4ZKRU

The crystal structure of upain-1-w3a in complex with upa at ph9.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU01
3RXIA 4A1XA 1ESAA 2FS8A 1IHTH 3ZZCA 2J9NA 9LPRA 3C1KA 4AFSA 1ABJH 4OS2A 3BEUA 3SU6A 2O8TA 4AGKA 1KXAA 2WPMS 4OS1A 2BDYA 4FUCA 2J38A 3V12A 1Y59T 2ANKH 4AN7A 3N7OA 1PPBH 3F9FA 1SB1H 1L0ZA 1SSXA 2CXVA 1JWTA 1DM4B 1AMHA 1IQMA 3PMAB 2HLCA 1EQ9A 3BTQE 2R3YA 1ETSH 1C5TA 5L6NH 1G36A 4Y8XA 1SOTA 2WYGA 4E06H 2CF9H 4A1TA 1SFIA 2BVRH 1CGHA 1VGCB 1C5VA 1GJAB 2ALPA 3GCOA 2K1QA 1NRQH 1HAZB 1GCTC 1WU1A 2FS9A 1SGPE 4CREA 5F8TA 2A4RA 2BM2A 1DWEH 3GCTG 1J16A 4U30A 1LMWB 3LIWA 4CRGA 5FPYA 2FX4A 3TJOA 4FUEA 1NM6A 3SNEA 1O2MA 3TIUA 3VFEA 5DK1A 1MBMA 1UTOA 2VINA 1C1TA 1FUJA 5A09A 4K3JA 3AVZA 1KTSB 2ESTE 1E37B 1JOUB 1CBWB 3GDSA 4E7NA 1GI1A 1O3DA 3A83A 2XNIA 5GCHG 1THSH 4RKJB 3EA8A 3P8OA 2PKAA 3LPRA 4WJG2 4E7RG 1GHBG 3TH3H 8GCHF 2TBSA 5EQRA 4Y79A 3SU1A 1BDAA 5CHAB 3M7QA 1Z8GA 4AFUA 2FP7B 3L33A 1DT2A 1FQ3A 3PB1E 4CRDA 4H6TA 5E0JA 5JPMH 1NO9H 4NIXA 2FOAA 3A8BA 1OWDA 3P92A 3RMNH 2V6NA 2OP9A 1HAGE 1MTVA 1O3HA 4ISOA 3SNDA 4CH2B 2GCTB 1KLJH 1MKWH 1TB6H 2WUCA 3LKWA 5GIBA 3RXQA 4BAKB 1AVWA 3WY8A 1BB0B 4YOIA 2GZ7A 3PMBB 2PTCE 1WUNH 2OC0A 2BQ6B 1A0LA 2QCYA 3SV2H 1HIAB 2BY6X 2VWNA 2W7SA 3U1IB 1GL1A 1O2XA 3TJUA 3EA9A 4BAOB 2ZDLA 1DWBH 2B8OH 2BOHB 4ZAEA 1GJ4H 1F0SA 4ZKNU 5DGJA 4A5TS 1C2DA 4YOGA 3LH1A 1THRH 2ZDVH 2ZCKP 3A81A 4DT7B 4BAQB 1V2UT 2FOEA 1ZTKA 1DXPA 1O38A 3NCLA 1AY6H 1EJNA 4YT7H 4O3UA 1A5HA 4NA9H 2Y5FA 2ZFPH 4TPYA 6ESTA 1DSTA 3MH6A 1O35A 5ETXA 4H42U 4NZLA 3SU4A 4I33A 2P8OC 3KQBA 2HOBA 3M5OA 4TY7A 1V2JT 4FU9A 1UVOA 1EZUC 4X1RU 1JRTA 4X2YA 3URDA 3OY5U 4U32A 2QXHA 4JZFH 1G2LA 2HRVA 2F83A 1GJDB 1IQIA 2EI6A 4ZHLU 1T4UH 2QXIA 4OS7A 5E0HA 3H7TA 1T32A 1L1GA 3SUGA 3NPSA 1Z8IB 5FX6A 1LVBA 1P04A 3BTDE 1SOZA 1E0FD 1P57B 2QIQA 1UK4A 1Q3XA 1SLWB 3RXMA 1QJ6B 2M5TA 3A7XA 1CU1A 1TFXA 3SNBA 2PKSC 1EB2A 1T7CA 1C1SA 2R2WU 1EAIA 2ZPQA 2Z9IA 3QTVH 2BB4A 1W7XH 1N6XA 4ZHMU 1SMFE 4ISNA 4D8NA 3RXRA 2CV3A 3FZZA 2ZIQH 3AASA 2CMYA 3SJKA 2BD9A 2V0BA 4WXIA 1GHZA 7KMEH 4PROA 1Y3UA 1DWCH 1GJBB 1GHYH 2ZKSA 4WF8A 4NIWA 4NG9H 1FZZA 2ZG0H 3RXPA 2NU4E 1OX1A 2P94A 4J2YB 4JZEH 1Y5AT 1O39A 2G8TA 3RC4A 1CGIE 2G4TA 4TWYA 1KIGH 1D4PB 1CA8B 1VITF 3KF2A 4X2VA 1F92A 1V2QT 2A2QH 3UREA 4TYDA 4LOYH 3ODFA 1E34B 5LPEA 1XUKA 2UWLA 3LGVA 2Y7ZA 1PQ8A 2A7CA 1C1PA 4XDEA 5I46H 3OU0A 1HAHH 2ZP0H 4ZKSU 1CHGA 4X6OA 3ZVAA 1MU6B 1BHXB 2OTVA 4WH8A 4AYYB 1QCPA 2A31A 1UTPA 1FJSA 5EXMA 4UFDH 1E35B 2AGEX 2GX4A 2ODYB 3PLKA 3V7TA 3BTTE 2HALA 2VNTA 2VIPA 4MNYA 5BPEA 5DP9A 1GI0A 1EZSC 1O2JA 2YOLA 1S81A 1W13U 2VU8E 2BD4A 2ZI2H 2BZAA 4YZUA 5JBAS 3RXCA 3HGNA 3BTWE 1K1PA 3ZV8A 1O0DH 4IN1A 1P0SH 5EXNA 2BDHA 3QTOH 3P95A 4I8KA 3SOSA 1Z1JA 4UFGH 1DDJA 2ZDNA 1V2TT 1UHBA 1WOFA 4DOQA 3M36A 2GCHG 3FP8E 1G37A 1O33A 1SGQE 2AIPA 1ID5H 1HXEH 1LDTT 5DJ7A 3JZ1B 1HYLA 1GBAA 3RXSA 3SU0A 1O34A 3ZZ3A 1OWHA 1PPHE 1HAOH 1F0RA 3DA9B 4INKA 2TGAA 2XCNA 1O2UA 1ZGVA 3PTBA 1HJ8A 2TGTA 3Q3YA 2GTBA 2ZA5A 1T8LA 4NFEA 1ZMLA 2OCVB 4JZIA 3VPKA 2F9PA 2BXUH 5AVDA 1UTLM 1ZHRA 3RDZA 1O36A 1DANH 3HGPA 1K1IA 4X6MA 1G30B 4I32A 4IBLH 2VWMA 1ZHPA 3HKJB 2XBYA 1KY9A 2AERH 1A5GH 1FPCH 1FXYA 2QY0B 4X1QU 1ANDA 4INLA 3SBKA 3AW0A 4Z6AH 1ZOMA 3SUDA 1LKBA 3O8RA 4BOHA 3UPEA 1HNEE 3K2UA 2AIQA 3ZVGA 3S69A 2ZHFH 1XMNB 4ABHA 2GD4B 5DP8A 4F4OC 4KTUA 3KNXA 1D3QB 2F9NA 3E1XB 4ZROA 3RXDA 5JB9S 1G32B 1GBEA 1KXFA 4I7YH 1Y3XA 1FV9A 1P2NA 2A1DB 2PWXA 1ELCA 1P01A 1O5DH 3VGCC 1Z71A 2ANWA 4AFZA 1A1RA 3PLPA 1SHYA 2BX4A 2RG3A 4VGCC 3SI4H 4X8SH 1RXPA 1ESTA 4KELA 5F8XA 1SVPA 1O2ZA 1JXPA 3RXJA 4X8VH 1C5XB 1NPMA 1GVKB 4Z0KA 1GBHA 1XKBC 3BTHE 4ZMAH 2GDDA 2ZTZA 5F03A 2QF0A 3LH3A 1TOMH 5C5OA 3UR9A 3RU4E 1QURH 3OSYA 6CHAC 1IQJA 3A8CA 3BN9A 1TNJA 1KXEA 2D2DA 3D23A 5A8ZA 1K28D 1SGFG 2Z9JA 2C8YB 4I8LA 3LGIA 2BD7A 2FLRH 2XBWA 1OOKB 3GCNA 1WAYB 4FVDA 2TPIZ 2GDEH 4BTIB 3ZV9A 5LH8A 1FPHH 3H7OA 1FY8E 2FWWA 3M7UA 3MU8A 1LPZB 2V3HH 4UFFH 1W10U 3MU0A 1IQHA 4DJZB 2XYAA 1C1NA 5HMAA 2RA0A 1NS3A 3BTKE 3SGAE 3QZQA 5PTPA 4DIHH 1O3AA 2FOCA 1P3EA 1EOJA 4O03A 1RD3B 3T27A 4I8HA 4A6LA 1GBCA 1A2CH 3FP7E 1MTUA 4X1NU 2ANMH 1YPHE 4MNVA 1DITH 2SGFE 3S9BA 1LHEH 4GCHG 5DP6A 2HGTH 1C2IA 1CHOF 1GHAF 2ZU1A 1DY8A 1G3DA 1ZGIA 5T6DA 1ELGA 1DUEA 1W7GH 2ZGJA 3E90B 3OY6U 2ZHDA 2ZZUH 3A7TA 3PTNA 2FOHA 2F9VA 2R0LA 5E0GA 1AKSA 1GVZA 3L6PA 3MNSA 3RMMH 1GCTB 2CF8H 1BTUA 1UVUH 3RP2A 3U1JB 2ILNA 1YM0A 5T6FA 1T8OA 1ZRKA 3A7WA 2SNWA 4WH6A 1P06A 4OGYA 3LGUA 1F0TA 5JBTA 1GI6A 1QGFA 2R0KA 3QK1A 1NROH 1ZJDA 1C5MD 2H6MA 1KXBA 1OWIA 3MMGA 1AWHB 2PHBA 3ESTA 3MNCA 1C2EA 4ABGA 3ENSB 3T5FH 1YPJH 1SC8U 1L1JA 1C1WH 1TMUH 2ZQ2A 2BVXH 2VWLA 4AB9A 3S7KB 3AW1A 4QT8C 2A32A 2WUBA 2GV7A 4U2WA 2RCEA 2A5KA 3ATIA 3TVJB 2ZO3H 2ZFQH 1BOQA 4BAMB 2AEIH 2P8OB 1BCUH 4ISHH 3R3GB 1MKWK 1UTNA 2BXTH 1QL8A 3TK6A 3EDXB 2FOMB 2ZQ1A 1YPGH 4IC5A 2A45B 2AH4X 2ZDAH 3C27B 1NC6A 4ZXYH 2BLQA 1IQNA 1BA8B 4BAHB 2UUYA 4MPWA 1W3CA 2I6QA 1HXFH 3SV8A 2IPHA 4D7GA 1MAYA 1S83A 5EU8A 4NA7A 1W8BH 1INCA 3D62A 2FEQH 3LT3A 4UDWH 3SJOA 