1MKWH 2TPIZ 1P04A 2TGPZ 3E91A 7ESTE 1DWBH 1HDTH 1EAUA 3BG4B 2A4RA 1GWAA 2R3YA 2OXSA 3L6PA 3Q00A 3RU4D 3KHVA 4X0WU 1YCPH 5GIBA 1FJSA 2C90B 1IOEA 1A46H 1QFKH 1GBLA 1VR1H 4Y10E 4O3TA 2R2WU 1HAXB 7KMEH 1O31A 3SN8A 4Q80A 3JZ2B 1LQEA 1Z7KA 4NIWA 1Y3WA 1GHVH 1C1VH 4JMYA 1ZPCA 2IPHA 2Z9JA 3SU6A 2UUFB 3RXTA 1BJUA 1HBTH 3M7UA 1UHBB 2QY0B 2BVSH 3SNDA 1O35A 4GAWA 2EI7A 5LPEA 1UCYE 4TY7A 4A1VA 5EG4A 1W14U 3Q3XA 2O8LA 2VIPA 3P8GA 2UUKB 1GCTB 1D3PB 3RXLA 3S9BA 2ALVA 1XKAC 2R2MB 3QGJA 4AB8A 5FPTA 1KXAA 1UTNA 1ZTLA 5C5OA 4I8GA 2ZTYA 3HK3B 1BHXB 1UTPA 3TJVA 1TFXA 3MO9A 1C1TA 1EKBB 2C8XB 2PUQH 3Q76A 1S6HA 3V13A 1GMCF 1W0YH 1HJ8A 1O2XA 2P8OB 4BXWA 3TJOA 3BTKE 5JB9S 3PV4A 1AVGH 4YOIA 1L0ZA 3U69H 2ZCKP 1EB1H 4FU9A 2FOCA 2V3OH 1Z6JH 1KXEA 2CHAB 1WCZA 5J4SA 4AZ2B 1V2QT 1NU9A 1BBRK 1Y5UT 1IAUA 4K1TA 1FUJA 2WPIS 3V0XA 5L2ZH 2VH0A 1NRPH 1S6FA 2V35A 1NFWA 1NU7B 3F9FA 3I77A 1L1GA 3MHWU 3MU1A 2XCNA 5FXLA 3RXOA 4ZHLU 1EPTC 2UUYA 5CHAC 3MU8A 2GKVE 2AGGX 1YF4A 1GBEA 2BM2A 2P59A 2VJ1A 2A4OA 5A8XA 2BQWB 3RXCA 4Q2KA 6ESTA 4SGAE 1HAGE 3RMMH 3GYMA 1MD8A 5EXNA 1ID5H 3KQCA 1KDQB 2SGPE 1GI5A 1OP0A 4B71A 5FCRA 1HV7A 5AF9H 2LNCA 4UONA 2Z9IA 3PWCA 4GCHF 2AMDA 1TPOA 2VWMA 2ZZUH 3U8RH 1PPGE 4NZLA 3M61U 1NFUA 1JIMA 1ZYOA 3ZZBA 3RU4T 3GISB 1N1LA 1O39A 2FI3E 1MD7A 1KDQA 1ESTA 1QJ7B 2ZPSA 2P93A 3M3SA 4UFDH 4Q7XA 2SGFE 2FPZA 2XWAA 3KQEA 1K28D 2FTLE 1HAHH 3UY9A 2G55A 2FX6A 1YPEH 1MBMA 2PGQB 4CRGA 1IQIA 4B75A 3BSQA 2Z3EA 1DXWA 1TGSZ 1W7XH 1GCTC 1BIOA 2ZDAH 1SI5H 2P3FH 4WMDA 5T6DA 1UK3A 1GCDA 2SNVA 1GHAF 1F2SE 3LIWA 2WPMS 1O2TA 1NFXA 1NO9H 3MO6A 1GBFA 3TH3H 1EXFA 1BHXF 2ZF0H 3PMHB 2R3UA 4Z6AH 2XYAA 1QBVH 1L1NA 4BTTB 1SG8B 5HGGA 3UNRA 1C2IA 1A0JA 1DM4B 1C1QA 5L6NH 3SUGA 3M3TA 1Y5AT 1AMHA 2PSXA 1C2LA 3OTJE 1P02A 1TQ0B 4WVPE 3C27B 3KNXA 1AB9B 3SHCH 5JDUB 4F49A 4DVAU 4FUFA 3PLBA 3NKKA 2Z7FE 1AE8H 1EASA 3U98H 2Z94A 2FP7B 1BITA 5E0HA 1LHFH 3LONA 5BRRE 2XBVA 1JOUB 1AFQC 1G9IE 2J2UA 4E05H 1ZPZA 4JYUH 1GBHA 1NS3A 1YGCH 4U2WA 1LPZB 1V2TT 2XXLA 3SV9A 1BBRH 2ZHDA 3ZZAA 6GCHF 3S0NA 3H5CB 3TPIZ 1Z71A 1FY1A 1MUEB 5TJXA 3UOPA 1YCPM 3UPEA 2B8OH 5EXLA 3DUXH 1CHGA 1BMAA 3A82A 4CBOA 1G3CA 4ISOA 1C5YB 4F4OC 1RTKA 1V2ST 1C5ZB 2ZDLA 5C67A 2OC8A 1X7AC 1VCPA 3UR9A 1ABIH 1N8OC 2G8TA 1QA7A 4ZKRU 1FIWA 1HNEE 3EA8A 2STBE 2A7CA 3MNBA 1HXFH 1LMWB 3RXUA 3SUDA 2XBWA 1UCYH 3RXMA 4Y11E 1THRH 1IHSH 4Y79A 4Y8XA 3T26A 4XBDA 2PKAA 4IMZA 1O3PB 1P12E 1YC0A 4AGJA 1BTPA 4J2YB 2TRMA 5A09A 3RXSA 2TGTA 1TQ7B 1GI6A 6CHAB 3SI3H 3MFJA 2ZNKH 4DG4A 1QY6A 5LPFA 4RKJB 4OGYA 2KAIB 1G30B 2XBYA 4YESB 2JETC 2FYQA 2GT7A 3EE0B 1PPHE 3HATH 1V2UT 1HIAA 1BRCE 1OSSA 2A1DB 1TNJA 1A2CH 4RKOB 1J15A 1FY5A 2J34A 2A7HA 1O2UA 2BD9A 1XKBC 2BVXH 3NPSA 1BMNH 2F83A 1GPZA 1UTKA 4O03A 3D23A 2QXJA 3CENA 4YT6H 3W94A 1MTWA 1Z6EA 3ATLA 5DPAA 2GZ7A 1QIXB 5A0AE 4IGDA 1C9PA 1F0TA 2FZZA 3CS7A 1FV9A 5FBIA 5HMAA 1JMOH 5JBBS 1DY9A 3RDZA 1V2NT 1MKWK 4NIXA 3GOVB 1HAOH 1GI0A 1GL1A 1SC8U 3P95A 2WUBA 1P9SA 1K22H 1C5QA 4INLA 4AX9H 1C1OA 1V2PT 1Y3YA 1TNGA 1TPPA 1UVTH 5TCAA 5C3NA 4DJZB 1B0EA 5E8EH 1GJ5H 3SHAH 1ESAA 3TGKE 3AASA 2UWLA 3DT0H 1C5RA 1E38B 3NZIA 5F03A 4X6OA 1NZQH 1BTZA 3KN2A 2ZQ1A 3MH6A 4H4FA 3UOUA 4BAOB 1UMAH 3RXAA 3D65E 5AFYH 3EGKH 3VB3A 4NWLA 1LQDB 2QGRA 1FONA 1E35B 4AYYB 1GJ6A 1MH0A 1INCA 1D3QB 1GVZA 3SJOA 1O3KA 3KIDU 1G3EA 1SGCA 3ZZ3A 1FMGA 4I32A 1H8IH 3F9GA 1YPGH 2Y7ZA 2QXHA 4WH8A 2C8WB 1D6WA 4X1SU 1GMDF 1ZHMA 4JZFH 2ZO3H 3GY8A 4NFEA 3BTEE 2ZFPH 3HGNA 3QLPH 2H5CA 4OS7A 3SU1A 3OY6U 2QC2A 1ZSKA 5CHAB 3GYLB 3SU2A 2H9EH 1C2MA 2ZU2A 3UQVA 1A1RA 2W3IA 2FLRH 3ZZ9A 1BUIA 1K1OA 2VNTA 4CR9A 1P0SH 3URCA 1E36B 3CS0A 2O8WA 1SGPE 2FOFA 4X8TH 1CBWC 2GV6A 2OUAA 2JH0D 4AGKA 4CRDA 2VVUA 2F9BH 5SGAE 2GDEH 1S85A 1TOCB 3URDA 2C3SA 1J9CH 1K21H 2NU4E 3TNSA 1PYTC 1WU1A 1AU8A 1N6XA 4K60A 3PTNA 1GJDB 2THFB 1MQ6A 1QL8A 1OWIA 4YOJA 4MPWA 1O5EH 5T6FA 4K5ZA 3A89A 3BTWE 1P2KA 