4X1QU

The crystal structure of mupain-1 in complex with murinised human upa at ph7.4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords mupain-1
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1qU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1qU01
3Q00A 1KXFA 2ALVA 3RXVA 1ZSJA 1HJAC 4B1TA 1RD3B 2JH0D 4H6TA 5DPAA 2TPIZ 1RIWB 1BJUA 3RMOH 1ZHPA 3MNCA 1W10U 1AHTH 3LONA 1FONA 4BTIB 3ZVDA 3LJOA 5GCHG 2SNWA 1GG6B 3HKJB 3AAUA 1TGCA 3W95A 1O2RA 1DITH 1D3QB 3MYWA 3PMHB 3RXIA 1TPSA 3C27B 4A1XA 4OS5A 2P94A 2BDAA 1C5NH 5A8ZA 1MAXA 1T31A 1IQJA 4UEHH 2GMTC 1GBAA 2HPQH 4NG9H 1TMBH 2ZDAH 4JZDH 1HCGA 3RLYH 4A1VA 4J1YA 1YPLH 1L4DA 1P2QA 1HAIH 1YP9A 2BLVA 1BTHH 3RC5A 2JH6D 4DVAU 1A7SA 1GBLA 1GMCG 1DXWA 2AGGX 4AB8A 1C2DA 3SQEE 1AN1E 1Q2WA 2ZU3A 3SV7A 1MZAA 3QK1A 3KQCA 1PQAA 2BDIA 1DS2E 2FOGA 2ZEBA 1HAOH 1KTTB 1AFQC 4K1EA 2C8ZB 2F83A 1V2KT 5EW2H 1CVWH 3UQOA 1SFQB 3EA9A 3SU1A 1ETSH 1WYKA 2Q1JA 4Q7ZA 3A89A 3UQVA 1CGHA 1GJAB 4CHAC 1TX7A 4OGYA 3MWIU 1O2WA 2GCHG 2XC0A 2XYAA 6GCHF 1AMHA 1AVWA 2FLRH 3KGPA 2BQ6B 1QHRB 4KP0A 3ZYDA 4BAKB 3Q3KA 1HIAB 1FIWA 2CHAC 4IN1A 1T8LA 3KL6A 5T6FA 1GHWH 2AMQA 2KAIA 2BOHB 1TABE 1LMWB 3GICB 4I33A 5JPMH 1DE7H 1G37A 5I46H 1QL8A 1EAWA 4ABFA 3PM3A 2Q6DA 3GY2A 2J95A 4E06H 1SLUB 2SFAA 3RDZA 1F2SE 4GCHG 1MMJN 3PMBB 1MKWK 4F49A 3QN7A 2HPPH 3UFAA 3QZQA 1NU9A 4H4FA 1EAUA 4ESTE 1OX1A 1XXDA 3ZZ7A 1QJ6B 4O3UA 1ZLRA 1Y5UT 4WVPE 1P04A 3RLWH 1Y5BT 4ASHA 1HB0B 1LPGB 1EAIA 1BUIA 2C8XB 1GHAF 3S9AA 1C2IA 4CH8B 4JK5A 2XRCA 2P8OB 2V6NA 4BXWA 1ZSLA 1ZRBA 4X8SH 1GBJA 5GDSH 2NU2E 4DT7B 5FPSA 1OWKA 3ODFA 1XUGA 5DP7A 3B8JA 2EC9H 4FU8A 1UTJA 1MH0A 4HTCH 1Z8JB 1TX8A 1GJ7B 2HOBA 3K2UA 3K6ZA 1YPKH 4FU9A 4AX9H 2PUQH 5JB9S 1DX5M 1GI2A 1H9LB 4Y76A 1O5EH 3O8DA 2UWPA 4JZIA 2FI3E 2FOHA 2Q6GA 1O3OA 2A7CA 1V2LT 3ELAH 1GHXH 1XKBC 1XVOA 1NESE 1VITF 3FP6E 1O3MA 2JH5D 1Y5AT 5L2YH 1DLKB 1LPKB 4THNH 3RXMA 2G4UA 2ZGCA 4UDWH 2Z94A 1D3DB 2ANWA 2UUFB 1DXPA 4ZHAA 1DANH 1K1NA 3U8TH 1YPHC 1YBWA 1P01A 3UIRA 1WQVH 3F6UH 1AE5A 2FOBA 2WPJS 2PTNA 2Y82A 1NFXA 4JZFH 1RRKA 2BMGB 1BMMH 4RSPA 1SGDE 2OBQA 2XWAA 2IPHA 1Z8IB 4QT8C 2ZO3H 1OP8A 3S7HB 3M7QA 4IC5A 5CMXH 2HNTE 4K8YA 4XBBA 1BB0B 4WF8A 5J4SA 2F9NA 1ELAA 2G8TA 1W7GH 1NY22 1T8NA 1AD8H 4IC6A 2G5VA 3NZIA 1GJBB 3SGBE 1TX6A 1UTQA 4OS1A 2WV5A 3RU4E 2F91A 2GKVE 4BXSA 2GZ7A 1QRXA 3GCOA 2HNTC 5DGJA 1TIOA 2VWNA 2PWXA 3EYDA 1O31A 3ZZ4A 1FY5A 2PHBA 1SGFG 3P95A 1LTOA 1QL7A 2CN0H 1DY8A 1DUEA 3SNEA 2EEKA 3TU7H 3GOVB 3M7TA 1O2LA 5EQRA 5ESBA 1AUTC 3ZVBA 3ATKA 1GHZA 2AS9A 2PSYA 3E90B 1EATA 2R2WU 1G3CA 4I8KA 1O5AB 5A2MH 4YESB 1P3CA 5T6DA 2FTMA 1ZTKA 2R3YA 1JMOH 1HGTH 4JZEH 1TNJA 2ULLA 4MLFB 4XSKU 1O2UA 1QB1A 1BIOA 1O3NA 1MUEB 1CHGA 3PWCA 3IG6B 1OWHA 1NM6A 3NK8A 3T2NA 3HK6B 1A46H 5C1YA 4NA8A 2GV6A 1DLEA 3HGPA 3MU4A 4BTUB 2J94A 1GJ4H 1V2NT 4KGAA 5DJ7A 1DFPA 1VJ9U 4D7FA 2CF9H 1GI5A 4INKA 4DG4A 2ZCLP 3MOCA 2QXHA 1C5ZB 3U1IB 1ORFA 1CHOG 2QF0A 1GJCB 4X2XA 1NRQH 2HALA 4NFEA 1O2TA 1DUAA 3OSYA 4B75A 3RXJA 3Q3XA 1F0TA 1TMUH 5AHGH 4B2CA 2AERH 2YOLA 2ZA5A 3RXLA 2FOAA 1QBOA 3IWMA 1Z8RA 3WY8A 3MO9A 1LHFH 4K5ZA 1Z1IA 5EPYA 1CA8B 1MKXK 3M3VA 3MH7A 1EZUC 1QCPA 1NTPA 1PPCE 2SGEE 1HAHH 2ZTYA 3M5LA 3U98H 3M37A 1FY4A 2ZHFH 4LZ1H 1DT2A 1TNKA 1YLDA 2G52A 4AFUA 5JB8S 1TPOA 1IQKA 1V2ST 1GHBG 1C5OH 4U32A 1HAVB 3ESTA 1HXEH 2BVSH 1O3BA 1PYTC 2G5NA 3OTJE 5ABWA 2A5KA 1THRH 1AZ8A 1GCTB 4K1SA 3F9HA 1ETTH 1W3CA 2G00A 4TY7A 5DKMA 2RA3A 1MKWH 1IQMA 4NIVA 2PGBB 1OPHB 1T8OA 4ABEA 1P09A 1BMNH 2SNVA 3GCHB 1GBFA 4X1PU 1LVBA 1AQ7A 1LPZB 4B76A 1JWTA 1FI8A 3LH1A 4FUJA 1UK3A 2CJIA 2RDLA 3A8DA 3NPSA 1GMDF 1GBEA 1BTUA 3P8OA 4ZKSU 2FO9A 1FV9A 1ABIH 2R3UA 3ZZ8A 2VINA 4AGKA 1V2TT 5JBTA 3PLKA 3F9FA 3M3SA 3KN2A 3URDA 1G3BA 1T32A 3LGIA 2PFEA 1M9UA 3QTOH 1F0RA 1ZJDA 4R8TB 3A7TA 3SU2A 1CGJE 2ESTE 3L33A 1FLEE 3RXAA 1S84A 3S7KB 4GPGA 3VPKA 4XFQA 1ELDE 1P05A 2B5TB 5FCKA 1O5CB 5EG4A 1C5MD 2RG3A 2ASUB 4RKJB 1UK4A 3RXQA 1O37A 3UNSA 8GCHF 1SGTA 2VIWA 3P92A 1HV7A 3ZVAA 3T28A 1J16A 1P10A 3RXKA 1EP5A 2BM2A 1P02A 2F9PA 1NN6A 1QQ4A 1WAYB 3V12A 4I31A 2YNBA 1LKBA 1CT0E 1TONA 1YLCA 2AH4X 3LIWA 3RXCA 1AY6H 4GUXA 3TJUA 1HDTH 1SL3A 2A2XH 1O33A 1SOZA 4FUEA 4X6OA 2G4TA 3KHVA 1ELFA 9ESTA 4YOIA 2W7UA 1C5QA 4FUHA 1DWCH 1C2LA 1W11U 4O3TA 1O2VA 1C1WH 1V2MT 7GCHG 1SLWB 3FAOA 3A7YA 3E91A 1KSNA 4HI3A 1GL0E 1N6YA 1EXFA 1YPMH 2ZHDA 3QGJA 5AFYH 3FP7E 2O9QA 4U2WA 2ZHWH 2C8WB 4X6PA 1ZMJA 1SGFA 1BZXE 3V0XA 2XBYA 1IQNA 1HJAB 1T4VH 3MH4A 1ELVA 3MFJA 3TPIZ 2J4IA 2Z9KA 2UUKB 3TJVA 1O3CA 3PTNA 5DG6A 3SU5A 2PLXA 3T29A 5GXPA 1SGCA 3D65E 5EOKA 2A1DB 3BF6H 5E8EH 2JETC 1TOMH 2OP9A 1C5UA 1NO9H 3QGNB 3RXDA 1EQ9A 1RTFB 1JOUB 1CU1A 2BLOA 4WWYA 1UCYK 3GDSA 1Y3UA 3LJJA 3RU4T 1ZHMA 3OY6U 3P8FA 1AVGH 1A0JA 1H1BA 1O3EA 1A0HB 1DVAH 2H9TH 4NA9H 2EA3A 2ZU4A 4LZ4B 2GMTB 1FMGA 1TPAE 2SGPE 1UMAH 5A8XA 3SUEA 5FX6A 3OX7U 1UTPA 1AI8H 1L1NA 3BTDE 1BTPA 2BB4A 1SPJA 1JIRA 3SU4A 2D26C 1P2NA 1Z7KA 3MMGA 4M7GA 3STJA 5GCHF 4Y7AA 3NCLA 4DIHH 2H9EH 1WQSA 4NGAH 1ZHRA 7KMEH 3N7OA 2FLBH 1ARCA 4NWLA 5HGGA 1UTOA 3SQHE 1BHXF 