4ZKRU

The crystal structure of upain-1-w3a in complex with upa at ph9.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU01
1KIGH 4CRFA 1CHOF 4MLFB 4NA8A 1J14A 1ELEE 1L4DA 1HAPH 3M3VA 1F5LA 1PPBH 2FTMA 1FDPA 3KHVA 2BQ7B 1EZUC 3UFAA 1T8OA 1IQLA 5L2YH 4THNH 3RXJA 5HXFA 3P8FA 1GMDG 1TBRH 4CH8B 2SGDE 2ZU3A 3K65B 4DJZB 2Z9IA 4TY7A 1C1QA 1GHAF 2BTCE 2AGGX 4TPYA 3GYLB 1EZSC 3NXPA 1MQ5A 3RU4E 1KSNA 1UJ1A 3M7QA 1BTPA 5B6OA 3ZV9A 1T31A 5T3HA 1SGNE 1C1WH 1ZPCA 1GVLA 1L1JA 4RSPA 3UOUA 1AI8H 1E38B 2ZDKA 2ZFQH 3T29A 4TPIZ 3VPKA 3GDVA 3GYMA 5A0AE 4AB9A 2TGAA 4B2BA 1GI1A 1MCTA 3PWCA 4WVPE 3SV7A 1QRXA 4SGAE 2AERH 4YESB 1OOKB 4BAOB 1QQ4A 1J17T 5HM9A 1DWCH 1GJ9B 2HNTF 2NU2E 1NRNH 1GJBB 5FBEA 8GCHG 3GICB 4NIXA 1SC8U 1P2IA 2FP7B 1ESAA 1QB9A 2Z94A 1CU1A 1NN6A 5F03A 1UTPA 3ATLA 1Q31A 1GMDF 2GCTB 3I78A 3SN8A 4HZHA 2J34A 2GKVE 1GJ7B 2F9NA 2ANKH 1EAUA 1XM1A 4JZDH 3TIUA 2Y7XA 2IN2A 1TALA 2CXVA 1PYTC 4YTAA 4JK6A 1AWFH 1BBRH 3GCTG 3ZZDA 2GP9B 3LH3A 4ZH8A 1DVAH 2WYGA 3RMLH 3TJUA 2BX4A 1MMJN 6CHAB 1MTUA 4MG3A 1NFWA 2O8TA 1F0TA 2VH6A 3ATKA 5ESBA 3UQOA 4F4OC 3MHWU 4AFZA 1EB2A 5GXPA 1Y5AT 1AZ8A 3R3GB 3TLOA 4YO9A 3UUZA 3BTFE 1O3BA 4MNVA 1MTNB 2GDDA 2H1UA 3MU0A 1UO6A 1VCWA 3UQVA 1BMAA 2QIQA 4I32A 2FX6A 2WV5A 4INKA 2OXSA 3BTHE 1GMHG 1QTFA 4CBOA 2Y80A 4KKDA 2BXTH 1UTJA 1C9TA 2BLWA 1SL3A 2BLVA 2OD3B 2ZHQH 1O0DH 1G2LA 2PSYA 4Y11E 1GBAA 8GCHF 2UUYA 1Y3YA 1TNGA 2ZDLA 1SHHB 2A5AA 1BA8B 1J8AA 4WWYA 4BAKB 1HXEH 1LVYA 2ZGHA 3RXLA 3UR6A 5C5NA 5F8XA 2R9PA 2RA3A 1LHDH 3RU4T 3RXQA 3OY5U 2P3UB 4IMQA 1W13U 1AE8H 4UD9H 1C1SA 1UHBA 4IBLH 3P95A 1KDQA 1MTSA 1SOZA 3QO6A 3PMJA 4Q80A 5GWZA 1GI7B 5HMAA 2FOGA 1PPEE 5ESTE 3PMBB 3UNRA 1RTFB 4D7GA 3GY8A 4X8TH 1GBLA 3VGCB 3MH6A 2JETC 1O2TA 1SQTA 3P92A 1EAXA 3EDXB 1ZRBA 3C27B 4IC5A 5FXLA 4GVUA 1J16A 1DLEA 4JMYA 1GMHF 4HGCA 1B5GH 2K1QA 1ELVA 3JZ2B 5EQRA 1KLTA 1SGRE 1P2KA 2WPMS 1VJAU 5GJ4B 4H4FA 1LHFH 1YCPH 1GPZA 4FUCA 1EOLA 3V7TA 3R0FA 2BD3A 2PGBB 2A5IA 1ANCA 3SZNA 4Y76A 4OS1A 1K1MA 1S6FA 1TQ0B 1ZOMA 4Z0KA 3SU0A 3FFGA 3MO6A 1XUJA 1HXFH 3SHCH 3D23A 4E7RG 3QN7A 1SMFE 5ETXA 3KCGH 1YBWA 2FESH 3TVJB 1JIMA 3MWIU 1F92A 4RKOB 2SGFE 4DGJA 2C3SA 5FCRA 4X1QU 5C2ZA 4CR5A 3LOXA 1QJ1B 3RM0H 5HGGA 2G00A 2VGCB 1TAWA 4X8VH 1FMGA 2Z9GA 3RXGA 2W3IA 2JH5D 2ZCLP 3O8RA 3RMNH 1QL7A 2GCHG 4ABFA 2FWWA 1C1PA 5T6FA 2ODQA 3ODDA 1ACBE 5GPIB 3PTNA 1TBQH 1AD8H 1XKBC 1O2XA 2H5CA 2V0BA 3A8CA 2ALVA 3GISB 3QGJA 2G52A 2B5TB 2QC2A 1AQ7A 1DT2A 1AFQC 1DOJA 1UK2A 2TPIZ 2OQUA 4INHA 4BTIB 2BD4A 2BHGA 1SGPE 5T6DA 1SQAA 4DURA 1LVOA 4CREA 1GI0A 1H8DH 2FO9A 4Y0YE 4AGJA 2G4UA 1AGJA 3QTOH 1AIXH 2FI3E 8LPRA 3MI4A 4A1TA 