1GJBB 2Z3CA 3G01A 1G37A 2VU8E 4FUJA 2BY7X 1MU8B 3ITIA 1GMHF 1O2NA 4YLUA 1ZMLA 1O0DH 1Y59T 1PQ8A 1QB1A 2JKHA 2DE9A 1XM1A 1O5AB 1DANH 2O8MA 3KCGH 1HXEH 1UO6A 3GCNA 1BRUP 3E90B 3AW0A 4KELA 4UFEH 3LH1A 2P16A 5E0JA 2Y7XA 1HCGA 3ODFA 4D9RA 3VXEH 4MLFB 5DP4A 2ZPRA 4AB9A 1WTHD 3MU5A 1FY3A 2QA9E 3M7TA 3RM0H 1GMDG 1ELEE 4U01A 2UUJB 4Y6DA 2PW8H 3RXKA 4Y8YA 2ZKSA 3PMBB 3MTYA 1XUKA 2ANMH 2NU1E 2H5DA 4AFZA 2FOAA 1W8BH 3SJIA 1NTPA 1TALA 2AH4X 1O3LA 1SFIA 2R0KA 4R0IA 2GMTC 3RXQA 2QAAA 1GGDC 1LHDH 1TNIA 5HYOA 3JZ1B 3UREA 2I6QA 4MQAA 1CGJE 1LPGB 2ODQA 3E6PH 1O34A 1OWHA 1T4VH 1IQKA 1DLKB 3QWCH 2AERH 3ZYEA 3OU0A 1GI1A 2V6NA 2A4GA 5C20A 3A84A 2OD3B 2Y5GA 1TONA 3FANA 3A8CA 3GDVA 5IDKA 3S9AA 2VIQA 1DDJA 2W5EA 1QURH 2HNTF 3SO3A 3RUOA 1YLDA 2A7JA 1J8AA 5JBAS 1GGDB 4IN1A 1XXDA 2FS9A 3K6YA 4OGXA 3OY5U 3A7YA 1BTHH 3ZVCA 5IYTA 1Z8JB 2A2QH 3QTOH 1FY4A 3GY4A 5DP5A 4FUCA 1DITH 3PTBA 1PPFE 1NY22 8GCHG 3RXIA 3TLOA 1MQ5A 2FTMA 5C2ZA 2OP9A 1AN1E 3ENSB 4NGAH 1E34B 4KTCA 5DP8A 3SV8A 3SJ8A 2OTVA 8GCHF 2ZP0H 1OWDA 1GI7B 2BDCA 4QT8C 1DOJA 4NIYA 3MNCA 2G52A 1EAWA 4ZHAA 1PQ5A 1NRSH 1AY6H 2H6MA 2ZHQH 1SGDE 3B23B 5F8ZA 1DWDH 3ZVDA 3DFLA 2PUXB 4ABAA 3I78A 3S69A 1AVWA 2VWNA 4GLYA 1T8NA 4BTIB 3SV6A 4GUXA 1GI8B 1GBIA 1V6DA 2AMPA 3VPKA 2QN5T 5F8TA 3S9CA 4X8SH 2FS8A 1ELTA 3GDSA 5A8ZA 4IC5A 2ZECA 2H9TH 4Q7YA 2BXTH 1C4U2 4O3UA 1LVOA 4I31A 8LPRA 2BXUH 2VIWA 3P8NA 2VWLA 2B5TB 4K1EA 3T2NA 1NFYA 1PPCE 2ANWA 2ANKH 3D49H 2BD4A 3SJ9A 1UJ1A 4ABHA 4X8VH 5GWZA 1ELVA 5EOKA 3FFGA 3GDUA 1AIXH 1F0SA 1RIWC 1GHAG 2GCTB 3RXDA 2HPPH 1SPJA 1HGTH 2WINI 1GDUA 1H9IE 3BIVH 2HPQH 3ELAH 1HRTH 2BMGB 4K1SA 1ZSJA 2BQ7B 2EEKA 1DFPA 4NSYA 2GP9B 3FP6E 1JRSA 2ZG0H 1BZXE 3DHKH 1O2LA 2H9HA 3SGBE 1RGQA 5LGOA 1TNKA 5AVDA 2Z9KA 5A0BA 5C1YA 1GHZA 1UTMA 1RXPA 2BQ6B 2PTNA 4CHAC 4HGCA 4BAKB 4LZ4B 3P8FA 3QX5H 1KLTA 3PMJA 7LPRA 1QR3E 2CN0H 1GG6B 2CF9H 1SHHB 1C5LH 2ILNA 1NPMA 4O9VA 1JIRA 4ISNA 2AS9A 1UTLM 1O3AA 2OINA 1A3BH 1GBMA 1MAYA 3GCOA 7GCHF 2AIQA 1C5VA 2FEQH 1AZ8A 3LGVA 2F3CE 3KF2A 1DSUA 4X1RU 5F8XA 1UK4A 1TABE 1P2OA 1VCQA 1O5BB 1DY8A 3VEQB 1A5GH 5HM9A 1TRYA 1YPMH 3Q3KA 3AAVA 4AYVB 2FMJA 1KLJH 3A8AA 1HJ9A 3K2UA 5A8YA 3A7TA 3BTGE 1YPLH 1NESE 4YLQH 2OC1A 1E0FD 2F9UA 2IJOB 5I46H 1SGRE 3A86A 1B0FA 3SORA 2SGDE 1C2GA 4UEHH 1VITH 2HOBA 3EQ0H 4OS4A 3VGCC 2XWBI 4WXVA 1PYTD 2VIOA 1V2JT 3BEFB 1HAZB 3RMLH 4M7GA 3GCTF 1TLDA 3F6UH 1KSNA 1TGTA 1G3BA 5EU8A 2OLGA 1THPB 3EA7A 1MTUA 1ESBA 2CF8H 2RA3A 4I7YH 5GCHF 2BD7A 6CHAC 3SV2H 3NUMA 3A88A 4B2AA 1XXFA
chains in the Genus database with same CATH superfamily
1XX9A 4X6MA 4FVDA 2AEIH 3E0PB 5EJ1A 2J4IA 3O8BA 4ZMAH 1RS0A 1W0KD 3RXVA 2XTTB 1YCPK 3QN7A 5ESBA 3SGQE 1FI8A 1GJ9B 4FUBA 3F1SB 1P03A 4GCHG 3RLYH 2ANYA 4ISIH 4XRNA 2ZDMA 3F0PA 3VB4A 3FN8A 2O8UA 3AAUA 4BANB 2ZQ2A 1FAXA 2BLOA 2D8WA 3PLPA 2ZHFH 3P70B 2BDYA 5GXPA 1PPBH 1S81A 2FI5E 2J97A 1O2KA 2FXRA 4CRBA 4YOGA 2GX4A 3UTUH 2RFKC 2M5TA 4UD9H 1E79D 3T29A 2GZ8A 1BQYA 5KGOA 1ZTKA 2VVCA 2BD2A 3FZZA 1EPTB 1LVMA 1V3XA 2BOKA 2Z6BD 2ZFTA 5ESTE 3P17H 4ZKSU 2BDAA 3EE7A 3T27A 2CMYA 1HAVA 2BY8X 1P2MA 2VIDA 1SOZA 2HVYB 3O8DA 1ANCA 3IG6B 4OS1A 1HYLA 2ZGHA 2BY5X 4MNYA 4U32A 1LKAA 2J5UA 1A0HB 3N7OA 4ZKNU 4DW2U 1OP2A 1JWTA 1WQVH 2ZGJA 2GD4B 2G81E 2ZHWH 1O5GH 1O3FA 1DS2E 1XVMA 3SUEA 1C9TA 2R0LA 3H7OA 1DPOA 1AKSB 1EZUC 4Y7BA 3PWBA 5GNDA 4A1XA 2XC0A 3RXGA 1RTLA 4KGAA 1TMUH 1PPEE 3TNTA 2XC4A 3ZZ5A 5BPEA 1CGIE 1O3GA 5L30H 1O2GH 3MOCA 2WV4A 1YYY1 3OX7U 4FU8A 2YMSC 2BYAX 8ESTE 2GCHG 3LH3A 4K8BA 1MTSA 3MU4A 1TAWA 1C1PA 1NROH 1A4WH 1IQJA 1TGCA 2G51A 2GMTB 3QTVH 1BJVA 2KR7A 1BTXA 1YPJH 5JYIA 5K7RA 4K3JA 2EC9H 1QHRB 2J92A 1NN6A 1XUGA 1P09A 1J14A 1UHBA 2BLWA 2ALPA 4X6NA 2K8IA 4ACBA 2RCEA 1O30A 1S82A 1O38A 1IQGA 3RXBA 1CT4E 1O2OA 4X1PU 1C5WB 1TA6A 2W7UA 2ULLA 1FZZA 1AI8H 1C2DA 1K1NA 1QRWA 9LPRA 5EQQA 1SL3A 4FU7A 1WBGB 5EIYA 3E3TA 1QJ1B 1K2I1 5HM2A 2KFWA 