1E34B

Porcine pancreatic elastase complexed with (3s, 4s)n-para- toluenesulphonyl-3-ethyl-4-(carboxylic acid) pyrrolidin-2-one soaked in ph 9 buffer for one minute
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title `Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
molecule keywords ELASTASE
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B01
3ZV9A 4UD9H 5IDKA 2QF0A 4CHAB 1HAYB 1LPGB 1AVWA 2ZEBA 2Y5HA 3ZVAA 1GMCF 4X2XA 3E6PH 1CA8B 2BB4A 3ZVCA 1SQTA 4D9RA 1AE5A 1ETSH 4CRGA 4ABGA 4Y79A 1GDUA 5FHTA 2TPIZ 2J94A 1NC6A 3Q76A 3PM3A 1GJDB 1O2MA 5K7RA 1XX9A 1FI8A 3MOCA 1OWDA 5C1UA 1BMMH 1GI6A 1AB9B 4OS1A 4MNYA 2A5AA 1ZLRA 5T3HA 2BMGB 2HGTH 4GSOA 4DGJA 1V2KT 4ISLA 1KDQB 1HIAB 1A3BH 4THNH 3A7YA 2GDDA 2FYRA 1C1VH 4AFZA 3RMOH 1O32A 1G3DA 1NN6A 1SGPE 4Y11E 2UUJB 3ATLA 2QYIA 1AZZA 3KHVA 3M5LA 2F9VA 3RC5A 3S0NA 1EZSC 1CA0C 4D8NA 4A1VA 3JZ1B 6GCHG 1C1NA 3F9GA 4KTCA 1JIRA 1S82A 5CE1A 1SVPA 4Y76A 7KMEH 1LVOA 1MKWK 3JZ2B 1E37B 1FN8A 4K8BA 4ZHMU 2JKHA 1DLKB 1MAYA 5L6NH 4CH2B 4BAMB 2OBQA 4IGDA 2FLBH 2QAAA 6GCHF 3U8RH 1IQHA 1HBTH 1MTUA 3E8LA 2PKAB 3GOVB 1A0LA 3A89A 1DVAH 3ATWA 1CHOF 1N6YA 1O34A 3LC3A 2CF8H 1Y8TA 3P70B 1G3EA 3ITIA 1HV7A 4BXWA 4NA9H 4RKJB 3SUFA 2RDLA 3SNCA 5DP4A 5FX5A 5TCCA 5L2ZH 4B73A 2F91A 3ZZBA 3HPTB 4GCHF 1GDNA 1TGNA 1AN1E 3EYDA 5ETXA 1SHHB 1VITF 3SU4A 3VFEA 2ZGJA 1RTFB 3E0NB 1EZUC 2C3SA 1O3AA 2ZDVH 2CXVA 3SOSA 3KL6A 1G2MA 1NESE 4WF8A 4ABIA 5FAHA 2G8TA 2QGRA 3NCLA 1OYTH 1AI8H 5TJXA 3QX5H 2F9NA 3E16B 2BDBA 3M37A 2P59A 4CRCA 2IN2A 2A1DB 2HWLB 2SGFE 3NZIA 5A0BA 3GY3A 1H8DH 2EI8A 2F3CE 1HAHH 2I6QA 2G4UA 4K5ZA 1FXYA 2C8YB 2VWNA 3OU0A 1BOQA 2RA3A 4FU8A 1C2HA 1GJCB 1MH0A 3LGIA 1XXFA 3TIUA 2CN0H 1O3PB 1G3BA 4DOQA 5GCHF 3TPIZ 6CHAC 2ZGHA 4X8SH 4NFEA 1T8NA 3A8AA 2A7CA 2ZKSA 1HJ9A 4GUXA 1PYTD 3UNRA 1C2GA 3GYMA 1PQAA 3HATH 2ODYB 3SV7A 4A1TA 3ATMA 3STIA 1QBNA 2PWXA 1DWCH 2SNVA 1O33A 1V2LT 1O3HA 2ANMH 2O8LA 2VJ1A 2ZQ1A 3S7KB 1TX7A 1SGRE 5JBBS 3UNQA 2JETB 1W10U 3LPRA 3NKKA 4DJZB 4JZFH 3LKWA 1UTQA 2ZFRH 5EQRA 1YKTA 5C5OA 2QXIA 3RXSA 3RXIA 4UFDH 1NU7B 2PKAA 5C67A 4WWYA 1SGQE 2ZDNA 2ZC9H 2FOCA 4K1TA 3RU4T 1ELCA 1LO6A 3TNSA 1K28D 2CJIA 1K1PA 1HJAC 1MTNB 4H6SB 5A09A 3LJOA 5T6DA 1TGSZ 4CBOA 2Q6GA 2CGAA 1CT4E 2ZHQH 3S9AA 3RUOA 4PROA 3VB5A 1BB0B 3RXJA 2BLQA 2FOEA 1BBRE 2W3IA 2Y80A 1V2QT 1IHTH 3R3GB 2F9BH 4X8TH 1ELVA 1YPHC 2VGCB 4DY7B 1O2ZA 1SGFG 1KSNA 1F0SA 2BQ7B 1Z6EA 1J16A 4MTBA 1C5PA 3A86A 2FX6A 4Y8YA 3OY5U 1GJ4H 1TWXB 3M7UA 3ZZDA 1DUAA 1JIMA 1G36A 2P8OB 4IN2A 1GBTA 4ZH8A 4TY6A 1GHYH 1GBJA 1NZQH 1SGYE 1JOUB 3GY4A 1BTUA 3LJJA 1O2QA 3NXPA 2UWPA 1BBRH 1SGFA 3A85A 4FU7A 1TYNA 1V2JT 5A8XA 5F03A 3M3VA 3TGJE 3P92A 1MTWA 4D7FA 1OWHA 3RMMH 1WTHD 1RTLA 1K2I1 3KNXA 2FI4E 5GJ4B 1BTHH 1HUTH 1NO9H 4NIWA 1ZRBA 2BD3A 1Z71A 2AGEX 1V2PT 3RU4E 1EAIA 4CHAC 1ELTA 5F8XA 1AZ8A 4X6NA 1GI1A 2ALPA 2AH4X 1W3CA 1WUNH 3IG6B 3BG4B 1MBQA 2DE8A 1BA8B 4Y10E 4DIHH 4OS7A 3M5OA 2ZHDA 5DP6A 1O2IA 2PUQH 3MNXA 3PROA 4BAOB 2FMJA 3E90B 2P3FH 2AIQA 1EPTB 4FUHA 1LHEH 5A2MH 2FEQH 1H1BA 5JB8S 3UQVA 3O8RA 1P2OA 1NRQH 1O2VA 4WY3A 2BD9A 1JMOH 5IYTA 1EPTC 5I46H 2BZAA 4NIXA 4WMFA 1DE7H 1WTGH 1C1RA 1FN6A 3U69H 5FBIA 3W94A 1L1JA 1GBAA 1UVSH 2NWNA 2GGVB 1TRNA 1QB1A 2VWOA 2FOAA 3T28A 2BDAA 4SGBE 1IQGA 1MKXH 1PPEE 1EUFA 4XBBA 3SW2B 2OQ5A 4RKOB 4JYTA 1OWKA 1QFKH 5K0HA 3HGPA 1XUKA 3UREA 1ZGIA 4H4FA 1EJAA 2XRCA 2A32A 3A7XA 1UMAH 3GDVA 2HRVA 4X2YA 3KF2A 2H6MA 3GISB 3K9XB 2HNTC 1SGNE 2BD2A 2ZWLH 4IMZA 5FPTA 1KXCA 1WBGB 1NU9A 2F9PA 1ZMLA 4ZKRU 4WXIA 3TGKE 3FP7E 1OKXA 1CBWB 1ORFA 3SBKA 1J14A 1ZRKA 2VINA 1G37A 4ZAEA 1OX1A 1RJXB 3Q77A 1W0YH 3LC5A 2XCFA 4LZ4B 1EZQA 2TGPZ 4YOJA 1FY4A 5HM2A 4Y0YE 1P03A 1QB6A 5E0JA 2HNTF 1GJBB 3ESTA 2ZFSA 1QIXB 3SQHE 1ARCA 4IC6A 5EODA 3U98H 3ZZ3A 1TAWA 1P57B 1P0SH 3RXDA 3LU9B 4GCHG 1P09A 3OTJE 1FPHH 1RFNA 1PJPA 1DY8A 1GBFA 1UTJA 3B9FH 3ZZ5A 4AFUA 2ZCHP 1CT0E 1C2IA 4HTCH 4AYYB 4Z0KA 1KXFA 3RC6A 3O8BA 1RRKA 2SNWA 2BD8A 4XDEA 3PB1E 1C5VA 1FJSA 4E05H 2Z9GA 1EJNA 2XBWA 2VIDA 3GCOA 1C1WH 3ENSB 2A4QA 1D3PB 2GMTB 2GV7A 3P8GA 2BVRH 3FVFB 2GDEH 1QCPA 1MTVA 1EQ9A 4U2WA 4X1PU 5C5NA 2ZF0H 3T27A 1DWEH 5EW2H 4NZLA 1Y3WA 1O5BB 1GCDA 1Y5AT 1HNEE 1XUIA 1NROH 2KAIA 5G4BA 3SZNA 4XBCA 3V13A 1C5QA 1YP9A 1ELAA 3UR9A 2ZTXA 1GWAA 2BVSH 2FO9A 3MNBA 2FDAA 3DFLA 2QXGA 4JZIA 1V2RT 3T62A 7GCHF 5GIBA 1KTSB 3TITA 1ZTJA 4UONA 1PPCE 1V2ST 1XMNB 4OS2A 1C5OH 1ETTH 3QLPH 2VIVA 1C9TA 1BT7A 2QXJA 1ESBA 3BG8A 1H8IH 3GY7A 4ISIH 3TK5A 1BMNH 1O5FH 4F4OC 1XUFA 2A2QH 1C1QA 3UOPA 1FUJA 3UFAA 1GMHG 4MQAA 4AX9H 4I8KA 1YM0A 5AFZH 2EI7A 2P8OC 3TGIE 1VITG 3GY2A 2ILNA 4MNWA 3OYPA 1UVPA 3MHWU 2BDYA 1F5KU 2UUKB 1UO6A 1UK3A 1UTKA 1ZR0A 1HRTH 3KQDA 4CRDA 4NIVA 3RDZA 5TCAA 3TK6A 1G2LA 2PFEA 1DSTA 3SV2H 3VB3A 3SU5A 2AMPA 4OGYA 2BXTH 1KLTA 3P8OA 5E2PA 2XXLA 4TYDA 2AMDA 1C5MD 3ZZ9A 1MQ6A 2J92A 1IQJA 3ZZAA 1AFEH 4ABHA 1PPFE 1O2XA 2THFB 3M7TA 3MWIU 1TA2A 1VGCC 2CHAC 4GLYA 1EASA 3TLOA 2UWOA 3QTOH 1EAWA 3M5NA 1EB2A 1NRSH 3T29A 1G32B 1B5GH 4IC5A 2ZPQA 1TRMA 1BMAA 4WMDA 1RXPA 3RXQA 4AYVB 3ODDA 3NK8A 1C4Y2 3KQCA 3GY6A 