4ZKRU

The crystal structure of upain-1-w3a in complex with upa at ph9.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU01
1AE8H 1K1MA 1O37A 4X0WU 3VPKA 1G30B 1G37A 1TPPA 2ZA5A 3PROA 1C5OH 1YPGH 4NFEA 2BLVA 1K1LA 2UUKB 4MPUA 4AG1A 1MTSA 1A5IA 1DUAA 1EX3A 1F0SA 3JZ1B 3C1KA 3R3GB 3BIUH 1NT1A 2ZTXA 5AHGH 3V0XA 5JDUB 2A2XH 4THNH 5TCAA 1SMFE 1TNIA 3HK3B 3URCA 3R0FA 4ISLA 4CREA 1BMAA 1EPTA 4LXBH 4ZKOU 2B0FA 1SL3A 1Y5UT 2VWOA 3LH3A 4ZH8A 4J1YA 1QR3E 2PKSC 1AFQB 1O3CA 1GI7B 2VB0A 4Y0ZE 3SU6A 1P8VC 1GHAG 2Y5HA 1LVBA 1GHBG 3NWUA 1S82A 1L1GA 1T32A 2BQWB 2UWPA 2G51A 2SGQE 4MTBA 2BYAX 4AB9A 1EATA 1D6WA 1LHFH 2FODA 3MWIU 4K3JA 1GJ9B 4HTCH 3CS0A 1ORFA 1OYQA 1C5PA 4M7GA 1KXAA 2ZF0H 1AN1E 3E8LA 3E3TA 1T4VH 1OWIA 1THSH 2AYWA 1V2QT 4CRDA 1F2SE 4YOGA 2AIPA 2ZDVH 5C3NA 3VXEH 1DSUA 3M61U 4ZMAH 4NIVA 1NM6A 1KTTB 1F7ZA 3ZZ8A 2ZGCA 1N8OC 1YCPM 4D7GA 2ZCHP 3MO9A 5JBTA 1OSSA 2Y81A 1SGPE 5IDKA 1C1QA 2GMTC 1MTVA 3L3TA 1KDQB 1AFEH 1FNIA 1C5QA 4O3TA 1G3DA 3LJJA 1OWKA 3JZ2B 4A7IB 3T2NA 3P70B 4OS4A 2UWLA 3CP7A 1OP2A 5BRRE 3EA8A 1IQNA 3SI4H 3ZZDA 4TWYA 3TU7H 4NZLA 1OWDA 1Z6JH 2PLXA 1ZZZA 1QRZA 1UTJA 1VJAU 2TPIZ 2FOGA 3ZZ4A 1F5KU 3ZVGA 3HPTB 5ABWA 3UOUA 4CHAC 1KLIH 1NFXA 3E0PB 1C5NH 1QURH 2EEKA 1GI3A 2GV6A 1HAXB 1O5CB 3PM3A 1TNLA 5J4QA 1GI6A 3SQEE 4XOJA 1ABJH 1LPGB 1ELAA 2KAIB 2OTVA 3MYWA 5E8EH 1SLWB 3BTWE 3RMLH 2Z3DA 2AS9A 4X1SU 3FVFB 4BAMB 1GL0E 3RXIA 3A88A 1C5ZB 2D2DA 2UUJB 4I31A 2ZTZA 3U8OH 1P10A 2P8OB 3NKKA 1HAPH 1QJ6B 3KN2A 1AB9B 2BOHB 3P8NA 4A92A 1SQOA 2HPQH 2AGIX 4UE7H 2XBWA 1XUIA 5C67A 5LPFA 3VB3A 2NU3E 2XBYA 4BXWA 5FX5A 1ZTLA 2FZZA 4X6OA 1D6RA 3WY8A 1GBTA 3RXUA 5CHAB 2BD8A 2FIRH 1SHHB 1C2HA 1Y3WA 1MUEB 1KXDA 2ZG0H 1BOQA 4WJG2 4WMFA 1QRWA 4ABJA 1O2GH 2BQ6B 1DPOA 1LVYA 4JK5A 3UPEA 4E05H 1GI9B 1WTHD 2RCEA 4NCYA 1MTWA 1YF4A 2ZECA 1HUTH 1PQ8A 1GJ4H 2QAAA 1QQUA 1TNKA 3QX5H 5T6GA 1FQ3A 2OC0A 3EA7A 2R3UA 1HJAC 2DE8A 2QGRA 3QK1A 5LPRA 1SGRE 1K1NA 5EG4A 1GJ8B 1Y5AT 2AGGX 3A87A 3RXBA 1YKTA 1YLCA 2QCYA 5ESBA 5FBEA 5JB8S 1A0LA 4Y8XA 1HFDA 2A7HA 4AB8A 2TGAA 3BTTE 2LPRA 2P93A 2K1QA 1ETSH 2UUFB 4NSVA 1F0TA 1X7AC 4NA8A 1C2JA 3OYPA 2WV5A 3S9BA 3MOCA 1GPZA 1TOMH 1OP8A 2C8XB 4E7RG 2CF9H 3ZZ9A 1AHTH 1GJ5H 1AVWA 1GBEA 1O3DA 4Q7YA 2EI8A 5AF9H 1IQIA 1WU1A 2QA9E 3ZVDA 1T31A 3MNSA 3BTHE 1Y5BT 3V12A 1S84A 5A09A 3KGPA 2ANKH 3A7VA 3TNTA 3TNSA 4I8HA 3GICB 2SNWA 4HZHA 5EQRA 4ASHA 2XCNA 4CRBA 1RD3B 2O8MA 2Q1JA 3M5OA 4TYDA 1Q31A 4R8TB 1AIXH 2F9UA 1P0SH 4LOYH 2STBE 3VB6A 3A8CA 2ZDNA 3RU4E 7GCHG 2UWOA 4YESB 1AFQC 5GCHG 2ZKSA 3K6ZA 4CRFA 2GZ9A 1N6XA 1TGSZ 2AGEX 1C1WH 3MHWU 1V2NT 1P9SA 2WUCA 1GCTB 5F8TA 1FZZA 1B0EA 3TGIE 1O2XA 2BZAA 1RS0A 3RMMH 1YPHE 2NWNA 2GTBA 2UUYA 5DJ7A 2B5TB 1UCYH 1W0ZU 1HGTH 4UONA 1W10U 3HGNA 5E2PA 3SU4A 2A2QH 4B74A 1BITA 2P16A 1BIOA 1VCWA 1RTFB 3E90B 3E91A 4Z0KA 3U8TH 3PLPA 1GBKA 1LQDB 2P59A 3PTNA 1TX7A 1LVMA 1LHDH 1FPHH 2XBVA 1HV7A 1EJAA 1HAHH 1NO9H 1G2MA 1XM1A 1G3EA 1Y3VA 4MPXA 3TJUA 3FFGA 2ZQ1A 1FJSA 1ZSLA 4KTCA 1SGFG 4LK4A 1C1SA 1JMOH 1XUGA 1QHRB 2C3SA 3SO3A 1K21H 3ZVBA 1XKAC 3LGIA 5PTPA 2CN0H 1T8OA 1UVUH 1DS2E 2Y5GA 3GY3A 1L1NA 2ZFTA 1XVOA 3URDA 1O3BA 1ELCA 1MD7A 1S0RA 3ZZ6A 3UUZA 2BLOA 4MVNA 2F91A 3A81A 3TLOA 1GCDA 1O30A 2GVFA 2F9OA 2ZEBA 2BZ6H 3EYDA 1FY1A 1H8DH 2BDIA 3P8GA 3SUGA 1UHBA 1V3XA 3ZVEA 1DUEA 1FIWA 2SNVA 3ATLA 1P02A 1VGCB 1C2FA 2F9NA 3RC6A 5DO4H 1C1OA 1GDUA 1ZYOA 5FHTA 4OGYA 1K1IA 1AO5A 3BG8A 2P8OC 1C2KA 3UR6A 1O5EH 4YLUA 3SNCA 1G36A 1S6FA 1TMBH 3BTGE 4OGXA 4U01A 1C5UA 3BEFB 1GHYH 1UCYK 1G3CA 2C93B 1CHOF 1RIWB 3BG4B 3RLYH 2QXHA 1BBRE 3A7WA 2V0BA 5EQSA 4X8UH 1JIMA 1UTKA 2GX4A 1CE5A 3Q3KA 3A82A 3STIA 5CHAC 2GD4B 4JYTA 1EZXC 1O38A 1SFQB 2HLCA 3SV9A 3BEUA 3FZDA 1O2UA 3QGNB 5SGAE 3ODFA 2F83A 3Q3YA 2G8TA 3GY2A 1GBLA 4UFDH 3AAVA 1EXFA 4Y8YA 1JXPA 2FLRH 1GMDG 1SGFA 1EZUC 1Z1IA 2OP9A 1KSNA 3NCLA 4GHQA 2BHGA 4B2BA 3ATWA 1V2LT 2ASUB 2P3UB 2SGEE 1UK2A 2XWBI 4WY3A 4X8TH 3GCHC 2HRVA 1C5LH 1GJAB 2B7DH 2FI4E 5EW2H 3F9HA 2JETB 3AAUA 4IC5A 5EODA 4MLFB 1GHAF 1ZPCA 3O8CA 1OS8A 1LPKB 2BLWA 4X2WA 4BXSA 4DVAU 2BXUH 1EJMA 1TQ7B 2LNCA 3SNAA 2PR3A 1P3EA 1OX1A 1MH0A 1NTPA 3ATKA 1T8LA 1ZPBA 3T62A 1KTSB 2ZPQA 2Y7ZA 4OS7A 2ZU1A 3RP2A 1O3HA 3U1IB 3SU2A 1SFIA 1AE5A 1RGQA 1S85A 5EXMA 4BTTB 1O3PB 1GL1A 1QGFA 1O2PA 2SGAA 1B5GH 5T6FA 4X6MA 2H9TH 1PPGE 2ZU2A 3ZVFA 1TWXB 4WVPE 1HB0B 5JBBS 1KDQA 4X2YA 4DOQA 8GCHF 4AFUA 1ZTKA 2CMYA 3HATH 3RC5A 1AUJA 4WF8A 1YP9A 1N8OB 1O0DH 1TRMA 6CHAC 1L4ZA 1M9UA 4D76A 3KF2A 1V2OT 5HYOA 2P94A 2HNTC 4X6PA 2PFEA 1WYKA 2PGQB 1FY4A 3RXDA 4GHTA 1EAIA 2G5NA 2YOLA 1GCTC 1MTUA 1HAGE 3BTME 1H1BA 1K2I1 3S9CA 1ZRBA 1KXFA 1O2VA 3S7KB 2KAIA 4YM9A 5DP6A 1TPOA 4K2YA 3GCOA 2BDYA 2GZ8A 2XYAA 4CHAB 3E16B 2V3OH 4H4FA 4LZ4B 1DT2A 2Z3EA 3GY7A 2J92A 4GAWA 4GUXA 1S5SA 3PMAB 1BHXF 3UY9A 4CRCA 2ZHQH 4X1RU 2AH4X 2AERH 2IN2A 1Z8JB 5LPEA 2TBSA 4XBCA 2EI6A 5A8YA 5EGMA 1UTNA 3M3VA 3QDZB 1ZMNA 3TPIZ 1P2IA 1TYNA 4IGDA 1P05A 2G4TA 1SC8U 1OOKB 2ANYA 2PKAB 3ZVCA 4ZXYH 2O8WA 1OYTH 3MO6A 1DLEA 1H4WA 2FI3E 8ESTE 1PPEE 1ZGVA 1DXPA 4XDEA 2ZGXH 