1N8OC 5CHAC 5HMAA 1GVKB 1O2YA 1QB9A 2FIRH 2H5CA 2WV4A 1ELCA 1ZSKA 3GYLB 2BD4A 4YLUA 1QRZA 3RMLH 1KXCA 1MTUA 1K22H 3LGUA 1E35B 1XM1A 1MKXH 3ZZ5A 1JRSA 1AFQB 2ZFTA 3UREA 1O3HA 2Y5HA 1F7ZA 1BCUH 1S81A 1VZQH 3SI4H 4DIIH 2G81E 1C1MA 1OKXA 3RXRA 3A87A 3SORA 1T8MA 5TCCA 1QL9A 2A2QH 2FYRA 4YOGA 1O38A 3UR6A 1SGQE 4CHAB 1OOKB 4NZLA 3FANA 4Y11E 1RJXB 4BANB 3A7VA 2THFB 1MTSA 1GMCF 1W0ZU 1SGYE 2BLQA 1SHHB 3UWJH 2A32A 1P11E 4ZUHA 2QY0B 1BITA 1TNIA 1FXYA 2CHAB 1EB2A 5C2ZA 1C5WB 4OS6A 1ZPZA 1SBWA 1O2KA 2OC7A 2QAAA 4MPVA 3SJIA 3OY5U 4ISHH 3SOSA 1F5LA 1OWDA 2BDCA 3UOUA 2BD8A 3TNTA 1ZTJA 4Y6DA 4X8UH 1RS0A 3E6PH 1G30B 1EOJA 2ZDLA 2HRVA 2R0LA 2ODYB 2RCEA 2ZGXH 1UK2A 1B0EA 2DE8A 2ZP0H 3PYHA 1GBDA 2XW9A 2CXVA 2GCHF 4H42U 1SSXA 1K1MA 3F9GA 5EGMA 4CR5A 3MO6A 1FJSA 2QV1A 1ZOMA 2FPZA 2GGVB 2VIOA 3NXPA 4WJG2 2H1UA 3P6ZB 1TGSZ 2GX4A 3I29A 5C1UA 3S9CA 1FN6A 1TGTA 4K1TA 2P3FH 1BOQA 1PFXC 4DGJA 2AIQA 3NWUA 1TB6H 2BDYA 1SGNE 1TRNA 2P95A 1O2MA 3SBKA 2GV7A 1ESBA 2I6QA 3DT0H 2FOMB 5DK1A 1C5PA 5F03A 4GCHF 1P06A 1K9OE 1SQOA 3M3TA 4TYDA 5J4QA 2NU1E 2O8LA 4WMDA 1JRTA 3P17H 4FUFA 1GJ6A 1UVUH 4AOQA 5FAHA 1C1PA 1F5RA 3UNQA 5FHTA 3JZ2B 2F9UA 4K8BA 3VB5A 4I7YH 2QC2A 1EJAA 2V0BA 3F9EA 1ANBA 1FZZA 1O3PB 1OYTH 2FYQA 8LPRA 1HAZB 3PMAB 2XC4A 5GPIB 1QTFA 2XCFA 1TMTH 2ZTXA 2OUAA 1ESTA 3QDZB 1EP6A 3BTKE 3E0PB 1KLTA 1FIZA 3BTTE 4O97A 1TLDA 1GBCA 2OQUA 3GY5A 5C3NA 4NFFA 2J34A 4AFSA 1GI0A 3PLPA 3SNDA 4ABDA 5DP6A 1O3GA 2ANMH 1KYNA 1K1IA 2BXTH 1CE5A 2AMPA 2TGDA 4I8LA 3V7TA 3LGTA 1D3PB 2CMYA 4J2YB 1QY6A 4Z0KA 4XOJA 1Q3XA 2Z3EA 2C93B 4FUIA 3TLOA 2TIOA 1IQLA 4NIYA 4GAWA 3A8CA 2OC8A 2QXGA 3MO3A 1D6RA 2HGTH 1AKSB 4LXBH 4HGCA 1GGDC 4U30A 2PGQB 1BRCE 4OS4A 1NFYA 1OYQA 2AFQB 3I78A 3SGAE 4AG1A 4CBOA 1PPBH 1UCYH 2Y5GA 4ZXXH 4KTSA 1W7XH 4K2YA 1EASA 4WY3A 4FVBA 1QNJA 2ZFFH 2BD5A 1O0DH 3F1SB 1NRSH 4DY7B 2QGRA 2AGEX 1EZQA 1GBKA 3AASA 3QUMP 4Z6AH 1FY1A 4CREA 1H9HE 1KLJH 5I25A 1IHSH 4ISOA 3NUMA 1EZSC 3VEQB 1UHBB 1S0QA 2HVXA 1XX9A 2FZZA 3ATLA 3KEEA 5DP4A 1AWFH 1OP0A 5E0JA 3GYMA 4MPWA 2Y7XA 4NIWA 3STIA 4X6NA 4IMZA 3P8GA 3BV9B 3SHAH 1RTKA 4Y0YE 1WBGB 1TNGA 1C2HA 3PO1C 1S85A 5C5OA 1E37B 1V2QT 1MD7A 5FXLA 4IW4E 3A84A 4ZAEA 2Z6BD 4DOQA 3LGYA 5F8ZA 1J15A 3PMJA 2PUXB 3SN8A 2CF8H 3U8OH 4XE4A 1FY3A 1TYNA 2NWNA 3SJ8A 1ANDA 3BTHE 3PTBA 1LDTT 2O8UA 1O30A 1BRBE 1HXFH 4CRGA 2Z9IA 1H4WA 2A7HA 1DPOA 3DFLA 2ZDNA 3M35A 4UONA 1ZGIA 3MNSA 1K1PA 1ZMNA 1HPGA 2VWMA 2IJOB 3C1KA 3SGQE 4UFEH 1OWIA 2V35A 1A3EH 2BX4A 1IQFA 2OBOA 2BY5X 4AN7A 3SV9A 3LH3A 2ZU5A 2W3KA 1CHOF 1HAVA 2GDDA 1S6FA 1C2KA 1EX3A 4JYTA 6CHAC 1O2GH 2PKSC 1FPHH 1C9TA 1CT4E 2VWOA 2FS8A 1AE8H 1HAGE 2ZFRH 4E7NA 1G3DA 1JBUH 3QZRA 3RU4D 4HZHA 4ZKRU 1KLIH 3JZ1B 2BQWB 1QURH 2PSXA 3RMNH 2P3TB 2FOFA 1AIXH 1C1SA 1SGRE 5C67A 3ZVGA 2PTCE 1FNIA 4TY6A 1E0FD 1QR3E 1VCWA 3M36A 5JBCS 3QX5H 5FBIA 2R9PA 1P03A 2B8OH 1IOEA 2AYWA 4BOHA 1GBMA 2G51A 1TBRH 4ABGA 3P70B 3ZV9A 5LPEA 5L30H 1TWXB 2SGAA 3KQEA 3SV8A 3DUXH 4NIXA 1Y3YA 1GHBF 1GI9B 2GP9B 1UVTH 1T7CA 3SU0A 5H4IB 1W13U 3OYPA 3RM2H 5A0AE 2VU8E 1A0LA 4GHQA 4CBNA 5E0GA 5T3HA 3HKIB 1C2EA 1NRPH 1XKAC 1C1NA 5LH8A 3SI3H 3UUZA 5DO4H 1UTNA 1YCPM 3SNAA 1C5XB 4AYYB 1TPPA 2ANKH 1TALA 1TFXA 4Q80A 1A5GH 1KIGH 3KIDU 2FOCA 3LPRA 2I6SA 3TIUA 3AVZA 3RC6A 1PPHE 3ZYEA 3T27A 1HFDA 2VWLA 1PPZA 2XBXA 4FXGH 1G3EA 2BD7A 1NRRH 4X8TH 2Z9GA 1UCYE 2XCNA 2ALPA 1V2VT 2FI4E 4YM9A 1YKTA 2TGAA 1ACBE 1BDAA 3ATIA 1BBRK 1GJ5H 1BHXB 1ZJKA 3FP8E 2Z3CA 4BAOB 2G55A 2XWBI 1O3LA 2C4FH 3A85A 2J2UA 2PW8H 1ELEE 1D6WA 1HUTH 3GY6A 1PYTD 1GHYH 1GBHA 2LNCA 3S0NA 4E7RG 2ZECA 1C1QA 2IN2A 2UWLA 1ZZZA 1RXPA 2A4OA 1XUKA 1EKBB 2PV9B 1W12U 3ZVCA 1O3AA 1O2ZA 1XUHA 2W26A 4MPXA 1CSOE 1KXEA 1Y3VA 1MQ5A 5C1XA 3QLPH 2TGTA 4MNYA 2SGFE 3ATMA 1EB1H 2ZNKH 3H7TA 3KNXA 1F0SA 1A1RA 1P2KA 1LO6A 2VH6A 1S0RA 1C9PA 3A8BA 4WXIA 1MTWA 1ELGA 3ZZDA 5DP9A 1LQEA 3A88A 3GCNA 2OXSA 4O9VA 4D9QA 4DW2U 1VJAU 1WV7H 1GPZA 2BQ7B 3RXOA 3A82A 5AVDA 3ZZCA 4DURA 2JETB 3EDXB 1AGJA 1HJ9A 7GCHF 2BDGA 1XUIA 4JMYA 5HM9A 1AO5A 2W3IA 1SVPA 2CV3A 1GVZA 4AB9A 1E34B 1B5GH 4K69A 5F8XA 1MCTA 2FP7B 4MVNA 7LPRA 4CRCA 1NC6A 1L1GA 1O36A 1F5KU 1KXDA 2XBVA 4X1QU 4KELA 2ZF0H 5K7RA 1E36B 1EPTA 2BHGA 2ZFSA 2BTCE 4AFQA 2FS9A 1SB1H 2Z9LA 2ZFPH 1K28D 1LHEH 1P2OA 1A5HA 3LGWA 1YYY1 4K60A 2J92A 1SI5H 1TBZH 1YPJH 1KTSB 1W8BH 4MNVA 4NSYA 2H6MA 3ZV8A 1J14A 1N8OB 5CHAB 2ODPA 2SGDE 2ZDVH 3A83A 1C2FA 1TA2A 1O3JA 3U69H 1A61H 1Y3WA 3GISB 1FDPA 2VVCA 3R0FA 5LPFA 1NU7B 4Y8ZA 3HK3B 8ESTE 2H9HA 2GD4B 5GWZA 1ELTA 1AB9C 4UFGH 2A4RA 1VGCC 2QYIA 4R0IA 4ZMAH 4Y71A 2ZKSA 2H5DA 1V6DA 3QO6A 1MCVA 1FUJA 4JYVH 1C2GA 2XTTB 1HBTH 3UNRA 1C5SA 4D7GA 3MU8A 1O2PA 3FFGA 1LHGH 2B7DH 2ZGBH 1SQTA 3ATWA 4ABBA 1IQHA 1OWEA 4MTBA 1W2KH 2PKAB 3TNSA 1WTHD 3TK5A 1O3IA 4IBLH 4CRDA 2BOKA 3UWIA 3I77A 1G2LA 1QFKH 5EQSA 1U6QA 3K6YA 4NCYA 4KTCA 1TAWA 2O8TA 4I8GA 2B0FA 1ZPCA 1BTXA 1O2XA 1WOFA 2BY9X 2QF3A 2VGCC 1V2PT 3GCTG 3TJOA 1GI7B 5JDUB 1WU1A 1O2HA 3SO3A 1DSTA 4XBDA 1C5RA 1BQYA 4WXVA 3FVFB 3BSQA 2FODA 1KDQB 4X2VA 3RXSA 2A0QB 5L2ZH 1GJ8B 1ARBA 2XBWA 2F3CE 4NZQA 