1E34B

Porcine pancreatic elastase complexed with (3s, 4s)n-para- toluenesulphonyl-3-ethyl-4-(carboxylic acid) pyrrolidin-2-one soaked in ph 9 buffer for one minute
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title `Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e34B01
2XC4A 5PTPA 1WAYB 2FTLE 3NKKA 3RC5A 1O2SA 2ESTE 4GCHF 4K5ZA 1G30B 1SGQE 4ZHLU 5EGMA 5JBTA 4B71A 1YLCA 1RTLA 3AW0A 3MYWA 1V2LT 3P6ZB 4KP0A 2VVUA 3V0XA 3KCGH 1GHYH 1GGDB 2B9LA 3U8OH 3FZDA 2IN2A 5DK1A 1ZSJA 2VIQA 4DVAU 1O2UA 1QNJA 2ZTXA 1KYNA 3RMMH 1DWBH 1XUHA 1JRTA 1QRZA 4F49A 2FI4E 1FNIA 1UJ1A 3D62A 5C1UA 3O8RA 3SJ9A 3GYMA 1PPFE 3U8RH 3NZIA 1J15A 3MNXA 1GJ7B 2A4QA 1FAXA 1SGNE 1CGHA 1SLUB 2G51A 5LH8A 1L0ZA 1SGCA 1DSTA 1EATA 1TMBH 1RXPA 2BDYA 2OBQA 3PO1C 1TMUH 5FCRA 1QB1A 3GY5A 3KNXA 1IQLA 2ODQA 2ZGJA 5GDSH 1UTNA 1ELFA 2SGEE 4ZKRU 4OS7A 4LZ1H 4Y79A 2QC2A 1UTMA 1ZJDA 4FUFA 3C27B 1CA8B 3BTGE 5FBEA 2ZHQH 3SNAA 2ZPRA 1IOEA 2R2WU 4X2XA 1AO5A 3SHCH 1SGIB 3M7TA 1V2WT 3ZVGA 1KDQB 3MMGA 4JMYA 3SJ8A 4CRBA 1GBJA 3MU1A 2QAAA 1GPZA 1O2KA 4IW4E 3BV9B 3ODDA 1A0LA 2BD8A 1TOMH 1G3DA 4D7GA 2BQWB 4Y8YA 1GJ8B 3PMAB 1TNLA 3T29A 3EAJA 3GYLB 4AORA 4MNVA 1SFIA 4WF8A 1V2MT 1Y59T 4GSOA 1BITA 1QJ6B 1KY9A 1P2QA 1WU1A 3M5OA 4KTSA 2BLVA 1G3EA 3LC3A 2H6MA 3GDUA 3MNSA 1IQEA 4I8GA 5AFYH 3M3SA 3DHKH 2ILNA 2FESH 3SBKA 1GBAA 3RXVA 5AVDA 2CGAA 1YPKH 4FVDA 2P3FH 5EXMA 1QRXA 3ATIA 3ZZDA 1ZTJA 3KGPA 5A0BA 6CHAB 1NM6A 3ZV9A 3ZZ8A 1N1LA 3LT3A 1J16A 4UFEH 1TE0A 1QR3E 3U98H 2VVCA 5J4QA 1C2IA 2PTNA 1AB9C 2RA3A 9LPRA 1CA0B 2G8TA 1UVSH 1C1VH 1Z8RA 3PLPA 4KGAA 5EU8A 1A0HB 4DURA 1CVWH 1MD7A 4KTUA 3IWMA 5E0GA 3ODFA 3SQEE 1NU7B 1SGEE 1O5DH 4ZROA 1ARCA 4FU8A 1P9SA 1RD3B 2Q6GA 2JH5D 3EA7A 4ZMAH 2ZIQH 1RGQA 2V3HH 1Z7KA 1ZMJA 4NIVA 1NT1A 1GBMA 2RG3A 4ISLA 1LTOA 1TPPA 1PPEE 4DIIH 1L1JA 1G32B 1CU1A 2QIQA 3UWJH 1SB1H 1MUEB 1BTZA 2HOBA 4CR9A 4Y71A 5EQRA 5BPEA 2WPLS 2C8WB 1DITH 3UNQA 1O32A 2STBE 1FPHH 5FXLA 3SGBE 1DWCH 5EPYA 5F8XA 4K60A 1SFQB 1BQYA 2AYWA 3TJUA 2XW9A 3WY8A 3KEEA 1A46H 1BIOA 1W13U 1XUFA 5AF9H 2A32A 1S81A 2SGPE 1O39A 2P3TB 1KLIH 2TBSA 1EASA 3O8BA 1GDNA 2GCTC 2GGVB 2ZDKA 1GWAA 2O9QA 2ZHEH 2HLCA 2V6NA 4I33A 3GY8A 2D8WA 1MKWK 3DD2H 3A81A 3B23B 1UHBA 3FVFB 3R0FA 1C5NH 3Q76A 1LVYA 1PFXC 4BAOB 1KXDA 4WXIA 1F5KU 1QQUA 3RXLA 3ZVCA 2A5IA 2PV9B 2ZGBH 1C2KA 1J8AA 3LGWA 1Y8TA 1FZZA 1UHBB 1TOCB 4ABGA 4CHAB 1P2JA 4LXBH 1A5IA 1EAIA 4AGKA 1YCPM 2G00A 4NSVA 1IQJA 1TIOA 1RIWB 3STJA 4H4FA 4JZDH 2WUCA 1GHBG 1JMOH 4ISOA 1GDUA 2BOKA 1VJAU 4DJZB 1TA6A 1K1JA 3QDZB 2Y80A 4E7NA 2G5VA 2OQUA 3SUDA 1DPOA 4Y8XA 4AFSA 1O3DA 3JZ1B 5C1XA 1Y3WA 2WPKS 2AMDA 3NWUA 4AN7A 2P93A 3VGCC 4D76A 1QURH 2EC9H 5DP3A 4K1EA 1O5GH 2P16A 1J9CH 1UTOA 1XM1A 1GHBF 2W3IA 5EQQA 1FLEE 1P2MA 2ULLA 2HPQH 4ASHA 1TBRH 2BLOA 4RSPA 3SW2B 1V2PT 1S6HA 1QL7A 1W11U 1XXFA 2ZFFH 1VITG 2ZU2A 2ALVA 3UOPA 2QN5T 4AGJA 1GMDF 2P8OC 2FP7B 4AG1A 3I78A 3T28A 1UCYH 1EP5A 1B0EA 3Q77A 3M37A 4WMDA 2VNTA 1E36B 1HAVA 2BVRH 3LGTA 5DP5A 3PMJA 2ANKH 3Q00A 2RDLA 4OS2A 1JWTA 3UTUH 5A2MH 1TNHA 1MCVA 3BTFE 1C1PA 1C1RA 1HAVB 5AHGH 1ZSLA 2NU3E 3KQEA 1VITF 1V2JT 3A86A 4YOJA 2HNTC 1BTXA 3M5LA 2H2ZA 1TAWA 1TGTA 2CN0H 2ZDNA 1NRPH 1C1SA 4FUIA 4ABHA 5IYTA 1C1TA 4U2WA 1F0UA 5JBCS 4IS5A 1HJ9A 5SGAE 3IITA 1IQIA 3P92A 4BAQB 3SJKA 2ZCHP 2J4IA 3MU4A 1LHEH 4UFFH 3TVJB 1G3CA 1YBWA 2G5NA 1TRYA 2CMYA 5EODA 3BTME 3FZZA 2EA3A 8KME2 1SSXA 1LKBA 4FUCA 4FVBA 2OD3B 3UPEA 4XSKU 3Q3KA 8GCHG 3E0NB 5E8EH 1UK2A 4ZAEA 1ZPBA 1AUTC 1DOJA 2G81E 2OCVB 1TX8A 1UVTH 2XXLA 1FAKH 1LPZB 3RXHA 2GVFA 1LVMA 2Y82A 4NA8A 2JETB 1FQ3A 1C2HA 4MQAA 5EXLA 3RP2A 2FO9A 1RTFB 5ABWA 1TABE 2QF3A 5HXFA 1H8IH 1CT0E 2A0QB 8GCHF 1IQGA 2TIOA 4JZEH 3A7ZA 3PM3A 3A87A 1O5EH 1DY9A 5DP6A 3HKJB 3NCLA 3QZQA 1OYTH 4QT8C 1C1MA 1A5HA 3RC6A 3QGNB 1ANDA 1WYKA 3P95A 3E3TA 1QHRB 4BAHB 1O5CB 1B7XB 2VGCB 1TPSA 1AN1E 1NS3A 3V3MA 1G3BA 5GPIB 1AD8H 1AZZA 5DPAA 3SV2H 1TLDA 1NFXA 2ZGCA 4X1QU 5LPFA 2BDIA 2CHAB 2PKAA 2OQ5A 3GCNA 5A8YA 3H7OA 3SU5A 2QGRA 1HAXB 1EJAA 1GI1A 2ANYA 3Q3XA 2PW8H 5IDKA 1GL0E 4DW2U 1ORFA 1GHVH 3OY5U 1T8NA 1CSOE 3BN9A 3QGJA 4AB9A 4TWWA 2F9PA 2PKAB 1ELDE 1E38B 1P2OA 2A31A 1G2LA 4Z0KA 1ETSH 2F91A 1GBHA 3TNSA 4B2AA 4FUGA 1EKBB 3ATMA 2FPZA 2ZQ2A 1HNEE 1N6YA 3O8DA 2GP9B 4MPXA 1FY1A 2TGDA 2KAIA 2SNVA 1C5ZB 5TCCA 1MKWH 1EUFA 4A7IB 2Y81A 1C5TA 1IQFA 2Z3CA 2BD4A 5DP9A 1O3OA 1ETRH 5DP4A 2SGDE 3BIUH 2KAIB 4FUHA 1TB6H 4NWLA 1SGPE 3EQ0H 1P09A 1GG6B 1SOTA 2CJIA 2G4TA 1AIXH 2Z6BD 4O3UA 1N8OC 1A4WH 4VGCB 3T2NA 2ZGXH 3PTBA 4BAMB 3SGQE 1U6QA 2BZAA 2Y5FA 1TPAE 2FI3E 1MTNB 1PPBH 4GPGA 3ZYEA 2BXTH 1YC0A 3EDXB 4ABEA 3BTQE 2NU1E 1GCTB 3ZVAA 3E16B 1V2RT 2B8OH 4H6SB 2ZGHA 3HPTB 2ZHDA 1TGNA 5CHAB 3VFEA 2ZP0H 3AW1A 1SGYE 5FAHA 3HGNA 4UEHH 1GJAB 1O3HA 5DP8A 3SOSA 1S0RA 2F3CE 3VB6A 1TFXA 2QYIA 1PYTC 1QCPA 1O3NA 5TCAA 1Z8IB 1DS2E 3SU3A 3FP8E 2BZ6H 2BD9A 1S84A 5A09A 2HGTH 1C2EA 5L6NH 1H9IE 1P01A 1BTHH 1ETTH 2BLWA 4A5TS 1TMTH 5JB9S 2TGPZ 2GT8A 2ODPA 3M5NA 1O2JA 4ZKSU 4NIXA 3LH1A 5HYOA 2W3KA 3VXEH 4J2YB 1O2HA 1O3CA 1Y5BT 1F5LA 1KLJH 3I77A 5DP7A 3RXKA 