1RFNA 1ELBA 1CT2E 3MYWA 1GVLA 3TIUA 1ARBA 4NIVA 3O8CA 1C5XB 2H1UA 1DWEH 3PO1C 1DUEA 1SLXB 4R8TB 1O2ZA 5EXMA 5ETXA 1YWUA 3A8DA 3BTME 1SQAA 1PQAA 1AHTH 1AWHB 1IQMA 4DCDA 1BTWA 2HLCA 3TGIE 4TSFD 4KP0A 1W12U 1ABJH 1MKXK 3RC4A 2M2AA 1GVKB 5E0GA 1ZZZA 2ZCHP 1Z1IA 3IITA 3C1KA 4OS5A 1AVXA 1QRXA 4X8UH 2BZAA 1FXYA 1SGIB 4FUHA 3V7TA 4A7IB 1VJAU 1MU6B 1WQSA 5FBEA 1ARCA 1FDPA 1ZLRA 4I8JA 1F5KU 4ISHH 4K2YA 3OSYA 1P3EA 4WF8A 4B2CA 3N99A 4SGBE 3TK5A 5FAHA 1Y3VA 2EI6A 1HLTH 3UNSA 2JH6D 5DO4H 1ELFA 5LH8A 1A5IA 1C5PA 3VGCB 4CBNA 4DY7B 2HNTE 2ZFQH 2A4QA 3OYPA 2QXGA 3BTDE 5GPIB 3SYJA 3ZVEA 1O2WA 2TBSA 3K9XB 4X1QU 1O36A 3U28C 1O2RA 1ETTH 1HIAB 1L4ZA 4UFGH 3SQEE 4CH2B 2O9QA 2FOHA 1GHXH 1LTOA 1XUHA 2YNAA 3V12A 2VVVA 2F43B 1JXPA 2ZGBH 1TPAE 2ASUB 1UVOA 4MTBA 3B9FH 4K8YA 3A8BA 3ODDA 1A5HA 2L74A 4OS2A 1GHBG 4ESTE 4ZCNA 1TMBH 1ZHPA 1Z8RA 1QB6A 1WXRA 4X2YA 2PP6A 3L33A 4MPXA 3UUZA 1N8OB 1P06A 2LP6A 2BDBA 1SSXA 2LPRA 3RP2A 3TK6A 2Y5HA 1P2QA 4JK5A 2W3KA 2BDGA 4KTSA 2NU0E 1TGNA 1UK2A 2AFQB 1DICA 2ZFFH 5G4BA 2Y5FA 1O37A 1D6RA 1DVAH 5GJ4B 2WPJS 4ZROA 2FX4A 2WUCA 2F4LA 4TY6A 5FHTA 3RLWH 5AHGH 4B74A 1MZDA 3PRBA 3GY5A 2XBXA 4ABEA 4DT4A 3U1JB 1UTJA 4NWKA 3GCHC 1MKXH 1QL9A 4NA9H 3FZDA 2BTCE 1NM6A 3QO6A 2OK5A 3VB7A 1MTVA 3FAOA 1N6YA 1SLWB 3FOAA 4INKA 1SGQE 3N7DA 1KTTB 2KAIA 2PGBB 5FX6A 1MCVA 1TE0A 1L4DA 5A2MH 1RIWB 1AWFH 3LKWA 3M5OA 1P9UA 3TVJB 1TWXB 1W7GH 4IBLH 1NBMD 1IHTH 1OPHB 4WH6A 3HKJB 4DIHH 1C5MD 1K1PA 1ZJDA 4JCNA 3LU9B 1BRBE 4TWWA 2WPHS 1SGNE 1EQ9A 1TBQH 1ELCA 2PWXA 1P11E 4HFPB 1ANDA 2AIPA 3BIUH 2HNTC 1Q3XA 2JH5D 2WPKS 1GHBF 3SU3A 3RU4E 1RTFB 4ZH8A 4ABFA 3VG8A 2A5IA 2ZGCA 1O3DA 1O5CB 3TJNA 3PV2A 3ZV8A 3M3VA 4DGJA 3RC6A 3WWBA 3BN9A 1CE5A 4Q7ZA 5T3HA 2G00A 2WPLS 1V2MT 2FOMB 4Y8ZA 3LC3A 3UWJH 3OE7D 2PR3A 4I33A 1NC6A 1GJ8B 1HJAB 1C2JA 1VGCB 1C5TA 1AKSA 1YKTA 3STJA 2BD3A 2HALA 2OC7A 3ZIAD 4D9QA 3E1XB 1O32A 1T8OA 4BAHB 1LKBA 3A7ZA 1PPZA 3HGPA 1SKYE 1YBWA 3HPTB 1T8MA 4AORA 2HVXA 4ZUHA 1C5OH 3GS9A 5DP3A 2Y82A 3LGYA 3BF6H 1JRTA 2WYJA 2WYGA 5C94A 2XW9A 4JZIA 2BD8A 1ZTJA 1W0ZU 1B5GH 5HKKD 2PV9B 1OYQA 3SGAE 1H4WA 2K1QA 1T4UH 1HAYB 2I6SA 1KY9A 4WXIA 3ZZ8A 1FPCH 3ZZ6A 4YZUA 2QV1A 1SGYE 3PLKA 2A45B 1ORFA 4Y0YE 1TRNA 1WOFA 3ATIA 4TPIZ 1LVYA 1Y5BT 3HKIB 6LPRA 2FODA 1DE7H 1EOLA 2Q6DA 3BTHE 5F6MA 3M36A 4UDWH 3T25A 3ZVFA 4RN6A 4F48B 3FP7E 2BOHB 1O5FH 1P01A 3P6ZB 1AQ7A 1A3EH 3T62A 2EA3A 3M37A 3KL6A 4O97A 1ZHRA 1XVOA 3W1EA 5FX5A 1S83A 1C2EA 1O3CA 1P10A 1EJNA 4X2XA 1OKXA 5HXFA 4BNRA 4MPVA 3KQDA 3LGIA 3EDXB 1WUNH 5DP6A 4A92A 3MWIU 1A0LA 3BEIB 1DWCH 1O2MA 2BDIA 2ESTE 3MI4A 5J4QA 3BTQE 1LO6A 3GCHB 1ACBE 1OWEA 1GI2A 1BDAA 1EOJA 1GDNA 3VFEA 1W13U 1SFQB 1P57B 2F9OA 4CREA 4NA8A 1C4Y2 5DK1A 3GY2A 3MH5A 1MBQA 3ZVGA 1BMMH 1F5RA 3F3BA 2AYWA 4MG3A 2KCAA 1V2LT 4Y7AA 1V2OT 3ZVBA 2ZFRH 3DSPA 1QZ8A 1FAKH 2ZU3A 1GHWH 2ZU4A 4NCYA 1OX1A 2BD5A 4IN2A 1TGBA 1EJAA 1EB2A 1MTNC 1CA0C 2ZFSA 4XFQA 2PFEA 3UNQA 4AFUA 4D8NA 1KXCA 1KIGH 3ZYDA 3A81A 2ZDNA 4FETA 3LGWA 2BVRH 4AN7A 1LHGH 3FP8E 1QNJA 3I29A 4ZHMU 1HFDA 1UCYK 2JETB 1AFEH 1ELAA 1C1MA 2WZQA 1FQ3A 4XE4A 5EPYA 1Y8TA 1GMHG 2XCFA 3MQKC 2D26C 2BLQA 4D7FA 3IWMA 1K9OE 1YPHE 1GHYH 1Q2WA 4FUDA 1K0HA 4IMQA 2UWOA 1P05A 1RJXB 1TX7A 4YM9A 1QBOA 1O3HA 3OTPA 5DP7A 4XBBA 3MO3A 5CE1A 1UVSH 1Z1JA 4KTUA 3BEUA 4H6SB 1EZQA 2ODPA 2JJ2D 1H1BA 3TH2H 3SOSA 4NG9H 5A0CA 1DLEA 4Z0KA 2FIRH 1O3JA 5JBCS 1J16A 1KTSB 4X2VA 1SGFG 1GI4A 1S0RA 1WSSH 3KQBA 3E0NB 5C1XA 3RXHA 3B8JA 2CV3A 5EPNA 1Y3XA 3NK8A 6GCHG 4JK6A 3SZNA 2AMQA 1GBTA 4X2WA 1GBAA 1T8LA 2BX3A 1Y3UA 3A87A 1DX5M 3DFJA 1V2KT 2SFAA 1BBRE 1OHHD 2Q1JA 3R3GB 3RC5A 1FIZA 4FUGA 7GCHG 5DGJA 1D4PB 2Z9GA 1UTQA 4GPGA 1O2PA 2VIVA 1TNLA 3OFND 2OQUA 2YNBA 4ACAA 1W10U 3EYDA 1UVUH 1AFQB 1PQ7A 1YLCA 3SU5A 4IW4E 3WY8A 1AD8H 4CRCA 1S84A 3ZZ7A 2HWLB 1OWKA 2B9LA 3QZRA 1F0RA 1JBUH 3SBKA 1O2IA 1QQ4A 2PKSC 1GJAB 4JZ1A 3DSOA 4LXBH 4DIIH 3GY7A 