1BTWA 1HAIH 3M36A 3MNBA 4FVBA 3O8DA 4XE4A 5A8XA 3T29A 1DX5M 1C5TA 1NN6A 3IWMA 1YYY1 2BY6X 3PWBA 3QN7A 4ABAA 2F3CE 3MH7A 2A7JA 2F9PA 3ZV9A 4WMEA 1SI5H 2NU4E 1EB1H 5FX6A 1NRSH 3TIUA 7KMEH 1MU8B 3LPRA 2HALA 1NRNH 1VGCC 1C1RA 2QY0B 2WPMS 3PV4A 4FUEA 9ESTA 1C5RA 1A4WH 1K1JA 1TIOA 1EJNA 1V2TT 1W8BH 2O8TA 3SJKA 2TGPZ 1TGCA 2Z94A 2ZO3H 1V2KT 2R3YA 5IYTA 1RRKA 2A4OA 1WSSH 1CHOG 2PTNA 3T27A 3D62A 4YOJA 3A80A 2HGTH 2QYIA 3RXAA 5GXPA 4MNYA 1AWFH 5CE1A 1A3BH 3GY5A 4BTIB 2TIOA 1TGBA 5LH8A 3LGYA 1BA8B 4Q7XA 1A1RA 3F6UH 2ZDMA 1HJ9A 4GCHG 2ZDKA 1O3EA 2Y6TA 2FOBA 1QNJA 2FEQH 3S9AA 4YOIA 1L4DA 1BCUH 1YCPH 2A4RA 5JBAS 4UDWH 2C8WB 5EW1H 1QL7A 2G81E 4I33A 2G4UA 2JETC 3M7TA 7GCHF 1SGQE 4Y7BA 1V2ST 1P01A 1OWEA 5GCHF 5DP3A 1W11U 4BNRA 1WV7H 2ODQA 1GBCA 3MO3A 3M5NA 4F4OC 5A2MH 2WPLS 1Z6EA 1E34B 3W95A 2BM2A 4ZAEA 2ZWLH 3FAOA 1F0UA 1O2TA 4K1TA 4ZKRU 2YNBA 1UVSH 2ZFFH 3P95A 3PMJA 4Z6AH 1ZOMA 1QJ7B 3K6YA 3SV6A 1FY8E 1TBRH 1TNJA 1MU6B 1C5WB 2OQ5A 4ABBA 2YNAA 3DHKH 5HM9A 5A8ZA 3RXRA 9LPRA 4NIYA 1LHEH 5C1XA 1GHWH 6GCHG 8GCHG 1UJ1A 2WV4A 5GJ4B 5C1YA 1F0RA 1V2JT 3K9XB 5F6MA 3O8RA 1RFNA 4XBBA 2W3IA 3KHVA 1XXDA 1ARCA 3RXJA 1ANDA 1UO6A 1ZHMA 3GY8A 4NG9H 5FPTA 1K22H 2BY8X 2Z6BD 1C2MA 4FUDA 1HDTH 3BTFE 3M3SA 4WMDA 3PO1B 4TPYA 1Z8GA 3SU5A 2ZFSA 3DD2H 1HLTH 2VU8E 2OBOA 4KELA 2C90B 1FMGA 2NU2E 2Q6DA 2FXRA 5A0BA 1T4UH 1QBOA 4K69A 1YCPK 5C1UA 4FUJA 1S6HA 4KKDA 3SUEA 1SLVB 1N1LA 1BBRH 3BV9B 1QL9A 3SU0A 2AFQB 2OUAA 1SSXA 4F49A 3TH4H 3A8DA 1L1JA 1GBJA 3QO6A 3IITA 1JIRA 1UTQA 4ZHAA 1J14A 1ARBA 1C4V2 4YTAA 4YZUA 5TCCA 1GDNA 1G2LA 2EI7A 2PUQH 2QC2A 4YT7H 2A7CA 3FANA 2JH0D 1PQ7A 1DY9A 3F1SB 4MG3A 4K60A 1F5RA 4FUCA 4JK6A 1P2QA 4MQAA 3NUMA 1EASA 2ZU3A 1VITF 2C4FH 3VEQB 2ZFRH 1EZSC 2EC9H 1QBNA 1GBFA 1ELDE 6ESTA 2J34A 2ZHEH 4Y10E 1O5GH 2BVRH 2ZI2H 1BMNH 3RXLA 2AIQA 4OS1A 2ZGHA 2ANMH 2FDAA 1WTGH 1QCPA 1W7XH 2BX4A 3OTJE 5HMAA 1E36B 1GMDF 2BD5A 1HIAB 1ETRH 1UTPA 2STAE 5L6NH 1AGJA 2VIPA 1O34A 3B9FH 4B1TA 2BOKA 2FOMB 4DGJA 1Z7KA 1O2IA 1D3PB 2SGDE 5TJXA 1O2HA 4VGCB 2FYQA 2W7SA 2A0QB 2ZZUH 1O3MA 3PTBA 1SOTA 1WUNH 4SGAE 3SZNA 1PPBH 1YGCH 2PWXA 4DCDA 1SQAA 3GCHB 2VWMA 1ABIH 3RXGA 3G01A 5BPEA 1WBGB 5DP7A 1OP0A 4I8JA 2HWLB 2QF3A 1HYLA 4BTUB 1EOLA 1BBRK 1V2WT 3HK6B 3SJIA 2A1DB 1ANEA 1INCA 4Y71A 2OD3B 1A61H 1XUFA 4XBDA 3EE0B 4X2XA 3SBKA 2OC1A 1SGTA 1Z8IB 4ZUHA 3RM2H 2G52A 2FESH 3GY4A 3T25A 5K0HA 1H9IE 1P06A 2ZP0H 1FLEE 4UFGH 1THRH 3A7XA 2GDEH 3ZZCA 1C1UH 1KYNA 3ZZ7A 4NWLA 3A89A 4Q7ZA 4A1VA 1ELTA 2XC0A 2WPIS 4K1SA 2CHAB 1DWDH 3F9EA 4MPVA 4Y0YE 2FOAA 1AZZA 4OS6A 3RXHA 1O5BB 2FX6A 2TRMA 6CHAB 3RLWH 1BJVA 4AZ2B 5EQQA 1DICA 1D4PB 4A1XA 4A6LA 3PLBA 1G3BA 2WPHS 1BT7A 3K65B 1FI8A 2J94A 4K8BA 3UOPA 1BZXE 1MZAA 2WYJA 2ILNA 1ELFA 1C5XB 3NK8A 1GWAA 3ZZ3A 1DVAH 1AKSB 1AQ7A 2F9BH 3ZZ5A 3L6PA 2BTCE 1LKBA 4JZ1A 4UFEH 2F9VA 1E35B 1KLJH 5DGJA 3UNQA 1PQAA 1O32A 2D8WA 1ACBE 1XVMA 3ITIA 3T5FH 1HAVA 3SNBA 1DOJA 1K28D 1C2GA 1LHGH 3ATIA 2FWWA 2OCVB 1EPTB 1MKXH 2IOTA 2ZCKP 4ABHA 3PLKA 1GJBB 4RSPA 4MNVA 2AEIH 2SFAA 1UK4A 2VGCC 2XWAA 4IN1A 3A84A 2BD7A 3SHCH 1OWHA 1ESBA 3PO1C 3ODDA 2VVCA 1DY8A 2THFB 4UD9H 2HNTF 3UNSA 3BTDE 1TNHA 3S0NA 1O5AB 4I32A 2DE9A 2PGBB 1UMAH 3M7UA 5DPAA 3SW2B 4ZHMU 2J2UA 3PMBB 3OX7U 4DURA 1S83A 1HPGA 3GISB 3B23B 4INKA 3GCTG 1CT4E 3L33A 2Z9GA 1SQTA 1ZSKA 4DT7B 1VJ9U 4CR5A 2JKHA 1G32B 3ENSB 4JZEH 4CH8B 1Y3YA 2CF8H 1IAUA 3TK5A 2VWNA 1UK3A 2QXJA 2HPPH 4O9VA 1DWBH 1SGCA 1BRAA 1VITG 4FUHA 3SNEA 1YPMH 1TRYA 3QLPH 4TWWA 4Y11E 1GMHF 3MTYA 3TH3H 5C2ZA 4ESTE 4FUGA 1MKXK 2B9LA 2P3FH 2GZ7A 3EQ0H 1TFXA 3F9GA 5AFYH 3P92A 4RKJB 7ESTE 5JB9S 2FS8A 4NIWA 1DXWA 4GCHF 4K1EA 5DP5A 3QTOH 1K1OA 4CR9A 4I8LA 1O36A 1FPCH 1TRNA 3AW1A 4VGCC 5EXLA 3UFAA 3TH2H 1CGHA 4AFQA 2AMDA 4K5ZA 4NWKA 3LGVA 3SGQE 1CT2E 1YPKH 2R0LA 3ELAH 1CA8B 2C8YB 8KME2 3P17H 1S0QA 2Z9IA 1T8MA 1GVZA 1OKXA 3RXSA 5JPMH 4IBLH 1TB6H 1VZQH 1O3GA 2OC7A 2PTCE 1TA6A 3TK6A 1CHGA 1V2MT 2H5CA 3SORA 4U2WA 1NS3A 1HRTH 4AFZA 1Y59T 3PB1E 2W26A 2GP9B 1SGYE 5DK1A 3E6PH 4IN2A 2ZCLP 5GPIB 4ABIA 1ESAA 5L30H 3BSQA 2JH5D 2ALVA 1IOEA 4Y79A 1CQQA 4NIXA 1BUIA 1W0YH 3Q77A 1P11E 2FOFA 1P2KA 6GCHF 1H8IH 1ANCA 4OS2A 2CHAC 2BX3A 1YPHC 1O2QA 4ISIH 2H6MA 1Z8RA 4FUFA 3FP7E 4Q80A 2ZGBH 4FU9A 2HOBA 1PYTC 1ANBA 1CO7E 3LC3A 3IG6B 1GHZA 1NFWA 3SJ8A 2ZFQH 3H5CB 4KGAA 5EU8A 4H6SB 1QTFA 1THPB 3AVZA 1A7SA 2A5AA 5GWZA 3HKJB 1SB1H 5C5OA 3A8BA 4WH6A 2O8UA 3SU3A 2QIQA 4FUBA 4WXVA 1KIGH 1O31A 2PSXA 1QA7A 1AMHA 1ZSJA 1TAWA 1QB1A 3RMOH 4H6TA 1ZRKA 1CT0E 1XX9A 3HGPA 4AYYB 1NRQH 1WQVH 2P95A 1HAYB 1ZMJA 1MAXA 1ETTH 4DW2U 5E2OA 3UTUH 2ZGJA 1BMLA 5T6DA 1ZHPA 1EPTC 3D65E 4MPWA 1MD8A 2A31A 2G55A 4ABEA 1IHTH 4AOQA 1J9CH 1FN8A 2J9NA 4FVDA 4AYVB 2NU0E 1JOUB 1PFXC 1D3TB 4X1PU 2A5IA 2Y82A 4JZIA 1EAXA 4JCNA 3C27B 2FOCA 5L2ZH 2FTMA 5I46H 1HIAA 3A7TA 3QZRA 5AFZH 1EAUA 4HFPB 1A3EH 1V2RT 1O3LA 1GI5A 1O35A 2H1UA 4DJZB 1GGDC 1J15A 3M3TA 2I6SA 2ULLA 1GJ7B 1MCTA 1LO6A 1P12E 3SHAH 5FCKA 3DT0H 1O2ZA 1GMCG 2ZU4A 1AD8H 2D26C 2EA3A 4INHA 1A5GH 3STJA 3LGWA 3NPSA 1ELGA 2FYRA 1O39A 1GI8B 