3BTME 1MCVA 1S5SA 4VGCB 3KIDU 1D3TB 1NRNH 1B5GH 1F7ZA 4CBOA 3VB4A 1LCYA 2ZPRA 1HJ9A 3W95A 1IQKA 2NU1E 2C8WB 5EG4A 1C2KA 1O2QA 5GCHF 1QBOA 1XXFA 4CRFA 2GCTC 3SHCH 1TBRH 2CGAA 4HGCA 2FOBA 3QDZB 1PPCE 4UONA 4Y0YE 1KXDA 4HZHA 2ZEBA 3MO6A 1EZQA 2PGQB 1MCTA 4MQAA 2VIDA 2QN5T 1Y3YA 1XM1A 1P12E 4JZ1A 3ZZBA 2XC0A 1FMGA 1O2PA 3LC5A 1C9TA 5FHTA 5C3NA 5CHAC 1O2WA 2KAIA 3UIRA 3Q00A 1D6RA 1GGDC 1MBQA 2R2MB 2ZFRH 1QTFA 3RXFA 4Y7AA 1EASA 1EJMA 1NZQH 4M7GA 1EPTB 3D49H 1ELAA 3F9EA 1YCPK 3EYDA 4BNRA 1HV7A 1K2I1 1AFEH 3QO6A 3QZRA 1NFUA 5K7RA 2ZU3A 4YM9A 2QXJA 1VZQH 3U8TH 1LHDH 2PLXA 3RC6A 2Y82A 3DFLA 1IHSH 3UWJH 3MU1A 1RIWB 2O8LA 1A4WH 2EI8A 5EPYA 1E36B 2C8ZB 5EXLA 1TPPA 4MNXA 2Z3EA 5AFZH 1BTHH 2BDCA 4YLUA 1AU8A 1O2TA 4AYVB 3PYHA 1V2LT 4D9RA 1YLCA 4XSKU 1IQGA 1P2JA 1ZJKA 4MDSA 4CR9A 4YESB 1GBJA 1WBGB 2P16A 2ZDKA 1VGCC 3P8NA 3MNBA 2JH5D 3PLBA 1K21H 2ZC9H 3SJ8A 4DW2U 1UO6A 2ASUB 3F9GA 4LZ1H 2LPRA 1LVYA 3U69H 2ZDMA 1UCYE 3TH2H 2HVXA 2H1UA 3TU7H 3PMJA 2FESH 2HPQH 3F9HA 1HGTH 3W94A 2F9OA 1H8IH 1AUJA 3RM2H 1O3JA 5E8EH 1ELFA 2ZGBH 1U6QA 3BV9B 1GMDF 3IG6B 3RXAA 5EPNA 2NWNA 2CJIA 2BX3A 3KGPA 1QL9A 2BD8A 2CN0H 1H4WA 3GY4A 1F5RA 1MD8A 3DHKH 3RMOH 1BBRK 3RU4D 2G5NA 1XUFA 1EPTA 1JIMA 3LU9B 2FZZA 1YP9A 2FXRA 6GCHF 3I78A 4Q2KA 2FOFA 1YPMH 4F49A 1QHRB 5DP4A 1GBDA 2BY9X 1GJ9B 3LJOA 2PR3A 4WXVA 1OS8A 1AI8H 3ZZ8A 2W3KA 2B5TB 3S9CA 1BRBE 2OD3B 3FZDA 2R9PA 1MD7A 1C2GA 4ZUHA 2C3SA 1YCPM 5DPAA 2AS9A 4D7FA 5L2YH 2IOTA 3TGIE 1SLXB 2V35A 1ANBA 2Y5HA 3VEQB 4CR5A 1TE0A 3NK8A 4CRCA 2W7UA 3BEFB 1KDQA 4ISIH 2G5VA 1GDQA 3O8DA 5A2MH 2THFB 3UOUA 1LO6A 4XFQA 4MPXA 3SNAA 1ZYOA 1ZTJA 2WINI 1NFWA 1HAXB 1ZZZA 2FTLE 3GY3A 5A0CA 3RXGA 1AUTC 2GCHF 1BMMH 4X0WU 3PWCA 1M9UA 5B6OA 1QB9A 1DX5M 1FONA 1TX8A 1L4DA 4KTSA 1Z8JB 1VCQA 3DFJA 1MTNB 1V2MT 4U01A 3ZZ7A 3GCHB 1OYTH 1TGTA 4DIIH 1CO7E 1O2RA 2BDAA 1BJUA 3TLOA 1JMOH 5HM2A 3PO1C 2HNTF 2BQWB 4K1SA 4OS4A 2GMTB 2XWAA 1QB6A 1BT7A 4A7IB 3NWUA 1AB9C 1AN1E 4JYUH 4BTTB 3QLPH 2A4OA 1OP2A 2QYIA 1BTYA 3QUMP 3LOXA 3VB6A 4B73A 1GHVH 1C5QA 1ZPZA 1EP6A 1CHOG 1GHAG 2C4FH 1FY5A 1G3CA 1QY6A 4MPUA 3SU3A 3RUOA 4CRAA 1O2YA 5GXPA 1GMDG 1O3CA 2OQ5A 1MMJN 3RXHA 1UTJA 1WCZA 5DKMA 1AD8H 4RSPA 1C5SA 2CHAB 1EOLA 3P6ZB 3ATLA 4YO9A 4LZ4B 2ULLA 1CA0C 1HCGA 1SGTA 1NRPH 4NFFA 4MG3A 3SU2A 1GI8B 3IITA 4XBBA 4GPGA 4KGAA 4AG2A 2QAAA 1X7AC 1UK2A 3UFAA 2F9UA 1RRKA 1GI5A 2A7HA 2Y80A 3TITA 4DURA 2PW8H 2FYRA 2KAIB 1DE7H 2PSXA 4UE7H 2BDGA 3ZZAA 1XXDA 2ZFTA 3B23B 3SV6A 1H9LB 1GBTA 1BMLA 4AB8A 1O3KA 1T8MA 1VITG 1P11E 4AGJA 3KEEA 2DUCA 2GP9B 2PKAB 4FUIA 2OQUA 5C1YA 4ZH8A 2JKHA 2WYJA 1BZXE 1D3DB 1O3FA 3V13A 1P8VC 1HAVA 1GWAA 4B2BA 2ZHQH 1QBVH 4ABFA 3UR6A 3P8FA 3T2NA 3M7TA 3DD2H 1UK3A 1BIOA 1PPGE 1XVMA 4IC6A 3SV7A 1CGJE 3GCHC 1ETTH 1GBLA 1MTNC 2VIQA 3RXUA 3SGQE 1O3NA 1H8DH 2PTNA 2AGGX 3SJ9A 1C1MA 1ARBA 3NZIA 2C90B 1Y5UT 3SO3A 1HJAB 1CSOE 1GPZA 3HK3B 1AZZA 4Q7ZA 1TBZH 4O9VA 1O2GH 1NU7B 1SGFA 4K60A 2Q6FA 1AVXA 3PM3A 3SHAH 3ZYEA 1VITH 5K0HA 1AWFH 3GYLB 3UNSA 3JZ2B 1C5LH 1OP0A 1W2KH 3SGBE 2FLBH 4O97A 4IMZA 4DGJA 1KLIH 3QN7A 1GDNA 2PUQH 1EP5A 3ATWA 2PUXB 7LPRA 2SGQE 3E16B 1RGQA 2O8UA 3VB7A 2QGRA 3V3MA 3MU4A 1TNLA 4LK4A 1BHXF 2C93B 2PGBB 4K5ZA 2VVCA 5FBIA 4NSVA 3TNSA 5DG6A 1SL3A 1BTPA 1Y3WA 7GCHF 2ZTYA 1VJAU 1UHBB 1A0JA 1W0ZU 1L4ZA 1DOJA 2G00A 1GBKA 2PV9B 1WQVH 2WPHS 2AMPA 1SQOA 2ZCLP 2UWOA 4X2XA 5FBEA 2Z3CA 5FCKA 1P2QA 4B2AA 1G9IE 1MAXA 4ABEA 1NU9A 5C20A 6GCHG 2ZECA 3UOPA 1GJ6A 1LPGB 3T28A 4Q80A 2OLGA 4CHAB 1O5GH 1DS2E 3E0PB 2ALVA 5G4BA 2BY8X 4MLFB 5A0BA 3RXLA 4INHA 1EZXC 1GBIA 1P3CA 1IQFA 2STAE 1TNGA 1TONA 4B1TA 4B74A 4Y8YA 1O32A 2D26C 1A3EH 2A5IA 2OC8A 1XX9A 3M3SA 4JMYA 2P95A 4NSYA 1ZSJA 3BTEE 4ESTE 1QJ1B 5ABWA 2VVUA 4B75A 2ZWLH 1O2SA 2H5DA 2NU0E 1JIRA 1NTPA 1G2MA 4Y76A 2J2UA 3B8JA 2ANYA 1V3XA 4JK5A 3F6UH 3SUEA 4K8YA 4FUGA 3RM0H 2GGVB 4YTAA 1GJ8B 1HAPH 5EODA 3VB3A 1K1JA 2JETB 1PFXC 4NIYA 1JBUH 2BY7X 1AKSB 2AMQA 1B7XB 3CS0A 1TPAE 3RU4T 5AFYH 1C4U2 1TMBH 1YGCH 1AO5A 3RXOA 3RC5A 1PPFE 1OYQA 2Y6TA 3UQVA 8GCHG 1NFYA 1GI7B 5GPIB 3MYWA 3T29A 1O3GA 1S0RA 5EQSA 3ZVDA 5J4SA 1C1RA 1WQSA 5EOKA 3E0NB 1KSNA 4IN2A 3PO1B 4H4FA 2O8MA 1D9IA 1W0YH 2BD5A 3U8OH 3QX5H 4ABIA 5JYIA 4ABBA 3A84A 1AFQB 4X6NA 5LGOA 1C5ZB 2FPZA 4KP0A 1VCWA 2GKVE 1O2LA 1IQLA 1GHXH 3HATH 1GHWH 2D1JA 3MOCA 1XUIA 1P10A 3Q77A 1MZAA 2BD2A 2XWBI 3CP7A 1C4Y2 1C1QA 1UJ1A 4X2WA 2STBE 5C1XA 1BJVA 1GG6B 1W14U 1YCPH 4YOJA 3STIA 2TGPZ 3UNQA 1EKBB 1G3EA 4NWLA 3EGKH 5EQQA 3NKKA 1S82A 2OUAA 1TQ7B 5A0AE 1K1MA 1UCYK 1LHFH 4CHAC 3BTFE 1J9CH 5C2ZA 4K2YA 1V2WT 5IDKA 3KQCA 1Y8TA 1LVMA 1ARCA 3GDUA 1RTKA 3SNCA 3MI4A 4X6PA 4DCDA 3FVFB 1P09A 2Q1JA 1CT4E 3ODDA 1DFPA 3QGJA 4RKOB 2AGIX 1ELTA 2H2ZA 5F6MA 1UVPA 3KL6A 2ZPSA 4D9QA 1GJCB 1K1LA 2ZFSA 4Y6DA 5LPFA 5E2PA 1V2OT 2WPKS 1C1UH 1DLEA 3A7ZA 1F0UA 3GICB 3F68H 5TJXA 1SGEE 1O3OA 1SHHB 1J14A 2BD3A 4NCYA 2BDBA 3LGTA 2XTTB 5AF9H 1C2HA 1HAIH 3ZZ6A 4WWYA 5AHGH 1MU8B 1P2IA 3P70B 2G52A 4FUHA 1MH0A 1GI2A 1SGYE 1LKAA 3V0XA 1EATA 3QWCH 3RLYH 1HFDA 1GCDA 1TNHA 1T4VH 3B9FH 3FFGA 1BRCE 