2FTMA 1GI9B 3LJJA 2AEIH 3FANA 1AZ8A 2WYJA 3STIA 1HPGA 3ELAH 4U32A 4FU9A 4NG9H 1OP2A 1C1QA 2FOMB 2XNIA 2JH0D 1MBMA 1FIWA 1A5GH 1A3EH 1HJ8A 1D6RA 3ZZ5A 4Y0ZE 1BMMH 1WV7H 4ZXYH 2PGQB 4RN6A 3SNCA 3SJIA 2ANWA 1SHHB 2ZDAH 1QQ4A 1HBTH 5E0HA 2VH0A 3MH7A 4U30A 4NGAH 4Y76A 1GGDC 2ZKSA 1J14A 5ETXA 1O2XA 4ZHMU 3GISB 1O2TA 1BUIA 1O2GH 1T4UH 2SNWA 2QV1A 1XXDA 2GKVE 2A4GA 4TYDA 1P04A 1IQMA 3UWIA 1V2UT 3RXFA 3T27A 1YGCH 4JZFH 4X8UH 5FX5A 4GHTA 3A8AA 2AIQA 1XUIA 5EQSA 3SI3H 1HJAC 1O3EA 5GCHG 1SLVB 2A4OA 1C5YB 2XC5A 3E90B 3TU7H 1C2MA 4X1SU 3M3TA 3OSYA 4Q2KA 8ESTE 3MO9A 2GCHG 2ZHWH 2FODA 3RDZA 2XBXA 2O8TA 1P3CA 2VIOA 1HCGA 4K1TA 3A7XA 4K69A 4OGXA 1O3PB 1C5UA 5GCHF 1YPHE 5TJXA 4Q7ZA 2BB4A 3RXBA 4DCDA 3VXFH 4B74A 1CGJE 4D7FA 1P3EA 3LH3A 2VJ1A 3H5CB 2GCHF 1GI0A 3BTHE 4X2VA 5T6FA 1C1WH 3MO3A 1C5XB 2GX4A 4FU7A 2Q1JA 4JYTA 4NFEA 3NXPA 2WPIS 5E2OA 4CRDA 2NU0E 3PV4A 4HTCH 1K2I1 1GHZA 1K1NA 1O2IA 1F0SA 2H9EH 2GV7A 1WSSH 3EA8A 1C2LA 2NU2E 4XBBA 1ZTKA 2O8LA 1AU8A 4A1TA 3MWIU 2D2DA 1ZMLA 1TQ0B 3SJOA 1YPJH 1DUEA 1D3QB 2HALA 1SGDE 3AAUA 5C1YA 1KSNA 1T31A 2SFAA 2ZZUH 2QXGA 1SLXB 3SQHE 1RJXB 3SU4A 3DUXH 2J92A 1H9LB 4AOQA 2ZPSA 3ITIA 2ZDMA 1OX1A 1LHDH 1NRRH 1GI8B 1C4Y2 1P57B 5JYIA 1C4V2 4Z6AH 1ZGIA 2H1UA 4MG3A 2RA0A 2FOBA 1CHGA 2ZU4A 7KMEH 1V6DA 1O3GA 1PQAA 3K6ZA 4AYVB 6CHAC 1L1GA 2A45B 4GHQA 1H9HE 2GZ7A 1SBWA 1AMHA 4BXWA 1YF4A 1MQ5A 1KXFA 1EZXC 2UUYA 3KQBA 2OC7A 2AH4X 1CA0C 2PUQH 3MH4A 3ZVEA 1OPHB 1W2KH 1QFKH 2OXSA 4ISNA 1P11E 2NWNA 1O2WA 4XBCA 1BHXB 3URDA 4YT7H 5JBBS 4X6PA 2BMGB 2VWLA 2PTCE 2VVVA 1K1MA 3S69A 1GBTA 1GVZA 4NZLA 1GJCB 3L33A 1TA2A 2AGEX 1NESE 3FFGA 5C5NA 3EE0B 6LPRA 1PQ8A 1O31A 1Z1JA 1UTLM 2BOHB 1ESTA 2ODYB 2ZI2H 3LJOA 3LIWA 1BTPA 4INHA 2C90B 3SV6A 2P94A 3RXQA 3TGJE 1ANBA 1MKXH 3EYDA 2WINI 4MNWA 4TPIZ 4LOYH 3GCTG 1ELCA 1ELVA 7ESTE 2Z9KA 3RUOA 1P06A 2A4RA 1OSSA 1VCPA 3E6PH 1ZHRA 2HNTF 4B73A 1TGBA 1A1RA 3MNBA 1HB0B 1Y3VA 2FS8A 1LPKB 3VB4A 1QTFA 1EPTA 1O37A 2A1DB 2I6QA 3T62A 1BMAA 1T8LA 4E06H 1O34A 4I8LA 1LHGH 1BBRK 3GCTF 2STAE 4CBOA 3KL6A 1EPTB 5A0CA 1BBRE 3RXTA 4WXVA 1CO7E 4WH6A 4DG4A 1SHYA 1PQ7A 3Q3YA 1G9IE 2XBVA 2XYAA 9ESTA 2BD3A 1EP6A 1AB9B 2VINA 1RIWC 3SUEA 3P8GA 3QTOH 3U1IB 1NRNH 2FOCA 2ZFQH 2ZFSA 1NC6A 2BYAX 3FP6E 2IPHA 1NN6A 1MZAA 3BG4B 2Z9IA 2FOFA 5EOKA 5H4IB 3OTJE 5C20A 2DE8A 1ZR0A 3A83A 3UQVA 3SU1A 1A61H 4D9QA 4X0WU 1VGCB 1F5RA 1O2PA 1S85A 5DJ7A 3TGIE 1Z8JB 5A8XA 2HPPH 5HM9A 1GHWH 3ZVFA 5T6DA 4B2CA 3QUMP 2R3YA 2J2UA 3RXAA 1SGFG 4WY3A 5ESBA 1ZLRA 1RS0A 2FXRA 1WOFA 3T25A 3KQDA 4UFGH 2BHGA 3MH5A 1IHSH 2ZQ1A 1YKTA 3BEUA 1DWDH 1ZGVA 2H5CA 2J38A 2W7UA 2VB0A 2D26C 1DSUA 2W26A 1FPCH 4ZUHA 2J94A 1GBBA 2BD5A 1YPMH 3V7TA 2XC0A 1PPZA 1GBLA 3RMNH 3SN8A 1LDTT 3MI4A 3MFJA 4HI3A 1AVGH 1HV7A 1OWEA 3QN7A 1XUJA 1HIAA 3T26A 2QA9E 3A7YA 2PWXA 1F7ZA 4OS1A 4YZUA 5C67A 4Q7YA 3QLPH 4RKJB 4DY7B 2CF8H 1JXPA 1PPHE 2AIPA 2ZFPH 3ZVBA 5CMXH 5GWZA 4I8JA 5F8ZA 1AY6H 3F1SB 2FIRH 3PWBA 1HIAB 1O2OA 1TONA 1W0YH 2ZECA 2A2QH 2H9TH 1UTPA 4TY7A 1O2VA 3DFJA 1ZJKA 1HAYB 2GDEH 2BY7X 1SQTA 2F9BH 1YPLH 1P02A 1ELGA 3QZRA 3RXEA 2TGTA 3S0NA 1SQAA 3MNCA 4JK6A 1Q31A 1WQVH 4B2BA 1SGTA 3OYPA 2D1JA 5F03A 1MD8A 1V2OT 2BQ7B 3RXMA 3RU4D 2GZ8A 1NO9H 4XOJA 2HVXA 1BZXE 2JETC 4K8BA 2J9NA 2XRCA 4HZHA 1CT4E 5DO4H 4K2YA 3CS7A 1GI6A 1KLTA 4KELA 1WTGH 2PSXA 1AHTH 4TY6A 5C5OA 2PUXB 1ZHMA 2BTCE 4Y8ZA 3OU0A 1FMGA 5J4SA 4THNH 3ZVDA 1H8DH 4MVNA 1P05A 2VIWA 4I8KA 1TBQH 3N7OA 4Y11E 1AVWA 1QA7A 3ATWA 3M35A 4FXGH 4FUJA 4WVPE 4X1NU 1MAXA 1MTUA 2VGCC 5T6GA 1O2RA 1CBWB 2R2MB 2WV4A 1D6WA 3QTVH 2V0BA 3F6UH 4WMEA 2CHAC 1HRTH 1O3LA 3LU9B 5HM2A 2ANMH 1PYTD 1UK3A 5BRRE 3V12A 4AYYB 1SG8B 5LPRA 3P8NA 1Y3YA 4X6MA 1GMCG 3QK1A 1O35A 2SGAA 1EJNA 2CV3A 3E0PB 1DE7H 3DT0H 3A8BA 3D49H 1W12U 1D9IA 3U8TH 3TK9A 2PR3A 1BB0B 4BNRA 2XBWA 1T7CA 1Y5AT 2ZDLA 2VIDA 1LQEA 1SQOA 1THSH 4AFUA 2BDAA 2JH6D 2R3UA 3CENA 1GVKB 3LGYA 1K1IA 5FHTA 4ZKNU 1CE5A 1GMCF 4O03A 1KXAA 1DLKB 2QY0B 2FMJA 3HGPA 1LHCH 1WUNH 1WCZA 2FDAA 3ZZAA 1BA8B 2ZWLH 2ZCKP 4B1TA 1AVXA 1GG6C 2EI7A 4KKDA 1EB2A 2GT7A 4H42U 3BF6H 1EAUA 1PQ5A 3LPRA 1O3KA 1K28D 1QBVH 2O8WA 2UUJB 1WBGB 4VGCC 1C5SA 2Z9GA 1IHTH 3A84A 1AI8H 1ARBA 7GCHG 1DWEH 8LPRA 3ZYDA 2CXVA 3TITA 1DXPA 1MTNC 2J34A 2C4FH 2IOTA 1O5BB 3ENSB 3TH4H 1UTJA 1GCTC 2ASUB 5HMAA 1TYNA 3LDXH 1EJMA 2HNTE 3S7HB 3ZZCA 2ZU5A 1YP9A 3KN2A 2OLGA 5CHAC 4X2YA 1EZQA 4D8NA 1O3AA 2IJOB 3SUFA 1RRKA 7GCHF 1V2VT 4BTTB 1HXFH 1AFQB 2WUBA 3RXOA 2VWMA 2ZFRH 1YPGH 3QX5H 4Y0YE 5LPEA 4OS6A 2BX4A 4JCNA 1DXWA 1TGSZ 2C8XB 1BTYA 1HUTH 1A3BH 5HGGA 3UNRA 1O3MA 1LKAA 2CF9H 1K1PA 2GMTB 1MTWA 4ABJA 1FY8E 1EZSC 5L30H 2FI5E 1W10U 1VZQH 2GTBA 3ZZ4A 1YLDA 1SL3A 4IMQA 2OUAA 4NIWA 1KXEA 3VEQB 1UVOA 1AKSA 4JZIA 4IN1A 1HAPH 1HLTH 1O2NA 1YCPK 2FOAA 4YLUA 4ESTE 3FP7E 3D23A 2C3SA 3K9XB 3PB1E 3TPIZ 3AVZA 3NK8A 2AMQA 1AKSB 3F9GA 4HFPB 1DY8A 3UR9A 4AX9H 2BLQA 3T5FH 1EAXA 3ATKA 1EQ9A 1DX5M 3PYHA 1C5WB 2BY8X 2BY9X 1B0FA 5JBAS 4HGCA 4A6LA 2VWOA 3DA9B 3S7KB 1OXGA 3TH2H 1P03A 1EOJA 3OY6U 4I32A 4FUDA 1DVAH 1BRCE 2C8ZB 3GY6A 2FLBH 2FOHA 4X6NA 1C2FA 2G4UA 