1UVTH 1NRPH 4RN6A 5LGOA 1NESE 1UCYE 1KXEA 1MQ5A 2ZHWH 3QWCH 2VJ1A 3ZVAA 1GJCB 1MQ6A 3MNXA 1CGIE 1ZGIA 1GBIA 3RU4D 1FY3A 1FUJA 1P2JA 1GG6B 2RA3A 1FDPA 4IS5A 4CRGA 6LPRA 1P2NA 1KLTA 3TJVA 1Y8TA 1MZDA 1GJ6A 3LOXA 3GOVB 2BY9X 1A5HA 2Q6FA 1FAXA 1GDQA 3AW0A 2HVXA 3LH1A 1GVLA 2VH0A 1GMHG 3EGKH 3RMNH 1AWHB 1J17T 3ZV8A 5J4SA 1TX8A 4Y7AA 4OS5A 3E1XB 1PYTD 2H2ZA 1SVPA 3SGBE 4JYUH 1FV9A 1WCZA 1DANH 3VGCC 1E37B 3TJNA 1CA0C 4TPIZ 3I78A 1GBAA 5I25A 3Q00A 3FP8E 1V2PT 4QT8C 2ODYB 1LPZB 3DUXH 1MKWH 1UVPA 3BTQE 2PUXB 2Z9KA 2A45B 1AKSA 4IC6A 1C5YB 2VIWA 7LPRA 1EAWA 1EP6A 4ZHLU 2BD4A 4ABFA 1P09A 2TGTA 2G00A 1C2EA 4X6NA 3KNXA 4INLA 4CBNA 3LGUA 1JRTA 1HBTH 2W3KA 1B0FA 3MI4A 4NGAH 2GDDA 1C1NA 3MMGA 1HNEE 4DIHH 1P2OA 1NZQH 3KIDU 2G5VA 4X8SH 1S81A 4KTUA 3TGJE 1C2IA 1LDTT 2VVUA 1QJ1B 1C9PA 3KQBA 2B8OH 5F03A 3RXFA 5C5NA 1E38B 2GCHF 3QZQA 4AGKA 2BDHA 4D9RA 1BJUA 2FMJA 1O3NA 1BTXA 2VINA 2BDAA 1LMWB 4IMZA 1QRXA 1C1VH 2XC4A 5FCRA 1VR1H 5DKMA 5C20A 1CGJE 5F8ZA 4YT6H 3VFEA 1TGNA 1W13U 2BMGB 2VGCB 3BIVH 3SV7A 1ELBA 4JZDH 2A4GA 3OSYA 4GSOA 3UNRA 1W14U 3RXTA 3LIWA 3RXQA 4U30A 4AG2A 1NROH 1NY22 1W2KH 3Q3XA 3E0NB 1SLXB 3SOSA 1PPCE 1GI4A 2FX4A 3EDXB 1PPFE 1AVXA 1MKWK 1XMNB 1YC0A 2QN5T 1SHYA 2GCTC 4NFFA 2V35A 1MAYA 2FPZA 3OU0A 4TY6A 1A46H 1SGDE 2BD9A 4JYVH 1ZLRA 3GCTF 4MNWA 4GLYA 2IPHA 4CBOA 4IMQA 5DG6A 4B75A 4Y76A 1TE0A 4NZQA 4JMYA 2QXIA 3DA9B 1KXBA 1WAYB 1NFYA 3SU1A 1P9UA 3KQCA 4ISNA 1SGEE 4AFSA 1SPJA 1TMTH 1UTLM 3ESTA 1TPSA 1P57B 1Y3XA 1K9OE 3RM0H 2ZDAH 2CV3A 1ZJDA 2FOEA 2ODPA 2PW8H 1FN6A 1A0HB 1GBDA 1TALA 4A5TS 1ELEE 2WUBA 2BD2A 3EA9A 3BF6H 3MU8A 1XUHA 4YO9A 3F68H 5EPNA 3RXMA 4HI3A 3I29A 5FBIA 5DP8A 2Z9LA 3UREA 3RXKA 3LONA 1W3CA 2OLGA 1A0JA 8LPRA 1WOFA 1GVKB 2Z3CA 1E0FD 2Z7FE 2TGDA 2ZFPH 3UWIA 4B2AA 1LVOA 1TOCB 2V3HH 1GBHA 2RDLA 1CVWH 2W5EA 1BTUA 1OPHB 3SNDA 2BQ7B 5HM2A 2ZNKH 3CENA 3W94A 4Y6DA 4ZROA 2XCFA 4AX9H 1HXEH 1LTOA 4B2CA 4A1TA 5CMXH 1DLKB 1JWTA 3RC4A 2BVSH 4CRAA 1NPMA 1O3FA 1BRBE 1QQ4A 3KEEA 1GBBA 4GPGA 2Y5FA 3U69H 3FZZA 3NXPA 1IQKA 2XC5A 2M5TA 2ZDLA 2NU1E 2XNIA 1O5DH 2A5KA 4D8NA 3VB5A 5AVDA 1ZR0A 1O3JA 1ZJKA 1FAKH 1GG6C 3UIRA 3UQVA 4LZ1H 3KCGH 4FXGH 1BTYA 2Z9JA 4B76A 1YM0A 4XSKU 1NFUA 1UTOA 2ZC9H 1O2MA 3GDVA 1LQEA 1Q2WA 2VIVA 3A85A 1MMJN 2I6QA 4NA9H 1C5SA 1TONA 1O5FH 4ZXXH 1D9IA 4WXIA 3TJOA 4BANB 3GYMA 5DP4A 1TQ0B 1IQGA 3U98H 3ZZAA 1IQLA 4ISOA 1NU7B 1O2KA 5E0JA 1NC6A 2R0KA 3A7YA 1IQHA 1TGTA 4SGBE 4X8VH 4YLQH 3I77A 3F9FA 2BY7X 4NA7A 1P03A 2GGVB 3MH4A 4ZKNU 2CJIA 2ALPA 4O3UA 1ZPZA 3A83A 1IHSH 3QGJA 1HAZB 2FP7B 4FU8A 1PPHE 1J16A 2BVXH 1C2LA 1EKBB 1K1PA 3NZIA 4E06H 4E7NA 1TPAE 1CBWB 1YPEH 1MTNB 3OY5U 2JH6D 2VWLA 5ETXA 1B7XB 2ZHDA 2XTTB 4BAOB 4FUIA 2BD3A 2SGFE 1C5VA 1OWJA 3SJOA 1SBWA 1TA2A 3TVJB 1V2VT 5A0CA 3KQEA 4H42U 2VH6A 3LU9B 3TITA 1MCVA 1SGIB 1RXPA 3GY6A 3GDSA 1DM4B 3V7TA 2QF0A 4BAHB 1TMUH 3H7OA 4I8KA 1XKBC 2PKAA 2GCHG 1YPJH 1EOJA 3S7HB 5EOKA 3QUMP 1T7CA 1C9TA 2BDGA 5FAHA 4UEHH 1Z1JA 2VIOA 1V6DA 1P04A 4I7YH 1RTKA 1DSTA 3DFJA 1ZHRA 2GT8A 1DITH 1Y3UA 2C8ZB 2OQUA 4J2YB 1SR5C 2FOHA 5GDSH 3DFLA 1IQMA 1DDJA 3MU4A 3M5MA 1A2CH 1LCYA 2HNTE 2OC8A 3H7TA 2A32A 1U6QA 1O33A 3VB4A 5ESTE 1TBQH 1C4Y2 3ZYDA 2BY5X 2J4IA 5A0AE 1GHXH 1YBWA 1GGDB 2FTLE 3SGAE 1GMCF 1KY9A 3CS7A 1SG8B 5FPYA 5DP9A 3KL6A 1H9HE 4B73A 2ANWA 2BDCA 3MH6A 4B71A 4GVUA 5GIBA 1C1MA 3QTVH 2VIDA 1IQJA 3P6ZB 1O2SA 1QY6A 2XBXA 1QBVH 3RXVA 4WH8A 5EPYA 3MU5A 1O2LA 3D23A 2FS9A 4ABGA 1GI2A 1J8AA 3SI3H 3M7QA 3RXPA 1GBMA 1AI8H 1GHVH 1DWEH 1CSOE 3VXFH 2OINA 4XFQA 1HJ8A 3V13A 1GI0A 2D1JA 5E0GA 2RG3A 1XXFA 1AB9C 1AZ8A 3LJOA 5FXLA 1C1TA 1DWCH 1Z71A 3OY6U 4U32A 1QB9A 4Q2KA 3SUFA 3A7ZA 4K8YA 3VGCB 1G9IE 1CA0B 1BTPA 3UQOA 4R0IA 1AUTC 1AY6H 4DY7B 1MBMA 1LHCH 1N6YA 3LGTA 3MFJA 4ABDA 3Q76A 2FO9A 2VIQA 1O2YA 1SOZA 4X2VA 1BB0B 4IW4E 3RXOA 1F5LA 3U8RH 1EB2A 1SGNE 3GDUA 5JYIA 1ID5H 1KXCA 2SGPE 4NSYA 3M37A 2QXGA 1QA0A 1JRSA 1XUKA 4JZFH 4RKOB 1ESTA 3PMHB 2BDBA 4Y8ZA 1C5MD 5HGGA 1P3CA 2XW9A 4ZKSU 1PQ5A 1O2RA 1BTHH 2H9HA 2ZIQH 2ZU5A 1MBQA 1ELVA 1QB6A 2DUCA 1GHBF 2PKSB 1FIZA 1O2WA 1O2OA 4O03A 1GI1A 3TK9A 1BRUP 4WWYA 1QIXB 4AGJA 2W7UA 3EAJA 3MU0A 1O3AA 1H9LB 2AMPA 2R9PA 1UTMA 5L2YH 2ZTYA 3P8FA 2H9EH 4D9QA 1FY5A 1HXFH 1EUFA 4FU7A 5K7RA 1IQFA 1D3QB 1O2JA 1XUJA 1EQ9A 3SQHE 3D49H 1DE7H 3MH5A 1NRRH 3TGKE 1UVOA 1TABE 1BHXB 1BQYA 1O3OA 1EP5A 2RA0A 2O9QA 1CBWC 1SLUB 1MTNC 4BAQB 2BB4A 5E0HA 2OXSA 2VNTA 1JBUH 1OXGA 1BMMH 2CXVA 1O3KA 1VITH 4X1NU 2R2WU 1HAOH 1TX6A 1HCGA 2BLQA 1P2MA 1QFKH 4ISHH 3FP6E 1NU9A 1AU8A 2ZPSA 1W7GH 3PWCA 3MNCA 3LC5A 2GMTB 2PHBA 1BRCE 5HXFA 2ESTE 1WQSA 3B8JA 1TNGA 2WINI 2GCTB 1V2UT 1VCPA 5T3HA 3U9AH 3GYLB 3N7OA 2XXLA 3A86A 4D7FA 4PROA 3S69A 5FPSA 4CH2B 3T26A 2V6NA 1AVGH 2ZPRA 3RDZA 2R2MB 1TLDA 3MU1A 1FONA 3SUDA 3UWJH 2IJOB 4I8GA 2FLBH 5G4BA 1T8NA 3SV2H 3RUOA 3HKIB 1BDAA 1W12U 3M5LA 1GJDB 4KTSA 4AN7A 1Q3XA 3M35A 3O8BA 1O2NA 2H5DA 2Q6GA 1IQEA 1PJPA 2Y80A 1RJXB 2CGAA 4O97A 3LKWA 2A4QA 5JBCS 1BTZA 1FXYA 2WPJS 1C2DA 1HAVB 1TBZH 1ZTJA 3AASA 3SV8A 3BTKE 3ZYEA 3RXEA 3UR9A 2J38A 3ZZBA 3VB7A 2WPKS 5H4IB 1YLDA 2FM2A 1F92A 1C1PA 1L0ZA 3RXCA 5F8XA 1LKAA 1L2EA 3LT3A 3V3MA 4MNXA 1CU1A 1YPLH 2AMQA 2FI5E 4KP0A 4UFFH 3GCNA 3BTEE 2GT7A 1EZQA 1DFPA 3PYHA 1PPZA 2P3TB 1C4U2 2O8LA 2GKVE 4BAKB 2ZQ2A 2Y7XA 5B6OA 2WYGA 3A8AA 4TY7A 2VVVA 4AORA 1D3DB 3BEIB 3BN9A 3LDXH 1O3IA 5EXNA 3SN8A 1VCQA 2PSYA 1HJAB 2QV1A 2ZHFH 4BOHA 1QL8A 1UHBB 3SJ9A 4X1QU 1RTLA 4HGCA 4DIIH 3T28A 1RIWC 3BG4C 2OBQA 3RU4T 4MDSA 4DG4A 2BXTH 2XRCA 2PV9B 3U1JB 3KQDA 3K2UA 3P8OA 2J95A 3ATMA 1ZMLA 2GV7A
