1E34B

Porcine pancreatic elastase complexed with (3s, 4s)n-para- toluenesulphonyl-3-ethyl-4-(carboxylic acid) pyrrolidin-2-one soaked in ph 9 buffer for one minute
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine protease)
molecule keywords ELASTASE
publication title `Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B01
3A8CA 1GBJA 3SNCA 1AVGH 2FOFA 1EXFA 2FO9A 2FYRA 2ZWLH 3M5MA 1S5SA 4GHTA 3RC5A 4UEHH 1K1JA 3GY6A 1KY9A 4E06H 5A8ZA 5K0HA 1C1WH 1FDPA 3GYLB 1FZZA 2VIQA 3TH3H 2B7DH 3ZZ3A 2RDLA 4NIYA 3ZV9A 2HLCA 1GDQA 4TYDA 4Z6AH 4FUHA 2FS9A 2A4GA 3SU5A 3MO9A 2BDGA 1GMCG 1P06A 2CV3A 5EQRA 5EXNA 1Y8TA 1X7AC 1AE5A 3VB7A 1P2JA 2ZHWH 1ETRH 1UCYH 1C5SA 1TBRH 1FAKH 4YLQH 1IQIA 1C5VA 1EP5A 4ZKSU 4B75A 1BJUA 2ZGCA 1O3AA 3MNCA 2H6MA 2D2DA 5EQQA 6ESTA 2H2ZA 1G32B 1PYTC 1YPMH 1GJ7B 5DK1A 2XC5A 1HAYB 3SN8A 2B5TB 5TCAA 1GI4A 4FUCA 2AIPA 3Q3KA 1FPHH 3BTME 5LPRA 2KAIA 3LOXA 1SGTA 2GCTC 3BTGE 3ZVBA 1OPHB 1TX8A 5E0GA 3F1SB 1CGJE 4YOGA 5SGAE 3P6ZB 1CT4E 1CT2E 1KXAA 5L2ZH 5EG4A 1YCPH 3T29A 2ODQA 4FUFA 3A7WA 1D4PB 1C5YB 6GCHG 5E0JA 2ZGXH 1ZOMA 1YYY1 1EB1H 1O2SA 2CGAA 1NY22 1AE8H 4VGCC 2XXLA 2OC1A 3P17H 1TNGA 5GIBA 1GBHA 3RU4E 2YOLA 3ZZBA 1CGHA 1ZTKA 1ZMJA 2BZAA 1VITG 1FY8E 8GCHG 1RRKA 1IQJA 1T4UH 3Q76A 1TOCB 2BY6X 3EDXB 1QB1A 1ZGVA 4JZIA 2RA3A 3VB6A 1SGEE 3A83A 2XWBI 1L1JA 1Y3WA 2GZ8A 2O8MA 2GT8A 2QXJA 1F0SA 3P8NA 4MPWA 2A5AA 2RG3A 3RC4A 1K1NA 2G4UA 4DOQA 4NA7A 1GI9B 3ELAH 2IN2A 4E7RG 3PLBA 3UOUA 4X1PU 1AO5A 2BQ6B 2QN5T 5I46H 2C8YB 5EPYA 3RMNH 4A1VA 1BBRE 1VCPA 2VH6A 2BDAA 3PTBA 5I25A 3Q3YA 3PWCA 1OYQA 1AUTC 4YO9A 5AVDA 3EE0B 2PTNA 4IN2A 3RMLH 2PKSB 2A2QH 1FV9A 3GCHB 3UOPA 3BEFB 2QIQA 2WPKS 4ZKNU 3BTQE 2C90B 3RM0H 3LGWA 2F91A 2R0LA 2V3OH 3MU0A 2JKHA 3M7UA 1O3FA 4WXVA 1ZMLA 1XKBC 2XTTB 3QO6A 3V3MA 1GDUA 2SFAA 1Y3YA 5FHTA 1T8OA 4WWYA 1XUIA 1ELAA 2ZDVH 4XOJA 1K2I1 5F8TA 2Z9KA 3V0XA 5DP9A 3JZ2B 3ZVAA 4DW2U 1TRNA 1GBLA 1Z7KA 2O8UA 3RU4T 3BTFE 4B73A 3ZVGA 2PW8H 3AVZA 1RD3B 4NIWA 4JYVH 3TJOA 1TBQH 2FP7B 1C5NH 5TCCA 4AG2A 2TPIZ 3W95A 3MNSA 4OS6A 4JYTA 1EJAA 1O2NA 1QBOA 3ZZ6A 2TGDA 2FOAA 1BTZA 1AU8A 1MH0A 4ISLA 2PGBB 2Q6GA 3AW0A 1WUNH 1GGDB 1NRRH 1DWDH 1E36B 2BDBA 2ZTZA 1INCA 3PV4A 5JB8S 2ANYA 2ZDMA 1SMFE 2A7JA 5EW2H 2IJOB 2GV6A 1O3JA 1ETSH 2TIOA 3R3GB 1TOMH 1UTMA 3OU0A 1DT2A 2AIQA 2CHAB 3PMAB 4SGAE 1HAVB 2FS8A 1NPMA 2UWLA 1OP2A 1D3PB 4YT6H 3VXEH 3KQBA 4MNYA 5TJXA 3U8TH 1SGYE 2VGCB 3A81A 5JDUB 2H5CA 5DP7A 2ZPRA 3MO6A 2BX4A 4GPGA 3RDZA 3TGJE 2AYWA 1HBTH 4F4OC 2FYQA 2FESH 4Y7BA 3TPIZ 2FOBA 2H9TH 3SJ8A 1EAIA 1QRXA 2ZDKA 1VZQH 2HRVA 3SOSA 3TH4H 1P2QA 1FI8A 7GCHF 4FUBA 5EXMA 1PQ5A 4IBLH 1O2TA 1H4WA 2C8ZB 3PMJA 3U1JB 1O3EA 1QB9A 2K1QA 2AGEX 2XBWA 3LC5A 3MOCA 4FXGH 2WV5A 4MNXA 1C1NA 3N7OA 4D8NA 1FY4A 1DUAA 2GKVE 3SUGA 1NS3A 1KXBA 3MU4A 3QN7A 1D3DB 1JMOH 2NWNA 2WYJA 1GI5A 1GJ4H 1NESE 2XC0A 3FZZA 1NFUA 1CA0C 1QL8A 1O5FH 4X6OA 1W7XH 1TRYA 2ZG0H 1GJ5H 1QCPA 2GCHF 1GJBB 3MH4A 1LDTT 3K6ZA 4DJZB 1EP6A 1IHSH 1MBMA 4CHAC 3TGKE 1O0DH 2Y6TA 2GVFA 3G01A 1CQQA 4X6NA 1O2PA 3M5LA 1OWEA 1ZHMA 3HPTB 2FOGA 1C1TA 1DICA 4CBNA 1PPBH 5FBIA 4UFDH 3A8AA 1AWHB 1O32A 5DP6A 2OTVA 2ZC9H 1C1OA 1P9SA 2BY8X 2FM2A 2XYAA 1Y3UA 1P57B 1EPTB 3UY9A 3UWIA 2BD5A 1RXPA 2ZPQA 3M3TA 3ATWA 3UPEA 3S69A 5J4QA 4ZHLU 1O5BB 2ZHDA 2H5DA 4KTSA 1ZPCA 1UO6A 5IDKA 4X1SU 3CS7A 1SLXB 2W26A 1SR5C 4Y10E 3A89A 3SUDA 2HVXA 1SGNE 1Z1IA 2THFB 1T8LA 5C3NA 1C2MA 2ZDLA 1ARBA 1O3MA 1Z6EA 3UUZA 2J38A 1ORFA 1S0QA 4B2BA 1C5RA 1C5ZB 2ZI2H 2STBE 2D1JA 1YBWA 1V2UT 1Y5AT 2HPQH 2UUYA 3H5CB 2OC8A 1P12E 5H4IB 4ABAA 4K2YA 1GBCA 2ANWA 4E05H 5LGOA 1BMLA 3MWIU 1FY3A 4GLYA 1SGFA 1ID5H 1G2LA 3RP2A 1GI0A 2VWMA 2PWXA 1DS2E 1H8IH 3GCTF 1TB6H 1G3BA 2NU1E 1PFXC 2D26C 3A82A 4MPUA 1XUGA 4MVNA 1P3EA 7GCHG 5ESTE 2SNWA 1SGRE 3LKWA 1SGPE 2SNVA 3SU2A 5LPFA 1E35B 4I31A 4WH6A 4NCYA 4UONA 3PM3A 4B76A 5K7RA 4BNRA 3A88A 4A7IB 1J16A 1KIGH 1O5AB 1WAYB 2BDCA 3MHWU 1C4Y2 3LJJA 1BRUP 2PUXB 1V2VT 5EQSA 1NRSH 2QF3A 3RXDA 1SHHB 4ISOA 1BA8B 1OYTH 3MMGA 3SV7A 1BIOA 4NZLA 1HAVA 4GCHG 2BM2A 3MYWA 5CE1A 1DY9A 1ELTA 4YT7H 1OS8A 2GCHG 1FY5A 2QXIA 4Q7YA 3RXTA 1GBDA 1SB1H 1TPOA 4NGAH 4CR9A 3K2UA 2ZFQH 2SGPE 2EEKA 4IMZA 4AB8A 1W13U 4UFGH 2OBOA 4KTCA 1O3DA 1JRTA 2AH4X 1XUFA 1LPKB 4WF8A 9LPRA 2PUQH 3CS0A 3SJ9A 4AFSA 3A86A 1TRMA 1UTKA 3U1IB 1CHGA 5CHAC 1YCPK 2FTLE 1LHGH 3VFEA 1FAXA 1THRH 2NU3E 1HV7A 3KCGH 3LDXH 3M37A 1NT1A 3K65B 1O2QA 3M7QA 4XBDA 3DFJA 4R8TB 1HB0B 2HALA 1THPB 3KQCA 5FBEA 4FU8A 1C2EA 3SUFA 2PKSC 3QTVH 2H9EH 2RCEA 2O8TA 4JZEH 4Y8XA 2ASUB 3MU8A 4KELA 2ZQ2A 3Q77A 3TITA 3SQEE 1GDNA 4DGJA 2GT7A 4JZ1A 4MLFB 3BSQA 1XMNB 1F0UA 1S6FA 2J94A 3M35A 1WOFA 2OQ5A 1W0YH 1P2NA 1RTKA 1JOUB 2FZZA 2BY7X 3VXFH 1WV7H 3OY5U 3SU4A 1GHZA 2ZFPH 3VB5A 4I8KA 3QZQA 2FI5E 2DE9A 2FX4A 2SGAA 4HFPB 4OGXA 1K21H 3FP6E 3M7TA 3RXKA 2WUCA 1TGBA 1HLTH 2WINI 4H6TA 5HM2A 1Z71A 3U9AH 1LHFH 1GBEA 3PB1E 3GCNA 1C5XB 1O3KA 1A5GH 3I78A 4D9RA 5DG6A 1IQLA 2P3FH 3EA7A 4B2AA 4SGBE 1C2IA 1ZHRA 1GBAA 3SZNA 4QT8C 2R2MB 2CHAC 1EPTA 4IC5A 2ZTYA 3RXGA 4NFFA 4OS4A 1ABIH 3A7ZA 1W0ZU 3UTUH 1A0LA 