2HALA 2JKHA 3AW0A 1FY3A 4BAMB 1EQ9A 1SGCA 1ZSLA 2XC4A 3P8OA 3MYWA 2ZZUH 5DP5A 4ISLA 1S84A 1EB1H 1S82A 2RDLA 3BTDE 5FBIA 1MD8A 1TRMA 5TCCA 1TRYA 4U01A 2ZU4A 2PSXA 2GCHF 2HLCA 4ABIA 1KXFA 5AF9H 1Z6JH 5A8ZA 1G2MA 1ETRH 4IMZA 1UTMA 1V6DA 1V2PT 1FY4A 2VWLA 1F2SE 3VXEH 1BMMH 1W10U 2G5VA 4QT8C 1JBUH 1TWXB 3BG4C 1XVMA 4Y71A 1P0SH 1XUIA 2ZQ1A 2XWBI 2V3OH 1AHTH 3LDXH 4NZQA 1ELTA 2A5KA 2XRCA 3CS0A 3ELAH 3UIRA 2AMQA 1A2CH 1NROH 1NFXA 3OSYA 3RXFA 3MOCA 5E0HA 5FHTA 3RU4D 3F9HA 1GBMA 2STBE 3MH5A 1P57B 3S9AA 2QV1A 3T5FH 2NU3E 1HIAB 1XX9A 1C2IA 3ESTA 2R0KA 2PKSB 2ZA5A 1SVPA 1CGHA 4ISOA 1CO7E 1C2DA 7ESTE 4OGXA 1TGSZ 1QNJA 1TX7A 5C5OA 2ZFRH 1CBWC 2B7DH 4O97A 4YOGA 1FI8A 2EA3A 1O2YA 2ZIQH 1L1GA 1ZRKA 2FXRA 2GZ9A 3RLYH 4NA7A 1F0RA 1HBTH 3ZVCA 4CHAB 2G5NA 1XXDA 4INLA 4E05H 3BEFB 2PTCE 1ZZZA 4D8NA 2VU8E 4UFDH 3RXPA 3T26A 1P2NA 1AZZA 4JCNA 3FVFB 1GBEA 4YT7H 3N7OA 1EAIA 1RTKA 4B76A 5DP4A 5TCAA 2V3HH 2Q6FA 3A8AA 4A1VA 1NO9H 4D76A 1LVMA 2BZ6H 4NSYA 3FP8E 4AGKA 3A89A 2Z6BD 3P17H 3S0NA 2VNTA 2ZU2A 1FONA 1WV7H 4PROA 2CF8H 2ZF0H 1BTWA 1D9IA 2ANYA 1T7CA 1GCTB 2IPHA 2BY8X 1A61H 1MCVA 1AFEH 1W11U 1NU7B 1V2TT 3BTME 3FAOA 1FLEE 3Q77A 1FAXA 1H9IE 4Y6DA 1C1TA 1O5AB 2CN0H 4D9RA 1V2KT 2OBOA 3GY3A 8ESTE 1SGQE 1DPOA 2THFB 5FPSA 1FV9A 2ZG0H 1N6XA 3V0XA 1M9UA 1ZHPA 2BD2A 3KQDA 1N8OB 3EYDA 1NTPA 3PO1B 4ZXXH 3TH2H 1VITG 1GHVH 1O2UA 2ANMH 4MVNA 1H1BA 2GD4B 5GDSH 2PFEA 1C2MA 1N1LA 1UTQA 2A2QH 2OTVA 2RCEA 4ASHA 2WUBA 4WMEA 2EI8A 5F6MA 1P8VC 2SNWA 1DWDH 1WCZA 3EA9A 3SU5A 1Z7KA 1ELCA 1TGTA 1MH0A 1ZPBA 4FVBA 1GVZA 1UTNA 2O8LA 1WU1A 1O5GH 4K1TA 4NIWA 1O2HA 3HGPA 2D26C 2FZZA 4JYTA 1DE7H 3LGTA 1GG6C 1VCPA 2ZWLH 1ZJDA 2HPQH 3SU2A 2BD8A 2R2WU 2ZDVH 5E2PA 4I8KA 1NRPH 1XKAC 2BQWB 1JOUB 3A7WA 3NZIA 1QCPA 2FEQH 3OY6U 5E2OA 2QAAA 1F0UA 2QY0B 1PPGE 3M36A 2SGEE 5FPYA 5J4QA 2P3TB 1AN1E 3VB5A 1UK4A 4A92A 4LXBH 2F9BH 5EW1H 2WPJS 4ZUHA 1YPMH 5HM2A 3RXKA 1IHSH 1CQQA 3V13A 1RS0A 3ATIA 2FOCA 3SUGA 3ZZAA 1TA6A 4XBCA 1RIWB 2C90B 4XBDA 1FY1A 2A4OA 3UPEA 1Q2WA 3D62A 3KQBA 4MNWA 1HJ9A 4ZKRU 1K1IA 3VB3A 5EW2H 1O2KA 4ISIH 2C8YB 2XTTB 2XC0A 4I8GA 3BF6H 2UUKB 4GUXA 4XDEA 1GHBG 1A3EH 1THRH 3ZZ7A 3PMHB 3RXSA 3F6UH 1O2ZA 1IQJA 1WTHD 1HAIH 1O5DH 2HNTC 3QK1A 1PPZA 2Q1JA 5JBBS 2J38A 1GMCG 3D49H 4KP0A 2FIRH 1G3BA 4MPUA 4DVAU 1HB0B 1V2VT 2TIOA 4MNYA 7KMEH 1GGDC 3LU9B 2Y6TA 5E8EH 1HGTH 1O2QA 3ZVAA 5A8YA 1AKSA 1LQEA 1HRTH 2NWNA 1HLTH 4FXGH 3TK5A 3NPSA 1GDQA 3SBKA 1P10A 3M5NA 1VITH 1MTNC 4LZ4B 4IGDA 1KLJH 5EGMA 1H9LB 1P09A 5DP3A 1EKBB 3TNTA 5DP7A 2BOHB 4NCYA 5K7RA 2SFAA 4R8TB 2ULLA 1O3CA 3RXEA 2EEKA 1O5CB 5I25A 3S9BA 1ID5H 3OX7U 1MBMA 3M61U 