1SGIB 2AMDA 2PFEA 2QV1A 2GVFA 5HGGA 2TGDA 1EUFA 2ZNKH 1GBFA 3Q76A 1O5AB 3T26A 2BVSH 3GY6A 1GJ5H 1LPKB 5I25A 3MTYA 1ORFA 1MUEB 4B2CA 2F3CE 2Z3DA 1P9SA 3H5CB 1W12U 1ZMNA 4FUJA 1AGJA 1O37A 1PQAA 2PKSB 1N8OB 3I29A 1BTWA 1GJ7B 2B7DH 6LPRA 3KQDA 1ELBA 1SR5C 4FU8A 4ASHA 1CT0E 4BANB 4IS5A 1O2OA 1O3IA 1RIWC 5IYTA 5EW1H 3ZVFA 1EAXA 4AX9H 1ZPCA 4ZKOU 4FXGH 1TABE 2XCFA 3UTUH 1F5KU 3VB5A 4Y11E 2EEKA 3LGWA 5CMXH 4CH8B 1MZDA 1QB1A 2ZU2A 4WMDA 2A2XH 1TWXB 3HKIB 5HM9A 3MU5A 1TYNA 4K8BA 3TK5A 2Z9LA 1GBBA 3M37A 3LC3A 2VIVA 1O5CB 1XUGA 2WV5A 3ZVCA 1HPGA 2VWOA 1BMNH 5E2OA 1MQ5A 5EGMA 4TWWA 3ZVBA 4SGAE 1IOEA 5T3HA 4Q7XA 3A82A 1EJAA 1ELDE 4D76A 1O3BA 2W3IA 5FCRA 1A7SA 1AZ8A 1DXWA 4GCHF 2Z6BD 1TPOA 1L1NA 1CA0B 3GOVB 4XE4A 3VXFH 4AOQA 4K1EA 3NXPA 1SQTA 1ZSKA 1TALA 4GUXA 1O31A 2J94A 2SGDE 3DT0H 1BRAA 4ISLA 1TIOA 3KCGH 5TCAA 1SG8B 3LDXH 4DG4A 2SFAA 3A7VA 5DP7A 3BIUH 1EX3A 2VIWA 2A5AA 1MKXH 3A87A 1AVGH 3BIVH 1NFXA 1V2KT 3AAUA 1TGBA 4X1PU 1GI4A 5FX5A 1PYTD 4ABJA 3Q3KA 1OPHB 1KYNA 1GG6C 1A5IA 4Q7YA 1QQ4A 1ZSLA 4WMFA 2BQ7B 1TA6A 1OKXA 1KXCA 4ZHAA 3SV9A 4FVBA 2GMTC 1EXFA 4X8TH 1O5EH 1TMTH 5A8XA 1GDUA 2Z94A 1QJ7B 3SZNA 1OSSA 5CE1A 1S85A 2QC2A 2OC7A 8ESTE 3K6ZA 1C2JA 3P8GA 4FUBA 4R8TB 1ABIH 4THNH 1ZMJA 2AYWA 1HRTH 3ZZ5A 1C4V2 3TGKE 3LGYA 1TRNA 1TRMA 1WSSH 3A80A 1GBMA 3MFJA 1H1BA 4OS5A 1ZTLA 1FN6A 3UY9A 1S6HA 5HXFA 2A7JA 1C5WB 2PSYA 3TNTA 3E6PH 2ZTXA 1FLEE 2XRCA 1O3LA 5JBCS 1EAWA 1BTZA 1UVTH 1YPHC 2UUKB 2RA3A 2SGAA 4BXSA 2J92A 2BY5X 4Y71A 1SGNE 1AIXH 2OBOA 1CBWC 3ITIA 5ESBA 4X1SU 3M5MA 1AB9B 1PQ7A 2C8XB 3ZYDA 3MH4A 2DE9A 1SBWA 2FOGA 1C5YB 1ELEE 2UWPA 1HUTH 1UMAH 2FIRH 2ODPA 1AE5A 2OXSA 1BUIA 2Q6DA 3OYPA 1A46H 1XUHA 4KKDA 4I31A 1HBTH 1F5LA 1A3BH 1BRUP 1FNIA 4TPIZ 2XC4A 2HPPH 2OBQA 5GDSH 3OX7U 1DICA 4H6SB 5J4QA 1O3MA 1O5BB 1UTQA 1O2NA 4XBCA 3URCA 1Z6JH 2QXGA 3ATMA 2JH0D 1TQ0B 2HWLB 1C9PA 1QFKH 1XKAC 2NU2E 3P17H 1TOCB 2Q6GA 1QRWA 2TIOA 3QGNB 3GDVA 3M5NA 2H5CA 1HAVB 2A0QB 1SGCA 5BRRE 1PYTC 5A8YA 2FODA 1H9IE 1P2OA 2W5EA 4NGAH 1YYY1 2XBVA 4I8JA 1TLDA 5JB8S 1TX7A 1SPJA 1SFQB 2AFQB 1K1OA 1O30A 4GAWA 3SQEE 4UFEH 2XC5A 2VH0A 3U98H 2Z9GA 2Y7XA 4FU7A 1WYKA 5LPRA 2FTMA 1E38B 1F2SE 1Q31A 3MHWU 5GJ4B 2ZGCA 1GI9B 3GISB 1PPZA 2VB0A 1GVLA 2VGCC 3UUZA 4Y10E 2NU3E 3E3TA 2J34A 1GMHF 1P9UA 6CHAB 2GZ9A 3T25A 2SNVA 1CT2E 1SLVB 4UEHH 3I77A 2XW9A 1C5OH 1QRZA 1HDTH 4MVNA 1Y5BT 1LHCH 1NRRH 3NUMA 4UD9H 1DSUA 1HIAA 3Q3XA 2BTCE 1ESBA 1EPTC 1B0FA 3KN2A 2DE8A 3MWIU 2WPJS 1GGDB 3A88A 5T6GA 1Q2WA 1EB1H 3SW2B 2BHGA 4CRBA 2WV4A 4JYVH 4AG1A 1GHBF 1GI3A 3FP6E 2P3TB 3AAVA 4K1TA 4E05H 3BEIB 3MNXA 2WPIS 1C5UA 2BOKA 4AFQA 3TPIZ 2G51A 1AFQC 1Z8RA 1UCYH 1XUJA 1PPEE 1QR3E 2R3UA 1V2VT 3UWIA 1MKXK 4HI3A 1PQ5A 4FUDA 1RJXB 2B9LA 1V2PT 1P2MA 4IMQA 2EA3A 3M3VA 1GMHG 4OGXA 3HK6B 4NWKA 1CVWH 2BLWA 1OWEA 1UVSH 2VVVA 2J95A 1DLKB 1MTWA 3TGJE 2G55A 5ESTE 3GCTF 5JBBS 2BLOA 1VCPA 1J17T 3GY8A 3RXKA 3MO3A 1QRXA 2JETC 1DVAH 2GT8A 4GSOA 1G3BA 4A92A 1BMAA 3SORA 1HB0B 4GHQA 5DP3A 3RXVA 3PWBA 1ZLRA 3O8BA 3MH7A 1AQ7A 1QBNA 3E8LA 1ZRBA 1YPKH 1O3EA 3SJIA 1DPOA 3S7HB 2GZ8A 1DWDH 5DP5A 3RXBA 3K9XB 1A0HB 4MNWA 4NIVA 4I8GA 4GLYA 5C1UA 1YLDA 3RMLH 4JCNA 3TJVA 4AZ2B 4WVPE 3K65B 2D8WA 2XXLA 2ZF0H 3IWMA 2VIOA 2UUFB 7GCHG 1P2KA 1TX6A 2ZFFH 4RN6A 3G01A 1FY3A 1SI5H 1C1OA 1O3PB 1UTMA 4MPVA 5FXLA 4GHTA 1D3PB 1YPEH 1Z1IA 1CQQA 2FMJA 3GY2A 1MQ6A 2FM2A 2QA9E 2ZU5A 4JK6A 4FUFA 1FIZA 4XOJA 2QF3A 2Y81A 1OP8A 1OWJA 4K69A 2OINA 2JH6D 2V3OH 4BXWA 1YBWA 2ZGXH 3KQEA 2H9TH 5F8ZA 1FIWA 1HLTH 2F9BH 8LPRA 1AHTH 2FI4E 3M35A 3PV4A 2LNCA 3ELAH 3RLWH 3LJJA 2FI5E 2J4IA 1K22H 1P02A 3A89A 2FX6A 1RFNA 1AE8H 2W26A 3EQ0H 3TJNA 1YF4A 1ELVA 1SLUB 1P05A 1C5RA 3EA7A 3SN8A 1C5PA 2Z9KA 1VJ9U 1QL7A 2IJOB 4R0IA 3BSQA 2BYAX 3D65E 1KTTB 2ZCHP 3CS7A 5JDUB 1C2FA 1GMCG 2IN2A 5C67A 1SGDE 3LONA 3S9AA 1BTXA 1O5FH 1FI8A 4SGBE 1T31A 3A86A 2EC9H 2BMGB 9ESTA 1V2NT 1O2VA 2FI3E 1NY22 5FPTA 3M3TA 1ZR0A 1TPSA 2ZGHA 4WMEA 1HJAC 2HNTE 1LQEA 1FAXA 1DY9A 1WTHD 1QA0A 1XVOA 1N8OC 2P3UB 4HTCH 4CBNA 1FY4A 1RTLA 2EI7A 1D6WA 4JYTA 3GY7A 3A8DA 5FAHA 4NA8A 3SU5A 3HPTB 1Y3VA 4IGDA 3SI3H 3VXEH 3OTJE 2ZHEH 1ANEA 4LXBH 1NT1A 1TBQH 7ESTE 1LVOA 1O2KA 2Y5GA 1OXGA 3UQOA 4Y7BA 2ZU4A 1V2RT 2YNBA 2GT7A 1K1NA 3EAJA 1YC0A 1QA7A 1S0QA 3A8AA 4MTBA 3TH4H 1LHGH 3PROA 1A61H 3FANA 5HYOA 1H9HE 1TA2A 2RDLA 1QQUA 5L30H 1J15A 1O2HA 3EE0B 4O3TA 3RXTA 1BITA 2I6SA 3U9AH 2O9QA 1NRSH 3A85A 2H9EH 3VGCB 2WPLS 2P93A 1ACBE 3R0FA 1Z6EA 1TGNA 3MH5A 1IAUA 3L3TA 3ZZ4A 4ABAA 4BTUB 3BG4C 4B76A 2H9HA 2CHAC 1ZHMA 3F1SB 1TGCA 3BF6H 4WY3A 2A4GA 1ETRH 2G4UA 1TNIA 1C5NH 3GYMA 2HNTC 1KLTA 3KHVA 1FY1A 4B71A 1C2LA 1THPB 2BLVA 4YT6H 1ANCA 2P3FH 4ZXXH 4YLQH 1TRYA 1HAYB 1N1LA 2GV6A 2YNAA 5L2ZH 1CE5A 3DUXH 2G81E 5H4IB 2XBXA 3SQHE 1T8NA 1OWKA 1BQYA 2SGPE 1FN8A 3RXEA 1VR1H 4A1VA 3UNRA 1TNKA 4KTCA 4IW4E 3T62A 3SUFA 3O8CA 4GVUA 1JRSA 1Z7KA 1N6YA 1L2EA 4ZKRU 1FAKH 5TCCA 3BTGE 4DVAU 3FAOA 1EAUA 1RS0A 2TRMA 1SGRE 3ZZ9A 1FDPA 5C5NA 2SGEE 1V2ST 1K9OE 2O8WA 3GY5A 2VH6A 1GL0E 4X8UH 3E91A 1J8AA 3M61U 5FPSA 2ZHWH 1S6FA 5GWZA 1V6DA 1P03A 3STJA 4J1YA 1PJPA 2A4QA 1QNJA 1C2MA 1YPLH 2Z7FE 5DO4H 4Y0ZE 1GMCF 2FDAA 5EW2H 2P59A 3A7YA 3ZVEA 4ABDA 3CENA 2FYQA 1NN6A 1NESE 3K6YA 4JZDH 4HFPB 2F91A 2BDIA 1S84A 3ZZDA 1C1VH 3M5LA 1MTSA 1TAWA 1LQDB 1LTOA 4AORA 2VJ1A 3BG8A 4Y8ZA 1IQEA 8KME2 3ATKA 4OS6A 1TGSZ 2B0FA 1RTFB 2ODQA 3U8RH 1O2IA 1WTGH 1W11U 1ZPBA 2FO9A 3PMHB 1DUAA 1UTKA 2BZ6H 1WV7H 1SQAA 5SGAE 2OC1A 1KDQB 3MO9A 4TY6A 2UUJB 2VGCB 3S0NA 1YKTA 3BG4B 4NZQA 1BBRE 1BBRH 4XBDA 3TK9A 1QIXB 4DY7B 1B0EA