chains in the Genus database with same CATH superfamily
1AE8H 1K1MA 1O37A 4X0WU 3VPKA 1G30B 1G37A 1TPPA 2ZA5A 3PROA 1C5OH 1YPGH 4NFEA 2BLVA 1K1LA 2UUKB 4MPUA 4AG1A 1MTSA 1A5IA 1DUAA 1EX3A 1F0SA 3JZ1B 3C1KA 3R3GB 3BIUH 1NT1A 2ZTXA 5AHGH 3V0XA 5JDUB 2A2XH 4THNH 5TCAA 1SMFE 1TNIA 3HK3B 3URCA 3R0FA 4ISLA 4CREA 1BMAA 1EPTA 4LXBH 4ZKOU 2B0FA 2LELA 1SL3A 1Y5UT 2VWOA 3LH3A 2HVYB 4ZH8A 4J1YA 1QR3E 2PKSC 1AFQB 1O3CA 1GI7B 2VB0A 4Y0ZE 3SU6A 1P8VC 1GHAG 2Y5HA 1LVBA 1GHBG 3NWUA 1S82A 1L1GA 1T32A 2BQWB 2UWPA 2G51A 2SGQE 4MTBA 2BYAX 4AB9A 1EATA 1D6WA 1LHFH 2FODA 3MWIU 4K3JA 1GJ9B 4HTCH 3CS0A 1ORFA 1OYQA 1C5PA 4M7GA 1KXAA 2ZF0H 1AN1E 3E8LA 3E3TA 1T4VH 1OWIA 1THSH 2AYWA 1V2QT 2WZQA 4CRDA 1F2SE 4YOGA 2AIPA 2ZDVH 5C3NA 3VXEH 1DSUA 3M61U 4ZMAH 4NIVA 1NM6A 1KTTB 1F7ZA 3ZZ8A 2ZGCA 1N8OC 1YCPM 1H8ED 4D7GA 2ZCHP 3MO9A 5JBTA 1OSSA 2Y81A 1SGPE 5IDKA 1C1QA 2GMTC 1MTVA 3L3TA 1KDQB 1AFEH 1FNIA 1C5QA 4O3TA 1G3DA 3LJJA 1OWKA 3JZ2B 4A7IB 3T2NA 1WXRA 3P70B 1KMHB 4OS4A 2UWLA 3CP7A 1OP2A 5BRRE 3EA8A 1IQNA 3SI4H 3ZZDA 4TWYA 3TU7H 4NZLA 1OWDA 1Z6JH 2PLXA 3OFND 1ZZZA 1QRZA 1UTJA 1VJAU 2TPIZ 5KEDA 2FOGA 3ZZ4A 1F5KU 3ZVGA 3HPTB 5ABWA 3UOUA 4CHAC 1KLIH 1NFXA 3E0PB 5KGOA 1C5NH 1QURH 2EEKA 4F48B 4ZCNA 1GI3A 2GV6A 3OEHD 1HAXB 1O5CB 2KCYA 3PM3A 1TNLA 5J4QA 1GI6A 4RT1A 4XOJA 3SQEE 1YLNA 1ABJH 1LPGB 1ELAA 2KAIB 2OTVA 3MYWA 5E8EH 1SLWB 3BTWE 3RMLH 2Z3DA 2AS9A 4X1SU 3FVFB 4BAMB 1GL0E 3RXIA 3A88A 1C5ZB 2D2DA 2F43B 2UUJB 4I31A 2ZTZA 2WPDD 3U8OH 1P10A 2P8OB 3NKKA 1HAPH 1QJ6B 3KN2A 1AB9B 2BOHB 3P8NA 4A92A 1SQOA 2HPQH 2AGIX 4UE7H 2XBWA 1XUIA 3PV2A 5C67A 5LPFA 2WV9A 2NU3E 2XBYA 3VB3A 4BXWA 1OHHD 5FX5A 1ZTLA 2FZZA 4X6OA 1D6RA 3WY8A 1GBTA 3RXUA 5CHAB 2BD8A 2FIRH 1SHHB 1C2HA 1Y3WA 1MUEB 1KXDA 2KCOA 2ZG0H 1BOQA 4WJG2 4WMFA 1QRWA 4ABJA 1O2GH 2BQ6B 1DPOA 1LVYA 4JK5A 3UPEA 4E05H 1GI9B 1WTHD 2RCEA 4NCYA 1MTWA 1YF4A 2ZECA 1HUTH 1PQ8A 1GJ4H 2QAAA 1QQUA 1TNKA 3QX5H 5T6GA 1FQ3A 2OC0A 2EQNA 3EA7A 2R3UA 1HJAC 2DE8A 2QGRA 3QK1A 5LPRA 1SGRE 1K1NA 5EG4A 1GJ8B 1Y5AT 2AGGX 3A87A 3RXBA 1YKTA 1YLCA 2QCYA 5ESBA 5FBEA 5JB8S 1A0LA 4Y8XA 1HFDA 3DSPA 2A7HA 4AB8A 2TGAA 3BTTE 3UB0A 2LPRA 2P93A 2W6ID 2YMSC 2K1QA 5HIYA 1ETSH 2UUFB 4NSVA 1F0TA 1X7AC 4NA8A 3SYJA 1C2JA 3OYPA 2WV5A 3S9BA 3MOCA 1GPZA 1TOMH 1OP8A 2C8XB 4E7RG 2CF9H 3ZZ9A 1AHTH 1GJ5H 1AVWA 2J97A 1GBEA 1O3DA 4Q7YA 2EI8A 5AF9H 1IQIA 1WU1A 2QA9E 3ZVDA 1T31A 2M2AA 3MNSA 3BTHE 1Y5BT 3V12A 1S84A 5A09A 4ACAA 3KGPA 2ANKH 3A7VA 3TNTA 3TNSA 4I8HA 3GICB 2SNWA 4HZHA 5EQRA 4ASHA 2XCNA 4CRBA 1RD3B 2O8MA 2Q1JA 3M5OA 4TYDA 1Q31A 4R8TB 1AIXH 2F9UA 1P0SH 4LOYH 2STBE 1NBMD 3VB6A 3A8CA 2ZDNA 3RU4E 7GCHG 2UWOA 4YESB 1AFQC 5GCHG 2ZKSA 3K6ZA 4CRFA 2GZ9A 1N6XA 1TGSZ 3DCLA 2AGEX 1C1WH 3MHWU 1V2NT 1P9SA 2WUCA 1GCTB 5F8TA 1FZZA 1B0EA 3TGIE 1O2XA 2BZAA 1RS0A 3RMMH 1YPHE 2NWNA 2GTBA 2UUYA 5DJ7A 2B5TB 1UCYH 1W0ZU 1HGTH 4UONA 1W10U 3HGNA 5E2PA 3SU4A 2A2QH 4B74A 1BITA 2P16A 1BIOA 1VCWA 1W0JD 1RTFB 3E90B 3E91A 4Z0KA 3U8TH 3PLPA 1GBKA 1LQDB 2P59A 3VG8A 3PTNA 1TX7A 1LVMA 1LHDH 1FPHH 2XBVA 1HV7A 1EJAA 1HAHH 1NO9H 1G2MA 1XM1A 1G3EA 1Y3VA 4MPXA 3TJUA 3FFGA 2ZQ1A 1FJSA 1ZSLA 4B6EA 4KTCA 1SGFG 4LK4A 1C1SA 1JMOH 1XUGA 1QHRB 2C3SA 3F0PA 3SO3A 1K21H 3ZVBA 1XKAC 3LGIA 5PTPA 2CN0H 1T8OA 1UVUH 1DS2E 2Y5GA 3N99A 3GY3A 1L1NA 2ZFTA 1XVOA 3URDA 1O3BA 1ELCA 1MD7A 1S0RA 3ZZ6A 3UUZA 2BLOA 4MVNA 2F91A 2RDEA 3A81A 3TLOA 1GCDA 1O30A 4RI0A 2GVFA 4DT4A 2F9OA 2ZEBA 2BZ6H 3EYDA 1FY1A 1H8DH 2BDIA 3P8GA 3SUGA 1UHBA 5KECA 1V3XA 3ZVEA 1DUEA 2YMSD 1FIWA 2SNVA 3ATLA 1P02A 1VGCB 1C2FA 2F9NA 3RC6A 5DO4H 1C1OA 1GDUA 1ZYOA 5FHTA 4OGYA 1K1IA 1AO5A 3BG8A 2P8OC 1C2KA 3UR6A 1O5EH 4YLUA 3SNCA 1G36A 1S6FA 1TMBH 3BTGE 4OGXA 4U01A 3MQKC 1C5UA 3BEFB 1GHYH 1UCYK 1G3CA 2C93B 1CHOF 1RIWB 3BG4B 3RLYH 2QXHA 1BBRE 3A7WA 2V0BA 5EQSA 4X8UH 1JIMA 1UTKA 3CNRA 2GX4A 1CE5A 3Q3KA 3A82A 3STIA 5CHAC 2GD4B 4JYTA 1EZXC 1O38A 1SFQB 2HLCA 3SV9A 3BEUA 3FZDA 2KX4A 1O2UA 3QGNB 5SGAE 3ODFA 2F83A 3Q3YA 2G8TA 3GY2A 1GBLA 4UFDH 3AAVA 1EXFA 4Y8YA 1JXPA 2FLRH 1GMDG 1SGFA 1EZUC 1Z1IA 2OP9A 1KSNA 3NCLA 4GHQA 2BHGA 4B2BA 3ATWA 1V2LT 2ASUB 2P3UB 2SGEE 1UK2A 2XWBI 4WY3A 4X8TH 3GCHC 2HRVA 1C5LH 1GJAB 2B7DH 2FI4E 2JIZD 5EW2H 3F9HA 2JETB 3AAUA 4IC5A 5EODA 4MLFB 1GHAF 1ZPCA 3O8CA 1OS8A 1LPKB 2BLWA 4X2WA 4TT3D 4BXSA 2BXUH 4DVAU 1EJMA 1E79D 1TQ7B 2LNCA 3SNAA 2PR3A 1P3EA 3ZIAD 1OX1A 1MH0A 1NTPA 3ATKA 1T8LA 1ZPBA 3T62A 1KTSB 2ZPQA 2L74A 2Y7ZA 4OS7A 2ZU1A 3RP2A 1O3HA 3U1IB 3SU2A 1SFIA 1AE5A 1RGQA 1S85A 5EXMA 4BTTB 5HIZA 1O3PB 1GL1A 1QGFA 1O2PA 2SGAA 1B5GH 5T6FA 