3A88A 1AWFH 1F0TA 3E8LA 2PKSB 4UONA 1H4WA 1IQNA 1O2QA 3F9HA 5G4BA 4BXSA 1TWXB 1UTKA 1C1NA 3GCHB 4MLFB 2A2XH 5F8TA 2OP9A 5ESTE 2GZ9A 1GI3A 1FUJA 3RXIA 1GI4A 1XX9A 3SI4H 2R9PA 4MNYA 1BT7A 1W0ZU 1O30A 1MMJN 1EZUC 3MHWU 3O8CA 3U1JB 1O3BA 1ELAA 4K1SA 1F2SE 3K65B 3SUGA 4U01A 1GMHG 1PJPA 1OWDA 1NROH 5FPYA 3SU2A 4WWYA 1ELBA 1VCWA 4IN2A 3SO3A 2Y5GA 3M36A 3RU4E 1S82A 3ZZ6A 3S9CA 1GJ4H 1FONA 4INLA 4GUXA 1KTTB 2O8MA 1BJVA 1GBDA 1E0FD 4IBLH 4YOGA 4YTAA 1GMHF 1W14U 5L2ZH 1DLEA 1MBQA 1E35B 3UOUA 1K1OA 2BXUH 2UUKB 3SNEA 1FY4A 2VIVA 4NA7A 5FX6A 1MQ6A 3A7WA 2Z94A 4LK4A 1NZQH 1SVPA 3MOCA 1AWHB 1AFEH 2O8UA 2C93B 1AQ7A 2F83A 1TPOA 3TK6A 4DGJA 2B0FA 1OWHA 4UFDH 3L6PA 1MTSA 1C5QA 2FZZA 2ZNKH 3PROA 2ZC9H 3HKIB 1Q3XA 2ZF0H 1ABJH 2Y6TA 3PLBA 5GIBA 1YYY1 4ISIH 1P2NA 1ZOMA 1D4PB 3BTWE 4ZXXH 4H6TA 3SGAE 4IC5A 3AAVA 1ZTLA 4O9VA 4R0IA 1ZZZA 1FV9A 1SC8U 4AG2A 5B6OA 1HJAB 2F9NA 3F68H 1KIGH 2OC1A 3TJNA 1MU6B 2Y5HA 1ANEA 1HXEH 1D3DB 4WMFA 1S83A 3RXRA 1FXYA 2XCNA 2ZTYA 5EW2H 3K2UA 4ISHH 2SGFE 2FYRA 4INKA 1HAOH 3A8CA 1V3XA 1GBKA 2BDCA 1MAYA 3S9BA 2GV6A 4A1VA 3UQOA 3LGIA 2THFB 5JDUB 4FUBA 3AASA 1AGJA 2XCFA 1TX6A 5E0JA 7LPRA 1LVBA 3MH6A 2JKHA 4ABBA 4GLYA 2VWNA 3SNBA 2XWBI 1KDQA 1UCYK 4A92A 2G52A 4X1PU 1OKXA 1THRH 1UCYE 3HK3B 1C2GA 2G55A 3BG8A 4NWKA 3SV9A 2K1QA 2W5EA 4Y10E 3BEIB 5T3HA 1GJ9B 1O33A 1LQDB 3A80A 2I6SA 3GY2A 2AGGX 2ZO3H 2FX4A 3EA9A 4GAWA 1LHFH 4UE7H 1GBCA 3PO1B 1OWKA 1XVOA 2ZU1A 1H1BA 1P2IA 1T32A 2VU8E 1YCPH 5EXNA 1L1NA 4JYUH 4FUEA 4CRAA 2BVSH 3KHVA 4YOIA 1C9TA 4K3JA 3B9FH 4XDEA 1A7SA 1QIXB 4AZ2B 4BAKB 1ZSKA 2P59A 1QA0A 1TX7A 2P95A 1M9UA 3TGKE 1GJDB 5I46H 3E1XB 1S6FA 3VB5A 2ZFTA 1V2ST 2OINA 1FN6A 5I25A 1V2NT 2SGQE 3KIDU 1QJ7B 2ZDVH 4MDSA 3L3TA 5L2YH 1HAHH 1CT2E 3ZZ9A 2DE9A 1Z8GA 1TNKA 3F9EA 1UVPA 1DUAA 1GL1A 3GOVB 1EB1H 3GCOA 1XMNB 3RXPA 1EPTC 1BDAA 4I7YH 4Q7XA 3P70B 3W94A 3ATLA 3VB7A 4AFZA 4LZ4B 1C4U2 1W7XH 3MU5A 3UFAA 2WPHS 3URCA 1Y3XA 1MU8B 3W95A 1GHAG 1CQQA 1QBOA 4YO9A 3UR6A 1O36A 2EI8A 2OC0A 1YPEH 1P0SH 3C1KA 1W7GH 2OC8A 3E91A 1LO6A 1ZYOA 4XFQA 3BG4C 1JRSA 3RXJA 2V35A 1T8MA 1VGCC 1GBIA 3BEFB 3LKWA 1VITH 3LGVA 5JPMH 1GHAF 1Y5UT 1O5AB 3DFLA 1GJ5H 1L4DA 3RLYH 3ZZ3A 4CHAC 3FAOA 1TBZH 3KF2A 1EAWA 4Y6DA 1BOQA 4Q80A 1SGRE 4X1RU 1ANCA 3BSQA 2UUFB 3KQCA 4KTCA 1L4ZA 1FY5A 1E37B 4ZKOU 3P8OA 3UUZA 5EPNA 4NFFA 3UY9A 5A8ZA 1HAIH 1GBEA 1C5VA 1NY22 4X8TH 3RXDA 3GDVA 4ABAA 1LPGB 2A7JA 3PTNA 4ZHAA 4D9RA 1BMLA 4MPWA 1NRQH 1ZHPA 4A1XA 4SGBE 2A5KA 1NU9A 2TGAA 1XUKA 4MPVA 4X2WA 1NRSH 2PSYA 1UO6A 3SU0A 3RXCA 1OYQA 1XKBC 2QXJA 5FPTA 1P12E 2Z9JA 1K22H 1WTHD 4JYVH 1INCA 1C5LH 1JIRA 2ZU3A 3TK5A 2ZCLP 1TGCA 3RMLH 2AGIX 1ESAA 1FIZA 1EX3A 1JIMA 2B5TB 1VCQA 4DOQA 1LCYA 4OS4A 1FI8A 1N6XA 2VH6A 3ZV8A 2GCTB 3CS0A 1W8BH 1BMNH 1OWIA 1P2KA 3OX7U 2WV5A 1OWJA 2XBYA 1NPMA 3TNTA 1ZPCA 1MH0A 3A85A 4XE4A 1GI7B 1GMDG 2R0LA 1E34B 2YOLA 2BM2A 3I29A 1BJUA 1YM0A 4R8TB 1O3IA 1EOLA 1J17T 1BTWA 2P3UB 3VPKA 2QXIA 1A0JA 3SORA 2Z3DA 1C9PA 1EXFA 2Z3EA 3V13A 3S9AA 4NA9H 2BX3A 1V2KT 4NCYA 1DICA 3RMOH 1GI5A 2BVXH 3QWCH 3LGUA 2EEKA 1CBWC 4NZQA 3B8JA 4BTIB 1L2EA 3VGCB 2BD7A 1ELTA 3EGKH 5AFZH 1GDQA 1QB9A 3MO6A 1O2YA 1ESBA 5C3NA 3NPSA 1D3PB 1HAZB 2Z9LA 4X8SH 1SMFE 3GICB 3PMHB 2W7SA 3LC5A 1VJ9U 1ZRBA 3HK6B 2P8OB 1F0RA 3H7TA 1BCUH 2C8YB 3SV7A 3A7TA 5EG4A 1FDPA 1C2JA 3A8DA 3ESTA 2RCEA 2OBOA 3R3GB 1KTSB 3M5MA 3RU4T 4B75A 1TNIA 2XTTB 4O3TA 2Q6FA 1Y3UA 5DKMA 2J95A 3A89A 1NFYA 4XBDA 4AFQA 1HGTH 4NIYA 1GJ6A 1C5MD 4BOHA 3SU6A 3LOXA 3K6YA 5JB8S 3SV8A 2BQ6B 3P8FA 5DGJA 1G37A 1P9UA 1FN8A 1JBUH 1MCTA 4WH8A 3TH3H 2YNBA 3PWCA 2A7CA 4IMZA 4MNXA 1OS8A 3F9FA 4DIHH 1QRWA 1GI2A 1JOUB 2OTVA 1ID5H 1ZMNA 1QJ1B 1S5SA 3U69H 1ZRKA 4YT6H 1BBRH 4CRCA 1NTPA 1QB6A 2ZTZA 4CH2B 1LVOA 2AMPA 3LONA 3RXUA 1DDJA 3IG6B 1DFPA 1NFUA 5GJ4B 4YESB 1CHOG 2FWWA 2FS9A 1TNGA 2H5DA 1GVLA 2ZA5A 1AE8H 1IQKA 1SI5H 3PMBB 3P17H 2QF0A 1V2QT 1O38A 5LGOA 3JZ2B 4IGDA 1AFQC 3QO6A 2GDDA 1O2LA 2FX6A 1T4VH 4I8HA 3U9AH 4E7RG 1UMAH 4I31A 4ZH8A 2TPIZ 5K0HA 1AUJA 4GVUA 2XWAA 4OGYA 4BTUB 3TJVA 2V3OH 4NSYA 2BDHA 1MZDA 1SR5C 1S0QA 1O3JA 2BDGA 3NUMA 1CHOF 1C2DA 2H9HA 3BTKE 3MU8A 3RLWH 1O0DH 1K9OE 1O5FH 2AFQB 3GY7A 2PFEA 5K7RA 2GMTC 1XUGA 1QY6A 3MU0A 2GD4B 1Q2WA 1SGFA 3SNDA 3UREA 6GCHG 2WYGA 1BTUA 2ZG0H 3BTTE 1ZPZA 4RKOB 4ABDA 1TRMA 3UNSA 1G36A 1TALA 1O2ZA 1SPJA 2A7HA 1C1OA 4MTBA 2FYQA 4JK5A 4O97A 4JZ1A 1XKAC 1HFDA 1B5GH 2QXHA 4OS5A 3ZZBA 4TWYA 1SLWB 3PLKA 2FM2A 3A82A 3HATH 2YNAA 1GHXH 4J1YA 3RXGA 2LNCA 1QL8A 4CH8B 4WJG2 2ZPQA 6GCHF 1T8OA 1SOZA 1C1UH 1RTKA 1D3TB 2WPJS 1X7AC 1BRAA 1VR1H 3BTEE 1QL9A 4UDWH 1AE5A 4MPUA 1DANH 1HYLA 1FJSA 2ZHFH 3M7QA 2AERH 4Y7BA 1Z71A 2BY6X 1QBNA 1ABIH 1DM4B 2HWLB 1UK4A 2WPMS 3VB3A 3TJOA 1LMWB 3GY4A 1P10A 5EW1H 3CP7A 2DUCA 2FLRH 1MTVA 4AB8A 4PROA 4CRGA 2PKSC 4M7GA 1KXCA 5E2PA 4B76A 1P8VC 4CBNA 1FY3A 1OOKB 5DG6A 1G2MA 2F9OA 1YPHC 1PPGE 4SGAE 1UVUH 1W3CA 1N8OB 3GCHC 1TQ7B 1BRUP 1UTQA 2UWPA 5FPSA 1GCDA 2AS9A 2UWLA 5FCKA 5F6MA 2Y7ZA 1PPCE 1KXBA 2EI6A 1IQHA 1ACBE 1F92A 5FBIA 4YLQH 3SZNA 3BIVH 4DT7B 3TIUA 1DT2A 1Z6EA 3RC4A 1C5PA 1IAUA 1TNJA 4BANB 4F4OC 2Q6DA 2ALPA 2LPRA 1Z1IA 4ABFA 4E05H 2ZEBA 4K8YA 1GBFA 1BHXF 2TRMA 1QGFA 2QCYA 3A7VA 2BY5X 2PLXA 1RFNA 2PGBB 3D65E 2FEQH 1TRNA 1OP8A 2M5TA 2FOEA 4CR5A 3RM2H 1K1LA 4X6OA 2BDBA 1MKXK 3BTDE 3TLOA 3ZZ7A 2Y7XA 2NU4E 1K21H 4CRFA 4YM9A 3GDSA 1HAGE 3RXSA 2F9UA 4CREA 2UWOA 2Z7FE 1A2CH 1C5OH 4Y7AA 3G01A 1C5RA 2B7DH 3GY3A 3UIRA 4IC6A 3RM0H 1HDTH 2VIPA 5A0AE 1V2TT 2HRVA 1XVMA 3MTYA 5CE1A 1BRBE 4ABIA 2R0KA 4UD9H 4GCHG 2PHBA 1WQSA 3M3VA 1ELEE 1NFWA 3M7UA 4X8VH 2F9VA 1GJBB 5C2ZA 1CGIE 5GXPA 4TPYA 1THPB 1Z6JH 2FOGA 1O3FA 1OP0A 1O2MA 6ESTA 2A5AA 2BD2A 3SHAH 3M61U