4ABIA 5AFZH 1UTKA 2RA0A 3D62A 4MG3A 4NWKA 3HPTB 3ENSB 1UJ1A 1LVYA 2OCVB 2OTVA 2ZQ2A 4VGCC 4MNXA 1P2JA 2P93A 1CBWC 4UD9H 3ODDA 1TGBA 2BDHA 1C1UH 1RFNA 2STBE 1J9CH 3TH3H 3VGCC 4D8NA 4DCDA 3MH6A 4X2YA 1GBBA 3VB3A 4YT6H 1SC8U 4ISLA 4Q7XA 1TOCB 1O3FA 1TQ0B 5IDKA 1D3TB 4B73A 1W0YH 1C1RA 2AMDA 2GT8A 3SU3A 1YC0A 2AIPA 3CP7A 2FESH 1ZMLA 1HYLA 1VR1H 4FU7A 5GIBA 3M5MA 3QWCH 3ZZ9A 2TGPZ 1BBRH 3T5FH 4SGAE 1V2JT 3KQDA 3SJ9A 2NU3E 1DICA 1HIAA 1K1OA 2ZI2H 1MU8B 5F8TA 2WYJA 1ELBA 5HM2A 3QTVH 3EA7A 1V2OT 1GDQA 1QB6A 1WCZA 2C3SA 1MTNC 1S82A 1NRNH 7ESTE 3M5OA 1OSSA 2C90B 2D1JA 3PWBA 2FEQH 2W7SA 1DSUA 2GDEH 1V2RT 3EQ0H 4X6MA 1NZQH 3BTQE 3VB4A 3OU0A 5AF9H 1EUFA 1G32B 5ETXA 2GZ9A 4I8JA 3BG4C 3M7UA 4Y8YA 2NU0E 1GMHG 1YPEH 1C2JA 2BY6X 2AEIH 2OLGA 3V3MA 1CT2E 1CA0C 3RXEA 1O3DA 1PPGE 3IITA 1PQ7A 3LT3A 1RTLA 1DWDH 1QJ1B 1MU6B 1ID5H 3BTFE 3T25A 1EPTC 1AKSA 1GGDB 3BIVH 1C1VH 3MU0A 4I32A 3H7OA 1DM4B 1BRUP 1O2NA 4CR9A 1DWEH 2O8WA 1XXFA 3UR9A 1Y59T 1ETRH 2WPIS 1QQUA 2QXIA 2ZPSA 1SLVB 1FPCH 2F9BH 4UFFH 4FUCA 3W94A 1FAXA 3BTGE 1CO7E 1V3XA 1SLXB 1YGCH 1SHYA 3AAVA 2Z7FE 1O2IA 4D9RA 1IQIA 3S69A 3CS7A 1P9SA 2BX3A 3DA9B 1PPEE 1UHBA 1P2IA 4GLYA 2D2DA 1O5DH 5A0CA 5EW1H 3ZZAA 4E05H 4UE7H 1O34A 1O32A 4O03A 4K3JA 1F92A 5PTPA 3TH2H 3PO1B 3BIUH 3PV4A 5FPYA 1KXAA 4RKOB 1JIMA 1PQ5A 1NFWA 2XNIA 5FPTA 1RIWC 1KXBA 2WYGA 4BTTB 3SUGA 3MH5A 2XC5A 4ZH8A 5JBAS 1IQGA 3BEIB 1MD8A 2BLWA 1ESAA 1GG6C 2ZWLH 3U9AH 4ABJA 2BZAA 3UY9A 1GI6A 1AUJA 1ZTLA 2Q6FA 1B0FA 1FY8E 2DUCA 4ISIH 5GJ4B 1GDNA 2OC0A 1A3BH 2BDBA 3SUFA 5CE1A 5HYOA 1LQDB 3ZVEA 1C5LH 2OD3B 2R2MB 1DWBH 5FX5A 1Q31A 4AGJA 2STAE 1D4PB 3RM0H 3F68H 3BEFB 1LVMA 2W5EA 5A09A 4B2BA 2FDAA 1TNLA 2VB0A 3U1JB 1YPGH 1C1OA 3VXFH 1P57B 1BRAA 4ZHLU 2ZDMA 1BJVA 1O2JA 2VNTA 4Y7BA 3VB6A 1QBVH 1N1LA 1TRMA 1ZGVA 3T62A 3O8RA 1J8AA 2CGAA 4ZHMU 4FVDA 4TPIZ 2UWOA 5C20A 3DHKH 6GCHG 1L1JA 4Y10E 1SQAA 5EU8A 4OS2A 1OS8A 1HAPH 3MU1A 1WTGH 4Q2KA 6CHAB 5T6GA 2PKSB 5BRRE 5JBBS 2WPHS 1O5BB 4A7IB 2D8WA 3Q76A 3TVJB 5F6MA 4SGBE 1V2WT 1ANCA 4AORA 6LPRA 3RXHA 4YT7H 1UTMA 2EI6A 2FXRA 3BEUA 4MPUA 4ZXYH 3RXBA 1THPB 3TGJE 1E38B 2J38A 1HJ8A 1EZXC 1O3KA 3HATH 3KF2A 5SGAE 1BBRE 5ESTE 2ZG0H 3U8RH 4ZROA 2C8YB 2UUYA 1DDJA 1ZPBA 3MHWU 1P8VC 1H8DH 1MQ6A 5JYIA 2ZIQH 1IQEA 4TPYA 1K1JA 1C5VA 4BNRA 1SGPE 4KKDA 2ZDKA 1O2QA 3B9FH 1YPHE 3ZZ6A 1Z71A 4GVUA 2GT7A 1O35A 2VVUA 5BPEA 4NA7A 2GVFA 1XVMA 1NROH 3R3GB 1GHAG 3TITA 2HLCA 2FM2A 3MTYA 1G2MA 1Z8GA 2KAIB 5EXMA 3PB1E 1UO6A 1HNEE 1SGEE 2BVRH 3M5NA 1TE0A 4GSOA 5EXNA 4D76A 2WPKS 3A80A 2AGIX 1DY9A 2VIPA 4NSVA 1L4ZA 1UVSH 3LU9B 1TGNA 1S83A 1P0SH 4MDSA 1P2MA 1LVOA 2Y80A 3M61U 3O8BA 4WMFA 2EI7A 5K0HA 4BAMB 1A5IA 3UPEA 1UTLM 3UOPA 3GY3A 1BMLA 4IN2A 3RXPA 3LGVA 2M5TA 1TA6A 2QCYA 4IMQA 1VITG 2A4QA 2QA9E 1OWJA 4ZKNU 3SZNA 3MI4A 4X2WA 1C4Y2 3E8LA 3TGKE 2VIQA 3PROA 1GWAA 4TWWA 2ZU2A 1B7XB 1FQ3A 2P8OC 2TBSA 4AFZA 5A0BA 1V2UT 1GHVH 1BTYA 1WUNH 3L3TA 2ZZUH 1LCYA 3RXGA 1MBQA 1YCPK 1HAYB 1C5TA 2A5IA 1GBIA 3KQBA 2V3OH 3E3TA 2GCTB 1SFIA 3VFEA 5C5NA 2FX4A 4LK4A 2O8MA 1Y3XA 2FI5E 3EAJA 1NS3A 4FUDA 2ODQA 3SNCA 1K21H 1P12E 1SMFE 1C4V2 1MBMA 1GJDB 2DE9A 4AZ2B 2VH0A 1KY9A 1NT1A 2OC1A 2P3UB 1QGFA 1TRYA 5A8YA 5HXFA 2ZTZA 2HWLB 3MNXA 4TWYA 2ZPQA 4HFPB 1ZYOA 2FOEA 4F4OC 2VJ1A 1LHCH 2JKHA 1W14U 3BTWE 2A5AA 2BYAX 1NFUA 9LPRA 3TH4H 1EJMA 5B6OA 3SU6A 3HGNA 1XUFA 1ZRKA 4X0WU 5FBEA 3URCA 3RXFA 1YF4A 2VIVA 2WPLS 1O5GH 4ABAA 2BVXH 3AW0A 3GY4A 4XBCA 2Z9JA 3RXUA 4MQAA 1H9IE 2WINI 4JCNA 3MNBA 4YTAA 1EOLA 4WMEA 1L0ZA 3AW1A 3SUDA 4X8VH 3GDUA 2EI8A 5EODA 2Y6TA 4U01A 4OS7A 3A7WA 3E0NB 1PPFE 2XXLA 4MNWA 2K1QA 1HLTH 2NU4E 3EGKH 4YZUA 1C4U2 4JZ1A 1G9IE 4Q7YA 4JYUH 3BTME 1C5YB 1SR5C 1AFEH 1GI3A 1N6XA 5DP8A 1OP2A 3D49H 3NKKA 4ISNA 3GY8A 3P8NA 2HNTF 1G36A 1AVXA 1AWHB 3RP2A 2GCTC 2ILNA 2BY7X 3ZVFA 4CRAA 1IAUA 1ZR0A 5LGOA 3A7ZA 1GBTA 3DD2H 1BMAA 1GDUA 2BD2A 1MZDA 5DP3A 3A81A 3LC5A 3B23B 1AB9B 1C2MA 1VGCB 2OQ5A 3A7XA 1ABJH 1S6HA 2VVVA 1ANEA 3GDVA 2Y5FA 5EXLA 3VB7A 4B71A 3TGIE 1FAKH 1TQ7B 2P59A 1VCQA 2GTBA 3LC3A 1FN8A 2Z3DA 3E1XB 1O39A 1H8IH 4I8HA 5TJXA 3LKWA 4XDEA 1RGQA 1CGIE 3G01A 1A4WH 4LOYH 1GI4A 3LOXA 2WUCA 1MTVA 1OXGA 1XMNB 4Y0ZE 3RMMH 6ESTA 2YNAA 2B9LA 4CH2B 2ZPRA 2Y81A 5LPRA 3SV2H 2PKAA 2LPRA 1O5FH 4A6LA 1HRTH 3SJKA 5EQQA 2Y7ZA 4BAQB 3SW2B 3Q77A 1QA7A 1LKAA 2BD3A 3ZZBA 4AYVB 3LDXH 1QJ7B 2VGCB 4WH8A 3EA8A 4YLQH 2PR3A 5DP5A 1BTWA 3TK9A 1P9UA 3EE0B 2TRMA 1C1TA 2ZGHA 4GHTA 1K2I1 1KDQA 3V13A 4IS5A 3A8AA 1TBQH 3DFJA 4INHA 3S9BA 2ZFQH 3E16B 1GMDG 3ZZ3A 2A7JA 3TK6A 4B2AA 4B74A 2BD9A 1GJ9B 2F9VA 4UFDH 4Y8XA 3O8CA 1SG8B 2ZCKP 2ZHQH 3MU5A 2A4GA 4VGCB 1INCA 1WSSH 1Z6EA 4BAHB 1CBWB 2A45B 1P3EA 2FX6A 4AG2A 4FUBA 2ZHEH 1O2OA 1PQ8A 1GCTC 1EJNA 4YO9A 2UUJB 2OINA 3VGCB 3SV6A 4A92A 4KTUA 1GL1A 1UVOA 1SOTA 3GCTF 4JK6A 3TJNA 3PLBA 1J17T 2H2ZA 1TNHA 3H5CB 1THSH 1A2CH 5L6NH 3GCHC 8GCHG 2ZC9H 5E0HA 1IHTH 1VITH 2IOTA 2ANYA 3L6PA 2GZ8A 2P16A 2FMJA 3FZZA 1GI8B 2ZU1A 3RC4A 2SGQE 1QIXB 1BA8B 3FZDA 3RUOA 3RXTA 3GY7A 4RN6A 3K9XB 1VCPA 3SNBA 1MTNB 2QIQA 2WUBA 2A31A 5G4BA 1YCPH 4CRFA 2WPMS 1DOJA 4X1NU 5E2PA 1UVPA 2VIDA 3Q3YA 1AZZA 1PJPA 1T4UH 1D9IA 2ZQ1A 4IGDA 1L2EA 1MAYA 1QA0A 3BG4B 3CENA 1S5SA 1SGIB 2ZGJA 4CRBA 3BG8A 2R0KA 2FTLE 3CS0A 1CQQA 4PROA 3VXEH 1XUJA 4X1RU 1NPMA 3D23A 1EAXA 1CA0B 4Y79A 5FCRA 3A86A 4A5TS 5EPNA 2ZCHP 5TCAA 1F0UA 4H6SB 1BT7A 1GI1A 1Z1JA 1EPTB 1JXPA 2BZ6H 2FWWA 1QBNA 5IYTA 2V3HH 3SJOA 1YM0A 5E2OA 2J9NA 3UTUH 2BY8X 1Z6JH 1GVLA 4ABHA 3K65B 1X7AC 4FUGA 3ITIA 4A1TA 1QRWA 2BXUH 1GCDA 4OGXA 1HAXB 3BTEE 1O2SA 4INLA 1Y8TA 4WH6A 4DJZB 3T26A 4X1SU 4YOJA 1BTZA 2QN5T 3KCGH 1GMHF 3SHCH 3BN9A 2QXJA 4ZKOU 8KME2 1AU8A 2F9OA 1LHDH 1K1LA
