1E34B

Porcine pancreatic elastase complexed with (3s, 4s)n-para- toluenesulphonyl-3-ethyl-4-(carboxylic acid) pyrrolidin-2-one soaked in ph 9 buffer for one minute
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title `Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B01
1THRH 1RFNA 1HIAA 1FY5A 2B8OH 1JWTA 1O2ZA 1HJ9A 3QLPH 4B73A 4TPIZ 1F5KU 2BVXH 8GCHG 1HLTH 1XVMA 2FLBH 1ANDA 1ABJH 1C1RA 2FOFA 5F8ZA 1T32A 1O31A 1PPBH 3S0NA 1O39A 3SNAA 1GHZA 6GCHG 4CH8B 2JH5D 3SQHE 3VGCB 5A0BA 2J94A 3M5LA 1OXGA 1BBRH 1OOKB 1B5GH 2WV5A 2SNWA 2BB4A 1ZRKA 3ATIA 3UNRA 2FM2A 2VWNA 3RXGA 1V2MT 2RCEA 4K60A 2ODYB 2R9PA 1MTVA 2ANMH 3C27B 1P9SA 1BRUP 1C5SA 3SNDA 1EX3A 2K1QA 3JZ1B 5HM2A 4Y76A 1ZSLA 2G00A 4CRCA 2BD9A 3SGAE 3MWIU 4FVBA 1IAUA 2BY9X 1WOFA 1OWIA 4UEHH 2Q6DA 1GL1A 1WQVH 4BNRA 1L4ZA 3SV6A 2XWAA 1EOJA 1YPHC 2ZTYA 3A7VA 1V2LT 1B0EA 1MUEB 1SGEE 1RIWC 5I46H 4FUEA 3TK9A 1GL0E 1CU1A 1O34A 1SFQB 1Z71A 3TVJB 1GMCG 3RMOH 1SGFG 4HGCA 2VGCC 3SJIA 1NT1A 3BEFB 3B23B 3RXOA 3E3TA 4IC5A 2CF9H 1NU7B 2Z9LA 1PYTC 1F0RA 3HGPA 5C67A 9LPRA 1O2SA 2BVSH 4A1VA 3M5NA 1NRPH 2IJOB 3AVZA 2JH0D 1Y5UT 4CRBA 1ZHMA 1Y59T 3KQCA 1HPGA 1SLVB 1HCGA 5J4SA 2QGRA 1BT7A 1C5VA 1NRNH 2GDDA 3GY8A 5CE1A 3FAOA 2UWOA 1B0FA 2HPPH 4RKOB 1VITG 2ZU2A 2ZTZA 1HFDA 5EXMA 4A5TS 4WVPE 1CT4E 1C4V2 1S85A 2FYQA 3HATH 2BLOA 2WPMS 1HAYB 1MAXA 1LHEH 2FOCA 1WV7H 4BAKB 3ZZ7A 1O3HA 1P2MA 1OP2A 1PPGE 2BYAX 4Y71A 1FNIA 4YOGA 2ZI2H 4YOIA 1GBHA 2TRMA 2H5DA 2F83A 1WU1A 3KEEA 4WY3A 4MQAA 3GY3A 2A4OA 1EZUC 1ABIH 1UO6A 5JPMH 2J4IA 4NZQA 1MTWA 2XC0A 1GMDG 3KN2A 3M36A 1HAVA 3KF2A 1GI8B 1O2WA 2QC2A 1C2DA 4AN7A 1MTUA 1UTLM 4H6SB 2GMTB 4NA7A 3HK6B 4BANB 2BD2A 2UWPA 3F9FA 3TH4H 4Q80A 3DUXH 4WH6A 1QB9A 1TRNA 5EXNA 5EU8A 1AUTC 1C2MA 2PWXA 2ZIQH 3RXSA 1V2PT 1HAIH 1AWHB 4J2YB 1D3TB 3PMJA 1V2KT 4TPYA 1MTNB 2BOKA 1QNJA 1IQGA 3TGKE 1WBGB 4DVAU 1G30B 1O2IA 3MNXA 4OGXA 2EI6A 8ESTE 1SGDE 2QN5T 1L4DA 2GTBA 1TNHA 1PPFE 1WSSH 2PUQH 2SGDE 2SGAA 3UFAA 4X1RU 4SGBE 1OWHA 3A7ZA 1SR5C 2STAE 3GISB 2NWNA 1LQEA 2PW8H 3Q3YA 2ZTXA 3SV8A 4ABHA 3SHCH 2R0KA 3LU9B 3TITA 2GZ9A 4Y0ZE 1ELGA 2YNAA 1V6DA 1AO5A 1AE5A 1SGYE 2P3TB 1PYTD 2Z6BD 4UFFH 1VCQA 4AB8A 2A5IA 2NU2E 4CRGA 1QA7A 1YPGH 1YCPK 2H6MA 5EXLA 2ZQ1A 1MCVA 2ZDMA 1ELFA 1Z8GA 5C1XA 3PLPA 1YPMH 1TLDA 1EPTC 1GDUA 5J4QA 1KXDA 1ZRBA 3ATKA 3KCGH 4DCDA 1YPLH 4MLFB 3MHWU 3RXMA 2QF3A 1V2ST 3GY4A 3U9AH 3NPSA 3V3MA 2FXRA 1LKBA 3RXPA 3T26A 4X1NU 2ILNA 1BHXB 4ISHH 2P8OC 1LHCH 2JETC 3MU5A 2O8WA 2ZNKH 2C8ZB 2OQ5A 2P16A 4U2WA 2QF0A 3PV4A 1SG8B 2G5VA 2VVUA 3M3VA 1BDAA 1LPZB 1TBZH 3MYWA 1HAHH 3V12A 1XXDA 4NIXA 1C5TA 3BTFE 3U69H 2Z3DA 1KSNA 2SGEE 3SV7A 3SN8A 1XVOA 1S81A 2QXJA 3QZQA 1ELAA 1YPHE 2BVRH 2OQUA 3BTTE 4OS1A 1A0HB 1K9OE 1BTXA 3RM0H 1GHAG 4WMFA 1FN6A 2VGCB 1TGBA 3M7TA 1ESBA 1CHGA 4KGAA 3AASA 1TMBH 1O3KA 3TK6A 1O2KA 3P6ZB 2ASUB 1CA0B 1ZHRA 1SGCA 3T28A 3RM2H 4LZ4B 3MH6A 1ESAA 1TBQH 4A6LA 1JIRA 1K1LA 1O37A 5GJ4B 2PFEA 1HAPH 4ZKRU 1TAWA 3OY5U 3EA9A 1KLJH 2XC5A 1CGIE 4X6PA 3MO9A 1MZAA 2BQ6B 1N1LA 1BA8B 1IQFA 1RXPA 3PO1B 3QDZB 4MDSA 2GT7A 5FX5A 1VITF 4Y10E 1ACBE 3U8TH 1JOUB 1H8DH 2VIQA 2PTNA 1V2JT 2XBXA 5E0GA 3NUMA 3ZVBA 1GBAA 2V3HH 2J9NA 2D2DA 3TJOA 3SQEE 3AAVA 4GUXA 1Z7KA 2ZZUH 1P2IA 1VCWA 1Y8TA 3RMLH 1IQHA 4WF8A 2BDHA 1AIXH 1UTJA 3GDUA 2BDAA 5DP8A 1NFYA 4X1PU 2RA0A 2GP9B 3DHKH 3VGCC 1F0UA 2A32A 1N6XA 3RXBA 4FUFA 1ZZZA 4ZKSU 1ETSH 1QIXB 4GCHG 2VB0A 1UK2A 4AYYB 2GV6A 3Q3KA 1BUIA 1ESTA 2BD4A 4VGCB 3RXFA 1LHFH 3QN7A 2J2UA 2ZGHA 3A81A 3A89A 5BPEA 2TGPZ 1NU9A 3SGQE 1AN1E 3D23A 4DOQA 1ZPCA 4WH8A 1H9LB 1OYQA 1TX7A 5A09A 1UK3A 3RMNH 1QHRB 4OS5A 2UUYA 1AE8H 2RA3A 3LC5A 4O3TA 4IN1A 1MBMA 1GPZA 1O3FA 1P3CA 1O2VA 1GMHG 2IOTA 4ZAEA 3LONA 5TCCA 2PSXA 4I8GA 4GAWA 3SU1A 3LOXA 1OWKA 1UK4A 3EQ0H 4INLA 3MMGA 4NGAH 3U98H 3UNQA 3LJOA 1FMGA 1SGTA 1TOMH 3MU8A 1QBOA 2C4FH 5FCRA 3TJVA 1OWDA 1P8VC 1UMAH 1VJAU 1MZDA 1D6RA 2QYIA 2F3CE 1IQJA 3SNBA 1IQMA 2ZCLP 3EDXB 4MNYA 4CR9A 4JMYA 3U1IB 2R3YA 2LNCA 2C3SA 3TGJE 1BTPA 4MNXA 4UFGH 1JMOH 1LMWB 1ZTJA 3ENSB 5EPNA 1GBIA 2HVXA 3VB6A 2PUXB 4NFFA 3KQDA 1VR1H 1M9UA 1O35A 3RMMH 4WXVA 4A1XA 1QFKH 2ZHDA 1TNIA 3E91A 1SLUB 2BDIA 2CJIA 2IPHA 1GWAA 2G81E 2J95A 1TMTH 1FAKH 2Z9IA 1SQOA 4JYUH 4RKJB 1C2FA 3A84A 4YLUA 1NTPA 1ZGVA 1KTTB 1P2JA 1C2HA 2BLQA 2UUJB 2UUFB 1KLTA 2LPRA 3OSYA 3VB5A 1AWFH 1K1IA 1T4UH 1V3XA 4U01A 1SFIA 2XCNA 1CT0E 1FDPA 4YT6H 5FPYA 4IS5A 2ZGBH 4Y79A 3K6ZA 4JZIA 2H9TH 1OP0A 3BG4B 1GJCB 4FUCA 3STIA 1GJ7B 1L1GA 1TPSA 1TRYA 3M7QA 4I8HA 3RXLA 2ZDNA 3SOSA 4K5ZA 5GCHG 4HI3A 5EOKA 1J14A 4I8LA 4ISOA 2GV7A 4E7RG 1UTQA 2P8OB 4IGDA 3DFJA 2JETB 3L3TA 1P03A 3UR9A 1G32B 5LGOA 4IMQA 2Q6FA 2R3UA 2QAAA 5ABWA 1YC0A 3BTKE 3ESTA 2BX3A 1Z1JA 5TCAA 3RXTA 2H9EH 4FUDA 1LVOA 3LKWA 1EZSC 2PKSB 2GMTC 5EW2H 1GHAF 1W7GH 2BDBA 4JZ1A 3RXQA 1IHSH 3SJ8A 3U1JB 3P17H 1ZPZA 3GCTF 2AGEX 1ZMLA 1CHOG 2ZCHP 3NKKA 1CBWB 4AZ2B 2FEQH 4UFEH 3TJNA 1CT2E 8LPRA 5EG4A 1K1JA 2G4TA 1GDQA 2PTCE 2D1JA 2Z94A 1MTNC 4INHA 2XW9A 5GDSH 3OTJE 2CN0H 2EI7A 5EPYA 1ZLRA 1ZYOA 3P70B 2PKAB 3MNBA 1VGCC 1PPCE 2GZ8A 