3LC5A 4DT7B 1YPLH 2HPPH 1YLCA 2ZTXA 3OYPA 3KL6A 1YPGH 1GDNA 1ZMNA 4UFEH 1S0QA 4ABGA 3MH7A 4ZKSU 4I8HA 1BJUA 4X1PU 1XUGA 3RXHA 4FUBA 1O3NA 1TNLA 3HGNA 2BLQA 1NC6A 4ABBA 1RGQA 2RG3A 4ZMAH 2HRVA 3MFJA 2BDHA 1TMBH 1JRTA 1V2LT 3SI3H 1YC0A 2XW9A 3H5CB 1MZAA 1C2EA 4YM9A 4DY7B 2ZHEH 5T6GA 5JB9S 1ANEA 1EUFA 4X1RU 1GI3A 2Z7FE 1TBZH 3RM2H 4NZLA 1OWEA 1TGBA 5C67A 2VWNA 3BIUH 1ZTJA 2QF0A 2VIWA 3TJOA 3QLPH 3ZZ4A 1KXDA 1UVOA 3B23B 2P59A 1H4WA 3BIVH 2J95A 2VIQA 3GY6A 1THSH 1P2MA 5C1UA 3F9FA 2QGRA 1V2WT 1V2NT 1V2RT 1QB1A 4A5TS 1K9OE 1NRSH 4LOYH 2XBWA 2TRMA 4FVDA 5LGOA 1OKXA 2FTLE 2PLXA 1TOMH 3QWCH 1OWDA 1C5SA 2AIQA 1EASA 3SO3A 4I31A 5JBAS 1NRRH 1Y3WA 3GOVB 3PLPA 4AYVB 2BVRH 2BVSH 1SGDE 3T2NA 1RTLA 1LPGB 1MTVA 5C1XA 1V2QT 3A80A 4ABJA 2VIOA 1OXGA 2CV3A 2WUCA 1WAYB 3BEUA 2VIVA 3PLKA 2VGCC 1O2MA 1P05A 4B75A 4BXWA 3M3TA 3ZYEA 2CHAB 1GI8B 4B2CA 4DG4A 4JZFH 2EI7A 2OINA 3PWBA 2EI6A 3RXTA 3ZZBA 3S9CA 5FCKA 2ZFSA 4X1NU 1ZHMA 3LGVA 2Z3EA 4H6SB 1LVBA 1O5EH 1EPTB 4X2XA 2QXIA 4GHQA 5BRRE 1A0HB 1P04A 1EZXC 3SOSA 4M7GA 4SGBE 3GCHC 1GI6A 3RC5A 3P6ZB 4X1SU 1K2I1 2WINI 3AASA 3H7OA 2VVUA 4MPXA 1O30A 3FANA 1WQVH 1O37A 1XMNB 2BY9X 3GCTF 1TNIA 2FYQA 1TNJA 3SGBE 2ZC9H 1GJ5H 2GX4A 1BRUP 3SU3A 2UWLA 1IHTH 1DXWA 4J1YA 2HOBA 2AYWA 5LPRA 2O8UA 5DO4H 3ENSB 2NU4E 1PQ8A 1D3PB 4FU9A 1C1MA 1SLUB 1DY9A 2A45B 2XCNA 1QURH 4Q7YA 5E0GA 3QUMP 1SG8B 3TJNA 4ZHMU 2R3YA 1NZQH 4VGCC 3SQEE 1C1RA 3EA7A 1ZTKA 2FYRA 4IN2A 1TMTH 3RXVA 4UE7H 1HAVA 1A5IA 2UUFB 1GBJA 1YPHC 2PW8H 2BDAA 3CENA 3E0PB 4HTCH 3P8GA 1CVWH 4YT6H 1FIWA 3K6ZA 3M7TA 2ZDNA 2Y5HA 2XNIA 3TGJE 2H6MA 5L30H 1K22H 1FAKH 2I6SA 3PROA 3OU0A 1DITH 1EOJA 3IG6B 2BX3A 1LTOA 1AU8A 1O2SA 2FOFA 5EG4A 3TGIE 3BSQA 4JK5A 1JWTA 2NU0E 2Z9LA 1WTGH 4X6OA 4XFQA 3QZQA 4CRAA 2OC0A 1NESE 3V12A 4I8JA 1O2JA 2QXHA 2GMTC 1YPJH 1A4WH 2JH6D 3M7UA 1QRWA 3U1JB 3SJ8A 3TH4H 2QA9E 1SGIB 4ABHA 4FUJA 1RXPA 1A0JA 1TPPA 2QCYA 1OP0A 5C3NA 1NFUA 4X8SH 4Y7BA 5EPYA 4TWWA 4NGAH 1ELAA 3RXIA 2ASUB 5DKMA 4FUGA 2A0QB 1NFYA 2ZQ2A 2Q6DA 1YPEH 2WPIS 4D9QA 4K1SA 5JB8S 3NWUA 3GDUA 4O03A 4NG9H 1Y5BT 3E0NB 4CHAC 2KAIB 1P3EA 3O8BA 1WBGB 2HWLB 2PGQB 3MO3A 1UTKA 2OLGA 4K8YA 5CHAC 1GL1A 4Q7ZA 3DFLA 1K28D 3M5OA 6ESTA 1A5GH 3P8NA 3A83A 4I33A 1ELFA 3SJKA 4BAHB 1YCPM 1W2KH 1SQOA 4O3TA 3QX5H 4BNRA 2IOTA 1SBWA 1K1JA 1G30B 1O36A 2P93A 3BTKE 1ZMLA 1LHCH 3H7TA 1Y59T 3RXOA 3S69A 3U69H 1ZR0A 3A81A 2PKAB 1EAWA 2M5TA 1BZXE 2BOKA 3RXBA 4UONA 1GBCA 3SV6A 1C5UA 2J94A 4Y8XA 2PV9B 1K1LA 2QF3A 4X8UH 4AB8A 2VWMA 1PPFE 2GV6A 3SUDA 2GDEH 1XUKA 2VB0A 1GBBA 2J92A 3SHAH 1S0RA 3PV4A 4UDWH 4B1TA 1CHGA 1L1NA 1NPMA 2XBVA 2R2MB 1QL8A 3PO1C 2VJ1A 