3LJOA 3AASA 2C3SA 1TPSA 3ATMA 3UNQA 4LOYH 2VIDA 1XM1A 1ELVA 2Z9GA 2ZNKH 1Y5UT 1HFDA 2G5NA 1V2MT 1GJDB 1F0RA 1UTLM 4K69A 1JRSA 4Y76A 4X2YA 1LHEH 1A2CH 1J14A 3OY6U 1BQYA 1W8BH 3S0NA 4IW4E 1QL9A 2JH0D 1GHWH 3HK6B 5C20A 1DLEA 4LZ1H 4X2VA 2VIWA 5A0BA 1EOLA 4R0IA 1T7CA 4IS5A 1DY8A 1FN6A 3TLOA 3E3TA 1MZAA 1QTFA 1AY6H 3E16B 1BDAA 1GBMA 3T27A 1EQ9A 1H9LB 1ZMNA 4CH8B 2EI8A 4LZ4B 1TGTA 1GHVH 2BMGB 1BJVA 2Z3DA 1WTHD 2JH6D 3NZIA 1O2YA 1BMMH 2QA9E 1HUTH 1MKXH 1WYKA 1TWXB 4ZHMU 2FX6A 3U8RH 3LPRA 1UVUH 5EXLA 3ZZ8A 1TGSZ 1ZHPA 4AZ2B 1EB2A 2BHGA 3V13A 5DP3A 1GHAF 4U32A 1GBKA 5AFZH 3TH2H 3GY4A 1T31A 4I8GA 2CXVA 3RXIA 4AORA 3DHKH 1P02A 1C2DA 1Q3XA 2FDAA 2HPPH 1YC0A 1O2MA 3FP7E 1O3OA 1A7SA 4Y11E 1TPAE 5E2PA 5C5NA 1O35A 4Z0KA 3KHVA 4U01A 2F9NA 4FUJA 4CRAA 2NU4E 4UE7H 1NC6A 3PO1B 2FI4E 1P3CA 1PPCE 1A3BH 4BTUB 2OXSA 1QJ1B 3LIWA 2R2WU 4INLA 2DUCA 1BRBE 1XXDA 1QR3E 4KTUA 1SGCA 1BZXE 2A7HA 4YOJA 3SU6A 4DVAU 4XSKU 1EPTC 2BXTH 4X8VH 2G55A 2G4TA 1C1UH 3RXRA 1MTWA 1C2FA 4I32A 4GAWA 1A61H 1EZXC 2BLOA 1BTPA 1G2MA 2VNTA 2HNTE 2F9OA 2BYAX 1MQ6A 1FY1A 3SNAA 2H9HA 3GDUA 5C1UA 4Y71A 3D62A 1BHXF 1NZQH 4H42U 2BD8A 1JBUH 3KN2A 2XC4A 3URDA 3MU1A 4OS1A 1W10U 2QYIA 1LKAA 4ABDA 3RXMA 2A0QB 1C1SA 3SV9A 3F68H 3NXPA 4WJG2 2UUFB 3B9FH 1K1LA 1MBQA 1S0RA 1B0EA 2ZECA 3B23B 3SJIA 1QB6A 1HYLA 1J9CH 1GG6C 1Y3VA 2BB4A 3T5FH 5A8XA 3NCLA 5A2MH 3T62A 1XVOA 1TPPA 4CH2B 4YM9A 1WU1A 2LPRA 2JH5D 1LQDB 5HGGA 1N8OC 5CHAB 1GVKB 3ATKA 4BAKB 1Z8RA 1C4V2 1ZSJA 4AGKA 4CREA 4ZKOU 4Y0YE 1GI2A 1PPHE 2FTMA 4IGDA 1PJPA 4M7GA 2AFQB 1YLCA 5DP8A 1OWKA 1GHXH 1WSSH 2UUKB 2ZO3H 2ALPA 2WV4A 1YCPM 4Q2KA 1TGNA 1MTSA 3A8DA 3RXCA 1O2JA 1TX7A 2XCNA 2HNTC 1G9IE 1F2SE 4X6MA 1A46H 2VU8E 1O5EH 3GYMA 1HIAA 4MDSA 4KKDA 1O2XA 2G51A 3OYPA 2FPZA 2ZU5A 1LVMA 1PPFE 1SC8U 5AHGH 4J2YB 5GPIB 1EZUC 3D49H 2W3IA 1NU9A 3ZZ9A 1TNHA 1QURH 2ZPSA 3QTOH 5PTPA 2GMTB 4INHA 4JYUH 1QBVH 2SGQE 4A5TS 1C1QA 1QBNA 4MNWA 1EAWA 2VIOA 1FPCH 2ZP0H 4X8SH 4JZFH 4OS5A 3F9EA 6LPRA 3TU7H 1O3HA 1E37B 3ZVEA 2H1UA 2OC0A 4LK4A 5E2OA 3Q00A 2BQ7B 2Q6FA 1ARCA 1GJ6A 2BOHB 2FLBH 1YPEH 4E7NA 3LGTA 3SQHE 2A4OA 3L33A 4AB9A 4AFZA 1ZRBA 1C1MA 1UHBB 3P70B 3JZ1B 2CF8H 1HAIH 1LHDH 3RXHA 1D9IA 1DM4B 1QJ6B 3HKIB 2GGVB 3UREA 2XCFA 5IYTA 4ZUHA 2ZCLP 4YLUA 4B1TA 1FONA 4DCDA 1TNJA 2F3CE 4UFFH 4A1XA 3I77A 5A0AE 1DDJA 3RXLA 1IQEA 8LPRA 1DOJA 3BIVH 4B2CA 1VCWA 1V2WT 2UWOA 1AHTH 1TGCA 1VJ9U 3PLPA 1BTWA 1O2RA 1K1IA 1Y5BT 4I33A 5T6DA 3UR9A 4ZXXH 3BTDE 1RTLA 1NM6A 2O8WA 4O3TA 1WCZA 1AIXH 4RKJB 2VINA 2ZDAH 1C2KA 1LCYA 4DURA 1YPHE 4RSPA 3FVFB 1PPGE 2PGQB 1XUKA 2QC2A 3FZDA 2SGDE 1GVZA 1C1VH 2CMYA 2QGRA 1KTSB 1O5GH 3BIUH 1IQGA 3LH1A 1VGCB 4IN1A 1CVWH 1GBTA 1O2LA 1DSUA 1MCVA 2M5TA 2XNIA 3MNBA 2V6NA 4I8LA 4FUEA 1CA8B 4K1SA 4WVPE 2RA0A 1WQVH 3BG4B 1HAGE 1JIMA 5JPMH 4JK5A 1AN1E 4LXBH 1HAOH 5B6OA 3C27B 1UK4A 2A45B 2P3UB 2AMDA 1GPZA 1WBGB 3BTHE 4INKA 1DPOA 1K9OE 2VB0A 1ZYOA 1AZ8A 3QWCH 3GY8A 2BD4A 1OWJA 3PTNA 2Y80A 1A4WH 1XUJA 4K5ZA 1YPHC 3ODFA 1SFQB 2XBYA 3VGCB 1GI3A 4X2WA 4GSOA 1C5OH 2WPMS 1BTYA 2TGTA 1P09A 1H1BA 2FOCA 1P9UA 2PSYA 4ISHH 4D7FA 3A85A 5A8YA 3ZV8A 2C93B 1CGIE 1GBIA 4O3UA 2CN0H 4CRBA 2J34A 1U6QA 2HWLB 2OUAA 1BBRH 1D3TB 1GBBA 2WUBA 2A31A 3UNSA 5LPEA 1BTUA 1DE7H 3SV8A 3MO3A 3H7OA 4ZH8A 1PQAA 5BRRE 4NG9H 2PR3A 1SHYA 1XKAC 3E8LA 3T28A 5C67A 2IPHA 3KEEA 2VVVA 1QY6A 1GG6B 2A4RA 1JXPA 5EOKA 2ZCKP 3TNTA 2BY9X 2JETB 4BANB 1XX9A 1O36A 1N8OB 3LGUA 2P3TB 1ELDE 2ZQ1A 1O5DH 1BMAA 2FODA 5C5OA 4DY7B 2VVUA 1SQTA 3NUMA 3V7TA 1UK2A 1C1RA 2EI7A 2TBSA 1WTGH 2A2XH 3NKKA 2AEIH 1QQ4A 1MTUA 3A7XA 3L3TA 5FAHA 1FUJA 3AW1A 3C1KA 3PO1C 2XBXA 4XE4A 1KLIH 1OSSA 2Y82A 1C5MD 1HJAB 3BN9A 1NFWA 2GDEH 5FX5A 4O97A 3TK5A 1C5LH 3TGIE 3GDVA 3OSYA 3ZYDA 2AMPA 1DXPA 1TYNA 1EAUA 5G4BA 4MG3A 1GI7B 1O5CB 3UQVA 2BZ6H 1MKXK 1TABE 1QRWA 4TWWA 1TA2A 4FUDA 1O2GH 1S85A 4AFQA 1JIRA 1UCYE 1FN8A 2ZGBH 1J8AA 1SI5H 3TK6A 1UCYK 2ZTXA 1G30B 5T3HA 1UHBA 1O33A 1S83A 2A5IA 2W3KA 2ZFRH 5F8XA 1SBWA 1O2ZA 1V2OT 3K6YA 4ZXYH 4Y7AA 1ELFA 1ANBA 1DX5M 1ZTJA 3NK8A 4ISIH 4MQAA 2BLWA 2Y7XA 1UK3A 1HXFH 3GOVB 3ZZAA 3BV9B 3MH6A 1MKWH 2GV7A 2GDDA 3SW2B 1XXFA 5DO4H 5FPTA 3EGKH 3GICB 1GMDF 3RC6A 2GZ7A 3U8OH 1PPEE 3OTJE 1E0FD 1O39A 2P93A 1GJAB 1TA6A 3B8JA 3BTKE 2FI3E 4FVBA 1YF4A 4JK6A 1L1GA 3RXUA 4TY7A 2OLGA 3RXAA 5C1XA 5ESBA 5F6MA 1S81A 1O2HA 1MMJN 1K1PA 1TBZH 2XBVA 2Y5GA 4NZQA 2ODPA 1H8DH 3D23A 4OGYA 1EOJA 1GMCF 1SG8B 3VB3A 1T4VH 3PROA 2Z6BD 2ZU3A 1H9HE 1LVYA 1HJ8A 2O8LA 3LONA 3HGPA 4X1NU 1J15A 2BD2A 2BLVA 4JZDH 3ITIA 2Q6DA 1P2IA 1AD8H 3EYDA 3TJNA 5JBTA 1DITH 2GMTC 3SV6A 3GCOA 1C2LA 1OOKB 2GP9B 5A0CA 2ANMH 2QF0A 4CRDA 5F8ZA 1O37A 1HIAB 3SGBE 1P2KA 2LNCA 3ATLA 3P8GA 1A1RA 2B8OH 3ZZCA 1TALA 4JCNA 1IQHA 3PWBA 1QRZA 1FQ3A 3S9AA 2ZU2A 5T6FA 3T25A 3GCTG 2P59A 1HAXB 2Y81A 4Q7ZA 3NPSA 1CT0E 1EASA 1CBWB 1BHXB 4D7GA 5F03A 4XBBA 2OP9A 1GI6A 1V2NT 1RGQA 1Z8IB 3MU5A 3DUXH 1D6WA 1YPJH 3KNXA 1Q31A 1O2KA 3RXJA 1UMAH 2ZFSA 4GUXA 4BAMB 1SSXA 4X6PA 1GL1A 5FXLA 3SI3H 1GJ8B 1ABJH 1W12U 2F9BH 1ANCA 1NROH 8KME2 1Z6JH 1N1LA 3EAJA 4RKOB 1ZLRA 1SQAA 1F0TA 