1O2TA 4I8JA 1BTWA 1OP8A 3I29A 1EOLA 2ZECA 3A81A 1VGCB 2CHAB 3FZDA 3VPKA 3A84A 1AY6H 1WQVH 2Y7XA 1Y5BT 1C5ZB 3ZVFA 1A7SA 2OXSA 1L4DA 2BX3A 2G51A 4FVDA 4YT7H 5EQQA 1JRTA 1AWHB 2C93B 4ZUHA 1QNJA 1A5IA 1FZZA 1QL8A 3MU5A 1TLDA 3SI4H 1MCVA 1XUHA 2HVXA 4Y7AA 1H4WA 4I32A 1AIXH 3T25A 1TPAE 3RU4D 6CHAB 4E7NA 3MYWA 2VH0A 1CU1A 1SSXA 4MPVA 1F0RA 3ZVBA 2Y5GA 1S81A 1DXPA 1TNGA 1LHDH 2A5KA 1SOTA 3M3SA 1F2SE 1MKWH 5DP7A 4MPUA 1C5UA 3P17H 3F9EA 1GL1A 2QXHA 3SNAA 4O97A 1OP0A 5JDUB 3LGYA 3SU2A 1BRUP 4X6OA 1O2NA 4X6MA 3BEIB 2BHGA 4TPIZ 1SQAA 3MH6A 2ZFTA 1O3EA 2G81E 2ODQA 4FUIA 5I25A 1EX3A 4FUFA 4YLQH 1H9HE 1F5LA 3AW0A 1PQ7A 3RXKA 5E2OA 1N8OC 4YO9A 1O31A 1GI9B 1GG6C 3MO6A 1ZGVA 1UCYE 4XFQA 4B74A 3A83A 4U01A 4TWWA 5FCRA 1PQ8A 1YCPH 5FX6A 1CGIE 1KLIH 4H42U 2A7HA 1C4U2 1HAVA 3GYLB 1O5DH 3PLKA 2CF9H 3K65B 1O3BA 1SGCA 4HFPB 5HM9A 1RIWC 2P94A 4DG4A 1EAUA 1S85A 3RXBA 5GCHG 2QC2A 1G3CA 4R8TB 2P93A 2P3UB 3QDZB 3SV6A 2ZHWH 1O35A 1WCZA 4JMYA 1TNIA 1Y59T 1Q3XA 2C8XB 1KXBA 1MU8B 4FUJA 1HXEH 2Y5FA 1O2JA 2YNAA 1CSOE 2V6NA 3FAOA 2ZG0H 3PMHB 2BQ6B 2WPJS 5DKMA 1W12U 2PR3A 1GGDC 3D23A 4BAHB 1CA0B 1IQKA 1GBKA 4KGAA 1QURH 1ZMNA 4X1RU 4GHQA 1S5SA 5A8ZA 2F83A 1CO7E 4X6PA 2JH5D 1GBIA 2BY8X 3CS7A 1J17T 1WYKA 2ZDLA 1DLEA 5J4SA 3STJA 3EGKH 3RM2H 1V2NT 7LPRA 1MZDA 1GBHA 3QTVH 3M36A 1KTTB 2XNIA 2GD4B 3RMNH 2ZA5A 4NFFA 4LZ1H 2WPHS 1SG8B 2Y82A 1IQIA 1KXEA 1OYQA 1GBBA 2AEIH 1PQ5A 3ZYEA 4NIYA 5C20A 1T4UH 1S0RA 1UJ1A 2XC4A 2GT7A 1UHBA 2Z9KA 3V0XA 5BRRE 1XM1A 2STBE 2Z3DA 2D2DA 1A0JA 1GMHF 3BV9B 2CMYA 3LONA 5EPYA 1GVLA 2D8WA 3GCHB 1NFYA 3SV8A 1EJMA 2STAE 3QUMP 1QQ4A 3A88A 1LVYA 1GVZA 3BIVH 4ABJA 7ESTE 1ELGA 1HAGE 2BD4A 1C5SA 3VGCC 1HXFH 2XWBI 1H9IE 2R0LA 3E91A 1YCPM 1C2JA 1E34B 1GJ8B 2TGAA 4O3TA 1GI8B 1GMDG 1UTNA 2WUCA 1F0TA 3QO6A 1GHAG 3EE0B 1KXAA 2BY6X 6ESTA 2NU3E 5HMAA 3Q3XA 4ABDA 1CT2E 4Y8ZA 2QIQA 1NRNH 4ABBA 2WUBA 1HJAB 3TH4H 1BRCE 4CRFA 1TONA 1ZSLA 3F6UH 3O8DA 3MU0A 2Q6FA 2FI3E 3RXEA 3K6YA 4CBNA 2XW9A 4O9VA 2F9OA 2H9EH 3B23B 4D76A 1WAYB 2TGDA 3IWMA 1GHWH 1IQEA 3UWJH 5BPEA 1QGFA 1IQNA 4BTIB 2BQWB 4MLFB 4X2VA 4XSKU 1O2KA 2O8MA 2A0QB 2BLVA 4HI3A 1S6FA 2W5EA 1GG6B 3A7VA 1FPCH 2ANWA 1QRXA 4DCDA 4MVNA 1O39A 1AKSA 2XBXA 2BDIA 1HAVB 1PPHE 1XKAC 2XBVA 1GHBF 4BOHA 1BCUH 3A8BA 1A61H 1QL7A 2OTVA 3RXHA 5LPRA 2IPHA 1A5HA 1BUIA 4MNXA 3TK9A 2FX4A 4K69A 3H7OA 5EXMA 2A31A 2M5TA 1CGJE 2VNTA 3GICB 3LGWA 4JYVH 4AGJA 2NU0E 2WPLS 1K1MA 2B0FA 2ZGXH 1Z8RA 1V2OT 3F9HA 1PYTC 5EOKA 2GT8A 3SNEA 3HKJB 3UR6A 4OGXA 1O3CA 3TJNA 2FPZA 2FTLE 3SV9A 1SGEE 4K1SA 1YPLH 1TNKA 1KLJH 1UTLM 1HGTH 2O8WA 4B76A 1VCWA 2G5VA 3QZRA 1GMDF 1O37A 1TMTH 1LHGH 2VIPA 2ESTE 4WXVA 5DK1A 4DT7B 1JBUH 2BD7A 1BHXB 3LT3A 1BHXF 1NTPA 3SU6A 3IITA 1FDPA 1TX8A 1RD3B 4D9QA 1FONA 3BSQA 1DICA 2VWMA 1GHZA 1GPZA 1QB9A 2ZHFH 5LH8A 1D3DB 2P95A 4IS5A 2GTBA 3ZVEA 1T32A 3T5FH 5ESBA 2JETC 3RXMA 1UHBB 3EA9A 2LNCA 4ABFA 1K1IA 2XBYA 1QRWA 2NU2E 1MBMA 1IQFA 1T8MA 3HK3B 4CH8B 4R0IA 3SUGA 5F6MA 2AYWA 2H2ZA 1JRSA 4I8LA 3ZZ6A 3UNSA 2AGGX 4X2WA 4OS5A 1TE0A 1Z1JA 1BTXA 2R3UA 1C5RA 2ZU4A 1A46H 1ZMJA 2FOFA 4X8UH 1BTPA 1D6RA 1FAKH 1AVGH 1P10A 1Z6JH 1BTYA 5GPIB 4BTTB 3MO3A 3DHKH 1GI0A 1CVWH 2QY0B 2A4OA 2WINI 1Y3XA 3DA9B 1X7AC 2RA0A 3EQ0H 1AO5A 5DO4H 2R3YA 3KIDU 1TPPA 2ANYA 1UVOA 1TABE 2B7DH 5A0CA 4H6TA 3MFJA 2AFQB 1FY3A 2GCTC 1P06A 5E8EH 1QY6A 2P3TB 3MI4A 2WYJA 1P12E 2V3OH 4ESTE 3FANA 1TFXA 2EC9H 4X1NU 3FP6E 1SGDE 1UK4A 1D9IA 2Z9LA 5F8ZA 3EA7A 1TBRH 2V0BA 2RG3A 1AFQB 2ZDAH 2ZU2A 4NWLA 4AB9A 2HLCA 1IQMA 4J1YA 3SHAH 1HLTH 4GHTA 1GBDA 1UCYH 2QA9E 4VGCB 1B7XB 1K21H 2OD3B 2F9UA 1ABJH 1YPKH 3FZZA 1LHCH 3URDA 3UTUH 1GCTB 4MDSA 2AMQA 2GCHG 1TIOA 2PSYA 2OLGA 2WPMS 3PTNA 3A8DA 3M35A 3ZZCA 1C2EA 2C8ZB 3P8FA 1ARBA 3A7WA 1BZXE 3T2NA 1NFWA 4B71A 1O2WA 5L30H 3GCTF 1SLVB 1EOJA 2J34A 5CHAC 4ISHH 1FIZA 1TX6A 4DVAU 1ESAA 2VB0A 4FUEA 3K6ZA 2QN5T 3UIRA 5DG6A 2PGQB 1OWEA 1AD8H 1ELEE 1MMJN 1LVMA 1S84A 2LPRA 4Y71A 3OY6U 1HAXB 3E0PB 4ZKSU 1SGIB 1WU1A 1O2HA 2VIWA 2BDGA 5JB9S 4UDWH 5GWZA 1LPKB 3TJUA 3N7OA 2W26A 2ZU5A 5FBEA 2BD5A 5C1XA 1UVTH 1S6HA 2FODA 4K2YA 5C2ZA 1SQOA 3BIUH 5DGJA 1AVXA 3SNBA 1L4ZA 1G30B 4JZ1A 3QWCH 2YOLA 4YOIA 2ASUB 3VGCB 5H4IB 2H9HA 2ZDMA 3DFJA 3RMLH 3DD2H 4XBDA 3Q3YA 3RC4A 1DITH 1IAUA 1DS2E 1P05A 1CE5A 3GCHC 4JK6A 4AZ2B 5DP8A 3KQBA 1Z1IA 2DUCA 1LTOA 9ESTA 5EXNA 2ZP0H 3V3MA 2VIOA 1GBMA 1TGTA 5FXLA 2XWAA 1GBCA 3P8NA 3V7TA 2C4FH 2FWWA 1AWFH 1YC0A 4JZEH 1GBEA 1LMWB 4NA8A 2HPQH 4UE7H 1D3TB 5EXLA 4Z6AH 1GJ9B 3L3TA 1O2PA 4AG1A 2ZQ2A 4OS6A 1WV7H 2IJOB 3PLBA 3V12A 3P6ZB 1DM4B 1LQDB 1ZPZA 2B8OH 1ZHMA 3H7TA 1KYNA 2XCNA 1O2RA 1G9IE 1MKXK 2BY7X 1NRPH 1OWIA 1PPGE 4FVBA 1A4WH 1J9CH 1SHYA 4MNVA 1EP6A 3F1SB 3GCTG 2HNTE 4ZMAH 4IN1A 1OS8A 4Y8XA 1TA6A 2AS9A 2VGCC 1C2KA 2ZO3H 1GGDB 3QGNB 3SUDA 1THPB 1V6DA 4WH8A 4ZHLU 2FM2A 3O8CA 1GHXH 1O3DA 2GZ7A 2WV4A 1P02A 1OXGA 2WYGA 2BM2A 1PPZA 1DUEA 1C2MA 3ATIA 1F5RA 1VR1H 1OPHB 3HK6B 1VITH 3A82A 1MTNC 2A45B 2ZGCA 2BOKA 3RXFA 1ZTKA 1RIWB 4Q80A 4Q7XA 4Q2KA 2NU4E 4X1QU 2QCYA 4FUCA 3RLYH 3AVZA 4JCNA 2R9PA 5E0GA 1C2LA 2R0KA 3VB7A 4SGAE 1CGHA 