chains in the Genus database with same CATH superfamily
2XC4A 5PTPA 1WAYB 2FTLE 3NKKA 3RC5A 1O2SA 2ESTE 4GCHF 4K5ZA 1G30B 1SGQE 4ZHLU 5EGMA 5JBTA 4B71A 1YLCA 1RTLA 3AW0A 3MYWA 1V2LT 3P6ZB 4KP0A 2VVUA 3V0XA 3KCGH 1GHYH 1GGDB 2B9LA 3U8OH 3FZDA 2IN2A 5DK1A 1ZSJA 2VIQA 4DVAU 1O2UA 1QNJA 2J97A 1KYNA 2ZTXA 3RMMH 1DWBH 1XUHA 1JRTA 1QRZA 3N7DA 4F49A 2FI4E 2F4LA 5HIZA 1YWUA 1FNIA 1UJ1A 3D62A 2XNDD 1YLNA 5C1UA 3O8RA 3SJ9A 3GYMA 1PPFE 3U8RH 3NZIA 1J15A 3MNXA 1GJ7B 2A4QA 1FAXA 1SGNE 1CGHA 1SLUB 2G51A 5LH8A 1L0ZA 1SGCA 1DSTA 1EATA 3KQ5A 3OEHD 1TMBH 1RXPA 2BDYA 2OBQA 3PO1C 1TMUH 5FCRA 1QB1A 3GY5A 3KNXA 1IQLA 2ODQA 2ZGJA 5GDSH 1UTNA 3F2HA 1ELFA 1WDIA 2SGEE 4ZKRU 4DT4A 4OS7A 4LZ1H 4Y79A 2QC2A 1UTMA 1ZJDA 4FUFA 3C27B 4XRNA 1CA8B 3BTGE 2PP6A 2ZHQH 5FBEA 3SNAA 2ZPRA 1IOEA 2R2WU 4X2XA 1AO5A 3SHCH 1SGIB 3M7TA 1V2WT 3ZVGA 1KDQB 3MMGA 4JMYA 3SJ8A 4CRBA 1GBJA 3MU1A 2QAAA 1GPZA 1O2KA 4IW4E 3BV9B 3ODDA 4FOUC 1A0LA 2BD8A 1UW7A 1TOMH 1G3DA 4D7GA 2BQWB 4Y8YA 1GJ8B 3PMAB 1TNLA 3T29A 3EAJA 3GYLB 4AORA 4MNVA 1SFIA 4WF8A 1V2MT 1Y59T 4GSOA 1BITA 1QJ6B 1KY9A 1P2QA 1VKYA 1WU1A 3M5OA 4KTSA 2BLVA 1G3EA 3LC3A 2H6MA 3GDUA 3MNSA 5B6LA 1IQEA 4I8GA 5AFYH 3OEED 3M3SA 2KCPA 3DHKH 2ILNA 2FESH 2W6ID 3SBKA 1GBAA 3F3BA 3RXVA 5AVDA 2CGAA 1YPKH 4FVDA 2P3FH 5EXMA 1QRXA 3ATIA 3ZZDA 1ZTJA 3KGPA 5A0BA 6CHAB 1NM6A 3ZV9A 3ZZ8A 1N1LA 3LT3A 1J16A 4UFEH 1TE0A 1QR3E 3U98H 2VVCA 5J4QA 1C2IA 2PTNA 1AB9C 2RA3A 9LPRA 4RI0A 1CA0B 2G8TA 1UVSH 1C1VH 1Z8RA 3PLPA 4KGAA 5EU8A 1A0HB 4DURA 1CVWH 1MD7A 4KTUA 3H09A 3IWMA 3ODFA 5E0GA 3SQEE 1NU7B 1SGEE 1O5DH 4ZROA 1ARCA 4FU8A 1P9SA 1RD3B 2Q6GA 2JH5D 3EA7A 4ZMAH 2ZIQH 1RGQA 2V3HH 3VG8A 1Z7KA 1ZMJA 4NIVA 1NT1A 1GBMA 2RG3A 2QF4A 4ISLA 1LTOA 1TPPA 1PPEE 4DIIH 1L1JA 1G32B 1CU1A 2QIQA 3UWJH 1SB1H 1MUEB 1BTZA 2HOBA 4CR9A 4Y71A 5EQRA 5BPEA 2WPLS 2C8WB 1DITH 3UNQA 1O32A 2STBE 1FPHH 5FXLA 3SGBE 1DWCH 5EPYA 5F8XA 4K60A 1SFQB 1BQYA 2AYWA 3TJUA 2XW9A 3WY8A 3KEEA 1A46H 1BIOA 1W13U 1XUFA 5AF9H 2A32A 1S81A 2SGPE 1O39A 2P3TB 1KLIH 2TBSA 1EASA 3O8BA 4RT0A 1GDNA 2GCTC 2GGVB 2ZDKA 1GWAA 2O9QA 2ZHEH 4P00A 2HLCA 2V6NA 4I33A 3GY8A 2D8WA 1MKWK 3DD2H 3A81A 3B23B 1UHBA 3FVFB 3R0FA 1C5NH 3Q76A 1LVYA 1PFXC 4BAOB 1KXDA 4WXIA 5EJZA 1F5KU 3U28C 1QQUA 3RXLA 3ZVCA 2RDEA 2A5IA 2PV9B 2ZGBH 1C2KA 1J8AA 3LGWA 1Y8TA 1FZZA 1UHBB 1TOCB 4ABGA 4CHAB 1P2JA 4LXBH 1A5IA 1EAIA 4AGKA 1YCPM 2G00A 4NSVA 1IQJA 1TIOA 1RIWB 3STJA 4H4FA 4JZDH 2WUCA 1GHBG 1JMOH 4ISOA 1GDUA 2BOKA 1VJAU 4DJZB 1TA6A 1K1JA 3QDZB 2Y80A 4E7NA 2G5VA 2OQUA 3SUDA 1DPOA 4Y8XA 4AFSA 1O3DA 3JZ1B 5C1XA 1Y3WA 2WPKS 2AMDA 3NWUA 4AN7A 2P93A 3VGCC 4D76A 1QURH 2EC9H 5DP3A 2KX4A 4K1EA 1O5GH 2P16A 5EJLA 1J9CH 1UTOA 1XM1A 1GHBF 2W3IA 5EQQA 1FLEE 1P2MA 2ULLA 2HPQH 4ASHA 1TBRH 4ZCNA 2BLOA 4RSPA 3SW2B 1V2PT 1S6HA 1QL7A 1W11U 1XXFA 2YMSB 1VITG 2ZFFH 2ALVA 2ZU2A 2QN5T 3UOPA 4AGJA 1GMDF 2P8OC 2FP7B 4AG1A 3I78A 3T28A 1UCYH 1EP5A 1B0EA 3Q77A 3M37A 4WMDA 2VNTA 1E36B 1HAVA 2BVRH 4ACBA 3LGTA 5DP5A 3PMJA 2ANKH 3Q00A 2RDLA 4OS2A 1JWTA 3UTUH 5A2MH 1TNHA 1MCVA 3BTFE 4F55A 1C1PA 1C1RA 1HAVB 5AHGH 1ZSLA 2NU3E 3KQEA 1VITF 1V2JT 3A86A 4YOJA 2HNTC 1BTXA 3M5LA 2H2ZA 1TAWA 1TGTA 2CN0H 2ZDNA 1NRPH 1C1SA 4FUIA 4ABHA 5IYTA 1C1TA 4U2WA 1F0UA 5JBCS 4IS5A 1HJ9A 5SGAE 3IITA 1IQIA 3P92A 4BAQB 2AHME 3SJKA 2ZCHP 2J4IA 3MU4A 1LHEH 4UFFH 3TVJB 5KEDA 1G3CA 1YBWA 2G5NA 1TRYA 2CMYA 5EODA 2KZ4A 3BTME 3FZZA 2EA3A 8KME2 1SSXA 1LKBA 3WW7A 4FUCA 4FVBA 2OD3B 3UPEA 4XSKU 3Q3KA 8GCHG 3E0NB 5E8EH 1UK2A 4ZAEA 1ZPBA 1AUTC 1DOJA 2G81E 2OCVB 1TX8A 1UVTH 2XXLA 1FAKH 1LPZB 3RXHA 2GVFA 1LVMA 2Y82A 4NA8A 2JETB 1FQ3A 1C2HA 4MQAA 5EXLA 3RP2A 2FO9A 1RTFB 5ABWA 1TABE 2QF3A 5HXFA 1H8IH 1CT0E 2A0QB 8GCHF 1IQGA 2TIOA 4JZEH 3A7ZA 3PM3A 3A87A 1O5EH 1DY9A 5DP6A 3HKJB 3NCLA 3QZQA 1OYTH 4QT8C 1C1MA 1A5HA 3RC6A 3QGNB 1ANDA 1WYKA 3P95A 3E3TA 2GJGA 1QHRB 4BAHB 1O5CB 1B7XB 2VGCB 3UAIC 1TPSA 1AN1E 1NS3A 3V3MA 1G3BA 5GPIB 1AD8H 1AZZA 5DPAA 3SV2H 1TLDA 1NFXA 2ZGCA 4X1QU 5LPFA 2BDIA 2CHAB 2PKAA 2OQ5A 3GCNA 5A8YA 3H7OA 3SU5A 2QGRA 1HAXB 1EJAA 1GI1A 2ANYA 3Q3XA 2PW8H 5IDKA 1GL0E 4DW2U 1ORFA 1GHVH 3OY5U 1T8NA 1CSOE 3BN9A 3QGJA 4AB9A 4TWWA 2F9PA 2PKAB 1ELDE 1E38B 1P2OA 2A31A 1G2LA 4Z0KA 1ETSH 2F91A 1GBHA 2F43B 3TNSA 4B2AA 4FUGA 1EKBB 3ATMA 2FPZA 1E1RD 2ZQ2A 1HNEE 1N6YA 1KMHB 3O8DA 2GP9B 4MPXA 1FY1A 2TGDA 2KAIA 2SNVA 1C5ZB 5TCCA 1MKWH 1EUFA 4A7IB 2Y81A 1C5TA 1IQFA 2Z3CA 1BMFD 2BD4A 5DP9A 1O3OA 1ETRH 5DP4A 2SGDE 3BIUH 2KAIB 4FUHA 1TB6H 