4BTIB 4MNVA 1QNJA 8GCHF 1KSNA 3RXPA 2OD3B 1ZJDA 2V3HH 3T2NA 1O2OA 2YNBA 4AYYB 2ZEBA 3SNEA 1C2GA 1QL7A 1UTOA 1O34A 2ZHEH 4BAOB 1S6HA 1ANEA 1TAWA 1TNIA 1UVSH 2AGIX 3PLKA 1P03A 3SUEA 3IG6B 4CRFA 3BF6H 3RXVA 4HTCH 1VR1H 1M9UA 1LKBA 1IQKA 3SBKA 3QUMP 3RMOH 2BD3A 1IOEA 4GVUA 4Y79A 5E0HA 3S9BA 1C5UA 2AGGX 3DD2H 2BDYA 1SL3A 4UDWH 5GWZA 1V2RT 1GMDG 2ZF0H 4ISNA 4FU7A 3RMMH 1ACBE 1O2UA 1ETTH 3MH7A 2ZU4A 3SJOA 1TMUH 2BX3A 6CHAB 4A6LA 2P95A 3F6UH 1LVBA 2R3UA 3A7TA 2R9PA 4O03A 1VGCC 5J4SA 4YZUA 1ELGA 2VWOA 2G52A 4K60A 3UWJH 1AWFH 5FCKA 1TQ0B 1HAHH 1YPLH 1ZZZA 2D8WA 1CO7E 1V2JT 1W3CA 2P16A 4K8YA 5ETXA 5T6GA 3BG4C 1ZRKA 1XVMA 1PQ7A 2P8OB 2QXHA 4D76A 1E38B 3M3SA 3RUOA 1NU7B 1SOTA 1P0SH 4XFQA 4K1TA 2G81E 4A1TA 3BEIB 4YESB 1PPZA 3RXOA 1IQNA 3KL6A 1MTVA 1DUEA 5GXPA 5FPYA 1HGTH 3SV2H 4XBCA 1K22H 3CP7A 2ODYB 1MU6B 4ZMAH 1N6XA 1ANDA 1L0ZA 1HPGA 2QV1A 1MQ5A 2G00A 1W2KH 3A7VA 2ZGJA 3QX5H 2ANKH 1VJAU 2Z94A 3F9FA 1C4U2 7LPRA 1AKSB 1ELCA 1T8MA 2OINA 4A92A 1P2MA 3VGCC 1EX3A 1F5LA 1NO9H 3BTTE 1O3GA 2FEQH 1GVLA 1AQ7A 1V2PT 4MPXA 1BOQA 1EJMA 3VB4A 1G3DA 1FXYA 1CE5A 2GX4A 1YPGH 2Z7FE 1YPKH 3M61U 3QK1A 3LT3A 1SPJA 4CRGA 1RTFB 1AVXA 1C9PA 3U69H 1DWBH 1GBFA 2QCYA 1QA7A 2PKAB 2A32A 3FANA 1NRNH 3BTWE 1GCTB 3URCA 2P94A 1ZPZA 4HI3A 3PMHB 1KXCA 2FLRH 1SOZA 4CR5A 5A09A 2YNAA 2Y5FA 4ESTE 4I8HA 3ODDA 1HDTH 2PLXA 4DT7B 4ZROA 3P92A 4CBOA 3GY2A 1W7GH 1TLDA 2R0KA 2F9VA 1DFPA 4FUIA 3ZZ4A 2VJ1A 2TGPZ 2JETC 3ZZDA 1KXDA 3SO3A 1LMWB 1OXGA 2NU0E 5JYIA 2ESTE 5DP5A 1BUIA 5BPEA 3MFJA 1HRTH 4WMEA 1MTNC 1F7ZA 3MNXA 3O8RA 1EJNA 1LHCH 5C2ZA 4NFEA 1ZGIA 3UFAA 3IWMA 4KGAA 1UVTH 1V6DA 2UWPA 1ZSKA 1O3BA 3P8OA 3ZYEA 3P8FA 1GHYH 5EU8A 1TQ7B 2ZHQH 2ZHFH 4X8UH 4Y0ZE 4WXIA 2BD9A 4AOQA 2STAE 3S7KB 4Q80A 1HJAC 4O9VA 2BQWB 1HCGA 1ZTLA 1BBRK 2ULLA 4F49A 3SI4H 1DWEH 1OP8A 4DIIH 1EATA 3HATH 4THNH 1QA0A 1OWHA 1TIOA 2HGTH 1EZQA 4X0WU 3SHCH 2C8XB 5JBBS 3RLWH 3D65E 2PFEA 2VWLA 4JMYA 1IHTH 3M36A 3QLPH 1DSTA 1SFIA 1GHAG 2NU2E 1RJXB 1V2LT 1GJCB 4U30A 1C5PA 1GI1A 3OX7U 4GHQA 3HKJB 1IQFA 4IMQA 3LGVA 4AN7A 1AGJA 4BXSA 1NFYA 1UTPA 3TJVA 3M5NA 5FPSA 3A87A 4OS2A 1ESBA 1AB9B 4WMDA 5DJ7A 2BDHA 1P11E 5HMAA 1EAXA 4K3JA 3RXEA 1T32A 4RN6A 4BOHA 3SHAH 2C8WB 1OP0A 1XUHA 3A8BA 1TONA 3GISB 2O9QA 2FIRH 3A7YA 1V2TT 1J17T 1GI8B 2Z9LA 3LGYA 1BRAA 2BOKA 5GCHF 1RIWB 1HNEE 1LPGB 1OWIA 1BRCE 1GHBF 4X2XA 3EA8A 4XDEA 1O38A 5GJ4B 1TNKA 1PYTD 2ZFTA 2BDIA 1BMNH 3FP8E 3SU3A 1G3CA 1SLUB 2BXUH 2F83A 3RXFA 1UTQA 4NIXA 3I29A 1DANH 1YP9A 1C5QA 5EPNA 2GZ9A 2B9LA 1S84A 3UQOA 1O31A 3LGIA 5LH8A 2G8TA 1RFNA 3A84A 1QJ7B 2F9PA 3Q3XA 1BTXA 3GY3A 4NA9H 1O3NA 2SGFE 5JBAS 1AFQC 1G36A 1MAYA 5L6NH 2A5KA 1PQ8A 1YM0A 4NA8A 1DWCH 2Z9JA 2ZFFH 3K9XB 4TWYA 2A1DB 4Y8YA 1SVPA 3CENA 1MKWK 2C4FH 1C5WB 1P8VC 3S9CA 3MI4A 1GL0E 2G5VA 1LTOA 4ZKRU 2IOTA 4ASHA 1C2JA 1LO6A 1SQOA 4WY3A 3W94A 1Y59T 3QDZB 3ATIA 1LVOA 1CHOF 1CBWC 2WPJS 5AF9H 4X8TH 3STIA 3E6PH 1BB0B 1DVAH 2ZKSA 1MUEB 3P95A 2Z3EA 1P2OA 1AKSA 3QGNB 1VITH 1H9IE 1UVPA 1YKTA 4D9QA 5HXFA 2Q1JA 3T26A 3TIUA 3KGPA 1F5KU 3SNBA 3O8CA 3AAVA 1AFEH 1MZDA 4AYVB 5DGJA 4ABJA 5FX6A 2V35A 1GMHF 1DXWA 1BCUH 1ZR0A 4GCHF 5L30H 1P04A 4TY6A 2GD4B 4NIVA 2PKAA 5DPAA 1EZSC 2OQUA 3SJKA 2GCTB 3UNRA 3STJA 2PTCE 1O3PB 4X1RU 1BT7A 1O30A 5AFYH 1Y3XA 3GDSA 8ESTE 1AVWA 3RU4D 2BLQA 3WY8A 3DT0H 4AG1A 4BTTB 1C5TA 5E8EH 4H6SB 1KDQB 1AZZA 1TE0A 2VIVA 1NTPA 2WPLS 1G3EA 4B71A 2VIPA 2CF9H 4ZAEA 2BTCE 2XRCA 4J1YA 3LC3A 1K1OA 2FOMB 1HAPH 2QXGA 1Z8JB 3KQEA 3TJUA 3KF2A 1L2EA 1QFKH 4MPVA 1V3XA 1F5RA 2FOEA 5GCHG 2EA3A 4VGCB 3O8DA 1GHBG 3E90B 4HZHA 2HOBA 2R3YA 6CHAC 3BG8A 2BVSH 1Z1JA 3RLYH 4AFUA 3ZVCA 5JBCS 3GY5A 2ZIQH 2OC7A 4Y6DA 1LPZB 1W11U 1HAZB 2ALVA 1OX1A 2ZDNA 1NN6A 2FMJA 1E34B 1FLEE 2WYGA 2EC9H 3TK9A 1MTNB 1JWTA 2BD7A 1C9TA 1F92A 1TMBH 4CRCA 2WPHS 2AMQA 3SGAE 3UR6A 2P8OC 3V12A 1FNIA 1P05A 2Z3CA 1IQMA 9ESTA 2EI6A 1A0HB 2WPIS 5CMXH 1QGFA 2Y7ZA 1ZPBA 4K1EA 1ELBA 1KLJH 3RXQA 2VWNA 1ELEE 3S7HB 2A7CA 3FFGA 4U2WA 3ESTA 5DKMA 1FMGA 1L4ZA 3HGNA 1V2KT 2J4IA 1GCDA 2VVCA 2QAAA 4DG4A 1B5GH 1A5HA 2PSXA 1O3LA 1SLVB 1QQUA 4ABHA 3TVJB 1B0FA 2FOHA 4UD9H 3EQ0H 2ZA5A 2ZU1A 1SLWB 5EGMA 2FWWA 2OCVB 3E0NB 1MU8B 1UVOA 3SGQE 3ZZ7A 1W14U 4FVDA 2OBQA 1NRQH 1FIWA 1QIXB 1CHOG 1THSH 3A80A 2UUJB 1L1NA 3FAOA 4MTBA 3TNSA 1P01A 1TNLA 1YGCH 1NFXA 3DFLA 5EODA 2PV9B 1KLTA 2KAIB 3KQDA 4ABIA 4TPYA 1A0JA 3M5OA 4NWLA 3E1XB 1GCTC 3SU1A 1MD8A 1HXEH 2I6SA 1EKBB 1O2VA 2J9NA 1T8NA 4HGCA 5FCRA 3LU9B 1C1PA 2AS9A 4BAHB 4BXWA 1AMHA 5ABWA 1C2HA 1LQEA 2TGAA 3M3VA 1ZJKA 2F9UA 1GMHG 4KP0A 3E91A 4WH8A 4OS7A 3MH5A 3U98H 2PHBA 2W7UA 5HYOA 4YOIA 1VCQA 1FIZA 1SGQE 3AAUA 1MCTA 3E0PB 3NWUA 5L2YH 2TRMA 5DP4A 4NSVA 4FU9A 4ABBA 1RS0A 1SGFG 1KXEA 1DLKB 1UJ1A 2BVRH 4Y8ZA 1TFXA 1A5IA 1ZSLA 2ILNA 2SGEE 1NRPH 1BTHH 1O2IA 4TPIZ 1UTJA 1O2WA 3PYHA 3ZVFA 3H7TA 3KIDU 4AGJA 1FJSA 1O3IA 3R0FA 4UFEH 4I7YH 3IITA 1HJ9A 1P10A 2Y5HA 1G37A 7ESTE 2AERH 1AFQB 4X1QU 1Q2WA 2CJIA 1EUFA 4NWKA 5GDSH 1N6YA 2Z9IA 2VH0A 3GCHC 1YLDA 1ESTA 4BAQB 1CSOE 2J2UA 1BITA 1SGIB 2A4QA 1TX6A 2BY5X 2J95A 2B0FA 2XWAA 5JB9S 1L4DA 3ENSB 3F9GA 3LH3A 1A3EH 3F9HA 3MTYA 2XW9A 1GJ9B 2ZCHP 2I6QA 1MAXA 1ESAA 4PROA 1B7XB 3GY7A 1CU1A 3SORA 4AX9H 1AB9C 4DIHH 1S82A 4NSYA 4ABFA 1O3CA 2W7SA 2J92A 1V2ST 6GCHF 1IAUA 3DA9B 3ZVDA 1OWDA 1GWAA 1TMTH 3RM2H 1V2QT 4I8JA 3O8BA 7KMEH 4ABGA 1RIWC 5C1YA 1AUJA 1QHRB 3VEQB 2FXRA 3EA9A 2ZGHA 5EW1H 3SNDA 1GGDC 2ZZUH 1VITF 2V0BA 1KDQA 1K1MA 2DE8A 4FUGA 3RXSA 1KTTB 4ABEA 1D6RA 1KXFA 3VPKA 1K28D 1CA0B 2HNTF 1Z8GA 4Q7XA 4B74A 2BVXH 3BTEE 3L6PA 3RXBA 1OKXA 4WMFA 3UIRA 3SU0A 4K8BA 4H4FA 2QY0B 4ZHAA 2GTBA 3ZZ5A 1WQSA 5HM9A 1MD7A 2W5EA 4IC6A 4CHAB 3QGJA 1D3QB 3HK3B 3BEUA 2VGCC 4YTAA 1KYNA 3PMBB 1AI8H 3QZRA 1SGDE 1UTNA