chains in the Genus database with same CATH superfamily
3Q00A 1KXFA 2ALVA 3UAIC 3RXVA 1ZSJA 1HJAC 4B1TA 1RD3B 2JH0D 4H6TA 5DPAA 2TPIZ 1RIWB 1BJUA 3RMOH 1ZHPA 3MNCA 1W10U 1AHTH 3LONA 1FONA 4BTIB 5C0UA 3ZVDA 3LJOA 5GCHG 2SNWA 1GG6B 3HKJB 3AAUA 1TGCA 3W95A 1O2RA 1DITH 1D3QB 3MYWA 3PMHB 3RXIA 1YY3A 1TPSA 3C27B 4A1XA 4OS5A 2P94A 2BDAA 1C5NH 3OE7D 5A8ZA 1MAXA 1T31A 1IQJA 4UEHH 2GMTC 1GBAA 2HPQH 4NG9H 1TMBH 2ZDAH 4JZDH 1HCGA 3RLYH 4A1VA 4J1YA 1YPLH 1L4DA 1P2QA 1HAIH 1YP9A 2KZ4A 2BLVA 2WZQA 1BTHH 3RC5A 2JH6D 4DVAU 1A7SA 1GBLA 1GMCG 1DXWA 2AGGX 4AB8A 1C2DA 3SQEE 1AN1E 1Q2WA 2ZU3A 3SV7A 1MZAA 3QK1A 3KQCA 1PQAA 2BDIA 1DS2E 2FOGA 3VG8A 2ZEBA 1HAOH 2KFWA 1KTTB 1AFQC 4K1EA 2C8ZB 2F83A 1V2KT 5EW2H 1CVWH 3UQOA 1SFQB 3EA9A 3SU1A 1ETSH 1WYKA 2Q1JA 3F2HA 4Q7ZA 3A89A 3UQVA 1CGHA 1GJAB 4CHAC 1TX7A 4OGYA 3MWIU 1O2WA 2GCHG 2XC0A 2XYAA 6GCHF 1AMHA 1AVWA 2FLRH 2CK3D 2BQ6B 3KGPA 1QHRB 4KP0A 1YLNA 3ZYDA 4I86A 4BAKB 3Q3KA 1HIAB 1FIWA 4YXWD 2CHAC 4IN1A 1T8LA 3KL6A 5T6FA 1GHWH 2AMQA 2KAIA 2BOHB 3F2FA 1TABE 1LMWB 3GICB 4I33A 5JPMH 1DE7H 1G37A 5I46H 1QL8A 1EAWA 4ABFA 3PM3A 2Q6DA 3GY2A 2J95A 4E06H 1SLUB 2SFAA 3RDZA 1F2SE 4GCHG 1MMJN 3PMBB 1MKWK 4F49A 3QN7A 2HPPH 3UFAA 3QZQA 1NU9A 4H4FA 1EAUA 4ESTE 1OX1A 1XXDA 3N99A 3ZZ7A 1QJ6B 4O3UA 1ZLRA 1Y5UT 4WVPE 1P04A 3RLWH 1Y5BT 2YMSB 4ASHA 1HB0B 1LPGB 1EAIA 1BUIA 2C8XB 1GHAF 2QF5A 4F55A 3S9AA 1C2IA 4CH8B 4JK5A 2XRCA 2P8OB 2V6NA 4BXWA 1ZSLA 1ZRBA 4X8SH 1GBJA 5GDSH 2NU2E 4DT7B 5FPSA 1OWKA 3ODFA 1XUGA 5DP7A 3B8JA 2EC9H 3CNRA 4FU8A 1UTJA 1MH0A 4HTCH 1Z8JB 1TX8A 1GJ7B 2HOBA 3K2UA 3K6ZA 1YPKH 4FU9A 4AX9H 2PUQH 5JB9S 1DX5M 1GI2A 1H9LB 4Y76A 1O5EH 3O8DA 2UWPA 4JZIA 2FI3E 2FOHA 2Q6GA 1O3OA 2A7CA 1V2LT 3ELAH 1GHXH 1XKBC 1XVOA 1NESE 1VITF 3FP6E 1O3MA 2JH5D 1Y5AT 5L2YH 1DLKB 1LPKB 4THNH 3RXMA 2G4UA 2ZGCA 4UDWH 2Z94A 1D3DB 2ANWA 2UUFB 1DXPA 4ZHAA 1DANH 1K1NA 3U8TH 1YPHC 1YBWA 1P01A 4P02A 3UIRA 1WQVH 3F6UH 1AE5A 2FOBA 2WPJS 2PTNA 2Y82A 1NFXA 4JZFH 1RRKA 4XD7D 2RFKC 2BMGB 1BMMH 1NBMD 4RSPA 1SGDE 2OBQA 2XWAA 2IPHA 1Z8IB 4QT8C 2ZO3H 1OP8A 3S7HB 3M7QA 4IC5A 2V3MA 2HNTE 5CMXH 4K8YA 5HKKD 4XBBA 2QF4A 1BB0B 4WF8A 5J4SA 2F9NA 1ELAA 2G8TA 1W7GH 1NY22 1T8NA 3SZEA 1AD8H 2OK5A 4IC6A 2G5VA 3NZIA 1GJBB 3SGBE 1TX6A 1UTQA 4OS1A 2WV5A 3RU4E 2F91A 2GKVE 4BXSA 2GZ7A 1EFRD 1QRXA 3GCOA 2HNTC 2YMSD 1TIOA 5DGJA 2VWNA 2PWXA 3EYDA 1O31A 3ZZ4A 1FY5A 2PHBA 1SGFG 2AHME 1LTOA 3P95A 1QL7A 2CN0H 1DY8A 1DUEA 3SNEA 2EEKA 3TU7H 3GOVB 3M7TA 1O2LA 5EQRA 5ESBA 1AUTC 3ZVBA 3ATKA 1GHZA 2AS9A 2PSYA 3E90B 1EATA 2R2WU 1G3CA 4I8KA 1O5AB 5A2MH 4YESB 1P3CA 5T6DA 2FTMA 1ZTKA 2R3YA 1JMOH 1HGTH 4JZEH 1TNJA 2ULLA 4MLFB 4XSKU 1O2UA 3FO8D 1QB1A 1BIOA 1O3NA 1MUEB 1CHGA 3PWCA 3IG6B 1OWHA 1NM6A 3NK8A 3T2NA 3HK6B 1A46H 5C1YA 4NA8A 2GV6A 1DLEA 3HGPA 2KX4A 3MU4A 4BTUB 2J94A 1GJ4H 1V2NT 4KGAA 5DJ7A 1DFPA 1VJ9U 4D7FA 2RDEA 2CF9H 1GI5A 4INKA 4DG4A 2ZCLP 3MOCA 2QXHA 1C5ZB 3U1IB 1ORFA 1CHOG 2QF0A 1GJCB 4X2XA 1NRQH 2HALA 4NFEA 1O2TA 1DUAA 3OSYA 4B75A 3RXJA 3Q3XA 1F0TA 1TMUH 5AHGH 4B2CA 2AERH 2YOLA 2ZA5A 3RXLA 2FOAA 1QBOA 3IWMA 1Z8RA 3WY8A 3MO9A 1LHFH 4K5ZA 1Z1IA 5EPYA 1CA8B 1MKXK 3M3VA 3MH7A 1EZUC 1QCPA 1NTPA 1PPCE 2SGEE 1HAHH 2ZTYA 3M5LA 3U98H 3M37A 1FY4A 2ZHFH 4B6FA 4LZ1H 1DT2A 1TNKA 1YLDA 2G52A 4AFUA 5JB8S 1TPOA 1W0KD 1IQKA 1V2ST 1GHBG 1C5OH 4U32A 1HAVB 3ESTA 1HXEH 2BVSH 1O3BA 1PYTC 2G5NA 3OTJE 5ABWA 2A5KA 1THRH 1AZ8A 4ACBA 1GCTB 4K1SA 3F9HA 1ETTH 1W3CA 2G00A 4TY7A 5DKMA 2RA3A 1MKWH 1IQMA 4NIVA 2PGBB 1OPHB 1T8OA 1UW7A 3PV5A 4ABEA 1P09A 1BMNH 2SNVA 1SQRA 1GBFA 3GCHB 4X1PU 1LVBA 1AQ7A 1LPZB 4B76A 1JWTA 1FI8A 3LH1A 4FUJA 1UK3A 2CJIA 2RDLA 3A8DA 3NPSA 1GMDF 1GBEA 1BTUA 3P8OA 3PV2A 4ZKSU 2FO9A 1FV9A 2JDID 1ABIH 2R3UA 3ZZ8A 2VINA 4AGKA 1V2TT 5JBTA 3PLKA 3F9FA 3M3SA 3KN2A 3URDA 1G3BA 1T32A 3LGIA 4RT0A 2PFEA 1M9UA 3QTOH 1F0RA 1ZJDA 4R8TB 3A7TA 3SU2A 5B6LA 1CGJE 2ESTE 3L33A 1FLEE 3RXAA 1S84A 3S7KB 2PP6A 4GPGA 3VPKA 4XFQA 1ELDE 1P05A 2B5TB 5FCKA 1O5CB 5EG4A 1C5MD 3FKSD 2RG3A 2ASUB 4RKJB 1UK4A 2J97A 3RXQA 1O37A 3UNSA 8GCHF 1SGTA 2VIWA 3P92A 1HV7A 3ZVAA 3T28A 1J16A 1P10A 3RXKA 1EP5A 2BM2A 1P02A 2F9PA 1NN6A 1QQ4A 1WAYB 3V12A 4I31A 2YNBA 1LKBA 1CT0E 1TONA 1YLCA 2AH4X 3LIWA 3RXCA 1AY6H 4GUXA 3TJUA 1HDTH 1SL3A 2A2XH 1O33A 1SOZA 4FUEA 4X6OA 2G4TA 3KHVA 1ELFA 9ESTA 4YOIA 2W7UA 1C5QA 4FUHA 1DWCH 1C2LA 1W11U 4O3TA 1O2VA 1C1WH 1V2MT 7GCHG 1SLWB 3FAOA 3A7YA 3E91A 1KSNA 4HI3A 1GL0E 1N6YA 1EXFA 1YPMH 2ZHDA 3QGJA 2KM0A 5AFYH 3FP7E 