4X6MA 2H9TH 1PPGE 2ZU2A 3ZVFA 1TWXB 4WVPE 1HB0B 5JBBS 1KDQA 4X2YA 4DOQA 8GCHF 4AFUA 1ZTKA 2CMYA 3HATH 3RC5A 1AUJA 4FETA 4WF8A 1YP9A 1N8OB 1O0DH 1TRMA 6CHAC 1L4ZA 1M9UA 4D76A 3KF2A 1V2OT 2KFWA 5CHBA 5HYOA 2P94A 2HNTC 4X6PA 2PFEA 1WYKA 2RFKC 2PGQB 3PRBA 1FY4A 3RXDA 4GHTA 1EAIA 2G5NA 2YOLA 1GCTC 3FO8D 1MTUA 1HAGE 3BTME 1H1BA 3F2FA 1K2I1 3S9CA 1ZRBA 1KXFA 1O2VA 3S7KB 2KAIA 4YM9A 5DP6A 1TPOA 4K2YA 3GCOA 2BDYA 2GZ8A 2XYAA 4CHAB 3E16B 2V3OH 4H4FA 4LZ4B 1DT2A 2Z3EA 3GY7A 2J92A 4GAWA 4GUXA 1S5SA 3PMAB 1BHXF 3UY9A 4CRCA 2ZHQH 4X1RU 2AH4X 2AERH 2IN2A 1Z8JB 5LPEA 2TBSA 4XBCA 2EI6A 5A8YA 5EGMA 1UTNA 3M3VA 3QDZB 1ZMNA 3TPIZ 1P2IA 1TYNA 4IGDA 1P05A 2G4TA 1SC8U 1OOKB 2ANYA 2PKAB 3ZVCA 4ZXYH 2O8WA 1OYTH 3MO6A 1DLEA 1H4WA 2FI3E 8ESTE 1PPEE 1ZGVA 4B6FA 1DXPA 4XDEA 2ZGXH 1BTWA 1HAIH 3M36A 3MNBA 2K8IA 3O8DA 4FVBA 4XE4A 3OAAD 5A8XA 3T29A 1DX5M 1C5TA 1NN6A 3IWMA 1YYY1 2BY6X 3PWBA 3QN7A 4ABAA 2F3CE 3MH7A 2A7JA 2F9PA 3ZV9A 4WMEA 1SI5H 2NU4E 1EB1H 5FX6A 1NRSH 3TIUA 3WWBA 1MU8B 7KMEH 3LPRA 3WWFA 2HALA 1NRNH 1VGCC 1C1RA 2QY0B 2WPMS 3PV4A 4FUEA 9ESTA 1C5RA 1A4WH 1K1JA 1TIOA 1EJNA 1V2TT 5EJ1A 1W8BH 2O8TA 3SJKA 5EJLA 2TGPZ 1TGCA 2Z94A 2ZO3H 1V2KT 2R3YA 5IYTA 1RRKA 2JJ2D 1MABB 2A4OA 1WSSH 1CHOG 2PTNA 3T27A 3D62A 4YOJA 2YMSB 3A80A 2HGTH 2QYIA 3RXAA 5GXPA 4HG6A 4MNYA 1AWFH 5CE1A 1A3BH 3GY5A 4BTIB 2TIOA 1TGBA 5LH8A 3LGYA 1BA8B 4Q7XA 1A1RA 3F6UH 2ZDMA 1HJ9A 4GCHG 2ZDKA 1O3EA 2Y6TA 2FOBA 1QNJA 1BMFD 4Q4LA 2FEQH 3S9AA 4YOIA 1L4DA 1BCUH 1YCPH 2A4RA 2F4LA 5JBAS 1QZ8A 4UDWH 2C8WB 5EW1H 1QL7A 2G81E 4I33A 2G4UA 2JETC 3M7TA 7GCHF 1SGQE 4Y7BA 1V2ST 1P01A 1OWEA 5GCHF 5DP3A 1W11U 4BNRA 1WV7H 2ODQA 1GBCA 3MO3A 3M5NA 1EFRD 4F4OC 5A2MH 2WPLS 1Z6EA 1E34B 3W95A 2BM2A 4ZAEA 2ZWLH 3FAOA 1F0UA 1O2TA 2KZ4A 4K1TA 4ZKRU 2YNBA 1UVSH 2ZFFH 3P95A 3PMJA 4Z6AH 1ZOMA 1QJ7B 3K6YA 3SV6A 1FY8E 1TBRH 1TNJA 1MU6B 1C5WB 2OQ5A 4ABBA 2YNAA 3DHKH 5HM9A 5A8ZA 3RXRA 9LPRA 4NIYA 1LHEH 5C1XA 1GHWH 6GCHG 8GCHG 1UJ1A 2WV4A 5GJ4B 5C1YA 1F0RA 1V2JT 3K9XB 5F6MA 3O8RA 1RFNA 4XBBA 2AHME 2W3IA 3KHVA 1XXDA 1ARCA 3RXJA 1ANDA 1UO6A 1ZHMA 3GY8A 4NG9H 5FPTA 1K22H 2BY8X 2Z6BD 1C2MA 4FUDA 1HDTH 3BTFE 3M3SA 4WMDA 3PO1B 4TPYA 1Z8GA 3SU5A 2ZFSA 5HKKD 3DD2H 1HLTH 2VU8E 2OBOA 4KELA 2C90B 1FMGA 2NU2E 2Q6DA 2FXRA 4F55A 2PP6A 5A0BA 1T4UH 1QBOA 4K69A 1YCPK 5C1UA 4FUJA 1S6HA 4KKDA 3SUEA 1SLVB 1N1LA 1BBRH 3BV9B 1QL9A 3FOAA 3SU0A 2AFQB 2OUAA 1SSXA 4F49A 4XD7D 3TH4H 3A8DA 1L1JA 1GBJA 2W6JD 3IITA 3QO6A 1JIRA 1UTQA 4ZHAA 1J14A 1ARBA 1C4V2 4YTAA 4YZUA 5TCCA 1GDNA 1G2LA 2EI7A 2PUQH 2QC2A 4YT7H 2A7CA 3FANA 2JH0D 1PQ7A 1DY9A 3F1SB 1YY3A 4K60A 4MG3A 1F5RA 4FUCA 4JK6A 1P2QA 4MQAA 3NUMA 1EASA 2ZU3A 1VITF 2C4FH 3VEQB 2ZFRH 1EZSC 2EC9H 1QBNA 1GBFA 1ELDE 6ESTA 2J34A 2ZHEH 4Y10E 1O5GH 2BVRH 2ZI2H 1BMNH 3RXLA 2AIQA 4OS1A 2ZGHA 2ANMH 2FDAA 1WTGH 1QCPA 1W7XH 2BX4A 3OTJE 5HMAA 1E36B 1GMDF 2BD5A 1HIAB 1ETRH 1UTPA 2STAE 5L6NH 2LP6A 1AGJA 2VIPA 1O34A 3B9FH 4B1TA 2BOKA 2FOMB 4DGJA 1Z7KA 1O2IA 1D3PB 2SGDE 5TJXA 1O2HA 4VGCB 2FYQA 2W7SA 2A0QB 2ZZUH 1O3MA 3PTBA 1SOTA 1WUNH 4SGAE 3SZNA 1PPBH 1YGCH 2PWXA 4DCDA 1SQAA 3GCHB 2VWMA 1ABIH 3RXGA 3G01A 5BPEA 1WBGB 5DP7A 1OP0A 4I8JA 2HWLB 2QF3A 1HYLA 2L6OA 4BTUB 1EOLA 1BBRK 1V2WT 3HK6B 3SJIA 2A1DB 1ANEA 1INCA 4Y71A 2OD3B 1A61H 1XUFA 4XBDA 3EE0B 4X2XA 4TSFD 3SBKA 2OC1A 1SGTA 1Z8IB 4ZUHA 3RM2H 2G52A 2FESH 3GY4A 3T25A 3WW7A 5K0HA 1H9IE 1P06A 2ZP0H 1FLEE 4UFGH 1THRH 3A7XA 2GDEH 3ZZCA 1C1UH 1KYNA 3ZZ7A 4NWLA 3A89A 4Q7ZA 4A1VA 1ELTA 2XC0A 2WPIS 4K1SA 2CHAB 1DWDH 3F9EA 4MPVA 4Y0YE 2FOAA 1AZZA 4OS6A 3RXHA 1O5BB 2FX6A 2TRMA 6CHAB 3RLWH 1BJVA 4AZ2B 5EQQA 1DICA 1D4PB 4A1XA 4A6LA 3PLBA 1G3BA 2WPHS 4P00A 1BT7A 3K65B 3U28C 1FI8A 2J94A 4K8BA 3UOPA 1BZXE 1MZAA 2WYJA 2ILNA 1ELFA 1C5XB 3NK8A 1GWAA 3ZZ3A 1DVAH 1AKSB 1AQ7A 2F9BH 3ZZ5A 3AK5A 3OE7D 3L6PA 2BTCE 1LKBA 4JZ1A 4UFEH 2F9VA 1E35B 1KLJH 5DGJA 3UNQA 1PQAA 1O32A 2D8WA 1ACBE 1XVMA 3ITIA 3T5FH 1HAVA 3SNBA 1DOJA 1K28D 1C2GA 1LHGH 3ATIA 2FWWA 2OCVB 1EPTB 1MKXH 2IOTA 2ZCKP 4ABHA 3PLKA 1GJBB 4RSPA 4MNVA 2AEIH 3NRLA 2SFAA 4M9FA 1UK4A 2VGCC 2XWAA 1YWUA 4IN1A 3A84A 2BD7A 3SHCH 1OWHA 1ESBA 3PO1C 3ODDA 2VVCA 1DY8A 1COWD 2THFB 4UD9H 2HNTF 3UNSA 3BTDE 3UAIC 1TNHA 3S0NA 1O5AB 4I32A 2DE9A 2PGBB 1UMAH 3M7UA 5DPAA 3SW2B 4ZHMU 2J2UA 3PMBB 3OX7U 4DURA 1S83A 1HPGA 3GISB 3B23B 4INKA 3F2GA 3GCTG 1CT4E 3L33A 2Z9GA 1SQTA 1ZSKA 4DT7B 1VJ9U 4CR5A 2JKHA 1G32B 3ENSB 4JZEH 4CH8B 5EJZA 1Y3YA 2CF8H 1IAUA 3TK5A 2VWNA 1UK3A 2QXJA 2HPPH 4O9VA 1DWBH 1SGCA 1BRAA 1VITG 4FUHA 3SNEA 1YPMH 1TRYA 3QLPH 4TWWA 4Y11E 1GMHF 3MTYA 3TH3H 5C2ZA 4ESTE 4FUGA 1MKXK 2B9LA 2P3FH 2GZ7A 3EQ0H 1TFXA 3F9GA 5AFYH 3P92A 4RKJB 7ESTE 5JB9S 2FS8A 4NIWA 1DXWA 2XNDD 4GCHF 4K1EA 5DP5A 3QTOH 4RT0A 1K1OA 4CR9A 4I8LA 1O36A 1FPCH 1TRNA 3AW1A 4VGCC 5EXLA 3UFAA 3TH2H 1CGHA 4AFQA 2AMDA 4K5ZA 4NWKA 3LGVA 3SGQE 1CT2E 1YPKH 2R0LA 3ELAH 1CA8B 2C8YB 8KME2 3P17H 1S0QA 2Z9IA 2J5UA 1T8MA 2HLDD 1GVZA 1OKXA 3RXSA 5JPMH 4IBLH 1TB6H 1VZQH 2QF4A 1O3GA 2OC7A 2PTCE 1TA6A 3TK6A 1CHGA 1V2MT 2H5CA 3SORA 4U2WA 1NS3A 1HRTH 2QE7D 