3VXFH 4GHTA 4FUHA 3A7YA 1TPAE 1E0FD 3DT0H 1P2QA 3RC6A 1J15A 1LPZB 4FUDA 2ZPQA 1B0FA 3A84A 4FU7A 4YOJA 2OBQA 1MKXH 2SGPE 2P16A 2FDAA 4J2YB 1GI4A 5J4SA 1DDJA 1DY8A 3K6YA 4AYYB 1GHYH 1MBQA 3ATMA 1BTUA 1CT4E 2HGTH 3EGKH 2B9LA 5TJXA 2WPLS 2BDCA 4AZ2B 4K2YA 4X6PA 2ZHFH 1C1NA 3VB6A 1G36A 4FUEA 3HK3B 1O3MA 1DXPA 1AO5A 1KXEA 1FY8E 1HAZB 3LGUA 5FAHA 2BVXH 5A8XA 1ARBA 2F91A 4ISHH 1FN8A 1K1PA 5JBTA 1BJVA 2ODYB 2LNCA 2ZDAH 1G32B 5EPNA 1BRBE 2Q6GA 1P9SA 4B2AA 2ZU1A 2FOHA 1O3PB 4Y10E 3B8JA 1Z8JB 1ETTH 5EOKA 1BTXA 1HYLA 3TH3H 1MKWK 3KN2A 1TLDA 2D8WA 2VINA 3ZVEA 2ZI2H 1T8MA 1RIWC 1ETSH 4NSVA 3SNCA 4YLUA 1DWEH 1WSSH 4CH2B 2A7JA 1HAOH 5JDUB 1E36B 4KTCA 1IAUA 1Z6EA 2A4GA 1TONA 1O35A 1UVPA 3V3MA 2YOLA 3T25A 2GT7A 4LK4A 1D6WA 3IWMA 3PYHA 1OP8A 1QBVH 1MKXK 1MU8B 3MNSA 1T4VH 1TMUH 3UNSA 5G4BA 1OPHB 1YP9A 1OWKA 3Q3YA 1HNEE 3S7HB 1HJ8A 1SGTA 2C8ZB 3F1SB 3ZZ6A 3ZVDA 1KTTB 1O2NA 1GBKA 1E34B 2XWAA 1HJAB 1O3AA 1AWHB 1JRSA 2OCVB 5EXLA 2FM2A 1BTHH 3E3TA 4U2WA 1IQIA 1OWHA 1W7GH 1VGCC 1S5SA 2H9TH 3PTBA 3GY4A 1YGCH 3WY8A 3M3SA 3STJA 3DHKH 2Y5FA 1CT2E 2C93B 3L33A 1AMHA 4K60A 1O39A 3O8CA 2FS9A 1O2PA 1P02A 1H8IH 3E90B 4RN6A 3I77A 2PWXA 1NM6A 3ZVGA 1DSTA 1KTSB 1TNHA 4TWYA 5AFYH 1TFXA 1Y3XA 3U98H 4X2VA 5DPAA 5FX6A 3UNQA 1KXBA 3NCLA 1C4V2 3E6PH 3E91A 4IW4E 1ZPZA 1Y8TA 3TPIZ 1F5KU 1GI9B 4Y79A 1L0ZA 1TABE 4CRCA 1CA0B 4AX9H 2FPZA 1OP2A 1MZDA 2FOMB 2OQ5A 3NUMA 1HV7A 5DK1A 4AFSA 2BMGB 1MU6B 1ZYOA 4A6LA 2IJOB 2PHBA 2VIDA 1X7AC 2WPHS 1EX3A 5DGJA 1W14U 1N6YA 3GCOA 2CMYA 4ZAEA 9ESTA 1TX8A 3GDSA 4KGAA 4Y8ZA 1OWJA 3RXAA 5LPFA 1BTYA 3MMGA 2QXGA 3SV2H 2DE8A 1Z8RA 2V6NA 3BEIB 1SFIA 2A7CA 1P01A 3TITA 3PM3A 1C2JA 1SI5H 4NIYA 1VITF 2CF9H 1IQEA 3EE0B 3SJIA 4AOQA 1CBWB 2RA0A 1AB9B 1C5XB 2Y5GA 1C5TA 4OS6A 2ZGBH 4OS5A 4BXSA 1MAXA 2O9QA 2ZHDA 1LQDB 3I29A 2HVXA 1SPJA 3Q3KA 3MU4A 1WOFA 4X2WA 2D2DA 1OYQA 2GV7A 4IC6A 4BTUB 3ATWA 1TX6A 3G01A 2VIPA 1LKAA 1C5MD 3MNCA 2D1JA 3EQ0H 1Y3UA 4AG1A 4KELA 2GCTC 3DA9B 5EXMA 4XE4A 2BM2A 3L3TA 3QTVH 2BQ6B 3PMAB 1CA8B 1UHBB 1O3OA 1ELGA 2C8WB 1KDQB 1KY9A 1CHOG 2GVFA 1GI5A 5GCHG 2VH0A 2BDYA 2ZTZA 2STAE 2ZGXH 5EXNA 6CHAC 2BY7X 3BN9A 1K21H 3SJOA 2J2UA 1VR1H 1P2JA 1SLXB 1C5NH 1SGFG 4Y7AA 1HIAA 1A46H 4GCHG 3SU4A 9LPRA 3LH1A 4ABDA 3E16B 1GHAG 1Z1JA 2ZNKH 1O3IA 1O2LA 2BDBA 2UWPA 2ZGJA 5EQQA 3SNBA 3Q3XA 2AGEX 1UCYH 1SFQB 3SU6A 2FOEA 1TNKA 1ZTLA 1G9IE 1V2UT 1ORFA 2ZCKP 1GHBF 3A85A 1DX5M 3VB4A 1C1VH 1ZGVA 3RC4A 4A7IB 3FP6E 1DWBH 3M35A 3RXRA 1W8BH 1EP5A 1HUTH 1AVGH 1O2IA 3URDA 1MAYA 1GMCF 3TNSA 4GLYA 2ANWA 5GCHF 1OYTH 1LCYA 3L6PA 3RP2A 2VWOA 1RFNA 3UREA 2BXUH 1FIZA 7LPRA 1ZSJA 1BHXB 4WMFA 1UVUH 1C5RA 