chains in the Genus database with same CATH superfamily
3A8CA 1GBJA 3SNCA 1AVGH 2FOFA 1EXFA 2FO9A 2FYRA 2ZWLH 3M5MA 3F2FA 1S5SA 4GHTA 3RC5A 4UEHH 1K1JA 4I86A 3GY6A 1KY9A 4E06H 5A8ZA 5K0HA 1C1WH 1FDPA 3GYLB 1FZZA 2VIQA 3TH3H 2B7DH 3ZZ3A 2RDLA 4NIYA 3ZV9A 2HLCA 1GDQA 4TYDA 4Z6AH 1E1QD 4FUHA 2FS9A 2A4GA 3SU5A 3MO9A 2BDGA 1GMCG 1P06A 2CV3A 5EQRA 5EXNA 1Y8TA 1X7AC 1AE5A 3VB7A 1P2JA 2ZHWH 1ETRH 1UCYH 1C5SA 5EJ1A 1TBRH 1FAKH 4XD7D 4YLQH 1IQIA 1C5VA 1EP5A 4ZKSU 4B75A 1BJUA 2ZGCA 1O3AA 3MNCA 2H6MA 2D2DA 5EQQA 6ESTA 2H2ZA 1G32B 1PYTC 1YPMH 1GJ7B 5DK1A 2XC5A 1HAYB 3SN8A 2B5TB 5TCAA 1GI4A 4FUCA 2AIPA 3Q3KA 1FPHH 3BTME 5LPRA 2KAIA 3LOXA 1SGTA 2GCTC 3BTGE 3ZVBA 2LELA 1OPHB 1TX8A 5E0GA 3F1SB 1CGJE 4YOGA 5SGAE 3P6ZB 5DSFA 1CT4E 1CT2E 1KXAA 5L2ZH 5EG4A 1YCPH 3T29A 2K8IA 2ODQA 4FUFA 3A7WA 1D4PB 1C5YB 6GCHG 5E0JA 2ZGXH 1ZOMA 1YYY1 1EB1H 1O2SA 5T1VA 2CGAA 4AC9A 1NY22 1AE8H 4VGCC 5GNDA 2XXLA 2OC1A 3P17H 1TNGA 5GIBA 1GBHA 3RU4E 2YOLA 3ZZBA 1CGHA 1ZTKA 1ZMJA 2BZAA 1VITG 1FY8E 8GCHG 1RRKA 1IQJA 1T4UH 3Q76A 1TOCB 2BY6X 3EDXB 1QB1A 1BMFD 1ZGVA 4JZIA 2RA3A 3VB6A 1SGEE 4FOUC 3A83A 2XWBI 1L1JA 1Y3WA 2GZ8A 2O8MA 2GT8A 2QXJA 1F0SA 3P8NA 4MPWA 2A5AA 2RG3A 3RC4A 1K1NA 2G4UA 4DOQA 4NA7A 1GI9B 3ELAH 2IN2A 1NBMD 4E7RG 3PLBA 3UOUA 4X1PU 1AO5A 2BQ6B 2QN5T 5I46H 2PP6A 2C8YB 5EPYA 3RMNH 4A1VA 1BBRE 1VCPA 2VH6A 2BDAA 3PTBA 5I25A 3Q3YA 2RDEA 3PWCA 2W6JD 1OYQA 3KYFA 1AUTC 4YO9A 5AVDA 3EE0B 2PTNA 4IN2A 3RMLH 2PKSB 2A2QH 1FV9A 1KMHB 3GCHB 3UOPA 3BEFB 2QIQA 2WPKS 4ZKNU 3BTQE 2C90B 3RM0H 3LGWA 2F91A 2R0LA 2V3OH 3MU0A 2JKHA 3M7UA 1O3FA 4WXVA 1ZMLA 1XKBC 2XTTB 3QO6A 3V3MA 1GDUA 2SFAA 1Y3YA 5FHTA 1T8OA 4WWYA 1XUIA 1ELAA 3F0PA 4ASUD 2ZDVH 4XOJA 1K2I1 5F8TA 2Z9KA 3V0XA 5DP9A 3JZ2B 3ZVAA 4DW2U 1TRNA 1GBLA 1Z7KA 2O8UA 3RU4T 3BTFE 4B73A 3ZVGA 2PW8H 3AVZA 1RD3B 4NIWA 4JYVH 3TJOA 1TBQH 2FP7B 1C5NH 5TCCA 3W1EA 4AG2A 2TPIZ 2JJ1D 3MNSA 3W95A 4OS6A 4JYTA 1EJAA 1O2NA 1QBOA 3ZZ6A 2TGDA 2FOAA 1BTZA 1AU8A 1MH0A 4ISLA 2PGBB 2Q6GA 2WPDD 3AW0A 1WUNH 1GGDB 1NRRH 1DWDH 1E36B 2BDBA 2ZTZA 1INCA 3PV4A 5JB8S 2ANYA 2ZDMA 1SMFE 2A7JA 5EW2H 2IJOB 2GV6A 1O3JA 1ETSH 2TIOA 3R3GB 1TOMH 1UTMA 3OU0A 1DT2A 2AIQA 2CHAB 3PMAB 4SGAE 1HAVB 1S6LA 2FS8A 1NPMA 2UWLA 1OP2A 1D3PB 4YT6H 2GJGA 3VXEH 3KQBA 4MNYA 5TJXA 3U8TH 1SGYE 2VGCB 3A81A 5JDUB 2H5CA 5DP7A 2ZPRA 3MO6A 2BX4A 4GPGA 3RDZA 3TGJE 1YLNA 2AYWA 1HBTH 4F4OC 2FYQA 2FESH 4Y7BA 3TPIZ 2FOBA 2H9TH 3SJ8A 1EAIA 1QRXA 2ZDKA 1VZQH 2HRVA 3SOSA 2KCAA 3TH4H 1P2QA 1FI8A 7GCHF 4FUBA 5EXMA 1PQ5A 4IBLH 1O2TA 1H4WA 2C8ZB 3PMJA 3U1JB 1O3EA 1QB9A 2K1QA 2AGEX 2XBWA 3LC5A 3MOCA 4FXGH 2WV5A 4MNXA 1C1NA 3N7OA 4D8NA 1FY4A 1DUAA 2GKVE 3F3BA 3SUGA 1NS3A 5C0UA 1KXBA 3MU4A 3QN7A 1D3DB 1JMOH 2NWNA 2WYJA 1GI5A 1GJ4H 1NESE 2XC0A 3FZZA 1NFUA 2M2AA 1CA0C 1QL8A 1O5FH 4X6OA 1W7XH 1TRYA 2ZG0H 1GJ5H 1QCPA 2GCHF 1GJBB 3MH4A 1LDTT 3K6ZA 4DJZB 1EP6A 1IHSH 1MBMA 4CHAC 3TGKE 1O0DH 2Y6TA 2GVFA 3G01A 1CQQA 4X6NA 1O2PA 3M5LA 1OWEA 3MQKC 1ZHMA 3HPTB 2FOGA 1C1TA 1DICA 4CBNA 1PPBH 5FBIA 4UFDH 3A8AA 1AWHB 1O32A 5DP6A 2YMSB 2OTVA 2ZC9H 2XOKD 1C1OA 1P9SA 2BY8X 3FO8D 2FM2A 2XYAA 1Y3UA 1P57B 1EPTB 1FX0B 3UY9A 2JJ2D 3NRLA 2BD5A 3UWIA 1RXPA 2ZPQA 3M3TA 3ATWA 3UPEA 3S69A 1WDIA 3SYJA 1SKYE 5J4QA 4ZHLU 1O5BB 2K0QA 2ZHDA 2H5DA 4KTSA 1ZPCA 1UO6A 3PV2A 5IDKA 4X1SU 3CS7A 1SLXB 2W26A 1SR5C 4Y10E 3A89A 3SUDA 2HVXA 1SGNE 1Z1IA 2THFB 1T8LA 5C3NA 1C2MA 2ZDLA 2OK5A 1ARBA 1O3MA 1Z6EA 3UUZA 2J38A 1ORFA 1S0QA 4OM9A 4B2BA 1C5RA 3WWFA 1C5ZB 2ZI2H 2STBE 2D1JA 1YBWA 1V2UT 1Y5AT 2HPQH 2UUYA 3H5CB 2OC8A 1P12E 5H4IB 4ABAA 4K2YA 1GBCA 2ANWA 4E05H 5LGOA 1BMLA 3MWIU 1FY3A 4GLYA 1SGFA 3U28C 1ID5H 1G2LA 3GS9A 1GI0A 3RP2A 2VWMA 2PWXA 1DS2E 1H8IH 3GCTF 1TB6H 1G3BA 2NU1E 1PFXC 2D26C 3A82A 4MPUA 1XUGA 4MVNA 2QF5A 1P3EA 7GCHG 5ESTE 2SNWA 1SGRE 3LKWA 3PV5A 1SGPE 2SNVA 3SU2A 5LPFA 1E35B 4I31A 4WH6A 4NCYA 4UONA 1QZ8A 3PM3A 4FETA 4B76A 5K7RA 4BNRA 3A88A 4A7IB 1J16A 1KIGH 1O5AB 1WAYB 2BDCA 3MHWU 1C4Y2 3LJJA 1BRUP 2PUXB 1V2VT 5EQSA 1NRSH 2QF3A 3RXDA 1SHHB 4ISOA 1BA8B 1OYTH 2CK3D 3MMGA 3SV7A 1BIOA 4NZLA 1HAVA 4GCHG 2BM2A 3MYWA 5CE1A 1DY9A 1ELTA 3UAIC 4YT7H 1OS8A 2GCHG 1FY5A 2QXIA 4Q7YA 3RXTA 1GBDA 1SB1H 1TPOA 4NGAH 4CR9A 3K2UA 2ZFQH 2SGPE 2EEKA 5CDFE 4IMZA 4AB8A 1W13U 4UFGH 2OBOA 4KTCA 1O3DA 1JRTA 2AH4X 1XUFA 1LPKB 4WF8A 3F0OA 9LPRA 2PUQH 3CS0A 3SJ9A 4AFSA 3A86A 1TRMA 1UTKA 3U1IB 1CHGA 5CHAC 1YCPK 2FTLE 1LHGH 3VFEA 1FAXA 1THRH 2NU3E 1HV7A 3KCGH 