4ZKRU

The crystal structure of upain-1-w3a in complex with upa at ph9.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU01
4AGKA 1ETRH 2Y5FA 3RLWH 4O97A 1AFEH 2A2XH 3F9EA 1GJ5H 3EA9A 4I8GA 4WWYA 1C2EA 1ZTJA 1P2MA 3UY9A 3I29A 2ODYB 1EZUC 1NU9A 3NPSA 1CVWH 2P95A 1SFQB 1GJDB 2GCTB 3QWCH 1A1RA 3WY8A 1EXFA 4H4FA 3ATIA 1ELEE 4UE7H 4D9RA 1QFKH 1O2XA 3SV8A 3A88A 3RU4E 1KDQB 1SHYA 2XCNA 3GY6A 1GBHA 2XBYA 2ZWLH 1S83A 1G37A 4WMEA 3RXGA 1CHGA 1TRNA 2XXLA 4UONA 1T31A 2GDEH 1V2JT 2P8OB 1Y5BT 2A5IA 4E7NA 1QA7A 1GI9B 1XUFA 1BQYA 1AWHB 4MNVA 3IWMA 3SN8A 1GDQA 2A7CA 1GJ6A 4JZFH 4Q7YA 3UOPA 1PJPA 1Q2WA 1D4PB 2GKVE 3K2UA 4Y0ZE 1GJ8B 2EC9H 2BDHA 2AIQA 2BQWB 4INKA 4A92A 3SJKA 2YNBA 3I77A 3UIRA 2C3SA 2QXJA 2EI7A 3M5OA 7ESTE 2AERH 2F9VA 1T32A 2GD4B 2G81E 4OGXA 3B9FH 1Y8TA 1ZTKA 2P8OC 3DT0H 1AVGH 1YF4A 1BMLA 5C3NA 4SGBE 3RXDA 4X6NA 2F83A 3KIDU 2D8WA 1O38A 2UUKB 4VGCB 3TK9A 4CBOA 2BVSH 2H1UA 1HAHH 2VWMA 1J15A 2XTTB 4FUGA 2ZFTA 1P8VC 1RIWB 3UQOA 3ZZ5A 1QRWA 2V6NA 3M36A 3RC6A 5HMAA 3SNCA 2G5NA 5I25A 2ZO3H 3SJ9A 3GDUA 1O2RA 1HIAB 3JZ2B 1C2HA 1XUKA 1GMCF 3M5NA 3UNQA 2F9PA 4ISOA 3BTWE 1ZSLA 1LHGH 1QGFA 2A32A 4NFFA 1AB9C 1SR5C 1WSSH 4ISIH 4KKDA 1TA6A 1ELGA 3OY5U 1WUNH 4ABFA 1XM1A 2HWLB 4RKJB 1ANEA 5FX6A 4WH6A 2H9HA 2FI5E 2ZCLP 2PHBA 3GCNA 1GI8B 4MQAA 3STIA 1MKXK 1ZJDA 2OC7A 4NA7A 3UR6A 1C1WH 3SUDA 3O8RA 1P2NA 1GCTC 4XBDA 2VVCA 4AFQA 3VGCB 1GHXH 1YPGH 5FPTA 1N1LA 4B73A 4ZAEA 1CE5A 1BTUA 2BLOA 1QCPA 2VU8E 2QA9E 1EP6A 1NPMA 1C5LH 1OWHA 2BZ6H 3V13A 1QB1A 1O2GH 1Z1JA 3QN7A 2STAE 4X1NU 1A7SA 3RXUA 1YM0A 1LQEA 1QURH 3RXPA 3LJOA 1CO7E 3P8OA 3O8CA 1QIXB 3QGNB 2VIVA 4B71A 3R0FA 3SU4A 1YYY1 4Q7XA 3HGNA 1O5BB 3ZZ6A 1OKXA 1L1NA 1DDJA 1GGDB 1GVZA 3MNSA 1AMHA 1O2LA 1MTUA 5H4IB 1O2NA 1JWTA 1LTOA 3S7KB 1WBGB 2ZU5A 4NCYA 1ZLRA 1GG6C 3LC3A 3GY2A 5IYTA 1AI8H 4D7GA 1O35A 4YT7H 1IHTH 3V7TA 3AASA 4UD9H 3Q3XA 1P09A 1QL7A 2B0FA 3ZZ7A 1UCYH 1MBMA 2GV6A 4BANB 1KLTA 3PMHB 4CH8B 3STJA 1AWFH 1V2RT 1GHBG 2QN5T 1D3PB 1L1JA 1WV7H 1HPGA 1XVMA 4IN1A 3BG4C 5JYIA 2FI4E 1TNIA 1INCA 1Z8RA 4DY7B 3E0PB 1NRNH 2PKAA 2C93B 1MU6B 3ELAH 1OWEA 1SHHB 2WYGA 3ATMA 1Y3XA 5HYOA 3TJNA 1S0QA 2VWLA 4Y0YE 4H6TA 4ABJA 1QB9A 2ANYA 1TOCB 3TK6A 1IOEA 1F0SA 2A4RA 2TBSA 1FONA 3LIWA 1YPJH 1C5SA 2GT7A 1LMWB 3C1KA 1HB0B 1EJNA 5A0BA 3MNBA 3FFGA 2NU3E 2PTNA 1EASA 1H9HE 1K22H 1O3CA 1YKTA 2Y80A 5JBBS 1TNJA 1HAVB 4Y7BA 2C8WB 3MU0A 2BVXH 4CRDA 4KELA 5K0HA 1OP0A 4K1TA 5JPMH 1FV9A 3QX5H 3T2NA 4JYTA 3AVZA 1HJAB 2BQ6B 3BG4B 1TMBH 1YPHC 2BDBA 1MKWK 1FNIA 4FUIA 3AW1A 7LPRA 1VJ9U 2FOCA 3NXPA 1S6FA 4FVDA 4UFGH 1P02A 5GIBA 2WPHS 3VXEH 2BX3A 1BBRE 1C5TA 3ENSB 1AN1E 3TPIZ 4AORA 1XUIA 2OUAA 3OX7U 2R3YA 1G3EA 1FDPA 1GBFA 3RXBA 1FIZA 3VB3A 3N7OA 2O8TA 1TE0A 4AYYB 1WCZA 2JETC 1MCTA 3P8GA 1NFWA 2ZU1A 2ZDMA 1FY5A 4Y11E 1GDNA 3DFJA 2ILNA 3P70B 2ZTYA 1UVUH 3TLOA 3U9AH 4X8UH 5T6DA 1EKBB 2ALVA 2H2ZA 3HKJB 2XBVA 3BTTE 5F8XA 3E8LA 1Z8IB 2HPQH 1QHRB 4MNWA 4IBLH 3LONA 4D76A 1WQSA 1SQOA 2BTCE 3MYWA 1BT7A 3QUMP 1THRH 1DUEA 2KAIA 1HFDA 1MZAA 3KL6A 1ZGIA 1LHDH 2DE9A 2R2MB 1N8OB 1ZSKA 2B5TB 3GY5A 4O3TA 3W95A 1FI8A 1C2LA 3E3TA 1HYLA 3AAVA 1GI5A 1O36A 1SPJA 2BDIA 2J92A 1VGCB 4ZKNU 2XBWA 2F9BH 5AHGH 2H6MA 1GCTB 2OXSA 2VGCC 5L30H 2JH0D 4YLUA 1YP9A 2EA3A 1P3CA 1SFIA 4I8LA 3ZYEA 4CRFA 2Q6FA 1VITG 4B2CA 4BXWA 1ELBA 5DJ7A 5ESBA 3EA7A 4ZHLU 1SC8U 2OQUA 4ABHA 1SGQE 3M7TA 2CF8H 3RM0H 1KTSB 2BXTH 1ARBA 1G32B 1C4Y2 2ZHFH 2B8OH 1BZXE 4X2XA 2Y5HA 2FLBH 1DOJA 1PPBH 1V6DA 1KDQA 1G9IE 3P8FA 5AFYH 3RU4T 2ZHWH 2F9OA 2CMYA 1DT2A 2VNTA 1NU7B 1EJAA 5J4SA 3T29A 1L2EA 2H5CA 2Z3CA 5LPRA 2R2WU 1EAUA 1MH0A 5A09A 1D3TB 4CREA 1GDUA 1S81A 5I46H 1WTGH 1K1IA 2OC0A 1BB0B 1YPKH 2W5EA 2XC4A 4HGCA 4BTTB 4UFDH 2GCHG 2VIDA 1V2MT 4HFPB 1BITA 1NRQH 4I8JA 3BSQA 1S5SA 3T5FH 5CHAC 3SZNA 1BCUH 2ZQ2A 1E0FD 1H8DH 3LGIA 1EPTB 1OP2A 1TMUH 3ZVAA 2RCEA 3VB7A 1ANDA 5GWZA 2PFEA 2FODA 1BRCE 4K1EA 4IS5A 1IQGA 2PUQH 3K65B 2SGDE 1Y5UT 3LOXA 4I33A 8ESTE 3KN2A 1BDAA 2Z7FE 3ESTA 4MNYA 1W3CA 1XUJA 1Y5AT 6GCHF 1BMMH 2ZEBA 1NS3A 3UOUA 4U01A 2R0LA 4FU8A 1CBWB 1NO9H 1O2WA 1P2IA 1D9IA 1O31A 1ACBE 3CS0A 3D23A 3GCHC 4TY6A 2G8TA 4X8SH 5DP3A 1O5GH 1BRBE 1SGIB 2G4TA 2PSXA 1C5MD 5PTPA 3RP2A 1SGFA 3MU5A 1BBRK 4YZUA 2BD7A 3MO9A 4U30A 4ZKRU 3MH4A 3BF6H 4MLFB 2FOBA 1EZSC 1C5YB 3ATLA 3CS7A 1UTOA 3Q77A 3MH5A 1FXYA 3QTVH 2BY9X 2OCVB 3UQVA 2GZ9A 3QTOH 4AOQA 5C67A 5JBTA 1UK4A 2FOGA 1G2LA 3QK1A 4B2BA 3MHWU 1BTYA 1PPZA 2BD5A 3SUEA 1GBEA 1DLEA 2BY8X 1JRTA 1T8LA 1O2TA 4YESB 1QBNA 2EI6A 4DOQA 1XKAC 1BMNH 1HAIH 1LDTT 1O2JA 3ZZAA 1EQ9A 1CT0E 1TPAE 1SI5H 2BD8A 1HAOH 1C1TA 6CHAB 1SBWA 3PMJA 1FAKH 3S9AA 1H9LB 3L6PA 1JBUH 2SNVA 2QXHA 5C20A 1AE8H 2PKSB 4XBBA 2VGCB 1MTWA 1O3AA 3U8RH 1CT2E 3O8BA 4Y8XA 2OINA 2UWOA 1C2JA 1A46H 3SGAE 2C4FH 4HZHA 5LH8A 3PO1C 3T28A 2FO9A 4Y8YA 5JB8S 2OBOA 3T62A 2Z9IA 3GISB 4NSYA 5DP4A 3TK5A 3EGKH 3U69H 2Y81A 1EAWA 1IQMA 7GCHF 4K8BA 4K5ZA 1TNKA 1C1VH 2BX4A 5HXFA 1O37A 4YO9A 1TX6A 5A8YA 1SGRE 1UVPA 1W11U 4U2WA 1GBMA 1TX8A 3EYDA 3MNXA 1WYKA 3HKIB 1FZZA 1T8NA 2Y5GA 4MTBA 3QDZB 