2V3HH 5LPRA 3ZZCA 4B2BA 4DOQA 1CA8B 1GBKA 4B76A 3Q77A 3SW2B 2W7SA 2CK3D 4B1TA 1DXPA 1UVPA 3D62A 4NSVA 3BG8A 1SVPA 4LZ1H 2CXVA 3QZQA 4DURA 1LCYA 3VXFH 2AGEX 1F5LA 2ZDKA 3BTFE 1EP5A 2DUCA 2KX4A 1NT1A 1YP9A 1ZJKA 2PKSB 4JYTA 4RT1A 1U6QA 4UFFH 2P3UB 4RT0A 1DT2A 1CSOE 1P3CA 4X1NU 1J17T 3UR6A 3ESTA 1SB1H 2P95A 2GGVB 3FVFB 3RMNH 3UFAA 4WMEA 1WTGH 1QBNA 2OQ5A 4NZQA 5GCHG 4AG2A 3BTTE 2G4TA 3LPRA 2FYRA 1XMNB 3RM2H 1HB0B 1DSTA 2A5AA 1C1SA 2QCYA 4H42U 4Q4LA 1D3DB 1SGFA 1ZRBA 1F92A 1AB9C 2D2DA 2XC5A 3M5MA 1ZSLA 1CT0E 1C5NH 3A80A 3PYHA 2TIOA 1C2HA 1SLUB 1GG6C 1OS8A 2P8OC 2A5KA 2HLDD 1C1RA 2ZC9H 2BDHA 4PROA 1FY8E 2FESH 3EAJA 4ABBA 1L1JA 3ATMA 2ZHEH 5JB8S 1BRAA 1GBBA 3K6ZA 1EAIA 3V3MA 1CU1A 4MNVA 1VITF 1AUTC 3GICB 4D76A 3E8LA 3DD2H 1QA0A 1KLIH 4TWYA 1THSH 3SJKA 1AGJA 3A85A 2P94A 4BXSA 3DA9B 1IQEA 4JZDH 2SGEE 3S7HB 3NCLA 3PO1B 2BB4A 4ZXYH 2IOTA 1CHOF 4X6PA 2ZTZA 2EY4C 2C93B 2H2ZA 1AZZA 3MNSA 2FI4E 1VZQH 2J94A 3M5LA 2Q6GA 2VWOA 1C5UA 1BMFD 1QRZA 1GJ7B 2IPQX 4ABDA 1CHOG 3T5FH 1QL7A 4E06H 1LHEH 4NFFA 1M9UA 1NRRH 1MCTA 2P3TB 4HTCH 1SLVB 1YM0A 1G2MA 2JIZD 2QF3A 4ASHA 1MAXA 2GT8A 4MDSA 1BTYA 4Y76A 4RI0A 2OBOA 1L2EA 1C1NA 1ANEA 4WMFA 4IS5A 1TBZH 3TU7H 1EP6A 1ELGA 1O3OA 4I8LA 4XSKU 1SQOA 1O2YA 1HUTH 2STAE 2ZU1A 4P00A 2ZDVH 5E2PA 3U8TH 3F9HA 2ZPQA 1IQHA 2GTBA 4ABIA 2SGQE 3MMGA 2Y80A 1CO7E 1CA0B 2SNWA 3LOXA 2GCHF 5JBTA 1KXFA 1E37B 4LK4A 4Y0ZE 5DJ7A 2GVFA 1TA2A 2Y6TA 5PTPA 4E7RG 5EW1H 1G32B 1ZMNA 1W3CA 1ZGVA 2Z3DA 3M5NA 1ZOMA 4UE7H 1OWJA 2ZIQH 3RXRA 3SNEA 3KEEA 1TPSA 1O3IA 2GCTC 1H8ED 1FN6A 1GBCA 1TMTH 1D9IA 2J95A 5H4IB 1GJ4H 1O5DH 3A7VA 3PM3A 3SQHE 1HAIH 1TRMA 3MH7A 1EPTA 1TIOA 3GY3A 3E16B 2PHBA 3MH4A 1GDQA 4MPUA 1PJPA 1LHCH 4VGCC 1GMCG 4CRFA 1TX6A 3TGJE 4YT7H 1C4V2 2F9PA 4TT3D 3AW1A 1QQUA 1IQLA 3LJOA 1ZR0A 3STIA 5DP9A 5K0HA 4BOHA 2ZI2H 2XNIA 1VCWA 1O3MA 2RDLA 1C5SA 5EQSA 4WY3A 1SBWA 1FPHH 4ZKOU 2ZU5A 1CGHA 5AFZH 3OAAD 2RA0A 1HJAC 4FUEA 3SNAA 1BCUH 1F7ZA 1G2LA 4I8KA 4INHA 2CHAC 1TNHA 3KYFA 4FXGH 1P8VC 1K1MA 5B6OA 4AOQA 2J38A 1SOTA 2RG3A 1EAXA 1ZPBA 3VB6A 4ISLA 3SV7A 1AO5A 2C4FH 1TOMH 1FNIA 2Z9LA 5T6GA 5FCKA 3A7WA 2ZTXA 2G4UA 1K1LA 1AE5A 3RXJA 2VGCC 1CQQA 5C0UA 5EQRA 3ATWA 1LPKB 1O33A 1GBJA 1XUJA 1EUFA 3PROA 4IC6A 4YTAA 1WDIA 4XBCA 2W26A 3R0FA 1O3EA 2ODYB 3LC5A 3LJJA 5L2YH 4RSPA 1K1IA 3NXPA 1A7SA 3ZZ4A 8KME2 1G3DA 1XUFA 5EGMA 1C1WH 1T7CA 2BZ6H 1OP8A 2FM2A 5I25A 2G5NA 2OBQA 1NRNH 3RXFA 2F91A 2ZWLH 4GHTA 1VITG 2F9VA 1P2NA 3T28A 1SGEE 5TCCA 2HRVA 1EX3A 1Z8IB 4NA7A 4YO9A 2B7DH 3RXEA 3EA9A 1P2IA 3UWIA 1BMLA 1IQNA 2QIQA 3ZZDA 4GSOA 3LT3A 3QDZB 2ZA5A 4I8HA 1FN8A 4WJG2 3M7QA 3BG4C 4Y71A 2DE8A 3CP7A 5GDSH 3P92A 1ETSH 3A7XA 3FO8D 4BAMB 1BA8B 1RRKA 1F0UA 1ZGIA 4ZXXH 4CHAB 1S0QA 2OCVB 2HGTH 1MZAA 4ZAEA 3TH4H 4AFQA 3VB5A 1EJMA 4XDEA 1QTFA 1YPKH 1ANBA 1WV7H 4D7GA 5FPSA 3MU0A 1TB6H 3U8OH 3RXPA 1V2RT 5E2OA 4J1YA 1D3TB 2A2XH 3QUMP 1GI9B 4LOYH 3MNXA 1IQFA 1DUAA 1WYKA 4AG1A 1GI3A 5DG6A 1MMJN 2D1JA 2NWNA 3SNCA 1MTNB 3UQOA 3SNBA 4DT7B 1EATA 1O2HA 3PB1E 4WWYA 3F68H 3LGUA 4VGCB 1CVWH 4MVNA 1AUJA 1P2JA 1KXBA 4CR5A 2V7QD 1ELDE 1T32A 1VJ9U 1SGTA 3KGPA 5F53A 1TX8A 2R9PA 3K65B 3TK9A 4U30A 4BAQB 1BT7A 2A31A 1BOQA 2GDDA 3AVZA 1LVBA 5ABWA 2QF0A 4ABGA 4XOJA 1O3BA 2ZGXH 1UTOA 3LGTA 1GL0E 1V2WT 3GCTG 1C2FA 5C1UA 1E1QD 2Q6FA 3BV9B 4GVUA 3CNRA 4CH8B 3H7TA 1QCPA 1ETRH 2BLVA 1NRQH 3L3TA 2C8ZB 1OYTH 1ZMJA 2QYIA 2EI8A 1BTUA 3SI4H 1KXDA 2CGAA 3O8RA 2CJIA 1SHYA 4JZEH 1SR5C 1HAPH 3ATKA 3OEHD 2XOKD 3PMAB 1QGFA 2BY6X 3TJUA 2QXIA 2SGAA 2J9NA 2G5VA 5EODA 4BTUB 3HK6B 4A5TS 3P8OA 2TGAA 1O2QA 1FLEE 2BHGA 2FO9A 4JYVH 2BX4A 3Q3YA 3SU4A 2GJGA 1EZSC 3QK1A 2IN2A 2PLXA 2PTCE 1YLNA 4A6LA 4FUIA 2FDAA 5B6LA 3GY6A 2NU2E 1H8DH 1TYNA 2C8YB 4FVBA 3W95A 1V2VT 2A0QB 2IJD1 2KZ4A 1S5SA 3RMOH 1CBWB 4B73A 1RD3B 1QJ6B 2VB0A 3ZV9A 1Q31A 2XRCA 3ZVAA 1A61H 3QGNB 1H9HE 2V0BA 2GV7A 1OXGA 2V3MA 2B0FA 3UAIC 5C5NA 2O8TA 