4AFZA 1Y59T 3PB1E 2W26A 2GP9B 1SGYE 5DK1A 3E6PH 4IN2A 2ZCLP 5GPIB 4ABIA 1ESAA 5L30H 3BSQA 2JH5D 2ALVA 1IOEA 4Y79A 1CQQA 4NIXA 1BUIA 1W0YH 3Q77A 1P11E 2FOFA 4YXWD 1P2KA 6GCHF 4Q63A 1H8IH 1ANCA 4OS2A 5C17A 5B6LA 2CHAC 2BX3A 1YPHC 1O2QA 4ISIH 2H6MA 4I86A 2KCPA 1Z8RA 4FUFA 3FP7E 4Q80A 2ZGBH 4FU9A 2HOBA 1PYTC 1ANBA 1CO7E 3LC3A 3IG6B 1GHZA 1NFWA 3SJ8A 2ZFQH 3H5CB 4KGAA 5EU8A 4H6SB 1QTFA 1THPB 3AVZA 1A7SA 2A5AA 5GWZA 3HKJB 1SB1H 5C5OA 3A8BA 4WH6A 2O8UA 3SU3A 2QIQA 4FUBA 4WXVA 1KIGH 1O31A 2PSXA 3FKSD 1QA7A 1AMHA 1ZSJA 1TAWA 1QB1A 3RMOH 4H6TA 1ZRKA 1CT0E 1XX9A 3HGPA 4AYYB 1NRQH 1WQVH 2P95A 1HAYB 1ZMJA 1MAXA 1ETTH 4DW2U 5E2OA 3UTUH 2ZGJA 1BMLA 5T6DA 1ZHPA 1EPTC 3D65E 4MPWA 1MD8A 2A31A 2G55A 4ABEA 1IHTH 4AOQA 1J9CH 1FN8A 2J9NA 4FVDA 4AYVB 2NU0E 1JOUB 1PFXC 1D3TB 4X1PU 2A5IA 2Y82A 4JZIA 1EAXA 4JCNA 3FN8A 3C27B 2FOCA 5L2ZH 2FTMA 5I46H 1HIAA 3A7TA 3QZRA 5AFZH 1EAUA 4HFPB 1A3EH 3N7EA 1V2RT 1O3LA 2OK5A 1GI5A 1O35A 2H1UA 4DJZB 1GGDC 1J15A 3M3TA 2I6SA 2ULLA 1GJ7B 1MCTA 1LO6A 1P12E 3SHAH 5FCKA 3DT0H 1O2ZA 1GMCG 2ZU4A 1AD8H 2D26C 2EA3A 4INHA 1A5GH 3STJA 3LGWA 3NPSA 1ELGA 2FYRA 1O39A 1GI8B 1UVTH 1NRPH 4RN6A 2JDID 4Z1MD 5LGOA 1NESE 1UCYE 1KXEA 1MQ5A 2ZHWH 3QWCH 2VJ1A 3ZVAA 1GJCB 1MQ6A 3MNXA 1CGIE 1ZGIA 1GBIA 3RU4D 1FY3A 1FUJA 1P2JA 1GG6B 1SKYE 1SQRA 2RA3A 1FDPA 5CDFE 4IS5A 4CRGA 6LPRA 1P2NA 1KLTA 3W1EA 3TJVA 1Y8TA 1MZDA 1GJ6A 3LOXA 3GOVB 2BY9X 1A5HA 2Q6FA 1FAXA 1GDQA 3AW0A 2HVXA 3LH1A 1GVLA 2J98B 2VH0A 1GMHG 3EGKH 3F0OA 3OTPA 3RMNH 1AWHB 1J17T 3ZV8A 5J4SA 1TX8A 4Y7AA 4OS5A 3E1XB 1PYTD 2H2ZA 1SVPA 3SGBE 4JYUH 1FV9A 4FOUC 1WCZA 1DANH 3VGCC 2KM0A 1E37B 3TJNA 1CA0C 4TPIZ 3I78A 1GBAA 5I25A 3Q00A 3FP8E 1V2PT 4QT8C 2ODYB 1LPZB 5C94A 3DUXH 1MKWH 1UVPA 3BTQE 2PUXB 2Z9KA 2A45B 1AKSA 4IC6A 1C5YB 2VIWA 7LPRA 1EAWA 1EP6A 4ZHLU 2BD4A 4ABFA 1P09A 2TGTA 2G00A 1C2EA 4X6NA 3KNXA 4INLA 4CBNA 3LGUA 1JRTA 1HBTH 2W3KA 1B0FA 3MI4A 4NGAH 2GDDA 1C1NA 3MMGA 1HNEE 2WSSD 4DIHH 1P2OA 1NZQH 2KCAA 3KIDU 2G5VA 4X8SH 1S81A 4KTUA 3TGJE 1C2IA 1LDTT 3EE7A 2VVUA 1QJ1B 1C9PA 3KQBA 2B8OH 5F03A 3RXFA 5C5NA 1E38B 2GCHF 3QZQA 4AGKA 2BDHA 4D9RA 1BJUA 2FMJA 1O3NA 1BTXA 2VINA 2BDAA 1LMWB 4IMZA 1QRXA 5IK2D 1C1VH 2XC4A 5FCRA 1VR1H 2IJD1 5DKMA 5C20A 1CGJE 5F8ZA 4YT6H 3VFEA 1TGNA 1W13U 2BMGB 2VGCB 3BIVH 3SV7A 1ELBA 4JZDH 2A4GA 3OSYA 4GSOA 3UNRA 1W14U 3RXTA 3OEED 3LIWA 3PRDA 3RXQA 4U30A 4AG2A 1NROH 1NY22 1W2KH 3Q3XA 3E0NB 1SLXB 3SOSA 1PPCE 1GI4A 2FX4A 3EDXB 1PPFE 1AVXA 1MKWK 1XMNB 1YC0A 2QN5T 1SHYA 2GCTC 4NFFA 2V35A 1MAYA 2FPZA 3OU0A 4TY6A 1A46H 1SGDE 2BD9A 4JYVH 1ZLRA 3GCTF 5DN6D 4MNWA 3PV5A 4GLYA 2IPHA 4CBOA 4IMQA 5DG6A 4B75A 4Y76A 1TE0A 4NZQA 4JMYA 2QXIA 3DA9B 1KXBA 1WAYB 1NFYA 3SU1A 1P9UA 3KQCA 4ISNA 1SGEE 4AFSA 1SPJA 1TMTH 1UTLM 3ESTA 1TPSA 1P57B 1Y3XA 1K9OE 3RM0H 2JJ1D 2CV3A 2ZDAH 1ZJDA 2FOEA 2ODPA 2PW8H 1FN6A 1A0HB 1GBDA 2QF5A 1TALA 4A5TS 1ELEE 2WUBA 2BD2A 3EA9A 3BF6H 3MU8A 1XUHA 4YO9A 3F68H 5EPNA 3RXMA 4HI3A 1E1RD 3I29A 5FBIA 5DP8A 2Z9LA 3UREA 3RXKA 3LONA 1W3CA 2OLGA 1A0JA 8LPRA 1WOFA 1GVKB 2Z3CA 1E0FD 2Z7FE 2TGDA 2ZFPH 3UWIA 4B2AA 1LVOA 1TOCB 2V3HH 1GBHA 2RDLA 1CVWH 2W5EA 1BTUA 1OPHB 3SNDA 2BQ7B 5HM2A 2ZNKH 3CENA 3W94A 4Y6DA 4ZROA 2XCFA 4AX9H 1HXEH 1LTOA 4B2CA 4A1TA 5CMXH 1DLKB 1JWTA 3RC4A 2BVSH 4CRAA 1NPMA 1O3FA 1BRBE 1QQ4A 3KEEA 1GBBA 4GPGA 2Y5FA 3U69H 3FZZA 3NXPA 1IQKA 2XC5A 2M5TA 2ZDLA 2NU1E 1S6LA 2XNIA 1O5DH 2A5KA 4D8NA 3VB5A 5AVDA 1ZR0A 1O3JA 1ZJKA 1FAKH 1GG6C 3UIRA 3UQVA 2V3MA 4XRNA 4LZ1H 3KCGH 4FXGH 1BTYA 2Z9JA 4B76A 1YM0A 4XSKU 1NFUA 1UTOA 2ZC9H 1O2MA 3GDVA 1LQEA 1Q2WA 2VIVA 3A85A 1MMJN 2I6QA 5EIYA 4NA9H 1C5SA 1TONA 1O5FH 4ZXXH 1D9IA 4WXIA 3TJOA 4BANB 3GYMA 5DP4A 1TQ0B 1IQGA 3U98H 3ZZAA 1IQLA 1FX0B 4ISOA 1NU7B 5C0UA 1O2KA 5E0JA 1NC6A 2R0KA 3A7YA 1IQHA 3DSOA 1TGTA 4SGBE 4X8VH 4OM9A 4YLQH 3I77A 3F9FA 2BY7X 4NA7A 1P03A 1W0KD 2GGVB 3MH4A 4ZKNU 2CJIA 2ALPA 4O3UA 1ZPZA 3A83A 1IHSH 3QGJA 1HAZB 2FP7B 4FU8A 1PPHE 1J16A 2BVXH 1C2LA 1EKBB 1K1PA 3NZIA 4E06H 4AC9A 4E7NA 1TPAE 1CBWB 1YPEH 1MTNB 3OY5U 2JH6D 2VWLA 5ETXA 1B7XB 2ZHDA 2XTTB 4BAOB 4FUIA 2BD3A 2SGFE 1C5VA 1OWJA 3SJOA 1SBWA 1TA2A 3TVJB 1V2VT 5A0CA 3KQEA 4H42U 2VH6A 4ACBA 3LU9B 3TITA 1MCVA 1SGIB 1RXPA 3GY6A 3GDSA 1DM4B 2XOKD 3V7TA 2QF0A 4BAHB 1TMUH 3H7OA 4I8KA 1XKBC 2PKAA 3N7DA 2GCHG 1YPJH 1EOJA 3S7HB 5EOKA 3QUMP 1T7CA 1C9TA 4P02A 2BDGA 5FAHA 4UEHH 1Z1JA 2VIOA 1V6DA 1P04A 4I7YH 1RTKA 1DSTA 3DFJA 1ZHRA 2GT8A 1DITH 1Y3UA 2C8ZB 2K0QA 2OQUA 4J2YB 1SR5C 2FOHA 5GDSH 3DFLA 1IQMA 1DDJA 3MU4A 3M5MA 1A2CH 1LCYA 2HNTE 2OC8A 3H7TA 2A32A 1U6QA 1O33A 3VB4A 5ESTE 1TBQH 1C4Y2 3ZYDA 5F53A 2BY5X 2J4IA 5A0AE 1GHXH 1YBWA 1GGDB 2FTLE 3SGAE 1GMCF 1KY9A 3CS7A 1K0HA 1SG8B 5FPYA 5DP9A 2GJGA 3KL6A 1H9HE 4B73A 2ANWA 2BDCA 3MH6A 4B71A 4GVUA 5GIBA 1C1MA 3QTVH 2CK3D 2J98A 2VIDA 1IQJA 3P6ZB 1O2SA 1QY6A 2XBXA 1QBVH 3RXVA 5C0TA 4WH8A 5EPYA 3MU5A 1O2LA 3D23A 2FS9A 4ABGA 1GI2A 1J8AA 3SI3H 3M7QA 3RXPA 1GBMA 1AI8H 1GHVH 1DWEH 1CSOE 3VXFH 2OINA 4XFQA 1HJ8A 3V13A 1GI0A 2D1JA 5E0GA 2RG3A 1XXFA 1AB9C 1AZ8A 3LJOA 5FXLA 1C1TA 1DWCH 