1F5RA 1TGSZ 3H5CB 3SGQE 1CGJE 4ABBA 3D62A 4TPIZ 3A81A 1EP5A 5E0HA 1GG6B 1O3OA 2PV9B 4JZDH 2C8YB 2O8MA 2TIOA 1J9CH 1P0SH 3A7YA 3A7XA 1W0ZU 3LH3A 1GI3A 3RMNH 4LOYH 2PW8H 1FUJA 1ELFA 1F2SE 4ZMAH 3SU0A 4GPGA 1C2KA 2XW9A 2P59A 1JMOH 4HTCH 3GCHB 3Q3YA 2XBXA 1C2IA 1H4WA 1PPHE 1LVYA 2FTLE 3PYHA 1PQ5A 1NFXA 1V2UT 4FUJA 5TCAA 1G2MA 1PFXC 1UO6A 2BDGA 2ZFPH 3RUOA 1AFQB 3OSYA 1D6RA 3S9BA 1HJ9A 4OS6A 1CA8B 1E36B 2BDCA 4Q2KA 1K1JA 2G4UA 1D3QB 1C1NA 2SNWA 1ZR0A 3H7OA 4ISLA 1FY3A 2QV1A 1IQLA 1CA0C 4I7YH 3KCGH 1GWAA 1ABJH 5CHAB 2TGTA 1NM6A 1O34A 1KTTB 1P3EA 1TOMH 2V35A 2AYWA 2ZU2A 3LPRA 1MAXA 2ZGHA 2VIQA 2VWOA 2BY5X 1KIGH 1EOJA 1UTNA 1KXEA 1O39A 1SQAA 2ZPSA 1V2ST 1ETSH 1FPHH 1ZOMA 1ZJKA 3GOVB 1TGCA 1GBAA 1DXWA 4UEHH 2J95A 1HCGA 4ISNA 4XDEA 1YCPH 3FZDA 5GCHG 1OWDA 4HI3A 5EXMA 2HNTC 3PLKA 4BAMB 3HPTB 1YPMH 2A4OA 4NSVA 1MQ6A 5DKMA 1C9TA 3LU9B 3FANA 2WPLS 2GT8A 2GDDA 3M61U 1A0JA 3TGIE 3U1JB 3RXHA 1FN8A 1SGCA 2BXUH 4AN7A 1UJ1A 3TVJB 1O3PB 2A7JA 4CBNA 1FPCH 1A3BH 3NK8A 2NU2E 1DFPA 1ANCA 2NU0E 3ZVFA 4ASHA 1K1NA 1C1OA 3D49H 1ELTA 1C5UA 1GI1A 3RXIA 1GL1A 2P3FH 4FUFA 3A7ZA 4K3JA 5C5OA 1GGDC 1S84A 2VH0A 1HAYB 4X1PU 5DO4H 4AX9H 3TH3H 4NWKA 4BAKB 3PMBB 1GHBF 3SU5A 1ZTLA 2BQ7B 1TPSA 2RA3A 2AMQA 3FVFB 2FOHA 3H7TA 2FMJA 5HGGA 5DP9A 4Y6DA 1LHEH 1CQQA 1GHYH 1TMTH 3SU3A 1UK2A 1OX1A 2FI3E 2YNAA 1GJ9B 4INLA 4KTSA 1JOUB 1ID5H 1N6XA 3EAJA 4CRAA 3KQBA 8GCHF 4BNRA 3ZVBA 1LPKB 3UNSA 1HDTH 1AD8H 4IGDA 1AGJA 4NWLA 2Z3DA 1C4V2 1EB1H 5ETXA 1GI4A 1FY1A 4AG2A 4ABAA 5L6NH 1CA0B 5FCRA 1KXCA 2VH6A 3GYMA 1V2OT 3RXVA 1EX3A 5DGJA 1DLKB 5A8ZA 1FLEE 3BN9A 3GY8A 1QL8A 4ZUHA 1SMFE 1CSOE 1OYTH 1SGYE 3KEEA 3M5LA 5T6FA 2Z9LA 4KP0A 1P04A 2SGAA 4YOGA 2ZHDA 4RN6A 1B5GH 3RU4D 1GHVH 2GCTC 5LPEA 4Y7AA 1FN6A 3NCLA 3SV7A 2NWNA 4Y76A 3V12A 4JZ1A 1L0ZA 2RA0A 2Z9KA 1O3HA 3TU7H 3ZVCA 3SW2B 2A5KA 2QCYA 4Y8ZA 4DG4A 2QXIA 4K1SA 2ZECA 1ARCA 1F0TA 1S82A 1BMAA 4D8NA 3TJOA 3QLPH 4H6SB 4DJZB 2VINA 3MU8A 4NGAH 1AIXH 5EQSA 3UNRA 1VJAU 5F03A 1NRSH 1QBVH 3SV6A 2A7HA 3D65E 1TNHA 1SOTA 1XKBC 1Z8GA 5FHTA 2ASUB 4FUCA 2DE8A 1T8MA 5JBAS 1QRZA 5GPIB 2ZPQA 1K1OA 2ZA5A 3MNCA 2LPRA 1GMCG 1C1MA 2IOTA 3TJUA 4KGAA 3G01A 4IC6A 4OS5A 1HJAC 4YM9A 4FVBA 4X2WA 1C1QA 1GBKA 1F92A 1MD7A 3DFLA 3A80A 3MO6A 3RXCA 1G36A 3LGYA 3BEIB 3BG8A 5C5NA 1FAXA 2BLQA 1P2JA 1ZRKA 2HGTH 1RJXB 1UTJA 1XXFA 2Y6TA 2SGEE 2ODQA 1G3DA 1DUAA 5EOKA 3E1XB 1HGTH 1V2WT 1DWCH 3LGTA 3PV4A 2NU1E 4A1XA 4J1YA 1K21H 5DP8A 4BTIB 2WINI 1YBWA 3RXOA 1LVMA 2PUXB 1F7ZA 4FU9A 4MG3A 2UWLA 2WV4A 4K2YA 3C27B 3BTGE 1K28D 1QJ7B 1ZGVA 2CGAA 4TWYA 1TPOA 2ZDLA 1T7CA 1O2KA 2GMTB 3PMAB 1V2QT 2Y82A 3ODFA 5HM2A 3LKWA 4ABEA 1HBTH 5EPNA 3E6PH 3NUMA 3RMOH 2VVUA 1O3NA 2TGDA 1TABE 2A0QB 3TGJE 1NRPH 4R0IA 4NG9H 5FBIA 4YOJA 1EPTA 3M7QA 3EE0B 9LPRA 2OP9A 5EW1H 1CHOG 2AEIH 1C9PA 4YTAA 1O2SA 1SGEE 3ZZ8A 4Q7ZA 4WH8A 2WUBA 1MCVA 1NROH 3ATKA 4ZXYH 2GZ7A 2G55A 5E2PA 3UPEA 2WPMS 2HRVA 3GDVA 2TGAA 4BXSA 3O8DA 2IN2A 1C1PA 2HPPH 2UUYA 2GP9B 5B6OA 2ZFSA 1DANH 3B23B 4O03A 3U1IB 1QQ4A 1O5DH 1WTHD 1OWIA 2TGPZ 1YPLH 1TWXB 4X6MA 4A5TS 1ZRBA 3VEQB 4NZLA 1QB6A 2BZAA 1O2VA 1L1GA 2FZZA 1ZPCA 3RXLA 1DM4B 1SGFG 3MU1A 1LKAA 5ABWA 3CP7A 1O3KA 2HNTF 1UHBB 5HM9A 3MFJA 1ZSJA 3SORA 5J4QA 3EA8A 1EB2A 3A84A 1RIWC 3M5MA 2G52A 7GCHG 1O3LA 5E0GA 1C4U2 1S85A 2PTCE 3TITA 1PPFE 5F8ZA 2A5AA 2ZCHP 5FBEA 1C5NH 4XE4A 2PKAB 3F1SB 1YCPM 2O8LA 5EQRA 2RDLA 1GI0A 3A82A 1O2MA 2A1DB 3SU2A 3BIVH 3VB6A 2THFB 4B74A 1C5RA 3ZZ9A 3DA9B 5T6GA 1IQFA 2ZDAH 1C5PA 3SQEE 3HATH 2FX6A 3RXFA 1A0LA 1UHBA 1E37B 1BTWA 2VIOA 1LPZB 3UTUH 1YGCH 4DGJA 3PLBA 4O3UA 2ANWA 1X7AC 1O3FA 4TYDA 1GMDG 3A8BA 1P06A 3FP7E 3SNDA 1DITH 1HAXB 1QY6A 3MTYA 5C2ZA 2M5TA 4DT7B 2ZNKH 1Z6JH 3VXFH 5LGOA 5CE1A 1P03A 1OP8A 1TB6H 4ESTE 1HIAA 3K6YA 1JRSA 1VCWA 3SJIA 1TPPA 5DP5A 1B0EA 4MPVA 1MZDA 1EOLA 3ATWA 1GBCA 4DVAU 1JIMA 2BLWA 4X6PA 2BY6X 1HXFH 4Y71A 2W3IA 5G4BA 1XVOA 2JH5D 1P01A 4UFFH 3TH2H 5C1YA 2W7UA 2J94A 4GHTA 5EW2H 1GL0E 1L4ZA 3QGJA 5FAHA 1H1BA 5TJXA 4YLQH 2R3UA 2D26C 3KQEA 1QR3E 3SV9A 3QO6A 1SGTA 1HXEH 4D9QA 5GJ4B 1N6YA 4CRBA 3ZZDA 1RTFB 4ZH8A 5TCCA 3FZZA 2FEQH 4X0WU 3RMMH 3UFAA 3SI4H 2Z94A 4ZROA 1DVAH 3SOSA 1AUTC 3UWJH 1BRUP 1CHOF 4JMYA 4IMQA 1W10U 4FU7A 3ZVGA 1SG8B 2FIRH 3OYPA 3RXAA 2WPIS 3SV2H 1TGTA 2J9NA 1RD3B 2PWXA 3ODDA 3F68H 1TQ0B 2ZDKA 1ELAA 3CENA 3PB1E 2Y7XA 3K9XB 4BTUB 3BIUH 2I6QA 1C5XB 1ZMNA 2F91A 3P8NA 2ALPA 1KXDA 4X1QU 3FP8E 1A5GH 3TNTA 1CBWC 1PQ8A 2ZU3A 3ZZCA 1VR1H 3KF2A 1DXPA 3U98H 1O2QA 1BUIA 1O0DH 3B8JA 3UREA 3MMGA 4DIIH 2FOMB 3I78A 1MTSA 4ZHMU 5AFZH 4FUHA 1ORFA 4YT6H 2BDAA 4X8TH 1GVLA 3NKKA 5F6MA 4NIYA 2BB4A 1Q3XA 3SJOA 4XOJA 3BTME 4GSOA 1V2PT 2VVVA 2QAAA 3S9CA 3AW0A 4CH2B 1AQ7A 2K1QA 2FESH 4I32A 1HNEE 1Y59T 1PPGE 1C1RA 2OD3B 3URDA 1QNJA 2CXVA 1DWBH 4ISHH 2AGIX 1RGQA 3QZRA 3W94A 1FY4A 3A87A 1A5IA 1GMHF 2AGGX 1GJCB 1FIWA 1K2I1 4AZ2B 1TRYA 1DWDH 1DS2E 1SLVB 2UUFB 2BVRH 1ESTA 4K60A 4RKOB 1TGNA 4AFSA 1FJSA 1TYNA 2A2QH 3RMLH 2ZIQH 4AFUA 1GBTA 4WVPE 3BTFE 4AG1A 2AMDA 4WJG2 1P05A 1SOZA 4LXBH 4WMDA 4NZQA 1GPZA 2YOLA 1Z6EA 