4NWLA 1SGPE 3EQ0H 1P09A 1GG6B 1SOTA 2CJIA 2G4TA 1AIXH 2Z6BD 3GS9A 4O3UA 1N8OC 1A4WH 4VGCB 3T2NA 2ZGXH 3PTBA 4BAMB 3SGQE 1U6QA 2BZAA 2Y5FA 1TPAE 2FI3E 3WWBA 1MTNB 1PPBH 4GPGA 3ZYEA 2BXTH 1YC0A 3EDXB 4ABEA 3BTQE 2NU1E 5C94A 1GCTB 3ZVAA 3E16B 1V2RT 2B8OH 4H6SB 2ZGHA 3HPTB 2ZHDA 1TGNA 5CHAB 3VFEA 2ZP0H 3AW1A 1SGYE 5FAHA 3HGNA 4UEHH 5HIYA 1GJAB 1O3HA 5DP8A 3SOSA 1S0RA 2F3CE 3OTPA 3VB6A 1TFXA 2QYIA 1PYTC 1QCPA 1O3NA 5TCAA 1Z8IB 1DS2E 3SU3A 3FP8E 3FN8A 2BZ6H 2BD9A 1S84A 5A09A 2HGTH 1C2EA 5L6NH 1H9IE 5KECA 1P01A 1BTHH 1ETTH 2BLWA 4A5TS 1TMTH 5JB9S 2TGPZ 2GT8A 2ODPA 3M5NA 1O2JA 4ZKSU 4NIXA 3LH1A 5HYOA 2W3KA 3VXEH 4J2YB 1O2HA 1O3CA 1Y5BT 1F5LA 1KLJH 3I77A 5DP7A 3RXKA 2FTMA 1GI9B 3LJJA 2AEIH 3FANA 5C17A 1AZ8A 2WYJA 3STIA 5DSFA 1HPGA 3ELAH 4U32A 4FU9A 4NG9H 1OP2A 1C1QA 2FOMB 5DN6D 2XNIA 2JH0D 1MBMA 1FIWA 1A5GH 1A3EH 1HJ8A 1D6RA 3ZZ5A 4Y0ZE 1BMMH 1WV7H 4ZXYH 2PGQB 4RN6A 3SNCA 3SJIA 2ANWA 1SHHB 2ZDAH 1QQ4A 1HBTH 5E0HA 2VH0A 4RT1A 3MH7A 4U30A 4NGAH 4Y76A 1MABB 1GGDC 2ZKSA 1J14A 5ETXA 1O2XA 4ZHMU 3GISB 1O2TA 1BUIA 1O2GH 1T4UH 2SNWA 2QV1A 1XXDA 2GKVE 2A4GA 4TYDA 1P04A 1IQMA 3UWIA 1V2UT 3RXFA 3T27A 1YGCH 4JZFH 4X8UH 5FX5A 4GHTA 3A8AA 2AIQA 1XUIA 5EQSA 3SI3H 1HJAC 1O3EA 5GCHG 3N7EA 1SLVB 2A4OA 1SKYE 1C5YB 2XC5A 3E90B 3TU7H 1C2MA 4X1SU 3M3TA 3OSYA 4Q2KA 8ESTE 3MO9A 2GCHG 2ZHWH 3ZIAD 2FODA 3RDZA 2XBXA 2O8TA 1P3CA 2VIOA 5CHBA 1HCGA 4K1TA 3A7XA 4K69A 4OGXA 1O3PB 1C5UA 5GCHF 1YPHE 3KYGA 5TJXA 1W0JD 4Q7ZA 2BB4A 3RXBA 4DCDA 3VXFH 4B74A 1CGJE 4D7FA 2HLDD 1P3EA 3LH3A 2VJ1A 3H5CB 2GCHF 5EJ1A 1GI0A 3BTHE 4X2VA 5T6FA 1C1WH 3MO3A 1C5XB 2GX4A 4FU7A 2Q1JA 4JYTA 4NFEA 3NXPA 2WPIS 5E2OA 4CRDA 2NU0E 3PV4A 4HTCH 1K2I1 1GHZA 1K1NA 1O2IA 1F0SA 2H9EH 3OE7D 2GV7A 1WSSH 3EA8A 1C2LA 2NU2E 4XBBA 1ZTKA 2O8LA 1AU8A 4A1TA 3MWIU 2D2DA 1ZMLA 4ACAA 1TQ0B 3SJOA 1YPJH 1DUEA 1D3QB 2HALA 1SGDE 3AAUA 4ASUD 5C1YA 1KSNA 1T31A 2SFAA 2ZZUH 2QXGA 1SLXB 3CNRA 3SQHE 1RJXB 3SU4A 3DUXH 2J92A 1H9LB 4AOQA 2ZPSA 3ITIA 2ZDMA 1OX1A 1LHDH 1NRRH 4Q63A 1GI8B 1C4Y2 1P57B 5JYIA 1C4V2 4Z6AH 1ZGIA 2H1UA 4MG3A 2RA0A 2FOBA 5C0TA 1CHGA 2ZU4A 7KMEH 1V6DA 1O3GA 1PQAA 3K6ZA 4AYVB 6CHAC 1L1GA 2A45B 4GHQA 1H9HE 2GZ7A 1SBWA 1AMHA 4BXWA 1YF4A 1MQ5A 1KXFA 1EZXC 2UUYA 3KQBA 2OC7A 2AH4X 1CA0C 2PUQH 3MH4A 3ZVEA 1OPHB 1W2KH 1QFKH 2OXSA 4ISNA 1P11E 2NWNA 1O2WA 4XBCA 1BHXB 3URDA 4YT7H 5JBBS 4X6PA 2BMGB 2VWLA 2PTCE 2VVVA 1K1MA 3S69A 1GBTA 1GVZA 4NZLA 1GJCB 3L33A 1TA2A 2AGEX 1NESE 3FFGA 5C5NA 3EE0B 6LPRA 1PQ8A 1O31A 1Z1JA 1UTLM 2BOHB 1ESTA 2ODYB 2ZI2H 3LJOA 3LIWA 1BTPA 4INHA 2C90B 3SV6A 2P94A 3RXQA 3TGJE 1ANBA 1MKXH 3EYDA 2WINI 4MNWA 4TPIZ 4LOYH 3GCTG 1ELCA 1ELVA 7ESTE 2Z9KA 3RUOA 1P06A 2A4RA 1OSSA 1VCPA 3E6PH 1ZHRA 2HNTF 4B73A 1TGBA 1A1RA 3MNBA 1HB0B 1Y3VA 2FS8A 1LPKB 3VB4A 1QTFA 1EPTA 1O37A 2A1DB 2I6QA 3T62A 1BMAA 1T8LA 4E06H 1O34A 4I8LA 1LHGH 1BBRK 3GCTF 2STAE 4CBOA 3KL6A 1EPTB 5A0CA 1BBRE 3RXTA 4WXVA 1CO7E 2WSSD 1S6LA 4WH6A 2QE7D 4DG4A 3FOAA 1SHYA 1PQ7A 3Q3YA 1G9IE 2XBVA 2XYAA 9ESTA 2BD3A 1W0KD 1EP6A 1AB9B 2VINA 1RIWC 3SUEA 3P8GA 3QTOH 3U1IB 1NRNH 2FOCA 2ZFQH 2ZFSA 1NC6A 2BYAX 3FP6E 2IPHA 1NN6A 1MZAA 3BG4B 2Z9IA 2FOFA 5EOKA 5H4IB 4AC9A 3OTJE 5C20A 2DE8A 1ZR0A 3A83A 3UQVA 3SU1A 1A61H 4D9QA 4X0WU 1VGCB 1F5RA 1O2PA 1S85A 5DJ7A 3TGIE 1Z8JB 5A8XA 2HPPH 5HM9A 1GHWH 3ZVFA 5T6DA 4B2CA 3QUMP 2R3YA 2J2UA 3RXAA 1SGFG 4WY3A 5ESBA 1ZLRA 1RS0A 2FXRA 1WOFA 3T25A 3KQDA 4UFGH 2BHGA 3MH5A 2YMSC 1IHSH 2ZQ1A 1YKTA 3BEUA 1DWDH 1ZGVA 2JJ2D 2H5CA 2J38A 1K0HA 2W7UA 2VB0A 2D26C 1DSUA 2W26A 1FPCH 4ZUHA 2J94A 1GBBA 2BD5A 1YPMH 3V7TA 2XC0A 1PPZA 1GBLA 3RMNH 3SN8A 1LDTT 3MI4A 3MFJA 4HI3A 1AVGH 2K0QA 1HV7A 1OWEA 3QN7A 1XUJA 1HIAA 3T26A 2QA9E 3A7YA 2PWXA 3DSOA 3AK5A 1F7ZA 4OS1A 4YZUA 5C67A 4Q7YA 5T1VA 3QLPH 4RKJB 4DY7B 2CF8H 1JXPA 1PPHE 2AIPA 2ZFPH 3ZVBA 5CMXH 5GWZA 4I8JA 5F8ZA 1AY6H 3F1SB 1H8HD 2FIRH 3PWBA 1H8ED 1HIAB 1O2OA 1TONA 1W0YH 2ZECA 2A2QH 2H9TH 1UTPA 4TY7A 1O2VA 3DFJA 3WWFA 1ZJKA 1HAYB 2GDEH 2BY7X 1SQTA 3OAAD 2F9BH 1YPLH 1P02A 1ELGA 3QZRA 3RXEA 2TGTA 3S0NA 1SQAA 3MNCA 4JK6A 1Q31A 1WQVH 4B2BA 1SGTA 3OYPA 2D1JA 5F03A 1MD8A 1V2OT 2BQ7B 3RXMA 3RU4D 2GZ8A 1NO9H 2J5UA 4XOJA 2HVXA 1BZXE 2JETC 4K8BA 2J9NA 2XRCA 4HZHA 1CT4E 5DO4H 4K2YA 3CS7A 1GI6A 1KLTA 4KELA 1WTGH 2PSXA 1AHTH 4TY6A 5C5OA 2PUXB 1ZHMA 2BTCE 2L74A 4Y8ZA 3OU0A 1FMGA 5J4SA 4THNH 3ZVDA 1H8DH 4MVNA 1P05A 2VIWA 4I8KA 2JDID 1TBQH 3N7OA 4Y11E 1AVWA 1QA7A 3ATWA 3M35A 4FXGH 4FUJA 4WVPE 4X1NU 1MAXA 1MTUA 2VGCC 5T6GA 1O2RA 1CBWB 2R2MB 2WV4A 1D6WA 3QTVH 2V0BA 3F6UH 4WMEA 2CHAC 2KCAA 1HRTH 1O3LA 3LU9B 5HM2A 2ANMH 1PYTD 1UK3A 5BRRE 3V12A 4AYYB 1SG8B 5LPRA 3P8NA 1Y3YA 4X6MA 1GMCG 3QK1A 1O35A 2SGAA 1EJNA 2CV3A 3E0PB 1DE7H 3DT0H 3A8BA 3D49H 2V7QD 1W12U 1D9IA 3U8TH 3TK9A 2PR3A 1BB0B 4BNRA 2XBWA 1T7CA 1Y5AT 2ZDLA 2VIDA 1LQEA 1SQOA 1THSH 4AFUA 2BDAA 2JH6D 2R3UA 3CENA 1GVKB 3LGYA 1K1IA 5FHTA 4ZKNU 1CE5A 1GMCF 5F53A 4Q4LA 4O03A 1KXAA 1DLKB 2QY0B 2FMJA 3HGPA 1LHCH 1WUNH 4B6FA 1WCZA 2FDAA 3ZZAA 1BA8B 2ZWLH 2ZCKP 4B1TA 1AVXA 1GG6C 2EI7A 4KKDA 1EB2A 2GT7A 4H42U 3BF6H 2JIZD 1EAUA 