chains in the Genus database with same CATH superfamily
3RXIA 4A1XA 1ESAA 2FS8A 1IHTH 3ZZCA 2J9NA 9LPRA 3C1KA 4AFSA 1ABJH 4OS2A 3BEUA 3SU6A 2O8TA 4AGKA 1KXAA 2WPMS 4OS1A 2BDYA 4FUCA 2J38A 3V12A 1Y59T 2ANKH 4AN7A 3N7OA 1PPBH 3F9FA 1SB1H 4ACAA 1L0ZA 1SSXA 2CXVA 1JWTA 1DM4B 1AMHA 1IQMA 3PMAB 2HLCA 1EQ9A 3BTQE 2R3YA 1ETSH 1C5TA 5L6NH 1G36A 4Y8XA 1SOTA 2WYGA 4E06H 2CF9H 4A1TA 1SFIA 2BVRH 1CGHA 1NBMD 1VGCB 1C5VA 1GJAB 2ALPA 3GCOA 2K1QA 1NRQH 1HAZB 1GCTC 1WU1A 2FS9A 1SGPE 4CREA 5F8TA 2A4RA 2BM2A 1DWEH 3GCTG 1J16A 4U30A 1LMWB 3LIWA 4CRGA 5FPYA 2FX4A 3TJOA 4FUEA 1NM6A 3SNEA 1O2MA 3TIUA 3VFEA 5DK1A 1MBMA 1UTOA 2VINA 1C1TA 1FUJA 5A09A 4K3JA 3AVZA 1KTSB 2ESTE 1E37B 1JOUB 1CBWB 3GDSA 2M2AA 1GI1A 4E7NA 1O3DA 3A83A 2XNIA 5GCHG 1THSH 4RKJB 3EA8A 3P8OA 2PKAA 1S6LA 3LPRA 4WJG2 4E7RG 1GHBG 3TH3H 5CHBA 8GCHF 2TBSA 5EQRA 4Y79A 3SU1A 1BDAA 5CHAB 3M7QA 1Z8GA 4AFUA 2FP7B 3L33A 1DT2A 1FQ3A 3PB1E 4CRDA 4H6TA 5E0JA 5JPMH 1NO9H 4NIXA 2FOAA 3A8BA 1OWDA 2L74A 3P92A 3RMNH 5C17A 2V6NA 2OP9A 1HAGE 1MTVA 1O3HA 4ISOA 3SNDA 4CH2B 2GCTB 1KLJH 1MKWH 1TB6H 2WUCA 1H8HD 3LKWA 5GIBA 2OK5A 3RXQA 1AVWA 4BAKB 3WY8A 1BB0B 4YOIA 2GZ7A 3PMBB 2PTCE 1WUNH 3WWBA 2OC0A 2BQ6B 1A0LA 2QCYA 3SV2H 1HIAB 2BY6X 2VWNA 2W7SA 3U1IB 1GL1A 1O2XA 3TJUA 3EA9A 4BAOB 4Q63A 2ZDLA 1DWBH 2B8OH 2BOHB 4ZAEA 1GJ4H 1F0SA 4ZKNU 5DGJA 4A5TS 1C2DA 3F2GA 4YOGA 3LH1A 1THRH 3F3BA 2ZDVH 2ZCKP 3A81A 4DT7B 4BAQB 1V2UT 2FOEA 1ZTKA 1DXPA 1O38A 3NCLA 1AY6H 1EJNA 4YT7H 4O3UA 1A5HA 4NA9H 2Y5FA 2ZFPH 4TPYA 6ESTA 1DSTA 3MH6A 1O35A 5ETXA 4H42U 4NZLA 4P02A 3SU4A 4I33A 2P8OC 3KQBA 2HOBA 2V7QD 3M5OA 4TY7A 2KCOA 1V2JT 4FU9A 1UVOA 1EZUC 4X1RU 1JRTA 4X2YA 3URDA 3OY5U 4U32A 2QXHA 4JZFH 1G2LA 2HRVA 2F83A 1GJDB 1IQIA 2EI6A 4ZHLU 4ACBA 1SQRA 1T4UH 2QXIA 4OS7A 5E0HA 3H7TA 1T32A 1L1GA 3SUGA 2XOKD 3NPSA 1Z8IB 5FX6A 3FO8D 1LVBA 1P04A 3BTDE 1SOZA 4YXWD 1E0FD 1P57B 2QIQA 1UK4A 1Q3XA 1SLWB 3RXMA 1QJ6B 2M5TA 3A7XA 1CU1A 1TFXA 3SNBA 2PKSC 1EB2A 1T7CA 1C1SA 2IPQX 2R2WU 1EAIA 2ZPQA 2Z9IA 3QTVH 2BB4A 1W7XH 3DSGA 1N6XA 4ZHMU 1SMFE 4ISNA 4D8NA 2WSSD 2CV3A 3FZZA 3RXRA 2ZIQH 3AASA 2CMYA 3SJKA 2BD9A 2V0BA 4WXIA 1GHZA 7KMEH 2CK3D 4PROA 3FKSD 5HIZA 1Y3UA 1DWCH 1GJBB 1GHYH 2ZKSA 4WF8A 4NIWA 4NG9H 1FZZA 2ZG0H 3RXPA 2NU4E 1E1RD 1OX1A 2P94A 4J2YB 4JZEH 1Y5AT 1O39A 2G8TA 3RC4A 1CGIE 2G4TA 4TWYA 1KIGH 1D4PB 1CA8B 1VITF 3KF2A 4X2VA 1F92A 1V2QT 2A2QH 3UREA 4TYDA 5F53A 4LOYH 3ODFA 1E34B 5LPEA 1XUKA 2UWLA 3LGVA 2Y7ZA 1PQ8A 2A7CA 1C1PA 4XDEA 5I46H 3OU0A 1HAHH 2ZP0H 4ZKSU 1CHGA 4X6OA 3ZVAA 1MU6B 1BHXB 2OTVA 4WH8A 4AYYB 1QCPA 2A31A 1UTPA 1FJSA 5EXMA 4UFDH 2PP6A 1E35B 3OFND 2AGEX 2GX4A 2ODYB 3PLKA 3V7TA 3BTTE 2HALA 2VNTA 5KGOA 2VIPA 4MNYA 5BPEA 5DP9A 1GI0A 1EZSC 1O2JA 2YOLA 1S81A 1W13U 2VU8E 2BD4A 2ZI2H 2BZAA 4YZUA 5JBAS 3RXCA 3HGNA 3BTWE 1K1PA 3ZV8A 1O0DH 4IN1A 1P0SH 5EXNA 2BDHA 5C0TA 3QTOH 3P95A 4I8KA 3SOSA 2VBCA 3F2HA 1Z1JA 4UFGH 1DDJA 2ZDNA 1V2TT 1UHBA 1WOFA 4DOQA 3M36A 2GCHG 3FP8E 1G37A 1O33A 1SGQE 2AIPA 1ID5H 1HXEH 1LDTT 5DJ7A 3JZ1B 1HYLA 1GBAA 3RXSA 3SU0A 4XD7D 1O34A 3F2FA 3U28C 1NBME 1OWHA 3ZZ3A 1PPHE 1HAOH 1F0RA 3DA9B 4INKA 2TGAA 2XCNA 1O2UA 1ZGVA 3PTBA 1HJ8A 2TGTA 3Q3YA 2GTBA 2ZA5A 2K0QA 1T8LA 4NFEA 1ZMLA 2OCVB 4JZIA 3VPKA 2F9PA 2BXUH 4RT0A 5AVDA 1UTLM 1ZHRA 3RDZA 1O36A 4F48B 1DANH 3HGPA 1K1IA 4X6MA 1G30B 2QF4A 4I32A 1ZHPA 2VWMA 4IBLH 3HKJB 2XBYA 1KY9A 2AERH 1A5GH 1FPCH 2QY0B 1FXYA 4X1QU 1ANDA 4INLA 3SBKA 3AW0A 4Z6AH 1ZOMA 3SUDA 1LKBA 3O8RA 4BOHA 3UPEA 1FX0B 1HNEE 3K2UA 2AIQA 3ZVGA 3S69A 3H09A 2ZHFH 1XMNB 4ABHA 2GD4B 5DP8A 4F4OC 4KTUA 3KNXA 1D3QB 2F9NA 2J97A 3E1XB 4ZROA 3RXDA 5JB9S 1G32B 1GBEA 1KXFA 4I7YH 1Y3XA 1FV9A 1P2NA 2A1DB 2PWXA 1ELCA 1P01A 1O5DH 3VGCC 1Z71A 2ANWA 4AFZA 1A1RA 4I86A 3PLPA 5GNDA 3WWFA 1SHYA 2BX4A 2RG3A 4VGCC 3SI4H 4X8SH 1RXPA 1ESTA 4KELA 5F8XA 2KCPA 1SVPA 1O2ZA 1JXPA 3RXJA 4X8VH 1C5XB 1NPMA 1GVKB 4Z0KA 1GBHA 1XKBC 3BTHE 4ZMAH 2GDDA 2ZTZA 5F03A 2QF0A 3LH3A 1TOMH 5C5OA 3UR9A 3RU4E 1QURH 3OSYA 6CHAC 1IQJA 3A8CA 3BN9A 1TNJA 1KXEA 2D2DA 3D23A 5A8ZA 1K28D 1SGFG 2Z9JA 2C8YB 4I8LA 3LGIA 2BD7A 2FLRH 2XBWA 1OOKB 3GCNA 1WAYB 4FVDA 2TPIZ 2GDEH 4BTIB 3ZV9A 5LH8A 1FPHH 3H7OA 3N99A 1FY8E 2FWWA 3M7UA 3MU8A 1LPZB 2V3HH 4UFFH 1W10U 3MU0A 1IQHA 4DJZB 2XYAA 1C1NA 5HMAA 2RA0A 1NS3A 2KCYA 3BTKE 3SGAE 3GS9A 3QZQA 2AHME 5PTPA 4DIHH 1O3AA 2FOCA 1P3EA 1EOJA 4O03A 1RD3B 5EJLA 3T27A 4I8HA 4A6LA 1GBCA 1A2CH 3FP7E 3PRDA 1MTUA 4X1NU 2ANMH 1YPHE 4MNVA 1DITH 2SGFE 3S9BA 1LHEH 4GCHG 5DP6A 2HGTH 1C2IA 1CHOF 1GHAF 2ZU1A 1DY8A 1G3DA 1ZGIA 5T6DA 1ELGA 1DUEA 