6CHAC 1O0DH 4AB9A 2OBOA 1T8OA 3MU4A 2OC0A 1LVYA 3ZZ8A 1GCDA 1PQ5A 2DE9A 3ZV9A 1A5GH 1DE7H 2GVFA 1BITA 4Q7XA 1TE0A 4UDWH 2ALVA 1DSUA 2KAIB 2P3FH 1HDTH 2F9PA 1MKWK 3N7OA 1TNGA 1RRKA 1E36B 3GDSA 1L1NA 1TRMA 1O5CB 4R8TB 4UE7H 3ZVGA 3A8AA 4RN6A 1TWXB 2H2ZA 5ESTE 4WMDA 5DJ7A 3E0NB 1O3CA 3KHVA 5EW1H 2EC9H 4HFPB 1W0ZU 1L2EA 5E0JA 2XRCA 1BMLA 2O8LA 1PJPA 1FZZA 1HB0B 1SGIB 1ELCA 1C5MD 3GICB 4DIIH 3ZZDA 2G55A 5T6GA 1PFXC 2W7SA 3UQVA 5L30H 3PMAB 1WQSA 3MU0A 5CHAB 4OGYA 1C4Y2 4MTBA 1C9TA 1Y3WA 4OS2A 1B7XB 4H4FA 3RXCA 1CSOE 1V2QT 5C1YA 3RC5A 1DX5M 1J9CH 1GMHF 2QV1A 4O97A 3NZIA 1GHVH 1CE5A 4TWYA 1F0SA 1DLEA 4B2AA 2WPIS 2HNTC 1QJ6B 2PLXA 3EYDA 2FS9A 5L2YH 1P57B 4Z6AH 2VIVA 1KLIH 3P8GA 3UWJH 3TLOA 2CF8H 3PMBB 1O5BB 3A8CA 2HLCA 1T4VH 4X8UH 2ESTE 1D4PB 3UY9A 1V2VT 2H1UA 1O3LA 4NZLA 4I8JA 2ZFPH 3OYPA 2VIWA 2ZGXH 3Q3XA 3RC4A 3VXFH 3QX5H 1K21H 3ZZ4A 4ZHMU 1AD8H 1SQTA 1V2RT 2GCHF 2BZ6H 2Y7XA 3H7OA 4LXBH 3AW1A 4DY7B 2XYAA 4J1YA 1QJ7B 1TPAE 2VIOA 1O2MA 3E6PH 3SBKA 1LHGH 1CA0C 7GCHG 4AFQA 4ZMAH 2GKVE 4AG1A 1O2LA 5JYIA 1HXFH 1LTOA 1C5LH 3ZZCA 4OS4A 3FVFB 1LVBA 1AUJA 1O2HA 1C2IA 1ELBA 4D9QA 4HZHA 1W2KH 2FI3E 2BTCE 2FX4A 5SGAE 2RDLA 1HYLA 3PO1C 2ANWA 4YTAA 5HYOA 1SGNE 3ODFA 1MCTA 2OC7A 2Z9KA 1P11E 5PTPA 2OXSA 3AW0A 1LQDB 2GX4A 1GI9B 2G5NA 2FX6A 3M61U 3HK3B 1PPEE 1ID5H 1RD3B 4A92A 3EE0B 4TWWA 1TMUH 2PSYA 4CR5A 3M5OA 1IQNA 2NU4E 1O2PA 4ABIA 1KXCA 1SPJA 1FIZA 4JZEH 5C20A 4XDEA 2HOBA 2ODPA 3GYMA 4GSOA 3F9HA 2ZHEH 3C1KA 4ZROA 2ZU4A 5HM9A 1P06A 8KME2 4CHAB 1DUEA 3GOVB 2O8MA 4VGCC 2ALPA 1H9IE 2GCTB 2A2QH 1GBBA 4BTUB 2FOEA 1DY8A 1GI1A 1XUJA 3A7TA 1E37B 4ZXYH 3GCHC 5HXFA 2UUKB 3O8DA 1DSTA 3R3GB 3Q00A 4WXIA 3PWCA 1SVPA 3SNEA 1LCYA 1HAOH 4Y7AA 3QK1A 1C1VH 1G36A 1T7CA 1QB6A 4NG9H 1GBDA 2I6QA 4I32A 4AYVB 5E2PA 1G3DA 1DWCH 1P10A 1ZJDA 1GHBF 5FBEA 3FFGA 1Q2WA 1D6WA 2AGGX 2BD5A 4ABAA 1BHXF 5L2ZH 2TGDA 5EQRA 3A86A 3ZVEA 1O36A 1O3OA 1O33A 2Y5GA 2ZO3H 3SJKA 4ISLA 3TIUA 2HNTF 4Y8XA 3ZZ5A 3RXEA 2OINA 2BD8A 3P8NA 1VGCB 3I78A 2BOHB 1P2NA 6CHAB 3QUMP 4ZXXH 2PV9B 1C2EA 1EKBB 1YGCH 2WV4A 3PTBA 1K1PA 1P2OA 5LPFA 1FY1A 3DT0H 4HTCH 1GI5A 1ZTKA 4AFUA 4AFZA 1VCPA 3LH3A 2A31A 1C1SA 2OC1A 2FOMB 4NIWA 2FESH 3A8BA 2WPHS 4MNWA 4B1TA 4AX9H 5A2MH 5JB8S 8GCHF 3D49H 2PR3A 5HMAA 1UTNA 6GCHF 1OYTH 1HUTH 3LGIA 2ANKH 1O2NA 1AZZA 2G4UA 1FPHH 2F9BH 3BEUA 2VINA 1FLEE 2J38A 1TNLA 1AVGH 2Y6TA 5T3HA 2BZAA 1E34B 2F9VA 1THSH 1UTKA 1TGTA 1GBFA 3TH2H 1H1BA 2GDEH 3BG4C 1ORFA 3MH5A 3QGNB 4MVNA 5C5OA 1NFXA 1SL3A 1W3CA 3P92A 3U8OH 1FQ3A 2G8TA 1NRQH 4PROA 5I25A 1X7AC 4X0WU 1O2GH 2FS8A 4XSKU 4JZDH 4ZHAA 2W26A 4K1EA 2WPJS 5TJXA 3ZZBA 1A3BH 1C5NH 1CVWH 2STBE 1XUFA 2ZFSA 3MH7A 3PYHA 5IDKA 3B9FH 2C8YB 1GHWH 3A8DA 1BTZA 2HNTE 2Z7FE 3E1XB 1MU8B 1TX8A 1KXAA 3GYLB 4BXWA 2ZDKA 1NRSH 2PKSC 1F5RA 2OCVB 2Y82A 1LKAA 1D3PB 3BTGE 3F9GA 1GMCF 2FOAA 1FPCH 3SU4A 1WUNH 1SC8U 3IITA 4Y8ZA 1CBWC 4Y11E 1BRAA 1CA8B 4X2YA 1K28D 1UVPA 5A8YA 2FLRH 1RGQA 7GCHF 2FYRA 2TPIZ 1F0TA 3EAJA 5DK1A 1GJ4H 4ESTE 5AFYH 1YBWA 3RU4T 2ZFQH 4O03A 4BTTB 2QIQA 3UOUA 1O5AB 4K8BA 2P3UB 1GCTC 4X2XA 1TNJA 1HV7A 1MBQA 1DANH 1BTHH 4AOQA 1SHYA 1SOZA 2CGAA 3QTOH 3VFEA 5K0HA 1L0ZA 3K9XB 3TH3H 5DP3A 1IQIA 2QXGA 2DE8A 4JK6A 1G3BA 5B6OA 1KXEA 1UHBB 3KIDU 1MAYA 4KTCA 2FIRH 1RJXB 1S5SA 2V6NA 2WPKS 3LGYA 1AQ7A 1HNEE 1BMAA 1RTKA 2XTTB 3D65E 4TY6A 2XBYA 4KP0A 2BXUH 2HGTH 3OX7U 2ZHWH 4X8SH 4NFEA 1N8OB 3SU3A 1GBMA 2BY6X 1QL7A 1T8LA 1NY22 1O3MA 1ZGIA 1C1NA 3M5MA 4GVUA 4BXSA 4FVDA 3I29A 1DFPA 2AMPA 4FU8A 5CHAC 1OKXA 1L1JA 1F7ZA 1XX9A 1MD8A 5F8TA 3ZZ9A 3RXJA 1TPOA 4D9RA 4NCYA 4MPXA 3P8FA 4D76A 1Y5BT 3URDA 2G51A 2C8WB 2B0FA 2A4QA 2GD4B 3A7WA 1F92A 3SU2A 1ANBA 1TOCB 1GMDF 1Z6JH 5E0HA 3UIRA 1W14U 1O5DH 1QCPA 1NZQH 3GCHB 1C2GA 3MH4A 2C93B 2ZHQH 3ZVAA 3ZZAA 1WYKA 3PM3A 1EAXA 2I6SA 2R2MB 4MPVA 1NFWA 5FBIA 3K65B 5C1UA 1CQQA 3UWIA 2V0BA 5DGJA 1BJVA 2ZU1A 3UREA 1SGFA 1XKAC 1TA2A 3ATWA 3F68H 4Q2KA 5GPIB 1GGDC 1Z6EA 1HJAB 1Z8RA 4GHTA 3QTVH 1FXYA 3TNTA 5EQSA 5HGGA 1P05A 1QR3E 1FY3A 3ITIA 4DG4A 1GBKA 1RTFB 3BTEE 3O8RA 1QJ1B 4CRDA 1S82A 2BY5X 2ZDAH 3ZVCA 1XUHA 1QRZA 2WINI 5DKMA 3TNSA 4JZFH 4LZ1H 1EAUA 2IN2A 3O8BA 3HKJB 4AG2A 1VZQH 3BTWE 5FXLA 1ELTA 4ABEA 4B74A 1KDQB 2A5AA 3K2UA 3MO6A 3T27A 4R0IA 2XBVA 1RTLA 4QT8C 1W7XH 2TIOA 2A0QB 2Y7ZA 3ATMA 1GI6A 1C5RA 3SZNA 1AB9B 2Y81A 3A82A 5JBAS 1GBLA 1A0JA 2Y5FA 2HRVA 3KL6A 1ZMNA 3Q76A 4AFSA 1SB1H 5E2OA 1HRTH 1LPGB 1PPZA 3FZDA 1C1MA 3ZYDA 1G3EA 3BTME 1UTPA 5C5NA 1TGNA 1VITH 3LDXH 3PROA 1SBWA 1FN8A 3Q77A 3B8JA 1O2JA 1EXFA 3NK8A 4NSVA 1TX6A 2QA9E 3EA8A 1DWDH 3SO3A 4YM9A 1T31A 1XM1A 2BHGA 1OP8A 3UUZA 1Z8IB 4ABBA 4H6TA 1ETRH 1SMFE 1EZQA 1HGTH 2HWLB 4OS6A 4K1TA 2AH4X 1O3IA 1PQAA 3D62A 4I8KA 1KXBA 1O2OA 1QTFA 2AIQA 4DT7B 3NXPA 5IYTA 3UR6A 1O30A 2ZWLH 4CHAC 1ANEA 5LPEA 2GCTC 3OU0A 1LO6A 1TPPA 1MKXK 1C1UH 1UTMA 3SNCA 1BRCE 1YKTA 2BXTH 1T8MA 1P2KA 1AU8A 1A4WH 3HGNA 3BIUH 1O3EA 3SUEA 2F9NA 1W13U 5FX6A 1EJMA 1HJ8A 1V2UT 1Z8JB 2SGPE 1ZMJA 3PWBA 2BD7A 1NRRH 1QL8A 2VWMA 3GY7A 3S7KB 5T6FA 3STJA 3G01A 1EPTA 4YESB 5C2ZA 1UVUH 1AFQB 3F1SB 1E35B 1YYY1 