2O9QA 4U2WA 2ZHWH 2C8WB 4X6PA 1ZMJA 1SGFA 1BZXE 2WHXA 3V0XA 2XBYA 1IQNA 1HJAB 1T4VH 3MH4A 1ELVA 3MFJA 3TPIZ 2J4IA 2Z9KA 2UUKB 3TJVA 1O3CA 3PTNA 5DG6A 3SU5A 2PLXA 3T29A 5GXPA 1SGCA 3D65E 5EOKA 2A1DB 3BF6H 5E8EH 2JETC 1TOMH 2OP9A 1C5UA 1NO9H 3QGNB 3RXDA 1EQ9A 1RTFB 1JOUB 1CU1A 2BLOA 4WWYA 4AC9A 1UCYK 3GDSA 1Y3UA 3LJJA 3RU4T 5KEDA 1ZHMA 3OY6U 3P8FA 1AVGH 1A0JA 1H1BA 1O3EA 1A0HB 1DVAH 2H9TH 4NA9H 2EA3A 2ZU4A 4LZ4B 2GMTB 1FMGA 1TPAE 2SGPE 1UMAH 5A8XA 3SUEA 5FX6A 3OX7U 1UTPA 1AI8H 1L1NA 3BTDE 1BTPA 2BB4A 1SPJA 1JIRA 3SU4A 2D26C 1P2NA 2KCAA 1Z7KA 3MMGA 3N7EA 4M7GA 3STJA 5GCHF 4Y7AA 3NCLA 4DIHH 2H9EH 1WQSA 4NGAH 1ZHRA 7KMEH 3N7OA 2FLBH 1ARCA 4NWLA 5HGGA 1UTOA 3SQHE 1BHXF 1N8OC 5CHAC 5HMAA 1GVKB 1O2YA 1QB9A 2FIRH 2H5CA 2WV4A 1ELCA 1ZSKA 3GYLB 2BD4A 4YLUA 1QRZA 3RMLH 1KXCA 2IJD1 1MTUA 1K22H 3LGUA 4ZCNA 1E35B 1XM1A 1MKXH 3ZZ5A 4F48B 1JRSA 1AFQB 2ZFTA 3UREA 1O3HA 2Y5HA 1F7ZA 1BCUH 1S81A 1VZQH 2WPDD 3SI4H 4DIIH 2G81E 1C1MA 1OKXA 3RXRA 3A87A 3SORA 1T8MA 5TCCA 1QL9A 2A2QH 2FYRA 2XOKD 4YOGA 5FL7D 1O38A 3UR6A 1SGQE 4CHAB 1OOKB 4NZLA 3FANA 4Y11E 1RJXB 4BANB 3A7VA 2THFB 1MTSA 1GMCF 1W0ZU 1SGYE 2BLQA 1SHHB 3UWJH 2A32A 1P11E 4ZUHA 2QY0B 1BITA 1TNIA 1FXYA 2CHAB 1EB2A 5C2ZA 1C5WB 4OS6A 1ZPZA 1SBWA 1O2KA 2OC7A 5C0TA 2QAAA 4MPVA 3SJIA 3OY5U 4ISHH 3SOSA 1F5LA 1OWDA 2BDCA 3UOUA 2BD8A 3TNTA 1ZTJA 2KCYA 4Y6DA 4X8UH 1RS0A 3E6PH 1G30B 1EOJA 2ZDLA 2HRVA 2R0LA 2ODYB 2RCEA 2ZGXH 1UK2A 1B0EA 2DE8A 2ZP0H 3PYHA 1GBDA 2XW9A 2CXVA 2GCHF 4H42U 1SSXA 1K1MA 3F9GA 5EGMA 4CR5A 3MO6A 1FJSA 2QV1A 1ZOMA 2FPZA 2GGVB 2VIOA 3NXPA 4WJG2 2H1UA 3P6ZB 1TGSZ 2GX4A 3I29A 5C1UA 3S9CA 1FN6A 1TGTA 4K1TA 2P3FH 1BOQA 1PFXC 4DGJA 2AIQA 3NWUA 1TB6H 2BDYA 1SGNE 1TRNA 3H09A 2P95A 1O2MA 3SBKA 2GV7A 1ESBA 2I6QA 3DT0H 2FOMB 5DK1A 1C5PA 5F03A 4GCHF 1P06A 1K9OE 1SQOA 3M3TA 4TYDA 5J4QA 2NU1E 2O8LA 3OFND 4WMDA 1JRTA 3P17H 4FUFA 1GJ6A 1UVUH 4AOQA 5FAHA 1C1PA 1F5RA 3UNQA 5FHTA 3JZ2B 2F9UA 4K8BA 3VB5A 4I7YH 2QC2A 1EJAA 2V0BA 3F9EA 1ANBA 1FZZA 1O3PB 1OYTH 2FYQA 8LPRA 1HAZB 3PMAB 2XC4A 5GPIB 1QTFA 2XCFA 1TMTH 2ZTXA 2K8IA 2OUAA 1ESTA 3QDZB 1EP6A 3BTKE 3E0PB 1KLTA 1FIZA 3BTTE 4O97A 1TLDA 1GBCA 2OQUA 3GY5A 5C3NA 4NFFA 2J34A 3OAAD 4AFSA 1GI0A 3PLPA 3SNDA 4ABDA 5DP6A 1O3GA 2ANMH 1KYNA 1K1IA 2BXTH 1CE5A 2AMPA 2TGDA 4I8LA 3V7TA 3LGTA 1D3PB 2CMYA 4J2YB 1QY6A 4Z0KA 4XOJA 1Q3XA 1FX0B 2Z3EA 2C93B 4FUIA 3NRLA 3TLOA 2TIOA 1IQLA 4NIYA 4GAWA 3A8CA 2OC8A 2QXGA 3MO3A 1D6RA 2LP6A 2HGTH 1AKSB 4LXBH 4HGCA 1GGDC 4U30A 4RT1A 2PGQB 1BRCE 4OS4A 1NFYA 1OYQA 2AFQB 3I78A 3KYGA 3SGAE 4AG1A 4CBOA 1PPBH 1UCYH 2Y5GA 4ZXXH 4KTSA 1W7XH 4K2YA 1EASA 4WY3A 4FVBA 1QNJA 2ZFFH 2BD5A 1O0DH 3F1SB 1NRSH 4DY7B 2QGRA 2AGEX 1EZQA 1GBKA 3AASA 3QUMP 4Z6AH 1FY1A 4CREA 1H9HE 1KLJH 5I25A 1IHSH 4ISOA 3NUMA 1EZSC 3VEQB 1UHBB 1S0QA 2HVXA 1XX9A 2FZZA 3ATLA 3KEEA 5DP4A 1AWFH 1OP0A 5E0JA 3GYMA 4MPWA 2Y7XA 4NIWA 3STIA 4X6NA 5KGOA 4IMZA 3P8GA 3BV9B 3SHAH 1RTKA 4Y0YE 3WWFA 1WBGB 1TNGA 1C2HA 3PO1C 1S85A 5C5OA 1E37B 1V2QT 1MD7A 5FXLA 4IW4E 3A84A 3ZIAD 4ZAEA 2Z6BD 4DOQA 3LGYA 5F8ZA 1J15A 3PMJA 2PUXB 3SN8A 2CF8H 4DT4A 3U8OH 4XE4A 1FY3A 1TYNA 2NWNA 3SJ8A 1ANDA 3BTHE 3PTBA 1LDTT 2W6ID 2O8UA 1O30A 1BRBE 3FN8A 1HXFH 3F0OA 2Z9IA 1H4WA 4CRGA 2A7HA 1DPOA 3DFLA 1OHHD 2ZDNA 3M35A 4UONA 1ZGIA 3MNSA 1K1PA 1ZMNA 1HPGA 2VWMA 2IJOB 1VKYA 3C1KA 3GS9A 3SGQE 4UFEH 1OWIA 2V35A 1A3EH 2BX4A 1IQFA 2OBOA 2BY5X 4AN7A 3SV9A 3LH3A 2ZU5A 2W3KA 1CHOF 1HAVA 2GDDA 1S6FA 1C2KA 1EX3A 4JYTA 6CHAC 1O2GH 2PKSC 1FPHH 1C9TA 1CT4E 2VWOA 2FS8A 1AE8H 1HAGE 2ZFRH 4E7NA 1G3DA 1JBUH 3QZRA 3RU4D 4HZHA 4ZKRU 1KLIH 3JZ1B 2BQWB 1QURH 2PSXA 5EJ1A 3RMNH 2P3TB 2FOFA 1AIXH 1C1SA 1SGRE 5C67A 3ZVGA 2PTCE 1FNIA 4TY6A 1E0FD 1QR3E 1VCWA 3M36A 5JBCS 3QX5H 3UB0A 5FBIA 2R9PA 1P03A 2B8OH 5C94A 1IOEA 2AYWA 4BOHA 1GBMA 2G51A 1TBRH 4ABGA 3P70B 3ZV9A 5LPEA 5L30H 1TWXB 2SGAA 3KQEA 3SV8A 3DUXH 4NIXA 1Y3YA 1GHBF 1GI9B 2GP9B 1UVTH 1T7CA 3SU0A 5H4IB 1W13U 3OYPA 3RM2H 5A0AE 2VU8E 1A0LA 4GHQA 4CBNA 5E0GA 5T3HA 3HKIB 1C2EA 1NRPH 1W0JD 1XKAC 1C1NA 2F4LA 3SI3H 5LH8A 2KR7A 3UUZA 5DO4H 1UTNA 1YCPM 3SNAA 1C5XB 4AYYB 1TPPA 2ANKH 1TALA 1TFXA 4Q80A 1A5GH 1WXRA 1KIGH 3KIDU 2FOCA 3LPRA 2I6SA 3TIUA 3AVZA 3RC6A 1PPHE 1QZ8A 3ZYEA 3T27A 1HFDA 2VWLA 1PPZA 2XBXA 4FXGH 1G3EA 2BD7A 1NRRH 4X8TH 2Z9GA 1UCYE 2XCNA 2ALPA 1V2VT 2FI4E 4YM9A 1YKTA 2TGAA 2KCOA 1ACBE 5DSFA 1BDAA 3ATIA 1BBRK 1GJ5H 1BHXB 1ZJKA 3FP8E 2Z3CA 4BAOB 3DSPA 2G55A 2XWBI 1O3LA 2C4FH 2W6JD 3A85A 2J2UA 2PW8H 1ELEE 1D6WA 1HUTH 3GY6A 1PYTD 1GHYH 5CDFE 1GBHA 2LNCA 3S0NA 4E7RG 2ZECA 1C1QA 2IN2A 4HG6A 2UWLA 1K0HA 1ZZZA 1RXPA 2A4OA 1XUKA 1EKBB 2PV9B 1W12U 3ZVCA 1O3AA 1O2ZA 1XUHA 2W26A 4MPXA 1CSOE 1KXEA 1Y3VA 1MQ5A 5C1XA 3QLPH 2TGTA 4MNYA 2SGFE 5EJZA 3ATMA 1EB1H 2ZNKH 3H7TA 3KNXA 1F0SA 1A1RA 1P2KA 1LO6A 2VH6A 1S0RA 1C9PA 3A8BA 4WXIA 1MTWA 1ELGA 3ZZDA 5DP9A 1LQEA 3A88A 3GCNA 2OXSA 4O9VA 4D9QA 5HIYA 1VJAU 4DW2U 1WV7H 2J98A 1GPZA 2BQ7B 3RXOA 3A82A 5AVDA 3ZZCA 4DURA 2JETB 3EDXB 1AGJA 2XNDD 1HJ9A 7GCHF 2BDGA 3F3BA 1XUIA 4JMYA 5HM9A 1AO5A 2W3IA 1SVPA 2CV3A 1GVZA 4AB9A 1E34B 