4MPVA 1OS8A 1P11E 1VCQA 4K5ZA 1O5FH 3VGCC 5LPEA 1VJ9U 1O2OA 2O8MA 3ZVBA 2F9OA 1F7ZA 1GG6B 4GCHF 5A2MH 3NK8A 4JYUH 1E35B 1GHZA 1A3BH 2FOBA 2W26A 3T27A 4Q2KA 1UCYE 2FODA 5LH8A 3K2UA 5A0CA 1TOCB 3A88A 1C5PA 1PQAA 1PYTD 1DUAA 1PQ7A 3D65E 1UCYK 3STIA 1IQKA 1UTOA 1W3CA 2XCFA 2Z9KA 3UTUH 1IQMA 1QQUA 2A32A 3URCA 4I8LA 4OGYA 1MQ6A 3DUXH 1HFDA 2QXJA 4ZROA 1V2JT 4WH8A 2OP9A 3SGQE 1SGEE 5FPTA 3RXMA 5EODA 4MTBA 2YNAA 4BANB 1IQNA 1ABJH 3KQCA 2A31A 3DFJA 3HATH 2F9UA 2A4QA 2LPRA 5I46H 1LMWB 3MU1A 1AY6H 1GDUA 1RJXB 1T8LA 5HYOA 1GBFA 1QIXB 4UFGH 3U8RH 1BB0B 1NY22 4B73A 4A1XA 1SOTA 4WXIA 2WV4A 3ZZ5A 1CSOE 2QN5T 3A7VA 4R0IA 3SNAA 4FUIA 3QZRA 1SB1H 1PFXC 2AS9A 2FS8A 4CRGA 1QL9A 1L4ZA 1GGDB 2C8XB 1BQYA 4ZHLU 2WPKS 1LO6A 4JZIA 3LJOA 1Q3XA 4X6NA 3PB1E 2P8OB 1ESBA 4ESTE 1J9CH 5A09A 2P3FH 1C1OA 2BLOA 3O8DA 3KF2A 3RMOH 4WF8A 2TGPZ 2XBYA 2H9HA 1UVSH 4YZUA 1BTZA 3A7XA 1FZZA 1C1UH 4WH6A 5JYIA 2F9VA 2A1DB 1YLDA 5AHGH 3F9GA 2P95A 2ZTYA 2FOAA 2UWOA 3RXDA 2H9EH 3DD2H 1LHEH 4ABEA 2ILNA 3SORA 1V2ST 3GY2A 3MNBA 4Q7XA 1GJ4H 1HAXB 3CS7A 4UEHH 1THPB 4X6MA 1AUTC 2OUAA 2F9PA 1BBRE 1LHGH 4ZKOU 4XSKU 2A4RA 2PUXB 1DLKB 4OS4A 2Z9JA 1BBRK 1DICA 3KQEA 3MO9A 1FUJA 2BDIA 1HCGA 3KGPA 3E1XB 2FMJA 2XBXA 3VFEA 1HDTH 5JPMH 3GY5A 4O9VA 2BY5X 1F0SA 2TGTA 1ZSKA 3AW1A 3Q00A 4E7NA 4D7FA 2AH4X 3ZV8A 1Y3VA 3P70B 3ZZ8A 1XVOA 1C2GA 3IITA 3SNDA 2HNTE 2ODPA 2AMPA 3QGNB 4U32A 1GVKB 1ELDE 1YYY1 3RUOA 4YOIA 4BOHA 1YM0A 6LPRA 1DUEA 1YF4A 3SQHE 1TE0A 3MNXA 3SNEA 1C4U2 1CE5A 1O3LA 1GJAB 3SV8A 7GCHG 1C5QA 3ZVFA 1O3JA 5F8TA 3BTQE 4CR9A 2TBSA 3RLWH 1B7XB 4NFEA 3ITIA 3LKWA 2AGIX 4WJG2 5GIBA 3NKKA 3HPTB 2PKSC 1EJMA 2Z3DA 5SGAE 4IS5A 1QBNA 1QY6A 1T32A 4CBNA 4GPGA 5DP8A 3ZZ9A 8KME2 1E37B 4CRDA 1SSXA 2VVVA 1P03A 5F8ZA 5CMXH 1V3XA 1O3FA 1D4PB 4WY3A 1C2KA 1FPHH 1D6RA 1BT7A 2G81E 1G3DA 4ZKNU 2R3UA 3LGIA 1EJNA 1HAGE 4HI3A 1Z71A 1ZJKA 3TJVA 2OC1A 1S83A 4BAQB 2XYAA 4X2YA 2J9NA 3LONA 6GCHG 5C1YA 1GJ6A 3RXUA 4AFUA 1SGFA 3ODFA 1Y5UT 4OS7A 4JZEH 5DJ7A 1EP6A 1INCA 1UTLM 1GJ8B 1FXYA 7GCHF 2YNBA 4X0WU 1YCPK 3U8TH 1C2FA 3GCHB 2EC9H 1G3CA 2BD5A 1KXAA 1AVXA 3SJ9A 1PPCE 2G8TA 4JYVH 4K69A 4LZ1H 1RD3B 3C1KA 1JIRA 2CGAA 1A0LA 1LKBA 5DG6A 1HAYB 1EJAA 1EZQA 3EAJA 2G51A 1ABIH 1QJ6B 1GL0E 4AFQA 2H5DA 3W94A 1DS2E 2F3CE 4FU8A 1XUHA 1HJAC 3A7ZA 1GCTC 2I6QA 2ZDMA 1FNIA 3JZ1B 1QBOA 2Y7ZA 1AE5A 2H2ZA 4ZXYH 5L2ZH 1ANBA 1BCUH 4DIIH 2ALPA 1WYKA 3SGAE 1VZQH 2JETB 1C2LA 1OSSA 2A2XH 2W5EA 1MKWH 3BTGE 4DOQA 5K0HA 4B71A 5EQSA 3A8DA 1DFPA 4TYDA 3F68H 1FQ3A 2OC7A 1N8OC 1TQ7B 1V2MT 3LJJA 1KYNA 3KEEA 6GCHF 2W3KA 3AAUA 1FJSA 4Y0ZE 4GAWA 3T62A 3UR9A 2Y82A 5EU8A 3KIDU 1QFKH 3AVZA 