3LDXH 3M37A 1NT1A 3K65B 1O2QA 3M7QA 4XBDA 3DFJA 4R8TB 1HB0B 2HALA 1THPB 3KQCA 5FBEA 4FU8A 1C2EA 3SUFA 2PKSC 3QTVH 2H9EH 2RCEA 2O8TA 4JZEH 4Y8XA 2ASUB 3MU8A 4KELA 2ZQ2A 3Q77A 3TITA 4Q63A 3SQEE 1GDNA 4DGJA 5F53A 2GT7A 4B6EA 4JZ1A 4MLFB 3BSQA 1XMNB 1F0UA 1S6FA 2J94A 3M35A 1WOFA 2OQ5A 1W0YH 1P2NA 1RTKA 1JOUB 2FZZA 2BY7X 3VXFH 1WV7H 3OY5U 2L74A 3SU4A 1GHZA 2ZFPH 3VB5A 4I8KA 3QZQA 2FI5E 2DE9A 2FX4A 2SGAA 4HFPB 3OFND 4OGXA 1K21H 3FP6E 3M7TA 3RXKA 2WUCA 1TGBA 3KYGA 1HLTH 2WINI 4H6TA 5HM2A 1Z71A 3U9AH 4B6FA 1LHFH 1GBEA 3PB1E 3GCNA 1C5XB 1O3KA 1A5GH 3UB0A 3I78A 4D9RA 5DG6A 3VG8A 1IQLA 2P3FH 3EA7A 4B2AA 4SGBE 1C2IA 1ZHRA 1GBAA 3SZNA 4QT8C 2R2MB 1WXRA 2CHAC 1EPTA 4IC5A 2ZTYA 3RXGA 4NFFA 4OS4A 1ABIH 3A7ZA 1W0ZU 2L6OA 3UTUH 1A0LA 3LJOA 3AASA 2C3SA 1TPSA 3ATMA 3UNQA 4LOYH 2VIDA 1XM1A 1ELVA 2Z9GA 2ZNKH 1Y5UT 1HFDA 2G5NA 1V2MT 1GJDB 1F0RA 1UTLM 4K69A 1JRSA 4Y76A 4X2YA 1LHEH 1A2CH 1J14A 3OY6U 1BQYA 1W8BH 3S0NA 4IW4E 3DSPA 1QL9A 5EIYA 2JH0D 1GHWH 3HK6B 5C20A 1DLEA 4LZ1H 4X2VA 2VIWA 5A0BA 1EOLA 4R0IA 1T7CA 4IS5A 1DY8A 1FN6A 3TLOA 3E3TA 1MZAA 1QTFA 1AY6H 1SQRA 3E16B 1BDAA 2EY4C 1GBMA 3T27A 1EQ9A 1H9LB 1ZMNA 4CH8B 2EI8A 4LZ4B 1TGTA 1GHVH 1UW7A 2BMGB 1BJVA 2Z3DA 1WTHD 2JH6D 3NZIA 1O2YA 1BMMH 2QA9E 1HUTH 1MKXH 1WYKA 1TWXB 4ZHMU 2FX6A 3U8RH 3LPRA 1UVUH 5EXLA 3ZZ8A 1TGSZ 1ZHPA 4AZ2B 1H8HD 1EB2A 2BHGA 3V13A 5DP3A 1GHAF 4U32A 1GBKA 5AFZH 3TH2H 3GY4A 1T31A 4I8GA 2CXVA 3RXIA 4AORA 3DHKH 1P02A 1C2DA 1Q3XA 2FDAA 2HPPH 1YC0A 1O2MA 3FP7E 1O3OA 1A7SA 2KCPA 4Y11E 1TPAE 5E2PA 3ZIAD 5C5NA 1O35A 4Z0KA 3KHVA 4U01A 2F9NA 4FUJA 4CRAA 2NU4E 4UE7H 1NC6A 3PO1B 2FI4E 1P3CA 1PPCE 1A3BH 4BTUB 2OXSA 1QJ1B 3LIWA 2R2WU 4INLA 2DUCA 1BRBE 1XXDA 1QR3E 2YMSC 1SGCA 4KTUA 1BZXE 2A7HA 4YOJA 3SU6A 4DVAU 4XSKU 1EPTC 2BXTH 4X8VH 2G55A 2G4TA 1C1UH 3RXRA 2HVYB 1MTWA 1C2FA 4I32A 4GAWA 1A61H 1EZXC 2BLOA 1BTPA 5EJLA 1G2MA 2VNTA 2HNTE 1EFRD 2F9OA 2BYAX 5HIZA 1MQ6A 1FY1A 3SNAA 2H9HA 3GDUA 5C1UA 4Y71A 3D62A 1BHXF 1NZQH 4H42U 2BD8A 1JBUH 3KN2A 2XC4A 5DN6D 3URDA 3MU1A 4OS1A 1W10U 2QYIA 1LKAA 4ABDA 3RXMA 2A0QB 1C1SA 2WZQA 3SV9A 3F68H 3NXPA 4WJG2 2UUFB 3B9FH 5KEDA 1K1LA 1MBQA 1S0RA 1B0EA 2ZECA 2QE7D 3B23B 3SJIA 1QB6A 1HYLA 1J9CH 1GG6C 1Y3VA 2BB4A 3T5FH 5A8XA 3NCLA 5A2MH 3T62A 1XVOA 1TPPA 4CH2B 4YM9A 1WU1A 2LPRA 2JH5D 1LQDB 5HGGA 1N8OC 5CHAB 1GVKB 3ATKA 4BAKB 1Z8RA 1C4V2 1ZSJA 4AGKA 4CREA 4ZKOU 4Y0YE 1GI2A 1PPHE 2FTMA 4IGDA 1PJPA 4HG6A 4M7GA 2AFQB 5HKKD 1YLCA 5DP8A 1OWKA 1GHXH 1WSSH 2UUKB 2ZO3H 2ALPA 2WV4A 1YCPM 3F2GA 4Q2KA 1TGNA 1MTSA 3A8DA 3RXCA 1O2JA 1TX7A 2XCNA 2HNTC 1K0HA 1G9IE 1F2SE 4X6MA 1A46H 2VU8E 1O5EH 3GYMA 1HIAA 4MDSA 4KKDA 1O2XA 2G51A 3OYPA 2FPZA 2ZU5A 2RFKC 1LVMA 1PPFE 1SC8U 5AHGH 4J2YB 5GPIB 1EZUC 3D49H 2W3IA 1NU9A 3ZZ9A 1TNHA 1QURH 2ZPSA 3QTOH 5PTPA 2GMTB 4INHA 4JYUH 1QBVH 2SGQE 4A5TS 1C1QA 1QBNA 4MNWA 1EAWA 2VIOA 1FPCH 2ZP0H 4X8SH 4JZFH 4OS5A 3F9EA 6LPRA 3TU7H 1O3HA 1E37B 3ZVEA 2H1UA 2OC0A 4LK4A 5E2OA 3Q00A 2BQ7B 2Q6FA 1ARCA 1GJ6A 2BOHB 2FLBH 1YPEH 4E7NA 3LGTA 3SQHE 2A4OA 3L33A 2HLDD 2V3MA 4AB9A 4AFZA 1ZRBA 1C1MA 1UHBB 3P70B 3JZ1B 2CF8H 1HAIH 1LHDH 3RXHA 1D9IA 1DM4B 1QJ6B 3HKIB 2GGVB 2KCYA 3UREA 2XCFA 5IYTA 2WV9A 4ZUHA 2ZCLP 4YLUA 4B1TA 3AK5A 1FONA 4DCDA 1TNJA 2F3CE 4UFFH 4A1XA 3I77A 5A0AE 1DDJA 3RXLA 1IQEA 8LPRA 1DOJA 3BIVH 2KM0A 4B2CA 1VCWA 1V2WT 2UWOA 1AHTH 1TGCA 1VJ9U 3PLPA 1BTWA 1E1RD 1K1IA 1O2RA 1Y5BT 4I33A 5T6DA 3UR9A 3F2HA 4ZXXH 3BTDE 1RTLA 1NM6A 2O8WA 4O3TA 1WCZA 1AIXH 4RKJB 4TT3D 2VINA 2ZDAH 1C2KA 1LCYA 4DURA 1YPHE 4RSPA 3FVFB 1PPGE 2PGQB 3PRDA 1XUKA 2QC2A 3FZDA 2SGDE 1GVZA 3DCLA 1C1VH 2CMYA 2QGRA 1KTSB 1O5GH 3BIUH 1IQGA 3LH1A 1VGCB 4IN1A 1CVWH 1GBTA 1O2LA 1DSUA 1MCVA 2M5TA 2XNIA 3MNBA 2V6NA 4I8LA 4FUEA 1CA8B 4K1SA 4WVPE 2RA0A 4DT4A 1WQVH 3BG4B 1HAGE 1JIMA 5JPMH 4JK5A 1AN1E 4LXBH 1HAOH 5B6OA 3C27B 1UK4A 2A45B 2KX4A 2P3UB 2AMDA 1GPZA 1WBGB 3BTHE 4INKA 1DPOA 1K9OE 2VB0A 1ZYOA 1AZ8A 3QWCH 3GY8A 2BD4A 1OWJA 3PTNA 2Y80A 1A4WH 1XUJA 4K5ZA 1YPHC 3ODFA 1SFQB 2XBYA 3VGCB 1GI3A 4X2WA 4GSOA 1C5OH 2WPMS 1BTYA 1COWD 1P09A 1H1BA 2FOCA 1P9UA 2PSYA 2TGTA 4ISHH 4D7FA 3A85A 5A8YA 3ZV8A 2C93B 1CGIE 1GBIA 4O3UA 2CN0H 4CRBA 2J34A 1U6QA 2HWLB 2OUAA 1BBRH 3FN8A 1D3TB 1GBBA 2WUBA 2A31A 3UNSA 5LPEA 1BTUA 1DE7H 3SV8A 3MO3A 3H7OA 4ZH8A 1PQAA 5BRRE 4NG9H 2PR3A 1SHYA 1XKAC 3E8LA 3T28A 5C67A 2IPHA 3KEEA 2VVVA 1QY6A 1GG6B 2A4RA 1JXPA 2WSSD 5EOKA 2ZCKP 3TNTA 2BY9X 2JETB 4BANB 1XX9A 1O36A 1N8OB 3LGUA 2P3TB 1ELDE 2ZQ1A 1O5DH 3OEED 4RT1A 1BMAA 2FODA 5C5OA 4DY7B 2VVUA 1SQTA 3NUMA 3V7TA 1UK2A 1C1RA 2EI7A 2TBSA 1WTGH 2A2XH 3NKKA 2AEIH 1QQ4A 1MTUA 3A7XA 3L3TA 3FKSD 5FAHA 4M9FA 1FUJA 3AW1A 3C1KA 3PO1C 2XBXA 4XE4A 4XRNA 4ZCNA 1KLIH 1OSSA 2Y82A 1C5MD 1HJAB 3BN9A 1NFWA 4Z1MD 2GDEH 5FX5A 4O97A 3TK5A 1C5LH 3TGIE 2KFWA 3GDVA 3OSYA 3ZYDA 2J98A 2AMPA 1DXPA 1TYNA 1EAUA 3DSOA 5G4BA 4MG3A 1GI7B 1O5CB 3UQVA 2BZ6H 1MKXK 1TABE 1QRWA 4TWWA 2F43B 1TA2A 3OAAD 4FUDA 1O2GH 1S85A 4AFQA 1JIRA 1UCYE 1FN8A 2ZGBH 1J8AA 1SI5H 3TK6A 1UCYK 2ZTXA 1G30B 5T3HA 1UHBA 1O33A 1S83A 2A5IA 2W3KA 2ZFRH 5F8XA 1SBWA 1O2ZA 1V2OT 