3SU1A 3GY7A 1KLJH 3GCTG 1V3XA 1Z8JB 1O3MA 5EGMA 1RXPA 1O3BA 1AKSB 1AVWA 1UK3A 1MTNB 1P9UA 1K9OE 2W7SA 4MVNA 1KXAA 1MQ5A 1NT1A 1HAVA 2FDAA 3M3TA 2WV5A 2AS9A 5EG4A 3TIUA 3SGBE 1CU1A 1W8BH 4ZHAA 4SGAE 1O3JA 4TY7A 1GJ7B 1KXFA 5FPYA 4MPWA 3EQ0H 1AZ8A 2QY0B 2QYIA 3T26A 2F3CE 4IMZA 3ZZBA 4DIHH 1O30A 1HV7A 2AIPA 1UTKA 3GYLB 3TH4H 2FX4A 1DX5M 4RSPA 1JXPA 3LGUA 1DSTA 1T8OA 5FPSA 4GVUA 2J34A 4AB8A 3M7UA 1ELCA 4GCHG 2B7DH 2CF9H 2V3HH 5FXLA 1ESBA 2H9EH 3S0NA 2ZPRA 1EPTC 2BD9A 1PQAA 3M35A 4A1TA 3GY3A 4MPUA 3RXQA 3U8OH 1EUFA 4LZ1H 2D1JA 1GJBB 4IC5A 4A7IB 2BOKA 1ZMLA 2XRCA 4Y10E 2Q6DA 4DCDA 3HK6B 3KNXA 1WAYB 1P10A 2C8ZB 1GHZA 1J17T 2ULLA 4I8HA 2V0BA 1LQDB 2AMPA 1OYQA 5A8XA 2FS9A 3LGWA 1O3GA 1IQIA 2ZF0H 3JZ1B 4FXGH 4INHA 2BOHB 4WY3A 2ZDNA 4E7RG 1TNGA 4XFQA 3SBKA 4GLYA 3MU4A 1GHAF 1GI2A 3SQHE 3Q3KA 1ABIH 5LPFA 1WQVH 1QBOA 1HAGE 2HNTE 4WXIA 3PWCA 4DW2U 1D3DB 4X1RU 3PLPA 4UFEH 2A31A 3SI3H 4THNH 2ZI2H 1TGBA 4AYVB 1C5QA 2FOEA 3MI4A 1RS0A 6ESTA 1V2LT 1UCYK 4FUDA 4JK6A 3T27A 5DP6A 1GMDF 1AU8A 2A45B 4NA8A 5AF9H 1GCDA 5E8EH 4F49A 2BM2A 4B76A 5A2MH 3VFEA 4CRGA 1FMGA 1ZMJA 1SB1H 3ZZ4A 1GHWH 2WYJA 2CHAB 1VGCC 1HJ8A 1UVOA 3Q76A 1XX9A 2P93A 2XC5A 1C2GA 3L33A 3M3SA 4MNXA 3NWUA 1D6WA 1QL9A 2OLGA 1MKXH 1C1UH 1A0HB 5EXNA 3KQDA 1NN6A 5GCHF 3RXEA 2D2DA 2ZFQH 1MMJN 3F9HA 2ZTXA 2Q6GA 1P2QA 1CGHA 3EDXB 1WOFA 1GJAB 1LPGB 3TGKE 3A86A 1UVTH 2ZG0H 4FUEA 1MTVA 2PLXA 1SGPE 4GHQA 3V0XA 3SU6A 1TRMA 1TIOA 2QIQA 1OSSA 2Y7ZA 2BYAX 3DHKH 1NFUA 2A4QA 2J4IA 2XYAA 4H42U 3SNAA 1F0UA 1F5LA 1O5EH 3RXMA 4PROA 1EZQA 5A0AE 4ZKOU 1RTKA 1QTFA 2GGVB 4MPXA 2J2UA 3BTEE 4GUXA 3SJ8A 1RTLA 1EATA 1PYTC 1P2KA 2GV7A 3IG6B 2ZFFH 2VB0A 3DUXH 4OS2A 2H5DA 1T4VH 3ZV9A 3A7VA 1KSNA 1IQNA 2CJIA 3A8AA 4NIXA 1Y3VA 5C1XA 3MO3A 3LJJA 3BV9B 2UWPA 2SGPE 1LVOA 5EPYA 1S0RA 2A4GA 1LHCH 1W7XH 2TRMA 3NZIA 1EAXA 3UWIA 4IW4E 2BY7X 1BJUA 1BRAA 2F9UA 1ZPBA 4ABIA 1BTHH 2VWNA 2ZGXH 2ANKH 1HRTH 2WUCA 1IHSH 2OTVA 4X8VH 3HGPA 1SLUB 4AFZA 1AVXA 1IAUA 2ZHEH 1V2VT 4I8KA 4MDSA 4K69A 2GVFA 3TNSA 1TA2A 1GBJA 2XC0A 4AB9A 3S69A 2JH6D 3RXTA 3E91A 4JCNA 3F9GA 1HAPH 1Q31A 1SL3A 1O2PA 4JK5A 4Y79A 1TBQH 2W26A 4OS7A 5EU8A 2JKHA 1Y3UA 5SGAE 4K8YA 3MH6A 4OS1A 3ZVDA 4BAQB 4CHAC 4LZ4B 2UUJB 5DK1A 3SNBA 5FX5A 1NTPA 5E0JA 1AB9B 4FUBA 2AFQB 3M37A 2CV3A 1MU8B 1GI6A 1O2HA 1S6HA 1M9UA 1A61H 2Z3EA 1BA8B 3PTNA 2Z9JA 2XWAA 1C5OH 1TNLA 3E90B 1TBRH 2GMTC 1RRKA 1T4UH 1SQTA 3GDSA 4Q80A 2BLVA 3OU0A 5CMXH 5L2ZH 1IQHA 2G5VA 4ZXXH 1EJMA 3VB5A 1KLIH 1XXDA 4CHAB 1DWEH 3Q00A 4M7GA 2ZP0H 4VGCC 1IQEA 4XBCA 3V3MA 3P17H 4NA9H 2EI8A 2SGFE 1PYTD 3ITIA 4BAHB 1H8IH 1GBDA 2QXGA 3RLYH 1GHAG 4A1VA 4DURA 3IITA 3LC5A 2NU4E 2BDYA 1B7XB 4XSKU 1PPCE 1J14A 1UTMA 1TFXA 1SGNE 2RG3A 2QGRA 3SNEA 2ZTZA 4I31A 8LPRA 1SVPA 5T3HA 3PWBA 1SLXB 3UR9A 2ZGCA 4TPYA 1Y3YA 4O9VA 1DY8A 1C5WB 2O8WA 1C2FA 2BD4A 4IN2A 5DP7A 1LCYA 2AH4X 2AGEX 5JDUB 1ZYOA 1BOQA 1ZPZA 1F5KU 1VCPA 2FXRA 3KHVA 4X2YA 5C1UA 4BAOB 2XNIA 1O3EA 1IQKA 3RM2H 4OGYA 1NESE 3KQCA 2FOFA 6GCHG 1N8OC 3ZV8A 2QF3A 4GCHF 3E0NB 4B1TA 1NC6A 1DICA 2ZCKP 1AHTH 3A89A 1AFQC 2G51A 1UCYE 2FP7B 1GBBA 1Z71A 2OBQA 3BEFB 5F8TA 4E06H 3SHCH 1O33A 2C8XB 2Q1JA 3P92A 1K1MA 1XUGA 4NIVA 5BRRE 1TAWA 3A8DA 1W0YH 4TWWA 3BTDE 1W14U 3ZVEA 4YOIA 1YPEH 2GCHF 7KMEH 1ZHPA 3A83A 2HOBA 1B0FA 2P3UB 1AZZA 3UUZA 8GCHG 1AUJA 4BOHA 1CGIE 2DUCA 1MAYA 1TONA 1BIOA 4R8TB 3P95A 1MUEB 2PSYA 1C2MA 2OC8A 3BTKE 3GCTF 2GZ8A 3PO1B 5K7RA 3OTJE 5IDKA 1OS8A 1ELVA 2B9LA 1OWJA 2ESTE 3PROA 1YLCA 2TPIZ 5GXPA 5EQQA 1O2YA 4OS4A 4A6LA 1VITH 1TLDA 1YC0A 4UDWH 4GAWA 1JIRA 2V3OH 1WU1A 3L3TA 1DE7H 1KY9A 1V2KT 1YLDA 1GMHG 1G30B 1XMNB 2EEKA 5DG6A 3KGPA 3MOCA 3LH1A 2STBE 1LKBA 1QRXA 1HLTH 3E16B 4F4OC 1O5CB 1VITF 1ZHRA 3F6UH 4QT8C 3GCOA 4E05H 1E34B 2OC1A 2CN0H 1O2IA 3HK3B 1LO6A 1G3CA 1ZHMA 3LGVA 3S7HB 1UVSH 2VJ1A 1QA0A 1W2KH 2HALA 2Z6BD 5JBCS 1P9SA 2ZQ1A 2CHAC 1O32A 2PKSC 1BBRH 3RXRA 1MKWH 1ETTH 1DPOA 2JETB 1W12U 2R9PA 1GVKB 1IQJA 1P11E 1OWKA 1TX7A 6LPRA 2QF0A 1C5VA 4D7FA 1HUTH 1O2UA 2HVXA 1BTPA 1UTQA 5E2OA 1CT4E 2FLRH 4WF8A 3U8TH 1Y3WA 1J16A 5FCKA 1V2NT 5EODA 2P94A 3BTHE 2ZZUH 1YPHE 1YCPK 2FOAA 2FTMA 2FWWA 1BJVA 1KYNA 2BD3A 1E35B 4NFEA 1A2CH 3DD2H 3ZZ3A 3LDXH 3M3VA 1P12E 3MH7A 3SUFA 1G3BA 5ESTE 3URCA 1W13U 1EZXC 2BHGA 3RXJA 5L2YH 2G00A 2F9NA 1L4DA 1GBLA 2ZGJA 1LHFH 1UTPA 3RC5A 2P3TB 1NZQH 2BMGB 1VCQA 1C5ZB 3SUGA 2ZDVH 1LVBA 2P16A 1UMAH 2FM2A 1A3EH 1DY9A 2FS8A 1P2OA 2XWBI 1OXGA 4ABDA 1FY8E 2IPHA 3A85A 8KME2 3SHAH 3FAOA 1V2TT 1C2DA 2ZKSA 2ANMH 1TBZH 3VPKA 2J38A 3MWIU 1GBIA 4CRCA 2GX4A 4ABGA 2XCFA 3PM3A 1THPB 1O2OA 2ODPA 1BTZA 1NRRH 3SO3A 5DPAA 5JB9S 4X1SU 1ESAA 1MBQA 1EAIA 2R0KA 9ESTA 1KXBA 5AVDA 2ZC9H 2I6SA 3TJVA 1AO5A 2SGQE 4X6OA 1ELDE 1C1SA 1Z7KA 1GI7B 1FQ3A 2O9QA 4U32A 3F9FA 2ZFRH 2O8UA 3LT3A 1TQ7B 1ZZZA 2LNCA 3PTBA 2ZHQH 2HLCA 3RXSA 2IJOB 2H9TH 4B2AA 2C90B 1BHXB 1AE5A 1MTNC 2W3KA 1W7GH 1OOKB 2FYQA 3OY6U 4CR9A 2ZU4A 1A5HA 1F0RA 1A4WH 2PR3A 4JZIA 4JYVH 1XUHA 2SFAA 2WPKS 3QZQA 4WMFA 2PGBB 3RDZA 1O5AB 1P57B 1RFNA 1QQUA 4LK4A 1UTLM 1BTXA 2VIWA 3A7TA 1THSH 3RC4A 3RXKA 4Z0KA 1U6QA 1OPHB 4ZKSU 2OQ5A 2ZGBH 3T25A 1TALA 2VIPA 3BTQE 1AY6H 1VZQH 4CR5A 3AAUA 2PGQB 4B75A 5GDSH 3GICB 2GTBA 3R3GB 1E38B 5BPEA 3A7WA 4Z6AH 1QJ6B 3GY4A 2Z9GA 4J2YB 1QJ1B 3ZYDA 4WXVA 3VGCC 2FPZA 3BEUA 1DSUA 1BHXF 1O2ZA 1SLWB 4NIWA 1O3IA 2FYRA 1HAZB 1MD8A 1PQ7A 3FP6E 4JYUH 4KTCA 3P6ZB 1GJ4H 1PPEE 1SGDE 3A8CA 4KTUA 1J8AA 6CHAC 5EXLA 2BD2A 4JZEH 3VB4A 4X2VA 1K1PA 2QC2A 1NFYA 1K1LA 2WPJS 1O5FH 2KAIB 1SSXA 1ANBA 1NY22 1Z1IA 1H9IE 1O3DA 1AKSA 5A0CA 4AGJA 3K6ZA