2R2WU 1BRBE 3GCOA 2P93A 3K6YA 2EA3A 1SGQE 2VJ1A 5AHGH 1P01A 2A7HA 3SJOA 3LPRA 1S0QA 3TPIZ 2XWBI 1IHTH 2ZPRA 4XFQA 2C90B 2ZU3A 1MQ5A 2BDCA 2BQ7B 4NWLA 1YPEH 1AZ8A 2Q1JA 3ELAH 1O3DA 1ZPBA 4DGJA 1UCYE 4ISIH 1GJ6A 1TQ7B 1MQ6A 1K22H 4FUBA 1AKSB 1JIMA 2AYWA 2ZF0H 4BAQB 1PQ8A 1QB1A 1DITH 1C2KA 3M7UA 3IG6B 2VNTA 1DVAH 4FUGA 1BQYA 1RS0A 1V2TT 1GCTB 2XBWA 2ZA5A 3ZVFA 4DURA 5DP6A 3FP8E 1ELEE 3TJUA 1DXWA 1EJNA 1KYNA 1J15A 1NPMA 2FOHA 1PQ7A 1P02A 1C5QA 1MKWH 4GPGA 1HIAB 4UD9H 5FPSA 3F9EA 2QXIA 1SSXA 2A4RA 5T6DA 5AF9H 4JYVH 4X6OA 4JCNA 3EGKH 2V3OH 1GI7B 3P8OA 1UCYK 3MTYA 1GVZA 1SOTA 5A0CA 1WTGH 4K1SA 4TY7A 1ARBA 1O38A 4BAOB 1ANCA 4K3JA 1LPKB 2ZHFH 1EATA 4H42U 2O8UA 1BBRE 3BEIB 4GCHF 3ODDA 1GJAB 2VH6A 2ZCKP 2A1DB 4OS7A 1E0FD 4JYTA 3QGJA 1O2YA 1O3JA 1OSSA 1SLXB 3ZV8A 2ZG0H 2KAIA 4B2BA 1AHTH 4Z0KA 2Q6GA 1C1OA 4ABFA 1TGSZ 4ZHLU 2FTMA 1AFEH 1H4WA 7LPRA 3RU4D 1G2MA 5LPRA 2ZDLA 5JBTA 3T5FH 1SGPE 2GT8A 2ZQ2A 1C1PA 1TYNA 3HPTB 5JBCS 1IOEA 3MNCA 1DICA 2BM2A 1TABE 2O8TA 1OWEA 4A7IB 1BBRK 2SGFE 5DP4A 3RXKA 1J17T 3NCLA 3RLWH 1P12E 4X6MA 1QURH 1GGDB 1FUJA 4BAMB 3BV9B 1KTSB 1QRXA 4IC6A 4BTIB 2W7UA 2WUBA 2ZFTA 1YLCA 1CO7E 4X8VH 4NA9H 4SGAE 2OC8A 3LGVA 4Y8YA 3A7YA 2FDAA 1A61H 2BY7X 2A45B 1K1NA 3F6UH 1QQUA 3SHAH 4XE4A 1D3DB 1GI0A 4F4OC 4XBDA 1Y3VA 2VVVA 3SGBE 4KELA 1PPHE 2ODQA 4BAHB 4MPUA 1UVTH 2F9UA 3PB1E 4LOYH 3QO6A 3VB4A 2QXHA 1F5LA 1C9PA 1C2JA 2ULLA 2SGQE 4GLYA 3RDZA 1Q31A 3VEQB 3S9BA 1OWJA 1AVWA 2FOGA 3H7TA 2DUCA 4NIYA 5DG6A 4FUJA 3VB7A 1GVLA 2EEKA 3LT3A 2BDYA 4Y7BA 4TYDA 1SHHB 3UNSA 1VJ9U 4WWYA 1S6FA 3SU6A 2ZC9H 1HXEH 5GWZA 3FZZA 4FUIA 1AVXA 3BSQA 1KIGH 2VU8E 1DDJA 3IWMA 3GCNA 1GBJA 4ZUHA 1K2I1 2PGQB 2P95A 1N8OC 1EAIA 1YF4A 5GCHF 3RU4E 3UOPA 1O5FH 3TU7H 1BMNH 1O3BA 3W95A 1DS2E 1ELVA 1AMHA 1EP5A 3NWUA 1W12U 1A7SA 4XOJA 1GBEA 3BTHE 2OP9A 2XXLA 1EQ9A 1BTUA 1OX1A 4B75A 4CREA 1QBVH 1F2SE 4X6NA 3A7XA 1SGRE 3BTDE 3T62A 1HAVB 4X1QU 2D26C 2OD3B 1A1RA 1HAZB 4K2YA 6LPRA 3LGWA 3KQBA 1D9IA 1FY8E 3MU1A 1FV9A 2JH6D 1O32A 2XNIA 1XUGA 3A88A 5JDUB 1CHOF 5L6NH 4YO9A 4X2WA 4Q7ZA 1AI8H 1D3QB 1O2TA 1HJAC 3UTUH 2BDGA 1S83A 3E0PB 1P0SH 2QY0B 2B9LA 3SU5A 4ZH8A 4KTSA 4AGJA 1P3EA 2VIPA 1OPHB 3OY6U 4DIHH 2ZFRH 2FZZA 1CGJE 2RG3A 5F8XA 3SORA 3T25A 1P2QA 5ESBA 2FWWA 5ETXA 1YLDA 1YP9A 5JBBS 1QL9A 1TBRH 3CS0A 2BQWB 2VWLA 3LH1A 3MO3A 1C4U2 2AMQA 2G52A 4UFDH 2CHAC 3QZRA 1BTYA 3L6PA 1T8NA 2Z3EA 1GBCA 1W10U 2JKHA 3RXUA 4M7GA 4D7FA 1AB9C 3P95A 3RC6A 2FO9A 1HAXB 1FIWA 3RXDA 1O2RA 1UVOA 1O2XA 3LJJA 1GG6B 2ZECA 1QQ4A 3CP7A 1EP6A 4ZKOU 1SQAA 2PHBA 2C8XB 5F03A 1YCPM 2WYJA 2ZU5A 1TALA 4B2CA 1C5ZB 3BIVH 3E8LA 1BTWA 3UPEA 3U8RH 1YCPH 4MG3A 3VXEH 1EZXC 2BY8X 1MTSA 3RXAA 3MNSA 3SV2H 1C1QA 5F6MA 3S9CA 1Y5AT 2TBSA 3PTNA 4D7GA 3SUDA 4Q7YA 3VPKA 1DY9A 1INCA 1GJ5H 2FPZA 2BLVA 5DPAA 1C5OH 3RXHA 2ZGJA 1XXFA 3SU0A 1NO9H 2HPQH 2OBQA 1QRWA 1SI5H 1DT2A 2TGAA 3BN9A 2XCFA 5FCKA 4O3UA 1SLWB 3M3SA 2AS9A 3PLKA 1Y3UA 2BLWA 1HBTH 2YOLA 3GDVA 1YPJH 3AAUA 4FUHA 1A2CH 1ARCA 1GJ9B 4D8NA 1JRTA 1C5XB 1C5UA 1BB0B 5C3NA 4MNVA 3MFJA 2H5CA 1AFQC 5AFZH 2A7JA 3A87A 1GI3A 4YOJA 3E90B 4X8TH 2AMDA 3T29A 1GJBB 2FMJA 3FP6E 4NWKA 4FU9A 1ZTLA 2P94A 4Y6DA 3TGIE 2FI4E 4Y0YE 3CENA 1WTHD 1NC6A 4I33A 3SW2B 2W3IA 1O2QA 1O5GH 7KMEH 1S84A 1GI4A 3M3TA 1A0LA 1XUIA 2V35A 1E38B 1LHDH 3A83A 1C5PA 3GY2A 1TNKA 1W8BH 3VB3A 2SNVA 3SUFA 3RXRA 3BF6H 5K7RA 1RIWB 5EODA 1O3NA 1DLKB 2H9HA 4XBBA 2BD3A 1UTOA 2A5KA 2ZPQA 4CBNA 1ZOMA 3E16B 4O9VA 1U6QA 1FI8A 2VVCA 4F49A 3GCTG 2PGBB 4MPWA 5JB9S 1KY9A 5BRRE 3SUGA 1C2LA 3URCA 2AEIH 1G9IE 2ZPSA 1V2NT 1UJ1A 4I31A 5A8XA 1NS3A 1G3CA 1NN6A 2W5EA 1DOJA 1Q3XA 4NIVA 3V13A 4E06H 2NU3E 5FPTA 2VIDA 3TK5A 1P04A 1BCUH 3W94A 3KQEA 4B76A 3DA9B 4ZKNU 1N6YA 2J34A 3SV9A 1C5YB 1FONA 1Y3YA 2FP7B 2ZFFH 2Y80A 5EGMA 1GHXH 1K1OA 1W0YH 3M35A 2ZP0H 3KGPA 1NM6A 1Y3XA 4JK5A 2WUCA 5CMXH 1FJSA 3DFLA 2Z9GA 1EB1H 4ISNA 1GJDB 2CMYA 1DWEH 3CS7A 4IN2A 1GVKB 1V2OT 1UHBA 2Z3CA 2B5TB 3MOCA 3S69A 1A3EH 1O3AA 3BTQE 1GBTA 1QA0A 1BJUA 4ABGA 1JBUH 1ZJKA 3ZVDA 3S7HB 2ZGCA 2XC4A 1C5WB 2GGVB 1H9HE 1QY6A 1XKBC 5GXPA 1FY4A 3LGUA 3RXIA 1EJAA 1G2LA 3FP7E 4XBCA 1TONA 3JZ2B 3GY6A 1J8AA 1OS8A 2WYGA 2Z9JA 2FOBA 3BG8A 4X1SU 5DP9A 2THFB 1LDTT 1P9UA 2GZ7A 1LVMA 1BOQA 1AGJA 4E05H 1TGCA 2O9QA 1NESE 1TFXA 2A7CA 3HKIB 1ZHPA 1UVSH 2B7DH 1H8IH 1EUFA 4X2VA 1A46H 2AFQB 1EB2A 3O8CA 2Y5HA 1IQKA 2VWOA 4WMEA 2CHAB 1GJ8B 3ZYEA 2CV3A 4GHQA 2A2XH 1O2UA 3SJ9A 3SI4H 4LK4A 4CRAA 1BMMH 4YZUA 1DWBH 3MI4A 1Z1IA 1TB6H 3QWCH 4KKDA 3EA7A 3RXVA 3FANA 3RP2A 2W3KA 5AVDA 6ESTA 2QCYA 2OLGA 1MH0A 2TGTA 5H4IB 4DW2U 1MD7A 4ABJA 2CXVA 2GCHG 4E7NA 3H5CB 5GIBA 1DUAA 4FXGH 3T2NA 1EAWA 4K69A 1J16A 2F91A 2SFAA 1EOLA 4DJZB 4KTUA 2R0LA 1DXPA 1KDQA 2FI5E 4YLQH 4U30A 3M37A 3LGTA 2OTVA 2FODA 1FAXA 1ZR0A 9ESTA 5DP7A 2M5TA 4IMZA 2OUAA 1NROH 1JRSA 3PLBA 1G37A 2AIPA 1QGFA 5FAHA 1TA6A 4RSPA 2VH0A 2UWLA 1MKXH 4ABDA 5DP5A 3RUOA 2ZDVH 5A8ZA 3LC3A 1EASA 1HAGE 2BMGB 1EPTB 3V0XA 4K8YA 1TQ0B 4I7YH 2YNBA 3R0FA 4FU7A 1IQLA 4A1TA 1QBNA 2P59A 2D8WA 2NU1E 3GY5A 4CBOA 1NFUA 1THPB 1S6HA 4U32A 1A5HA 1W11U 4NA8A 4THNH 3ZZ6A 1AY6H 2A4GA 4CRFA 1ZSKA 4NSYA 2J92A 1JXPA 2WPLS 4AGKA 1XMNB 5FHTA 1O3GA 2AGIX 5LH8A 5DO4H 3PMHB 2ZKSA 1S0RA 3V7TA 2ZEBA 2FTLE 1GHYH 2BX4A 3KNXA 3LIWA 1YM0A 1IQEA 3A85A 1WCZA 1KXFA 4YT7H 1YPKH 1WAYB 3RLYH 4CH2B 5A0AE 3S9AA 3DD2H 1MU6B 4AORA 1ELDE 2NU0E 1XUKA 2ANYA 4B71A 2HALA 1DM4B 7ESTE 5E8EH 1GHBG 1O3PB 3SI3H 3A80A 1A5IA 1GG6C 1K1MA 5EQQA 1P09A 4BOHA 4ASHA 2EI8A 3WY8A 3UQOA 3ATLA 4IBLH 1ETTH 4WJG2 1UCYH 1O5EH 4IW4E 1TIOA 1ZSJA 1DPOA 1V2WT 1C1TA 1CGHA 1C1WH 4UONA 1BZXE 1AKSA 1GDNA 3L33A 1MMJN 1BIOA 2PKAA 1GI2A 5G4BA 2AERH 3I77A 4INKA 3ZZ3A 2F9OA