3K6YA 4ZXYH 5KGOA 4Y7AA 1ELFA 1ANBA 1DX5M 1ZTJA 3NK8A 4ISIH 4MQAA 2BLWA 2Y7XA 1UK3A 1HXFH 3GOVB 3ZZAA 3BV9B 3MH6A 1MKWH 2GV7A 2GDDA 3SW2B 1XXFA 5DO4H 5FPTA 3EGKH 3GICB 1GMDF 5C17A 3RC6A 2GZ7A 3U8OH 1PPEE 1VKYA 3OTJE 1E0FD 1O39A 2P93A 1GJAB 1TA6A 3B8JA 3BTKE 2FI3E 1W0KD 4FVBA 1YF4A 4JK6A 1L1GA 3RXUA 4TY7A 2OLGA 3RXAA 5C1XA 5ESBA 5F6MA 2VBCA 1S81A 1O2HA 1MMJN 1K1PA 1TBZH 2XBVA 2Y5GA 3SZEA 4NZQA 2ODPA 1H8DH 3D23A 4OGYA 1EOJA 1GMCF 1SG8B 3VB3A 1T4VH 1NBME 3H09A 3PROA 2Z6BD 2ZU3A 1H9HE 1LVYA 2AHME 1HJ8A 2O8LA 3LONA 3HGPA 4X1NU 1J15A 2BD2A 2BLVA 4JZDH 3ITIA 2J97A 2Q6DA 1P2IA 1AD8H 3EYDA 3TJNA 5JBTA 1DITH 2GMTC 3SV6A 3GCOA 1C2LA 1OOKB 2GP9B 5A0CA 2ANMH 2QF0A 4CRDA 5F8ZA 1O37A 1HIAB 3SGBE 1P2KA 2LNCA 3ATLA 3P8GA 1A1RA 2B8OH 3ZZCA 1TALA 4JCNA 1IQHA 3PWBA 1QRZA 1FQ3A 3S9AA 2ZU2A 5T6FA 3T25A 3GCTG 2P59A 1HAXB 2Y81A 4Q7ZA 3NPSA 1CT0E 1EASA 1CBWB 2V7QD 1BHXB 4D7GA 5F03A 4XBBA 2OP9A 1GI6A 1V2NT 1RGQA 1Z8IB 3MU5A 3DUXH 1D6WA 1YPJH 3KNXA 1E79D 1Q31A 1O2KA 3RXJA 1UMAH 2ZFSA 4GUXA 4BAMB 1SSXA 2WHXA 4X6PA 1GL1A 5FXLA 3SI3H 1GJ8B 1ABJH 1W12U 2F9BH 1ANCA 1NROH 8KME2 1Z6JH 1N1LA 3EAJA 4RKOB 1ZLRA 1SQAA 1F0TA 4BTIB 4MNVA 1QNJA 8GCHF 1KSNA 3RXPA 2OD3B 1ZJDA 2V3HH 3T2NA 1O2OA 2YNBA 4AYYB 3OE7D 2ZEBA 3SNEA 1C2GA 1QL7A 1UTOA 1O34A 2ZHEH 4BAOB 1S6HA 1ANEA 1TAWA 1TNIA 1UVSH 2AGIX 3PLKA 1P03A 3SUEA 3IG6B 4CRFA 3BF6H 3RXVA 3WW7A 4HTCH 2QF4A 1VR1H 1M9UA 1LKBA 1IQKA 3SBKA 3QUMP 3RMOH 2BD3A 1IOEA 4GVUA 4Y79A 5E0HA 3S9BA 1C5UA 2AGGX 3DD2H 2BDYA 1SL3A 4UDWH 5GWZA 1V2RT 1GMDG 2KZ4A 3N7DA 2ZF0H 4ISNA 4FU7A 3RMMH 1ACBE 1O2UA 2LP6A 1ETTH 3MH7A 2ZU4A 3SJOA 1TMUH 5C94A 2BX3A 6CHAB 4A6LA 2P95A 3F6UH 1LVBA 2R3UA 3A7TA 2R9PA 4O03A 1VGCC 5J4SA 4YZUA 1YWUA 1ELGA 2VWOA 2G52A 4K60A 3UWJH 1AWFH 5EJZA 5FCKA 1TQ0B 1HAHH 1YPLH 1ZZZA 2D8WA 1CO7E 1V2JT 1W3CA 2P16A 4K8YA 5ETXA 5T6GA 3BG4C 1ZRKA 1XVMA 1PQ7A 2P8OB 2QXHA 4D76A 1E38B 3M3SA 3RUOA 1NU7B 1SOTA 1P0SH 4XFQA 4K1TA 2G81E 4A1TA 3BEIB 3CNRA 4YESB 1PPZA 3RXOA 1IQNA 3KL6A 1MTVA 1DUEA 5GXPA 5FPYA 1HGTH 3SV2H 4XBCA 1K22H 3CP7A 1YY3A 1MU6B 2ODYB 1N6XA 4ZMAH 1ANDA 1L0ZA 1HPGA 4F55A 2QV1A 1MQ5A 2G00A 1W2KH 3A7VA 2ZGJA 3QX5H 2ANKH 1VJAU 2Z94A 3F9FA 1C4U2 7LPRA 1AKSB 1ELCA 1T8MA 2OINA 4A92A 1P2MA 3VGCC 1EX3A 1F5LA 1NO9H 3BTTE 1O3GA 2FEQH 1GVLA 1AQ7A 1V2PT 4MPXA 1BOQA 1EJMA 3VB4A 1G3DA 4ACBA 1FXYA 1CE5A 2GX4A 1YPGH 2Z7FE 1YPKH 3M61U 3QK1A 3LT3A 1SPJA 4CRGA 1RTFB 1AVXA 1C9PA 3U69H 1DWBH 1GBFA 2QCYA 1QA7A 2KCOA 2PKAB 2A32A 3FANA 1NRNH 3BTWE 1GCTB 3URCA 2P94A 1ZPZA 4HI3A 3PMHB 1KXCA 2FLRH 1SOZA 4CR5A 5A09A 2YNAA 2Y5FA 4ESTE 4I8HA 3ODDA 1HDTH 2PLXA 4DT7B 4ZROA 3P92A 4CBOA 3GY2A 1W7GH 1TLDA 2R0KA 2F9VA 1DFPA 4FUIA 3ZZ4A 2VJ1A 2TGPZ 2JETC 3ZZDA 1KXDA 3SO3A 1LMWB 1OXGA 2NU0E 5JYIA 2ESTE 5DP5A 1BUIA 5BPEA 3MFJA 1HRTH 4WMEA 1MTNC 1F7ZA 3MNXA 3O8RA 1EJNA 1LHCH 5C2ZA 4NFEA 1ZGIA 3UFAA 3IWMA 4KGAA 1UVTH 2J5UA 1V6DA 2UWPA 1ZSKA 1O3BA 3P8OA 3ZYEA 3P8FA 1GHYH 5EU8A 1TQ7B 2ZHQH 2ZHFH 4X8UH 4Y0ZE 4WXIA 2BD9A 4AOQA 2STAE 3S7KB 4Q80A 1HJAC 4O9VA 2BQWB 1HCGA 1ZTLA 1BBRK 2ULLA 4F49A 3SI4H 1DWEH 1OP8A 4DIIH 1EATA 1W0JD 3HATH 4THNH 1QA0A 4RI0A 1OWHA 1TIOA 2HGTH 1EZQA 4X0WU 3SHCH 2C8XB 5JBBS 3RLWH 3D65E 2PFEA 2VWLA 4JMYA 1IHTH 3M36A 3QLPH 1DSTA 1SFIA 1GHAG 2NU2E 1RJXB 1V2LT 1GJCB 4U30A 1C5PA 1GI1A 3OX7U 4GHQA 3HKJB 1IQFA 4IMQA 3LGVA 4AN7A 1AGJA 4BXSA 1NFYA 2J98B 1UTPA 3TJVA 3M5NA 5FPSA 3A87A 4OS2A 1ESBA 1AB9B 4WMDA 5DJ7A 2BDHA 1P11E 5HMAA 1EAXA 4K3JA 3RXEA 1T32A 3OEHD 4RN6A 4BOHA 3SHAH 2C8WB 2EQNA 1OP0A 1XUHA 3A8BA 1TONA 3GISB 2O9QA 2FIRH 3A7YA 1V2TT 1J17T 1GI8B 2Z9LA 3LGYA 1BRAA 3KQ5A 2BOKA 5GCHF 1RIWB 1HNEE 1LPGB 1OWIA 1BRCE 1GHBF 4X2XA 3EA8A 4XDEA 1O38A 5GJ4B 1TNKA 1PYTD 2ZFTA 2BDIA 1BMNH 3FP8E 3SU3A 1G3CA 1SLUB 2BXUH 2F83A 3RXFA 1UTQA 2F4LA 4NIXA 3I29A 1DANH 1YP9A 1C5QA 5EPNA 2GZ9A 2B9LA 1S84A 3UQOA 1O31A 3LGIA 5LH8A 2G8TA 1RFNA 3A84A 1QJ7B 2F9PA 3Q3XA 1BTXA 3GY3A 4NA9H 5FL7D 1O3NA 2SGFE 5JBAS 1AFQC 1G36A 1MAYA 5L6NH 2A5KA 1PQ8A 1YM0A 4NA8A 2YMSD 1DWCH 2Z9JA 2ZFFH 3K9XB 4TWYA 3FOAA 2A1DB 4Y8YA 1SVPA 3CENA 1MKWK 2C4FH 1C5WB 1P8VC 3S9CA 3MI4A 1GL0E 5B6LA 2G5VA 1LTOA 4ZKRU 2IOTA 4ASHA 1C2JA 1LO6A 1SQOA 4WY3A 3W94A 1Y59T 3QDZB 3ATIA 1LVOA 1CHOF 1CBWC 2WPJS 5AF9H 4X8TH 3STIA 3E6PH 1BB0B 1DVAH 2ZKSA 1MUEB 3P95A 2Z3EA 1P2OA 1AKSA 1OHHD 3QGNB 1VITH 1H9IE 1UVPA 1YKTA 4D9QA 5HXFA 2Q1JA 3T26A 3TIUA 3KGPA 1F5KU 4ACAA 3SNBA 3O8CA 3AAVA 1AFEH 2W6ID 4F48B 1MZDA 4AYVB 5DGJA 4ABJA 5FX6A 2V35A 1GMHF 1DXWA 1BCUH 1ZR0A 4GCHF 5L30H 1P04A 4TY6A 2GD4B 4NIVA 2PKAA 5DPAA 1EZSC 2OQUA 3SJKA 2GCTB 3UNRA 3STJA 2PTCE 1O3PB 4X1RU 1BT7A 1O30A 5AFYH 1Y3XA 3GDSA 8ESTE 1AVWA 3RU4D 2BLQA 3WY8A 3DT0H 4AG1A 4BTTB 1C5TA 5E8EH 4H6SB 1KDQB 1AZZA 1TE0A 2VIVA 1NTPA 2WPLS 1G3EA 4B71A 2VIPA 2CF9H 4ZAEA 2BTCE 2XRCA 4J1YA 3LC3A 1K1OA 2FOMB 1HAPH 2QXGA 1Z8JB 3KQEA 3TJUA 3KF2A 1L2EA 4P02A 1QFKH 4MPVA 1V3XA 1F5RA 2FOEA 5GCHG 2EA3A 4VGCB 3O8DA 1GHBG 3E90B 4HZHA 4TSFD 2HOBA 2R3YA 6CHAC 3BG8A 2BVSH 1Z1JA 3RLYH 4AFUA 3ZVCA 5JBCS 3GY5A 2ZIQH 2OC7A 4RT0A 4Y6DA 2ALVA 1LPZB 1HAZB 1W11U 1OX1A 2ZDNA 