chains in the Genus database with same CATH superfamily
4AGKA 1ETRH 2Y5FA 3RLWH 4O97A 2KCYA 1AFEH 2A2XH 3F9EA 1GJ5H 3EA9A 4I8GA 4WWYA 1C2EA 1ZTJA 1P2MA 3UY9A 3I29A 2ODYB 1EZUC 1NU9A 3NPSA 1CVWH 2P95A 4ZCNA 1SFQB 1GJDB 2GCTB 3QWCH 1A1RA 3WY8A 4AC9A 1EXFA 4H4FA 3ATIA 1ELEE 2JJ2D 4UE7H 4D9RA 1QFKH 1O2XA 3SV8A 3A88A 3RU4E 1KDQB 1SHYA 2XCNA 3GY6A 1GBHA 2XBYA 2ZWLH 1S83A 1G37A 4WMEA 3RXGA 1CHGA 1TRNA 2XXLA 4UONA 1T31A 2GDEH 1V2JT 2P8OB 3DCLA 1Y5BT 2A5IA 4E7NA 1QA7A 4YXWD 1GI9B 1XUFA 1BQYA 1AWHB 4MNVA 3IWMA 3SN8A 1GDQA 2A7CA 1GJ6A 4JZFH 4Q7YA 3UOPA 1PJPA 1Q2WA 1D4PB 2GKVE 3K2UA 3FO8D 4Y0ZE 1GJ8B 2EC9H 2BDHA 2AIQA 2BQWB 4INKA 4A92A 3SJKA 2YNBA 3I77A 3UIRA 2YMSC 2C3SA 2QXJA 2EI7A 3M5OA 7ESTE 2AERH 2F9VA 1T32A 2GD4B 3CNRA 2G81E 4OGXA 3B9FH 1SQRA 1Y8TA 1ZTKA 2P8OC 1AVGH 3DT0H 4I86A 1YF4A 1BMLA 5C3NA 4SGBE 3RXDA 3OEED 4X6NA 2F83A 3KIDU 2D8WA 1O38A 2UUKB 4VGCB 3TK9A 4CBOA 2BVSH 2HLDD 2H1UA 1HAHH 2VWMA 1J15A 2XTTB 4FUGA 2ZFTA 1P8VC 1RIWB 3UQOA 3ZZ5A 1QRWA 2V6NA 3M36A 3RC6A 2JJ1D 5HMAA 3SNCA 2G5NA 3GS9A 2ZO3H 3SJ9A 5I25A 1H8ED 1S6LA 4HG6A 3GDUA 1O2RA 1HIAB 3JZ2B 1C2HA 1XUKA 1GMCF 4TT3D 3M5NA 3UNQA 2F9PA 4ISOA 3BTWE 1ZSLA 1LHGH 1QGFA 2A32A 4NFFA 1AB9C 1SR5C 1WSSH 4ISIH 4KKDA 1TA6A 1ELGA 3OY5U 1WUNH 4ABFA 1XM1A 2HWLB 4RKJB 1ANEA 5FX6A 4WH6A 2H9HA 2FI5E 2ZCLP 2PHBA 3GCNA 3OE7D 1GI8B 4MQAA 3STIA 1MKXK 1ZJDA 2OC7A 4NA7A 3UR6A 1C1WH 3SUDA 3O8RA 1P2NA 1GCTC 4XBDA 2VVCA 4AFQA 3VGCB 1GHXH 1YPGH 4FOUC 5FPTA 1N1LA 4B73A 4ZAEA 1CE5A 1BTUA 2BLOA 1QCPA 2VU8E 2QA9E 1EP6A 1NPMA 1C5LH 1OWHA 2BZ6H 4B6FA 3V13A 1QB1A 1O2GH 1Z1JA 3QN7A 2STAE 4X1NU 1A7SA 3RXUA 1YM0A 1LQEA 1QURH 3RXPA 3LJOA 3KQ5A 1CO7E 3P8OA 3O8CA 1QIXB 3QGNB 2VIVA 4B71A 3R0FA 3SU4A 1YYY1 4Q7XA 3HGNA 1O5BB 3ZZ6A 1OKXA 3WWFA 1L1NA 1DDJA 3PV5A 1GGDB 1GVZA 3MNSA 1AMHA 1O2LA 1MTUA 5H4IB 1O2NA 1JWTA 4P00A 1LTOA 3S7KB 1WBGB 2ZU5A 4NCYA 1ZLRA 1GG6C 3LC3A 3GY2A 5IYTA 1AI8H 4D7GA 1O35A 4YT7H 1IHTH 3V7TA 3AASA 4UD9H 3Q3XA 1P09A 1QL7A 2B0FA 3ZZ7A 1UCYH 1MBMA 2GV6A 4BANB 1KLTA 3PMHB 4CH8B 3STJA 1AWFH 1V2RT 1GHBG 2QN5T 3AK5A 1D3PB 1L1JA 1WV7H 1HPGA 1XVMA 4IN1A 3BG4C 5JYIA 2FI4E 1TNIA 1INCA 1Z8RA 4DY7B 3E0PB 1NRNH 2PKAA 2C93B 1K0HA 5KEDA 1MU6B 3ELAH 1OWEA 2KCAA 4TSFD 1SHHB 2WYGA 3ATMA 1Y3XA 3OTPA 5HYOA 3TJNA 3U28C 1S0QA 2VWLA 4Y0YE 4H6TA 4ABJA 1QB9A 2ANYA 1TOCB 3TK6A 1IOEA 1F0SA 2A4RA 2TBSA 1FONA 3LIWA 1YPJH 1C5SA 2GT7A 1LMWB 3C1KA 1HB0B 1EJNA 5A0BA 2LELA 3MNBA 3FFGA 2NU3E 2PTNA 1EASA 1H9HE 1K22H 1O3CA 1YKTA 2Y80A 2YMSB 5JBBS 4F48B 1TNJA 1HAVB 4Y7BA 5EJ1A 2C8WB 3MU0A 2BVXH 4CRDA 4KELA 5K0HA 1OP0A 3F0PA 4K1TA 5JPMH 1FV9A 3QX5H 3T2NA 4JYTA 3AVZA 1HJAB 2BQ6B 3BG4B 1TMBH 1YPHC 2BDBA 1MKWK 1FNIA 2JIZD 4FUIA 3AW1A 7LPRA 1VJ9U 2FOCA 3NXPA 1S6FA 4FVDA 4UFGH 1P02A 5GIBA 2WPHS 3VXEH 2BX3A 1BBRE 1C5TA 3ENSB 1AN1E 3TPIZ 4AORA 1XUIA 2OUAA 3OX7U 2R3YA 1G3EA 1FDPA 4B6EA 1GBFA 3RXBA 1FIZA 3VB3A 3N7OA 2O8TA 1TE0A 4AYYB 1WCZA 2JETC 1MCTA 3P8GA 1NFWA 2ZU1A 2ZDMA 1FY5A 4Y11E 5HIYA 1GDNA 3DFJA 2ILNA 3P70B 2ZTYA 1UVUH 3TLOA 3U9AH 4X8UH 5T6DA 5C17A 1EKBB 2ALVA 2H2ZA 3HKJB 2XBVA 3BTTE 5F8XA 3PV2A 3E8LA 1Z8IB 2HPQH 1NBMD 1QHRB 4MNWA 4IBLH 3LONA 4D76A 1WQSA 1SQOA 2BTCE 3MYWA 1BT7A 3QUMP 1THRH 1DUEA 2KAIA 1HFDA 4ASUD 1MZAA 3KL6A 1ZGIA 1LHDH 2DE9A 2R2MB 1N8OB 1ZSKA 2B5TB 3GY5A 4O3TA 3W95A 1FI8A 1C2LA 3E3TA 1HYLA 3AAVA 1GI5A 1O36A 1SPJA 2BDIA 2J92A 1VGCB 4ZKNU 2XBWA 2F9BH 5AHGH 2H6MA 1GCTB 2OXSA 2VGCC 5L30H 2JH0D 4YLUA 1YP9A 2EA3A 5C94A 1P3CA 1SFIA 4I8LA 3ZYEA 4CRFA 2Q6FA 1VITG 4B2CA 4BXWA 1ELBA 5DJ7A 5ESBA 3EA7A 4ZHLU 1SC8U 2OQUA 4ABHA 1SGQE 3M7TA 2CF8H 3RM0H 1KTSB 3F0OA 2BXTH 1ARBA 1G32B 1C4Y2 2ZHFH 2B8OH 1BZXE 4X2XA 2Y5HA 1OHHD 2FLBH 1DOJA 1PPBH 1V6DA 1KDQA 1G9IE 3P8FA 5AFYH 3RU4T 1W0JD 2ZHWH 2F9OA 2CMYA 1DT2A 1H8HD 2VNTA 1NU7B 1EJAA 5J4SA 3T29A 1L2EA 2H5CA 2Z3CA 2M2AA 5LPRA 2R2WU 1EAUA 1MH0A 5A09A 1D3TB 4CREA 1GDUA 1S81A 5I46H 3FKSD 1WTGH 1K1IA 2OC0A 1BB0B 1YPKH 2W5EA 2XC4A 4HGCA 4BTTB 4UFDH 2GCHG 2CK3D 2VIDA 1V2MT 4HFPB 1BITA 1NRQH 2QF4A 4I8JA 3BSQA 1S5SA 3T5FH 5CHAC 3SZNA 1BCUH 2ZQ2A 1E0FD 1H8DH 3LGIA 1EPTB 1OP2A 1TMUH 3ZVAA 2RCEA 3VB7A 1ANDA 5GWZA 2PFEA 2FODA 1BRCE 4K1EA 4IS5A 2V7QD 1IQGA 2PUQH 3K65B 1E1QD 2SGDE 1Y5UT 3LOXA 4I33A 8ESTE 3KN2A 1BDAA 2Z7FE 3EE7A 3ESTA 4MNYA 1W3CA 1XUJA 1Y5AT 6GCHF 1BMMH 2ZEBA 1NS3A 3UOUA 4U01A 2R0LA 4FU8A 1CBWB 1NO9H 1O2WA 1P2IA 1D9IA 1O31A 1ACBE 3CS0A 3D23A 3GCHC 4TY6A 2G8TA 4X8SH 5DP3A 5FL7D 1O5GH 1BRBE 1SGIB 2G4TA 2PSXA 1C5MD 5PTPA 3RP2A 1SGFA 3MU5A 1BBRK 4YZUA 2BD7A 3MO9A 4U30A 4ZKRU 3MH4A 