1ZSJA 1BDAA 2H1UA 3ZVGA 1FY8E 3NWUA 4Y7BA 1XVOA 1P2KA 1W0ZU 2G00A 2ZZUH 1MTSA 1NFUA 2IOTA 1P11E 2BLOA 3MO9A 4CREA 1ACBE 3BEFB 2XTTB 1UTPA 4ZKNU 1HFDA 1C5WB 3AAUA 2R2WU 4VGCC 5JYIA 1Z7KA 4ISOA 1NY22 1EATA 1PFXC 3BTGE 4CR9A 3HKIB 3ZZ4A 1ZYOA 2A5IA 1AFQC 4UFEH 3ZZ8A 1EXFA 2Q1JA 3SQEE 1AU8A 3SJKA 1NFXA 4HZHA 1QBVH 4YOGA 4DURA 1MZAA 1BQYA 1P2IA 4GVUA 1UVUH 3FP8E 1XKBC 2SFAA 4KP0A 5JBCS 1E36B 2OQUA 3ODFA 1V2MT 1K9OE 4MPWA 4NSYA 2O9QA 3A7TA 1W2KH 4A1XA 1FQ3A 5FCKA 1TNJA 5PTPA 4TY7A 1BIOA 3U8TH 4YZUA 2H5CA 3TH2H 1W7XH 3EDXB 3AAVA 1HAZB 2VWLA 1UTOA 2D26C 3AW1A 4FUDA 1GHBG 1UTMA 1ZPBA 8GCHG 1LPZB 3GDUA 3BTFE 2PTCE 5DP5A 1F0UA 1O3OA 1V2UT 2ZGBH 2ANKH 4DIIH 4HGCA 2RCEA 4INHA 1CHGA 1LKAA 1O3NA 1O38A 2BX4A 1W7GH 5CHAB 1VJ9U 4GAWA 3ZZ7A 2FYQA 3BTWE 1ZHRA 2FESH 1V3XA 3NUMA 1AKSB 1FNIA 2ZTYA 2SGDE 1Y3YA 4Y6DA 4RSPA 3RXTA 2W3KA 1XVMA 3PMAB 3D49H 3KQEA 2ZFQH 2BTCE 1T7CA 1MD8A 1UK2A 5A0AE 5HGGA 3QZQA 1THRH 1DSUA 1O2GH 5HYOA 1J15A 1V2VT 2BY5X 3Q3KA 1DFPA 4NG9H 4O03A 1YPHE 1B0EA 1XUGA 2HPPH 2J4IA 4B1TA 2SGQE 4Y0ZE 1YBWA 4J2YB 1ELBA 2OP9A 2G55A 2OINA 1DWDH 2VU8E 5GXPA 5JBAS 1EB1H 3ZVDA 2FP7B 3BTEE 4NGAH 3MMGA 2G52A 2ZFPH 2ZCKP 3MH4A 2GCHF 1AE8H 1YLDA 2V35A 4NZQA 2BYAX 2VVUA 1P3CA 1GJAB 2GZ9A 4X0WU 2Z6BD 1D3QB 2DE9A 1F7ZA 1HYLA 1HPGA 1BRAA 3RXCA 1CQQA 2GZ8A 2FXRA 1ZJKA 5F8TA 4MPXA 1O5GH 2EA3A 4WMEA 5LGOA 4LXBH 4X1SU 1ANCA 4I8HA 3CS0A 3QN7A 3K2UA 3DT0H 1SFQB 1O5CB 2ODPA 3D65E 2TRMA 3BTDE 3UY9A 3B8JA 3LH3A 1TMBH 3LGTA 4NWKA 4BAKB 1YPJH 4JZDH 3SU0A 1DX5M 1QJ6B 3NPSA 1O30A 2FTMA 1SBWA 1C1SA 1SPJA 2PHBA 2PKSB 4U32A 1AQ7A 2AIPA 1ELDE 4AFQA 4IMQA 3TU7H 4JK5A 3D62A 4CRBA 1Q31A 1TOMH 1WSSH 1AUJA 1Z8IB 2ZCLP 7GCHG 1TALA 1LHFH 1A2CH 1RGQA 1DY9A 4ZKOU 1M9UA 2BDCA 5C3NA 1EAXA 1TMUH 1QJ7B 4ABAA 4BNRA 4Q7YA 1OP2A 3TNTA 2XC0A 3P95A 3PMJA 3LGUA 3RLWH 3SHCH 1O36A 2XYAA 1W14U 3LGVA 1A1RA 1FLEE 3C1KA 1GI2A 1L0ZA 3L33A 2PV9B 1K1OA 1YLCA 1ZJDA 5DP9A 3RXVA 1O5AB 3PO1B 4ASHA 2XC5A 3GY5A 1T31A 3PV4A 2J2UA 3SGAE 1ANEA 1ZOMA 2BZ6H 1C1MA 2JH6D 2Q6DA 4KTSA 2YNBA 3QGJA 1BITA 3SO3A 5AHGH 2FS9A 2BLWA 2G4TA 1O5EH 1QBOA 3GCNA 1C1OA 4XE4A 4I8GA 2HALA 4A6LA 3BTME 1HAIH 4K3JA 4NA7A 3SORA 1YCPK 1TB6H 1GVKB 2KAIB 2K1QA 1QJ1B 5LPFA 4U30A 1DOJA 1AB9C 4AORA 1QR3E 3PWBA 2EEKA 2AERH 2WPKS 1TQ7B 1Y3UA 2VIQA 1S83A 1AHTH 3M3TA 1P8VC 1TBQH 2W7SA 1VCQA 1EZXC 4FXGH 1GJ5H 1P3EA 1TBZH 2OC1A 3MU1A 3W95A 8GCHF 3SJ9A 3L6PA 1V2WT 2UUFB 1ANBA 1O2SA 1SB1H 1GI4A 4LK4A 2SGAA 1TPOA 1LQEA 2ZNKH 1C9PA 3CP7A 3SGBE 3SJIA 1TQ0B 3SJOA 3MU8A 1KDQA 2GX4A 4O3UA 1FAXA 1TGBA 4XOJA 3PYHA 1SR5C 1MU6B 1GBLA 1GI3A 5FPYA 3U1IB 2PGBB 2ZIQH 3VB4A 5EW1H 3RXRA 2FOMB 3BN9A 4I33A 3MNCA 1GJ7B 1ID5H 1VCPA 2GVFA 5DP3A 1DT2A 2WPIS 2PSXA 1O2LA 3VEQB 1HCGA 3SGQE 4TPYA 5SGAE 1O3IA 1C2DA 4INKA 3F9FA 1QTFA 3M7QA 1IQLA 3MTYA 4TWYA 2FOBA 5HXFA 1ZTLA 1K1JA 8KME2 1P2QA 1QA0A 1GHAF 2P16A 5EPNA 3LDXH 3LIWA 2ZPRA 1SOZA 4ZROA 4YM9A 4CR5A 3LH1A 3GY8A 3RXPA 1OWJA 3BTQE 1KY9A 4QT8C 2I6SA 1KXDA 5AVDA 3ELAH 1QQUA 3RM0H 4F49A 1MD7A 1C1PA 2ULLA 3UOUA 5DJ7A 1LVBA 1ZSKA 4AN7A 1GCTC 4INLA 1T8LA 5EQSA 2OBOA 4MG3A 1Y3VA 5L2YH 2A7JA 1P2MA 4OS4A 3C27B 5EU8A 1OSSA 3M61U 4NSVA 1BBRK 1RTKA 1O3GA 3I78A 3ZYDA 1P2NA 1IHSH 1SMFE 1OOKB 1PPBH 5CMXH 3WY8A 4K1EA 3OSYA 2GCTB 3EA8A 4I7YH 1D4PB 1GL0E 1XUJA 1P9SA 1P2JA 3PWCA 2OUAA 4FU9A 3RP2A 1AGJA 2Z94A 2FZZA 4ZXYH 1FMGA 1O2UA 3KCGH 2AGIX 5ABWA 1NPMA 1C5TA 1THSH 1QRZA 1C1UH 1E35B 1YYY1 1YPGH 1E38B 3SUEA 4B2BA 3G01A 2V3HH 4KTUA 1O3MA 2ZU1A 5A8YA 1DXWA 4AOQA 4AG2A 3PTBA 2WV5A 4IW4E 3TJVA 1E0FD 8ESTE 1L2EA 3S9CA 3S69A 1AUTC 3R0FA 1EKBB 5ESTE 4B2AA 1Z8JB 1B0FA 2HOBA 4KKDA 4I31A 1O2OA 1DANH 6LPRA 1MUEB 3MH5A 3M5MA 1HB0B 4YLUA 3TJOA 1T4VH 1AMHA 1BRBE 1WOFA 2PKSC 1U6QA 4ZHAA 1BTZA 1O3JA 1C5NH 1HDTH 2ZHEH 2Z3CA 1P9UA 2PLXA 2Z9IA 1ZPCA 3E3TA 2J95A 2VVCA 1Q2WA 3UWIA 5DPAA 1W13U 1O3KA 1SI5H 1EPTA 5J4QA 3A8CA 2Y81A 1C2FA 5E0HA 5JPMH 4B2CA 1ABIH 3MNSA 1SC8U 3F68H 3KEEA 4BAQB 1CHOG 2GP9B 1SFIA 1LCYA 1INCA 1ETRH 3RXUA 4YT6H 1FV9A 2OCVB 4UFGH 1TNLA 2PW8H 2FI5E 3S7HB 3MH7A 1A3EH 3E1XB 1V2TT 1L1NA 4KELA 4NCYA 4CRAA 2FIRH 1GMCG 2BXUH 4AFSA 4A7IB 2Z3EA 3BTTE 4BANB 1NRRH 1TPSA 3BF6H 3A7ZA 3BEUA 1HAOH 2BOHB 1GI7B 2TBSA 3BTKE 4E7RG 2Y7ZA 4FUGA 1BJUA 2ZU3A 3SU3A 1WQSA 3U9AH 4IBLH 5LPEA 1CBWC 5EG4A 4DW2U 4UEHH 2J9NA 3SI3H 2Y6TA 3QK1A 2OC8A 1W11U 2ZPSA 1NT1A 1S0QA 2EI6A 1A0HB 3EAJA 1T8OA 5FPSA 4E06H 1HAPH 1TGCA 1C5XB 2H9TH 2B9LA 2ZTZA 3CENA 3UUZA 3VB6A 1P01A 2FOGA 2PUXB 4M7GA 1ZZZA 3Q00A 2NU1E 4LOYH 2GMTC 3SNDA 5AF9H 3S9BA 2J38A 5T6GA 1D6WA 1ESTA 3SJ8A 4BTUB 3UPEA 5B6OA 1O3LA 4UFFH 4AB8A 3U8OH 1ZHPA 3MU4A 2VH6A 4ISNA 4B75A 8LPRA 3UQOA 1K22H 2CV3A 1P04A 2FOHA 5GDSH 4GPGA 1BJVA 1XXDA 3URCA 2R2MB 2QF3A 9LPRA 1N1LA 4RN6A 1MCTA 5AFYH 3VXEH 2B5TB 2OC0A 3AASA 3T26A 2G5NA 1K1LA 2JH0D 2A4GA 3A87A 3H5CB 4ABEA 3LOXA 3KN2A 2BDHA 3PMBB 4BXSA 1FY5A 4WJG2 1SLXB 1C5LH 1JWTA 3BG4C 2TIOA 1O0DH 1F92A 3TVJB 2FS8A 4WVPE 4YTAA 4FUBA 1JXPA 3I77A 4X8VH 4JYUH 1HIAA 1L1GA 3OX7U 1C1TA 3DUXH 1W8BH 3HGNA 2A2XH 1O2YA 1QHRB 1EP5A 2UUYA 4D7GA 1C4V2 1Z8GA 3VXFH 1A5GH 1FIWA 5C1YA 1DDJA 1LKBA 1SLWB 1KIGH 3TH3H 2BY9X 3SN8A 1C5YB 3KGPA 4AGKA 4A92A 3RXGA 1BMLA 2SGEE 2C90B 2PTNA 1IOEA 1NM6A 2H5DA 3A80A 1H9LB 4YESB 3FFGA 1SLUB 3RXOA 1K1NA 2Z9JA 2ALVA 2D1JA 4A5TS 1TOCB 2BVXH 1DPOA 2SGPE 3U1JB 1FY1A 1VJAU 2VVVA 1GHVH 3BTHE 1HJ8A 1LDTT 3RXLA 2TGTA 3SU1A 1GJ6A 1RS0A 1YPMH 1ELFA 2ZDKA 2W7UA 1YGCH 1YF4A 2QV1A 1J8AA 2A4RA 2GV6A 2Z7FE 2C8WB 3RXAA 2GKVE 1NS3A 1UCYK 3PO1C 1MQ5A 4K8YA 1DWBH 1VZQH 1SL3A 1QL9A 3GDSA 1TRYA 1SGTA 1QA7A 1GDQA 4Q7ZA 5JBTA 2ZI2H 1MAXA 5EGMA 1N6XA 2O8UA 2OC7A 3ATKA 5T6FA 4ZXXH 1O3FA 2ZFFH 4K60A 2UWLA 2FLRH 2O8TA 1TNHA 1YPEH 4WH6A 1ANDA 1N8OB 1Y5UT 3ZV8A 1GI5A 3PLPA