1B7XB 1ZRKA 2TGDA 3A83A 4ABJA 2A32A 1BB0B 3SUFA 1TBRH 2VINA 1EZXC 5HIYA 2FOEA 4HI3A 2PKAB 5DSFA 1PFXC 1HPGA 2ZCLP 4KKDA 4TPYA 1Z8GA 4CRAA 2NU3E 5FPYA 3LDXH 2FOBA 1SMFE 2YOLA 4MNXA 4THNH 1W2KH 1O2JA 1O2VA 3S7KB 1T31A 5CMXH 1G36A 1LDTT 2Y81A 1C2KA 1HAVB 3TITA 4A1TA 1S6LA 2UWPA 4MNWA 3F9EA 5EW2H 1WAYB 2GZ9A 3SU0A 3PRDA 1GJCB 2F9NA 3U1IB 1C1UH 1QB9A 2FOGA 1O2SA 4AFSA 1XUIA 2FWWA 2OC0A 1W11U 1H9LB 2FLBH 4HZHA 2AGIX 4H6TA 1YY3A 3NWUA 4K69A 5JPMH 1YPHC 3OEED 5DKMA 1GBDA 2BY9X 1O3NA 2VH6A 1K1JA 4TYDA 2PSYA 9ESTA 4GHQA 2WV5A 1VGCC 3UIRA 1SQTA 4OS6A 2QE7D 3M35A 4E7NA 1OOKB 2ZEBA 3U9AH 1KYNA 4YXWD 2VGCB 1MKWH 2TPIZ 1P04A 2TGPZ 3E91A 7ESTE 1DWBH 1HDTH 1EAUA 3BG4B 2A4RA 1GWAA 2R3YA 2OXSA 3L6PA 3Q00A 3RU4D 3KHVA 4X0WU 1YCPH 5GIBA 4ASUD 1FJSA 2C90B 1IOEA 1A46H 1QFKH 1GBLA 5C17A 1VR1H 4Y10E 5HIZA 4O3TA 4P02A 2R2WU 1HAXB 7KMEH 1O31A 3SN8A 4Q80A 3JZ2B 1LQEA 1Z7KA 4NIWA 1Y3WA 1GHVH 1C1VH 4JMYA 1ZPCA 2IPHA 2Z9JA 3SZEA 3SU6A 2UUFB 3RXTA 1BJUA 1HBTH 3M7UA 1UHBB 2QY0B 2BVSH 3SNDA 1O35A 4GAWA 2EI7A 5LPEA 1UCYE 4TY7A 4A1VA 5EG4A 1W14U 5DN6D 3Q3XA 2O8LA 2VIPA 3P8GA 2UUKB 1GCTB 1D3PB 3RXLA 3S9BA 2ALVA 1XKAC 2R2MB 3QGJA 4AB8A 5FPTA 1KXAA 2W6ID 1UTNA 1ZTLA 5C5OA 4I8GA 2ZTYA 3HK3B 1BHXB 1UTPA 3TJVA 1TFXA 3MO9A 1C1TA 1EKBB 2C8XB 2PUQH 3Q76A 1S6HA 3V13A 1GMCF 1W0YH 1HJ8A 1O2XA 2P8OB 4BXWA 3TJOA 3BTKE 3N7EA 5JB9S 3PV4A 1AVGH 4YOIA 1L0ZA 3U69H 2ZCKP 1EB1H 2L6OA 4FU9A 2FOCA 2V3OH 1Z6JH 1KXEA 2CHAB 1COWD 3F2HA 1WCZA 5J4SA 4AZ2B 1V2QT 1NU9A 1BBRK 1Y5UT 1IAUA 4K1TA 1FUJA 2WPIS 3V0XA 5L2ZH 1NRPH 1S6FA 2V35A 2VH0A 1NFWA 1NU7B 3F9FA 3I77A 1L1GA 3MHWU 3MU1A 2XCNA 5FXLA 3RXOA 4ZHLU 1EPTC 2UUYA 5CHAC 3MU8A 2GKVE 2AGGX 1YF4A 1GBEA 2BM2A 2P59A 2VJ1A 2A4OA 3F0OA 5A8XA 1EFRD 2BQWB 3RXCA 4Q2KA 6ESTA 2WSSD 1HAGE 4SGAE 3RMMH 3GYMA 1MD8A 5EXNA 1ID5H 3KQCA 1KDQB 2SGPE 1GI5A 1OP0A 1MABB 4B71A 5FCRA 1HV7A 5AF9H 2LNCA 4UONA 2XNDD 2Z9IA 3PWCA 4GCHF 2AMDA 1TPOA 2VWMA 2ZZUH 3U8RH 1PPGE 4NZLA 3M61U 1NFUA 1JIMA 1ZYOA 3ZZBA 3RU4T 3GISB 1N1LA 1O39A 2FI3E 1MD7A 1KDQA 1ESTA 1QJ7B 2ZPSA 2P93A 3M3SA 4UFDH 4Q7XA 2SGFE 2FPZA 2XWAA 3KQEA 1K28D 2FTLE 1HAHH 3UY9A 2G55A 2FX6A 1YPEH 1MBMA 4Q63A 4OM9A 2PGQB 4CRGA 1IQIA 4B75A 3BSQA 2Z3EA 1DXWA 1TGSZ 1W7XH 1GCTC 2RDEA 1BIOA 2ZDAH 1SI5H 2P3FH 4WMDA 5T6DA 1UK3A 1GCDA 2SNVA 1GHAF 1F2SE 3LIWA 3UB0A 4I86A 2WPMS 1O2TA 1NFXA 2J98B 1NO9H 3MO6A 1GBFA 3TH3H 1EXFA 1BHXF 2ZF0H 3PMHB 5CDFE 2R3UA 4Z6AH 2XYAA 1QBVH 1L1NA 4BTTB 1SG8B 5HGGA 3UNRA 1C2IA 1A0JA 1DM4B 1C1QA 5L6NH 5T1VA 3SUGA 3M3TA 1Y5AT 1AMHA 2PSXA 1C2LA 3OTJE 1P02A 1TQ0B 4WVPE 3C27B 3KNXA 1AB9B 3SHCH 5JDUB 4F49A 4DVAU 2QF4A 4FUFA 3PLBA 3NKKA 2Z7FE 1AE8H 1EASA 3U98H 2Z94A 2FP7B 1BITA 2KCOA 5E0HA 1LHFH 3LONA 5BRRE 2XBVA 1JOUB 1AFQC 1G9IE 2J2UA 4E05H 1ZPZA 4JYUH 1GBHA 1NS3A 1YGCH 4U2WA 1LPZB 1V2TT 2XXLA 3SV9A 1BBRH 2ZHDA 3ZZAA 6GCHF 3S0NA 3H5CB 3TPIZ 1Z71A 1FY1A 1MUEB 5TJXA 3UOPA 1YCPM 3UPEA 2B8OH 5EXLA 3DUXH 1CHGA 1BMAA 3A82A 4CBOA 1G3CA 4ISOA 1C5YB 4F4OC 1RTKA 1V2ST 1C5ZB 2ZDLA 5C67A 2OC8A 2KCPA 1X7AC 1VCPA 3UR9A 1ABIH 1N8OC 2G8TA 1QA7A 4ZKRU 1FIWA 2EQNA 1HNEE 3EA8A 2STBE 2A7CA 3MNBA 1HXFH 1LMWB 3RXUA 3SUDA 2XBWA 1UCYH 3RXMA 4Y11E 1THRH 1IHSH 4Y79A 4Y8XA 3T26A 4XBDA 2KCYA 2PKAA 4IMZA 1O3PB 1P12E 1YC0A 4AGJA 1BTPA 4J2YB 2TRMA 5A09A 3RXSA 2TGTA 1TQ7B 1GI6A 6CHAB 3SI3H 3MFJA 2ZNKH 4DG4A 1QY6A 5LPFA 4RKJB 4OGYA 2KAIB 1G30B 2XBYA 4YESB 2JETC 2FYQA 2GT7A 3EE0B 1PPHE 3HATH 1V2UT 1HIAA 1BRCE 1OSSA 2A1DB 1TNJA 4XD7D 1A2CH 4RKOB 4B6FA 1J15A 1FY5A 2J34A 2A7HA 1O2UA 3FKSD 2BD9A 1XKBC 2BVXH 3NPSA 1BMNH 2F83A 3KQ5A 1GPZA 1UTKA 4O03A 3D23A 2QXJA 3CENA 4YT6H 4B6EA 3W94A 1MTWA 1Z6EA 3ATLA 5DPAA 2GZ7A 1QIXB 3F2GA 5A0AE 4IGDA 1C9PA 1F0TA 2FZZA 2JJ1D 1FV9A 3CS7A 4Z1MD 5FBIA 5HMAA 1JMOH 1NBME 5JBBS 1DY9A 3RDZA 1V2NT 1MKWK 4NIXA 1VKYA 3GOVB 1HAOH 1GI0A 1GL1A 1SC8U 3P95A 2WUBA 1P9SA 1K22H 1C5QA 4INLA 4AX9H 1C1OA 1V2PT 