1W7GH 2ZGJA 3E90B 3OY6U 5FL7D 1W0KD 2ZHDA 2ZZUH 3A7TA 3PTNA 2FOHA 2F9VA 2R0LA 5E0GA 1AKSA 1GVZA 3L6PA 3MNSA 3RMMH 1GCTB 2CF8H 1BTUA 1UVUH 3RP2A 3U1JB 2ILNA 1YM0A 5T6FA 1T8OA 2JDID 1ZRKA 3A7WA 3F0PA 2SNWA 4WH6A 1P06A 4OGYA 3LGUA 1F0TA 5JBTA 1GI6A 1QGFA 2R0KA 3QK1A 3AK5A 1NROH 1ZJDA 1C5MD 2H6MA 1KXBA 1OWIA 3MMGA 1AWHB 2PHBA 3ESTA 3MNCA 1C2EA 1YWUA 4ABGA 3ENSB 3T5FH 1YPJH 3KYFA 1SC8U 1L1JA 1C1WH 1TMUH 5KECA 2ZQ2A 2BVXH 4Z1MD 2VWLA 4AB9A 3S7KB 3AW1A 4QT8C 2A32A 2WUBA 2GV7A 4U2WA 2RCEA 2A5KA 3ATIA 3TVJB 2ZO3H 2ZFQH 1BOQA 4BAMB 2AEIH 2P8OB 1BCUH 4ISHH 3R3GB 1MKWK 1UTNA 2BXTH 1QL8A 3TK6A 3EDXB 2FOMB 2ZQ1A 1YPGH 4IC5A 2A45B 2AH4X 2ZDAH 3C27B 1NC6A 1UW7A 4ZXYH 2BLQA 1IQNA 1BA8B 4BAHB 2UUYA 4MPWA 1W3CA 2I6QA 1HXFH 3SV8A 2IPHA 4D7GA 1MAYA 1S83A 5EU8A 4F55A 4NA7A 1W8BH 1INCA 3D62A 2FEQH 3LT3A 4UDWH 3SJOA 3BTME 1MCVA 1S5SA 4VGCB 3KIDU 1D3TB 1NRNH 1B5GH 1F7ZA 4CBOA 3VB4A 1LCYA 2ZPRA 1HJ9A 3W95A 1IQKA 2NU1E 2C8WB 5EG4A 1C2KA 1O2QA 4FETA 5GCHF 1QBOA 1XXFA 4CRFA 2GCTC 2WPDD 2KCAA 3SHCH 1TBRH 2CGAA 4HGCA 2WV9A 2FOBA 3QDZB 1PPCE 4UONA 4Y0YE 1KXDA 4HZHA 2ZEBA 1KMHB 3MO6A 1EZQA 2PGQB 1MCTA 4MQAA 2VIDA 2QN5T 1Y3YA 1XM1A 1P12E 4JZ1A 3ZZBA 2XC0A 1FMGA 1O2PA 3LC5A 1C9TA 5FHTA 5C3NA 5CHAC 1O2WA 2KAIA 3UIRA 3Q00A 1D6RA 1GGDC 1MBQA 2R2MB 2KX4A 1QTFA 2ZFRH 3RXFA 4Y7AA 1EASA 1EJMA 1NZQH 4M7GA 1EPTB 3D49H 4ZCNA 1ELAA 3F9EA 1YCPK 3EYDA 4BNRA 1HV7A 1K2I1 1AFEH 3QO6A 3QZRA 1NFUA 5K7RA 2ZU3A 4YM9A 2QXJA 1VZQH 3EE7A 2LP6A 1LHDH 3U8TH 2PLXA 1H8ED 3RC6A 2Y82A 3DFLA 1IHSH 3UWJH 3MU1A 2HVYB 1RIWB 2O8LA 1A4WH 2EI8A 5EPYA 1E36B 2C8ZB 5EXLA 1TPPA 4MNXA 2Z3EA 5AFZH 1BTHH 2BDCA 4YLUA 1AU8A 1O2TA 4AYVB 3PYHA 1MABB 1V2LT 4D9RA 1YLCA 2K8IA 4XSKU 1IQGA 1P2JA 1ZJKA 4MDSA 4CR9A 4YESB 1GBJA 1WBGB 2P16A 2ZDKA 1VGCC 5CDFE 3P8NA 3MNBA 2JH5D 3PLBA 1K21H 2ZC9H 3SJ8A 4DW2U 2J98A 1UO6A 2ASUB 3F9GA 4LZ1H 2LPRA 1LVYA 3U69H 2ZDMA 1UCYE 3TH2H 2HVXA 2H1UA 3TU7H 3PMJA 2FESH 2HPQH 3F9HA 1HGTH 3W94A 2F9OA 1H8IH 3CNRA 1AUJA 3RM2H 1COWD 1O3JA 5E8EH 1ELFA 3F0OA 2ZGBH 1U6QA 5KEDA 3BV9B 1GMDF 3IG6B 3RXAA 5EPNA 2NWNA 2KZ4A 2CJIA 2BX3A 3KGPA 1QL9A 2BD8A 2CN0H 1H4WA 3GY4A 1F5RA 1MD8A 3DHKH 3RMOH 1BBRK 3RU4D 2G5NA 1XUFA 1EPTA 1JIMA 2F4LA 3LU9B 2FZZA 1YP9A 2FXRA 6GCHF 3I78A 4Q2KA 2FOFA 1YPMH 4F49A 1QHRB 5DP4A 1GBDA 2BY9X 1GJ9B 3LJOA 2PR3A 4WXVA 5DN6D 1OS8A 1AI8H 3ZZ8A 1YLNA 2W3KA 2B5TB 3S9CA 1BRBE 2OD3B 3FZDA 2R9PA 1MD7A 1C2GA 4ZUHA 2C3SA 1YCPM 5DPAA 2AS9A 4D7FA 5L2YH 2IOTA 3TGIE 1SLXB 2V35A 1ANBA 2Y5HA 3VEQB 4CR5A 1TE0A 3NK8A 4CRCA 2W7UA 3BEFB 1KDQA 4ISIH 2G5VA 1GDQA 3O8DA 5A2MH 2THFB 3UOUA 1LO6A 4XFQA 4MPXA 2JJ2D 3SNAA 1ZYOA 1ZTJA 2WINI 1NFWA 3PV2A 1HAXB 1ZZZA 2FTLE 3GY3A 1SKYE 5A0CA 3RXGA 1AUTC 2GCHF 1BMMH 4X0WU 3PWCA 1E79D 1M9UA 5B6OA 1QB9A 1DX5M 1FONA 1TX8A 1L4DA 4KTSA 1Z8JB 1VCQA 3DFJA 1MTNB 1V2MT 4U01A 3SYJA 3GCHB 3ZZ7A 1OYTH 1TGTA 4DIIH 1CO7E 1O2RA 2BDAA 1BJUA 2J5UA 3TLOA 1JMOH 5HM2A 3PO1C 2HNTF 2BQWB 4K1SA 3NRLA 4OS4A 2GMTB 2XWAA 1QB6A 4OM9A 1BT7A 4A7IB 3NWUA 1AB9C 1AN1E 4JYUH 4BTTB 3QLPH 2A4OA 1OP2A 2QYIA 1BTYA 3QUMP 3LOXA 3VB6A 4B73A 1GHVH 1C5QA 1ZPZA 1EP6A 1CHOG 1GHAG 2C4FH 1FY5A 1G3CA 1QY6A 4MPUA 3SU3A 3RUOA 4CRAA 1O2YA 5GXPA 1GMDG 1O3CA 2OQ5A 1MMJN 3RXHA 1UTJA 1WCZA 5DKMA 1AD8H 4RSPA 1C5SA 2CHAB 1EOLA 3P6ZB 3ATLA 4YO9A 4LZ4B 2ULLA 1CA0C 1HCGA 1SGTA 1NRPH 4NFFA 4MG3A 3SU2A 1GI8B 3IITA 4XBBA 4GPGA 2W6ID 4KGAA 4AG2A 2QAAA 1X7AC 1UK2A 3UFAA 2F9UA 1RRKA 1GI5A 2A7HA 2Y80A 3TITA 4DURA 2PW8H 4RT1A 2FYRA 2KAIB 2WZQA 1DE7H 2PSXA 4UE7H 2BDGA 3ZZAA 1XXDA 2ZFTA 3B23B 3SV6A 1H9LB 1GBTA 1BMLA 4AB8A 1O3KA 1T8MA 1VITG 1P11E 4AGJA 3KEEA 2DUCA 2GP9B 2PKAB 4FUIA 2OQUA 5C1YA 4ZH8A 2JKHA 2WYJA 1BZXE 1D3DB 5C94A 1O3FA 3V13A 1P8VC 1HAVA 1GWAA 4B2BA 2ZHQH 1QBVH 4ABFA 3UR6A 3P8FA 3T2NA 4B6EA 3M7TA 3DD2H 1UK3A 1BIOA 1PPGE 1XVMA 4IC6A 3SV7A 1CGJE 3GCHC 1ETTH 1GBLA 1MTNC 2VIQA 3RXUA 3SGQE 1O3NA 1H8DH 2PTNA 2AGGX 4HG6A 3SJ9A 1C1MA 1ARBA 3NZIA 2C90B 1Y5UT 3SO3A 1HJAB 1CSOE 1GPZA 3HK3B 1AZZA 4Q7ZA 1TBZH 4O9VA 1O2GH 1NU7B 1SGFA 4B6FA 4K60A 2Q6FA 1AVXA 3PM3A 3SHAH 3ZYEA 1VITH 5K0HA 1AWFH 3GYLB 4XRNA 3UNSA 3JZ2B 1C5LH 1OP0A 1W2KH 2YMSB 5EJ1A 3SGBE 2FLBH 4O97A 4IMZA 4DGJA 1KLIH 3QN7A 1GDNA 2PUQH 1EP5A 3ATWA 2PUXB 7LPRA 2SGQE 3E16B 1RGQA 3PRBA 2O8UA 3VB7A 2QGRA 5C0UA 3V3MA 3MU4A 1TNLA 4LK4A 5HIYA 1BHXF 2C93B 2PGBB 4K5ZA 2VVCA 5FBIA 4NSVA 3TNSA 5DG6A 1SL3A 1BTPA 1Y3WA 7GCHF 2ZTYA 1VJAU 1UHBB 1A0JA 1W0ZU 1L4ZA 1DOJA 2G00A 1GBKA 2PV9B 2L6OA 1WQVH 2WPHS 2AMPA 1SQOA 2KR7A 2ZCLP 2UWOA 4X2XA 5FBEA 2Z3CA 2WHXA 5FCKA 1P2QA 4B2AA 1G9IE 2KM0A 1MAXA 4ABEA 1NU9A 5C20A 6GCHG 2ZECA 3UOPA 1GJ6A 1LPGB 3T28A 4Q80A 2OLGA 4CHAB 1O5GH 1DS2E 3E0PB 2ALVA 5G4BA 2BY8X 4MLFB 5A0BA 3RXLA 4INHA 1EZXC 1GBIA 1P3CA 1IQFA 2STAE 3DCLA 1TNGA 1TONA 4B1TA 4B74A 4Y8YA 1O32A 2D26C 1A3EH 2A5IA 2OC8A 1XX9A 3M3SA 4JMYA 2P95A 4NSYA 1ZSJA 3BTEE 4ESTE 1QJ1B 5ABWA 2VVUA 4B75A 2ZWLH 1O2SA 2H5DA 2NU0E 1JIRA 1NTPA 1G2MA 4Y76A 2J2UA 3B8JA 2ANYA 1V3XA 4JK5A 3F6UH 3SUEA 4K8YA 4FUGA 3RM0H 2GGVB 4YTAA 1GJ8B 1HAPH 5EODA 3VB3A 1K1JA 2JETB 