4VGCB 1LPKB 1QR3E 1CGIE 1O3DA 2BD7A 2BYAX 1ARCA 1EPTA 1GCDA 1O3HA 4ISNA 2UUJB 4GSOA 3SUEA 1MD7A 2FX4A 2SNVA 1GI2A 2J4IA 1OX1A 3K9XB 1GJCB 2GZ8A 1HAHH 1UK3A 1CA0C 3EA8A 1BMNH 2BD9A 1FN6A 2ZECA 2GTBA 1O34A 1B0EA 1NU9A 2DE9A 1A1RA 3LIWA 1ELBA 1T4UH 2W7SA 5L6NH 1S6HA 4XOJA 5AVDA 1C5VA 2O8WA 5E0JA 1SGYE 4AN7A 1QRZA 1EATA 1YKTA 2FLBH 3HKIB 3F9EA 3TGKE 1EXFA 1QA0A 4U30A 4UFFH 3SUFA 1O2WA 3UWIA 1BRCE 1W0YH 2GMTB 4NA9H 1AKSB 2TGDA 3FP7E 1ZMJA 2JH0D 3FZDA 4E06H 1PPHE 4AG2A 1QB6A 2PTNA 2FI5E 1UMAH 1O38A 1TGCA 3UOPA 1P06A 1AB9C 4WMDA 3GCNA 1C2HA 1XUFA 1GWAA 1BMLA 1O3GA 4CRBA 3LGYA 1QA7A 1AVWA 4ABAA 1ANDA 1AUJA 1G3EA 2ESTE 4DIHH 2OC8A 1O2RA 1P9UA 2ZHWH 1AFQB 1QHRB 1RRKA 2XC5A 1Z8IB 3A86A 5CHAB 4NWKA 1PJPA 3W95A 1D3QB 1C9PA 4JZ1A 4B74A 1O2VA 1F5RA 1S85A 1Z1IA 2BB4A 1ZGIA 1ZHRA 2ZEBA 3HK6B 3A82A 2G4TA 1G37A 1P3CA 3Q76A 1A5HA 1GBDA 1GHXH 2PUQH 2FLRH 1C4Y2 2AEIH 1K1OA 1U6QA 5BPEA 1H9HE 2ZPSA 1T8NA 1YPHE 4MDSA 1P2OA 2GZ7A 1BIOA 4O3UA 1WQSA 1GBHA 2R0LA 1GHWH 1BUIA 4RKJB 1GBIA 2QYIA 3A8BA 1SR5C 2Y81A 1DANH 1TPOA 1C5LH 1BOQA 2WYJA 4XBBA 3CP7A 1TRNA 2ZKSA 4KTUA 1C5YB 2GGVB 1SLWB 5H4IB 1LDTT 1TYNA 1L2EA 5CE1A 2ZP0H 3BG4B 1S81A 4F49A 5ABWA 2KAIA 1IQHA 4K8BA 3SI4H 1UVTH 1JMOH 5C20A 1BDAA 3BTWE 5AFZH 1IOEA 3UWJH 1V2OT 5IDKA 1MUEB 3RXCA 1DSUA 4YLQH 2ZPRA 2ZGCA 3ZZCA 2BY6X 1O5BB 2C4FH 2BDGA 1SLVB 1ESTA 4NIVA 4TY6A 2ZCHP 1D3TB 4I7YH 1CGJE 1GBTA 4HFPB 3U9AH 1A7SA 4NFFA 1HPGA 2PR3A 1FY5A 3ZZ3A 2ZO3H 3SW2B 4K3JA 3SV9A 5PTPA 3MU5A 3BG8A 1O33A 4ZHAA 2FI4E 2ZFTA 4AORA 3M37A 1XXFA 3GY7A 2PKAA 1YPKH 1NS3A 1D3DB 3LT3A 1KXCA 4DCDA 1O32A 3TK9A 5IYTA 3TU7H 1QGFA 2B0FA 1O31A 1TGNA 4OS2A 2ZFPH 4H42U 3MH4A 4MQAA 2W7UA 1NRQH 1FPCH 3U1IB 3RMMH 3U8OH 3LGWA 3M5LA 3A7TA 5DP6A 2G55A 5A0BA 3E8LA 1IQGA 1Z8GA 1NT1A 1TPSA 1DM4B 3VEQB 1SHYA 1KLIH 1TB6H 3BTTE 1MTWA 2V35A 3HKJB 4DW2U 5FX5A 2A7HA 2BZAA 3BTEE 2SGQE 1O2GH 2XXLA 1K1NA 2NU1E 3QDZB 2F83A 2Z3CA 2ZFFH 3RDZA 4KTSA 1CT0E 2AIPA 1OWIA 1C5OH 2B8OH 3OTJE 1TA2A 1ZLRA 2CJIA 5JBCS 4IN1A 1PQ5A 3MTYA 3MU8A 3BV9B 4Z6AH 1BRAA 4MPWA 2CHAC 1JXPA 3TK6A 3B9FH 3ZYDA 4Y8YA 2P94A 1VGCB 3FZZA 4BTTB 4NWLA 1BITA 2DUCA 3UY9A 3LC3A 2ZU5A 2AFQB 4MNXA 1P12E 3S7KB 1TIOA 1C5ZB 1EPTC 5DP9A 1HAVB 3LPRA 3AAVA 2P8OC 2SGAA 2AMDA 1W7XH 1W12U 1WUNH 3SU1A 1W0ZU 1QJ7B 3KNXA 3PLBA 1IQFA 2GT8A 3VB7A 1O3KA 4K1EA 3A87A 1C5WB 2VVCA 1GJDB 4WXVA 1BHXF 3T28A 4FUFA 4H6TA 1O3EA 3M5MA
chains in the Genus database with same CATH superfamily