chains in the Genus database with same CATH superfamily
3ZV9A 4UD9H 5IDKA 2QF0A 4CHAB 1HAYB 1LPGB 1AVWA 2ZEBA 2Y5HA 3ZVAA 1GMCF 4X2XA 3E6PH 1CA8B 2BB4A 3ZVCA 4TSFD 1SQTA 4D9RA 1AE5A 1KMHB 1E1RD 1ETSH 4CRGA 4ABGA 4Y79A 1GDUA 5FHTA 2TPIZ 2J94A 1NC6A 3Q76A 3PM3A 1GJDB 1O2MA 5K7RA 1XX9A 1FI8A 3MOCA 1OWDA 5C1UA 1BMMH 1AB9B 1GI6A 4OS1A 4MNYA 2A5AA 1ZLRA 5T3HA 2BMGB 2HGTH 4GSOA 4DGJA 1V2KT 3F0OA 4ISLA 1KDQB 1HIAB 1A3BH 4FETA 4THNH 3A7YA 2GDDA 2FYRA 1C1VH 4AFZA 3RMOH 1O32A 1G3DA 1NN6A 1SGPE 4Y11E 2UUJB 3ATLA 2QYIA 1AZZA 3KHVA 3M5LA 2F9VA 3RC5A 3S0NA 1EZSC 1CA0C 4D8NA 4A1VA 3JZ1B 6GCHG 1C1NA 3F9GA 4KTCA 1JIRA 1S82A 5CE1A 1SVPA 4Y76A 7KMEH 1LVOA 1MKWK 3JZ2B 1E37B 1FN8A 4K8BA 4ZHMU 2JKHA 1DLKB 1MAYA 5L6NH 4CH2B 4BAMB 2OBQA 4YXWD 4IGDA 2FLBH 2QAAA 6GCHF 3U8RH 1IQHA 1HBTH 1MTUA 3E8LA 2PKAB 3GOVB 1A0LA 3A89A 1DVAH 3OEHD 3ATWA 1CHOF 1N6YA 1O34A 3LC3A 2CF8H 1Y8TA 3P70B 1G3EA 3ITIA 1HV7A 4BXWA 4NA9H 4RKJB 3SUFA 2RDLA 3SNCA 5DP4A 5FX5A 5TCCA 5L2ZH 4B73A 2F91A 3ZZBA 3HPTB 4GCHF 1GDNA 1TGNA 1AN1E 3EYDA 5ETXA 1SHHB 4F55A 1VITF 3SU4A 3VFEA 2ZGJA 1RTFB 3E0NB 1EZUC 2C3SA 1O3AA 3SZEA 2ZDVH 2CXVA 3SOSA 3KL6A 1G2MA 1NESE 4WF8A 4ABIA 2J98A 5FAHA 2G8TA 2QGRA 3NCLA 1OYTH 1AI8H 3WWFA 5TJXA 3QX5H 2F9NA 3E16B 2BDBA 3M37A 2P59A 4CRCA 2IN2A 2A1DB 2HWLB 2M2AA 2KX4A 2SGFE 3NZIA 5A0BA 3GY3A 1H8DH 2EI8A 2F3CE 1HAHH 2I6QA 2G4UA 3WWBA 4K5ZA 1FXYA 2C8YB 2VWNA 3OU0A 1BOQA 2RA3A 4FU8A 1C2HA 5EJZA 1GJCB 1MH0A 3LGIA 1XXFA 3TIUA 2CN0H 1O3PB 1G3BA 4DOQA 3OAAD 5GCHF 3TPIZ 6CHAC 2ZGHA 4X8SH 4NFEA 1T8NA 3A8AA 2A7CA 2ZKSA 1HJ9A 4GUXA 1PYTD 3UNRA 1C2GA 3GYMA 1PQAA 3HATH 2ODYB 3SV7A 4A1TA 3ATMA 3STIA 1QBNA 2PWXA 1DWCH 2SNVA 2WSSD 1O33A 1V2LT 1O3HA 2ANMH 2O8LA 2VJ1A 2ZQ1A 3S7KB 1TX7A 1SGRE 4DT4A 5JBBS 3UNQA 2JETB 1W10U 3LPRA 3NKKA 4DJZB 4JZFH 3LKWA 1UTQA 2IJD1 2ZFRH 5EQRA 5HIYA 1YKTA 5C5OA 2QXIA 3RXSA 3RXIA 4UFDH 1NU7B 2PKAA 5C67A 4WWYA 1SGQE 2ZDNA 2ZC9H 2FOCA 4K1TA 3RU4T 1ELCA 1LO6A 3TNSA 1K28D 2CJIA 1K1PA 1HJAC 1MTNB 4H6SB 5A09A 3LJOA 5T6DA 1TGSZ 4CBOA 2Q6GA 2CGAA 1CT4E 2ZHQH 3S9AA 3RUOA 4PROA 3VB5A 1BB0B 3RXJA 2BLQA 2FOEA 1BBRE 2W3IA 2Y80A 1V2QT 2HLDD 1IHTH 3R3GB 2F9BH 4X8TH 1ELVA 1YPHC 2VGCB 4DY7B 1O2ZA 1SGFG 1KSNA 1EFRD 1F0SA 2BQ7B 1Z6EA 1J16A 4MTBA 1C5PA 2HVYB 3A86A 2FX6A 4Y8YA 3OY5U 1GJ4H 1TWXB 3M7UA 3ZZDA 1DUAA 4ACAA 1JIMA 1G36A 2P8OB 4IN2A 1GBTA 4ZH8A 4TY6A 1GHYH 1GBJA 1NZQH 1SGYE 1JOUB 3GY4A 1BTUA 3LJJA 1O2QA 3NXPA 2UWPA 3F2HA 1BBRH 1SGFA 3A85A 4FU7A 1TYNA 1V2JT 3EE7A 5A8XA 5F03A 3M3VA 3TGJE 3P92A 1MTWA 4D7FA 1OWHA 3RMMH 3CNRA 1WTHD 1RTLA 1K2I1 3KNXA 1W0JD 2FI4E 5GJ4B 1BTHH 1HUTH 1NO9H 4NIWA 1ZRBA 2BD3A 1Z71A 2AGEX 1V2PT 3RU4E 1EAIA 4CHAC 5KEDA 1ELTA 5F8XA 1AZ8A 4X6NA 1GI1A 2ALPA 2AH4X 1W3CA 1WUNH 3IG6B 3BG4B 1MBQA 2DE8A 1BA8B 3DSOA 4Y10E 4DIHH 4OS7A 3M5OA 2ZHDA 5DP6A 1O2IA 2PUQH 3MNXA 3PROA 4BAOB 2FMJA 3E90B 2P3FH 2AIQA 1EPTB 4FUHA 1LHEH 5A2MH 2FEQH 1H1BA 5JB8S 3UQVA 3O8RA 1P2OA 1NRQH 1O2VA 4WY3A 2BD9A 1JMOH 5IYTA 2OK5A 1EPTC 2QF4A 5I46H 2BZAA 4NIXA 4WMFA 1DE7H 1WTGH 1C1RA 1FN6A 3OE7D 3U69H 5FBIA 3W94A 1L1JA 1GBAA 1UVSH 2NWNA 1MABB 2GGVB 1TRNA 1QB1A 2VWOA 2FOAA 3T28A 2BDAA 4SGBE 1IQGA 5KECA 1MKXH 1PPEE 1EUFA 5DSFA 4XBBA 3SW2B 4ASUD 2OQ5A 4RKOB 4JYTA 1OWKA 1QFKH 5K0HA 3HGPA 1XUKA 3UREA 1ZGIA 4H4FA 1EJAA 2A32A 2XRCA 2WHXA 3A7XA 1UMAH 3GDVA 2XNDD 2HRVA 3F2GA 4X2YA 3KF2A 2H6MA 3GISB 3K9XB 2HNTC 1SGNE 2BD2A 2ZWLH 4IMZA 2V3MA 5FPTA 1KXCA 3MQKC 5CDFE 1WBGB 1NU9A 2F9PA 1ZMLA 4ZKRU 4WXIA 3TGKE 3FP7E 1OKXA 1CBWB 1ORFA 3SBKA 1J14A 1ZRKA 2VINA 1G37A 4ZAEA 1OX1A 1RJXB 3Q77A 1W0YH 3LC5A 2XCFA 4LZ4B 1EZQA 2TGPZ 4YOJA 1FY4A 5HM2A 4Y0YE 1P03A 1QB6A 5E0JA 2HNTF 1GJBB 3ESTA 2ZFSA 1QIXB 3FO8D 3SQHE 1ARCA 4IC6A 5EODA 3U98H 3ZZ3A 1TAWA 1P57B 1P0SH 3RXDA 3LU9B 4GCHG 1P09A 3OTJE 1FPHH 1RFNA 1PJPA 1DY8A 1GBFA 1UTJA 2JDID 2V7QD 3B9FH 3KYGA 3ZZ5A 4AFUA 2ZCHP 1CT0E 1C2IA 4HTCH 4AYYB 4Z0KA 1KXFA 3RC6A 3O8BA 1RRKA 2SNWA 2BD8A 3NRLA 4XDEA 3PB1E 1C5VA 1FJSA 4E05H 2Z9GA 1EJNA 2K8IA 2XBWA 2VIDA 3GCOA 1C1WH 3ENSB 2A4QA 1D3PB 2W6JD 2GMTB 2GV7A 3P8GA 2BVRH 3FVFB 2GDEH 1QCPA 1MTVA 1EQ9A 4U2WA 4X1PU 5C5NA 2ZF0H 3T27A 1DWEH 3DSPA 5EW2H 4NZLA 1Y3WA 1O5BB 1GCDA 1Y5AT 1HNEE 1XUIA 1NROH 2KAIA 5G4BA 3SZNA 4XBCA 3V13A 1C5QA 1YP9A 1ELAA 3OEED 3UR9A 2ZTXA 1GWAA 2BVSH 2FO9A 3MNBA 2FDAA 3DFLA 3PRDA 2QXGA 4JZIA 1V2RT 3T62A 7GCHF 5GIBA 1KTSB 3TITA 1ZTJA 4UONA 1PPCE 1V2ST 1XMNB 4OS2A 1C5OH 1ETTH 3QLPH 