1PFXC 4NIYA 1JBUH 2BY7X 1AKSB 4ASUD 2AMQA 1B7XB 3CS0A 1TPAE 3RU4T 5AFYH 1C4U2 2V3MA 1TMBH 1YGCH 1AO5A 3RXOA 3RC5A 1PPFE 1OYQA 2Y6TA 3UQVA 8GCHG 1NFYA 1GI7B 5GPIB 3MYWA 3WW7A 3T29A 3OTPA 1O3GA 1S0RA 5EQSA 3ZVDA 5J4SA 1C1RA 1WQSA 5EOKA 3E0NB 1KSNA 4IN2A 3PO1B 4H4FA 2O8MA 1D9IA 2HLDD 1W0YH 2BD5A 3U8OH 3QX5H 4ABIA 5JYIA 4ABBA 3A84A 1AFQB 4X6NA 5LGOA 1C5ZB 2FPZA 4KP0A 1VCWA 2GKVE 1O2LA 1IQLA 1GHXH 3HATH 1GHWH 5EJZA 2D1JA 3N7EA 3MOCA 1XUIA 1P10A 3Q77A 1MZAA 2BD2A 2XWBI 3CP7A 1C4Y2 1C1QA 1UJ1A 4X2WA 1E1QD 2STBE 5C1XA 1BJVA 1GG6B 1W14U 1YCPH 4YOJA 3OE7D 3STIA 2TGPZ 3UNQA 1EKBB 1G3EA 4NWLA 3EGKH 5EQQA 3NKKA 1S82A 2OUAA 1TQ7B 5A0AE 1K1MA 1UCYK 1LHFH 4CHAC 3BTFE 1J9CH 5C2ZA 4K2YA 1V2WT 5IDKA 3KQCA 1Y8TA 1LVMA 1ARCA 3GDUA 1RTKA 3SNCA 3MI4A 2EY4C 4X6PA 4DCDA 3FVFB 1P09A 2Q1JA 1CT4E 3ODDA 1DFPA 3QGJA 4RKOB 2AGIX 1ELTA 2H2ZA 5F6MA 1UVPA 3KL6A 2ZPSA 4D9QA 1GJCB 1K1LA 2ZFSA 4Y6DA 5LPFA 5E2PA 1V2OT 2WPKS 1C1UH 1DLEA 3A7ZA 1F0UA 3GICB 4AC9A 3F68H 5TJXA 1SGEE 1O3OA 1SHHB 1J14A 2BD3A 4NCYA 2BDBA 3LGTA 2XTTB 5AF9H 1C2HA 1HAIH 3ZZ6A 4WWYA 5AHGH 1MU8B 1P2IA 3P70B 2G52A 4FUHA 1MH0A 1GI2A 1SGYE 1LKAA 3W1EA 3V0XA 1EATA 3QWCH 1WDIA 3MQKC 3RLYH 1HFDA 1GCDA 1TNHA 1T4VH 3B9FH 3FFGA 1BRCE 1SGIB 2AMDA 2PFEA 2QV1A 2GVFA 5HGGA 2TGDA 1EUFA 2ZNKH 1GBFA 3Q76A 1O5AB 3T26A 2BVSH 3OAAD 3GY6A 1GJ5H 1LPKB 5I25A 3MTYA 1ORFA 1MUEB 4B2CA 3VG8A 2F3CE 2Z3DA 1P9SA 3H5CB 1W12U 1ZMNA 4FUJA 1AGJA 1O37A 1PQAA 2PKSB 1N8OB 3I29A 1BTWA 1GJ7B 2B7DH 6LPRA 3KQDA 1ELBA 1SR5C 4FU8A 4ASHA 1CT0E 4BANB 4IS5A 1O2OA 1O3IA 1RIWC 5IYTA 5EW1H 3ZVFA 1EAXA 4AX9H 1ZPCA 4ZKOU 4FXGH 1TABE 2XCFA 3UTUH 1F5KU 3VB5A 4Y11E 2EEKA 3LGWA 5CMXH 4CH8B 1MZDA 1QB1A 2ZU2A 4WMDA 2YMSC 2A2XH 3KQ5A 1TWXB 3HKIB 5HM9A 3MU5A 1TYNA 4K8BA 3TK5A 2Z9LA 1GBBA 2LELA 3M37A 3LC3A 2VIVA 1O5CB 1XUGA 2WV5A 3ZVCA 1HPGA 2VWOA 1BMNH 5E2OA 1MQ5A 5EGMA 4TWWA 3ZVBA 4SGAE 1IOEA 5T3HA 4Q7XA 3A82A 1EJAA 1ELDE 4D76A 1O3BA 2W3IA 5FCRA 1A7SA 1AZ8A 1DXWA 4GCHF 2Z6BD 1TPOA 1L1NA 3KYGA 1CA0B 3GOVB 4XE4A 3VXFH 4AOQA 4K1EA 3NXPA 4TSFD 1SQTA 1ZSKA 1TALA 4GUXA 1O31A 3SZEA 2J94A 2SGDE 3DT0H 4M9FA 1BRAA 4ISLA 1TIOA 3KCGH 5HKKD 5TCAA 1SG8B 3LDXH 4DG4A 2SFAA 3A7VA 5DP7A 3BIUH 1EX3A 2VIWA 2A5AA 1MKXH 2QE7D 3A87A 1AVGH 3BIVH 3N7DA 1NFXA 1V2KT 3AAUA 1TGBA 4X1PU 1GI4A 5FX5A 1PYTD 4ABJA 3Q3KA 1OPHB 1KYNA 1GG6C 1A5IA 4Q7YA 1QQ4A 1ZSLA 4WMFA 2BQ7B 1TA6A 1OKXA 1KXCA 4ZHAA 3SV9A 4FVBA 2GMTC 1EXFA 4X8TH 2RFKC 1O5EH 1TMTH 5A8XA 1GDUA 2Z94A 1QJ7B 3SZNA 1OSSA 5CE1A 1S85A 2QC2A 2OC7A 8ESTE 3K6ZA 1C2JA 3P8GA 4FUBA 4R8TB 1ABIH 4THNH 1ZMJA 2AYWA 1HRTH 3ZZ5A 1C4V2 3TGKE 3LGYA 1TRNA 1WSSH 1TRMA 3A80A 1GBMA 3MFJA 1H1BA 4OS5A 1ZTLA 1FN6A 3UY9A 1S6HA 5HXFA 2A7JA 1C5WB 2PSYA 3TNTA 2IJD1 3E6PH 2ZTXA 1FLEE 2XRCA 1O3LA 5JBCS 1EAWA 1BTZA 1UVTH 1YPHC 2UUKB 2RA3A 2SGAA 4BXSA 2J92A 2BY5X 4Y71A 1SGNE 1AIXH 2OBOA 1CBWC 3ITIA 5ESBA 4X1SU 3M5MA 1AB9B 1PQ7A 3DSPA 2C8XB 3ZYDA 3MH4A 2DE9A 1SBWA 2FOGA 1C5YB 1ELEE 2UWPA 1HUTH 1UMAH 2FIRH 2ODPA 1AE5A 2OXSA 1BUIA 2Q6DA 3OYPA 1A46H 1XUHA 4KKDA 4I31A 1HBTH 1F5LA 1A3BH 1BRUP 1FNIA 4TPIZ 2JIZD 2XC4A 2HPPH 2OBQA 5GDSH 3OX7U 4Q4LA 1DICA 4H6SB 5J4QA 1O3MA 1O5BB 1UTQA 5DSFA 1O2NA 4DT4A 4XBCA 3URCA 1Z6JH 2QXGA 3ATMA 2JH0D 2KFWA 1TQ0B 2HWLB 1C9PA 1QFKH 1XKAC 2NU2E 2YMSD 1TOCB 3P17H 2Q6GA 1QRWA 2TIOA 3QGNB 3GDVA 1YY3A 3M5NA 2H5CA 1HAVB 2A0QB 1SGCA 5BRRE 1PYTC 5A8YA 2FODA 1H9IE 1P2OA 2W5EA 4NGAH 1YYY1 2XBVA 4I8JA 1TLDA 5JB8S 1TX7A 1SPJA 1SFQB 2AFQB 1K1OA 1O30A 4GAWA 3SQEE 4UFEH 2XC5A 2VH0A 3U98H 2Z9GA 2Y7XA 4FU7A 1WYKA 4RI0A 5LPRA 2FTMA 1E38B 1F2SE 1Q31A 3MHWU 5GJ4B 2ZGCA 1GI9B 3GISB 1PPZA 2VB0A 1GVLA 2VGCC 3UUZA 4Y10E 2NU3E 2W6JD 3E3TA 2J34A 1GMHF 1P9UA 6CHAB 2GZ9A 3T25A 2SNVA 1CT2E 1SLVB 4UEHH 3I77A 2XW9A 2QF5A 1C5OH 1QRZA 1HDTH 4MVNA 1Y5BT 1LHCH 1NRRH 3NUMA 4UD9H 1DSUA 1HIAA 3Q3XA 2BTCE 1ESBA 1EPTC 1B0FA 3KN2A 2DE8A 3MWIU 2WPJS 3ZIAD 1GGDB 3A88A 4P00A 5T6GA 1Q2WA 3OEHD 4FOUC 1EB1H 3SW2B 2BHGA 4CRBA 2WV4A 4JYVH 4AG1A 1GHBF 1GI3A 3FP6E 2P3TB 3AAVA 4K1TA 4E05H 3BEIB 3MNXA 2WPIS 3DSOA 1C5UA 2BOKA 4AFQA 3TPIZ 2G51A 1AFQC 1Z8RA 1UCYH 1XUJA 1PPEE 1QR3E 2R3UA 1V2VT 3UWIA 1MKXK 4HI3A 1PQ5A 4FUDA 1RJXB 2B9LA 1V2PT 1P2MA 4IMQA 2EA3A 3M3VA 1GMHG 4OGXA 3HK6B 4NWKA 1CVWH 2BLWA 1OWEA 1UVSH 2VVVA 2J95A 1DLKB 1MTWA 3TGJE 2G55A 2F43B 5ESTE 3GCTF 5JBBS 2BLOA 1VCPA 1J17T 3GY8A 3RXKA 3MO3A 1QRXA 2JETC 1DVAH 2GT8A 4GSOA 1G3BA 4A92A 1BMAA 3FOAA 3SORA 1HB0B 4GHQA 5DP3A 3RXVA 3PWBA 1ZLRA 3O8BA 3MH7A 1AQ7A 1QBNA 3E8LA 1ZRBA 1YPKH 1O3EA 3SJIA 1DPOA 3S7HB 2GZ8A 1DWDH 5DP5A 3RXBA 3K9XB 1A0HB 4MNWA 4NIVA 4I8GA 4GLYA 5C1UA 1YLDA 3RMLH 4JCNA 3TJVA 4AZ2B 4WVPE 3K65B 2D8WA 2XXLA 2ZF0H 3IWMA 2VIOA 2UUFB 1BMFD 7GCHG 1P2KA 1TX6A 2ZFFH 4RN6A 3G01A 1FY3A 1SI5H 1C1OA 1O3PB 1UTMA 4MPVA 5B6LA 1W0JD 5T1VA 5FXLA 4GHTA 1D3PB 1YPEH 1Z1IA 1CQQA 2FMJA 3GY2A 1MQ6A 2FM2A 2QA9E 2ZU5A 4JK6A 4FUFA 1FIZA 4XOJA 2QF3A 2Y81A 1OP8A 1OWJA 4K69A 2OINA 2JH6D 2V3OH 4BXWA 1YBWA 2ZGXH 3KQEA 2H9TH 5F8ZA 1FIWA 1HLTH 2F9BH 8LPRA 1AHTH 2FI4E 3M35A 3PV4A 2LNCA 3ELAH 3RLWH 