chains in the Genus database with same CATH superfamily
1THRH 1RFNA 1HIAA 1FY5A 2B8OH 1JWTA 1O2ZA 1HJ9A 3QLPH 4B73A 4TPIZ 1F5KU 2BVXH 8GCHG 1HLTH 1XVMA 2FLBH 1ANDA 1ABJH 1C1RA 2FOFA 5F8ZA 1T32A 1O31A 1PPBH 3S0NA 1O39A 3SNAA 1GHZA 6GCHG 4CH8B 2JH5D 3SQHE 3VGCB 5A0BA 2J94A 3M5LA 1OXGA 1BBRH 1OOKB 1B5GH 2WV5A 2IPQX 2SNWA 2BB4A 1ZRKA 3ATIA 3UNRA 2FM2A 2VWNA 3RXGA 1V2MT 2RCEA 4K60A 2ODYB 2R9PA 1MTVA 2ANMH 3C27B 1P9SA 1BRUP 1C5SA 3SNDA 1EX3A 2K1QA 3JZ1B 5HM2A 4Y76A 1ZSLA 2G00A 4F48B 2YMSD 4CRCA 2BD9A 3SGAE 3MWIU 4FVBA 3VG8A 1IAUA 2BY9X 1WOFA 1OWIA 4UEHH 2Q6DA 1GL1A 1WQVH 4BNRA 1L4ZA 2K0QA 3SV6A 2XWAA 1EOJA 1YPHC 2ZTYA 3A7VA 1V2LT 1B0EA 1MUEB 1SGEE 1RIWC 5I46H 4FUEA 3TK9A 1GL0E 1CU1A 1O34A 1SFQB 1Z71A 3TVJB 1GMCG 3RMOH 1SGFG 4HGCA 2VGCC 3SJIA 1NT1A 3CNRA 3BEFB 2XOKD 3B23B 3RXOA 3E3TA 4IC5A 3DCLA 2CF9H 1WXRA 1NU7B 2Z9LA 5HIYA 1PYTC 1F0RA 3HGPA 5C67A 9LPRA 1O2SA 3OFND 2V7QD 2BVSH 4A1VA 3M5NA 1NRPH 2IJOB 3AVZA 2JH0D 1Y5UT 4CRBA 1ZHMA 1Y59T 3KQCA 1HPGA 1SLVB 1HCGA 5J4SA 2QGRA 1BT7A 1C5VA 2W6JD 1NRNH 2GDDA 3GY8A 5CE1A 3FAOA 2UWOA 1B0FA 2HPPH 4RKOB 1VITG 2EQNA 2ZU2A 2ZTZA 1HFDA 5EXMA 4A5TS 1E79D 4WVPE 1CT4E 3N99A 1C4V2 1S85A 2FYQA 5F53A 3HATH 2BLOA 2WPMS 1HAYB 1MAXA 1LHEH 2FOCA 1WV7H 4BAKB 3N7EA 3ZZ7A 1O3HA 1P2MA 1OP2A 1PPGE 2BYAX 4Y71A 1FNIA 4YOGA 2ZI2H 4YOIA 1GBHA 2TRMA 2H5DA 2F83A 1WU1A 3KEEA 4WY3A 4MQAA 3GY3A 2A4OA 1EZUC 1ABIH 3W1EA 1UO6A 5JPMH 2J4IA 4NZQA 1MTWA 2XC0A 1GMDG 3KN2A 3M36A 1HAVA 3KF2A 1GI8B 1O2WA 2QC2A 1C2DA 4AN7A 1MTUA 1UTLM 4H6SB 1MABB 2GMTB 2WSSD 4NA7A 3HK6B 4BANB 2BD2A 2UWPA 3F9FA 3TH4H 4Q80A 3DUXH 4WH6A 1QB9A 1TRNA 5EXNA 5EU8A 1AUTC 1C2MA 2PWXA 2ZIQH 3RXSA 1V2PT 3WWFA 5DSFA 1HAIH 1AWHB 4J2YB 1D3TB 3PMJA 1V2KT 4TPYA 1MTNB 2BOKA 1QNJA 1IQGA 3TGKE 1WBGB 4DVAU 1G30B 1O2IA 3MNXA 4OGXA 2EI6A 8ESTE 1SGDE 2QN5T 1L4DA 2GTBA 3WW7A 1TNHA 1PPFE 1WSSH 2PUQH 2SGDE 2SGAA 3UFAA 4X1RU 4SGBE 1OWHA 3A7ZA 1OHHD 1SR5C 2STAE 3GISB 2NWNA 1LQEA 2PW8H 3Q3YA 2ZTXA 3SV8A 4ABHA 3SHCH 2R0KA 3LU9B 3TITA 3F2HA 2GZ9A 4Y0ZE 1ELGA 2YNAA 1V6DA 1AO5A 1AE5A 1SGYE 1FX0B 2P3TB 2W6ID 5HIZA 1PYTD 2Z6BD 4UFFH 1VCQA 4AB8A 2A5IA 2NU2E 4CRGA 1QA7A 1YPGH 1YCPK 2H6MA 5EXLA 2ZQ1A 1MCVA 2ZDMA 1ELFA 1Z8GA 5B6LA 5C1XA 3PLPA 1YPMH 1TLDA 1EPTC 1GDUA 5J4QA 1KXDA 1ZRBA 3ATKA 3KCGH 4DCDA 1YPLH 4MLFB 3MHWU 3RXMA 2QF3A 2KCPA 1V2ST 3GY4A 3U9AH 3NPSA 3V3MA 2FXRA 1LKBA 3RXPA 3T26A 4X1NU 2ILNA 1BHXB 4ISHH 2P8OC 1LHCH 2JETC 3MU5A 2O8WA 2ZNKH 2C8ZB 2OQ5A 2P16A 4U2WA 2QF0A 3PV4A 1SG8B 2G5VA 2VVUA 3M3VA 1BDAA 1LPZB 1TBZH 3MYWA 1HAHH 3V12A 1XXDA 4NIXA 1C5TA 3BTFE 2HLDD 2OK5A 3U69H 2Z3DA 1KSNA 2SGEE 3SV7A 3SN8A 1XVOA 1S81A 2QXJA 3QZQA 2VBCA 1ELAA 1YPHE 2BVRH 2OQUA 3BTTE 4OS1A 1A0HB 1K9OE 1BTXA 3RM0H 1GHAG 4ACAA 4WMFA 1FN6A 2VGCB 2J97A 1TGBA 3M7TA 1ESBA 1CHGA 4KGAA 3AASA 1TMBH 1O3KA 3TK6A 1O2KA 3P6ZB 2ASUB 1CA0B 2RDEA 1ZHRA 1SGCA 3T28A 3RM2H 4LZ4B 4P02A 3MH6A 1ESAA 1TBQH 4A6LA 1JIRA 1K1LA 1O37A 5GJ4B 2PFEA 1HAPH 4ZKRU 1TAWA 3OY5U 3EA9A 1KLJH 2XC5A 1CGIE 4X6PA 3MO9A 1MZAA 2BQ6B 1N1LA 1BA8B 1IQFA 1RXPA 3PO1B 3QDZB 4MDSA 2GT7A 5FX5A 1VITF 4Y10E 1ACBE 3U8TH 1COWD 1SKYE 1JOUB 1H8DH 2VIQA 2PTNA 1V2JT 2XBXA 5E0GA 3NUMA 3ZVBA 1GBAA 2V3HH 2J9NA 2D2DA 3TJOA 3SQEE 3AAVA 4XD7D 4GUXA 1Z7KA 2ZZUH 1P2IA 1VCWA 1Y8TA 3RMLH 1IQHA 4WF8A 2BDHA 1AIXH 1UTJA 3GDUA 2BDAA 5DP8A 1NFYA 4X1PU 2RA0A 1VKYA 4Z1MD 2GP9B 3DHKH 3VGCC 1F0UA 2A32A 1N6XA 3RXBA 4FUFA 1ZZZA 4ZKSU 1QZ8A 1ETSH 1QIXB 4GCHG 2VB0A 1UK2A 4AYYB 2GV6A 3Q3KA 1BUIA 1W0JD 1ESTA 2BD4A 4VGCB 3RXFA 1LHFH 3QN7A 2J2UA 2ZGHA 3A81A 3A89A 3DSOA 5BPEA 2TGPZ 1NU9A 3SGQE 1AN1E 3D23A 2KM0A 4DOQA 1ZPCA 4WH8A 2IJD1 1H9LB 1OYQA 1TX7A 5A09A 1UK3A 3RMNH 1QHRB 4OS5A 2UUYA 1AE8H 2RA3A 3LC5A 4O3TA 4IN1A 1MBMA 1GPZA 1O3FA 1P3CA 1O2VA 1GMHG 2IOTA 4ZAEA 3LONA 5TCCA 2PSXA 4I8GA 4GAWA 3SU1A 2J98A 3LOXA 1OWKA 1UK4A 2JJ2D 3EQ0H 4INLA 3MMGA 4NGAH 3U98H 3UNQA 3LJOA 1FMGA 1SGTA 1TOMH 2KZ4A 3MU8A 1QBOA 2C4FH 5FCRA 3TJVA 1OWDA 1P8VC 1UMAH 1VJAU 1MZDA 1D6RA 2KFWA 2QYIA 2F3CE 1IQJA 3SNBA 1IQMA 2ZCLP 3EDXB 4MNYA 4CR9A 4JMYA 3U1IB 2R3YA 2C3SA 2LNCA 3TGJE 1BTPA 4MNXA 4UFGH 1JMOH 1LMWB 1ZTJA 3ENSB 5EPNA 1GBIA 2HVXA 3VB6A 2PUXB 4NFFA 3KQDA 1VR1H 1M9UA 1O35A 3RMMH 4WXVA 4A1XA 1QFKH 2ZHDA 1TNIA 3E91A 1SLUB 3PV5A 2HVYB 2BDIA 2CJIA 2IPHA 1GWAA 2G81E 2J95A 1TMTH 1FAKH 2Z9IA 1SQOA 4JYUH 4RKJB 1C2FA 3A84A 4YLUA 1NTPA 1ZGVA 1KTTB 1P2JA 1C2HA 2BLQA 2UUJB 3OE7D 2EY4C 2UUFB 1KLTA 2LPRA 3OSYA 3VB5A 1AWFH 1K1IA 1NBMD 