2VIVA 1C9TA 1BT7A 2QXJA 1ESBA 3BG8A 3FKSD 1H8IH 3GY7A 4ISIH 3TK5A 1BMNH 1O5FH 4F4OC 1XUFA 2A2QH 1C1QA 3UOPA 1FUJA 3UFAA 1GMHG 4MQAA 4B6EA 4AX9H 4I8KA 1YM0A 5AFZH 2EI7A 5HIZA 2P8OC 3TGIE 1VITG 2IPQX 1YWUA 2ILNA 3GY2A 4MNWA 3OYPA 1UVPA 3MHWU 2BDYA 1F5KU 2UUKB 1UO6A 1UK3A 1UTKA 1ZR0A 1HRTH 3KQDA 4CRDA 4NIVA 3RDZA 5TCAA 3TK6A 1G2LA 2PFEA 1DSTA 3SV2H 3VB3A 3SU5A 2AMPA 4OGYA 2BXTH 1KLTA 3P8OA 5E2PA 2XXLA 4TYDA 2AMDA 1C5MD 4ACBA 3KYFA 3ZZ9A 1MQ6A 2J92A 1IQJA 3ZZAA 1AFEH 3N7EA 4ABHA 1PPFE 1O2XA 2THFB 3M7TA 3MWIU 1TA2A 1VGCC 2CHAC 4GLYA 1EASA 3TLOA 2UWOA 3QTOH 1EAWA 3M5NA 1EB2A 1NRSH 3T29A 1G32B 2PP6A 1B5GH 2KCPA 4IC5A 2L74A 2ZPQA 1TRMA 1BMAA 4WMDA 1RXPA 3RXQA 4AYVB 3ODDA 3NK8A 1C4Y2 3KQCA 3N7DA 3GY6A 1O2TA 4I8JA 1BTWA 1OP8A 1QZ8A 3I29A 1EOLA 2ZECA 5EJ1A 3A81A 1VGCB 2CHAB 3FZDA 3VPKA 3A84A 1AY6H 1WQVH 2Y7XA 1Y5BT 1C5ZB 3ZVFA 1A7SA 2OXSA 4XD7D 1L4DA 2BX3A 2G51A 4FVDA 4YT7H 1W0KD 5EQQA 1JRTA 1AWHB 2C93B 4ZUHA 1QNJA 1A5IA 5FL7D 1FZZA 1YY3A 1QL8A 3MU5A 1TLDA 3SI4H 1MCVA 1XUHA 2HVXA 4Y7AA 1H4WA 4I32A 5CHBA 1AIXH 3T25A 1TPAE 3RU4D 6CHAB 4E7NA 3MYWA 2VH0A 1CU1A 1SSXA 4MPVA 1F0RA 3ZVBA 2Y5GA 1S81A 1DXPA 1TNGA 1LHDH 2A5KA 1SOTA 3M3SA 1F2SE 1MKWH 5DP7A 2KM0A 4Z1MD 4MPUA 1C5UA 3P17H 3F9EA 1GL1A 2QXHA 3SNAA 4O97A 1OP0A 5JDUB 3LGYA 3SU2A 1BRUP 3PRBA 4X6OA 1O2NA 4X6MA 3BEIB 2BHGA 4TPIZ 1SQAA 3MH6A 3W1EA 2ZFTA 1O3EA 2G81E 2ODQA 4FUIA 5I25A 1EX3A 4FUFA 4YLQH 2JJ1D 1H9HE 1F5LA 3AW0A 1PQ7A 3RXKA 5E2OA 1N8OC 4YO9A 1O31A 1GI9B 1GG6C 3MO6A 1ZGVA 1UCYE 4XFQA 4B74A 3A83A 4U01A 4TWWA 5FCRA 1PQ8A 1YCPH 5FX6A 1CGIE 4P00A 1KLIH 4H42U 2A7HA 1C4U2 1HAVA 3GYLB 1O5DH 3PLKA 2CF9H 3K65B 1O3BA 1SGCA 4HFPB 5HM9A 1RIWC 2P94A 4DG4A 1EAUA 1S85A 1OHHD 5GCHG 2QC2A 1G3CA 3RXBA 4R8TB 2P93A 2P3UB 2VBCA 3QDZB 3SV6A 2ZHWH 1O35A 1WCZA 4JMYA 1TNIA 1Y59T 1Q3XA 2C8XB 1KXBA 1MU8B 4FUJA 1HXEH 2Y5FA 1O2JA 2YNAA 1CSOE 2V6NA 3FAOA 2ZG0H 3PMHB 2BQ6B 2WPJS 5DKMA 1W12U 2PR3A 1GGDC 3D23A 4BAHB 1CA0B 1IQKA 1GBKA 4KGAA 1QURH 1ZMNA 4X1RU 4GHQA 1S5SA 5A8ZA 2F83A 1CO7E 4X6PA 2JH5D 1GBIA 2BY8X 3CS7A 1J17T 1WYKA 2ZDLA 1DLEA 5J4SA 3STJA 3EGKH 3RM2H 1V2NT 1SKYE 7LPRA 1MZDA 1GBHA 3QTVH 3M36A 1KTTB 2XNIA 2GD4B 3RMNH 2ZA5A 4NFFA 4LZ1H 2WPHS 1SG8B 2Y82A 1IQIA 1KXEA 1OYQA 1GBBA 2AEIH 1PQ5A 3ZYEA 4NIYA 5C20A 1T4UH 1S0RA 1UJ1A 2XC4A 2GT7A 1UHBA 2Z9KA 3V0XA 5BRRE 1XM1A 2STBE 2Z3DA 2D2DA 1A0JA 1GMHF 3BV9B 2CMYA 3LONA 5EPYA 1GVLA 2D8WA 3GCHB 1NFYA 3SV8A 1EJMA 2STAE 3QUMP 1QQ4A 3U28C 3A88A 1LVYA 1GVZA 3BIVH 4ABJA 7ESTE 1ELGA 1HAGE 2BD4A 1E79D 1C5SA 3VGCC 1HXFH 2XWBI 1H9IE 2R0LA 3E91A 1YCPM 1C2JA 1E34B 1GJ8B 2TGAA 4O3TA 1GI8B 1GMDG 1UTNA 2WUCA 1F0TA 3QO6A 1GHAG 3EE0B 1KXAA 2BY6X 6ESTA 2NU3E 5HMAA 3Q3XA 4ABDA 1CT2E 4Y8ZA 2QIQA 1NRNH 4ABBA 4RT0A 2WUBA 1HJAB 3TH4H 1BRCE 4CRFA 1TONA 1ZSLA 3F6UH 3O8DA 3MU0A 2Q6FA 2FI3E 3RXEA 3K6YA 4CBNA 2XW9A 4O9VA 2F9OA 2H9EH 3B23B 4D76A 1WAYB 2TGDA 3IWMA 1GHWH 1IQEA 3UWJH 5BPEA 1QGFA 1IQNA 4BTIB 2BQWB 4MLFB 4X2VA 4XSKU 1O2KA 2O8MA 2A0QB 2BLVA 4HI3A 1S6FA 1GG6B 2W5EA 3A7VA 1FPCH 1UW7A 1K0HA 2ANWA 1QRXA 4DCDA 4MVNA 2W6ID 1O39A 1AKSA 2XBXA 2BDIA 1HAVB 1PPHE 1XKAC 2XBVA 1GHBF 4BOHA 1BCUH 3A8BA 1A61H 1QL7A 2OTVA 3RXHA 1BMFD 5LPRA 2IPHA 1A5HA 1BUIA 4MNXA 3TK9A 2FX4A 4K69A 3H7OA 5EXMA 2A31A 2M5TA 1CGJE 2VNTA 3GICB 3LGWA 4JYVH 5T1VA 4AGJA 2NU0E 2WPLS 1K1MA 2B0FA 2ZGXH 1Z8RA 1V2OT 3F9HA 1PYTC 5EOKA 2GT8A 3SNEA 3HKJB 3UR6A 4OGXA 1O3CA 3TJNA 2FPZA 2FTLE 3SV9A 1SGEE 4K1SA 1YPLH 1TNKA 1KLJH 1UTLM 1HGTH 2O8WA 4M9FA 4B76A 1VCWA 2G5VA 3QZRA 1GMDF 1O37A 1TMTH 1LHGH 2VIPA 2ESTE 4WXVA 5DK1A 4DT7B 1JBUH 2BD7A 1BHXB 3LT3A 1BHXF 1NTPA 3SU6A 3IITA 1FDPA 1TX8A 1RD3B 4D9QA 1FONA 3BSQA 1DICA 2VWMA 1GHZA 1GPZA 4Q4LA 1QB9A 2ZHFH 5LH8A 1D3DB 2P95A 4IS5A 2GTBA 3ZVEA 1T32A 3T5FH 5ESBA 2JETC 3RXMA 1UHBB 3EA9A 2LNCA 4ABFA 1K1IA 2XBYA 1QRWA 2NU2E 1MBMA 1IQFA 1T8MA 3HK3B 4CH8B 4R0IA 3SUGA 5F6MA 2AYWA 2H2ZA 1JRSA 4I8LA 3ZZ6A 1S6LA 3UNSA 2AGGX 4X2WA 4OS5A 1TE0A 1Z1JA 1BTXA 2R3UA 1C5RA 2ZU4A 1A46H 1ZMJA 2FOFA 4X8UH 1BTPA 1D6RA 1FAKH 1AVGH 4B6FA 1P10A 1Z6JH 1BTYA 5GPIB 2RDEA 3MO3A 4BTTB 3DHKH 1GI0A 1CVWH 2QY0B 2A4OA 2WINI 1Y3XA 3DA9B 1X7AC 2RA0A 3EQ0H 1AO5A 5DO4H 2R3YA 3KIDU 1TPPA 2ANYA 1UVOA 1TABE 2B7DH 5A0CA 4H6TA 3MFJA 2AFQB 1FY3A 2GCTC 1P06A 5E8EH 1QY6A 2P3TB 2XOKD 2F43B 2WYJA 1P12E 2V3OH 3MI4A 4ESTE 3FANA 1TFXA 3N99A 2EC9H 4X1NU 3FP6E 1SGDE 1UK4A 1D9IA 2Z9LA 5F8ZA 3EA7A 1TBRH 2V0BA 2RG3A 1AFQB 2ZDAH 2ZU2A 4NWLA 4AB9A 2HLCA 1IQMA 4J1YA 3SHAH 1HLTH 4GHTA 1GBDA 1UCYH 2QA9E 3OTPA 1B7XB 1K21H 4VGCB 2OD3B 2F9UA 1ABJH 1YPKH 3FZZA 1LHCH 3URDA 3UTUH 1GCTB 4MDSA 2AMQA 2GCHG 1TIOA 2PSYA 2OLGA 2WPMS 3PTNA 3A8DA 3M35A 3ZZCA 1C2EA 2C8ZB 3P8FA 1ARBA 3A7WA 1BZXE 3T2NA 1NFWA 4B71A 1O2WA 5L30H 3GCTF 1SLVB 3VG8A 1EOJA 2J34A 5CHAC 5GNDA 4ISHH 1FIZA 1TX6A 2YMSD 4DVAU 1ESAA 2VB0A 4FUEA 3K6ZA 2QN5T 3UIRA 5DG6A 2PGQB 1OWEA 4ZCNA 1AD8H 1ELEE 1MMJN 1LVMA 1S84A 2LPRA 4Y71A 3OY6U 1HAXB 3E0PB 4ZKSU 1SGIB 4HG6A 1WU1A 1O2HA 2VIWA 2BDGA 5JB9S 4UDWH 5GWZA 1LPKB 3TJUA 3N7OA 2W26A 2ZU5A 5FBEA 2BD5A 5C1XA 1UVTH 1S6HA 2FODA 4K2YA 5C2ZA 