1PQ5A 3LPRA 1O3KA 1K28D 1QBVH 2O8WA 2UUJB 1WBGB 4VGCC 1C5SA 2Z9GA 1IHTH 3A84A 1AI8H 1ARBA 1OHHD 7GCHG 1DWEH 8LPRA 3ZYDA 2CXVA 3TITA 1DXPA 1MTNC 2J34A 2J98A 2C4FH 2IOTA 1O5BB 3ENSB 3TH4H 1UTJA 1GCTC 2ASUB 5HMAA 1TYNA 3LDXH 1EJMA 2HNTE 3S7HB 3ZZCA 2J98B 2ZU5A 1YP9A 3KN2A 2OLGA 5CHAC 3EE7A 4X2YA 1EZQA 4D8NA 1O3AA 2IJOB 3SUFA 1RRKA 7GCHF 1V2VT 4BTTB 1HXFH 1AFQB 4XD7D 2KR7A 2WUBA 3RXOA 2VWMA 2ZFRH 1YPGH 3QX5H 4Y0YE 5LPEA 4OS6A 2BX4A 4JCNA 1DXWA 1TGSZ 2C8XB 1BTYA 1HUTH 1A3BH 5HGGA 3UNRA 1O3MA 1LKAA 2CF9H 1K1PA 2GMTB 1MTWA 2K8IA 1FY8E 4ABJA 1EZSC 5L30H 2FI5E 1W10U 1VZQH 2GTBA 3ZZ4A 1YLDA 1SL3A 3PV2A 4IMQA 2OUAA 4NIWA 1KXEA 3VEQB 1UVOA 4P02A 1AKSA 4JZIA 4IN1A 1HAPH 1HLTH 1O2NA 1YCPK 2FOAA 4YLUA 4ESTE 3FP7E 3D23A 2C3SA 3K9XB 3PB1E 3TPIZ 3AVZA 3NK8A 2AMQA 1AKSB 3F9GA 1COWD 4F48B 4HFPB 1DY8A 1WXRA 3UR9A 4AX9H 2BLQA 2LELA 1EAXA 3T5FH 2V3MA 1EQ9A 3ATKA 1DX5M 5HKKD 3PYHA 1C5WB 2BY8X 2BY9X 1B0FA 5JBAS 4HGCA 4A6LA 4I86A 2VWOA 3DA9B 3S7KB 1OXGA 3TH2H 1P03A 1EOJA 3OY6U 4I32A 4FUDA 1DVAH 1BRCE 2C8ZB 3GY6A 2FLBH 2FOHA 4X6NA 1C2FA 2G4UA 3A88A 1AWFH 1F0TA 3E8LA 2PKSB 4UONA 1H4WA 1IQNA 1O2QA 3F9HA 5G4BA 4BXSA 1TWXB 1UTKA 3W1EA 1C1NA 3GCHB 4MLFB 2A2XH 5F8TA 2OP9A 5ESTE 2GZ9A 1GI3A 1FUJA 3RXIA 1GI4A 1XX9A 2LP6A 3SI4H 2R9PA 4MNYA 1BT7A 5C0UA 1W0ZU 1O30A 1MMJN 1EZUC 3MHWU 3O8CA 3U1JB 1O3BA 1ELAA 4K1SA 1F2SE 3K65B 3SUGA 4U01A 1GMHG 1PJPA 1OWDA 1NROH 5FPYA 3SU2A 4WWYA 1ELBA 1VCWA 4IN2A 3FO8D 3SO3A 2Y5GA 2IJD1 3M36A 3RU4E 1S82A 3ZZ6A 3S9CA 1GJ4H 1FONA 4INLA 4GUXA 1KTTB 2O8MA 1BJVA 1GBDA 1E0FD 4IBLH 4YOGA 4YTAA 1GMHF 1W14U 5L2ZH 1DLEA 1E79D 1MBQA 1E35B 3UOUA 1K1OA 2BXUH 2UUKB 3SNEA 1FY4A 2VIVA 4NA7A 5FX6A 2KCYA 1MQ6A 3A7WA 2Z94A 4LK4A 1NZQH 1SVPA 3MOCA 1AWHB 1AFEH 2O8UA 2C93B 1AQ7A 2F83A 1TPOA 4TT3D 3TK6A 4DGJA 2B0FA 1OWHA 4UFDH 3L6PA 1MTSA 1C5QA 2FZZA 2ZNKH 3PROA 2ZC9H 3HKIB 2OK5A 1Q3XA 2ZF0H 1ABJH 2HVYB 2Y6TA 3PLBA 4M9FA 1YYY1 4ISIH 5GIBA 1P2NA 1ZOMA 1D4PB 3BTWE 4ZXXH 4H6TA 5GNDA 3SGAE 4IC5A 3AAVA 1ZTLA 4O9VA 4R0IA 1ZZZA 1FV9A 1SC8U 4AG2A 5B6OA 1HJAB 2F9NA 3F68H 1KIGH 2OC1A 3TJNA 1MU6B 2Y5HA 1ANEA 1HXEH 1D3DB 4WMFA 1S83A 3RXRA 1FXYA 2XCNA 2ZTYA 5EW2H 3K2UA 4ISHH 1NBMD 2SGFE 2FYRA 4INKA 2JJ1D 1HAOH 3A8CA 3F2FA 1V3XA 1GBKA 2BDCA 1MAYA 3S9BA 2GV6A 4A1VA 3UQOA 3LGIA 2THFB 5JDUB 4FUBA 3AASA 1E1QD 1AGJA 3FKSD 2XCFA 1TX6A 5E0JA 7LPRA 1LVBA 3MH6A 2JKHA 4ABBA 4GLYA 2VWNA 3SNBA 2XWBI 1KDQA 1UCYK 4A92A 2G52A 4X1PU 2KCOA 1OKXA 1THRH 1UCYE 3HK3B 1C2GA 2G55A 3BG8A 4NWKA 3SV9A 2K1QA 2W5EA 4Y10E 3BEIB 5T3HA 1GJ9B 1O33A 1LQDB 3A80A 2I6SA 2YMSD 3GY2A 2AGGX 2KM0A 2ZO3H 2FX4A 3EA9A 4GAWA 1LHFH 4UE7H 3DSGA 1GBCA 3PO1B 1OWKA 1XVOA 2ZU1A 1H1BA 1P2IA 1T32A 2VU8E 1YCPH 5EXNA 1L1NA 4JYUH 4FUEA 4CRAA 2BVSH 3KHVA 4YOIA 1C9TA 4K3JA 3B9FH 4XDEA 1A7SA 1QIXB 4AZ2B 4BAKB 1ZSKA 2P59A 1QA0A 1TX7A 2P95A 1M9UA 3TGKE 1GJDB 5I46H 3E1XB 1S6FA 3VB5A 2ZFTA 1V2ST 2M2AA 2OINA 1FN6A 5FL7D 5I25A 1V2NT 2SGQE 3KIDU 1QJ7B 2ZDVH 4MDSA 3L3TA 5L2YH 5KGOA 1HAHH 2VBCA 1CT2E 3ZZ9A 2DE9A 1Z8GA 1TNKA 3F9EA 1UVPA 1DUAA 1GL1A 3GOVB 1EB1H 3GCOA 1XMNB 3RXPA 1EPTC 1BDAA 4I7YH 4Q7XA 3P70B 3W94A 3ATLA 3VB7A 4AFZA 4LZ4B 1C4U2 1W7XH 3MU5A 3UFAA 2W6JD 2WPHS 3URCA 1Y3XA 2XOKD 1MU8B 3W95A 1GHAG 1CQQA 1QBOA 4YO9A 3UR6A 1O36A 2EI8A 2OC0A 1YPEH 1P0SH 3C1KA 1W7GH 2OC8A 3E91A 1LO6A 1ZYOA 4XFQA 3BG4C 1JRSA 3RXJA 2V35A 3UB0A 1T8MA 1VGCC 1GBIA 3BEFB 3LKWA 1VITH 3LGVA 3PV5A 5JPMH 1GHAF 1Y5UT 1O5AB 3DFLA 3MQKC 1GJ5H 1L4DA 3RLYH 3ZZ3A 4CHAC 3FAOA 1TBZH 3KF2A 1EAWA 4Y6DA 1BOQA 4Q80A 1SGRE 4X1RU 1ANCA 3BSQA 2UUFB 3KQCA 4KTCA 1L4ZA 1FY5A 1E37B 4ZKOU 3P8OA 3UUZA 5EPNA 4NFFA 3UY9A 5A8ZA 1HAIH 1GBEA 1C5VA 1NY22 4X8TH 3RXDA 3GDVA 4ABAA 1LPGB 2A7JA 3PTNA 4ZHAA 4D9RA 1BMLA 4MPWA 1NRQH 1ZHPA 4A1XA 4SGBE 2A5KA 1NU9A 2TGAA 1XUKA 4MPVA 4X2WA 1NRSH 2PSYA 1UO6A 3SU0A 3RXCA 1OYQA 1XKBC 2QXJA 5FPTA 1P12E 2Z9JA 1K22H 1WTHD 4JYVH 1INCA 1C5LH 1JIRA 2ZU3A 3TK5A 2ZCLP 3F2GA 1TGCA 2CK3D 2AGIX 3RMLH 1ESAA 1FIZA 1EX3A 1JIMA 2B5TB 1VCQA 5CDFE 4DOQA 1LCYA 4OS4A 1FI8A 1N6XA 1SQRA 2VH6A 3ZV8A 2GCTB 3CS0A 1W8BH 1BMNH 1OWIA 1P2KA 3OX7U 2WV5A 1OWJA 2XBYA 1NPMA 3TNTA 1ZPCA 1MH0A 3A85A 4XE4A 1GI7B 1GMDG 2R0LA 1E34B 2YOLA 2BM2A 3I29A 3DCLA 1BJUA 1YM0A 4R8TB 1O3IA 1EOLA 4TSFD 1J17T 1BTWA 2P3UB 3VPKA 2QXIA 1A0JA 3SORA 2Z3DA 1C9PA 1EXFA 2Z3EA 1QZ8A 3V13A 3S9AA 4NA9H 2BX3A 1V2KT 3DSPA 4NCYA 1DICA 3RMOH 1GI5A 2BVXH 3QWCH 3LGUA 2EEKA 1CBWC 4NZQA 3B8JA 4BTIB 1L2EA 3F0OA 3VGCB 2BD7A 1ELTA 3EGKH 4OM9A 5AFZH 1GDQA 5EIYA 1QB9A 3MO6A 1O2YA 1ESBA 5C3NA 3NPSA 1D3PB 1HAZB 2Z9LA 4X8SH 1SMFE 3GICB 3PMHB 2W7SA 3LC5A 1NBME 1VJ9U 1ZRBA 3HK6B 2P8OB 1F0RA 3H7TA 2WHXA 1BCUH 2C8YB 3SV7A 3A7TA 5EG4A 1FDPA 1C2JA 3A8DA 3ESTA 2RCEA 2OBOA 3R3GB 1KTSB 3KYFA 3M5MA 3RU4T 4B75A 2EQNA 1TNIA 2XTTB 4O3TA 2Q6FA 1Y3UA 5DKMA 2J95A 2RFKC 3A89A 1NFYA 4XBDA 4AFQA 3PRBA 1HGTH 4NIYA 1GJ6A 1C5MD 4BOHA 3SU6A 3LOXA 3K6YA 5JB8S 3SV8A 2BQ6B 3P8FA 5DGJA 1G37A 1P9UA 1FN8A 1JBUH 1MCTA 4WH8A 3TH3H 2YNBA 4YXWD 3PWCA 2A7CA 4IMZA 4MNXA 1OS8A 4Z1MD 3F9FA 4DIHH 1QRWA 1GI2A 1JOUB 2OTVA 1ID5H 1ZMNA 1QJ1B 