3BF6H 4MLFB 2FOBA 1EZSC 1C5YB 3ATLA 3CS7A 1UTOA 3Q77A 3MH5A 1FXYA 3QTVH 2BY9X 2OCVB 3UQVA 2GZ9A 3QTOH 4AOQA 4ACAA 5C67A 5JBTA 3W1EA 1UK4A 2FOGA 1G2LA 3QK1A 4B2BA 1YY3A 3MHWU 1BTYA 1PPZA 2BD5A 3SUEA 1GBEA 1DLEA 2BY8X 1JRTA 1T8LA 1O2TA 4YESB 1QBNA 2EI6A 3DSGA 4DOQA 1XKAC 3PRBA 1BMNH 1HAIH 1LDTT 2K8IA 1O2JA 3ZZAA 1EQ9A 1CT0E 1TPAE 1SI5H 2BD8A 1HAOH 1C1TA 6CHAB 1SBWA 2F4LA 1FAKH 3PMJA 3S9AA 1H9LB 3L6PA 1JBUH 2SNVA 2QXHA 5C20A 1AE8H 2PKSB 4XBBA 2VGCB 1MTWA 1O3AA 3U8RH 4M9FA 1CT2E 3O8BA 4Y8XA 2OINA 2UWOA 1C2JA 1A46H 3SGAE 2C4FH 4HZHA 5LH8A 3PO1C 3T28A 2W6JD 2FO9A 4Y8YA 5JB8S 2OBOA 3T62A 2Z9IA 3GISB 4NSYA 5DP4A 3TK5A 2L6OA 3EGKH 3U69H 2Y81A 5CDFE 1EAWA 1IQMA 7GCHF 4K8BA 4K5ZA 1TNKA 1C1VH 2BX4A 5HXFA 1O37A 4YO9A 1TX6A 5A8YA 5T1VA 1SGRE 1UVPA 1W11U 4U2WA 2EQNA 1GBMA 1TX8A 3EYDA 3WW7A 1SKYE 3MNXA 1WYKA 3HKIB 1FZZA 1T8NA 2Y5GA 4MTBA 3QDZB 1F5RA 1TGSZ 3H5CB 3SGQE 1CGJE 4ABBA 3D62A 4TPIZ 3A81A 1EP5A 5E0HA 1GG6B 1O3OA 2PV9B 4JZDH 2C8YB 2O8MA 2TIOA 1J9CH 1P0SH 3A7YA 3A7XA 1W0ZU 3LH3A 1GI3A 3KYGA 3DSOA 3RMNH 4LOYH 2PW8H 1FUJA 1ELFA 1F2SE 4ZMAH 3SU0A 2WHXA 1C2KA 4GPGA 2XW9A 5DN6D 2P59A 1JMOH 4HTCH 3GCHB 3Q3YA 3PRDA 2XBXA 1C2IA 1H4WA 1PPHE 1LVYA 5EJZA 2FTLE 3PYHA 1PQ5A 1NFXA 1V2UT 4FUJA 5TCAA 1G2MA 1PFXC 1UO6A 2BDGA 2ZFPH 3RUOA 1AFQB 3OSYA 1D6RA 3S9BA 1HJ9A 4OS6A 2XNDD 1CA8B 1E36B 2BDCA 4Q2KA 1K1JA 2G4UA 1D3QB 1C1NA 2SNWA 1ZR0A 1KMHB 3H7OA 4ISLA 1FY3A 2QV1A 1IQLA 1CA0C 4I7YH 3KCGH 1GWAA 1ABJH 5CHAB 2TGTA 1NM6A 1O34A 1KTTB 1P3EA 1TOMH 2AYWA 2V35A 2ZU2A 3LPRA 1MAXA 2ZGHA 2VIQA 2VWOA 2BY5X 1KIGH 1EOJA 3FN8A 1UTNA 1KXEA 1O39A 1VKYA 1SQAA 2ZPSA 1V2ST 1ETSH 1FPHH 1ZOMA 1ZJKA 3GOVB 1TGCA 1GBAA 1DXWA 4UEHH 2J95A 1HCGA 4ISNA 4XDEA 1YCPH 3FZDA 5GCHG 1OWDA 4HI3A 2J98B 5EXMA 2HNTC 3PLKA 4BAMB 3HPTB 1YPMH 2A4OA 4NSVA 1MQ6A 5DKMA 1C9TA 3LU9B 3FANA 2WPLS 2GT8A 3WWBA 2GDDA 3M61U 1A0JA 3TGIE 3U1JB 3RXHA 1FN8A 1SGCA 2BXUH 4AN7A 1UJ1A 3TVJB 1O3PB 2A7JA 4CBNA 1FPCH 1A3BH 3NK8A 2NU2E 4RI0A 1DFPA 1ANCA 2NU0E 3ZVFA 4ASHA 1K1NA 1C1OA 3D49H 1ELTA 1C5UA 1GI1A 3RXIA 1GL1A 2P3FH 4FUFA 3A7ZA 4K3JA 5C5OA 1GGDC 3KYFA 1S84A 2VH0A 2J5UA 1HAYB 4X1PU 2OK5A 5DO4H 4AX9H 3TH3H 4NWKA 4BAKB 3PMBB 1GHBF 3SU5A 1ZTLA 2BQ7B 1TPSA 2RA3A 2AMQA 3FVFB 2FOHA 2KCPA 3H7TA 2FMJA 5HGGA 5DP9A 4Y6DA 2J97A 1LHEH 1CQQA 1GHYH 1QZ8A 2IPQX 1TMTH 3SU3A 1UK2A 1OX1A 2FI3E 2YNAA 1GJ9B 4INLA 4KTSA 1JOUB 1ID5H 1N6XA 3EAJA 4CRAA 3KQBA 2XOKD 8GCHF 4BNRA 3ZVBA 1LPKB 3UNSA 1HDTH 1AD8H 4IGDA 1AGJA 4NWLA 2Z3DA 1C4V2 1EB1H 3ZIAD 5ETXA 1GI4A 1FY1A 4AG2A 4ABAA 5L6NH 1CA0B 5FCRA 1KXCA 2F43B 2VH6A 3GYMA 5C0TA 1V2OT 3RXVA 1EX3A 5DGJA 1DLKB 5A8ZA 1FLEE 3BN9A 3GY8A 1QL8A 4ZUHA 1SMFE 1CSOE 1OYTH 1SGYE 3KEEA 3M5LA 5T6FA 2Z9LA 4KP0A 1P04A 5B6LA 2SGAA 4YOGA 2ZHDA 4RN6A 1B5GH 3RU4D 1GHVH 2GCTC 5LPEA 4Y7AA 1FN6A 3NCLA 3SV7A 2NWNA 4Y76A 3V12A 4JZ1A 1L0ZA 2RA0A 2Z9KA 1O3HA 3TU7H 3ZVCA 3SW2B 2A5KA 2QCYA 4Y8ZA 4DG4A 2QXIA 4K1SA 2ZECA 1ARCA 1F0TA 1S82A 1BMAA 4D8NA 3TJOA 3QLPH 4H6SB 4DJZB 2VINA 3MU8A 4NGAH 1AIXH 5EQSA 3UNRA 1VJAU 5F03A 1NRSH 1QBVH 3SV6A 2A7HA 3D65E 1TNHA 1SOTA 1XKBC 1Z8GA 5FHTA 2ASUB 4FUCA 2DE8A 1T8MA 5JBAS 1QRZA 5GPIB 2ZPQA 1K1OA 2ZA5A 3MNCA 2LPRA 1GMCG 1C1MA 2IOTA 3TJUA 4KGAA 3G01A 4IC6A 4OS5A 1HJAC 4YM9A 4FVBA 4X2WA 1C1QA 1GBKA 1F92A 1MD7A 3DFLA 3A80A 3MO6A 3RXCA 1G36A 3LGYA 3BEIB 3BG8A 5C5NA 1FAXA 2BLQA 1P2JA 1ZRKA 2HGTH 2KR7A 1RJXB 1UTJA 1XXFA 2Y6TA 2SGEE 2ODQA 1G3DA 1DUAA 5EOKA 3E1XB 1HGTH 1V2WT 1DWCH 3LGTA 3PV4A 2NU1E 4A1XA 4J1YA 1K21H 5DP8A 4BTIB 2WINI 3DSPA 1YBWA 3RXOA 1LVMA 2PUXB 1F7ZA 4FU9A 5DSFA 4MG3A 2UWLA 2WV4A 4K2YA 3C27B 3BTGE 1K28D 1QJ7B 1ZGVA 2CGAA 4TWYA 1TPOA 2ZDLA 1T7CA 1O2KA 2GMTB 3PMAB 1V2QT 2Y82A 3F2HA 3ODFA 5HM2A 3LKWA 4ABEA 4FETA 1HBTH 5EPNA 3E6PH 3NUMA 3RMOH 2VVUA 1O3NA 2TGDA 1TABE 2A0QB 3TGJE 1NRPH 4R0IA 4NG9H 5FBIA 4YOJA 1EPTA 3M7QA 3EE0B 9LPRA 2OP9A 5EW1H 1CHOG 2AEIH 1C9PA 4YTAA 1O2SA 1SGEE 3ZZ8A 4Q7ZA 4WH8A 2WUBA 1MCVA 1NROH 3ATKA 4ZXYH 2GZ7A 2G55A 5E2PA 3UPEA 4Q4LA 4F55A 2WPMS 2HRVA 3GDVA 2TGAA 4BXSA 5KECA 3OEHD 3O8DA 2IN2A 1C1PA 2HPPH 2UUYA 2GP9B 5B6OA 2ZFSA 1DANH 3B23B 4O03A 3U1IB 1QQ4A 5CHBA 1O5DH 1WTHD 1OWIA 2TGPZ 1YPLH 1TWXB 4X6MA 4A5TS 1ZRBA 3VEQB 4NZLA 1QB6A 2BZAA 4RT0A 1O2VA 1L1GA 2FZZA 3MQKC 2KZ4A 1ZPCA 3RXLA 1DM4B 2JDID 1SGFG 3F2GA 3MU1A 1LKAA 5ABWA 3CP7A 1O3KA 2WV9A 2HNTF 1UHBB 5HM9A 3MFJA 1ZSJA 3SORA 1E79D 5J4QA 3EA8A 1EB2A 3A84A 1RIWC 5IK2D 3M5MA 2G52A 7GCHG 1O3LA 5E0GA 1C4U2 1S85A 2PTCE 3TITA 1PPFE 5F8ZA 2A5AA 2ZCHP 5FBEA 1C5NH 4XE4A 2PKAB 3F1SB 1YCPM 2AHME 2O8LA 5EQRA 2RDLA 1GI0A 3A82A 1O2MA 2A1DB 2RDEA 3SU2A 3BIVH 3VB6A 2THFB 4B74A 1C5RA 3ZZ9A 3DA9B 5T6GA 1IQFA 2ZDAH 1C5PA 3SQEE 3HATH 2FX6A 3RXFA 1A0LA 1UHBA 1E37B 1BTWA 2KFWA 2VIOA 1LPZB 3UTUH 1YGCH 4DGJA 3PLBA 4O3UA 2ANWA 1X7AC 1O3FA 4TYDA 1GMDG 3A8BA 1P06A 3FP7E 3SNDA 1DITH 1HAXB 1QY6A 3MTYA 5C2ZA 2M5TA 4DT7B 2ZNKH 1Z6JH 3VXFH 5LGOA 5CE1A 1P03A 1OP8A 1TB6H 4ESTE 1HIAA 3K6YA 1JRSA 1VCWA 3SJIA 1TPPA 2J98A 5DP5A 1B0EA 4MPVA 1MZDA 1EOLA 3ATWA 1GBCA 4DVAU 1JIMA 2BLWA 4X6PA 2BY6X 1HXFH 