1Y3YA 1TNGA 1TPPA 1UVTH 5TCAA 5C3NA 4DJZB 1B0EA 5E8EH 1GJ5H 3SHAH 1ESAA 3TGKE 1W0JD 3AASA 2UWLA 3DT0H 1C5RA 1E38B 3NZIA 5F03A 4X6OA 1NZQH 1BTZA 3KN2A 2ZQ1A 3MH6A 4H4FA 3UOUA 4BAOB 1UMAH 3RXAA 3D65E 5AFYH 3EGKH 3VB3A 4NWLA 1LQDB 2QGRA 1FONA 1E35B 4AYYB 1GJ6A 1MH0A 3DSGA 1INCA 1D3QB 1GVZA 3SJOA 1O3KA 1UW7A 3KIDU 1G3EA 1SGCA 3ZZ3A 1FMGA 4I32A 1H8IH 3F9GA 1YPGH 2Y7ZA 2QXHA 4WH8A 3F2FA 2W6JD 2C8WB 1D6WA 4X1SU 1GMDF 1ZHMA 4JZFH 2ZO3H 3GY8A 4NFEA 3BTEE 2ZFPH 3HGNA 3QLPH 2H5CA 4OS7A 3SU1A 2YMSB 3OY6U 2QC2A 1ZSKA 5CHAB 3GYLB 3SU2A 2H9EH 1C2MA 4AC9A 2ZU2A 3UQVA 1A1RA 2W3IA 2FLRH 2AHME 3ZZ9A 1BUIA 1K1OA 2VNTA 4CR9A 1P0SH 3URCA 1E36B 3CS0A 2O8WA 1SGPE 2FOFA 4X8TH 1CBWC 5CHBA 2GV6A 2OUAA 3KYGA 2JH0D 4AGKA 4CRDA 2VVUA 2F9BH 5SGAE 2GDEH 1S85A 1TOCB 3URDA 2C3SA 1J9CH 1K21H 2NU4E 3TNSA 1PYTC 1WU1A 1AU8A 1N6XA 4K60A 3PTNA 1GJDB 2THFB 1MQ6A 1QL8A 1OWIA 4YOJA 4MPWA 1O5EH 5T6FA 4K5ZA 3A89A 3BTWE 1P2KA 1GJBB 2Z3CA 3G01A 1G37A 2VU8E 4FUJA 2BY7X 1MU8B 3ITIA 1GMHF 1O2NA 4YLUA 1ZMLA 1O0DH 1Y59T 1PQ8A 1QB1A 2JKHA 2DE9A 1XM1A 1O5AB 1DANH 2O8MA 3KCGH 5C0TA 1HXEH 1UO6A 3GCNA 1BRUP 3E90B 3AW0A 4KELA 4UFEH 3LH1A 2P16A 5E0JA 2Y7XA 2KM0A 1HCGA 3ODFA 2QF5A 4D9RA 3VXEH 4MLFB 1H8HD 3H09A 5DP4A 2ZPRA 4AB9A 1WTHD 3MU5A 1FY3A 2QA9E 3M7TA 3RM0H 1GMDG 1ELEE 4U01A 2UUJB 4Y6DA 2PW8H 3RXKA 4Y8YA 2ZKSA 3PMBB 3MTYA 1XUKA 2ANMH 2NU1E 2H5DA 4AFZA 2FOAA 1W8BH 3SJIA 1NTPA 1TALA 2AH4X 1O3LA 1SFIA 2R0KA 3DCLA 4R0IA 5KECA 2GMTC 1KMHB 3RXQA 2QAAA 1GGDC 1LHDH 1TNIA 5HYOA 3JZ1B 3UREA 2I6QA 4MQAA 1CGJE 1LPGB 2ODQA 3E6PH 1O34A 1OWHA 1T4VH 1IQKA 1DLKB 3QWCH 2AERH 3ZYEA 3OU0A 1GI1A 2V6NA 2A4GA 5C20A 3A84A 2OD3B 2Y5GA 1TONA 3FANA 3A8CA 3GDVA 5IDKA 3S9AA 2VIQA 1DDJA 2W5EA 1QURH 2HNTF 3SO3A 3RUOA 1YLDA 2A7JA 1J8AA 5JBAS 1GGDB 4IN1A 4M9FA 1XXDA 2FS9A 3K6YA 4OGXA 2WV9A 3OY5U 3A7YA 4FOUC 1BTHH 3ZVCA 5IYTA 1Z8JB 2A2QH 3QTOH 1FY4A 3GY4A 5DP5A 4FUCA 1DITH 3PTBA 1PPFE 1NY22 8GCHG 3RXIA 3TLOA 1MQ5A 2FTMA 5C2ZA 3NRLA 2OP9A 1AN1E 3ENSB 4NGAH 1E34B 4KTCA 5DP8A 3SV8A 3SJ8A 2OTVA 8GCHF 2ZP0H 1OWDA 1GI7B 2BDCA 4QT8C 1DOJA 4NIYA 3MNCA 2G52A 1EAWA 4ZHAA 1PQ5A 1NRSH 1AY6H 2H6MA 2ZHQH 1SGDE 3B23B 5F8ZA 1DWDH 3ZVDA 3DFLA 2PUXB 4ABAA 2WPDD 3I78A 3S69A 1AVWA 2VWNA 4GLYA 1T8NA 4BTIB 3SV6A 4GUXA 1GI8B 1GBIA 1V6DA 2AMPA 2WHXA 3VPKA 2QN5T 5F8TA 3S9CA 4X8SH 2FS8A 1ELTA 3GDSA 5A8ZA 4IC5A 2ZECA 2H9TH 4Q7YA 2BXTH 1C4U2 4O3UA 1LVOA 4I31A 8LPRA 2BXUH 5EJLA 2VIWA 3P8NA 2VWLA 2B5TB 4K1EA 5EJZA 3T2NA 1NFYA 1PPCE 2ANWA 2ANKH 3D49H 2BD4A 3SJ9A 1UJ1A 4ABHA 4X8VH 3WWFA 5GWZA 1ELVA 5EOKA 3FFGA 3GDUA 1AIXH 1F0SA 1RIWC 1GHAG 2GCTB 3RXDA 4HG6A 2HPPH 1SPJA 1HGTH 2WINI 1GDUA 1H9IE 2K0QA 3BIVH 2HPQH 3ELAH 1HRTH 2BMGB 4K1SA 1ZSJA 2BQ7B 2EEKA 1DFPA 4NSYA 2GP9B 3FP6E 1JRSA 2ZG0H 1BZXE 3DHKH 1O2LA 2H9HA 3SGBE 1RGQA 5LGOA 1TNKA 5AVDA 2Z9KA 5A0BA 5C1YA 3AK5A 1GHZA 1UTMA 1RXPA 2BQ6B 2PTNA 5KEDA 4CHAC 4HGCA 4BAKB 4LZ4B 3P8FA 1E1RD 3QX5H 1KLTA 3PMJA 7LPRA 1QR3E 2CN0H 1GG6B 2CF9H 1SHHB 1C5LH 2ILNA 1NPMA 4O9VA 1JIRA 4ISNA 2AS9A 1UTLM 1O3AA 2OINA 1A3BH 1GBMA 1SQRA 1MAYA 3GCOA 7GCHF 2AIQA 5FL7D 1C5VA 2FEQH 1AZ8A 3LGVA 2F3CE 2JDID 3KF2A 1DSUA 2VBCA 4X1RU 1UK4A 1TABE 1P2OA 1VCQA 1O5BB 1DY8A 2J98A 5F8XA 3VEQB 1A5GH 5HM9A 1TRYA 1YPMH 3Q3KA 3AAVA 4AYVB 2FMJA 1KLJH 3A8AA 3PV5A 1HJ9A 3K2UA 5A8YA 3A7TA 3BTGE 1YPLH 1NESE 4YLQH 2OC1A 1E0FD 2F9UA 2IJOB 5I46H 1SGRE 3A86A 1B0FA 3SORA 2SGDE 1C2GA 4UEHH 1VITH 2HOBA 3EQ0H 4OS4A 3VGCC 2XWBI 4WXVA 1PYTD 2VIOA 1V2JT 3BEFB 1HAZB 3RMLH 4M7GA 3GCTF 1TLDA 3F6UH 1KSNA 1TGTA 4F55A 1FX0B 1G3BA 5EU8A 2LELA 2OLGA 1THPB 3EA7A 1MTUA 5IK2D 1ESBA 2CF8H 2RA3A 4I7YH 5GCHF 2BD7A 6CHAC 3SV2H 2YMSD 3NUMA 3A88A 4B2AA 3WW7A 1XXFA
chains in the Genus database with same CATH topology