1EFRD 1S5SA 3U69H 1ZRKA 1YY3A 1FX0B 4HG6A 4YT6H 1BBRH 4CRCA 1NTPA 1QB6A 2ZTZA 4CH2B 1LVOA 2AMPA 3LONA 3RXUA 1DDJA 2EY4C 3IG6B 1DFPA 1NFUA 5GJ4B 2WPDD 4YESB 1CHOG 2FWWA 2FS9A 1TNGA 2H5DA 1GVLA 2ZA5A 1AE8H 1IQKA 1SI5H 3PMBB 3P17H 2QF0A 1V2QT 1O38A 5LGOA 3JZ2B 4IGDA 3N99A 1AFQC 3QO6A 2GDDA 1O2LA 3F0PA 2FX6A 1T4VH 4I8HA 3U9AH 4E7RG 1UMAH 4I31A 4ZH8A 2TPIZ 5K0HA 1AUJA 4GVUA 2XWAA 4OGYA 4BTUB 3TJVA 2V3OH 4FETA 4NSYA 2BDHA 1MZDA 1SR5C 1S0QA 1O3JA 2BDGA 3NUMA 1CHOF 1C2DA 2H9HA 3BTKE 3MU8A 3RLWH 1O0DH 1K9OE 1O5FH 2AFQB 3GY7A 2PFEA 5K7RA 2GMTC 4B6EA 3PRDA 1XUGA 1QY6A 3MU0A 2GD4B 3OFND 1Q2WA 1SGFA 3SNDA 3UREA 6GCHG 2WYGA 1BTUA 2ZG0H 3BTTE 1ZPZA 4RKOB 4ABDA 1TRMA 3UNSA 1G36A 1TALA 1O2ZA 1SPJA 2A7HA 1C1OA 4MTBA 2FYQA 4JK5A 4O97A 4JZ1A 1XKAC 1HFDA 1B5GH 2QXHA 4OS5A 3ZZBA 4TWYA 1SLWB 3PLKA 2FM2A 2WV9A 3A82A 3HATH 2WZQA 2YNAA 1GHXH 4J1YA 3RXGA 2LNCA 1QL8A 4CH8B 4WJG2 2ZPQA 6GCHF 1T8OA 2IPQX 1SOZA 1C1UH 1RTKA 1D3TB 2WPJS 1X7AC 1BRAA 1VR1H 3BTEE 1QL9A 4UDWH 1AE5A 4MPUA 1DANH 1HYLA 1FJSA 2ZHFH 3SYJA 3M7QA 2AERH 4Y7BA 1Z71A 2BY6X 1QBNA 1ABIH 1DM4B 2HWLB 1UK4A 2QF5A 2WPMS 3VB3A 3TJOA 1LMWB 3GY4A 3SZEA 5IK2D 1P10A 5EW1H 3CP7A 2DUCA 2KFWA 2FLRH 1MTVA 4AB8A 4PROA 4CRGA 2PKSC 4M7GA 1KXCA 5E2PA 4B76A 1P8VC 4CBNA 1FY3A 1OOKB 5DG6A 1G2MA 2F9OA 1YPHC 1PPGE 4SGAE 1UVUH 1W3CA 1N8OB 3GCHC 1TQ7B 1BRUP 1UTQA 2UWPA 5FPSA 1GCDA 2AS9A 2UWLA 5FCKA 5F6MA 2Y7ZA 1PPCE 1KXBA 2EI6A 1IQHA 1ACBE 1F92A 5FBIA 4YLQH 3SZNA 3BIVH 4DT7B 3TIUA 1DT2A 1Z6EA 3RC4A 1C5PA 1IAUA 1TNJA 4BANB 4F4OC 2Q6DA 2ALPA 2LPRA 1Z1IA 4ABFA 4E05H 2ZEBA 4K8YA 1GBFA 1BHXF 2TRMA 1QGFA 2QCYA 3A7VA 2BY5X 2PLXA 1RFNA 2PGBB 3D65E 2FEQH 1TRNA 1OP8A 2M5TA 3NRLA 2FOEA 4CR5A 3RM2H 1K1LA 4X6OA 2BDBA 1MKXK 3BTDE 3TLOA 3ZZ7A 2Y7XA 2NU4E 1K21H 4CRFA 4YM9A 3GDSA 1HAGE 3RXSA 2F9UA 4CREA 2UWOA 2Z7FE 1A2CH 1C5OH 4Y7AA 3G01A 1C5RA 2B7DH 3GY3A 3UIRA 4IC6A 3RM0H 1HDTH 2VIPA 5A0AE 1V2TT 2HRVA 1XVMA 3MTYA 5CE1A 1BRBE 4ABIA 2R0KA 4UD9H 4GCHG 2PHBA 1WQSA 3M3VA 1ELEE 1NFWA 3M7UA 4X8VH 2F9VA 1GJBB 5C2ZA 1CGIE 5GXPA 4TPYA 1THPB 1Z6JH 2FOGA 2L6OA 1O3FA 1OP0A 1O2MA 6ESTA 2A5AA 2BD2A 3SHAH 3M61U
chains in the Genus database with same CATH topology
2XC4A 5PTPA 1WAYB 2FTLE 3NKKA 3RC5A 1O2SA 2ESTE 4GCHF 4K5ZA 1G30B 1SGQE 4ZHLU 5EGMA 5JBTA 4B71A 1YLCA 1RTLA 3AW0A 3MYWA 1V2LT 3P6ZB 4KP0A 2VVUA 3V0XA 3KCGH 1GHYH 1GGDB 2B9LA 3U8OH 3FZDA 2IN2A 5DK1A 1ZSJA 2VIQA 4DVAU 1O2UA 1QNJA 2ZTXA 1KYNA 3RMMH 1DWBH 1XUHA 1JRTA 1QRZA 4F49A 2FI4E 1FNIA 1UJ1A 3D62A 5C1UA 3O8RA 3SJ9A 3GYMA 1PPFE 3U8RH 3NZIA 1J15A 3MNXA 1GJ7B 2A4QA 1FAXA 1SGNE 1CGHA 1SLUB 2G51A 5LH8A 1L0ZA 1SGCA 1DSTA 1EATA 1TMBH 1RXPA 2BDYA 2OBQA 3PO1C 1TMUH 5FCRA 1QB1A 3GY5A 3KNXA 1IQLA 2ODQA 2ZGJA 5GDSH 1UTNA 1ELFA 2SGEE 4ZKRU 4OS7A 4LZ1H 4Y79A 2QC2A 1UTMA 1ZJDA 4FUFA 3C27B 1CA8B 3BTGE 5FBEA 2ZHQH 3SNAA 2ZPRA 1IOEA 2R2WU 4X2XA 1AO5A 3SHCH 1SGIB 3M7TA 1V2WT 3ZVGA 1KDQB 3MMGA 4JMYA 3SJ8A 4CRBA 1GBJA 3MU1A 2QAAA 1GPZA 1O2KA 4IW4E 3BV9B 3ODDA 1A0LA 2BD8A 1TOMH 1G3DA 4D7GA 2BQWB 4Y8YA 1GJ8B 3PMAB 1TNLA 3T29A 3EAJA 3GYLB 4AORA 4MNVA 1SFIA 4WF8A 1V2MT 1Y59T 4GSOA 1BITA 1QJ6B 1KY9A 1P2QA 1WU1A 3M5OA 4KTSA 2BLVA 1G3EA 3LC3A 2H6MA 3GDUA 3MNSA 1IQEA 4I8GA 5AFYH 3M3SA 3DHKH 2ILNA 2FESH 3SBKA 1GBAA 3RXVA 5AVDA 2CGAA 1YPKH 4FVDA 2P3FH 5EXMA 1QRXA 3ATIA 3ZZDA 1ZTJA 3KGPA 5A0BA 6CHAB 1NM6A 3ZV9A 3ZZ8A 1N1LA 3LT3A 1J16A 4UFEH 1TE0A 1QR3E 3U98H 2VVCA 5J4QA 1C2IA 2PTNA 1AB9C 2RA3A 9LPRA 1CA0B 2G8TA 1UVSH 1C1VH 1Z8RA 3PLPA 4KGAA 5EU8A 1A0HB 4DURA 1CVWH 1MD7A 4KTUA 3IWMA 5E0GA 3ODFA 3SQEE 1NU7B 1SGEE 1O5DH 4ZROA 1ARCA 4FU8A 1P9SA 1RD3B 2Q6GA 2JH5D 3EA7A 4ZMAH 2ZIQH 1RGQA 2V3HH 1Z7KA 1ZMJA 4NIVA 1NT1A 1GBMA 2RG3A 4ISLA 1LTOA 1TPPA 1PPEE 4DIIH 1L1JA 1G32B 1CU1A 2QIQA 3UWJH 1SB1H 1MUEB 1BTZA 2HOBA 4CR9A 4Y71A 5EQRA 5BPEA 2WPLS 2C8WB 1DITH 3UNQA 1O32A 2STBE 1FPHH 5FXLA 3SGBE 1DWCH 5EPYA 5F8XA 4K60A 1SFQB 1BQYA 2AYWA 3TJUA 2XW9A 3WY8A 3KEEA 1A46H 1BIOA 1W13U 1XUFA 5AF9H 2A32A 1S81A 2SGPE 1O39A 2P3TB 1KLIH 2TBSA 1EASA 3O8BA 1GDNA 2GCTC 2GGVB 2ZDKA 1GWAA 2O9QA 2ZHEH 2HLCA 2V6NA 4I33A 3GY8A 2D8WA 1MKWK 3DD2H 3A81A 3B23B 1UHBA 3FVFB 3R0FA 1C5NH 3Q76A 1LVYA 1PFXC 4BAOB 1KXDA 4WXIA 1F5KU 1QQUA 3RXLA 3ZVCA 2A5IA 2PV9B 2ZGBH 1C2KA 1J8AA 3LGWA 1Y8TA 1FZZA 1UHBB 1TOCB 4ABGA 4CHAB 1P2JA 4LXBH 1A5IA 1EAIA 4AGKA 1YCPM 2G00A 4NSVA 1IQJA 1TIOA 1RIWB 3STJA 4H4FA 4JZDH 2WUCA 1GHBG 1JMOH 4ISOA 1GDUA 2BOKA 1VJAU 4DJZB 1TA6A 1K1JA 3QDZB 2Y80A 4E7NA 2G5VA 2OQUA 3SUDA 1DPOA 4Y8XA 4AFSA 1O3DA 3JZ1B 5C1XA 1Y3WA 2WPKS 2AMDA 3NWUA 4AN7A 2P93A 3VGCC 4D76A 1QURH 2EC9H 5DP3A 4K1EA 1O5GH 2P16A 1J9CH 1UTOA 1XM1A 1GHBF 2W3IA 5EQQA 1FLEE 1P2MA 2ULLA 2HPQH 4ASHA 1TBRH 2BLOA 4RSPA 3SW2B 1V2PT 1S6HA 1QL7A 1W11U 1XXFA 2ZFFH 1VITG 2ZU2A 2ALVA 3UOPA 2QN5T 4AGJA 1GMDF 2P8OC 2FP7B 4AG1A 3I78A 3T28A 1UCYH 1EP5A 1B0EA 3Q77A 3M37A 4WMDA 2VNTA 1E36B 1HAVA 2BVRH 3LGTA 5DP5A 3PMJA 2ANKH 3Q00A 2RDLA 4OS2A 1JWTA 3UTUH 5A2MH 1TNHA 1MCVA 3BTFE 1C1PA 1C1RA 1HAVB 5AHGH 1ZSLA 2NU3E 3KQEA 1VITF 1V2JT 3A86A 4YOJA 2HNTC 1BTXA 3M5LA 2H2ZA 