1SQOA 3BIUH 5DGJA 1AVXA 3SNBA 1L4ZA 1G30B 4JZ1A 3QWCH 2YOLA 4YOIA 2ASUB 3VGCB 5H4IB 2H9HA 2ZDMA 3DFJA 3SYJA 3RMLH 3DD2H 4XBDA 3Q3YA 3RC4A 1DITH 1IAUA 1DS2E 1P05A 1CE5A 3GCHC 4JK6A 4AZ2B 5DP8A 2QE7D 3KQBA 1Z1IA 2DUCA 1LTOA 9ESTA 5EXNA 2ZP0H 3V3MA 2VIOA 1GBMA 1TGTA 5FXLA 2XWAA 1GBCA 3P8NA 3V7TA 2C4FH 2FWWA 1AWFH 1YC0A 4JZEH 1GBEA 1LMWB 4NA8A 5KGOA 2HPQH 4UE7H 1D3TB 5EXLA 4Z6AH 1GJ9B 1NBME 3L3TA 1O2PA 4AG1A 2ZQ2A 4OS6A 1WV7H 2IJOB 3PLBA 3V12A 3P6ZB 1DM4B 1LQDB 1ZPZA 2B8OH 1ZHMA 3H7TA 1KYNA 3UAIC 2XCNA 1O2RA 1G9IE 1MKXK 2BY7X 1NRPH 1OWIA 1PPGE 4FVBA 1A4WH 1J9CH 1SHYA 4MNVA 1EP6A 3F1SB 3GCTG 2HNTE 4ZMAH 4IN1A 1OS8A 4Y8XA 1TA6A 2AS9A 2VGCC 1C2KA 2ZO3H 1GGDB 3QGNB 3SUDA 1THPB 1V6DA 4WH8A 5C0TA 4ZHLU 2FM2A 3O8CA 1GHXH 1O3DA 2J98B 2GZ7A 2WV4A 1P02A 1OXGA 2WYGA 2BM2A 1PPZA 5C17A 1DUEA 1C2MA 3ATIA 1F5RA 1VR1H 1OPHB 3HK6B 1VITH 3A82A 1MTNC 2A45B 2ZGCA 3FN8A 2BOKA 3RXFA 2F4LA 1ZTKA 1RIWB 4Q80A 4Q7XA 4Q2KA 2NU4E 4X1QU 2QCYA 4FUCA 3RLYH 3AVZA 4JCNA 1WXRA 2R9PA 2YMSB 5E0GA 1C2LA 2R0KA 3VB7A 4SGAE 1CGHA 1ZSJA 1BDAA 2KCOA 1H8HD 2H1UA 3ZVGA 1FY8E 3NWUA 4Y7BA 1XVOA 1P2KA 1W0ZU 2G00A 4AC9A 2ZZUH 1MTSA 1NFUA 2IOTA 1P11E 2BLOA 3MO9A 5EIYA 4CREA 1ACBE 3BEFB 2XTTB 1UTPA 4ZKNU 1HFDA 1C5WB 3AAUA 2R2WU 4VGCC 5JYIA 1Z7KA 4ISOA 1NY22 1EATA 1PFXC 3BTGE 4CR9A 3HKIB 3ZZ4A 1ZYOA 2A5IA 1AFQC 3DSGA 4UFEH 3ZZ8A 3PV2A 1EXFA 2Q1JA 3SQEE 1AU8A 3SJKA 1NFXA 4HZHA 5IK2D 1QBVH 4YOGA 4DURA 1MZAA 1BQYA 1P2IA 4GVUA 1UVUH 3FP8E 1XKBC 2SFAA 4KP0A 5JBCS 1E36B 2KCYA 2OQUA 1E1QD 3ODFA 1V2MT 1K9OE 4MPWA 4NSYA 2O9QA 3A7TA 1W2KH 4A1XA 1FQ3A 5FCKA 1TNJA 5PTPA 4TY7A 1BIOA 3U8TH 4YZUA 2H5CA 3TH2H 1W7XH 3EDXB 3AAVA 1HAZB 2VWLA 1UTOA 2D26C 3AW1A 4FUDA 1GHBG 1UTMA 1ZPBA 8GCHG 1LPZB 3GDUA 3BTFE 2PTCE 5DP5A 1F0UA 1O3OA 1V2UT 2ZGBH 2ANKH 4DIIH 4HGCA 2RCEA 4INHA 1CHGA 1LKAA 1O3NA 1O38A 2BX4A 3OFND 1W7GH 5CHAB 1VJ9U 4GAWA 3ZZ7A 2FYQA 4TT3D 3BTWE 1ZHRA 2FESH 1V3XA 3NUMA 1AKSB 1FNIA 2ZTYA 2SGDE 1Y3YA 4Y6DA 4RSPA 3RXTA 2W3KA 1XVMA 3PMAB 3D49H 3KQEA 2ZFQH 2BTCE 1T7CA 4F48B 1MD8A 1UK2A 5A0AE 5HGGA 3QZQA 1THRH 1DSUA 1O2GH 5HYOA 1J15A 1V2VT 2BY5X 4RI0A 3Q3KA 1DFPA 4NG9H 4O03A 1YPHE 1B0EA 1XUGA 2HPPH 2J4IA 4B1TA 2SGQE 4Y0ZE 1YBWA 4J2YB 1ELBA 2OP9A 2G55A 2OINA 1DWDH 2VU8E 3F0PA 5GXPA 5JBAS 1EB1H 3ZVDA 2FP7B 3BTEE 4NGAH 3ZIAD 3MMGA 2G52A 2ZFPH 2ZCKP 3MH4A 2GCHF 1AE8H 1YLDA 2V35A 4NZQA 2BYAX 2VVUA 1P3CA 2WV9A 1GJAB 2GZ9A 4X0WU 2Z6BD 1D3QB 2DE9A 1F7ZA 1HYLA 1HPGA 1BRAA 3RXCA 1CQQA 2GZ8A 2FXRA 1ZJKA 5F8TA 4MPXA 1O5GH 2EA3A 4WMEA 5LGOA 4LXBH 4X1SU 1ANCA 4I8HA 3CS0A 3QN7A 4Q63A 3K2UA 3DT0H 1SFQB 1O5CB 5F53A 2JJ2D 2ODPA 3D65E 2TRMA 3BTDE 1COWD 3UY9A 2JIZD 3B8JA 3LH3A 1TMBH 3LGTA 4NWKA 4BAKB 1YPJH 4JZDH 3SU0A 1DX5M 1QJ6B 3NPSA 1O30A 2FTMA 1SBWA 1C1SA 2EQNA 1SPJA 2PHBA 2PKSB 4U32A 1AQ7A 2AIPA 1ELDE 4AFQA 4IMQA 3TU7H 4JK5A 3D62A 4CRBA 1Q31A 1TOMH 1WSSH 4OM9A 1AUJA 1Z8IB 2ZCLP 7GCHG 1TALA 1LHFH 1A2CH 1RGQA 1DY9A 4ZKOU 1M9UA 2BDCA 5C3NA 1EAXA 1TMUH 1QJ7B 4ABAA 4BNRA 4Q7YA 5C0UA 1OP2A 2K0QA 3F2FA 3TNTA 5C94A 2XC0A 3P95A 3PMJA 3LGUA 3RLWH 3SHCH 1O36A 2XYAA 1W14U 3LGVA 1A1RA 1FLEE 3C1KA 1GI2A 1L0ZA 3L33A 2PV9B 1K1OA 1YLCA 1ZJDA 5DP9A 3RXVA 1O5AB 3PO1B 3KQ5A 4ASHA 2XC5A 3GY5A 1T31A 3PV4A 2J2UA 3SGAE 1ANEA 1ZOMA 2BZ6H 1C1MA 2JH6D 2Q6DA 4KTSA 2YNBA 3QGJA 1BITA 3SO3A 5AHGH 2FS9A 2BLWA 2G4TA 1O5EH 1QBOA 3GCNA 1C1OA 4XE4A 4I8GA 2HALA 4A6LA 3BTME 1HAIH 4K3JA 4NA7A 3SORA 1YCPK 1TB6H 1GVKB 2KAIB 2K1QA 1QJ1B 5LPFA 4U30A 1DOJA 1AB9C 4AORA 1QR3E 3PWBA 2EEKA 2AERH 2WPKS 1TQ7B 1Y3UA 2VIQA 1S83A 1AHTH 3M3TA 1P8VC 1TBQH 2W7SA 1VCQA 1EZXC 4FXGH 1GJ5H 1P3EA 1TBZH 1SQRA 2OC1A 3MU1A 3W95A 8GCHF 3SJ9A 3L6PA 1V2WT 2UUFB 1ANBA 1O2SA 1SB1H 2KR7A 1GI4A 4LK4A 2SGAA 2L6OA 1TPOA 1LQEA 2ZNKH 1C9PA 3CP7A 3SGBE 3SJIA 1TQ0B 3SJOA 3MU8A 1KDQA 2GX4A 4O3UA 1FAXA 1TGBA 4XOJA 3PYHA 1SR5C 1MU6B 1GBLA 1GI3A 5FPYA 3U1IB 2PGBB 2ZIQH 3VB4A 5EW1H 3RXRA 2FOMB 3BN9A 4I33A 3MNCA 1GJ7B 1ID5H 1VCPA 2GVFA 5DP3A 1DT2A 2WPIS 2PSXA 1O2LA 3VEQB 1HCGA 3SGQE 4TPYA 5SGAE 4XRNA 1O3IA 1C2DA 4INKA 3F9FA 1QTFA 3M7QA 1IQLA 3MTYA 4TWYA 2FOBA 5HXFA 1ZTLA 3WW7A 1K1JA 8KME2 1P2QA 5HKKD 1QA0A 1GHAF 2P16A 5EPNA 3LDXH 3LIWA 2ZPRA 1SOZA 2GJGA 4ZROA 4YM9A 4CR5A 3LH1A 3GY8A 3RXPA 1OWJA 3BTQE 1KY9A 4QT8C 2I6SA 1KXDA 5AVDA 3ELAH 1QQUA 3RM0H 4F49A 1MD7A 1C1PA 2ULLA 2LELA 3FOAA 3UOUA 5DJ7A 1LVBA 1ZSKA 4AN7A 4P02A 1GCTC 3H09A 4INLA 5EJLA 1T8LA 5EQSA 2OBOA 4MG3A 1Y3VA 5L2YH 2A7JA 1P2MA 4OS4A 3C27B 5EU8A 1OSSA 3M61U 4NSVA 1BBRK 1RTKA 1O3GA 3I78A 3ZYDA 1P2NA 1IHSH 1SMFE 1OOKB 1PPBH 5CMXH 3WY8A 4K1EA 3OSYA 3GS9A 2GCTB 3EA8A 4I7YH 1D4PB 1GL0E 1XUJA 1P9SA 1P2JA 3PWCA 2OUAA 4FU9A 3RP2A 1AGJA 2Z94A 2FZZA 4ZXYH 1FMGA 2AHME 1O2UA 3KCGH 2AGIX 5ABWA 1NPMA 1C5TA 1THSH 1QRZA 1C1UH 1E35B 1YLNA 1YYY1 1YPGH 1E38B 3SUEA 4B2BA 2EY4C 3G01A 2V3HH 4KTUA 1O3MA 2ZU1A 2KCAA 5A8YA 1DXWA 4AOQA 4AG2A 1H8ED 3PTBA 2WV5A 2J5UA 4IW4E 1E0FD 3TJVA 8ESTE 1L2EA 3S9CA 3S69A 1AUTC 3R0FA 1EKBB 5ESTE 4B2AA 1Z8JB 1B0FA 2HOBA 4KKDA 4I31A 1O2OA 1DANH 6LPRA 1MUEB 3MH5A 3M5MA 1HB0B 4YLUA 3TJOA 1T4VH 1AMHA 1BRBE 1WOFA 