3EE7A 1NN6A 2FMJA 1E34B 1FLEE 2WYGA 2EC9H 3TK9A 1MTNB 1JWTA 2BD7A 1C9TA 1F92A 1TMBH 4CRCA 4YXWD 2WPHS 2AMQA 3SGAE 3UR6A 2P8OC 3V12A 1FNIA 4Q4LA 1P05A 2Z3CA 1IQMA 9ESTA 2EI6A 1A0HB 2WPIS 5CMXH 1QGFA 2Y7ZA 1ZPBA 4K1EA 1ELBA 1KLJH 3RXQA 2VWNA 1ELEE 3S7HB 2A7CA 3FFGA 4U2WA 3ESTA 5DKMA 1FMGA 1L4ZA 3HGNA 1V2KT 2IJD1 2J4IA 1GCDA 2VVCA 2QAAA 4DG4A 1B5GH 2XNDD 1A5HA 2PSXA 1O3LA 5HIYA 1SLVB 1QQUA 4ABHA 3TVJB 1B0FA 2FOHA 4UD9H 3EQ0H 2ZA5A 2ZU1A 1SLWB 5EGMA 2FWWA 2OCVB 3E0NB 5C0TA 1MU8B 1UVOA 3SGQE 3ZZ7A 1W14U 4FVDA 2OBQA 1NRQH 1FIWA 1QIXB 1CHOG 1THSH 3A80A 2UUJB 1L1NA 3FAOA 4MTBA 3TNSA 1P01A 1TNLA 1YGCH 5CHBA 1NFXA 3DFLA 5EODA 2PV9B 1KLTA 2KAIB 3KQDA 4ABIA 4TPYA 1A0JA 3M5OA 4NWLA 3E1XB 1GCTC 3SU1A 1MD8A 1HXEH 2I6SA 1EKBB 1O2VA 3N99A 2J9NA 1T8NA 4HGCA 5FCRA 3LU9B 1C1PA 2AS9A 4BAHB 4BXWA 1AMHA 5ABWA 1C2HA 1LQEA 2TGAA 3M3VA 1ZJKA 2F9UA 1GMHG 4KP0A 3E91A 4WH8A 4OS7A 3MH5A 3U98H 2PHBA 2W7UA 5HYOA 4YOIA 1H8ED 1VCQA 1FIZA 1SGQE 3AAUA 1MCTA 3E0PB 3NWUA 5L2YH 2TRMA 5DP4A 4NSVA 4FU9A 4ABBA 1RS0A 1SGFG 2JDID 1KXEA 1DLKB 1UJ1A 2BVRH 2JIZD 4Y8ZA 1TFXA 1A5IA 1ZSLA 2ILNA 2SGEE 1NRPH 1BTHH 1O2IA 4TPIZ 1UTJA 1O2WA 3PYHA 3ZVFA 3H7TA 3KIDU 4AGJA 1FJSA 1O3IA 3R0FA 4UFEH 4I7YH 3IITA 1HJ9A 1P10A 2Y5HA 3PRBA 3WWBA 1G37A 7ESTE 2AERH 1AFQB 4X1QU 1Q2WA 2CJIA 1EUFA 4NWKA 5GDSH 1N6YA 2Z9IA 2VH0A 3GCHC 1YLDA 1ESTA 2KR7A 4BAQB 1CSOE 2J2UA 1BITA 1SGIB 2A4QA 5IK2D 1TX6A 2IPQX 2BY5X 2J95A 2B0FA 2XWAA 5JB9S 1L4DA 3ENSB 3F9GA 3LH3A 1A3EH 3OTPA 3F9HA 3MTYA 2XW9A 1GJ9B 2ZCHP 2I6QA 1MAXA 1ESAA 4PROA 1B7XB 3GY7A 1CU1A 3SORA 4AX9H 1AB9C 4DIHH 1S82A 4NSYA 4ABFA 1O3CA 2W7SA 4P00A 2J92A 1V2ST 6GCHF 1IAUA 3DA9B 3ZVDA 1OWDA 1GWAA 1TMTH 3RM2H 1V2QT 4I8JA 3O8BA 7KMEH 4ABGA 1RIWC 5C1YA 1AUJA 1QHRB 3VEQB 2FXRA 3EA9A 5KECA 2ZGHA 5EW1H 1MABB 3SNDA 1GGDC 2ZZUH 1VITF 2V0BA 1KDQA 1K1MA 2DE8A 4FUGA 3RXSA 1KTTB 4ABEA 1D6RA 3DSGA 1KXFA 3VPKA 1K28D 1CA0B 2HNTF 1Z8GA 4Q7XA 4B74A 2BVXH 3BTEE 3L6PA 3N7EA 3RXBA 1OKXA 4WMFA 3UIRA 3SU0A 4K8BA 4H4FA 2QY0B 4ZHAA 2GTBA 3ZZ5A 1WQSA 5HM9A 1MD7A 2W5EA 4IC6A 4CHAB 3QGJA 1D3QB 3HK3B 3BEUA 2VGCC 4YTAA 1KYNA 3PMBB 1AI8H 3QZRA 1SGDE 1UTNA
chains in the Genus database with same CATH topology
3A8CA 1GBJA 3SNCA 1AVGH 2FOFA 1EXFA 2FO9A 2FYRA 2ZWLH 3M5MA 1S5SA 4GHTA 3RC5A 4UEHH 1K1JA 3GY6A 1KY9A 4E06H 5A8ZA 5K0HA 1C1WH 1FDPA 3GYLB 1FZZA 2VIQA 3TH3H 2B7DH 3ZZ3A 2RDLA 4NIYA 3ZV9A 2HLCA 1GDQA 4TYDA 4Z6AH 4FUHA 2FS9A 2A4GA 3SU5A 3MO9A 2BDGA 1GMCG 1P06A 2CV3A 5EQRA 5EXNA 1Y8TA 1X7AC 1AE5A 3VB7A 1P2JA 2ZHWH 1ETRH 1UCYH 1C5SA 1TBRH 1FAKH 4YLQH 1IQIA 1C5VA 1EP5A 4ZKSU 4B75A 1BJUA 2ZGCA 1O3AA 3MNCA 2H6MA 2D2DA 5EQQA 6ESTA 2H2ZA 1G32B 1PYTC 1YPMH 1GJ7B 5DK1A 2XC5A 1HAYB 3SN8A 2B5TB 5TCAA 1GI4A 4FUCA 2AIPA 3Q3KA 1FPHH 3BTME 5LPRA 2KAIA 3LOXA 1SGTA 2GCTC 3BTGE 3ZVBA 1OPHB 1TX8A 5E0GA 3F1SB 1CGJE 4YOGA 5SGAE 3P6ZB 1CT4E 1CT2E 1KXAA 5L2ZH 5EG4A 1YCPH 3T29A 2ODQA 4FUFA 3A7WA 1D4PB 1C5YB 6GCHG 5E0JA 2ZGXH 1ZOMA 1YYY1 1EB1H 1O2SA 2CGAA 1NY22 1AE8H 4VGCC 2XXLA 2OC1A 3P17H 1TNGA 5GIBA 1GBHA 3RU4E 2YOLA 3ZZBA 1CGHA 1ZTKA 1ZMJA 2BZAA 1VITG 1FY8E 8GCHG 1RRKA 1IQJA 1T4UH 3Q76A 1TOCB 2BY6X 3EDXB 1QB1A 1ZGVA 4JZIA 2RA3A 3VB6A 1SGEE 3A83A 2XWBI 1L1JA 1Y3WA 2GZ8A 2O8MA 2GT8A 2QXJA 1F0SA 3P8NA 4MPWA 2A5AA 2RG3A 3RC4A 1K1NA 2G4UA 4DOQA 4NA7A 1GI9B 3ELAH 2IN2A 4E7RG 3PLBA 3UOUA 4X1PU 1AO5A 2BQ6B 2QN5T 5I46H 2C8YB 5EPYA 3RMNH 4A1VA 1BBRE 1VCPA 2VH6A 2BDAA 3PTBA 5I25A 3Q3YA 3PWCA 1OYQA 1AUTC 4YO9A 5AVDA 3EE0B 2PTNA 4IN2A 3RMLH 2PKSB 2A2QH 1FV9A 3GCHB 3UOPA 3BEFB 2QIQA 2WPKS 4ZKNU 3BTQE 2C90B 3RM0H 3LGWA 2F91A 2R0LA 2V3OH 3MU0A 2JKHA 3M7UA 1O3FA 4WXVA 1ZMLA 1XKBC 2XTTB 3QO6A 3V3MA 1GDUA 2SFAA 1Y3YA 5FHTA 1T8OA 4WWYA 1XUIA 1ELAA 2ZDVH 4XOJA 1K2I1 5F8TA 2Z9KA 3V0XA 5DP9A 3JZ2B 3ZVAA 4DW2U 1TRNA 1GBLA 1Z7KA 2O8UA 3RU4T 3BTFE 4B73A 3ZVGA 2PW8H 3AVZA 1RD3B 4NIWA 4JYVH 3TJOA 1TBQH 2FP7B 1C5NH 5TCCA 4AG2A 2TPIZ 3W95A 3MNSA 4OS6A 4JYTA 1EJAA 1O2NA 1QBOA 3ZZ6A 2TGDA 2FOAA 1BTZA 1AU8A 1MH0A 4ISLA 2PGBB 2Q6GA 3AW0A 1WUNH 1GGDB 1NRRH 1DWDH 1E36B 2BDBA 2ZTZA 1INCA 3PV4A 5JB8S 2ANYA 2ZDMA 1SMFE 2A7JA 5EW2H 2IJOB 2GV6A 1O3JA 1ETSH 2TIOA 3R3GB 1TOMH 1UTMA 3OU0A 1DT2A 2AIQA 2CHAB 3PMAB 4SGAE 1HAVB 2FS8A 1NPMA 2UWLA 1OP2A 1D3PB 4YT6H 3VXEH 3KQBA 4MNYA 5TJXA 3U8TH 1SGYE 2VGCB 3A81A 5JDUB 2H5CA 5DP7A 2ZPRA 3MO6A 2BX4A 4GPGA 3RDZA 3TGJE 2AYWA 1HBTH 4F4OC 2FYQA 2FESH 4Y7BA 3TPIZ 2FOBA 2H9TH 3SJ8A 1EAIA 1QRXA 2ZDKA 1VZQH 2HRVA 3SOSA 3TH4H 1P2QA 1FI8A 7GCHF 4FUBA 5EXMA 1PQ5A 4IBLH 1O2TA 1H4WA 2C8ZB 3PMJA 3U1JB 1O3EA 1QB9A 2K1QA 2AGEX 2XBWA 3LC5A 3MOCA 4FXGH 2WV5A 4MNXA 1C1NA 3N7OA 4D8NA 1FY4A 1DUAA 2GKVE 3SUGA 1NS3A 1KXBA 3MU4A 3QN7A 1D3DB 1JMOH 2NWNA 2WYJA 1GI5A 1GJ4H 1NESE 2XC0A 3FZZA 1NFUA 1CA0C 1QL8A 1O5FH 4X6OA 1W7XH 1TRYA 2ZG0H 1GJ5H 1QCPA 2GCHF 1GJBB 3MH4A 1LDTT 3K6ZA 4DJZB 1EP6A 1IHSH 1MBMA 4CHAC 3TGKE 1O0DH 2Y6TA 2GVFA 3G01A 1CQQA 4X6NA 1O2PA 3M5LA 1OWEA 1ZHMA 3HPTB 2FOGA 1C1TA 1DICA 4CBNA 1PPBH 5FBIA 4UFDH 3A8AA 1AWHB 1O32A 5DP6A 2OTVA 2ZC9H 1C1OA 1P9SA 2BY8X 2FM2A 2XYAA 1Y3UA 1P57B 1EPTB 3UY9A 