1T4UH 1V3XA 4U01A 1SFIA 2XCNA 1CT0E 1FDPA 2WV9A 4YT6H 5FPYA 4IS5A 2ZGBH 4Y79A 3K6ZA 4JZIA 2H9TH 1OP0A 3BG4B 5EJ1A 1GJCB 4FUCA 3STIA 1GJ7B 1L1GA 1TPSA 1TRYA 3M7QA 4I8HA 3RXLA 3EE7A 2ZDNA 3KYGA 3SOSA 4K5ZA 5GCHG 4HI3A 5EOKA 1J14A 4I8LA 4ISOA 2GV7A 4RT1A 4E7RG 1UTQA 2P8OB 4IGDA 3DFJA 3F2FA 2JETB 3L3TA 1P03A 3UR9A 1G32B 5LGOA 4IMQA 2Q6FA 2R3UA 2QAAA 5ABWA 1YC0A 1E1RD 3BTKE 3ESTA 2BX3A 1Z1JA 5TCAA 3RXTA 2H9EH 4FUDA 1LVOA 3LKWA 1EZSC 2PKSB 2GMTC 5EW2H 1GHAF 1W7GH 2BDBA 4JZ1A 3RXQA 1IHSH 3SJ8A 3U1JB 3P17H 1ZPZA 3GCTF 2AGEX 1ZMLA 1CHOG 2ZCHP 2PP6A 3NKKA 1CBWB 4AZ2B 2FEQH 4UFEH 3TJNA 1CT2E 8LPRA 5EG4A 1K1JA 2G4TA 1GDQA 2PTCE 2D1JA 2Z94A 1MTNC 4INHA 2XW9A 5GDSH 3OTJE 2CN0H 2EI7A 5EPYA 5GNDA 1ZLRA 1ZYOA 3P70B 2PKAB 3MNBA 1VGCC 1PPCE 2GZ8A 6CHAC 1O0DH 4AB9A 2OBOA 1T8OA 4ACBA 3MU4A 4Q4LA 2OC0A 1LVYA 3ZZ8A 1GCDA 1PQ5A 2DE9A 3ZV9A 1A5GH 1DE7H 2GVFA 1BITA 4Q7XA 1TE0A 4UDWH 2ALVA 1DSUA 2KAIB 2P3FH 1HDTH 2F9PA 1MKWK 3N7OA 1TNGA 1RRKA 1E36B 3GDSA 1L1NA 1TRMA 1O5CB 4R8TB 4UE7H 3ZVGA 3A8AA 4RN6A 1TWXB 2H2ZA 5ESTE 4WMDA 5DJ7A 3E0NB 1O3CA 3KHVA 5EW1H 2EC9H 3F3BA 4HFPB 1W0ZU 1L2EA 5E0JA 2XRCA 1BMLA 2O8LA 1PJPA 1FZZA 1HB0B 1SGIB 1ELCA 1C5MD 3GICB 4DIIH 3ZZDA 2G55A 5T6GA 1PFXC 2W7SA 3UQVA 5L30H 3PMAB 1WQSA 3MU0A 5CHAB 4F55A 4OGYA 1C4Y2 4MTBA 1C9TA 1Y3WA 4OS2A 1B7XB 1SQRA 4H4FA 3RXCA 1CSOE 1V2QT 5C1YA 3RC5A 1DX5M 1J9CH 1GMHF 2QV1A 4O97A 3NZIA 1GHVH 1CE5A 4TWYA 1F0SA 1DLEA 4B2AA 2WPIS 2HNTC 1QJ6B 2PLXA 3EYDA 2FS9A 5FL7D 5L2YH 4FETA 1P57B 4Z6AH 2VIVA 1KLIH 3P8GA 3UWJH 3TLOA 2CF8H 3PMBB 1O5BB 3A8CA 2HLCA 1T4VH 4X8UH 2ESTE 1D4PB 3UY9A 1V2VT 2H1UA 1O3LA 4NZLA 4I8JA 2ZFPH 3OYPA 2VIWA 2ZGXH 3Q3XA 3RC4A 3VXFH 3QX5H 1K21H 3ZZ4A 4ZHMU 1AD8H 1SQTA 1V2RT 2GCHF 2BZ6H 2Y7XA 3H7OA 4LXBH 3AW1A 4DY7B 2XYAA 4J1YA 1QJ7B 1TPAE 2VIOA 1O2MA 3E6PH 3SBKA 1LHGH 1CA0C 7GCHG 4AFQA 4ZMAH 2GKVE 4AG1A 1O2LA 4ZCNA 5JYIA 1HXFH 1LTOA 1C5LH 3ZZCA 4HG6A 4OS4A 3FVFB 1LVBA 1AUJA 1O2HA 1C2IA 1ELBA 4D9QA 4HZHA 1W2KH 2FI3E 2BTCE 2FX4A 3KYFA 5SGAE 2RDLA 2RFKC 1HYLA 3PO1C 2ANWA 4YTAA 5HYOA 1SGNE 3ODFA 1MCTA 2OC7A 2Z9KA 1P11E 5PTPA 2OXSA 3AW0A 1LQDB 2GX4A 2J5UA 1GI9B 2G5NA 2FX6A 3M61U 3HK3B 1PPEE 1ID5H 1RD3B 4DT4A 4A92A 3EE0B 4TWWA 1TMUH 2PSYA 4CR5A 3M5OA 1IQNA 2QF5A 2NU4E 1O2PA 4ABIA 1KXCA 1SPJA 1FIZA 4JZEH 5C20A 4XDEA 2HOBA 2ODPA 3GYMA 4GSOA 3F0PA 3F9HA 2ZHEH 3C1KA 4ZROA 2ZU4A 5HM9A 1P06A 2LP6A 8KME2 4CHAB 5CDFE 1DUEA 3GOVB 2O8MA 4VGCC 2ALPA 1H9IE 2GCTB 2A2QH 1GBBA 4BTUB 2FOEA 1DY8A 1GI1A 1XUJA 3A7TA 4YXWD 1E37B 4ZXYH 2LELA 3GCHC 5HXFA 2UUKB 3O8DA 1DSTA 3R3GB 3Q00A 4WXIA 3PWCA 2WHXA 1SVPA 3SNEA 1LCYA 1HAOH 4Y7AA 3QK1A 1C1VH 1G36A 1T7CA 1QB6A 4NG9H 1GBDA 2I6QA 4I32A 4AYVB 5E2PA 3OAAD 1G3DA 1DWCH 1H8HD 1P10A 1ZJDA 1GHBF 5FBEA 3FFGA 1Q2WA 1D6WA 2AGGX 2BD5A 4ABAA 1BHXF 5L2ZH 2TGDA 5EQRA 2CK3D 3A86A 3ZVEA 1O36A 1O3OA 1O33A 2Y5GA 2ZO3H 3SJKA 4ISLA 3TIUA 2HNTF 4Y8XA 3ZZ5A 3RXEA 2OINA 2BD8A 3P8NA 1VGCB 3I78A 2BOHB 1P2NA 6CHAB 3QUMP 4ZXXH 2PV9B 1C2EA 1EKBB 5EJLA 1YGCH 2WV4A 3PTBA 1K1PA 1P2OA 5LPFA 1FY1A 3DT0H 4HTCH 1GI5A 1ZTKA 4AFUA 4AFZA 1VCPA 3LH3A 2A31A 1C1SA 2OC1A 2FOMB 4NIWA 2FESH 3A8BA 2WPHS 4MNWA 4B1TA 4AX9H 5A2MH 5JB8S 8GCHF 3D49H 2PR3A 5HMAA 1UTNA 6GCHF 1OYTH 1HUTH 3LGIA 2ANKH 1O2NA 1AZZA 2G4UA 1FPHH 2KCYA 2F9BH 3BEUA 2VINA 1FLEE 2J38A 1TNLA 1AVGH 2Y6TA 5T3HA 2BZAA 1E34B 2F9VA 1THSH 1UTKA 1TGTA 1GBFA 3TH2H 1H1BA 2GDEH 3BG4C 1ORFA 3MH5A 3QGNB 2QE7D 4MVNA 5C5OA 1NFXA 1SL3A 1W3CA 3P92A 3U8OH 1FQ3A 2G8TA 1NRQH 4PROA 5I25A 1X7AC 4X0WU 1O2GH 2FS8A 4XSKU 4JZDH 4ZHAA 2W26A 4K1EA 2WPJS 5TJXA 3ZZBA 1A3BH 1C5NH 1CVWH 2STBE 1XUFA 2ZFSA 3MH7A 3PYHA 5IDKA 3B9FH 2C8YB 1GHWH 3A8DA 1BTZA 2HNTE 2L6OA 2Z7FE 3E1XB 1MU8B 1TX8A 1KXAA 3GYLB 3UAIC 4BXWA 2ZDKA 1NRSH 2PKSC 1F5RA 2OCVB 2Y82A 1LKAA 1D3PB 3BTGE 3F9GA 1GMCF 2FOAA 1FPCH 3SU4A 1WUNH 1E1QD 1SC8U 3IITA 4Y8ZA 1CBWC 4Y11E 1BRAA 1CA8B 4X2YA 1K28D 1UVPA 5A8YA 2FLRH 1RGQA 7GCHF 5KEDA 2FYRA 2TPIZ 1F0TA 3EAJA 5DK1A 1GJ4H 4ESTE 5AFYH 1YBWA 3RU4T 2ZFQH 4O03A 4BTTB 2QIQA 3UOUA 1O5AB 4K8BA 2P3UB 1GCTC 4X2XA 1TNJA 1HV7A 1MBQA 1DANH 1BTHH 4AOQA 1SHYA 1SOZA 2CGAA 3QTOH 1UW7A 3VFEA 5K0HA 1L0ZA 3K9XB 3TH3H 5DP3A 1IQIA 2QXGA 5HKKD 4B6EA 2DE8A 4JK6A 1G3BA 5B6OA 1KXEA 1UHBB 3KIDU 1MAYA 4KTCA 2KX4A 2FIRH 1RJXB 1YWUA 1S5SA 2V6NA 2WPKS 3LGYA 1AQ7A 1HNEE 1BMAA 1RTKA 2XTTB 3D65E 4TY6A 2XBYA 4KP0A 2BXUH 2HGTH 3OX7U 2ZHWH 4X8SH 4NFEA 1N8OB 3SU3A 1GBMA 2BY6X 1QL7A 1T8LA 1NY22 1O3MA 1ZGIA 1C1NA 3M5MA 4GVUA 4BXSA 4FVDA 3I29A 1DFPA 2AMPA 4FU8A 5CHAC 1OKXA 1L1JA 1F7ZA 1XX9A 1MD8A 5F8TA 3ZZ9A 3RXJA 1TPOA 5KECA 4D9RA 4NCYA 4MPXA 3P8FA 4D76A 1Y5BT 3URDA 2G51A 2C8WB 2B0FA 2A4QA 2GD4B 3A7WA 1F92A 3FKSD 1ANBA 3SU2A 1TOCB 1GMDF 1Z6JH 5E0HA 3UIRA 1W14U 1O5DH 1QCPA 1NZQH 3GCHB 1C2GA 3MH4A 2C93B 2ZHQH 3ZVAA 3ZZAA 1WYKA 3PM3A 2GJGA 1EAXA 2I6SA 2R2MB 4MPVA 1NFWA 5FBIA 3K65B 5C1UA 1CQQA 3UWIA 2V0BA 5DGJA 1BJVA 2ZU1A 3UREA 1SGFA 1XKAC 1TA2A 3ATWA 3F68H 5T1VA 4Q2KA 5GPIB 1GGDC 1Z6EA 1HJAB 1Z8RA 4GHTA 3QTVH 1FXYA 3TNTA 5EQSA 5HGGA 1P05A 1QR3E 1FY3A 3ITIA 4DG4A 1GBKA 1RTFB 2V3MA 3BTEE 