1Z71A 3OY6U 4U32A 1QB9A 4Q2KA 3SUFA 3A7ZA 4K8YA 3VGCB 1G9IE 1CA0B 2WHXA 1BTPA 1WDIA 3UQOA 4R0IA 1AUTC 1AY6H 4DY7B 2KR7A 1MBMA 1LHCH 1N6YA 3LGTA 3MFJA 4ABDA 3Q76A 2FO9A 2VIQA 1O2YA 1SOZA 4X2VA 1BB0B 4IW4E 3RXOA 1F5LA 3U8RH 1EB2A 1SGNE 3GDUA 5JYIA 1ID5H 1KXCA 3KYFA 2SGPE 4NSYA 3M37A 2QXGA 1QA0A 1JRSA 1XUKA 4JZFH 4RKOB 1ESTA 3PMHB 2BDBA 4Y8ZA 1C5MD 5HGGA 1P3CA 2XW9A 4ZKSU 3SZEA 1PQ5A 1O2RA 1BTHH 2H9HA 2ZIQH 2ZU5A 1MBQA 1ELVA 1QB6A 2DUCA 1GHBF 2PKSB 1FIZA 1O2WA 1O2OA 4O03A 1GI1A 3TK9A 1BRUP 4WWYA 1QIXB 4AGJA 2W7UA 3EAJA 3MU0A 1O3AA 1H9LB 2AMPA 2R9PA 1UTMA 5L2YH 2ZTYA 3P8FA 2H9EH 4D9QA 1FY5A 1HXFH 1EUFA 4FU7A 5K7RA 1IQFA 1D3QB 1O2JA 1XUJA 1EQ9A 3SQHE 3D49H 1DE7H 2VBCA 1NRRH 3MH5A 3TGKE 1UVOA 1TABE 1BHXB 1BQYA 1O3OA 1EP5A 2RA0A 2O9QA 1CBWC 1SLUB 1MTNC 4BAQB 4ASUD 2BB4A 5E0HA 2OXSA 2VNTA 1JBUH 1OXGA 1BMMH 2CXVA 1O3KA 1VITH 4X1NU 2R2WU 1HAOH 1TX6A 1HCGA 2BLQA 1P2MA 1QFKH 4ISHH 3FP6E 1NU9A 1AU8A 2ZPSA 1W7GH 3PWCA 3MNCA 3LC5A 2IPQX 2GMTB 2PHBA 1BRCE 5HXFA 3F3BA 2ESTE 5DSFA 1WQSA 3B8JA 1TNGA 2WINI 2GCTB 1V2UT 1VCPA 5T3HA 3U9AH 3GYLB 3N7OA 2XXLA 3A86A 4D7FA 4PROA 3S69A 3H09A 5FPSA 4CH2B 3T26A 2V6NA 1AVGH 2ZPRA 3RDZA 2R2MB 1TLDA 3MU1A 1FONA 3SUDA 3UWJH 2IJOB 3DSGA 4I8GA 2FLBH 5FL7D 5G4BA 1T8NA 3SV2H 3RUOA 3HKIB 1BDAA 1W12U 3M5LA 1GJDB 4KTSA 4AN7A 3KYGA 1Q3XA 3M35A 1VKYA 3O8BA 1O2NA 2H5DA 2Q6GA 1IQEA 1PJPA 2Y80A 1RJXB 5GNDA 2CGAA 4O97A 3LKWA 2A4QA 5JBCS 1BTZA 1FXYA 2WPJS 1C2DA 1HAVB 1TBZH 5T1VA 1UW7A 1ZTJA 3AASA 3SV8A 3BTKE 3ZYEA 1NBME 3RXEA 3UR9A 2J38A 3ZZBA 3VB7A 2WPKS 5H4IB 1YLDA 2FM2A 1F92A 1C1PA 1L0ZA 2EY4C 3RXCA 1E1QD 5F8XA 1LKAA 3F2HA 1L2EA 3LT3A 3V3MA 4MNXA 1CU1A 1YPLH 2AMQA 2FI5E 4KP0A 4UFFH 3GCNA 3BTEE 2GT7A 1EZQA 1DFPA 3PYHA 1PPZA 2P3TB 3KQ5A 1C4U2 1H8HD 2O8LA 2GKVE 4BAKB 2ZQ2A 2Y7XA 3GS9A 5B6OA 2WYGA 3A8AA 4TY7A 2VVVA 4AORA 1D3DB 3BEIB 3BN9A 3LDXH 1O3IA 5EXNA 3SN8A 1VCQA 2PSYA 1HJAB 2QV1A 2ZHFH 4BOHA 1QL8A 1UHBB 2V7QD 3SJ9A 4X1QU 1RTLA 4HGCA 4DIIH 3T28A 1RIWC 3BG4C 2OBQA 3RU4T 4MDSA 4DG4A 2BXTH 2XRCA 2PV9B 3U1JB 3KQDA 3K2UA 3P8OA 2J95A 3ATMA 1ZMLA 2GV7A
chains in the Genus database with same CATH topology
1AE8H 1K1MA 1O37A 4X0WU 3VPKA 1G30B 1G37A 1TPPA 2ZA5A 3PROA 1C5OH 1YPGH 4NFEA 2BLVA 1K1LA 2UUKB 4MPUA 4AG1A 1MTSA 1A5IA 1DUAA 1EX3A 1F0SA 3JZ1B 3C1KA 3R3GB 3BIUH 1NT1A 2ZTXA 5AHGH 3V0XA 5JDUB 2A2XH 4THNH 5TCAA 1SMFE 1TNIA 3HK3B 3URCA 3R0FA 4ISLA 4CREA 1BMAA 1EPTA 4LXBH 4ZKOU 2B0FA 1SL3A 1Y5UT 2VWOA 3LH3A 4ZH8A 4J1YA 1QR3E 2PKSC 1AFQB 1O3CA 1GI7B 2VB0A 4Y0ZE 3SU6A 1P8VC 1GHAG 2Y5HA 1LVBA 1GHBG 3NWUA 1S82A 1L1GA 1T32A 2BQWB 2UWPA 2G51A 2SGQE 4MTBA 2BYAX 4AB9A 1EATA 1D6WA 1LHFH 2FODA 3MWIU 4K3JA 1GJ9B 4HTCH 3CS0A 1ORFA 1OYQA 1C5PA 4M7GA 1KXAA 2ZF0H 1AN1E 3E8LA 3E3TA 1T4VH 1OWIA 1THSH 2AYWA 1V2QT 4CRDA 1F2SE 4YOGA 2AIPA 2ZDVH 5C3NA 3VXEH 1DSUA 3M61U 4ZMAH 4NIVA 1NM6A 1KTTB 1F7ZA 3ZZ8A 2ZGCA 1N8OC 1YCPM 4D7GA 2ZCHP 3MO9A 5JBTA 1OSSA 2Y81A 1SGPE 5IDKA 1C1QA 2GMTC 1MTVA 3L3TA 1KDQB 1AFEH 1FNIA 1C5QA 4O3TA 1G3DA 3LJJA 1OWKA 3JZ2B 4A7IB 3T2NA 3P70B 4OS4A 2UWLA 3CP7A 1OP2A 5BRRE 3EA8A 1IQNA 3SI4H 3ZZDA 4TWYA 3TU7H 4NZLA 1OWDA 1Z6JH 2PLXA 1ZZZA 1QRZA 1UTJA 1VJAU 2TPIZ 2FOGA 3ZZ4A 1F5KU 3ZVGA 3HPTB 5ABWA 3UOUA 4CHAC 1KLIH 1NFXA 3E0PB 1C5NH 1QURH 2EEKA 1GI3A 2GV6A 1HAXB 1O5CB 3PM3A 1TNLA 5J4QA 1GI6A 3SQEE 4XOJA 1ABJH 1LPGB 1ELAA 2KAIB 2OTVA 3MYWA 5E8EH 1SLWB 3BTWE 3RMLH 2Z3DA 2AS9A 4X1SU 3FVFB 4BAMB 1GL0E 3RXIA 3A88A 1C5ZB 2D2DA 2UUJB 4I31A 2ZTZA 3U8OH 1P10A 2P8OB 3NKKA 1HAPH 1QJ6B 3KN2A 1AB9B 2BOHB 3P8NA 4A92A 1SQOA 2HPQH 2AGIX 4UE7H 2XBWA 1XUIA 5C67A 5LPFA 3VB3A 2NU3E 2XBYA 4BXWA 5FX5A 1ZTLA 2FZZA 4X6OA 1D6RA 3WY8A 1GBTA 3RXUA 5CHAB 2BD8A 2FIRH 1SHHB 1C2HA 1Y3WA 1MUEB 1KXDA 2ZG0H 1BOQA 4WJG2 4WMFA 1QRWA 4ABJA 1O2GH 2BQ6B 1DPOA 1LVYA 4JK5A 3UPEA 4E05H 1GI9B 1WTHD 2RCEA 4NCYA 1MTWA 1YF4A 2ZECA 1HUTH 1PQ8A 1GJ4H 2QAAA 1QQUA 1TNKA 3QX5H 5T6GA 1FQ3A 2OC0A 3EA7A 2R3UA 1HJAC 2DE8A 2QGRA 3QK1A 5LPRA 1SGRE 1K1NA 5EG4A 1GJ8B 1Y5AT 2AGGX 3A87A 3RXBA 1YKTA 1YLCA 2QCYA 5ESBA 5FBEA 5JB8S 1A0LA 4Y8XA 1HFDA 2A7HA 4AB8A 2TGAA 3BTTE 2LPRA 2P93A 2K1QA 1ETSH 2UUFB 4NSVA 1F0TA 1X7AC 4NA8A 1C2JA 3OYPA 2WV5A 3S9BA 3MOCA 1GPZA 1TOMH 1OP8A 2C8XB 4E7RG 2CF9H 3ZZ9A 1AHTH 1GJ5H 1AVWA 1GBEA 1O3DA 4Q7YA 2EI8A 5AF9H 1IQIA 1WU1A 2QA9E 3ZVDA 1T31A 3MNSA 3BTHE 1Y5BT 3V12A 1S84A 5A09A 3KGPA 2ANKH 3A7VA 3TNTA 3TNSA 4I8HA 3GICB 2SNWA 4HZHA 5EQRA 4ASHA 2XCNA 4CRBA 1RD3B 2O8MA 2Q1JA 3M5OA 4TYDA 1Q31A 4R8TB 1AIXH 2F9UA 1P0SH 4LOYH 2STBE 3VB6A 3A8CA 2ZDNA 3RU4E 7GCHG 2UWOA 4YESB 1AFQC 5GCHG 2ZKSA 3K6ZA 4CRFA 2GZ9A 1N6XA 1TGSZ 2AGEX 1C1WH 3MHWU 1V2NT 1P9SA 2WUCA 1GCTB 5F8TA 1FZZA 1B0EA 3TGIE 1O2XA 2BZAA 1RS0A 3RMMH 1YPHE 2NWNA 2GTBA 2UUYA 5DJ7A 2B5TB 1UCYH 1W0ZU 1HGTH 4UONA 1W10U 3HGNA 5E2PA 3SU4A 2A2QH 4B74A 1BITA 2P16A 1BIOA 1VCWA 1RTFB 3E90B 3E91A 4Z0KA 3U8TH 3PLPA 1GBKA 1LQDB 2P59A 3PTNA 1TX7A 1LVMA 1LHDH 1FPHH 2XBVA 1HV7A 1EJAA 1HAHH 1NO9H 1G2MA 1XM1A 1G3EA 1Y3VA 4MPXA 3TJUA 3FFGA 2ZQ1A 1FJSA 1ZSLA 4KTCA 1SGFG 4LK4A 1C1SA 1JMOH 1XUGA 