3UWIA 2BD5A 1RXPA 2ZPQA 3M3TA 3ATWA 3UPEA 3S69A 5J4QA 4ZHLU 1O5BB 2ZHDA 2H5DA 4KTSA 1ZPCA 1UO6A 5IDKA 4X1SU 3CS7A 1SLXB 2W26A 1SR5C 4Y10E 3A89A 3SUDA 2HVXA 1SGNE 1Z1IA 2THFB 1T8LA 5C3NA 1C2MA 2ZDLA 1ARBA 1O3MA 1Z6EA 3UUZA 2J38A 1ORFA 1S0QA 4B2BA 1C5RA 1C5ZB 2ZI2H 2STBE 2D1JA 1YBWA 1V2UT 1Y5AT 2HPQH 2UUYA 3H5CB 2OC8A 1P12E 5H4IB 4ABAA 4K2YA 1GBCA 2ANWA 4E05H 5LGOA 1BMLA 3MWIU 1FY3A 4GLYA 1SGFA 1ID5H 1G2LA 3RP2A 1GI0A 2VWMA 2PWXA 1DS2E 1H8IH 3GCTF 1TB6H 1G3BA 2NU1E 1PFXC 2D26C 3A82A 4MPUA 1XUGA 4MVNA 1P3EA 7GCHG 5ESTE 2SNWA 1SGRE 3LKWA 1SGPE 2SNVA 3SU2A 5LPFA 1E35B 4I31A 4WH6A 4NCYA 4UONA 3PM3A 4B76A 5K7RA 4BNRA 3A88A 4A7IB 1J16A 1KIGH 1O5AB 1WAYB 2BDCA 3MHWU 1C4Y2 3LJJA 1BRUP 2PUXB 1V2VT 5EQSA 1NRSH 2QF3A 3RXDA 1SHHB 4ISOA 1BA8B 1OYTH 3MMGA 3SV7A 1BIOA 4NZLA 1HAVA 4GCHG 2BM2A 3MYWA 5CE1A 1DY9A 1ELTA 4YT7H 1OS8A 2GCHG 1FY5A 2QXIA 4Q7YA 3RXTA 1GBDA 1SB1H 1TPOA 4NGAH 4CR9A 3K2UA 2ZFQH 2SGPE 2EEKA 4IMZA 4AB8A 1W13U 4UFGH 2OBOA 4KTCA 1O3DA 1JRTA 2AH4X 1XUFA 1LPKB 4WF8A 9LPRA 2PUQH 3CS0A 3SJ9A 4AFSA 3A86A 1TRMA 1UTKA 3U1IB 1CHGA 5CHAC 1YCPK 2FTLE 1LHGH 3VFEA 1FAXA 1THRH 2NU3E 1HV7A 3KCGH 3LDXH 3M37A 1NT1A 3K65B 1O2QA 3M7QA 4XBDA 3DFJA 4R8TB 1HB0B 2HALA 1THPB 3KQCA 5FBEA 4FU8A 1C2EA 3SUFA 2PKSC 3QTVH 2H9EH 2RCEA 2O8TA 4JZEH 4Y8XA 2ASUB 3MU8A 4KELA 2ZQ2A 3Q77A 3TITA 3SQEE 1GDNA 4DGJA 2GT7A 4JZ1A 4MLFB 3BSQA 1XMNB 1F0UA 1S6FA 2J94A 3M35A 1WOFA 2OQ5A 1W0YH 1P2NA 1RTKA 1JOUB 2FZZA 2BY7X 3VXFH 1WV7H 3OY5U 3SU4A 1GHZA 2ZFPH 3VB5A 4I8KA 3QZQA 2FI5E 2DE9A 2FX4A 2SGAA 4HFPB 4OGXA 1K21H 3FP6E 3M7TA 3RXKA 2WUCA 1TGBA 1HLTH 2WINI 4H6TA 5HM2A 1Z71A 3U9AH 1LHFH 1GBEA 3PB1E 3GCNA 1C5XB 1O3KA 1A5GH 3I78A 4D9RA 5DG6A 1IQLA 2P3FH 3EA7A 4B2AA 4SGBE 1C2IA 1ZHRA 1GBAA 3SZNA 4QT8C 2R2MB 2CHAC 1EPTA 4IC5A 2ZTYA 3RXGA 4NFFA 4OS4A 1ABIH 3A7ZA 1W0ZU 3UTUH 1A0LA 3LJOA 3AASA 2C3SA 1TPSA 3ATMA 3UNQA 4LOYH 2VIDA 1XM1A 1ELVA 2Z9GA 2ZNKH 1Y5UT 1HFDA 2G5NA 1V2MT 1GJDB 1F0RA 1UTLM 4K69A 1JRSA 4Y76A 4X2YA 1LHEH 1A2CH 1J14A 3OY6U 1BQYA 1W8BH 3S0NA 4IW4E 1QL9A 2JH0D 1GHWH 3HK6B 5C20A 1DLEA 4LZ1H 4X2VA 2VIWA 5A0BA 1EOLA 4R0IA 1T7CA 4IS5A 1DY8A 1FN6A 3TLOA 3E3TA 1MZAA 1QTFA 1AY6H 3E16B 1BDAA 1GBMA 3T27A 1EQ9A 1H9LB 1ZMNA 4CH8B 2EI8A 4LZ4B 1TGTA 1GHVH 2BMGB 1BJVA 2Z3DA 1WTHD 2JH6D 3NZIA 1O2YA 1BMMH 2QA9E 1HUTH 1MKXH 1WYKA 1TWXB 4ZHMU 2FX6A 3U8RH 3LPRA 1UVUH 5EXLA 3ZZ8A 1TGSZ 1ZHPA 4AZ2B 1EB2A 2BHGA 3V13A 5DP3A 1GHAF 4U32A 1GBKA 5AFZH 3TH2H 3GY4A 1T31A 4I8GA 2CXVA 3RXIA 4AORA 3DHKH 1P02A 1C2DA 1Q3XA 2FDAA 2HPPH 1YC0A 1O2MA 3FP7E 1O3OA 1A7SA 4Y11E 1TPAE 5E2PA 5C5NA 1O35A 4Z0KA 3KHVA 4U01A 2F9NA 4FUJA 4CRAA 2NU4E 4UE7H 1NC6A 3PO1B 2FI4E 1P3CA 1PPCE 1A3BH 4BTUB 2OXSA 1QJ1B 3LIWA 2R2WU 4INLA 2DUCA 1BRBE 1XXDA 1QR3E 4KTUA 1SGCA 1BZXE 2A7HA 4YOJA 3SU6A 4DVAU 4XSKU 1EPTC 2BXTH 4X8VH 2G55A 2G4TA 1C1UH 3RXRA 1MTWA 1C2FA 4I32A 4GAWA 1A61H 1EZXC 2BLOA 1BTPA 1G2MA 2VNTA 2HNTE 2F9OA 2BYAX 1MQ6A 1FY1A 3SNAA 2H9HA 3GDUA 5C1UA 4Y71A 3D62A 1BHXF 1NZQH 4H42U 2BD8A 1JBUH 3KN2A 2XC4A 3URDA 3MU1A 4OS1A 1W10U 2QYIA 1LKAA 4ABDA 3RXMA 2A0QB 1C1SA 3SV9A 3F68H 3NXPA 4WJG2 2UUFB 3B9FH 1K1LA 1MBQA 1S0RA 1B0EA 2ZECA 3B23B 3SJIA 1QB6A 1HYLA 1J9CH 1GG6C 1Y3VA 2BB4A 3T5FH 5A8XA 3NCLA 5A2MH 3T62A 1XVOA 1TPPA 4CH2B 4YM9A 1WU1A 2LPRA 2JH5D 1LQDB 5HGGA 1N8OC 5CHAB 1GVKB 3ATKA 4BAKB 1Z8RA 1C4V2 1ZSJA 4AGKA 4CREA 4ZKOU 4Y0YE 1GI2A 1PPHE 2FTMA 4IGDA 1PJPA 4M7GA 2AFQB 1YLCA 5DP8A 1OWKA 1GHXH 1WSSH 2UUKB 2ZO3H 2ALPA 2WV4A 1YCPM 4Q2KA 1TGNA 1MTSA 3A8DA 3RXCA 1O2JA 1TX7A 2XCNA 2HNTC 1G9IE 1F2SE 4X6MA 1A46H 2VU8E 1O5EH 3GYMA 1HIAA 4MDSA 4KKDA 1O2XA 2G51A 3OYPA 2FPZA 2ZU5A 1LVMA 1PPFE 1SC8U 5AHGH 4J2YB 5GPIB 1EZUC 3D49H 2W3IA 1NU9A 3ZZ9A 1TNHA 1QURH 2ZPSA 3QTOH 5PTPA 2GMTB 4INHA 4JYUH 1QBVH 2SGQE 4A5TS 1C1QA 1QBNA 4MNWA 1EAWA 2VIOA 1FPCH 2ZP0H 4X8SH 4JZFH 4OS5A 3F9EA 6LPRA 3TU7H 1O3HA 1E37B 3ZVEA 2H1UA 2OC0A 4LK4A 5E2OA 3Q00A 2BQ7B 2Q6FA 1ARCA 1GJ6A 2BOHB 2FLBH 1YPEH 4E7NA 3LGTA 3SQHE 2A4OA 3L33A 4AB9A 4AFZA 1ZRBA 1C1MA 1UHBB 3P70B 3JZ1B 2CF8H 1HAIH 1LHDH 3RXHA 1D9IA 1DM4B 1QJ6B 3HKIB 2GGVB 3UREA 2XCFA 5IYTA 4ZUHA 2ZCLP 4YLUA 4B1TA 1FONA 4DCDA 1TNJA 2F3CE 4UFFH 4A1XA 3I77A 5A0AE 1DDJA 3RXLA 1IQEA 8LPRA 1DOJA 3BIVH 4B2CA 1VCWA 1V2WT 2UWOA 1AHTH 1TGCA 1VJ9U 3PLPA 1BTWA 1O2RA 1K1IA 1Y5BT 4I33A 5T6DA 3UR9A 4ZXXH 3BTDE 1RTLA 1NM6A 2O8WA 4O3TA 1WCZA 1AIXH 4RKJB 2VINA 2ZDAH 1C2KA 1LCYA 4DURA 1YPHE 4RSPA 3FVFB 1PPGE 2PGQB 1XUKA 2QC2A 3FZDA 2SGDE 1GVZA 1C1VH 2CMYA 2QGRA 1KTSB 1O5GH 3BIUH 1IQGA 3LH1A 1VGCB 4IN1A 1CVWH 1GBTA 1O2LA 1DSUA 1MCVA 2M5TA 2XNIA 3MNBA 2V6NA 4I8LA 4FUEA 1CA8B 4K1SA 4WVPE 2RA0A 1WQVH 3BG4B 1HAGE 1JIMA 5JPMH 4JK5A 1AN1E 4LXBH 1HAOH 5B6OA 3C27B 1UK4A 2A45B 2P3UB 2AMDA 1GPZA 1WBGB 3BTHE 4INKA 1DPOA 1K9OE 2VB0A 1ZYOA 1AZ8A 3QWCH 3GY8A 2BD4A 1OWJA 3PTNA 2Y80A 1A4WH 1XUJA 4K5ZA 1YPHC 3ODFA 1SFQB 2XBYA 3VGCB 1GI3A 4X2WA 4GSOA 1C5OH 2WPMS 1BTYA 2TGTA 1P09A 1H1BA 2FOCA 1P9UA 2PSYA 4ISHH 4D7FA 3A85A 5A8YA 3ZV8A 2C93B 1CGIE 1GBIA 4O3UA 2CN0H 4CRBA 2J34A 1U6QA 2HWLB 2OUAA 1BBRH 1D3TB 1GBBA 2WUBA <