3O8RA 1QJ1B 4CRDA 1S82A 2BY5X 2ZDAH 3ZVCA 1XUHA 2WZQA 1QRZA 2WINI 5DKMA 3TNSA 4JZFH 4LZ1H 1EAUA 2IN2A 3O8BA 3HKJB 4AG2A 1VZQH 3BTWE 5FXLA 3OTPA 3AK5A 1WDIA 1ELTA 4ABEA 5DN6D 4B74A 1KDQB 2A5AA 3K2UA 3MO6A 3T27A 4R0IA 3WWBA 2XBVA 1RTLA 4QT8C 1W7XH 2TIOA 1W0KD 2A0QB 2Y7ZA 3ATMA 1GI6A 1C5RA 3SZNA 1AB9B 2Y81A 3A82A 5JBAS 1GBLA 1A0JA 2Y5FA 2HRVA 3KL6A 1ZMNA 3Q76A 4AFSA 1SB1H 5E2OA 1HRTH 1LPGB 1PPZA 3FZDA 1C1MA 3ZYDA 1G3EA 3BTME 1UTPA 5C5NA 1TGNA 1VITH 3LDXH 3PROA 1SBWA 1FN8A 3Q77A 3B8JA 1O2JA 1EXFA 3NK8A 4NSVA 1TX6A 2QA9E 3EA8A 1DWDH 3SO3A 4YM9A 1T31A 1XM1A 2BHGA 1OP8A 3UUZA 1Z8IB 3OEHD 4ABBA 4H6TA 1ETRH 1SMFE 1EZQA 1HGTH 2HWLB 4OS6A 4K1TA 2AH4X 1O3IA 1PQAA 3D62A 4I8KA 1KXBA 1O2OA 1QTFA 2AIQA 4DT7B 3NXPA 5IYTA 3UR6A 1O30A 2ZWLH 4CHAC 1ANEA 5LPEA 2GCTC 3OU0A 5C0TA 1LO6A 1TPPA 1MKXK 1C1UH 1UTMA 3SNCA 1BRCE 1YKTA 2BXTH 1T8MA 1P2KA 3FO8D 1AU8A 1A4WH 3HGNA 3BIUH 1O3EA 3SUEA 2F9NA 1W13U 5FX6A 1EJMA 1HJ8A 1V2UT 1Z8JB 2SGPE 1ZMJA 3PWBA 2BD7A 1NRRH 1QL8A 2VWMA 3GY7A 3S7KB 5T6FA 3STJA 3G01A 1EPTA 3F0OA 4YESB 5C2ZA 1UVUH 1AFQB 3F1SB 1E35B 1YYY1 2R2WU 1BRBE 3GCOA 2P93A 3K6YA 2EA3A 1SGQE 2VJ1A 5AHGH 1P01A 2A7HA 3SJOA 3LPRA 1S0QA 3TPIZ 2XWBI 1IHTH 2ZPRA 4XFQA 3DSGA 2C90B 2ZU3A 1MQ5A 2BDCA 2BQ7B 4NWLA 1YPEH 1AZ8A 2Q1JA 3ELAH 1O3DA 1ZPBA 4DGJA 1UCYE 4ISIH 1GJ6A 1TQ7B 1MQ6A 1K22H 4FUBA 1AKSB 1JIMA 2AYWA 2AHME 2ZF0H 1PQ8A 1QB1A 1DITH 1C2KA 3M7UA 4BAQB 3IG6B 2VNTA 1DVAH 4FUGA 1BQYA 1RS0A 1V2TT 1GCTB 2XBWA 2ZA5A 3ZVFA 4DURA 5DP6A 3FP8E 1ELEE 3TJUA 1DXWA 1EJNA 1KYNA 1J15A 1NPMA 4ASUD 2FOHA 1PQ7A 1P02A 1C5QA 1MKWH 4GPGA 1HIAB 4UD9H 5FPSA 3F9EA 2QXIA 1SSXA 2A4RA 5T6DA 5AF9H 4JYVH 4X6OA 3KQ5A 4JCNA 3EGKH 2V3OH 1GI7B 3P8OA 1UCYK 2M2AA 3MTYA 1GVZA 1SOTA 5A0CA 1WTGH 4K1SA 4TY7A 4B6FA 1ARBA 1O38A 4BAOB 1ANCA 4K3JA 1LPKB 2ZHFH 1EATA 4H42U 2O8UA 1BBRE 3BEIB 4GCHF 3ODDA 1GJAB 2VH6A 2ZCKP 2A1DB 4OS7A 1E0FD 4JYTA 3QGJA 1O2YA 1O3JA 1OSSA 1SLXB 3ZV8A 2ZG0H 2KAIA 4B2BA 1AHTH 3FN8A 1K0HA 4Z0KA 2Q6GA 1C1OA 3N7DA 4ABFA 1TGSZ 4ZHLU 2FTMA 1AFEH 1H4WA 7LPRA 3RU4D 1G2MA 5LPRA 2ZDLA 5JBTA 3T5FH 1SGPE 2GT8A 3UB0A 2ZQ2A 1C1PA 1TYNA 3HPTB 5EIYA 4AC9A 5JBCS 1IOEA 3MNCA 1DICA 2BM2A 1TABE 2O8TA 1OWEA 4A7IB 1BBRK 2SGFE 5DP4A 4Q63A 3RXKA 1J17T 3NCLA 3RLWH 1P12E 4X6MA 1QURH 1GGDB 1FUJA 4I86A 4BAMB 4TSFD 3BV9B 1KTSB 1QRXA 4IC6A 4BTIB 2W7UA 3U28C 2WUBA 2ZFTA 3PRDA 1YLCA 1CO7E 4X8VH 4NA9H 4SGAE 2OC8A 3LGVA 4Y8YA 3A7YA 2FDAA 1A61H 2BY7X 2A45B 1K1NA 3F6UH 1QQUA 3SHAH 4XE4A 1D3DB 1GI0A 4F4OC 4XBDA 1Y3VA 2VVVA 2JJ1D 3SGBE 4KELA 1PPHE 2ODQA 4BAHB 4MPUA 1UVTH 2F9UA 3PB1E 4LOYH 3QO6A 3VB4A 2QXHA 1F5LA 1C9PA 1C2JA 2ULLA 2SGQE 2XNDD 4GLYA 1Q31A 3RDZA 3VEQB 3S9BA 1OWJA 1AVWA 2FOGA 3H7TA 2KCOA 2DUCA 2JDID 4FUJA 4NIYA 5DG6A 3VB7A 1GVLA 2EEKA 3LT3A 2BDYA 4Y7BA 4TYDA 1SHHB 3UNSA 1VJ9U 4WWYA 1S6FA 3SU6A 2ZC9H 2KR7A 1HXEH 5GWZA 3FZZA 3F2GA 4FUIA 1AVXA 3BSQA 1KIGH 2VU8E 1DDJA 3IWMA 3GCNA 1GBJA 4ZUHA 1K2I1 2PGQB 2P95A 1N8OC 1EAIA 1YF4A 5GCHF 5KGOA 3RU4E 3UOPA 1O5FH 3TU7H 2L74A 1BMNH 1O3BA 3W95A 1DS2E 1ELVA 1AMHA 1EP5A 3NWUA 1W12U 1A7SA 4XOJA 2WPDD 1GBEA 3BTHE 2OP9A 2XXLA 1EQ9A 1BTUA 1OX1A 4B75A 4CREA 1QBVH 1F2SE 4X6NA 3A7XA 1SGRE 5IK2D 3BTDE 3T62A 1HAVB 4X1QU 2D26C 2OD3B 1A1RA 1HAZB 4K2YA 6LPRA 2YMSB 3LGWA 3KQBA 1D9IA 1FY8E 3MU1A 1FV9A 2JH6D 1O32A 2XNIA 1XUGA 3A88A 5JDUB 1CHOF 5L6NH 5CHBA 4YO9A 4X2WA 4Q7ZA 1AI8H 1D3QB 1O2TA 1HJAC 2JIZD 3UTUH 2BDGA 1S83A 3E0PB 1P0SH 2QY0B 2B9LA 3SU5A 4ZH8A 4KTSA 4AGJA 2K8IA 1P3EA 2VIPA 1OPHB 3OY6U 4DIHH 2ZFRH 2FZZA 1CGJE 2RG3A 5F8XA 3SORA 3T25A 1P2QA 5ESBA 2FWWA 5ETXA 1YLDA 1YP9A 5JBBS 1QL9A 1TBRH 3PRBA 3CS0A 2BQWB 2VWLA 3LH1A 3MO3A 1C4U2 2AMQA 2G52A 4UFDH 2CHAC 3QZRA 1BTYA 3L6PA 1T8NA 2Z3EA 1GBCA 1W10U 2JKHA 3RXUA 4M7GA 4D7FA 1AB9C 3P95A 3RC6A 2FO9A 1HAXB 1FIWA 3RXDA 1O2RA 1UVOA 1O2XA 3LJJA 1GG6B 2ZECA 1QQ4A 3CP7A 1EP6A 4ZKOU 1SQAA 2PHBA 2C8XB 5F03A 1YCPM 2WYJA 2ZU5A 1TALA 4B2CA 1C5ZB 3BIVH 3E8LA 1BTWA 3UPEA 3U8RH 1YCPH 4MG3A 3VXEH 1EZXC 2BY8X 1MTSA 3MQKC 3RXAA 3MNSA 3SV2H 1C1QA 5F6MA 3S9CA 1Y5AT 2TBSA 3PTNA 4D7GA 3SUDA 4Q7YA 3VPKA 3OEED 1DY9A 1INCA 1GJ5H 1YLNA 2FPZA 4FOUC 2BLVA 5DPAA 1C5OH 3RXHA 2ZGJA 1XXFA 3SU0A 1NO9H 2HPQH 2OBQA 1QRWA 4RI0A 1SI5H 1DT2A 2TGAA 3BN9A 2XCFA 5FCKA 4O3UA 1SLWB 3M3SA 2AS9A 3PLKA 1Y3UA 2BLWA 1HBTH 2YOLA 3GDVA 1YPJH 3AAUA 4FUHA 1A2CH 1ARCA 1GJ9B 4D8NA 1JRTA 1C5XB 1C5UA 1BB0B 5C3NA 4MNVA 3MFJA 2H5CA 1AFQC 5AFZH 2A7JA 3A87A 1GI3A 4YOJA 3E90B 3GS9A 4X8TH 2AMDA 3T29A 1GJBB 2FMJA 3FP6E 4NWKA 4FU9A 1ZTLA 2P94A 4Y6DA 5EJZA 3TGIE 2FI4E 4Y0YE 3CENA 1WTHD 1NC6A 4I33A 3SW2B 2W3IA 1O2QA 1O5GH 7KMEH 1S84A 1GI4A 3M3TA 1A0LA 1XUIA 2V35A 1E38B 1LHDH 3A83A 1C5PA 3GY2A 1TNKA 1W8BH 3VB3A 2SNVA 3SUFA 3RXRA 3BF6H 5K7RA 1RIWB 5EODA 1O3NA 4P00A 1DLKB 2H9HA 4XBBA 2BD3A 3FOAA 1UTOA 2A5KA 2ZPQA 4CBNA 1ZOMA 3E16B 4O9VA 1U6QA 1FI8A 2VVCA 4F49A 3GCTG 2PGBB 4MPWA 5JB9S 1KY9A 5BRRE 3SUGA 1C2LA 3URCA 2AEIH 1G9IE 2ZPSA 1V2NT 1UJ1A 4I31A 5A8XA 1NS3A 1G3CA 1NN6A 2W5EA 1DOJA 1Q3XA 4NIVA 3V13A 4OM9A 4E06H 2NU3E 5FPTA 2VIDA 3TK5A 1P04A 1BCUH 3W94A 3KQEA 