4Y71A 2W3IA 5G4BA 1XVOA 2JH5D 2PP6A 1P01A 4UFFH 3TH2H 5C1YA 2W7UA 2J94A 4GHTA 5EW2H 1GL0E 1L4ZA 3QGJA 5FAHA 1H1BA 5TJXA 4YLQH 2R3UA 2D26C 3KQEA 1QR3E 3SV9A 3N99A 1SGTA 3QO6A 1HXEH 4D9QA 5GJ4B 1N6YA 4CRBA 3ZZDA 1RTFB 4ZH8A 5TCCA 3FZZA 2FEQH 4X0WU 3RMMH 3UFAA 3SI4H 2Z94A 3NRLA 4ZROA 1DVAH 3SOSA 1AUTC 3UWJH 1BRUP 1CHOF 4JMYA 4IMQA 1W10U 4FU7A 3ZVGA 1SG8B 2FIRH 3OYPA 3RXAA 2WPIS 3SV2H 1TGTA 2J9NA 1RD3B 2PWXA 3ODDA 3F68H 1TQ0B 2LP6A 1ELAA 2ZDKA 3CENA 3F3BA 3PB1E 2Y7XA 3K9XB 4BTUB 3BIUH 2I6QA 1C5XB 1ZMNA 2F91A 3P8NA 2ALPA 1KXDA 4X1QU 3FP8E 1A5GH 3TNTA 1CBWC 1EFRD 1PQ8A 2ZU3A 3ZZCA 1VR1H 3KF2A 1DXPA 3U98H 1O2QA 1BUIA 1O0DH 3B8JA 3UREA 3MMGA 4DIIH 2FOMB 3I78A 1MTSA 4ZHMU 5AFZH 4FUHA 1ORFA 4YT6H 4XD7D 2BDAA 4X8TH 1GVLA 3NKKA 5F6MA 4NIYA 2BB4A 1Q3XA 3SJOA 4XOJA 3BTME 4GSOA 1V2PT 2VVVA 2QAAA 3S9CA 3AW0A 4CH2B 1AQ7A 2K1QA 2FESH 4I32A 1HNEE 1Y59T 1PPGE 1C1RA 2OD3B 3URDA 1QNJA 2CXVA 1DWBH 4ISHH 2AGIX 1RGQA 3QZRA 2K0QA 3W94A 1FY4A 3A87A 1A5IA 1GMHF 2AGGX 1GJCB 1FIWA 1K2I1 4AZ2B 1TRYA 1DWDH 1WDIA 1DS2E 1SLVB 2UUFB 3SZEA 2BVRH 1ESTA 4K60A 4RKOB 1TGNA 4AFSA 1FJSA 1TYNA 2A2QH 3RMLH 2ZIQH 4AFUA 1GBTA 4WVPE 3BTFE 4AG1A 2AMDA 4WJG2 1P05A 1SOZA 4LXBH 4WMDA 4NZQA 1GPZA 2YOLA 1Z6EA 3SU1A 3GY7A 1KLJH 3GCTG 1V3XA 1Z8JB 1O3MA 5EGMA 1RXPA 1O3BA 1AKSB 1AVWA 1UK3A 1MTNB 1P9UA 1K9OE 2W7SA 4P02A 4MVNA 1KXAA 1MQ5A 1NT1A 1HAVA 2FDAA 3M3TA 2WV5A 2AS9A 5EG4A 3TIUA 3SGBE 1CU1A 1W8BH 4ZHAA 4SGAE 1O3JA 4TY7A 1GJ7B 1KXFA 5FPYA 4MPWA 3EQ0H 1AZ8A 2QY0B 2QYIA 3T26A 2F3CE 4IMZA 3ZZBA 1FX0B 4DIHH 1O30A 1NBME 2HVYB 1HV7A 2AIPA 1UTKA 3GYLB 3TH4H 2FX4A 1DX5M 4RSPA 1JXPA 3LGUA 1DSTA 1T8OA 5FPSA 4GVUA 2J34A 4AB8A 3M7UA 3N7DA 1ELCA 4GCHG 2B7DH 2CF9H 2V3HH 5FXLA 1ESBA 2H9EH 3S0NA 2ZPRA 1EPTC 2BD9A 1PQAA 3M35A 4A1TA 3GY3A 4MPUA 3RXQA 3U8OH 1EUFA 4LZ1H 2D1JA 1GJBB 4IC5A 4A7IB 2BOKA 1ZMLA 2XRCA 4Y10E 2Q6DA 4DCDA 3HK6B 3KNXA 1WAYB 2KM0A 1P10A 2C8ZB 1GHZA 1J17T 2ULLA 4I8HA 2V0BA 1LQDB 2AMPA 1OYQA 5A8XA 2FS9A 3LGWA 1O3GA 5GNDA 1IQIA 2ZF0H 3JZ1B 4FXGH 4INHA 2BOHB 4WY3A 2ZDNA 4E7RG 1TNGA 4XFQA 3SBKA 4GLYA 3MU4A 1GHAF 1GI2A 3SQHE 3Q3KA 1ABIH 5LPFA 1WQVH 1QBOA 1HAGE 2HNTE 4WXIA 3PWCA 4DW2U 1D3DB 4X1RU 3PLPA 3N7EA 4UFEH 2A31A 3SI3H 4THNH 2ZI2H 1TGBA 4AYVB 1C5QA 2FOEA 3MI4A 1RS0A 6ESTA 1V2LT 1UCYK 4FUDA 4JK6A 3T27A 5DP6A 1GMDF 1AU8A 2A45B 4NA8A 5AF9H 1GCDA 5E8EH 3H09A 4F49A 2GJGA 2BM2A 4B76A 5A2MH 3VFEA 4CRGA 1FMGA 1BMFD 1ZMJA 1SB1H 3ZZ4A 1GHWH 2WYJA 2CHAB 1VGCC 1HJ8A 1UVOA 3Q76A 5HKKD 1XX9A 2P93A 2XC5A 1C2GA 3L33A 3M3SA 4MNXA 3NWUA 1D6WA 1QL9A 2OLGA 4XRNA 1MKXH 1C1UH 4DT4A 1A0HB 5EXNA 3KQDA 1NN6A 5GCHF 3RXEA 2D2DA 2ZFQH 1MMJN 3F9HA 2ZTXA 1UW7A 2Q6GA 1P2QA 1CGHA 3EDXB 1WOFA 1GJAB 1LPGB 3TGKE 3A86A 1UVTH 2ZG0H 4FUEA 1MTVA 2PLXA 1SGPE 4GHQA 3V0XA 3SU6A 1TRMA 1TIOA 2QIQA 1OSSA 2Y7ZA 2BYAX 3DHKH 1NFUA 2A4QA 2J4IA 2XYAA 4H42U 3SNAA 1F0UA 1F5LA 4ACBA 1O5EH 3RXMA 4PROA 1EZQA 5A0AE 4ZKOU 1RTKA 1QTFA 2GGVB 4MPXA 1YLNA 2J2UA 3BTEE 4GUXA 3SJ8A 1RTLA 1EATA 1PYTC 1P2KA 2GV7A 3IG6B 2ZFFH 2VB0A 3DUXH 4OS2A 2H5DA 1T4VH 3ZV9A 3A7VA 1KSNA 1IQNA 2VBCA 2CJIA 3A8AA 4NIXA 1Y3VA 5C1XA 3MO3A 3LJJA 3BV9B 2UWPA 2SGPE 1LVOA 5EPYA 1S0RA 2A4GA 1LHCH 1W7XH 2TRMA 3NZIA 1EAXA 3UWIA 4IW4E 2BY7X 1BJUA 1BRAA 2F9UA 1ZPBA 4ABIA 1BTHH 2VWNA 2ZGXH 2ANKH 1HRTH 2WUCA 1IHSH 2OTVA 4X8VH 3HGPA 1SLUB 4AFZA 1AVXA 1IAUA 3UB0A 3VG8A 2ZHEH 1V2VT 4I8KA 4MDSA 4K69A 2GVFA 3TNSA 1TA2A 1GBJA 2XC0A 4AB9A 3S69A 2JH6D 3RXTA 3E91A 4JCNA 3F9GA 1HAPH 1Q31A 1SL3A 1O2PA 4JK5A 4Y79A 1TBQH 2W26A 4OS7A 5EU8A 2JKHA 1Y3UA 5SGAE 4K8YA 3MH6A 4OS1A 3ZVDA 4BAQB 4CHAC 4LZ4B 2UUJB 5DK1A 3SNBA 5FX5A 1NTPA 5E0JA 1AB9B 4FUBA 2AFQB 3M37A 2CV3A 1MU8B 1GI6A 1O2HA 1S6HA 1M9UA 1A61H 2Z3EA 1BA8B 3PTNA 2Z9JA 2XWAA 1C5OH 1TNLA 3E90B 1TBRH 2GMTC 1RRKA 1T4UH 1SQTA 3GDSA 4Q80A 2BLVA 3OU0A 5CMXH 5L2ZH 1IQHA 2G5VA 4ZXXH 1EJMA 3VB5A 1KLIH 1XXDA 4CHAB 1DWEH 4RT1A 3Q00A 4M7GA 2ZP0H 4VGCC 1IQEA 4XBCA 3V3MA 3P17H 4NA9H 2EI8A 2SGFE 1PYTD 3ITIA 4BAHB 1H8IH 1GBDA 2QXGA 3RLYH 1GHAG 4A1VA 4DURA 3IITA 3LC5A 2NU4E 2BDYA 1B7XB 4OM9A 4XSKU 1PPCE 1J14A 1UTMA 1TFXA 1SGNE 2RG3A 2QGRA 3SNEA 2ZTZA 4I31A 2YMSD 1SVPA 5T3HA 8LPRA 3PWBA 1SLXB 3UR9A 2ZGCA 4TPYA 1Y3YA 4O9VA 1DY8A 1C5WB 2O8WA 1C2FA 2BD4A 4IN2A 5DP7A 1LCYA 2AH4X 2AGEX 5JDUB 1ZYOA 1BOQA 1ZPZA 1F5KU 1VCPA 2FXRA 3KHVA 4X2YA 5C1UA 4BAOB 2XNIA 1O3EA 1IQKA 3RM2H 4OGYA 1NESE 3KQCA 2FOFA 6GCHG 1N8OC 1COWD 3ZV8A 2QF3A 4GCHF 3E0NB 4B1TA 1NC6A 1DICA 2ZCKP 1AHTH 3A89A 1AFQC 2G51A 1UCYE 1MABB 2WZQA 2FP7B 5EJLA 1GBBA 1Z71A 2OBQA 3BEFB 5F8TA 4E06H 3SHCH 1O33A 2C8XB 2Q1JA 3P92A 1K1MA 1XUGA 4NIVA 5BRRE 1TAWA 3A8DA 1W0YH 4TWWA 5EIYA 3BTDE 1W14U 3ZVEA 4YOIA 1YPEH 2GCHF 7KMEH 1ZHPA 3A83A 2HOBA 1B0FA 2P3UB 1AZZA 3UUZA 8GCHG 1AUJA 4BOHA 1CGIE 2DUCA 1MAYA 1TONA 1BIOA 4R8TB 3P95A 1MUEB 2PSYA 1C2MA 2OC8A 3BTKE 3GCTF 2GZ8A 3PO1B 5K7RA 3OTJE 5IDKA 5KGOA 1OS8A 1ELVA 2B9LA 1OWJA 2ESTE 3PROA 1YLCA 2TPIZ 5GXPA 5EQQA 1O2YA 4OS4A 4A6LA 1VITH 1TLDA 1YC0A 4UDWH 4GAWA 3UAIC 1JIRA 2V3OH 1WU1A 3L3TA 1DE7H 1KY9A 1V2KT 1YLDA 1GMHG 