1TAWA 1TGTA 2CN0H 2ZDNA 1NRPH 1C1SA 4FUIA 4ABHA 5IYTA 1C1TA 4U2WA 1F0UA 5JBCS 4IS5A 1HJ9A 5SGAE 3IITA 1IQIA 3P92A 4BAQB 3SJKA 2ZCHP 2J4IA 3MU4A 1LHEH 4UFFH 3TVJB 1G3CA 1YBWA 2G5NA 1TRYA 2CMYA 5EODA 3BTME 3FZZA 2EA3A 8KME2 1SSXA 1LKBA 4FUCA 4FVBA 2OD3B 3UPEA 4XSKU 3Q3KA 8GCHG 3E0NB 5E8EH 1UK2A 4ZAEA 1ZPBA 1AUTC 1DOJA 2G81E 2OCVB 1TX8A 1UVTH 2XXLA 1FAKH 1LPZB 3RXHA 2GVFA 1LVMA 2Y82A 4NA8A 2JETB 1FQ3A 1C2HA 4MQAA 5EXLA 3RP2A 2FO9A 1RTFB 5ABWA 1TABE 2QF3A 5HXFA 1H8IH 1CT0E 2A0QB 8GCHF 1IQGA 2TIOA 4JZEH 3A7ZA 3PM3A 3A87A 1O5EH 1DY9A 5DP6A 3HKJB 3NCLA 3QZQA 1OYTH 4QT8C 1C1MA 1A5HA 3RC6A 3QGNB 1ANDA 1WYKA 3P95A 3E3TA 1QHRB 4BAHB 1O5CB 1B7XB 2VGCB 1TPSA 1AN1E 1NS3A 3V3MA 1G3BA 5GPIB 1AD8H 1AZZA 5DPAA 3SV2H 1TLDA 1NFXA 2ZGCA 4X1QU 5LPFA 2BDIA 2CHAB 2PKAA 2OQ5A 3GCNA 5A8YA 3H7OA 3SU5A 2QGRA 1HAXB 1EJAA 1GI1A 2ANYA 3Q3XA 2PW8H 5IDKA 1GL0E 4DW2U 1ORFA 1GHVH 3OY5U 1T8NA 1CSOE 3BN9A 3QGJA 4AB9A 4TWWA 2F9PA 2PKAB 1ELDE 1E38B 1P2OA 2A31A 1G2LA 4Z0KA 1ETSH 2F91A 1GBHA 3TNSA 4B2AA 4FUGA 1EKBB 3ATMA 2FPZA 2ZQ2A 1HNEE 1N6YA 3O8DA 2GP9B 4MPXA 1FY1A 2TGDA 2KAIA 2SNVA 1C5ZB 5TCCA 1MKWH 1EUFA 4A7IB 2Y81A 1C5TA 1IQFA 2Z3CA 2BD4A 5DP9A 1O3OA 1ETRH 5DP4A 2SGDE 3BIUH 2KAIB 4FUHA 1TB6H 4NWLA 1SGPE 3EQ0H 1P09A 1GG6B 1SOTA 2CJIA 2G4TA 1AIXH 2Z6BD 4O3UA 1N8OC 1A4WH 4VGCB 3T2NA 2ZGXH 3PTBA 4BAMB 3SGQE 1U6QA 2BZAA 2Y5FA 1TPAE 2FI3E 1MTNB 1PPBH 4GPGA 3ZYEA 2BXTH 1YC0A 3EDXB 4ABEA 3BTQE 2NU1E 1GCTB 3ZVAA 3E16B 1V2RT 2B8OH 4H6SB 2ZGHA 3HPTB 2ZHDA 1TGNA 5CHAB 3VFEA 2ZP0H 3AW1A 1SGYE 5FAHA 3HGNA 4UEHH 1GJAB 1O3HA 5DP8A 3SOSA 1S0RA 2F3CE 3VB6A 1TFXA 2QYIA 1PYTC 1QCPA 1O3NA 5TCAA 1Z8IB 1DS2E 3SU3A 3FP8E 2BZ6H 2BD9A 1S84A 5A09A 2HGTH 1C2EA 5L6NH 1H9IE 1P01A 1BTHH 1ETTH 2BLWA 4A5TS 1TMTH 5JB9S 2TGPZ 2GT8A 2ODPA 3M5NA 1O2JA 4ZKSU 4NIXA 3LH1A 5HYOA 2W3KA 3VXEH 4J2YB 1O2HA 1O3CA 1Y5BT 1F5LA 1KLJH 3I77A 5DP7A 3RXKA 2FTMA 1GI9B 3LJJA 2AEIH 3FANA 1AZ8A 2WYJA 3STIA 1HPGA 3ELAH 4U32A 4FU9A 4NG9H 1OP2A 1C1QA 2FOMB 2XNIA 2JH0D 1MBMA 1FIWA 1A5GH 1A3EH 1HJ8A 1D6RA 3ZZ5A 4Y0ZE 1BMMH 1WV7H 4ZXYH 2PGQB 4RN6A 3SNCA 3SJIA 2ANWA 1SHHB 2ZDAH 1QQ4A 1HBTH 5E0HA 2VH0A 3MH7A 4U30A 4NGAH 4Y76A 1GGDC 2ZKSA 1J14A 5ETXA 1O2XA 4ZHMU 3GISB 1O2TA 1BUIA 1O2GH 1T4UH 2SNWA 2QV1A 1XXDA 2GKVE 2A4GA 4TYDA 1P04A 1IQMA 3UWIA 1V2UT 3RXFA 3T27A 1YGCH 4JZFH 4X8UH 5FX5A 4GHTA 3A8AA 2AIQA 1XUIA 5EQSA 3SI3H 1HJAC 1O3EA 5GCHG 1SLVB 2A4OA 1C5YB 2XC5A 3E90B 3TU7H 1C2MA 4X1SU 3M3TA 3OSYA 4Q2KA 8ESTE 3MO9A 2GCHG 2ZHWH 2FODA 3RDZA 2XBXA 2O8TA 1P3CA 2VIOA 1HCGA 4K1TA 3A7XA 4K69A 4OGXA 1O3PB 1C5UA 5GCHF 1YPHE 5TJXA 4Q7ZA 2BB4A 3RXBA 4DCDA 3VXFH 4B74A 1CGJE 4D7FA 1P3EA 3LH3A 2VJ1A 3H5CB 2GCHF 1GI0A 3BTHE 4X2VA 5T6FA 1C1WH 3MO3A 1C5XB 2GX4A 4FU7A 2Q1JA 4JYTA 4NFEA 3NXPA 2WPIS 5E2OA 4CRDA 2NU0E 3PV4A 4HTCH 1K2I1 1GHZA 1K1NA 1O2IA 1F0SA 2H9EH 2GV7A 1WSSH 3EA8A 1C2LA 2NU2E 4XBBA 1ZTKA 2O8LA 1AU8A 4A1TA 3MWIU 2D2DA 1ZMLA 1TQ0B 3SJOA 1YPJH 1DUEA 1D3QB 2HALA 1SGDE 3AAUA 5C1YA 1KSNA 1T31A 2SFAA 2ZZUH 2QXGA 1SLXB 3SQHE 1RJXB 3SU4A 3DUXH 2J92A 1H9LB 4AOQA 2ZPSA 3ITIA 2ZDMA 1OX1A 1LHDH 1NRRH 1GI8B 1C4Y2 1P57B 5JYIA 1C4V2 4Z6AH 1ZGIA 2H1UA 4MG3A 2RA0A 2FOBA 1CHGA 2ZU4A 7KMEH 1V6DA 1O3GA 1PQAA 3K6ZA 4AYVB 6CHAC 1L1GA 2A45B 4GHQA 1H9HE 2GZ7A 1SBWA 1AMHA 4BXWA 1YF4A 1MQ5A 1KXFA 1EZXC 2UUYA 3KQBA 2OC7A 2AH4X 1CA0C 2PUQH 3MH4A 3ZVEA 1OPHB 1W2KH 1QFKH 2OXSA 4ISNA 1P11E 2NWNA 1O2WA 4XBCA 1BHXB 3URDA 4YT7H 5JBBS 4X6PA 2BMGB 2VWLA 2PTCE 2VVVA 1K1MA 3S69A 1GBTA 1GVZA 4NZLA 1GJCB 3L33A 1TA2A 2AGEX 1NESE 3FFGA 5C5NA 3EE0B 6LPRA 1PQ8A 1O31A 1Z1JA 1UTLM 2BOHB 1ESTA 2ODYB 2ZI2H 3LJOA 3LIWA 1BTPA 4INHA 2C90B 3SV6A 2P94A 3RXQA 3TGJE 1ANBA 1MKXH 3EYDA 2WINI 4MNWA 4TPIZ 4LOYH 3GCTG 1ELCA 1ELVA 7ESTE 2Z9KA 3RUOA 1P06A 2A4RA 1OSSA 1VCPA 3E6PH 1ZHRA 2HNTF 4B73A 1TGBA 1A1RA 3MNBA 1HB0B 1Y3VA 2FS8A 1LPKB 3VB4A 1QTFA 1EPTA 1O37A 2A1DB 2I6QA 3T62A 1BMAA 1T8LA 4E06H 1O34A 4I8LA 1LHGH 1BBRK 3GCTF 2STAE 4CBOA 3KL6A 1EPTB 5A0CA 1BBRE 3RXTA 4WXVA 1CO7E 4WH6A 4DG4A 1SHYA 1PQ7A 3Q3YA 1G9IE 2XBVA 2XYAA 9ESTA 2BD3A 1EP6A 1AB9B 2VINA 1RIWC 3SUEA 3P8GA 3QTOH 3U1IB 1NRNH 2FOCA 2ZFQH 2ZFSA 1NC6A 2BYAX 3FP6E 2IPHA 1NN6A 1MZAA 3BG4B 2Z9IA 2FOFA 5EOKA 5H4IB 3OTJE 5C20A 2DE8A 1ZR0A 3A83A 3UQVA 3SU1A 1A61H 4D9QA 4X0WU 1VGCB 1F5RA 1O2PA 1S85A 5DJ7A 3TGIE 1Z8JB 5A8XA 2HPPH 5HM9A 1GHWH 3ZVFA 5T6DA 4B2CA 3QUMP 2R3YA 2J2UA 3RXAA 1SGFG 4WY3A 5ESBA 1ZLRA 1RS0A 2FXRA 1WOFA 3T25A 3KQDA 4UFGH 2BHGA 3MH5A 1IHSH 2ZQ1A 1YKTA 3BEUA 1DWDH 1ZGVA 2H5CA 2J38A 2W7UA 2VB0A 2D26C 1DSUA 2W26A 1FPCH 4ZUHA 2J94A 1GBBA 2BD5A 1YPMH 3V7TA 2XC0A 1PPZA 1GBLA 3RMNH 3SN8A 1LDTT 3MI4A 3MFJA 4HI3A 1AVGH 1HV7A 1OWEA 3QN7A 1XUJA 1HIAA 3T26A 2QA9E 3A7YA 2PWXA 1F7ZA 4OS1A 4YZUA 5C67A 4Q7YA 3QLPH 4RKJB 4DY7B 2CF8H 1JXPA 1PPHE 2AIPA 2ZFPH 3ZVBA 5CMXH 5GWZA 4I8JA 5F8ZA 1AY6H 3F1SB 2FIRH 3PWBA 1HIAB 1O2OA 1TONA 1W0YH 2ZECA 2A2QH 2H9TH 1UTPA 4TY7A 1O2VA 3DFJA 1ZJKA 1HAYB 2GDEH 2BY7X 1SQTA 2F9BH 1YPLH 1P02A 1ELGA 3QZRA 3RXEA 2TGTA 3S0NA 1SQAA 3MNCA 4JK6A 1Q31A 1WQVH 4B2BA 1SGTA 3OYPA 2D1JA 5F03A