4B76A 3DA9B 4ZKNU 4M9FA 1N6YA 2J34A 3SV9A 1C5YB 1FONA 1Y3YA 2FP7B 2ZFFH 1YY3A 2Y80A 5EGMA 3SYJA 1GHXH 1K1OA 1W0YH 3M35A 2ZP0H 3KGPA 1NM6A 1Y3XA 4JK5A 2WUCA 5CMXH 1FJSA 3DFLA 2Z9GA 1EB1H 4ISNA 1GJDB 2CMYA 1DWEH 3CS7A 4IN2A 1GVKB 1V2OT 1UHBA 2Z3CA 2B5TB 3MOCA 5C94A 3S69A 1A3EH 1O3AA 3BTQE 2J98B 1GBTA 1QA0A 1BJUA 4ABGA 3NRLA 1JBUH 1ZJKA 3ZVDA 3S7HB 1H8ED 2ZGCA 2XC4A 1C5WB 2GGVB 1H9HE 1QY6A 1XKBC 5GXPA 1FY4A 3LGUA 3RXIA 1EJAA 1G2LA 3FP7E 4XBCA 1TONA 3JZ2B 3GY6A 1J8AA 1OS8A 2WYGA 2Z9JA 2FOBA 1EFRD 3BG8A 4X1SU 5DP9A 2THFB 1LDTT 4XRNA 1P9UA 2GZ7A 1LVMA 1BOQA 1AGJA 4E05H 1TGCA 2O9QA 1NESE 1TFXA 2A7CA 3HKIB 5C0UA 1ZHPA 1UVSH 2B7DH 1H8IH 1EUFA 4X2VA 1A46H 2AFQB 1EB2A 3O8CA 2Y5HA 3PV2A 1IQKA 2VWOA 4WMEA 2CHAB 1GJ8B 3ZYEA 2CV3A 4GHQA 2A2XH 1O2UA 3SJ9A 3SI4H 4LK4A 4CRAA 1BMMH 4YZUA 1DWBH 3MI4A 1Z1IA 1TB6H 3H09A 3QWCH 4KKDA 3EA7A 3RXVA 3FANA 3RP2A 2W3KA 5AVDA 6ESTA 2QCYA 2OLGA 1MH0A 2TGTA 5H4IB 4DW2U 1MD7A 4ABJA 2CXVA 2GCHG 4E7NA 3H5CB 5C17A 5GIBA 1DUAA 4FXGH 3T2NA 4RT0A 1EAWA 4K69A 1J16A 2F91A 2SFAA 1EOLA 4DJZB 4KTUA 2R0LA 1DXPA 3DSPA 1KDQA 1S6LA 2FI5E 4YLQH 4U30A 3M37A 3LGTA 2OTVA 2FODA 1FAXA 1ZR0A 9ESTA 5DP7A 2M5TA 4IMZA 2OUAA 1NROH 1JRSA 3PLBA 1G37A 2AIPA 4TT3D 1QGFA 5FAHA 1TA6A 4RSPA 2VH0A 2UWLA 1MKXH 4ABDA 5DP5A 2KCAA 3RUOA 2ZDVH 5A8ZA 3LC3A 1EASA 1HAGE 2BMGB 1EPTB 3V0XA 4K8YA 1TQ0B 4I7YH 2YNBA 3R0FA 4FU7A 1IQLA 4A1TA 1QBNA 2P59A 2D8WA 2NU1E 3GY5A 2YMSC 4CBOA 1NFUA 1THPB 1S6HA 4U32A 1A5HA 1W11U 4NA8A 4THNH 3ZZ6A 1AY6H 2A4GA 4CRFA 1ZSKA 2F4LA 4NSYA 2J92A 1JXPA 2F43B 2WPLS 4AGKA 1XMNB 5FHTA 1O3GA 3SZEA 2AGIX 5LH8A 5DO4H 3PMHB 2ZKSA 1S0RA 3V7TA 2ZEBA 2FTLE 1GHYH 2BX4A 3KNXA 3LIWA 1YM0A 1IQEA 1KMHB 3A85A 1WCZA 1KXFA 4YT7H 1YPKH 1WAYB 3RLYH 4CH2B 5A0AE 3S9AA 3DD2H 1MU6B 4AORA 1ELDE 2NU0E 1XUKA 2ANYA 4B71A 2HALA 1DM4B 7ESTE 5E8EH 1GHBG 1O3PB 3SI3H 3A80A 1A5IA 1GG6C 1K1MA 5EQQA 1P09A 4BOHA 4ASHA 2EI8A 3WY8A 3UQOA 3ATLA 4IBLH 1ETTH 4WJG2 1BMFD 1UCYH 1O5EH 4IW4E 1TIOA 1ZSJA 1DPOA 1V2WT 1C1TA 1CGHA 1C1WH 4UONA 1BZXE 1AKSA 1GDNA 3L33A 1MMJN 1BIOA 2PKAA 1GI2A 1NBME 5G4BA 3ZIAD 2AERH 3I77A 4INKA 3ZZ3A 2F9OA 2QF4A
chains in the Genus database with same CATH topology
1THRH 1RFNA 1HIAA 1FY5A 2B8OH 1JWTA 1O2ZA 1HJ9A 3QLPH 4B73A 4TPIZ 1F5KU 2BVXH 8GCHG 1HLTH 1XVMA 2FLBH 1ANDA 1ABJH 1C1RA 2FOFA 5F8ZA 1T32A 1O31A 1PPBH 3S0NA 1O39A 3SNAA 1GHZA 6GCHG 4CH8B 2JH5D 3SQHE 3VGCB 5A0BA 2J94A 3M5LA 1OXGA 1BBRH 1OOKB 1B5GH 2WV5A 2SNWA 2BB4A 1ZRKA 3ATIA 3UNRA 2FM2A 2VWNA 3RXGA 1V2MT 2RCEA 4K60A 2ODYB 2R9PA 1MTVA 2ANMH 3C27B 1P9SA 1BRUP 1C5SA 3SNDA 1EX3A 2K1QA 3JZ1B 5HM2A 4Y76A 1ZSLA 2G00A 4CRCA 2BD9A 3SGAE 3MWIU 4FVBA 1IAUA 2BY9X 1WOFA 1OWIA 4UEHH 2Q6DA 1GL1A 1WQVH 4BNRA 1L4ZA 3SV6A 2XWAA 1EOJA 1YPHC 2ZTYA 3A7VA 1V2LT 1B0EA 1MUEB 1SGEE 1RIWC 5I46H 4FUEA 3TK9A 1GL0E 1CU1A 1O34A 1SFQB 1Z71A 3TVJB 1GMCG 3RMOH 1SGFG 4HGCA 2VGCC 3SJIA 1NT1A 3BEFB 3B23B 3RXOA 3E3TA 4IC5A 2CF9H 1NU7B 2Z9LA 1PYTC 1F0RA 3HGPA 5C67A 9LPRA 1O2SA 2BVSH 4A1VA 3M5NA 1NRPH 2IJOB 3AVZA 2JH0D 1Y5UT 4CRBA 1ZHMA 1Y59T 3KQCA 1HPGA 1SLVB 1HCGA 5J4SA 2QGRA 1BT7A 1C5VA 1NRNH 2GDDA 3GY8A 5CE1A 3FAOA 2UWOA 1B0FA 2HPPH 4RKOB 1VITG 2ZU2A 2ZTZA 1HFDA 5EXMA 4A5TS 4WVPE 1CT4E 1C4V2 1S85A 2FYQA 3HATH 2BLOA 2WPMS 1HAYB 1MAXA 1LHEH 2FOCA 1WV7H 4BAKB 3ZZ7A 1O3HA 1P2MA 1OP2A 1PPGE 2BYAX 4Y71A 1FNIA 4YOGA 2ZI2H 4YOIA 1GBHA 2TRMA 2H5DA 2F83A 1WU1A 3KEEA 4WY3A 4MQAA 3GY3A 2A4OA 1EZUC 1ABIH 1UO6A 5JPMH 2J4IA 4NZQA 1MTWA 2XC0A 1GMDG 3KN2A 3M36A 1HAVA 3KF2A 1GI8B 1O2WA 2QC2A 1C2DA 4AN7A 1MTUA 1UTLM 4H6SB 2GMTB 4NA7A 3HK6B 4BANB 2BD2A 2UWPA 3F9FA 3TH4H 4Q80A 3DUXH 4WH6A 1QB9A 1TRNA 5EXNA 5EU8A 1AUTC 1C2MA 2PWXA 2ZIQH 3RXSA 1V2PT 1HAIH 1AWHB 4J2YB 1D3TB 3PMJA 1V2KT 4TPYA 1MTNB 2BOKA 1QNJA 1IQGA 3TGKE 1WBGB 4DVAU 1G30B 1O2IA 3MNXA 4OGXA 2EI6A 8ESTE 1SGDE 2QN5T 1L4DA 2GTBA 1TNHA 1PPFE 1WSSH 2PUQH 2SGDE 2SGAA 3UFAA 4X1RU 4SGBE 1OWHA 3A7ZA 1SR5C 2STAE 3GISB 2NWNA 1LQEA 2PW8H 3Q3YA 2ZTXA 3SV8A 4ABHA 3SHCH 2R0KA 3LU9B 3TITA 2GZ9A 4Y0ZE 1ELGA 2YNAA 1V6DA 1AO5A 1AE5A 1SGYE 2P3TB 1PYTD 2Z6BD 4UFFH 1VCQA 4AB8A 2A5IA 2NU2E 4CRGA 1QA7A 1YPGH 1YCPK 2H6MA 5EXLA 2ZQ1A 1MCVA 2ZDMA 1ELFA 1Z8GA 5C1XA 3PLPA 1YPMH 1TLDA 1EPTC 1GDUA 5J4QA 1KXDA 1ZRBA 3ATKA 3KCGH 4DCDA 1YPLH 4MLFB 3MHWU 3RXMA 2QF3A 1V2ST 3GY4A 3U9AH 3NPSA 3V3MA 2FXRA 1LKBA 3RXPA 3T26A 4X1NU 2ILNA 1BHXB 4ISHH 2P8OC 1LHCH 2JETC 3MU5A 2O8WA 2ZNKH 2C8ZB 2OQ5A 2P16A 4U2WA 2QF0A 3PV4A 1SG8B 2G5VA 2VVUA 3M3VA 1BDAA 1LPZB 1TBZH 3MYWA 1HAHH 3V12A 1XXDA 4NIXA 1C5TA 3BTFE 3U69H 2Z3DA 1KSNA 2SGEE 3SV7A 3SN8A 1XVOA 1S81A 2QXJA 3QZQA 1ELAA 1YPHE 2BVRH 2OQUA 3BTTE 4OS1A 1A0HB 1K9OE 1BTXA 3RM0H 1GHAG 4WMFA 1FN6A 2VGCB 1TGBA 3M7TA 1ESBA 1CHGA 4KGAA 3AASA 1TMBH 1O3KA 3TK6A 1O2KA 3P6ZB 2ASUB 1CA0B 1ZHRA 1SGCA 3T28A 3RM2H 4LZ4B 3MH6A 1ESAA 1TBQH 4A6LA 1JIRA 1K1LA 1O37A 5GJ4B 2PFEA 1HAPH 4ZKRU 1TAWA 3OY5U 3EA9A 1KLJH 2XC5A 1CGIE 4X6PA 3MO9A 1MZAA 2BQ6B 1N1LA 1BA8B 1IQFA 1RXPA 3PO1B 3QDZB 4MDSA 2GT7A 5FX5A 1VITF 4Y10E 1ACBE 3U8TH 1JOUB 1H8DH 2VIQA 2PTNA 1V2JT 2XBXA 5E0GA 