1B5GH 4K69A 5F8XA 1MCTA 2FP7B 4MVNA 7LPRA 4CRCA 1NC6A 1L1GA 1O36A 1F5KU 1KXDA 2XBVA 4X1QU 4KELA 5T1VA 2ZF0H 5K7RA 1E36B 1MABB 1EPTA 2BHGA 2ZFSA 2BTCE 4AFQA 2FS9A 1SB1H 2Z9LA 2ZFPH 1K28D 1LHEH 1P2OA 1A5HA 3LGWA 1YYY1 4K60A 2J92A 1SI5H 1TBZH 1YPJH 1KTSB 1W8BH 4MNVA 4NSYA 2H6MA 3ZV8A 1J14A 1N8OB 5CHAB 2ODPA 2SGDE 2ZDVH 3A83A 1C2FA 1TA2A 1O3JA 3U69H 1A61H 1Y3WA 3GISB 1FDPA 3FOAA 2VVCA 3R0FA 5LPFA 1NU7B 4Y8ZA 3HK3B 4XRNA 8ESTE 2H9HA 2GD4B 5GWZA 1ELTA 1AB9C 4UFGH 2A4RA 1VGCC 2QYIA 4R0IA 4ZMAH 4Y71A 2QE7D 2ZKSA 3KQ5A 2H5DA 1V6DA 4TT3D 3QO6A 2HVYB 1MCVA 1FUJA 4JYVH 1C2GA 2XTTB 1HBTH 3UNRA 1C5SA 4D7GA 3MU8A 1O2PA 3FFGA 1LHGH 2B7DH 2ZGBH 5HIZA 1SQTA 3ATWA 4ABBA 1IQHA 1OWEA 4MTBA 1W2KH 2PKAB 3TNSA 1WTHD 3TK5A 1O3IA 4IBLH 4CRDA 2BOKA 3UWIA 3I77A 1G2LA 1QFKH 5EQSA 1U6QA 3K6YA 3WWBA 4NCYA 4KTCA 1TAWA 2O8TA 4I8GA 2B0FA 1ZPCA 1BTXA 1O2XA 1WOFA 2BY9X 4Z1MD 2QF3A 2VGCC 1V2PT 2WSSD 3GCTG 3TJOA 1GI7B 5JDUB 1WU1A 1O2HA 3SO3A 1DSTA 4XBDA 1C5RA 1BQYA 4WXVA 5KECA 3FVFB 3BSQA 2FODA 1KDQB 4X2VA 3RXSA 2A0QB 5L2ZH 1GJ8B 1ARBA 2XBWA 2F3CE 4NZQA 4ABIA 5AFZH 1UTKA 2RA0A 3D62A 4MG3A 4NWKA 3HPTB 3ENSB 1UJ1A 1LVYA 2OCVB 2OTVA 2ZQ2A 4VGCC 4MNXA 1P2JA 2P93A 1CBWC 4UD9H 3ODDA 1TGBA 2BDHA 1C1UH 1COWD 1RFNA 2STBE 1J9CH 3TH3H 3VGCC 4D8NA 4DCDA 3MH6A 4X2YA 1GBBA 3VB3A 4YT6H 1SC8U 4ISLA 1E79D 4Q7XA 1TOCB 1O3FA 1TQ0B 5IDKA 1D3TB 4B73A 1W0YH 1C1RA 2AMDA 2GT8A 3SU3A 1YC0A 2AIPA 3CP7A 2FESH 1ZMLA 1HYLA 1VR1H 4FU7A 5GIBA 3M5MA 3QWCH 3ZZ9A 2TGPZ 5EIYA 1BBRH 2M2AA 3T5FH 4SGAE 1V2JT 3KQDA 3SJ9A 2NU3E 1DICA 1HIAA 1K1OA 2ZI2H 1MU8B 5F8TA 2WYJA 1ELBA 5HM2A 3QTVH 3EA7A 1V2OT 1GDQA 1QB6A 1WCZA 2C3SA 1MTNC 1S82A 1NRNH 7ESTE 3M5OA 1OSSA 2C90B 2D1JA 3PWBA 2FEQH 2W7SA 1DSUA 2GDEH 1V2RT 3EQ0H 4X6MA 1NZQH 3BTQE 3VB4A 3OU0A 5AF9H 1EUFA 1G32B 2J5UA 2GZ9A 5ETXA 4I8JA 3BG4C 3M7UA 4Y8YA 1GMHG 1YPEH 2NU0E 1C2JA 2BY6X 2AEIH 2OLGA 3V3MA 1CT2E 4P00A 1CA0C 3RXEA 1O3DA 1PPGE 3IITA 1PQ7A 3LT3A 1RTLA 1DWDH 1QJ1B 1MU6B 1ID5H 3BTFE 3T25A 4Q4LA 1EPTC 1AKSA 1GGDB 3BIVH 1C1VH 3MU0A 4I32A 3H7OA 1DM4B 1BRUP 1O2NA 4CR9A 1DWEH 2O8WA 1XXFA 3UR9A 2GJGA 1Y59T 1ETRH 2WPIS 1QQUA 1E1RD 2QXIA 2ZPSA 1SLVB 1FPCH 2F9BH 4UFFH 4FUCA 3W94A 1FAXA 3BTGE 1CO7E 1V3XA 1SLXB 1YGCH 1SHYA 3AAVA 2Z7FE 1O2IA 4D9RA 1IQIA 3S69A 3CS7A 1P9SA 2BX3A 3DA9B 1PPEE 1UHBA 1P2IA 4GLYA 2D2DA 1O5DH 5A0CA 5EW1H 3EE7A 3ZZAA 4E05H 4UE7H 1O34A 1O32A 4O03A 4K3JA 1F92A 5PTPA 3TH2H 3PO1B 3BIUH 3PV4A 5FPYA 2IPQX 1KXAA 4RKOB 1JIMA 1PQ5A 1NFWA 2XNIA 5FPTA 1RIWC 1KXBA 2WYGA 4BTTB 3SUGA 3MH5A 2XC5A 4ZH8A 5JBAS 3OEHD 1IQGA 3BEIB 1MD8A 2BLWA 1ESAA 1GG6C 2ZWLH 3U9AH 4ABJA 2BZAA 3UY9A 1GI6A 1AUJA 1ZTLA 2Q6FA 1B0FA 1FY8E 2DUCA 4ISIH 2EY4C 5GJ4B 1GDNA 2OC0A 1A3BH 2BDBA 3SUFA 3PRDA 5CE1A 5HYOA 1LQDB 3ZVEA 1C5LH 2OD3B 2R2MB 1DWBH 5FX5A 4ACAA 1Q31A 4AGJA 2STAE 1D4PB 3RM0H 3F68H 3BEFB 1LVMA 2W5EA 5A09A 4B2BA 2JJ1D 2FDAA 1TNLA 2VB0A 3U1JB 1YPGH 1C1OA 3VXFH 1P57B 1BRAA 4ZHLU 2ZDMA 1BJVA 1O2JA 2VNTA 4Y7BA 3VB6A 1QBVH 1N1LA 1TRMA 1ZGVA 3T62A 3O8RA 1J8AA 2CGAA 4ZHMU 4FVDA 4TPIZ 2UWOA 5C20A 3DHKH 6GCHG 1L1JA 4Y10E 1SQAA 5EU8A 4OS2A 1OS8A 1E1QD 1HAPH 3MU1A 1WTGH 4Q2KA 6CHAB 5T6GA 2PKSB 5BRRE 5JBBS 2WPHS 1O5BB 4A7IB 1YWUA 2D8WA 3Q76A 3TVJB 5F6MA 4SGBE 1V2WT 1ANCA 4AORA 6LPRA 3RXHA 4YT7H 1UTMA 2EI6A 2FXRA 2JJ2D 2LELA 3BEUA 4MPUA 4ZXYH 1THPB 3RXBA 1E38B 5IK2D 3TGJE 2J38A 1HJ8A 1EZXC 1O3KA 3HATH 3KF2A 5SGAE 1BBRE 5ESTE 3U28C 2ZG0H 3U8RH 4ZROA 2C8YB 2UUYA 1DDJA 1ZPBA 3MHWU 1P8VC 5EJLA 3PRBA 5F53A 1H8DH 1MQ6A 5JYIA 3OEED 2ZIQH 1IQEA 4TPYA 1K1JA 1C5VA 4BNRA 1SGPE 4KKDA 2ZDKA 1O2QA 3B9FH 1YPHE 3ZZ6A 1Z71A 4GVUA 4RI0A 2GT7A 1O35A 1NBME 2VVUA 5BPEA 4NA7A 2GVFA 1XVMA 1NROH 3R3GB 1GHAG 3TITA 2HLCA 2FM2A 3MTYA 1G2MA 1Z8GA 2KAIB 5EXMA 3PB1E 1UO6A 1HNEE 1SGEE 2BVRH 3M5NA 1TE0A 4GSOA 5EXNA 4D76A 2WPKS 4Q63A 3A80A 2AGIX 1DY9A 3F0PA 2VIPA 4NSVA 1L4ZA 1UVSH 3N7DA 3LU9B 1TGNA 1S83A 4ASUD 1P0SH 4MDSA 1P2MA 1LVOA 2Y80A 3M61U 2F43B 3O8BA 2EI7A 4WMFA 5K0HA 4BAMB 1A5IA 3UPEA 1UTLM 3UOPA 3GY3A 1BMLA 4IN2A 3RXPA 3LGVA 2M5TA 1TA6A 2QCYA 4IMQA 1VITG 2A4QA 2QA9E 2YMSC 1OWJA 4ZKNU 3SZNA 3MI4A 4X2WA 1C4Y2 3E8LA 3TGKE 4FETA 2VIQA 3PROA 1GWAA 4TWWA 2ZU2A 1B7XB 1FQ3A 2P8OC 2TBSA 3OTPA 4AFZA 5A0BA 1V2UT 1GHVH 1BTYA 1WUNH 3L3TA 2ZZUH 1SKYE 2KCPA 1LCYA 3RXGA 5CHBA 1MBQA 1YCPK 1HAYB 1C5TA 2A5IA 1GBIA 3KQBA 2V3OH 3E3TA 2GCTB 1SFIA 3VFEA 5C5NA 2FX4A 4LK4A 2O8MA 1Y3XA 2FI5E 3EAJA 1NS3A 4FUDA 2ODQA 3SNCA 1K21H 1P12E 1SMFE 1C4V2 1MBMA 1GJDB 2DE9A 4AZ2B 2VH0A 1KY9A 1NT1A 2OC1A 2P3UB 1QGFA 1TRYA 5A8YA 1BMFD 5GNDA 5HXFA 1S6LA 2HWLB 2ZTZA 3MNXA 4TWYA 2ZPQA 4HFPB 1ZYOA 2FOEA 4F4OC 2VJ1A 1LHCH 2JKHA 1W14U 3BTWE 5C17A 2A5AA 2BYAX 1NFUA 9LPRA 3TH4H 1EJMA 5B6OA 3SU6A 3HGNA 1XUFA 1ZRKA 4X0WU 5FBEA 3URCA 3RXFA 1YF4A 2VIVA 2WPLS 1O5GH 4ABAA 2BVXH 3AW0A 2K0QA 3GY4A 4XBCA 2Z9JA 3RXUA 4MQAA 1H9IE 2WINI 4M9FA 4JCNA 3MNBA 1WDIA 4YTAA 1EOLA 4WMEA 1L0ZA 3AW1A 3SUDA 4X8VH 3GDUA 2EI8A 5EODA 2Y6TA 2V7QD 3DCLA 4U01A 4OS7A 3A7WA 3E0NB 1PPFE 2L6OA 2XXLA 4MNWA 2K1QA 1HLTH 2NU4E 3EGKH 4YZUA 1C4U2 4JZ1A 1G9IE 4Q7YA 