2PKSC 1U6QA 4ZHAA 1BTZA 1O3JA 1C5NH 1HDTH 2ZHEH 2Z3CA 1P9UA 2PLXA 2Z9IA 1ZPCA 4RT1A 3E3TA 2J95A 2VVCA 1Q2WA 3UWIA 5DPAA 1FX0B 1W13U 1O3KA 1SI5H 1EPTA 3UB0A 3A8CA 5J4QA 2Y81A 1C2FA 5E0HA 2QF5A 5JPMH 5B6LA 4B2CA 1ABIH 3MNSA 1SC8U 3F68H 3KEEA 4BAQB 1CHOG 2GP9B 1SFIA 1LCYA 1INCA 1ETRH 3RXUA 1VKYA 4YT6H 2J97A 1FV9A 2OCVB 4UFGH 4I86A 1TNLA 2PW8H 2FI5E 3S7HB 3MH7A 1A3EH 3E1XB 1V2TT 1L1NA 4KELA 4NCYA 4CRAA 2FIRH 1GMCG 2RFKC 2BXUH 4AFSA 4A7IB 2Z3EA 3BTTE 4BANB 1NRRH 1TPSA 3BF6H 3A7ZA 3BEUA 1HAOH 2BOHB 1GI7B 2TBSA 3BTKE 4E7RG 2Y7ZA 4FUGA 1BJUA 2ZU3A 3SU3A 1WQSA 3U9AH 4IBLH 5LPEA 1CBWC 5EG4A 4DW2U 4UEHH 2J9NA 3SI3H 2Y6TA 3QK1A 2OC8A 1W11U 2ZPSA 1NT1A 1S0QA 2EI6A 3F3BA 1A0HB 3EAJA 1T8OA 5FPSA 4E06H 1HAPH 1TGCA 1C5XB 2H9TH 2B9LA 2ZTZA 3CENA 3UUZA 3VB6A 2YMSC 1P01A 2FOGA 2PUXB 4M7GA 1ZZZA 3Q00A 2NU1E 4LOYH 2GMTC 3SNDA 5AF9H 3S9BA 2J38A 5T6GA 1D6WA 1ESTA 3SJ8A 4BTUB 3UPEA 5B6OA 1O3LA 4UFFH 4AB8A 3U8OH 1ZHPA 3MU4A 2VH6A 4ISNA 4B75A 8LPRA 3UQOA 1K22H 2CV3A 1P04A 2FOHA 5GDSH 4GPGA 1BJVA 1XXDA 3URCA 2R2MB 2QF3A 9LPRA 1N1LA 4RN6A 1MCTA 5AFYH 3VXEH 2B5TB 2OC0A 3AASA 3T26A 2G5NA 1K1LA 2JH0D 2A4GA 3A87A 3H5CB 4ABEA 3LOXA 3KN2A 2LP6A 2BDHA 3PMBB 4BXSA 1FY5A 4WJG2 1SLXB 1C5LH 1JWTA 3BG4C 2TIOA 1O0DH 1F92A 3TVJB 2FS8A 4WVPE 4YTAA 4FUBA 1JXPA 3I77A 4X8VH 4JYUH 2KZ4A 1HIAA 1L1GA 3OX7U 1C1TA 1WDIA 3DUXH 1W8BH 3HGNA 2A2XH 1O2YA 1QHRB 1EP5A 2UUYA 4D7GA 1C4V2 1Z8GA 3VXFH 1A5GH 1FIWA 5C1YA 1DDJA 1LKBA 1SLWB 1KIGH 3TH3H 2BY9X 3SN8A 1C5YB 3KGPA 4AGKA 4A92A 3RXGA 1BMLA 2SGEE 2C90B 2PTNA 1IOEA 1NM6A 2H5DA 3A80A 1H9LB 4YESB 3FFGA 1SLUB 3RXOA 1K1NA 2Z9JA 2ALVA 2D1JA 4A5TS 1TOCB 2BVXH 1DPOA 2SGPE 3U1JB 1FY1A 1VJAU 2VVVA 1GHVH 3BTHE 1HJ8A 1LDTT 3RXLA 3AK5A 4FOUC 2TGTA 3SU1A 1GJ6A 1RS0A 1YPMH 2CK3D 1ELFA 2ZDKA 2W7UA 1YGCH 1YF4A 2QV1A 1J8AA 2A4RA 2GV6A 2Z7FE 5DN6D 2C8WB 3RXAA 2GKVE 1NS3A 1UCYK 3PO1C 1MQ5A 3DCLA 4K8YA 1DWBH 1VZQH 1SL3A 1QL9A 3GDSA 1TRYA 1SGTA 1QA7A 1GDQA 4Q7ZA 5JBTA 2KFWA 2ZI2H 2WZQA 1MAXA 5EGMA 1N6XA 2O8UA 2OC7A 3ATKA 5T6FA 4ZXXH 1O3FA 3PV5A 2ZFFH 4K60A 1NBMD 2UWLA 2FLRH 2O8TA 1TNHA 1YPEH 4WH6A 1ANDA 1N8OB 1Y5UT 3ZV8A 1GI5A 2WPDD 3PLPA
chains in the Genus database with same CATH topology
3ZV9A 4UD9H 5IDKA 2QF0A 4CHAB 1HAYB 1LPGB 1AVWA 2ZEBA 2Y5HA 3ZVAA 1GMCF 4X2XA 3E6PH 1CA8B 2BB4A 3ZVCA 1SQTA 4D9RA 1AE5A 1ETSH 4CRGA 4ABGA 4Y79A 1GDUA 5FHTA 2TPIZ 2J94A 1NC6A 3Q76A 3PM3A 1GJDB 1O2MA 5K7RA 1XX9A 1FI8A 3MOCA 1OWDA 5C1UA 1BMMH 1GI6A 1AB9B 4OS1A 4MNYA 2A5AA 1ZLRA 5T3HA 2BMGB 2HGTH 4GSOA 4DGJA 1V2KT 4ISLA 1KDQB 1HIAB 1A3BH 4THNH 3A7YA 2GDDA 2FYRA 1C1VH 4AFZA 3RMOH 1O32A 1G3DA 1NN6A 1SGPE 4Y11E 2UUJB 3ATLA 2QYIA 1AZZA 3KHVA 3M5LA 2F9VA 3RC5A 3S0NA 1EZSC 1CA0C 4D8NA 4A1VA 3JZ1B 6GCHG 1C1NA 3F9GA 4KTCA 1JIRA 1S82A 5CE1A 1SVPA 4Y76A 7KMEH 1LVOA 1MKWK 3JZ2B 1E37B 1FN8A 4K8BA 4ZHMU 2JKHA 1DLKB 1MAYA 5L6NH 4CH2B 4BAMB 2OBQA 4IGDA 2FLBH 2QAAA 6GCHF 3U8RH 1IQHA 1HBTH 1MTUA 3E8LA 2PKAB 3GOVB 1A0LA 3A89A 1DVAH 3ATWA 1CHOF 1N6YA 1O34A 3LC3A 2CF8H 1Y8TA 3P70B 1G3EA 3ITIA 1HV7A 4BXWA 4NA9H 4RKJB 3SUFA 2RDLA 3SNCA 5DP4A 5FX5A 5TCCA 5L2ZH 4B73A 2F91A 3ZZBA 3HPTB 4GCHF 1GDNA 1TGNA 1AN1E 3EYDA 5ETXA 1SHHB 1VITF 3SU4A 3VFEA 2ZGJA 1RTFB 3E0NB 1EZUC 2C3SA 1O3AA 2ZDVH 2CXVA 3SOSA 3KL6A 1G2MA 1NESE 4WF8A 4ABIA 5FAHA 2G8TA 2QGRA 3NCLA 1OYTH 1AI8H 5TJXA 3QX5H 2F9NA 3E16B 2BDBA 3M37A 2P59A 4CRCA 2IN2A 2A1DB 2HWLB 2SGFE 3NZIA 5A0BA 3GY3A 1H8DH 2EI8A 2F3CE 1HAHH 2I6QA 2G4UA 4K5ZA 1FXYA 2C8YB 2VWNA 3OU0A 1BOQA 2RA3A 4FU8A 1C2HA 1GJCB 1MH0A 3LGIA 1XXFA 3TIUA 2CN0H 1O3PB 1G3BA 4DOQA 5GCHF 3TPIZ 6CHAC 2ZGHA 4X8SH 4NFEA 1T8NA 3A8AA 2A7CA 2ZKSA 1HJ9A 4GUXA 1PYTD 3UNRA 1C2GA 3GYMA 1PQAA 3HATH 2ODYB 3SV7A 4A1TA 3ATMA 3STIA 1QBNA 2PWXA 1DWCH 2SNVA 1O33A 1V2LT 1O3HA 2ANMH 2O8LA 2VJ1A 2ZQ1A 3S7KB 1TX7A 1SGRE 5JBBS 3UNQA 2JETB 1W10U 3LPRA 3NKKA 4DJZB 4JZFH 3LKWA 1UTQA 2ZFRH 5EQRA 1YKTA 5C5OA 2QXIA 3RXSA 3RXIA 4UFDH 1NU7B 2PKAA 5C67A 4WWYA 1SGQE 2ZDNA 2ZC9H 2FOCA 4K1TA 3RU4T 1ELCA 1LO6A 3TNSA 1K28D 2CJIA 1K1PA 1HJAC 1MTNB 4H6SB 5A09A 3LJOA 5T6DA 1TGSZ 4CBOA 2Q6GA 2CGAA 1CT4E 2ZHQH 3S9AA 3RUOA 4PROA 3VB5A 1BB0B 3RXJA 2BLQA 2FOEA 1BBRE 2W3IA 2Y80A 1V2QT 1IHTH 3R3GB 2F9BH 4X8TH 1ELVA 1YPHC 2VGCB 4DY7B 1O2ZA 1SGFG 1KSNA 1F0SA 2BQ7B 1Z6EA 1J16A 4MTBA 1C5PA 3A86A 2FX6A 4Y8YA 3OY5U 1GJ4H 1TWXB 3M7UA 3ZZDA 1DUAA 1JIMA 1G36A 2P8OB 4IN2A 1GBTA 4ZH8A 4TY6A 1GHYH 1GBJA 1NZQH 1SGYE 1JOUB 3GY4A 1BTUA 3LJJA 1O2QA 3NXPA 2UWPA 1BBRH 1SGFA 3A85A 4FU7A 1TYNA 1V2JT 5A8XA 5F03A 3M3VA 3TGJE 3P92A 1MTWA 4D7FA 1OWHA 3RMMH 1WTHD 1RTLA 1K2I1 3KNXA 2FI4E 5GJ4B 1BTHH 1HUTH 1NO9H 4NIWA 1ZRBA 2BD3A 1Z71A 2AGEX 1V2PT 3RU4E 1EAIA 4CHAC 1ELTA 5F8XA 1AZ8A 4X6NA 1GI1A 2ALPA 2AH4X 1W3CA 1WUNH 3IG6B 3BG4B 1MBQA 2DE8A 1BA8B 4Y10E 4DIHH 4OS7A 3M5OA 2ZHDA 5DP6A 1O2IA 2PUQH 3MNXA 3PROA 4BAOB 2FMJA 3E90B 2P3FH 2AIQA 1EPTB 4FUHA 1LHEH 5A2MH 2FEQH 1H1BA 5JB8S 3UQVA 3O8RA 1P2OA 1NRQH 1O2VA 4WY3A 2BD9A 1JMOH 5IYTA 1EPTC 5I46H 2BZAA 4NIXA 4WMFA 1DE7H 1WTGH 1C1RA 1FN6A 3U69H 5FBIA 3W94A 1L1JA 1GBAA 1UVSH 2NWNA 2GGVB 1TRNA 1QB1A 2VWOA 