3NUMA 3ZVBA 1GBAA 2V3HH 2J9NA 2D2DA 3TJOA 3SQEE 3AAVA 4GUXA 1Z7KA 2ZZUH 1P2IA 1VCWA 1Y8TA 3RMLH 1IQHA 4WF8A 2BDHA 1AIXH 1UTJA 3GDUA 2BDAA 5DP8A 1NFYA 4X1PU 2RA0A 2GP9B 3DHKH 3VGCC 1F0UA 2A32A 1N6XA 3RXBA 4FUFA 1ZZZA 4ZKSU 1ETSH 1QIXB 4GCHG 2VB0A 1UK2A 4AYYB 2GV6A 3Q3KA 1BUIA 1ESTA 2BD4A 4VGCB 3RXFA 1LHFH 3QN7A 2J2UA 2ZGHA 3A81A 3A89A 5BPEA 2TGPZ 1NU9A 3SGQE 1AN1E 3D23A 4DOQA 1ZPCA 4WH8A 1H9LB 1OYQA 1TX7A 5A09A 1UK3A 3RMNH 1QHRB 4OS5A 2UUYA 1AE8H 2RA3A 3LC5A 4O3TA 4IN1A 1MBMA 1GPZA 1O3FA 1P3CA 1O2VA 1GMHG 2IOTA 4ZAEA 3LONA 5TCCA 2PSXA 4I8GA 4GAWA 3SU1A 3LOXA 1OWKA 1UK4A 3EQ0H 4INLA 3MMGA 4NGAH 3U98H 3UNQA 3LJOA 1FMGA 1SGTA 1TOMH 3MU8A 1QBOA 2C4FH 5FCRA 3TJVA 1OWDA 1P8VC 1UMAH 1VJAU 1MZDA 1D6RA 2QYIA 2F3CE 1IQJA 3SNBA 1IQMA 2ZCLP 3EDXB 4MNYA 4CR9A 4JMYA 3U1IB 2R3YA 2LNCA 2C3SA 3TGJE 1BTPA 4MNXA 4UFGH 1JMOH 1LMWB 1ZTJA 3ENSB 5EPNA 1GBIA 2HVXA 3VB6A 2PUXB 4NFFA 3KQDA 1VR1H 1M9UA 1O35A 3RMMH 4WXVA 4A1XA 1QFKH 2ZHDA 1TNIA 3E91A 1SLUB 2BDIA 2CJIA 2IPHA 1GWAA 2G81E 2J95A 1TMTH 1FAKH 2Z9IA 1SQOA 4JYUH 4RKJB 1C2FA 3A84A 4YLUA 1NTPA 1ZGVA 1KTTB 1P2JA 1C2HA 2BLQA 2UUJB 2UUFB 1KLTA 2LPRA 3OSYA 3VB5A 1AWFH 1K1IA 1T4UH 1V3XA 4U01A 1SFIA 2XCNA 1CT0E 1FDPA 4YT6H 5FPYA 4IS5A 2ZGBH 4Y79A 3K6ZA 4JZIA 2H9TH 1OP0A 3BG4B 1GJCB 4FUCA 3STIA 1GJ7B 1L1GA 1TPSA 1TRYA 3M7QA 4I8HA 3RXLA 2ZDNA 3SOSA 4K5ZA 5GCHG 4HI3A 5EOKA 1J14A 4I8LA 4ISOA 2GV7A 4E7RG 1UTQA 2P8OB 4IGDA 3DFJA 2JETB 3L3TA 1P03A 3UR9A 1G32B 5LGOA 4IMQA 2Q6FA 2R3UA 2QAAA 5ABWA 1YC0A 3BTKE 3ESTA 2BX3A 1Z1JA 5TCAA 3RXTA 2H9EH 4FUDA 1LVOA 3LKWA 1EZSC 2PKSB 2GMTC 5EW2H 1GHAF 1W7GH 2BDBA 4JZ1A 3RXQA 1IHSH 3SJ8A 3U1JB 3P17H 1ZPZA 3GCTF 2AGEX 1ZMLA 1CHOG 2ZCHP 3NKKA 1CBWB 4AZ2B 2FEQH 4UFEH 3TJNA 1CT2E 8LPRA 5EG4A 1K1JA 2G4TA 1GDQA 2PTCE 2D1JA 2Z94A 1MTNC 4INHA 2XW9A 5GDSH 3OTJE 2CN0H 2EI7A 5EPYA 1ZLRA 1ZYOA 3P70B 2PKAB 3MNBA 1VGCC 1PPCE 2GZ8A 6CHAC 1O0DH 4AB9A 2OBOA 1T8OA 3MU4A 2OC0A 1LVYA 3ZZ8A 1GCDA 1PQ5A 2DE9A 3ZV9A 1A5GH 1DE7H 2GVFA 1BITA 4Q7XA 1TE0A 4UDWH 2ALVA 1DSUA 2KAIB 2P3FH 1HDTH 2F9PA 1MKWK 3N7OA 1TNGA 1RRKA 1E36B 3GDSA 1L1NA 1TRMA 1O5CB 4R8TB 4UE7H 3ZVGA 3A8AA 4RN6A 1TWXB 2H2ZA 5ESTE 4WMDA 5DJ7A 3E0NB 1O3CA 3KHVA 5EW1H 2EC9H 4HFPB 1W0ZU 1L2EA 5E0JA 2XRCA 1BMLA 2O8LA 1PJPA 1FZZA 1HB0B 1SGIB 1ELCA 1C5MD 3GICB 4DIIH 3ZZDA 2G55A 5T6GA 1PFXC 2W7SA 3UQVA 5L30H 3PMAB 1WQSA 3MU0A 5CHAB 4OGYA 1C4Y2 4MTBA 1C9TA 1Y3WA 4OS2A 1B7XB 4H4FA 3RXCA 1CSOE 1V2QT 5C1YA 3RC5A 1DX5M 1J9CH 1GMHF 2QV1A 4O97A 3NZIA 1GHVH 1CE5A 4TWYA 1F0SA 1DLEA 4B2AA 2WPIS 2HNTC 1QJ6B 2PLXA 3EYDA 2FS9A 5L2YH 1P57B 4Z6AH 2VIVA 1KLIH 3P8GA 3UWJH 3TLOA 2CF8H 3PMBB 1O5BB 3A8CA 2HLCA 1T4VH 4X8UH 2ESTE 1D4PB 3UY9A 1V2VT 2H1UA 1O3LA 4NZLA 4I8JA 2ZFPH 3OYPA 2VIWA 2ZGXH 3Q3XA 3RC4A 3VXFH 3QX5H 1K21H 3ZZ4A 4ZHMU 1AD8H 1SQTA 1V2RT 2GCHF 2BZ6H 2Y7XA 3H7OA 4LXBH 3AW1A 4DY7B 2XYAA 4J1YA 1QJ7B 1TPAE 2VIOA 1O2MA 3E6PH 3SBKA 1LHGH 1CA0C 7GCHG 4AFQA 4ZMAH 2GKVE 4AG1A 1O2LA 5JYIA 1HXFH 1LTOA 1C5LH 3ZZCA 4OS4A 3FVFB 1LVBA 1AUJA 1O2HA 1C2IA 1ELBA 4D9QA 4HZHA 1W2KH 2FI3E 2BTCE 2FX4A 5SGAE 2RDLA 1HYLA 3PO1C 2ANWA 4YTAA 5HYOA 1SGNE 3ODFA 1MCTA 2OC7A 2Z9KA 1P11E 5PTPA 2OXSA 3AW0A 1LQDB 2GX4A 1GI9B 2G5NA 2FX6A 3M61U 3HK3B 1PPEE 1ID5H 1RD3B 4A92A 3EE0B 4TWWA 1TMUH 2PSYA 4CR5A 3M5OA 1IQNA 2NU4E 1O2PA 4ABIA 1KXCA 1SPJA 1FIZA 4JZEH 5C20A 4XDEA 2HOBA 2ODPA 3GYMA 4GSOA 3F9HA 2ZHEH 3C1KA 4ZROA 2ZU4A 5HM9A 1P06A 8KME2 4CHAB 1DUEA 3GOVB 2O8MA 4VGCC 2ALPA 1H9IE 2GCTB 2A2QH 1GBBA 4BTUB 2FOEA 1DY8A 1GI1A 1XUJA 3A7TA 1E37B 4ZXYH 3GCHC 5HXFA 2UUKB 3O8DA 1DSTA 3R3GB 3Q00A 4WXIA 3PWCA 1SVPA 3SNEA 1LCYA 1HAOH 4Y7AA 3QK1A 1C1VH 1G36A 1T7CA 1QB6A 4NG9H 1GBDA 2I6QA 4I32A 4AYVB 5E2PA 1G3DA 1DWCH 1P10A 1ZJDA 1GHBF 5FBEA 3FFGA 1Q2WA 1D6WA 2AGGX 2BD5A 4ABAA 1BHXF 5L2ZH 2TGDA 5EQRA 3A86A 3ZVEA 1O36A 1O3OA 1O33A 2Y5GA 2ZO3H 3SJKA 4ISLA 3TIUA 2HNTF 4Y8XA 3ZZ5A 3RXEA 2OINA 2BD8A 3P8NA 1VGCB 3I78A 2BOHB 1P2NA 6CHAB 3QUMP 4ZXXH 2PV9B 1C2EA 1EKBB 1YGCH 2WV4A 3PTBA 1K1PA 1P2OA 5LPFA 1FY1A 3DT0H 4HTCH 1GI5A 1ZTKA 4AFUA 4AFZA 1VCPA 3LH3A 2A31A 1C1SA 2OC1A 2FOMB 4NIWA 2FESH 3A8BA 2WPHS 4MNWA 4B1TA 4AX9H 5A2MH 5JB8S 8GCHF 3D49H 2PR3A 5HMAA 1UTNA 6GCHF 1OYTH 1HUTH 3LGIA 2ANKH 1O2NA 1AZZA 2G4UA 1FPHH 2F9BH 3BEUA 2VINA 1FLEE 2J38A 1TNLA 1AVGH 2Y6TA 5T3HA 2BZAA 1E34B 2F9VA 1THSH 1UTKA 1TGTA 1GBFA 3TH2H 1H1BA 2GDEH 3BG4C 1ORFA 3MH5A 3QGNB 4MVNA 5C5OA 1NFXA 1SL3A 1W3CA 3P92A 3U8OH 1FQ3A 2G8TA 1NRQH 4PROA 5I25A 1X7AC 4X0WU 1O2GH 2FS8A 4XSKU 4JZDH 4ZHAA 2W26A 4K1EA 2WPJS 5TJXA 3ZZBA 1A3BH 1C5NH 1CVWH 2STBE 1XUFA 2ZFSA 3MH7A 3PYHA 5IDKA 3B9FH 2C8YB 1GHWH 3A8DA 1BTZA 2HNTE 2Z7FE 3E1XB 1MU8B 1TX8A 1KXAA 3GYLB 4BXWA 2ZDKA 1NRSH 2PKSC 1F5RA 2OCVB 2Y82A 1LKAA 1D3PB 3BTGE 3F9GA 1GMCF 2FOAA 1FPCH 3SU4A 1WUNH 1SC8U 3IITA 4Y8ZA 1CBWC 4Y11E 1BRAA 1CA8B 4X2YA 1K28D 1UVPA 5A8YA 2FLRH 1RGQA 7GCHF 2FYRA 2TPIZ 1F0TA 3EAJA 5DK1A 1GJ4H 4ESTE 5AFYH 1YBWA 3RU4T 2ZFQH 4O03A 4BTTB 2QIQA 3UOUA 1O5AB 4K8BA 2P3UB 1GCTC 4X2XA 1TNJA 1HV7A 1MBQA 1DANH 1BTHH 4AOQA 1SHYA 1SOZA 2CGAA 3QTOH 3VFEA 5K0HA 1L0ZA