1XX9A 4X6MA 4FVDA 2AEIH 3E0PB 2J4IA 3O8BA 4ZMAH 1RS0A 3RXVA 2XTTB 1YCPK 3QN7A 5ESBA 3SGQE 1FI8A 1GJ9B 4FUBA 3F1SB 1P03A 4GCHG 3RLYH 2ANYA 4ISIH 2ZDMA 3VB4A 2O8UA 3AAUA 4BANB 2ZQ2A 1FAXA 2BLOA 2D8WA 3PLPA 2ZHFH 3P70B 2BDYA 5GXPA 1PPBH 1S81A 2FI5E 1O2KA 2FXRA 4CRBA 4YOGA 2GX4A 3UTUH 2M5TA 4UD9H 3T29A 2GZ8A 1BQYA 1ZTKA 2VVCA 2BD2A 3FZZA 1EPTB 1LVMA 1V3XA 2BOKA 2Z6BD 2ZFTA 5ESTE 3P17H 4ZKSU 2BDAA 3T27A 2CMYA 1HAVA 2BY8X 1P2MA 2VIDA 1SOZA 3O8DA 1ANCA 3IG6B 4OS1A 1HYLA 2ZGHA 2BY5X 4MNYA 4U32A 1LKAA 1A0HB 3N7OA 4ZKNU 4DW2U 1OP2A 1JWTA 1WQVH 2ZGJA 2GD4B 2G81E 2ZHWH 1O5GH 1O3FA 1DS2E 1XVMA 3SUEA 1C9TA 2R0LA 3H7OA 1DPOA 1AKSB 1EZUC 4Y7BA 3PWBA 4A1XA 2XC0A 3RXGA 1RTLA 4KGAA 1TMUH 1PPEE 3TNTA 2XC4A 3ZZ5A 5BPEA 1CGIE 1O3GA 5L30H 1O2GH 3MOCA 2WV4A 1YYY1 3OX7U 4FU8A 2BYAX 8ESTE 2GCHG 3LH3A 4K8BA 1MTSA 3MU4A 1TAWA 1C1PA 1NROH 1A4WH 1IQJA 1TGCA 2G51A 2GMTB 3QTVH 1BJVA 1BTXA 1YPJH 5JYIA 5K7RA 4K3JA 2EC9H 1QHRB 2J92A 1NN6A 1XUGA 1P09A 1J14A 1UHBA 2BLWA 2ALPA 4X6NA 2RCEA 1O30A 1S82A 1O38A 1IQGA 3RXBA 1CT4E 1O2OA 4X1PU 1C5WB 1TA6A 2W7UA 2ULLA 1FZZA 1AI8H 1C2DA 1K1NA 1QRWA 9LPRA 5EQQA 1SL3A 4FU7A 1WBGB 3E3TA 1QJ1B 1K2I1 5HM2A 1RFNA 1ELBA 1CT2E 3MYWA 1GVLA 3TIUA 1ARBA 4NIVA 3O8CA 1C5XB 2H1UA 1DWEH 3PO1C 1DUEA 1SLXB 4R8TB 1O2ZA 5EXMA 5ETXA 3A8DA 3BTME 1SQAA 1PQAA 1AHTH 1AWHB 1IQMA 4DCDA 1BTWA 2HLCA 3TGIE 4KP0A 1W12U 1ABJH 1MKXK 3RC4A 1GVKB 5E0GA 1ZZZA 2ZCHP 1Z1IA 3IITA 3C1KA 4OS5A 1AVXA 1QRXA 4X8UH 2BZAA 1FXYA 1SGIB 4FUHA 3V7TA 4A7IB 1VJAU 1MU6B 1WQSA 5FBEA 1ARCA 1FDPA 1ZLRA 4I8JA 1F5KU 4ISHH 4K2YA 3OSYA 1P3EA 4WF8A 4B2CA 3TK5A 4SGBE 5FAHA 1Y3VA 2EI6A 1HLTH 3UNSA 2JH6D 5DO4H 1ELFA 5LH8A 1A5IA 1C5PA 3VGCB 4CBNA 4DY7B 2HNTE 2ZFQH 2A4QA 3OYPA 2QXGA 3BTDE 5GPIB 3ZVEA 1O2WA 2TBSA 3K9XB 4X1QU 1O36A 1O2RA 1ETTH 1HIAB 1L4ZA 4UFGH 3SQEE 4CH2B 2O9QA 2FOHA 1GHXH 1LTOA 1XUHA 2YNAA 3V12A 2VVVA 1JXPA 2ZGBH 1TPAE 2ASUB 1UVOA 4MTBA 3B9FH 4K8YA 3A8BA 3ODDA 1A5HA 4OS2A 1GHBG 4ESTE 1TMBH 1ZHPA 1Z8RA 1QB6A 4X2YA 3L33A 4MPXA 3UUZA 1N8OB 1P06A 2BDBA 1SSXA 2LPRA 3RP2A 3TK6A 2Y5HA 1P2QA 4JK5A 2W3KA 2BDGA 4KTSA 2NU0E 1TGNA 1UK2A 2AFQB 1DICA 2ZFFH 5G4BA 2Y5FA 1O37A 1D6RA 1DVAH 5GJ4B 2WPJS 4ZROA 2FX4A 2WUCA 4TY6A 5FHTA 3RLWH 5AHGH 4B74A 1MZDA 3GY5A 2XBXA 4ABEA 3U1JB 1UTJA 4NWKA 3GCHC 1MKXH 1QL9A 4NA9H 3FZDA 2BTCE 1NM6A 3QO6A 3VB7A 1MTVA 3FAOA 1N6YA 1SLWB 4INKA 1SGQE 1KTTB 2KAIA 2PGBB 5FX6A 1MCVA 1TE0A 1L4DA 5A2MH 1RIWB 1AWFH 3LKWA 3M5OA 1P9UA 3TVJB 1TWXB 1W7GH 4IBLH 1IHTH 1OPHB 4WH6A 3HKJB 4DIHH 1C5MD 1K1PA 1ZJDA 4JCNA 3LU9B 1BRBE 4TWWA 2WPHS 1SGNE 1EQ9A 1TBQH 1ELCA 2PWXA 1P11E 4HFPB 1ANDA 2AIPA 3BIUH 2HNTC 1Q3XA 2JH5D 2WPKS 1GHBF 3SU3A 3RU4E 1RTFB 4ZH8A 4ABFA 2A5IA 2ZGCA 1O3DA 1O5CB 3TJNA 3ZV8A 3M3VA 4DGJA 3RC6A 3BN9A 1CE5A 4Q7ZA 5T3HA 2G00A 2WPLS 1V2MT 2FOMB 4Y8ZA 3LC3A 3UWJH 2PR3A 4I33A 1NC6A 1GJ8B 1HJAB 1C2JA 1VGCB 1C5TA 1AKSA 1YKTA 3STJA 2BD3A 2HALA 2OC7A 4D9QA 3E1XB 1O32A 1T8OA 4BAHB 1LKBA 3A7ZA 1PPZA 3HGPA 1YBWA 3HPTB 1T8MA 4AORA 2HVXA 4ZUHA 1C5OH 5DP3A 2Y82A 3LGYA 3BF6H 1JRTA 2WYJA 2WYGA 2XW9A 4JZIA 2BD8A 1ZTJA 1W0ZU 1B5GH 2PV9B 1OYQA 3SGAE 1H4WA 2K1QA 1T4UH 1HAYB 1KY9A 2I6SA 4WXIA 3ZZ8A 1FPCH 3ZZ6A 4YZUA 2QV1A 1SGYE 3PLKA 2A45B 1ORFA 4Y0YE 1TRNA 1WOFA 3ATIA 4TPIZ 1LVYA 1Y5BT 3HKIB 6LPRA 2FODA 1DE7H 1EOLA 2Q6DA 3BTHE 5F6MA 3M36A 4UDWH 3T25A 3ZVFA 4RN6A 3FP7E 2BOHB 1O5FH 1P01A 3P6ZB 1AQ7A 1A3EH 3T62A 2EA3A 3M37A 3KL6A 4O97A 1ZHRA 1XVOA 5FX5A 1S83A 1C2EA 1O3CA 1P10A 1EJNA 4X2XA 1OKXA 5HXFA 4BNRA 4MPVA 3KQDA 3LGIA 3EDXB 1WUNH 5DP6A 4A92A 3MWIU 1A0LA 3BEIB 1DWCH 1O2MA 2BDIA 2ESTE 3MI4A 5J4QA 3BTQE 1LO6A 3GCHB 1ACBE 1OWEA 1GI2A 1BDAA 1EOJA 1GDNA 3VFEA 1W13U 1SFQB 1P57B 2F9OA 4CREA 4NA8A 1C4Y2 5DK1A 3GY2A 3MH5A 1MBQA 3ZVGA 1BMMH 1F5RA 2AYWA 4MG3A 1V2LT 4Y7AA 1V2OT 3ZVBA 2ZFRH 1FAKH 2ZU3A 1GHWH 2ZU4A 4NCYA 1OX1A 2BD5A 4IN2A 1TGBA 1EJAA 1EB2A 1MTNC 1CA0C 2ZFSA 4XFQA 2PFEA 3UNQA 4AFUA 4D8NA 1KXCA 1KIGH 3ZYDA 3A81A 2ZDNA 3LGWA 2BVRH 4AN7A 1LHGH 3FP8E 1QNJA 3I29A 4ZHMU 1HFDA 1UCYK 2JETB 1AFEH 1ELAA 1C1MA 1FQ3A 