1KIGH 4CRFA 1CHOF 4MLFB 1E1RD 4NA8A 1J14A 1ELEE 1L4DA 1HAPH 3M3VA 1F5LA 1PPBH 2FTMA 1FDPA 3KHVA 1COWD 1EZUC 2BQ7B 3UFAA 1T8OA 1IQLA 5L2YH 4THNH 3RXJA 5HXFA 3P8FA 1GMDG 1TBRH 4CH8B 2SGDE 2ZU3A 3K65B 4DJZB 3VG8A 2Z9IA 4TY7A 1C1QA 1GHAF 2BTCE 2AGGX 4TPYA 3GYLB 1EZSC 3NXPA 1MQ5A 3RU4E 1KSNA 1UJ1A 3M7QA 1BTPA 5B6OA 3ZV9A 1T31A 5T3HA 1SGNE 1C1WH 1ZPCA 1GVLA 1L1JA 4RSPA 3UOUA 1AI8H 1E38B 2ZDKA 2ZFQH 3T29A 4TPIZ 3VPKA 3GDVA 3GYMA 5A0AE 4AB9A 2TGAA 4B2BA 1GI1A 1MCTA 3PWCA 4WVPE 3SV7A 1QRXA 4SGAE 2AERH 4YESB 1OOKB 4BAOB 1QQ4A 1J17T 5HM9A 1DWCH 1GJ9B 2HNTF 2NU2E 1NRNH 1GJBB 5FBEA 8GCHG 3GICB 4NIXA 1SC8U 1P2IA 2FP7B 1ESAA 1QB9A 2Z94A 1CU1A 1NN6A 5F03A 1UTPA 3ATLA 1Q31A 1SKYE 1GMDF 2GCTB 3I78A 3SN8A 4HZHA 2J34A 2GKVE 1GJ7B 2F9NA 2ANKH 1EAUA 1XM1A 4JZDH 3TIUA 1YY3A 2Y7XA 2IN2A 1TALA 2CXVA 1PYTC 4YTAA 4JK6A 1AWFH 1BBRH 3GCTG 4XD7D 2GP9B 3LH3A 4ZH8A 3ZZDA 1DVAH 2WYGA 3RMLH 3TJUA 2BX4A 1MMJN 6CHAB 4B6EA 1MTUA 4MG3A 1NFWA 2O8TA 1F0TA 2VH6A 2KFWA 3ATKA 5ESBA 3UQOA 3MHWU 4F4OC 4AFZA 1EB2A 1YLNA 1Y5AT 1AZ8A 3R3GB 5GXPA 3TLOA 1W0KD 4YO9A 3UUZA 3BTFE 1O3BA 4MNVA 1MTNB 2GDDA 2H1UA 3MU0A 1UO6A 1VCWA 3UQVA 1BMAA 2QIQA 3U28C 4I32A 2FX6A 2WV5A 4INKA 2OXSA 3BTHE 1KMHB 1GMHG 1QTFA 4CBOA 2Y80A 4KKDA 2BXTH 1UTJA 1C9TA 3F0OA 2BLWA 1SL3A 2BLVA 2OD3B 2ZHQH 1O0DH 1G2LA 2PSYA 4Y11E 1GBAA 8GCHF 2UUYA 1Y3YA 1S6LA 1TNGA 2ZDLA 1SHHB 2A5AA 1BA8B 1J8AA 4WWYA 4BAKB 1HXEH 1LVYA 2ZGHA 3RXLA 3UR6A 5C5NA 2K0QA 5F8XA 2R9PA 2RA3A 1LHDH 3RU4T 3RXQA 3OY5U 2P3UB 4IMQA 1W13U 1AE8H 4UD9H 1C1SA 1UHBA 4IBLH 3P95A 1KDQA 1MTSA 1SOZA 3QO6A 3PMJA 4Q80A 5GWZA 1GI7B 2AHME 5HMAA 2FOGA 1PPEE 5ESTE 3PMBB 3UNRA 1RTFB 4D7GA 3GY8A 2V7QD 4X8TH 1GBLA 3VGCB 3MH6A 4B6FA 2JETC 1O2TA 1SQTA 3P92A 1EAXA 3EDXB 1ZRBA 2KZ4A 3C27B 4IC5A 5FXLA 4GVUA 1J16A 1DLEA 4JMYA 1GMHF 4HGCA 1B5GH 2K1QA 1ELVA 3JZ2B 5EQRA 1KLTA 1SGRE 1P2KA 2WPMS 1VJAU 5GJ4B 4H4FA 1LHFH 1YCPH 1GPZA 4FUCA 1EOLA 3V7TA 3R0FA 5IK2D 2BD3A 2PGBB 2A5IA 1ANCA 5DN6D 3SZNA 4Y76A 4OS1A 1K1MA 1S6FA 1TQ0B 1ZOMA 4Z0KA 3SU0A 3FFGA 3MO6A 2KCPA 1XUJA 1HXFH 3SHCH 3D23A 4E7RG 3QN7A 1SMFE 5ETXA 3WWBA 3KCGH 1YBWA 2FESH 3TVJB 1JIMA 3MWIU 1F92A 4RKOB 2SGFE 4DGJA 2C3SA 5FCRA 4X1QU 5C2ZA 4CR5A 3LOXA 1QJ1B 3RM0H 5HGGA 2G00A 2VGCB 1TAWA 4X8VH 1FMGA 2Z9GA 3RXGA 2W3IA 2JH5D 2ZCLP 3O8RA 3RMNH 1QL7A 2GCHG 4ABFA 2FWWA 1C1PA 5T6FA 2ODQA 3ODDA 1ACBE 5GPIB 3PTNA 5F53A 5C0UA 1TBQH 1AD8H 1XKBC 1O2XA 2H5CA 2V0BA 3A8CA 2ALVA 3GISB 3QGJA 3WWFA 2G52A 2B5TB 2QC2A 1AQ7A 1DT2A 1AFQC 1DOJA 1UK2A 2TPIZ 2OQUA 4INHA 4BTIB 2BD4A 2BHGA 1SGPE 2L74A 5T6DA 1SQAA 4DURA 1LVOA 3FN8A 4CREA 1GI0A 1H8DH 2FO9A 4Y0YE 4AGJA 2G4UA 1AGJA 3QTOH 1AIXH 2FI3E 8LPRA 3MI4A 3FO8D 4A1TA 2HALA 2JKHA 3AW0A 1FY3A 4BAMB 1EQ9A 1SGCA 4ACAA 1ZSLA 2XC4A 3P8OA 3MYWA 2ZZUH 5DP5A 2YMSD 4ISLA 1S84A 1EB1H 1S82A 2RDLA 