1QHRB 2C3SA 3SO3A 1K21H 3ZVBA 1XKAC 3LGIA 5PTPA 2CN0H 1T8OA 1UVUH 1DS2E 2Y5GA 3GY3A 1L1NA 2ZFTA 1XVOA 3URDA 1O3BA 1ELCA 1MD7A 1S0RA 3ZZ6A 3UUZA 2BLOA 4MVNA 2F91A 3A81A 3TLOA 1GCDA 1O30A 2GVFA 2F9OA 2ZEBA 2BZ6H 3EYDA 1FY1A 1H8DH 2BDIA 3P8GA 3SUGA 1UHBA 1V3XA 3ZVEA 1DUEA 1FIWA 2SNVA 3ATLA 1P02A 1VGCB 1C2FA 2F9NA 3RC6A 5DO4H 1C1OA 1GDUA 1ZYOA 5FHTA 4OGYA 1K1IA 1AO5A 3BG8A 2P8OC 1C2KA 3UR6A 1O5EH 4YLUA 3SNCA 1G36A 1S6FA 1TMBH 3BTGE 4OGXA 4U01A 1C5UA 3BEFB 1GHYH 1UCYK 1G3CA 2C93B 1CHOF 1RIWB 3BG4B 3RLYH 2QXHA 1BBRE 3A7WA 2V0BA 5EQSA 4X8UH 1JIMA 1UTKA 2GX4A 1CE5A 3Q3KA 3A82A 3STIA 5CHAC 2GD4B 4JYTA 1EZXC 1O38A 1SFQB 2HLCA 3SV9A 3BEUA 3FZDA 1O2UA 3QGNB 5SGAE 3ODFA 2F83A 3Q3YA 2G8TA 3GY2A 1GBLA 4UFDH 3AAVA 1EXFA 4Y8YA 1JXPA 2FLRH 1GMDG 1SGFA 1EZUC 1Z1IA 2OP9A 1KSNA 3NCLA 4GHQA 2BHGA 4B2BA 3ATWA 1V2LT 2ASUB 2P3UB 2SGEE 1UK2A 2XWBI 4WY3A 4X8TH 3GCHC 2HRVA 1C5LH 1GJAB 2B7DH 2FI4E 5EW2H 3F9HA 2JETB 3AAUA 4IC5A 5EODA 4MLFB 1GHAF 1ZPCA 3O8CA 1OS8A 1LPKB 2BLWA 4X2WA 4BXSA 4DVAU 2BXUH 1EJMA 1TQ7B 2LNCA 3SNAA 2PR3A 1P3EA 1OX1A 1MH0A 1NTPA 3ATKA 1T8LA 1ZPBA 3T62A 1KTSB 2ZPQA 2Y7ZA 4OS7A 2ZU1A 3RP2A 1O3HA 3U1IB 3SU2A 1SFIA 1AE5A 1RGQA 1S85A 5EXMA 4BTTB 1O3PB 1GL1A 1QGFA 1O2PA 2SGAA 1B5GH 5T6FA 4X6MA 2H9TH 1PPGE 2ZU2A 3ZVFA 1TWXB 4WVPE 1HB0B 5JBBS 1KDQA 4X2YA 4DOQA 8GCHF 4AFUA 1ZTKA 2CMYA 3HATH 3RC5A 1AUJA 4WF8A 1YP9A 1N8OB 1O0DH 1TRMA 6CHAC 1L4ZA 1M9UA 4D76A 3KF2A 1V2OT 5HYOA 2P94A 2HNTC 4X6PA 2PFEA 1WYKA 2PGQB 1FY4A 3RXDA 4GHTA 1EAIA 2G5NA 2YOLA 1GCTC 1MTUA 1HAGE 3BTME 1H1BA 1K2I1 3S9CA 1ZRBA 1KXFA 1O2VA 3S7KB 2KAIA 4YM9A 5DP6A 1TPOA 4K2YA 3GCOA 2BDYA 2GZ8A 2XYAA 4CHAB 3E16B 2V3OH 4H4FA 4LZ4B 1DT2A 2Z3EA 3GY7A 2J92A 4GAWA 4GUXA 1S5SA 3PMAB 1BHXF 3UY9A 4CRCA 2ZHQH 4X1RU 2AH4X 2AERH 2IN2A 1Z8JB 5LPEA 2TBSA 4XBCA 2EI6A 5A8YA 5EGMA 1UTNA 3M3VA 3QDZB 1ZMNA 3TPIZ 1P2IA 1TYNA 4IGDA 1P05A 2G4TA 1SC8U 1OOKB 2ANYA 2PKAB 3ZVCA 4ZXYH 2O8WA 1OYTH 3MO6A 1DLEA 1H4WA 2FI3E 8ESTE 1PPEE 1ZGVA 1DXPA 4XDEA 2ZGXH 1BTWA 1HAIH 3M36A 3MNBA 4FVBA 3O8DA 4XE4A 5A8XA 3T29A 1DX5M 1C5TA 1NN6A 3IWMA 1YYY1 2BY6X 3PWBA 3QN7A 4ABAA 2F3CE 3MH7A 2A7JA 2F9PA 3ZV9A 4WMEA 1SI5H 2NU4E 1EB1H 5FX6A 1NRSH 3TIUA 7KMEH 1MU8B 3LPRA 2HALA 1NRNH 1VGCC 1C1RA 2QY0B 2WPMS 3PV4A 4FUEA 9ESTA 1C5RA 1A4WH 1K1JA 1TIOA 1EJNA 1V2TT 1W8BH 2O8TA 3SJKA 2TGPZ 1TGCA 2Z94A 2ZO3H 1V2KT 2R3YA 5IYTA 1RRKA 2A4OA 1WSSH 1CHOG 2PTNA 3T27A 3D62A 4YOJA 3A80A 2HGTH 2QYIA 3RXAA 5GXPA 4MNYA 1AWFH 5CE1A 1A3BH 3GY5A 4BTIB 2TIOA 1TGBA 5LH8A 3LGYA 1BA8B 4Q7XA 1A1RA 3F6UH 2ZDMA 1HJ9A 4GCHG 2ZDKA 1O3EA 2Y6TA 2FOBA 1QNJA 2FEQH 3S9AA 4YOIA 1L4DA 1BCUH 1YCPH 2A4RA 5JBAS 4UDWH 2C8WB 5EW1H 1QL7A 2G81E 4I33A 2G4UA 2JETC 3M7TA 7GCHF 1SGQE 4Y7BA 1V2ST 1P01A 1OWEA 5GCHF 5DP3A 1W11U 4BNRA 1WV7H 2ODQA 1GBCA 3MO3A 3M5NA 4F4OC 5A2MH 2WPLS 1Z6EA 1E34B 3W95A 2BM2A 4ZAEA 2ZWLH 3FAOA 1F0UA 1O2TA 4K1TA 4ZKRU 2YNBA 1UVSH 2ZFFH 3P95A 3PMJA 4Z6AH 1ZOMA 1QJ7B 3K6YA 3SV6A 1FY8E 1TBRH 1TNJA 1MU6B 1C5WB 2OQ5A 4ABBA 2YNAA 3DHKH 5HM9A 5A8ZA 3RXRA 9LPRA 4NIYA 1LHEH 5C1XA 1GHWH 6GCHG 8GCHG 1UJ1A 2WV4A 5GJ4B 5C1YA 1F0RA 1V2JT 3K9XB 5F6MA 3O8RA 1RFNA 4XBBA 2W3IA 3KHVA 1XXDA 1ARCA 3RXJA 1ANDA 1UO6A 1ZHMA 3GY8A 4NG9H 5FPTA 1K22H 2BY8X 2Z6BD 1C2MA 4FUDA 1HDTH 3BTFE 3M3SA 4WMDA 3PO1B 4TPYA 1Z8GA 3SU5A 2ZFSA 3DD2H 1HLTH 2VU8E 2OBOA 4KELA 2C90B 1FMGA 2NU2E 2Q6DA 2FXRA 5A0BA 1T4UH 1QBOA 4K69A 1YCPK 5C1UA 4FUJA 1S6HA 4KKDA 3SUEA 1SLVB 1N1LA 1BBRH 3BV9B 1QL9A 3SU0A 2AFQB 2OUAA 1SSXA 4F49A 3TH4H 3A8DA 1L1JA 1GBJA 3QO6A 3IITA 1JIRA 1UTQA 4ZHAA 1J14A 1ARBA 1C4V2 4YTAA 4YZUA 5TCCA 1GDNA 1G2LA 2EI7A 2PUQH 2QC2A 4YT7H 2A7CA 3FANA 2JH0D 1PQ7A 1DY9A 3F1SB 4MG3A 4K60A 1F5RA 4FUCA 4JK6A 1P2QA 4MQAA 3NUMA 1EASA 2ZU3A 1VITF 2C4FH 3VEQB 2ZFRH 1EZSC 2EC9H 1QBNA 1GBFA 1ELDE 6ESTA 2J34A 2ZHEH 4Y10E 1O5GH 2BVRH 2ZI2H 1BMNH 3RXLA 2AIQA 4OS1A 2ZGHA 2ANMH 2FDAA 1WTGH 1QCPA 1W7XH 2BX4A 3OTJE 5HMAA 1E36B 1GMDF 2BD5A 1HIAB 1ETRH 1UTPA 2STAE 5L6NH 1AGJA 2VIPA 1O34A 3B9FH 4B1TA 2BOKA 2FOMB 4DGJA 1Z7KA 1O2IA 1D3PB 2SGDE 5TJXA 1O2HA 4VGCB 2FYQA 2W7SA 2A0QB 2ZZUH 1O3MA 3PTBA 1SOTA 1WUNH 4SGAE 3SZNA 1PPBH 1YGCH 2PWXA 4DCDA 1SQAA 3GCHB 2VWMA 1ABIH 3RXGA 3G01A 5BPEA 1WBGB 5DP7A 1OP0A 4I8JA 2HWLB 2QF3A 1HYLA 4BTUB 1EOLA 1BBRK 1V2WT 3HK6B 3SJIA 2A1DB 1ANEA 1INCA 4Y71A 2OD3B 1A61H 1XUFA 4XBDA 3EE0B 4X2XA 3SBKA 2OC1A 1SGTA 1Z8IB 4ZUHA 3RM2H 2G52A 2FESH 3GY4A 3T25A 5K0HA 1H9IE 1P06A 2ZP0H 1FLEE 4UFGH 1THRH 3A7XA 2GDEH 3ZZCA 1C1UH 1KYNA 3ZZ7A 4NWLA 3A89A 4Q7ZA 4A1VA 1ELTA 2XC0A 2WPIS 4K1SA 2CHAB 1DWDH 3F9EA 4MPVA 4Y0YE 2FOAA 1AZZA 4OS6A 3RXHA 1O5BB 2FX6A 2TRMA 6CHAB 3RLWH 1BJVA 4AZ2B 5EQQA 1DICA 1D4PB 4A1XA 4A6LA 3PLBA 1G3BA 2WPHS 1BT7A 3K65B 1FI8A 2J94A 4K8BA 3UOPA 1BZXE 1MZAA 2WYJA 2ILNA 1ELFA 1C5XB 3NK8A 1GWAA 3ZZ3A 1DVAH 1AKSB 1AQ7A 2F9BH 3ZZ5A 3L6PA 2BTCE 1LKBA 4JZ1A 4UFEH 2F9VA 1E35B 1KLJH 5DGJA 3UNQA 1PQAA 1O32A 2D8WA 1ACBE 1XVMA 3ITIA 3T5FH 1HAVA 3SNBA 1DOJA 1K28D 1C2GA 1LHGH 3ATIA 2FWWA 2OCVB 1EPTB 1MKXH 2IOTA 2ZCKP 4ABHA 3PLKA 1GJBB 4RSPA 4MNVA