4JYUH 3BTME 1C5YB 4OM9A 1SR5C 3KYFA 1AFEH 1GI3A 1N6XA 5DP8A 1OP2A 3D49H 3NKKA 4ISNA 3GY8A 3P8NA 2HNTF 1G36A 1AVXA 4TSFD 1AWHB 3RP2A 2GCTC 2ILNA 2BY7X 3ZVFA 4CRAA 1IAUA 1ZR0A 5LGOA 3A7ZA 1GBTA 3DD2H 1BMAA 1GDUA 2BD2A 1MZDA 5DP3A 3A81A 3LC5A 3B23B 1AB9B 1C2MA 1VGCB 2OQ5A 3A7XA 1ABJH 1S6HA 2VVVA 1ANEA 3GDVA 2Y5FA 5EXLA 3VB7A 4B71A 3TGIE 1FAKH 1TQ7B 2P59A 1VCQA 3WW7A 2GTBA 3LC3A 1FN8A 2Z3DA 3E1XB 1O39A 1H8IH 4I8HA 5TJXA 3LKWA 4XDEA 3MQKC 3DSOA 1RGQA 1CGIE 3G01A 1A4WH 4LOYH 1GI4A 3LOXA 2WUCA 1MTVA 1OXGA 1XMNB 4Y0ZE 3RMMH 6ESTA 2YNAA 2B9LA 4CH2B 2ZPRA 2Y81A 5LPRA 3SV2H 3W1EA 2PKAA 2LPRA 1O5FH 4A6LA 1HRTH 3SJKA 5EQQA 2Y7ZA 4BAQB 3SW2B 3Q77A 1QA7A 1LKAA 2BD3A 3ZZBA 4AYVB 2WV9A 3LDXH 1QJ7B 2VGCB 4WH8A 3EA8A 4YLQH 2PR3A 5DP5A 1BTWA 3TK9A 1P9UA 3EE0B 2TRMA 1C1TA 2ZGHA 4GHTA 1K2I1 1KDQA 3V13A 3SYJA 4IS5A 3A8AA 4FOUC 1TBQH 3DFJA 4INHA 3S9BA 2ZFQH 3E16B 1GMDG 3ZZ3A 2A7JA 3TK6A 4B2AA 4B74A 2BD9A 1GJ9B 2F9VA 4UFDH 4Y8XA 3O8CA 1SG8B 2ZCKP 2ZHQH 3MU5A 3AK5A 2A4GA 4VGCB 1INCA 1WSSH 1Z6EA 4BAHB 1CBWB 2A45B 1P3EA 2FX6A 4AG2A 4FUBA 2ZHEH 1O2OA 1PQ8A 1GCTC 1EJNA 4YO9A 2UUJB 2OINA 3VGCB 3SV6A 4A92A 4KTUA 1GL1A 3DSGA 2VBCA 2JIZD 1KMHB 1UVOA 1SOTA 3GCTF 2HLDD 4JK6A 3TJNA 3PLBA 1J17T 2H2ZA 1TNHA 3H5CB 1THSH 1A2CH 5L6NH 3GCHC 8GCHG 2ZC9H 5E0HA 1IHTH 1VITH 2IOTA 2ANYA 5DN6D 3L6PA 2GZ8A 2P16A 2FMJA 3FZZA 1GI8B 2ZU1A 3RC4A 2SGQE 1QIXB 1BA8B 3FZDA 3RUOA 3RXTA 3GY7A 4RN6A 3K9XB 1VCPA 3SNBA 3F2GA 1MTNB 2QIQA 2WUBA 2A31A 5G4BA 2L74A 1YCPH 4CRFA 2WPMS 1DOJA 2J98B 4X1NU 5E2PA 1UVPA 2VIDA 3Q3YA 1H8ED 1AZZA 1PJPA 1T4UH 1D9IA 2ZQ1A 4IGDA 1L2EA 1MAYA 1QA0A 3BG4B 3CENA 1S5SA 1SGIB 2ZGJA 4CRBA 3BG8A 2R0KA 2FTLE 3CS0A 1CQQA 4PROA 3VXEH 1XUJA 4X1RU 1NPMA 3D23A 1EAXA 1CA0B 4Y79A 5FCRA 3A86A 4B6EA 4A5TS 5EPNA 2ZCHP 5TCAA 2EQNA 1F0UA 4H6SB 1BT7A 1GI1A 1Z1JA 1EPTB 1JXPA 2BZ6H 2FWWA 1QBNA 1H8HD 5IYTA 2V3HH 3SJOA 1YM0A 5E2OA 2J9NA 3UTUH 2BY8X 1Z6JH 1GVLA 4ABHA 3K65B 1X7AC 4FUGA 3ITIA 4A1TA 1QRWA 2BXUH 1GCDA 4OGXA 1HAXB 3BTEE 1O2SA 4INLA 1Y8TA 4WH6A 4DJZB 3T26A 4X1SU 4YOJA 1BTZA 2QN5T 3KCGH 1GMHF 3SHCH 3BN9A 2QXJA 4ZKOU 8KME2 1AU8A 2F9OA 1LHDH 1K1LA
chains in the Genus database with same CATH topology
3Q00A 1KXFA 2ALVA 3RXVA 1ZSJA 1HJAC 4B1TA 1RD3B 2JH0D 4H6TA 5DPAA 2TPIZ 1RIWB 1BJUA 3RMOH 1ZHPA 3MNCA 1W10U 1AHTH 3LONA 1FONA 4BTIB 3ZVDA 3LJOA 5GCHG 2SNWA 1GG6B 3HKJB 3AAUA 1TGCA 3W95A 1O2RA 1DITH 1D3QB 3MYWA 3PMHB 3RXIA 1TPSA 3C27B 4A1XA 4OS5A 2P94A 2BDAA 1C5NH 5A8ZA 1MAXA 1T31A 1IQJA 4UEHH 2GMTC 1GBAA 2HPQH 4NG9H 1TMBH 2ZDAH 4JZDH 1HCGA 3RLYH 4A1VA 4J1YA 1YPLH 1L4DA 1P2QA 1HAIH 1YP9A 2BLVA 1BTHH 3RC5A 2JH6D 4DVAU 1A7SA 1GBLA 1GMCG 1DXWA 2AGGX 4AB8A 1C2DA 3SQEE 1AN1E 1Q2WA 2ZU3A 3SV7A 1MZAA 3QK1A 3KQCA 1PQAA 2BDIA 1DS2E 2FOGA 2ZEBA 1HAOH 1KTTB 1AFQC 4K1EA 2C8ZB 2F83A 1V2KT 5EW2H 1CVWH 3UQOA 1SFQB 3EA9A 3SU1A 1ETSH 1WYKA 2Q1JA 4Q7ZA 3A89A 3UQVA 1CGHA 1GJAB 4CHAC 1TX7A 4OGYA 3MWIU 1O2WA 2GCHG 2XC0A 2XYAA 6GCHF 1AMHA 1AVWA 2FLRH 3KGPA 2BQ6B 1QHRB 4KP0A 3ZYDA 4BAKB 3Q3KA 1HIAB 1FIWA 2CHAC 4IN1A 1T8LA 3KL6A 5T6FA 1GHWH 2AMQA 2KAIA 2BOHB 1TABE 1LMWB 3GICB 4I33A 5JPMH 1DE7H 1G37A 5I46H 1QL8A 1EAWA 4ABFA 3PM3A 2Q6DA 3GY2A 2J95A 4E06H 1SLUB 2SFAA 3RDZA 1F2SE 4GCHG 1MMJN 3PMBB 1MKWK 4F49A 3QN7A 2HPPH 3UFAA 3QZQA 1NU9A 4H4FA 1EAUA 4ESTE 1OX1A 1XXDA 3ZZ7A 1QJ6B 4O3UA 1ZLRA 1Y5UT 4WVPE 1P04A 3RLWH 1Y5BT 4ASHA 1HB0B 1LPGB 1EAIA 1BUIA 2C8XB 1GHAF 3S9AA 1C2IA 4CH8B 4JK5A 2XRCA 2P8OB 2V6NA 4BXWA 1ZSLA 1ZRBA 4X8SH 1GBJA 5GDSH 2NU2E 4DT7B 5FPSA 1OWKA 3ODFA 1XUGA 5DP7A 3B8JA 2EC9H 4FU8A 1UTJA 1MH0A 4HTCH 1Z8JB 1TX8A 1GJ7B 2HOBA 3K2UA 3K6ZA 1YPKH 4FU9A 4AX9H 2PUQH 5JB9S 1DX5M 1GI2A 1H9LB 4Y76A 1O5EH 3O8DA 2UWPA 4JZIA 2FI3E 2FOHA 2Q6GA 1O3OA 2A7CA 1V2LT 3ELAH 1GHXH 1XKBC 1XVOA 1NESE 1VITF 3FP6E 1O3MA 2JH5D 1Y5AT 5L2YH 1DLKB 1LPKB 4THNH 3RXMA 2G4UA 2ZGCA 4UDWH 2Z94A 1D3DB 2ANWA 2UUFB 1DXPA 4ZHAA 1DANH 1K1NA 3U8TH 1YPHC 1YBWA 1P01A 3UIRA 1WQVH 3F6UH 1AE5A 2FOBA 2WPJS 2PTNA 2Y82A 1NFXA 4JZFH 1RRKA 2BMGB 1BMMH 4RSPA 1SGDE 2OBQA 2XWAA 2IPHA 1Z8IB 4QT8C 2ZO3H 1OP8A 3S7HB 3M7QA 4IC5A 5CMXH 2HNTE 4K8YA 4XBBA 1BB0B 4WF8A 5J4SA 2F9NA 1ELAA 2G8TA 1W7GH 1NY22 1T8NA 1AD8H 4IC6A 2G5VA 3NZIA 1GJBB 3SGBE 1TX6A 1UTQA 4OS1A 2WV5A 3RU4E 2F91A 2GKVE 4BXSA 2GZ7A 1QRXA 3GCOA 2HNTC 5DGJA 1TIOA 2VWNA 2PWXA 3EYDA 1O31A 3ZZ4A 1FY5A 2PHBA 1SGFG 3P95A 1LTOA 1QL7A 2CN0H 1DY8A 1DUEA 3SNEA 2EEKA 3TU7H 3GOVB 3M7TA 1O2LA 5EQRA 5ESBA 1AUTC 3ZVBA 3ATKA 1GHZA 2AS9A 2PSYA 3E90B 1EATA 2R2WU 1G3CA 4I8KA 1O5AB 5A2MH 4YESB 1P3CA 5T6DA 2FTMA 1ZTKA 2R3YA 1JMOH 1HGTH 4JZEH 1TNJA 2ULLA 4MLFB 4XSKU 1O2UA 1QB1A 1BIOA 1O3NA 1MUEB 1CHGA 3PWCA 3IG6B 1OWHA 1NM6A 3NK8A 3T2NA 3HK6B 1A46H 5C1YA 4NA8A 2GV6A 1DLEA 3HGPA 3MU4A 4BTUB 2J94A 1GJ4H 1V2NT 4KGAA 5DJ7A 1DFPA 1VJ9U 4D7FA 2CF9H 1GI5A 4INKA 4DG4A 2ZCLP 3MOCA 2QXHA 1C5ZB 3U1IB 1ORFA 1CHOG 2QF0A 1GJCB 4X2XA 1NRQH 2HALA 4NFEA 1O2TA 1DUAA 3OSYA 4B75A 3RXJA 3Q3XA 1F0TA 1TMUH 5AHGH 4B2CA 2AERH 2YOLA 2ZA5A 3RXLA 2FOAA 1QBOA 3IWMA 1Z8RA 3WY8A 3MO9A 1LHFH 4K5ZA 1Z1IA 5EPYA 1CA8B 