3LJJA 2FI5E 2J4IA 1K22H 1P02A 3A89A 2FX6A 1RFNA 1AE8H 2W26A 3EQ0H 3TJNA 1YF4A 1ELVA 1SLUB 1P05A 1C5RA 3EA7A 3SN8A 1C5PA 2Z9KA 1VJ9U 1QL7A 2IJOB 4R0IA 3BSQA 2BYAX 3D65E 1KTTB 2ZCHP 3CS7A 5JDUB 1C2FA 1GMCG 2IN2A 5C67A 1SGDE 3LONA 3S9AA 1BTXA 1O5FH 1FI8A 4SGBE 1T31A 3A86A 2EC9H 2BMGB 9ESTA 2JJ1D 1V2NT 1O2VA 2FI3E 1NY22 5FPTA 3M3TA 1ZR0A 1TPSA 2ZGHA 4WMEA 3UAIC 1HJAC 2HNTE 1LQEA 1FAXA 1DY9A 1WTHD 1K0HA 3PV5A 1QA0A 1XVOA 1N8OC 2P3UB 4HTCH 4CBNA 1FY4A 1RTLA 2EI7A 2GJGA 1D6WA 4JYTA 1QZ8A 3GY7A 3A8DA 5FAHA 4NA8A 3SU5A 3HPTB 1Y3VA 4IGDA 3SI3H 3VXEH 3OTJE 2ZHEH 1ANEA 4LXBH 1NT1A 1TBQH 7ESTE 1LVOA 1O2KA 2Y5GA 1OXGA 3UQOA 4Y7BA 2ZU4A 1V2RT 2YNBA 2GT7A 1K1NA 3EAJA 1YC0A 1QA7A 1S0QA 3A8AA 4MTBA 3TH4H 1LHGH 3PROA 1A61H 3FANA 5HYOA 1H9HE 1TA2A 2RDLA 1QQUA 5L30H 5IK2D 1J15A 1O2HA 3EE0B 4O3TA 3RXTA 1BITA 2I6SA 2RDEA 2O9QA 3U9AH 1NRSH 3A85A 2H9EH 3VGCB 2WPLS 2P93A 1ACBE 3R0FA 1Z6EA 1TGNA 3MH5A 1IAUA 3L3TA 3UB0A 3ZZ4A 4ABAA 4BTUB 3BG4C 4B76A 2H9HA 2CHAC 1ZHMA 3F1SB 1TGCA 3BF6H 4WY3A 2A4GA 1ETRH 2G4UA 1TNIA 1C5NH 3GYMA 2HNTC 1KLTA 3KHVA 2EQNA 1FY1A 4B71A 1C2LA 1THPB 2BLVA 4YT6H 1ANCA 2P3FH 4ZXXH 4YLQH 1TRYA 1HAYB 1N1LA 4TT3D 2GV6A 2YNAA 5L2ZH 1CE5A 3DUXH 2G81E 5H4IB 2XBXA 3SQHE 1T8NA 1OWKA 1BQYA 2SGPE 1FN8A 3RXEA 1VR1H 4A1VA 3UNRA 1TNKA 4KTCA 4IW4E 3T62A 3SUFA 3O8CA 4GVUA 1JRSA 1Z7KA 1N6YA 1L2EA 4ZKRU 1FAKH 5TCCA 3BTGE 4DVAU 3FAOA 1EAUA 1RS0A 2TRMA 3OEED 1SGRE 3ZZ9A 1FDPA 5C5NA 2SGEE 2J98B 1EFRD 1V2ST 1K9OE 2O8WA 3GY5A 2VH6A 1GL0E 4X8UH 3E91A 1J8AA 3M61U 5FPSA 2ZHWH 1S6FA 5GWZA 1V6DA 1WXRA 1P03A 3STJA 4J1YA 1PJPA 2A4QA 1QNJA 1VKYA 1C2MA 1YPLH 2Z7FE 5DO4H 4Y0ZE 1GMCF 2FDAA 5EW2H 2P59A 3A7YA 3ZVEA 4ABDA 3CENA 2FYQA 1NN6A 1NESE 3K6YA 4JZDH 5EIYA 4HFPB 2F91A 2BDIA 1S84A 3ZZDA 1C1VH 3M5LA 1MTSA 1TAWA 1LQDB 1LTOA 2XNDD 4AORA 1OHHD 2VJ1A 3BG8A 4Y8ZA 1IQEA 8KME2 3ATKA 4OS6A 3FN8A 1TGSZ 2B0FA 1RTFB 2ODQA 3U8RH 1O2IA 1WTGH 1W11U 1ZPBA 2FO9A 3PMHB 1DUAA 1UTKA 2BZ6H 1WV7H 1SQAA 5SGAE 2OC1A 1KDQB 3MO9A 4TY6A 2UUJB 2VGCB 3S0NA 1YKTA 3BG4B 4NZQA 1BBRE 1BBRH 4XBDA 3TK9A 1QIXB 4DY7B 1B0EA
chains in the Genus database with same CATH topology
3RXIA 4A1XA 1ESAA 2FS8A 1IHTH 3ZZCA 2J9NA 9LPRA 3C1KA 4AFSA 1ABJH 4OS2A 3BEUA 3SU6A 2O8TA 4AGKA 1KXAA 2WPMS 4OS1A 2BDYA 4FUCA 2J38A 3V12A 1Y59T 2ANKH 4AN7A 3N7OA 1PPBH 3F9FA 1SB1H 1L0ZA 1SSXA 2CXVA 1JWTA 1DM4B 1AMHA 1IQMA 3PMAB 2HLCA 1EQ9A 3BTQE 2R3YA 1ETSH 1C5TA 5L6NH 1G36A 4Y8XA 1SOTA 2WYGA 4E06H 2CF9H 4A1TA 1SFIA 2BVRH 1CGHA 1VGCB 1C5VA 1GJAB 2ALPA 3GCOA 2K1QA 1NRQH 1HAZB 1GCTC 1WU1A 2FS9A 1SGPE 4CREA 5F8TA 2A4RA 2BM2A 1DWEH 3GCTG 1J16A 4U30A 1LMWB 3LIWA 4CRGA 5FPYA 2FX4A 3TJOA 4FUEA 1NM6A 3SNEA 1O2MA 3TIUA 3VFEA 5DK1A 1MBMA 1UTOA 2VINA 1C1TA 1FUJA 5A09A 4K3JA 3AVZA 1KTSB 2ESTE 1E37B 1JOUB 1CBWB 3GDSA 4E7NA 1GI1A 1O3DA 3A83A 2XNIA 5GCHG 1THSH 4RKJB 3EA8A 3P8OA 2PKAA 3LPRA 4WJG2 4E7RG 1GHBG 3TH3H 8GCHF 2TBSA 5EQRA 4Y79A 3SU1A 1BDAA 5CHAB 3M7QA 1Z8GA 4AFUA 2FP7B 3L33A 1DT2A 1FQ3A 3PB1E 4CRDA 4H6TA 5E0JA 5JPMH 1NO9H 4NIXA 2FOAA 3A8BA 1OWDA 3P92A 3RMNH 2V6NA 2OP9A 1HAGE 1MTVA 1O3HA 4ISOA 3SNDA 4CH2B 2GCTB 1KLJH 1MKWH 1TB6H 2WUCA 3LKWA 5GIBA 3RXQA 4BAKB 1AVWA 3WY8A 1BB0B 4YOIA 2GZ7A 3PMBB 2PTCE 1WUNH 2OC0A 2BQ6B 1A0LA 2QCYA 3SV2H 1HIAB 2BY6X 2VWNA 2W7SA 3U1IB 1GL1A 1O2XA 3TJUA 3EA9A 4BAOB 2ZDLA 1DWBH 2B8OH 2BOHB 4ZAEA 1GJ4H 1F0SA 4ZKNU 5DGJA 4A5TS 1C2DA 4YOGA 3LH1A 1THRH 2ZDVH 2ZCKP 3A81A 4DT7B 4BAQB 1V2UT 2FOEA 1ZTKA 1DXPA 1O38A 3NCLA 1AY6H 1EJNA 4YT7H 4O3UA 1A5HA 4NA9H 2Y5FA 2ZFPH 4TPYA 6ESTA 1DSTA 3MH6A 1O35A 5ETXA 4H42U 4NZLA 3SU4A 4I33A 2P8OC 3KQBA 2HOBA 3M5OA 4TY7A 1V2JT 4FU9A 1UVOA 1EZUC 4X1RU 1JRTA 4X2YA 3URDA 3OY5U 4U32A 2QXHA 4JZFH 1G2LA 2HRVA 2F83A 1GJDB 1IQIA 2EI6A 4ZHLU 1T4UH 2QXIA 4OS7A 5E0HA 3H7TA 1T32A 1L1GA 3SUGA 3NPSA 1Z8IB 5FX6A 1LVBA 1P04A 3BTDE 1SOZA 1E0FD 1P57B 2QIQA 1UK4A 1Q3XA 1SLWB 3RXMA 1QJ6B 2M5TA 3A7XA 1CU1A 1TFXA 3SNBA 2PKSC 1EB2A 1T7CA 1C1SA 2R2WU 1EAIA 2ZPQA 2Z9IA 3QTVH 2BB4A 1W7XH 1N6XA 4ZHMU 1SMFE 4ISNA 4D8NA 3RXRA 2CV3A 3FZZA 2ZIQH 3AASA 2CMYA 3SJKA 2BD9A 2V0BA 4WXIA 1GHZA 7KMEH 4PROA 1Y3UA 1DWCH 1GJBB 1GHYH 2ZKSA 4WF8A 4NIWA 4NG9H 1FZZA 2ZG0H 3RXPA 2NU4E 1OX1A 2P94A 4J2YB 4JZEH 1Y5AT 1O39A 2G8TA 3RC4A 1CGIE 2G4TA 4TWYA 1KIGH 1D4PB 1CA8B 1VITF 3KF2A 4X2VA 1F92A 1V2QT 2A2QH 3UREA 4TYDA 4LOYH 3ODFA 1E34B 5LPEA 1XUKA 2UWLA 3LGVA 2Y7ZA 1PQ8A 2A7CA 1C1PA 4XDEA 5I46H 3OU0A 1HAHH 2ZP0H 4ZKSU 1CHGA 4X6OA 3ZVAA 1MU6B 1BHXB 2OTVA 4WH8A 4AYYB 1QCPA 2A31A 1UTPA 1FJSA 5EXMA 4UFDH 1E35B 2AGEX 2GX4A 2ODYB 3PLKA 3V7TA 3BTTE 2HALA 2VNTA 2VIPA 4MNYA 5BPEA 5DP9A 1GI0A 1EZSC 1O2JA 2YOLA 1S81A 1W13U 2VU8E 2BD4A 2ZI2H 2BZAA 4YZUA 5JBAS 3RXCA 3HGNA 3BTWE 1K1PA 3ZV8A 1O0DH 4IN1A 1P0SH 5EXNA 2BDHA 3QTOH 3P95A 4I8KA 3SOSA 1Z1JA 4UFGH 1DDJA 2ZDNA 1V2TT 1UHBA 1WOFA 4DOQA 3M36A 2GCHG 3FP8E 1G37A 1O33A 1SGQE 2AIPA 1ID5H 1HXEH 1LDTT 5DJ7A 3JZ1B 1HYLA 1GBAA 3RXSA 3SU0A 1O34A 3ZZ3A 1OWHA 1PPHE 1HAOH 1F0RA 3DA9B 4INKA 2TGAA 2XCNA 1O2UA 1ZGVA 3PTBA 1HJ8A 2TGTA 3Q3YA 2GTBA 2ZA5A 1T8LA 4NFEA 