4XE4A 5EPYA 1Y8TA 1GMHG 2XCFA 2D26C 2BLQA 4D7FA 3IWMA 1K9OE 1YPHE 1GHYH 1Q2WA 4FUDA 4IMQA 2UWOA 1P05A 1RJXB 1TX7A 4YM9A 1QBOA 1O3HA 5DP7A 4XBBA 3MO3A 5CE1A 1UVSH 1Z1JA 4KTUA 3BEUA 4H6SB 1EZQA 2ODPA 1H1BA 3TH2H 3SOSA 4NG9H 5A0CA 1DLEA 4Z0KA 2FIRH 1O3JA 5JBCS 1J16A 1KTSB 4X2VA 1SGFG 1GI4A 1S0RA 1WSSH 3KQBA 3E0NB 5C1XA 3RXHA 3B8JA 2CV3A 5EPNA 1Y3XA 3NK8A 6GCHG 4JK6A 3SZNA 2AMQA 1GBTA 4X2WA 1GBAA 1T8LA 2BX3A 1Y3UA 3A87A 1DX5M 3DFJA 1V2KT 2SFAA 1BBRE 2Q1JA 3R3GB 3RC5A 1FIZA 4FUGA 7GCHG 5DGJA 1D4PB 2Z9GA 1UTQA 4GPGA 1O2PA 2VIVA 1TNLA 2OQUA 2YNBA 1W10U 3EYDA 1UVUH 1AFQB 1PQ7A 1YLCA 3SU5A 4IW4E 3WY8A 1AD8H 4CRCA 1S84A 3ZZ7A 2HWLB 1OWKA 2B9LA 3QZRA 1F0RA 1JBUH 3SBKA 1O2IA 1QQ4A 2PKSC 1GJAB 4JZ1A 4LXBH 4DIIH 3GY7A 2V3HH 5LPRA 3ZZCA 4B2BA 4DOQA 1CA8B 1GBKA 4B76A 3Q77A 3SW2B 2W7SA 4B1TA 1DXPA 1UVPA 3D62A 4NSVA 3BG8A 1SVPA 4LZ1H 2CXVA 3QZQA 4DURA 1LCYA 3VXFH 2AGEX 1F5LA 2ZDKA 3BTFE 1EP5A 2DUCA 1NT1A 1YP9A 1ZJKA 2PKSB 4JYTA 1U6QA 4UFFH 2P3UB 1DT2A 1CSOE 1P3CA 4X1NU 1J17T 3UR6A 3ESTA 1SB1H 2P95A 2GGVB 3FVFB 3RMNH 3UFAA 4WMEA 1WTGH 1QBNA 2OQ5A 4NZQA 5GCHG 4AG2A 3BTTE 2G4TA 3LPRA 2FYRA 1XMNB 3RM2H 1HB0B 1DSTA 2A5AA 1C1SA 2QCYA 4H42U 1D3DB 1SGFA 1ZRBA 1F92A 1AB9C 2D2DA 2XC5A 3M5MA 1ZSLA 1CT0E 1C5NH 3A80A 3PYHA 2TIOA 1C2HA 1SLUB 1GG6C 1OS8A 2P8OC 2A5KA 1C1RA 2ZC9H 2BDHA 4PROA 1FY8E 2FESH 3EAJA 4ABBA 1L1JA 3ATMA 2ZHEH 5JB8S 1BRAA 1GBBA 3K6ZA 1EAIA 3V3MA 1CU1A 4MNVA 1VITF 1AUTC 3GICB 4D76A 3E8LA 3DD2H 1QA0A 1KLIH 4TWYA 1THSH 3SJKA 1AGJA 3A85A 2P94A 4BXSA 3DA9B 1IQEA 4JZDH 2SGEE 3S7HB 3NCLA 3PO1B 2BB4A 4ZXYH 2IOTA 1CHOF 4X6PA 2ZTZA 2C93B 2H2ZA 1AZZA 3MNSA 2FI4E 1VZQH 2J94A 3M5LA 2Q6GA 2VWOA 1C5UA 1QRZA 1GJ7B 4ABDA 1CHOG 3T5FH 1QL7A 4E06H 1LHEH 4NFFA 1M9UA 1NRRH 1MCTA 2P3TB 4HTCH 1SLVB 1YM0A 1G2MA 2QF3A 4ASHA 1MAXA 2GT8A 4MDSA 1BTYA 4Y76A 2OBOA 1L2EA 1C1NA 1ANEA 4WMFA 4IS5A 1TBZH 3TU7H 1EP6A 1ELGA 1O3OA 4I8LA 4XSKU 1SQOA 1O2YA 1HUTH 2STAE 2ZU1A 2ZDVH 5E2PA 3U8TH 3F9HA 2ZPQA 1IQHA 2GTBA 4ABIA 2SGQE 3MMGA 2Y80A 1CO7E 1CA0B 2SNWA 3LOXA 2GCHF 5JBTA 1KXFA 1E37B 4LK4A 4Y0ZE 5DJ7A 2GVFA 1TA2A 2Y6TA 5PTPA 4E7RG 5EW1H 1G32B 1ZMNA 1W3CA 1ZGVA 2Z3DA 3M5NA 1ZOMA 4UE7H 1OWJA 2ZIQH 3RXRA 3SNEA 3KEEA 1TPSA 1O3IA 2GCTC 1FN6A 1GBCA 1TMTH 1D9IA 2J95A 5H4IB 1GJ4H 1O5DH 3A7VA 3PM3A 3SQHE 1HAIH 1TRMA 3MH7A 1EPTA 1TIOA 3GY3A 3E16B 2PHBA 3MH4A 1GDQA 4MPUA 1PJPA 1LHCH 4VGCC 1GMCG 4CRFA 1TX6A 3TGJE 4YT7H 1C4V2 2F9PA 3AW1A 1QQUA 1IQLA 3LJOA 1ZR0A 3STIA 5DP9A 5K0HA 4BOHA 2ZI2H 2XNIA 1VCWA 1O3MA 2RDLA 1C5SA 5EQSA 4WY3A 1SBWA 1FPHH 4ZKOU 2ZU5A 1CGHA 5AFZH 2RA0A 1HJAC 4FUEA 3SNAA 1BCUH 1F7ZA 1G2LA 4I8KA 4INHA 2CHAC 1TNHA 4FXGH 1P8VC 1K1MA 5B6OA 4AOQA 2J38A 1SOTA 2RG3A 1EAXA 1ZPBA 3VB6A 4ISLA 3SV7A 1AO5A 2C4FH 1TOMH 1FNIA 2Z9LA 5T6GA 5FCKA 3A7WA 2ZTXA 2G4UA 1K1LA 1AE5A 3RXJA 2VGCC 1CQQA 5EQRA 3ATWA 1LPKB 1O33A 1GBJA 1XUJA 1EUFA 3PROA 4IC6A 4YTAA 4XBCA 2W26A 3R0FA 1O3EA 2ODYB 3LC5A 3LJJA 5L2YH 4RSPA 1K1IA 3NXPA 1A7SA 3ZZ4A 8KME2 1G3DA 1XUFA 5EGMA 1C1WH 1T7CA 2BZ6H 1OP8A 2FM2A 5I25A 2G5NA 2OBQA 1NRNH 3RXFA 2F91A 2ZWLH 4GHTA 1VITG 2F9VA 1P2NA 3T28A 1SGEE 5TCCA 2HRVA 1EX3A 1Z8IB 4NA7A 4YO9A 2B7DH 3RXEA 3EA9A 1P2IA 3UWIA 1BMLA 1IQNA 2QIQA 3ZZDA 4GSOA 3LT3A 3QDZB 2ZA5A 4I8HA 1FN8A 4WJG2 3M7QA 3BG4C 4Y71A 2DE8A 3CP7A 5GDSH 3P92A 1ETSH 3A7XA 4BAMB 1BA8B 1RRKA 1F0UA 1ZGIA 4ZXXH 4CHAB 1S0QA 2OCVB 2HGTH 1MZAA 4ZAEA 3TH4H 4AFQA 3VB5A 1EJMA 4XDEA 1QTFA 1YPKH 1ANBA 1WV7H 4D7GA 5FPSA 3MU0A 1TB6H 3U8OH 3RXPA 1V2RT 5E2OA 4J1YA 1D3TB 2A2XH 3QUMP 1GI9B 4LOYH 3MNXA 1IQFA 1DUAA 1WYKA 4AG1A 1GI3A 5DG6A 1MMJN 2D1JA 2NWNA 3SNCA 1MTNB 3UQOA 3SNBA 4DT7B 1EATA 1O2HA 3PB1E 4WWYA 3F68H 3LGUA 4VGCB 1CVWH 4MVNA 1AUJA 1P2JA 1KXBA 4CR5A 1ELDE 1T32A 1VJ9U 1SGTA 3KGPA 1TX8A 2R9PA 3K65B 3TK9A 4U30A 4BAQB 1BT7A 2A31A 1BOQA 2GDDA 3AVZA 1LVBA 5ABWA 2QF0A 4ABGA 4XOJA 1O3BA 2ZGXH 1UTOA 3LGTA 1GL0E 1V2WT 3GCT