1G30B 1XMNB 2EEKA 5DG6A 3KGPA 2WSSD 3MOCA 3LH1A 2STBE 3FOAA 1LKBA 1QRXA 4Q63A 1HLTH 3E16B 4F4OC 1O5CB 1VITF 1ZHRA 3F6UH 4QT8C 3GCOA 4E05H 1E34B 2OC1A 2CN0H 1O2IA 3HK3B 1LO6A 1G3CA 1ZHMA 3LGVA 3S7HB 1WXRA 1UVSH 2VJ1A 1QA0A 1W2KH 2HALA 2Z6BD 5JBCS 1P9SA 2ZQ1A 2CHAC 1O32A 2PKSC 1BBRH 3RXRA 1MKWH 1ETTH 1DPOA 2JETB 2KCOA 1W12U 2R9PA 1GVKB 1IQJA 1P11E 1OWKA 1TX7A 2QF5A 6LPRA 2QF0A 1C5VA 4D7FA 1HUTH 1O2UA 2HVXA 1BTPA 1UTQA 5E2OA 1CT4E 2FLRH 4WF8A 3U8TH 1Y3WA 1J16A 5FCKA 1V2NT 5EODA 2P94A 3BTHE 2ZZUH 1YPHE 1YCPK 2FOAA 2FTMA 2FWWA 1BJVA 1KYNA 2BD3A 1E35B 4NFEA 1A2CH 3DD2H 3ZZ3A 3LDXH 3M3VA 1P12E 3MH7A 3SUFA 1G3BA 5ESTE 3URCA 1W13U 1EZXC 2BHGA 3OAAD 3RXJA 5L2YH 2G00A 2F9NA 1L4DA 1GBLA 2ZGJA 5F53A 1LHFH 1UTPA 3RC5A 2P3TB 1NZQH 2BMGB 1VCQA 1C5ZB 3SUGA 2ZDVH 1LVBA 2P16A 1UMAH 2FM2A 1A3EH 1DY9A 2FS8A 1P2OA 2XWBI 5HIZA 1OXGA 4ABDA 1FY8E 2IPHA 3A85A 8KME2 3SHAH 3FAOA 1V2TT 1C2DA 4Z1MD 2ZKSA 1E1RD 2ANMH 1TBZH 3VPKA 2J38A 3MWIU 1GBIA 4CRCA 2GX4A 4ABGA 2XCFA 3PM3A 1THPB 1O2OA 2ODPA 1BTZA 1NRRH 3SO3A 5DPAA 5C0UA 5JB9S 3SYJA 4X1SU 1ESAA 1MBQA 1EAIA 2R0KA 9ESTA 2RFKC 1KXBA 5AVDA 2ZC9H 2I6SA 3TJVA 1AO5A 2SGQE 3OFND 4X6OA 1ELDE 1C1SA 1Z7KA 1GI7B 1FQ3A 2O9QA 4U32A 3F9FA 2ZFRH 2O8UA 2V3MA 3LT3A 1TQ7B 1ZZZA 2LNCA 3PTBA 2ZHQH 2HLCA 3RXSA 2IJOB 2H9TH 4B2AA 2C90B 1BHXB 1AE5A 1MTNC 2W3KA 1W7GH 1OOKB 2FYQA 3OY6U 4CR9A 2ZU4A 1A5HA 1F0RA 1A4WH 2PR3A 4JZIA 4JYVH 1XUHA 2KX4A 2SFAA 2WPKS 3QZQA 4WMFA 2PGBB 3RDZA 1O5AB 1P57B 1RFNA 1QQUA 4LK4A 1UTLM 1BTXA 2VIWA 3A7TA 1THSH 1YWUA 3RC4A 3RXKA 3F2FA 4Z0KA 1U6QA 1OPHB 4ZKSU 2OQ5A 2ZGBH 3T25A 1TALA 2W6ID 2VIPA 3BTQE 1AY6H 1VZQH 4CR5A 3AAUA 2PGQB 4B75A 5GDSH 3GICB 2GTBA 2WPDD 3R3GB 1E38B 5BPEA 3A7WA 4Z6AH 1QJ6B 3GY4A 2Z9GA 4J2YB 1QJ1B 3ZYDA 4WXVA 3VGCC 2FPZA 3BEUA 1DSUA 1BHXF 1O2ZA 1SLWB 2IJD1 4NIWA 2QE7D 1O3IA 2FYRA 1HAZB 1MD8A 1PQ7A 3FP6E 4JYUH 4KTCA 3P6ZB 1GJ4H 1PPEE 1SGDE 3A8CA 4KTUA 1J8AA 6CHAC 5EXLA 2BD2A 4JZEH 3VB4A 4X2VA 1K1PA 2QC2A 2EY4C 1NFYA 1K1LA 2WPJS 2L74A 2KAIB 1O5FH 1W0KD 1ANBA 1NY22 1SSXA 1Z1IA 1H9IE 1O3DA 1AKSA 5A0CA 4AGJA 3K6ZA
chains in the Genus database with same CATH topology
4AGKA 1ETRH 2Y5FA 3RLWH 4O97A 1AFEH 2A2XH 3F9EA 1GJ5H 3EA9A 4I8GA 4WWYA 1C2EA 1ZTJA 1P2MA 3UY9A 3I29A 2ODYB 1EZUC 1NU9A 3NPSA 1CVWH 2P95A 1SFQB 1GJDB 2GCTB 3QWCH 1A1RA 3WY8A 1EXFA 4H4FA 3ATIA 1ELEE 4UE7H 4D9RA 1QFKH 1O2XA 3SV8A 3A88A 3RU4E 1KDQB 1SHYA 2XCNA 3GY6A 1GBHA 2XBYA 2ZWLH 1S83A 1G37A 4WMEA 3RXGA 1CHGA 1TRNA 2XXLA 4UONA 1T31A 2GDEH 1V2JT 2P8OB 1Y5BT 2A5IA 4E7NA 1QA7A 1GI9B 1XUFA 1BQYA 1AWHB 4MNVA 3IWMA 3SN8A 1GDQA 2A7CA 1GJ6A 4JZFH 4Q7YA 3UOPA 1PJPA 1Q2WA 1D4PB 2GKVE 3K2UA 4Y0ZE 1GJ8B 2EC9H 2BDHA 2AIQA 2BQWB 4INKA 4A92A 3SJKA 2YNBA 3I77A 3UIRA 2C3SA 2QXJA 2EI7A 3M5OA 7ESTE 2AERH 2F9VA 1T32A 2GD4B 2G81E 4OGXA 3B9FH 1Y8TA 1ZTKA 2P8OC 3DT0H 1AVGH 1YF4A 1BMLA 5C3NA 4SGBE 3RXDA 4X6NA 2F83A 3KIDU 2D8WA 1O38A 2UUKB 4VGCB 3TK9A 4CBOA 2BVSH 2H1UA 1HAHH 2VWMA 1J15A 2XTTB 4FUGA 2ZFTA 1P8VC 1RIWB 3UQOA 3ZZ5A 1QRWA 2V6NA 3M36A 3RC6A 5HMAA 3SNCA 2G5NA 5I25A 2ZO3H 3SJ9A 3GDUA 1O2RA 1HIAB 3JZ2B 1C2HA 1XUKA 1GMCF 3M5NA 3UNQA 2F9PA 4ISOA 3BTWE 1ZSLA 1LHGH 1QGFA 2A32A 4NFFA 1AB9C 1SR5C 1WSSH 4ISIH 4KKDA 1TA6A 1ELGA 3OY5U 1WUNH 4ABFA 1XM1A 2HWLB 4RKJB 1ANEA 5FX6A 4WH6A 2H9HA 2FI5E 2ZCLP 2PHBA 3GCNA 1GI8B 4MQAA 3STIA 1MKXK 1ZJDA 2OC7A 4NA7A 3UR6A 1C1WH 3SUDA 3O8RA 1P2NA 1GCTC 4XBDA 2VVCA 4AFQA 3VGCB 1GHXH 1YPGH 5FPTA 1N1LA 4B73A 4ZAEA 1CE5A 1BTUA 2BLOA 1QCPA 2VU8E 2QA9E 1EP6A 1NPMA 1C5LH 1OWHA 2BZ6H 3V13A 1QB1A 1O2GH 1Z1JA 3QN7A 2STAE 4X1NU 1A7SA 3RXUA 1YM0A 1LQEA 1QURH 3RXPA 3LJOA 1CO7E 3P8OA 3O8CA 1QIXB 3QGNB 2VIVA 4B71A 3R0FA 3SU4A 1YYY1 4Q7XA 3HGNA 1O5BB 3ZZ6A 1OKXA 1L1NA 1DDJA 1GGDB 1GVZA 3MNSA 1AMHA 1O2LA 1MTUA 5H4IB 1O2NA 1JWTA 1LTOA 3S7KB 1WBGB 2ZU5A 4NCYA 1ZLRA 1GG6C 3LC3A 3GY2A 5IYTA 1AI8H 4D7GA 1O35A 4YT7H 1IHTH 3V7TA 3AASA 4UD9H 3Q3XA 1P09A 1QL7A 2B0FA 3ZZ7A 1UCYH 1MBMA 2GV6A 4BANB 1KLTA 3PMHB 4CH8B 3STJA 1AWFH 1V2RT 1GHBG 2QN5T 1D3PB 1L1JA 1WV7H 1HPGA 1XVMA 4IN1A 3BG4C 5JYIA 2FI4E 1TNIA 1INCA 1Z8RA 4DY7B 3E0PB 1NRNH 2PKAA 2C93B 1MU6B 3ELAH 1OWEA 1SHHB 2WYGA 3ATMA 1Y3XA 5HYOA 3TJNA 1S0QA 2VWLA 4Y0YE 4H6TA 4ABJA 1QB9A 2ANYA 1TOCB 3TK6A 1IOEA 1F0SA 2A4RA 2TBSA 1FONA 3LIWA 1YPJH 1C5SA 2GT7A 1LMWB 3C1KA 1HB0B 1EJNA 5A0BA 3MNBA 3FFGA 2NU3E 2PTNA 1EASA 1H9HE 1K22H 1O3CA 1YKTA 2Y80A 5JBBS 1TNJA 1HAVB 4Y7BA 2C8WB 3MU0A 2BVXH 4CRDA 4KELA 5K0HA 1OP0A 4K1TA 5JPMH 1FV9A 3QX5H 3T2NA 4JYTA 3AVZA 1HJAB 2BQ6B 3BG4B 1TMBH 1YPHC 2BDBA 1MKWK 1FNIA 4FUIA 3AW1A 7LPRA 1VJ9U 2FOCA 3NXPA 1S6FA 4FVDA 4UFGH 1P02A 5GIBA 2WPHS 3VXEH 2BX3A 1BBRE 1C5TA 3ENSB 1AN1E 3TPIZ 4AORA 1XUIA 2OUAA 3OX7U 2R3YA 1G3EA 1FDPA 1GBFA 3RXBA 1FIZA 3VB3A 3N7OA 2O8TA 1TE0A 4AYYB 1WCZA 2JETC 1MCTA 3P8GA 1NFWA 2ZU1A 2ZDMA 1FY5A 4Y11E 1GDNA 3DFJA 2ILNA 3P70B 2ZTYA 1UVUH 3TLOA 3U9AH 4X8UH 5T6DA 1EKBB 2ALVA 2H2ZA 3HKJB 2XBVA 3BTTE 5F8XA 3E8LA 1Z8IB 2HPQH 1QHRB 4MNWA 4IBLH 3LONA 4D76A 1WQSA 1SQOA 2BTCE 3MYWA 1BT7A 3QUMP 1THRH 1DUEA 2KAIA 1HFDA 