2FOAA 3T28A 2BDAA 4SGBE 1IQGA 1MKXH 1PPEE 1EUFA 4XBBA 3SW2B 2OQ5A 4RKOB 4JYTA 1OWKA 1QFKH 5K0HA 3HGPA 1XUKA 3UREA 1ZGIA 4H4FA 1EJAA 2XRCA 2A32A 3A7XA 1UMAH 3GDVA 2HRVA 4X2YA 3KF2A 2H6MA 3GISB 3K9XB 2HNTC 1SGNE 2BD2A 2ZWLH 4IMZA 5FPTA 1KXCA 1WBGB 1NU9A 2F9PA 1ZMLA 4ZKRU 4WXIA 3TGKE 3FP7E 1OKXA 1CBWB 1ORFA 3SBKA 1J14A 1ZRKA 2VINA 1G37A 4ZAEA 1OX1A 1RJXB 3Q77A 1W0YH 3LC5A 2XCFA 4LZ4B 1EZQA 2TGPZ 4YOJA 1FY4A 5HM2A 4Y0YE 1P03A 1QB6A 5E0JA 2HNTF 1GJBB 3ESTA 2ZFSA 1QIXB 3SQHE 1ARCA 4IC6A 5EODA 3U98H 3ZZ3A 1TAWA 1P57B 1P0SH 3RXDA 3LU9B 4GCHG 1P09A 3OTJE 1FPHH 1RFNA 1PJPA 1DY8A 1GBFA 1UTJA 3B9FH 3ZZ5A 4AFUA 2ZCHP 1CT0E 1C2IA 4HTCH 4AYYB 4Z0KA 1KXFA 3RC6A 3O8BA 1RRKA 2SNWA 2BD8A 4XDEA 3PB1E 1C5VA 1FJSA 4E05H 2Z9GA 1EJNA 2XBWA 2VIDA 3GCOA 1C1WH 3ENSB 2A4QA 1D3PB 2GMTB 2GV7A 3P8GA 2BVRH 3FVFB 2GDEH 1QCPA 1MTVA 1EQ9A 4U2WA 4X1PU 5C5NA 2ZF0H 3T27A 1DWEH 5EW2H 4NZLA 1Y3WA 1O5BB 1GCDA 1Y5AT 1HNEE 1XUIA 1NROH 2KAIA 5G4BA 3SZNA 4XBCA 3V13A 1C5QA 1YP9A 1ELAA 3UR9A 2ZTXA 1GWAA 2BVSH 2FO9A 3MNBA 2FDAA 3DFLA 2QXGA 4JZIA 1V2RT 3T62A 7GCHF 5GIBA 1KTSB 3TITA 1ZTJA 4UONA 1PPCE 1V2ST 1XMNB 4OS2A 1C5OH 1ETTH 3QLPH 2VIVA 1C9TA 1BT7A 2QXJA 1ESBA 3BG8A 1H8IH 3GY7A 4ISIH 3TK5A 1BMNH 1O5FH 4F4OC 1XUFA 2A2QH 1C1QA 3UOPA 1FUJA 3UFAA 1GMHG 4MQAA 4AX9H 4I8KA 1YM0A 5AFZH 2EI7A 2P8OC 3TGIE 1VITG 3GY2A 2ILNA 4MNWA 3OYPA 1UVPA 3MHWU 2BDYA 1F5KU 2UUKB 1UO6A 1UK3A 1UTKA 1ZR0A 1HRTH 3KQDA 4CRDA 4NIVA 3RDZA 5TCAA 3TK6A 1G2LA 2PFEA 1DSTA 3SV2H 3VB3A 3SU5A 2AMPA 4OGYA 2BXTH 1KLTA 3P8OA 5E2PA 2XXLA 4TYDA 2AMDA 1C5MD 3ZZ9A 1MQ6A 2J92A 1IQJA 3ZZAA 1AFEH 4ABHA 1PPFE 1O2XA 2THFB 3M7TA 3MWIU 1TA2A 1VGCC 2CHAC 4GLYA 1EASA 3TLOA 2UWOA 3QTOH 1EAWA 3M5NA 1EB2A 1NRSH 3T29A 1G32B 1B5GH 4IC5A 2ZPQA 1TRMA 1BMAA 4WMDA 1RXPA 3RXQA 4AYVB 3ODDA 3NK8A 1C4Y2 3KQCA 3GY6A 1O2TA 4I8JA 1BTWA 1OP8A 3I29A 1EOLA 2ZECA 3A81A 1VGCB 2CHAB 3FZDA 3VPKA 3A84A 1AY6H 1WQVH 2Y7XA 1Y5BT 1C5ZB 3ZVFA 1A7SA 2OXSA 1L4DA 2BX3A 2G51A 4FVDA 4YT7H 5EQQA 1JRTA 1AWHB 2C93B 4ZUHA 1QNJA 1A5IA 1FZZA 1QL8A 3MU5A 1TLDA 3SI4H 1MCVA 1XUHA 2HVXA 4Y7AA 1H4WA 4I32A 1AIXH 3T25A 1TPAE 3RU4D 6CHAB 4E7NA 3MYWA 2VH0A 1CU1A 1SSXA 4MPVA 1F0RA 3ZVBA 2Y5GA 1S81A 1DXPA 1TNGA 1LHDH 2A5KA 1SOTA 3M3SA 1F2SE 1MKWH 5DP7A 4MPUA 1C5UA 3P17H 3F9EA 1GL1A 2QXHA 3SNAA 4O97A 1OP0A 5JDUB 3LGYA 3SU2A 1BRUP 4X6OA 1O2NA 4X6MA 3BEIB 2BHGA 4TPIZ 1SQAA 3MH6A 2ZFTA 1O3EA 2G81E 2ODQA 4FUIA 5I25A 1EX3A 4FUFA 4YLQH 1H9HE 1F5LA 3AW0A 1PQ7A 3RXKA 5E2OA 1N8OC 4YO9A 1O31A 1GI9B 1GG6C 3MO6A 1ZGVA 1UCYE 4XFQA 4B74A 3A83A 4U01A 4TWWA 5FCRA 1PQ8A 1YCPH 5FX6A 1CGIE 1KLIH 4H42U 2A7HA 1C4U2 1HAVA 3GYLB 1O5DH 3PLKA 2CF9H 3K65B 1O3BA 1SGCA 4HFPB 5HM9A 1RIWC 2P94A 4DG4A 1EAUA 1S85A 3RXBA 5GCHG 2QC2A 1G3CA 4R8TB 2P93A 2P3UB 3QDZB 3SV6A 2ZHWH 1O35A 1WCZA 4JMYA 1TNIA 1Y59T 1Q3XA 2C8XB 1KXBA 1MU8B 4FUJA 1HXEH 2Y5FA 1O2JA 2YNAA 1CSOE 2V6NA 3FAOA 2ZG0H 3PMHB 2BQ6B 2WPJS 5DKMA 1W12U 2PR3A 1GGDC 3D23A 4BAHB 1CA0B 1IQKA 1GBKA 4KGAA 1QURH 1ZMNA 4X1RU 4GHQA 1S5SA 5A8ZA 2F83A 1CO7E 4X6PA 2JH5D 1GBIA 2BY8X 3CS7A 1J17T 1WYKA 2ZDLA 1DLEA 5J4SA 3STJA 3EGKH 3RM2H 1V2NT 7LPRA 1MZDA 1GBHA 3QTVH 3M36A 1KTTB 2XNIA 2GD4B 3RMNH 2ZA5A 4NFFA 4LZ1H 2WPHS 1SG8B 2Y82A 1IQIA 1KXEA 1OYQA 1GBBA 2AEIH 1PQ5A 3ZYEA 4NIYA 5C20A 1T4UH 1S0RA 1UJ1A 2XC4A 2GT7A 1UHBA 2Z9KA 3V0XA 5BRRE 1XM1A 2STBE 2Z3DA 2D2DA 1A0JA 1GMHF 3BV9B 2CMYA 3LONA 5EPYA 1GVLA 2D8WA 3GCHB 1NFYA 3SV8A 1EJMA 2STAE 3QUMP 1QQ4A 3A88A 1LVYA 1GVZA 3BIVH 4ABJA 7ESTE 1ELGA 1HAGE 2BD4A 1C5SA 3VGCC 1HXFH 2XWBI 1H9IE 2R0LA 3E91A 1YCPM 1C2JA 1E34B 1GJ8B 2TGAA 4O3TA 1GI8B 1GMDG 1UTNA 2WUCA 1F0TA 3QO6A 1GHAG 3EE0B 1KXAA 2BY6X 6ESTA 2NU3E 5HMAA 3Q3XA 4ABDA 1CT2E 4Y8ZA 2QIQA 1NRNH 4ABBA 2WUBA 1HJAB 3TH4H 1BRCE 4CRFA 1TONA 1ZSLA 3F6UH 3O8DA 3MU0A 2Q6FA 2FI3E 3RXEA 3K6YA 4CBNA 2XW9A 4O9VA 2F9OA 2H9EH 3B23B 4D76A 1WAYB 2TGDA 3IWMA 1GHWH 1IQEA 3UWJH 5BPEA 1QGFA 1IQNA 4BTIB 2BQWB 4MLFB 4X2VA 4XSKU 1O2KA 2O8MA 2A0QB 2BLVA 4HI3A 1S6FA 2W5EA 1GG6B 3A7VA 1FPCH 2ANWA 1QRXA 4DCDA 4MVNA 1O39A 1AKSA 2XBXA 2BDIA 1HAVB 1PPHE 1XKAC 2XBVA 1GHBF 4BOHA 1BCUH 3A8BA 1A61H 1QL7A 2OTVA 3RXHA 5LPRA 2IPHA 1A5HA 1BUIA 4MNXA 3TK9A 2FX4A 4K69A 3H7OA 5EXMA 2A31A 2M5TA 1CGJE 2VNTA 3GICB 3LGWA 4JYVH 4AGJA 2NU0E 2WPLS 1K1MA 2B0FA 2ZGXH 1Z8RA 1V2OT 3F9HA 1PYTC 5EOKA 2GT8A 3SNEA 3HKJB 3UR6A 4OGXA 1O3CA 3TJNA 2FPZA 2FTLE 3SV9A 1SGEE 4K1SA 1YPLH 1TNKA 1KLJH 1UTLM 1HGTH 2O8WA 4B76A 1VCWA 2G5VA 3QZRA 1GMDF 1O37A 1TMTH 1LHGH 2VIPA 2ESTE 4WXVA 5DK1A 4DT7B 1JBUH 2BD7A 1BHXB 3LT3A 1BHXF 1NTPA 3SU6A 3IITA 1FDPA 1TX8A 1RD3B 4D9QA 1FONA 3BSQA 1DICA 2VWMA 1GHZA 1GPZA 1QB9A 2ZHFH 5LH8A 1D3DB 2P95A 4IS5A 2GTBA 3ZVEA 1T32A 3T5FH 5ESBA 2JETC 3RXMA 1UHBB 3EA9A 2LNCA 4ABFA 1K1IA 2XBYA 1QRWA 2NU2E 1MBMA 1IQFA 1T8MA 3HK3B 4CH8B 4R0IA 3SUGA 5F6MA 2AYWA 2H2ZA 1JRSA 4I8LA 3ZZ6A 3UNSA 2AGGX 4X2WA 4OS5A 1TE0A 1Z1JA 1BTXA 2R3UA 1C5RA 2ZU4A 1A46H 1ZMJA 2FOFA 4X8UH 1BTPA 1D6RA 1FAKH 1AVGH 1P10A 1Z6JH 1BTYA 5GPIB 4BTTB 3MO3A 3DHKH 1GI0A 1CVWH 2QY0B 2A4OA 2WINI 1Y3XA 3DA9B 1X7AC 2RA0A 3EQ0H 1AO5A 5DO4H