1ZMLA 2OCVB 4JZIA 3VPKA 2F9PA 2BXUH 5AVDA 1UTLM 1ZHRA 3RDZA 1O36A 1DANH 3HGPA 1K1IA 4X6MA 1G30B 4I32A 4IBLH 2VWMA 1ZHPA 3HKJB 2XBYA 1KY9A 2AERH 1A5GH 1FPCH 1FXYA 2QY0B 4X1QU 1ANDA 4INLA 3SBKA 3AW0A 4Z6AH 1ZOMA 3SUDA 1LKBA 3O8RA 4BOHA 3UPEA 1HNEE 3K2UA 2AIQA 3ZVGA 3S69A 2ZHFH 1XMNB 4ABHA 2GD4B 5DP8A 4F4OC 4KTUA 3KNXA 1D3QB 2F9NA 3E1XB 4ZROA 3RXDA 5JB9S 1G32B 1GBEA 1KXFA 4I7YH 1Y3XA 1FV9A 1P2NA 2A1DB 2PWXA 1ELCA 1P01A 1O5DH 3VGCC 1Z71A 2ANWA 4AFZA 1A1RA 3PLPA 1SHYA 2BX4A 2RG3A 4VGCC 3SI4H 4X8SH 1RXPA 1ESTA 4KELA 5F8XA 1SVPA 1O2ZA 1JXPA 3RXJA 4X8VH 1C5XB 1NPMA 1GVKB 4Z0KA 1GBHA 1XKBC 3BTHE 4ZMAH 2GDDA 2ZTZA 5F03A 2QF0A 3LH3A 1TOMH 5C5OA 3UR9A 3RU4E 1QURH 3OSYA 6CHAC 1IQJA 3A8CA 3BN9A 1TNJA 1KXEA 2D2DA 3D23A 5A8ZA 1K28D 1SGFG 2Z9JA 2C8YB 4I8LA 3LGIA 2BD7A 2FLRH 2XBWA 1OOKB 3GCNA 1WAYB 4FVDA 2TPIZ 2GDEH 4BTIB 3ZV9A 5LH8A 1FPHH 3H7OA 1FY8E 2FWWA 3M7UA 3MU8A 1LPZB 2V3HH 4UFFH 1W10U 3MU0A 1IQHA 4DJZB 2XYAA 1C1NA 5HMAA 2RA0A 1NS3A 3BTKE 3SGAE 3QZQA 5PTPA 4DIHH 1O3AA 2FOCA 1P3EA 1EOJA 4O03A 1RD3B 3T27A 4I8HA 4A6LA 1GBCA 1A2CH 3FP7E 1MTUA 4X1NU 2ANMH 1YPHE 4MNVA 1DITH 2SGFE 3S9BA 1LHEH 4GCHG 5DP6A 2HGTH 1C2IA 1CHOF 1GHAF 2ZU1A 1DY8A 1G3DA 1ZGIA 5T6DA 1ELGA 1DUEA 1W7GH 2ZGJA 3E90B 3OY6U 2ZHDA 2ZZUH 3A7TA 3PTNA 2FOHA 2F9VA 2R0LA 5E0GA 1AKSA 1GVZA 3L6PA 3MNSA 3RMMH 1GCTB 2CF8H 1BTUA 1UVUH 3RP2A 3U1JB 2ILNA 1YM0A 5T6FA 1T8OA 1ZRKA 3A7WA 2SNWA 4WH6A 1P06A 4OGYA 3LGUA 1F0TA 5JBTA 1GI6A 1QGFA 2R0KA 3QK1A 1NROH 1ZJDA 1C5MD 2H6MA 1KXBA 1OWIA 3MMGA 1AWHB 2PHBA 3ESTA 3MNCA 1C2EA 4ABGA 3ENSB 3T5FH 1YPJH 1SC8U 1L1JA 1C1WH 1TMUH 2ZQ2A 2BVXH 2VWLA 4AB9A 3S7KB 3AW1A 4QT8C 2A32A 2WUBA 2GV7A 4U2WA 2RCEA 2A5KA 3ATIA 3TVJB 2ZO3H 2ZFQH 1BOQA 4BAMB 2AEIH 2P8OB 1BCUH 4ISHH 3R3GB 1MKWK 1UTNA 2BXTH 1QL8A 3TK6A 3EDXB 2FOMB 2ZQ1A 1YPGH 4IC5A 2A45B 2AH4X 2ZDAH 3C27B 1NC6A 4ZXYH 2BLQA 1IQNA 1BA8B 4BAHB 2UUYA 4MPWA 1W3CA 2I6QA 1HXFH 3SV8A 2IPHA 4D7GA 1MAYA 1S83A 5EU8A 4NA7A 1W8BH 1INCA 3D62A 2FEQH 3LT3A 4UDWH 3SJOA 3BTME 1MCVA 1S5SA 4VGCB 3KIDU 1D3TB 1NRNH 1B5GH 1F7ZA 4CBOA 3VB4A 1LCYA 2ZPRA 1HJ9A 3W95A 1IQKA 2NU1E 2C8WB 5EG4A 1C2KA 1O2QA 5GCHF 1QBOA 1XXFA 4CRFA 2GCTC 3SHCH 1TBRH 2CGAA 4HGCA 2FOBA 3QDZB 1PPCE 4UONA 4Y0YE 1KXDA 4HZHA 2ZEBA 3MO6A 1EZQA 2PGQB 1MCTA 4MQAA 2VIDA 2QN5T 1Y3YA 1XM1A 1P12E 4JZ1A 3ZZBA 2XC0A 1FMGA 1O2PA 3LC5A 1C9TA 5FHTA 5C3NA 5CHAC 1O2WA 2KAIA 3UIRA 3Q00A 1D6RA 1GGDC 1MBQA 2R2MB 2ZFRH 1QTFA 3RXFA 4Y7AA 1EASA 1EJMA 1NZQH 4M7GA 1EPTB 3D49H 1ELAA 3F9EA 1YCPK 3EYDA 4BNRA 1HV7A 1K2I1 1AFEH 3QO6A 3QZRA 1NFUA 5K7RA 2ZU3A 4YM9A 2QXJA 1VZQH 3U8TH 1LHDH 2PLXA 3RC6A 2Y82A 3DFLA 1IHSH 3UWJH 3MU1A 1RIWB 2O8LA 1A4WH 2EI8A 5EPYA 1E36B 2C8ZB 5EXLA 1TPPA 4MNXA 2Z3EA 5AFZH 1BTHH 2BDCA 4YLUA 1AU8A 1O2TA 4AYVB 3PYHA 1V2LT 4D9RA 1YLCA 4XSKU 1IQGA 1P2JA 1ZJKA 4MDSA 4CR9A 4YESB 1GBJA 1WBGB 2P16A 2ZDKA 1VGCC 3P8NA 3MNBA 2JH5D 3PLBA 1K21H 2ZC9H 3SJ8A 4DW2U 1UO6A 2ASUB 3F9GA 4LZ1H 2LPRA 1LVYA 3U69H 2ZDMA 1UCYE 3TH2H 2HVXA 2H1UA 3TU7H 3PMJA 2FESH 2HPQH 3F9HA 1HGTH 3W94A 2F9OA 1H8IH 1AUJA 3RM2H 1O3JA 5E8EH 1ELFA 2ZGBH 1U6QA 3BV9B 1GMDF 3IG6B 3RXAA 5EPNA 2NWNA 2CJIA 2BX3A 3KGPA 1QL9A 2BD8A 2CN0H 1H4WA 3GY4A 1F5RA 1MD8A 3DHKH 3RMOH 1BBRK 3RU4D 2G5NA 1XUFA 1EPTA 1JIMA 3LU9B 2FZZA 1YP9A 2FXRA 6GCHF 3I78A 4Q2KA 2FOFA 1YPMH 4F49A 1QHRB 5DP4A 1GBDA 2BY9X 1GJ9B 3LJOA 2PR3A 4WXVA 1OS8A 1AI8H 3ZZ8A 2W3KA 2B5TB 3S9CA 1BRBE 2OD3B 3FZDA 2R9PA 1MD7A 1C2GA 4ZUHA 2C3SA 1YCPM 5DPAA 2AS9A 4D7FA 5L2YH 2IOTA 3TGIE 1SLXB 2V35A 1ANBA 2Y5HA 3VEQB 4CR5A 1TE0A 3NK8A 4CRCA 2W7UA 3BEFB 1KDQA 4ISIH 2G5VA 1GDQA 3O8DA 5A2MH 2THFB 3UOUA 1LO6A 4XFQA 4MPXA 3SNAA 1ZYOA 1ZTJA 2WINI 1NFWA 1HAXB 1ZZZA 2FTLE 3GY3A 5A0CA 3RXGA 1AUTC 2GCHF 1BMMH 4X0WU 3PWCA 1M9UA 5B6OA 1QB9A 1DX5M 1FONA 1TX8A 1L4DA 4KTSA 1Z8JB 1VCQA 3DFJA 1MTNB 1V2MT 4U01A 3ZZ7A 3GCHB 1OYTH 1TGTA 4DIIH 1CO7E 1O2RA 2BDAA 1BJUA 3TLOA 1JMOH 5HM2A 3PO1C 2HNTF 2BQWB 4K1SA 4OS4A 2GMTB 2XWAA 1QB6A 1BT7A 4A7IB 3NWUA 1AB9C 1AN1E 4JYUH 4BTTB 3QLPH 2A4OA 1OP2A 2QYIA 1BTYA 3QUMP 3LOXA 3VB6A 4B73A 1GHVH 1C5QA 1ZPZA 1EP6A 1CHOG 1GHAG 2C4FH 1FY5A 1G3CA 1QY6A 4MPUA 3SU3A 3RUOA 4CRAA 1O2YA 5GXPA 1GMDG 1O3CA 2OQ5A 1MMJN 3RXHA 1UTJA 1WCZA 5DKMA 1AD8H 4RSPA 1C5SA 2CHAB 1EOLA 3P6ZB 3ATLA 4YO9A 4LZ4B 2ULLA 1CA0C 1HCGA 1SGTA 1NRPH 4NFFA 4MG3A 3SU2A 1GI8B 3IITA 4XBBA 4GPGA 4KGAA 4AG2A 2QAAA 1X7AC 1UK2A 3UFAA 2F9UA 1RRKA 1GI5A 2A7HA 2Y80A 3TITA 4DURA 2PW8H 2FYRA 2KAIB 1DE7H 2PSXA 4UE7H 2BDGA 3ZZAA 1XXDA 2ZFTA 3B23B 3SV6A 1H9LB 1GBTA 1BMLA 4AB8A 1O3KA 1T8MA 1VITG 1P11E 4AGJA 3KEEA 2DUCA 2GP9B 2PKAB 4FUIA 2OQUA 5C1YA 4ZH8A 2JKHA 2WYJA 1BZXE 1D3DB 1O3FA 3V13A 1P8VC 1HAVA 1GWAA 4B2BA 2ZHQH 1QBVH 4ABFA 3UR6A 3P8FA 3T2NA 3M7TA 3DD2H 1UK3A 1BIOA 1PPGE 1XVMA 4IC6A 3SV7A 1CGJE 3GCHC 1ETTH 1GBLA 1MTNC 2VIQA 3RXUA 3SGQE 1O3NA 1H8DH 2PTNA 2AGGX 3SJ9A 1C1MA 1ARBA 3NZIA 2C90B 1Y5UT 3SO3A 1HJAB 1CSOE 1GPZA 3HK3B 1AZZA 4Q7ZA 1TBZH 4O9VA 1O2GH 1NU7B 1SGFA 4K60A 2Q6FA 1AVXA 3PM3A 3SHAH 3ZYEA 1VITH 5K0HA 1AWFH 3GYLB 3UNSA 3JZ2B 1C5LH 1OP0A