1MZAA 3KL6A 1ZGIA 1LHDH 2DE9A 2R2MB 1N8OB 1ZSKA 2B5TB 3GY5A 4O3TA 3W95A 1FI8A 1C2LA 3E3TA 1HYLA 3AAVA 1GI5A 1O36A 1SPJA 2BDIA 2J92A 1VGCB 4ZKNU 2XBWA 2F9BH 5AHGH 2H6MA 1GCTB 2OXSA 2VGCC 5L30H 2JH0D 4YLUA 1YP9A 2EA3A 1P3CA 1SFIA 4I8LA 3ZYEA 4CRFA 2Q6FA 1VITG 4B2CA 4BXWA 1ELBA 5DJ7A 5ESBA 3EA7A 4ZHLU 1SC8U 2OQUA 4ABHA 1SGQE 3M7TA 2CF8H 3RM0H 1KTSB 2BXTH 1ARBA 1G32B 1C4Y2 2ZHFH 2B8OH 1BZXE 4X2XA 2Y5HA 2FLBH 1DOJA 1PPBH 1V6DA 1KDQA 1G9IE 3P8FA 5AFYH 3RU4T 2ZHWH 2F9OA 2CMYA 1DT2A 2VNTA 1NU7B 1EJAA 5J4SA 3T29A 1L2EA 2H5CA 2Z3CA 5LPRA 2R2WU 1EAUA 1MH0A 5A09A 1D3TB 4CREA 1GDUA 1S81A 5I46H 1WTGH 1K1IA 2OC0A 1BB0B 1YPKH 2W5EA 2XC4A 4HGCA 4BTTB 4UFDH 2GCHG 2VIDA 1V2MT 4HFPB 1BITA 1NRQH 4I8JA 3BSQA 1S5SA 3T5FH 5CHAC 3SZNA 1BCUH 2ZQ2A 1E0FD 1H8DH 3LGIA 1EPTB 1OP2A 1TMUH 3ZVAA 2RCEA 3VB7A 1ANDA 5GWZA 2PFEA 2FODA 1BRCE 4K1EA 4IS5A 1IQGA 2PUQH 3K65B 2SGDE 1Y5UT 3LOXA 4I33A 8ESTE 3KN2A 1BDAA 2Z7FE 3ESTA 4MNYA 1W3CA 1XUJA 1Y5AT 6GCHF 1BMMH 2ZEBA 1NS3A 3UOUA 4U01A 2R0LA 4FU8A 1CBWB 1NO9H 1O2WA 1P2IA 1D9IA 1O31A 1ACBE 3CS0A 3D23A 3GCHC 4TY6A 2G8TA 4X8SH 5DP3A 1O5GH 1BRBE 1SGIB 2G4TA 2PSXA 1C5MD 5PTPA 3RP2A 1SGFA 3MU5A 1BBRK 4YZUA 2BD7A 3MO9A 4U30A 4ZKRU 3MH4A 3BF6H 4MLFB 2FOBA 1EZSC 1C5YB 3ATLA 3CS7A 1UTOA 3Q77A 3MH5A 1FXYA 3QTVH 2BY9X 2OCVB 3UQVA 2GZ9A 3QTOH 4AOQA 5C67A 5JBTA 1UK4A 2FOGA 1G2LA 3QK1A 4B2BA 3MHWU 1BTYA 1PPZA 2BD5A 3SUEA 1GBEA 1DLEA 2BY8X 1JRTA 1T8LA 1O2TA 4YESB 1QBNA 2EI6A 4DOQA 1XKAC 1BMNH 1HAIH 1LDTT 1O2JA 3ZZAA 1EQ9A 1CT0E 1TPAE 1SI5H 2BD8A 1HAOH 1C1TA 6CHAB 1SBWA 3PMJA 1FAKH 3S9AA 1H9LB 3L6PA 1JBUH 2SNVA 2QXHA 5C20A 1AE8H 2PKSB 4XBBA 2VGCB 1MTWA 1O3AA 3U8RH 1CT2E 3O8BA 4Y8XA 2OINA 2UWOA 1C2JA 1A46H 3SGAE 2C4FH 4HZHA 5LH8A 3PO1C 3T28A 2FO9A 4Y8YA 5JB8S 2OBOA 3T62A 2Z9IA 3GISB 4NSYA 5DP4A 3TK5A 3EGKH 3U69H 2Y81A 1EAWA 1IQMA 7GCHF 4K8BA 4K5ZA 1TNKA 1C1VH 2BX4A 5HXFA 1O37A 4YO9A 1TX6A 5A8YA 1SGRE 1UVPA 1W11U 4U2WA 1GBMA 1TX8A 3EYDA 3MNXA 1WYKA 3HKIB 1FZZA 1T8NA 2Y5GA 4MTBA 3QDZB 1F5RA 1TGSZ 3H5CB 3SGQE 1CGJE 4ABBA 3D62A 4TPIZ 3A81A 1EP5A 5E0HA 1GG6B 1O3OA 2PV9B 4JZDH 2C8YB 2O8MA 2TIOA 1J9CH 1P0SH 3A7YA 3A7XA 1W0ZU 3LH3A 1GI3A 3RMNH 4LOYH 2PW8H 1FUJA 1ELFA 1F2SE 4ZMAH 3SU0A 4GPGA 1C2KA 2XW9A 2P59A 1JMOH 4HTCH 3GCHB 3Q3YA 2XBXA 1C2IA 1H4WA 1PPHE 1LVYA 2FTLE 3PYHA 1PQ5A 1NFXA 1V2UT 4FUJA 5TCAA 1G2MA 1PFXC 1UO6A 2BDGA 2ZFPH 3RUOA 1AFQB 3OSYA 1D6RA 3S9BA 1HJ9A 4OS6A 1CA8B 1E36B 2BDCA 4Q2KA 1K1JA 2G4UA 1D3QB 1C1NA 2SNWA 1ZR0A 3H7OA 4ISLA 1FY3A 2QV1A 1IQLA 1CA0C 4I7YH 3KCGH 1GWAA 1ABJH 5CHAB 2TGTA 1NM6A 1O34A 1KTTB 1P3EA 1TOMH 2V35A 2AYWA 2ZU2A 3LPRA 1MAXA 2ZGHA 2VIQA 2VWOA 2BY5X 1KIGH 1EOJA 1UTNA 1KXEA 1O39A 1SQAA 2ZPSA 1V2ST 1ETSH 1FPHH 1ZOMA 1ZJKA 3GOVB 1TGCA 1GBAA 1DXWA 4UEHH 2J95A 1HCGA 4ISNA 4XDEA 1YCPH 3FZDA 5GCHG 1OWDA 4HI3A 5EXMA 2HNTC 3PLKA 4BAMB 3HPTB 1YPMH 2A4OA 4NSVA 1MQ6A 5DKMA 1C9TA 3LU9B 3FANA 2WPLS 2GT8A 2GDDA 3M61U 1A0JA 3TGIE 3U1JB 3RXHA 1FN8A 1SGCA 2BXUH 4AN7A 1UJ1A 3TVJB 1O3PB 2A7JA 4CBNA 1FPCH 1A3BH 3NK8A 2NU2E 1DFPA 1ANCA 2NU0E 3ZVFA 4ASHA 1K1NA 1C1OA 3D49H 1ELTA 1C5UA 1GI1A 3RXIA 1GL1A 2P3FH 4FUFA 3A7ZA 4K3JA 5C5OA 1GGDC 1S84A 2VH0A 1HAYB 4X1PU 5DO4H 4AX9H 3TH3H 4NWKA 4BAKB 3PMBB 1GHBF 3SU5A 1ZTLA 2BQ7B 1TPSA 2RA3A 2AMQA 3FVFB 2FOHA 3H7TA 2FMJA 5HGGA 5DP9A 4Y6DA 1LHEH 1CQQA 1GHYH 1TMTH 3SU3A 1UK2A 1OX1A 2FI3E 2YNAA 1GJ9B 4INLA 4KTSA 1JOUB 1ID5H 1N6XA 3EAJA 4CRAA 3KQBA 8GCHF 4BNRA 3ZVBA 1LPKB 3UNSA 1HDTH 1AD8H 4IGDA 1AGJA 4NWLA 2Z3DA 1C4V2 1EB1H 5ETXA 1GI4A 1FY1A 4AG2A 4ABAA 5L6NH 1CA0B 5FCRA 1KXCA 2VH6A 3GYMA 1V2OT 3RXVA 1EX3A 5DGJA 1DLKB 5A8ZA 1FLEE 3BN9A 3GY8A 1QL8A 4ZUHA 1SMFE 1CSOE 1OYTH 1SGYE 3KEEA 3M5LA 5T6FA 2Z9LA 4KP0A 1P04A 2SGAA 4YOGA 2ZHDA 4RN6A 1B5GH 3RU4D 1GHVH 2GCTC 5LPEA 4Y7AA 1FN6A 3NCLA 3SV7A 2NWNA 4Y76A 3V12A 4JZ1A 1L0ZA 2RA0A 2Z9KA 1O3HA 3TU7H 3ZVCA 3SW2B 2A5KA 2QCYA 4Y8ZA 4DG4A 2QXIA 4K1SA 2ZECA 1ARCA 1F0TA 1S82A 1BMAA 4D8NA 3TJOA 3QLPH 4H6SB 4DJZB 2VINA 3MU8A 4NGAH 1AIXH 5EQSA 3UNRA 1VJAU 5F03A 1NRSH 1QBVH 3SV6A 2A7HA 3D65E 1TNHA 1SOTA 1XKBC 1Z8GA 5FHTA 2ASUB 4FUCA 2DE8A 1T8MA 5JBAS 1QRZA 5GPIB 2ZPQA 1K1OA 2ZA5A 3MNCA 2LPRA 1GMCG 1C1MA 2IOTA 3TJUA 4KGAA 3G01A 4IC6A 4OS5A 1HJAC 4YM9A 4FVBA 4X2WA 1C1QA 1GBKA 1F92A 1MD7A 3DFLA 3A80A 3MO6A 3RXCA 1G36A 3LGYA 3BEIB 3BG8A 5C5NA 1FAXA 2BLQA 1P2JA 1ZRKA 2HGTH 1RJXB 1UTJA 1XXFA 2Y6TA 2SGEE 2ODQA 1G3DA 1DUAA 5EOKA 3E1XB 1HGTH 1V2WT 1DWCH 3LGTA 3PV4A 2NU1E 4A1XA 4J1YA 1K21H 5DP8A 4BTIB 2WINI 1YBWA 3RXOA 1LVMA 2PUXB 1F7ZA 4FU9A 4MG3A 2UWLA 2WV4A 4K2YA 3C27B 3BTGE 1K28D 1QJ7B 1ZGVA 2CGAA 4TWYA 1TPOA 2ZDLA 1T7CA 1O2KA 2GMTB 3PMAB 1V2QT 2Y82A 3ODFA 5HM2A 3LKWA 4ABEA 1HBTH 5EPNA 3E6PH 3NUMA 3RMOH 2VVUA 1O3NA 2TGDA 1TABE 2A0QB 3TGJE 1NRPH 4R0IA 4NG9H 5FBIA 4YOJA 1EPTA 3M7QA 3EE0B 9LPRA 2OP9A 5EW1H 1CHOG 2AEIH 1C9PA 4YTAA 1O2SA 1SGEE 3ZZ8A 4Q7ZA 4WH8A 2WUBA 1MCVA 1NROH 3ATKA 4ZXYH 2GZ7A 2G55A 5E2PA 3UPEA 2WPMS 2HRVA 3GDVA 2TGAA 4BXSA 3O8DA 2IN2A 1C1PA 2HPPH 2UUYA 2GP9B 5B6OA 2ZFSA 1DANH 3B23B 4O03A 3U1IB 1QQ4A 1O5DH