1MKXK 3M3VA 3MH7A 1EZUC 1QCPA 1NTPA 1PPCE 2SGEE 1HAHH 2ZTYA 3M5LA 3U98H 3M37A 1FY4A 2ZHFH 4LZ1H 1DT2A 1TNKA 1YLDA 2G52A 4AFUA 5JB8S 1TPOA 1IQKA 1V2ST 1GHBG 1C5OH 4U32A 1HAVB 3ESTA 1HXEH 2BVSH 1O3BA 1PYTC 2G5NA 3OTJE 5ABWA 2A5KA 1THRH 1AZ8A 1GCTB 4K1SA 3F9HA 1ETTH 1W3CA 2G00A 4TY7A 5DKMA 2RA3A 1MKWH 1IQMA 4NIVA 2PGBB 1OPHB 1T8OA 4ABEA 1P09A 1BMNH 2SNVA 3GCHB 1GBFA 4X1PU 1LVBA 1AQ7A 1LPZB 4B76A 1JWTA 1FI8A 3LH1A 4FUJA 1UK3A 2CJIA 2RDLA 3A8DA 3NPSA 1GMDF 1GBEA 1BTUA 3P8OA 4ZKSU 2FO9A 1FV9A 1ABIH 2R3UA 3ZZ8A 2VINA 4AGKA 1V2TT 5JBTA 3PLKA 3F9FA 3M3SA 3KN2A 3URDA 1G3BA 1T32A 3LGIA 2PFEA 1M9UA 3QTOH 1F0RA 1ZJDA 4R8TB 3A7TA 3SU2A 1CGJE 2ESTE 3L33A 1FLEE 3RXAA 1S84A 3S7KB 4GPGA 3VPKA 4XFQA 1ELDE 1P05A 2B5TB 5FCKA 1O5CB 5EG4A 1C5MD 2RG3A 2ASUB 4RKJB 1UK4A 3RXQA 1O37A 3UNSA 8GCHF 1SGTA 2VIWA 3P92A 1HV7A 3ZVAA 3T28A 1J16A 1P10A 3RXKA 1EP5A 2BM2A 1P02A 2F9PA 1NN6A 1QQ4A 1WAYB 3V12A 4I31A 2YNBA 1LKBA 1CT0E 1TONA 1YLCA 2AH4X 3LIWA 3RXCA 1AY6H 4GUXA 3TJUA 1HDTH 1SL3A 2A2XH 1O33A 1SOZA 4FUEA 4X6OA 2G4TA 3KHVA 1ELFA 9ESTA 4YOIA 2W7UA 1C5QA 4FUHA 1DWCH 1C2LA 1W11U 4O3TA 1O2VA 1C1WH 1V2MT 7GCHG 1SLWB 3FAOA 3A7YA 3E91A 1KSNA 4HI3A 1GL0E 1N6YA 1EXFA 1YPMH 2ZHDA 3QGJA 5AFYH 3FP7E 2O9QA 4U2WA 2ZHWH 2C8WB 4X6PA 1ZMJA 1SGFA 1BZXE 3V0XA 2XBYA 1IQNA 1HJAB 1T4VH 3MH4A 1ELVA 3MFJA 3TPIZ 2J4IA 2Z9KA 2UUKB 3TJVA 1O3CA 3PTNA 5DG6A 3SU5A 2PLXA 3T29A 5GXPA 1SGCA 3D65E 5EOKA 2A1DB 3BF6H 5E8EH 2JETC 1TOMH 2OP9A 1C5UA 1NO9H 3QGNB 3RXDA 1EQ9A 1RTFB 1JOUB 1CU1A 2BLOA 4WWYA 1UCYK 3GDSA 1Y3UA 3LJJA 3RU4T 1ZHMA 3OY6U 3P8FA 1AVGH 1A0JA 1H1BA 1O3EA 1A0HB 1DVAH 2H9TH 4NA9H 2EA3A 2ZU4A 4LZ4B 2GMTB 1FMGA 1TPAE 2SGPE 1UMAH 5A8XA 3SUEA 5FX6A 3OX7U 1UTPA 1AI8H 1L1NA 3BTDE 1BTPA 2BB4A 1SPJA 1JIRA 3SU4A 2D26C 1P2NA 1Z7KA 3MMGA 4M7GA 3STJA 5GCHF 4Y7AA 3NCLA 4DIHH 2H9EH 1WQSA 4NGAH 1ZHRA 7KMEH 3N7OA 2FLBH 1ARCA 4NWLA 5HGGA 1UTOA 3SQHE 1BHXF 1N8OC 5CHAC 5HMAA 1GVKB 1O2YA 1QB9A 2FIRH 2H5CA 2WV4A 1ELCA 1ZSKA 3GYLB 2BD4A 4YLUA 1QRZA 3RMLH 1KXCA 1MTUA 1K22H 3LGUA 1E35B 1XM1A 1MKXH 3ZZ5A 1JRSA 1AFQB 2ZFTA 3UREA 1O3HA 2Y5HA 1F7ZA 1BCUH 1S81A 1VZQH 3SI4H 4DIIH 2G81E 1C1MA 1OKXA 3RXRA 3A87A 3SORA 1T8MA 5TCCA 1QL9A 2A2QH 2FYRA 4YOGA 1O38A 3UR6A 1SGQE 4CHAB 1OOKB 4NZLA 3FANA 4Y11E 1RJXB 4BANB 3A7VA 2THFB 1MTSA 1GMCF 1W0ZU 1SGYE 2BLQA 1SHHB 3UWJH 2A32A 1P11E 4ZUHA 2QY0B 1BITA 1TNIA 1FXYA 2CHAB 1EB2A 5C2ZA 1C5WB 4OS6A 1ZPZA 1SBWA 1O2KA 2OC7A 2QAAA 4MPVA 3SJIA 3OY5U 4ISHH 3SOSA 1F5LA 1OWDA 2BDCA 3UOUA 2BD8A 3TNTA 1ZTJA 4Y6DA 4X8UH 1RS0A 3E6PH 1G30B 1EOJA 2ZDLA 2HRVA 2R0LA 2ODYB 2RCEA 2ZGXH 1UK2A 1B0EA 2DE8A 2ZP0H 3PYHA 1GBDA 2XW9A 2CXVA 2GCHF 4H42U 1SSXA 1K1MA 3F9GA 5EGMA 4CR5A 3MO6A 1FJSA 2QV1A 1ZOMA 2FPZA 2GGVB 2VIOA 3NXPA 4WJG2 2H1UA 3P6ZB 1TGSZ 2GX4A 3I29A 5C1UA 3S9CA 1FN6A 1TGTA 4K1TA 2P3FH 1BOQA 1PFXC 4DGJA 2AIQA 3NWUA 1TB6H 2BDYA 1SGNE 1TRNA 2P95A 1O2MA 3SBKA 2GV7A 1ESBA 2I6QA 3DT0H 2FOMB 5DK1A 1C5PA 5F03A 4GCHF 1P06A 1K9OE 1SQOA 3M3TA 4TYDA 5J4QA 2NU1E 2O8LA 4WMDA 1JRTA 3P17H 4FUFA 1GJ6A 1UVUH 4AOQA 5FAHA 1C1PA 1F5RA 3UNQA 5FHTA 3JZ2B 2F9UA 4K8BA 3VB5A 4I7YH 2QC2A 1EJAA 2V0BA 3F9EA 1ANBA 1FZZA 1O3PB 1OYTH 2FYQA 8LPRA 1HAZB 3PMAB 2XC4A 5GPIB 1QTFA 2XCFA 1TMTH 2ZTXA 2OUAA 1ESTA 3QDZB 1EP6A 3BTKE 3E0PB 1KLTA 1FIZA 3BTTE 4O97A 1TLDA 1GBCA 2OQUA 3GY5A 5C3NA 4NFFA 2J34A 4AFSA 1GI0A 3PLPA 3SNDA 4ABDA 5DP6A 1O3GA 2ANMH 1KYNA 1K1IA 2BXTH 1CE5A 2AMPA 2TGDA 4I8LA 3V7TA 3LGTA 1D3PB 2CMYA 4J2YB 1QY6A 4Z0KA 4XOJA 1Q3XA 2Z3EA 2C93B 4FUIA 3TLOA 2TIOA 1IQLA 4NIYA 4GAWA 3A8CA 2OC8A 2QXGA 3MO3A 1D6RA 2HGTH 1AKSB 4LXBH 4HGCA 1GGDC 4U30A 2PGQB 1BRCE 4OS4A 1NFYA 1OYQA 2AFQB 3I78A 3SGAE 4AG1A 4CBOA 1PPBH 1UCYH 2Y5GA 4ZXXH 4KTSA 1W7XH 4K2YA 1EASA 4WY3A 4FVBA 1QNJA 2ZFFH 2BD5A 1O0DH 3F1SB 1NRSH 4DY7B 2QGRA 2AGEX 1EZQA 1GBKA 3AASA 3QUMP 4Z6AH 1FY1A 4CREA 1H9HE 1KLJH 5I25A 1IHSH 4ISOA 3NUMA 1EZSC 3VEQB 1UHBB 1S0QA 2HVXA 1XX9A 2FZZA 3ATLA 3KEEA 5DP4A 1AWFH 1OP0A 5E0JA 3GYMA 4MPWA 2Y7XA 4NIWA 3STIA 4X6NA 4IMZA 3P8GA 3BV9B 3SHAH 1RTKA 4Y0YE 1WBGB 1TNGA 1C2HA 3PO1C 1S85A 5C5OA 1E37B 1V2QT 1MD7A 5FXLA 4IW4E 3A84A 4ZAEA 2Z6BD 4DOQA 3LGYA 5F8ZA 1J15A 3PMJA 2PUXB 3SN8A 2CF8H 3U8OH 4XE4A 1FY3A 1TYNA 2NWNA 3SJ8A 1ANDA 3BTHE 3PTBA 1LDTT 2O8UA 1O30A 1BRBE 1HXFH 4CRGA 2Z9IA 1H4WA 2A7HA 1DPOA 3DFLA 2ZDNA 3M35A 4UONA 1ZGIA 3MNSA 1K1PA 1ZMNA 1HPGA 2VWMA 2IJOB 3C1KA 3SGQE 4UFEH 1OWIA 2V35A 1A3EH 2BX4A 1IQFA 2OBOA 2BY5X 4AN7A 3SV9A 3LH3A 2ZU5A 2W3KA 1CHOF 1HAVA 2GDDA 1S6FA 1C2KA 1EX3A 4JYTA 6CHAC 1O2GH 2PKSC 1FPHH 1C9TA 1CT4E 2VWOA 2FS8A 1AE8H 1HAGE 2ZFRH 4E7NA 1G3DA 1JBUH 3QZRA 3RU4D 4HZHA 4ZKRU 1KLIH 3JZ1B 2BQWB 1QURH 2PSXA 3RMNH 2P3TB 2FOFA 1AIXH 1C1SA 1SGRE 5C67A 3ZVGA 2PTCE 1FNIA 4TY6A 1E0FD 1QR3E 1VCWA 3M36A 5JBCS 3QX5H 5FBIA 2R9PA 1P03A 2B8OH 1IOEA 2AYWA 4BOHA 1GBMA 2G51A 1TBRH 4ABGA 3P70B 3ZV9A 5LPEA 5L30H 1TWXB 2SGAA 3KQEA 3SV8A 3DUXH 4NIXA 1Y3YA 1GHBF 1GI9B 2GP9B 1UVTH 1T7CA 3SU0A 5H4IB 1W13U 3OYPA 3RM2H 5A0AE 2VU8E 1A0LA 4GHQA 4CBNA 5E0GA 5T3HA 3HKIB 1C2EA 1NRPH 1XKAC 1C1NA 5LH8A 3SI3H 3UUZA