3BTDE 5FBIA 1MD8A 1TRMA 5TCCA 1TRYA 1WDIA 4U01A 2ZU4A 2PSXA 2GCHF 2HLCA 4ABIA 1KXFA 5AF9H 1Z6JH 5A8ZA 1G2MA 1ETRH 4IMZA 1UTMA 1V6DA 1V2PT 1FY4A 2VWLA 1F2SE 3VXEH 1BMMH 2KCYA 1W10U 2G5VA 4QT8C 1JBUH 1TWXB 3BG4C 1XVMA 4Y71A 1P0SH 1XUIA 2ZQ1A 5CDFE 2XWBI 2V3OH 1AHTH 3LDXH 4NZQA 1ELTA 2YMSC 2A5KA 2XRCA 3CS0A 3ELAH 3UIRA 2AMQA 1A2CH 1NROH 1NFXA 3OSYA 3RXFA 1OHHD 3MOCA 5E0HA 5FHTA 3RU4D 3F9HA 1GBMA 2STBE 3MH5A 1P57B 3S9AA 2QV1A 3T5FH 1K0HA 2NU3E 1HIAB 1XX9A 1C2IA 3ESTA 2R0KA 2PKSB 2ZA5A 3H09A 1SVPA 1CGHA 4ISOA 1CO7E 1C2DA 7ESTE 4OGXA 1TGSZ 1QNJA 1TX7A 5C5OA 2ZFRH 1CBWC 2B7DH 4O97A 4YOGA 1FI8A 2EA3A 1O2YA 2ZIQH 1L1GA 1ZRKA 2FXRA 2GZ9A 3RLYH 4NA7A 1F0RA 1HBTH 3ZVCA 4CHAB 2G5NA 1XXDA 4INLA 4E05H 3BEFB 2PTCE 1ZZZA 4D8NA 2VU8E 4UFDH 3RXPA 3T26A 1P2NA 1YWUA 1AZZA 4JCNA 3FVFB 1GBEA 4YT7H 3N7OA 1EAIA 1RTKA 3PRDA 4B76A 5DP4A 5TCAA 2V3HH 2Q6FA 3A8AA 4A1VA 1NO9H 4D76A 1LVMA 2BZ6H 4NSYA 3FP8E 4AGKA 3A89A 2Z6BD 3P17H 3S0NA 2VNTA 2ZU2A 1FONA 1WV7H 4PROA 2CF8H 2ZF0H 1BTWA 1D9IA 2ANYA 1T7CA 1GCTB 2IPHA 2BY8X 1A61H 1AFEH 1MCVA 1W11U 1NU7B 1V2TT 3BTME 3FAOA 1FLEE 3MQKC 3Q77A 1FAXA 1H9IE 4Y6DA 1C1TA 1O5AB 2CN0H 4D9RA 1UW7A 1V2KT 2OBOA 3GY3A 8ESTE 1SGQE 1DPOA 2THFB 5FPSA 1FV9A 2ZG0H 1N6XA 3V0XA 1M9UA 1ZHPA 2BD2A 3KQDA 1N8OB 3EYDA 1NTPA 3PO1B 4ZXXH 3TH2H 1VITG 1GHVH 1VKYA 1O2UA 2ANMH 4MVNA 1H1BA 2GD4B 5GDSH 2PFEA 1C2MA 1N1LA 1UTQA 2A2QH 2OTVA 2RCEA 3DSOA 4ASHA 2WUBA 4WMEA 2EI8A 2PP6A 4OM9A 5T1VA 3SYJA 5F6MA 1P8VC 2SNWA 1DWDH 1WCZA 3EA9A 3SU5A 1Z7KA 1ELCA 1TGTA 1MH0A 1ZPBA 4FVBA 1GVZA 3GS9A 1UTNA 2O8LA 1WU1A 1O5GH 4K1TA 4NIWA 1O2HA 3HGPA 2D26C 2FZZA 4JYTA 1DE7H 3LGTA 1GG6C 1VCPA 2ZWLH 1ZJDA 2HPQH 3SU2A 2BD8A 2R2WU 2ZDVH 5E2PA 4I8KA 1NRPH 1XKAC 2BQWB 1JOUB 3A7WA 3NZIA 1QCPA 2FEQH 3OY6U 5E2OA 2QAAA 1F0UA 2QY0B 1PPGE 3M36A 2SGEE 5FPYA 5J4QA 2P3TB 1AN1E 3VB5A 4ZCNA 1UK4A 4A92A 4LXBH 2F9BH 5EW1H 2WPJS 4ZUHA 1YPMH 5HM2A 3RXKA 1IHSH 1CQQA 3V13A 1RS0A 3ATIA 2FOCA 3SUGA 3ZZAA 1TA6A 4XBCA 1RIWB 2C90B 4XBDA 1FY1A 2A4OA 3UPEA 1Q2WA 3D62A 3KQBA 4MNWA 1HJ9A 2EQNA 4ZKRU 1K1IA 3F2FA 3VB3A 5EW2H 1O2KA 4ISIH 2C8YB 2XTTB 2XC0A 4I8GA 3BF6H 2UUKB 4GUXA 4XDEA 1GHBG 1A3EH 1THRH 3N99A 3ZZ7A 3PMHB 3RXSA 3F6UH 1O2ZA 5GNDA 1IQJA 1WTHD 1HAIH 5C17A 1O5DH 2HNTC 3QK1A 1PPZA 2Q1JA 5JBBS 2J38A 1GMCG 3D49H 4KP0A 2FIRH 1G3BA 4MPUA 4DVAU 1HB0B 1V2VT 2TIOA 4MNYA 7KMEH 1GGDC 3LU9B 2K8IA 2Y6TA 5E8EH 1HGTH 1O2QA 4I86A 3ZVAA 5A8YA 1AKSA 3DCLA 1LQEA 1QZ8A 1HRTH 2NWNA 1HLTH 4FXGH 3TK5A 3NPSA 1GDQA 3SBKA 1P10A 3M5NA 1VITH 1MTNC 4LZ4B 4IGDA 1KLJH 5EGMA 1H9LB 1P09A 5DP3A 1EKBB 3TNTA 5DP7A 2BOHB 4NCYA 4FOUC 5B6LA 5K7RA 2SFAA 4R8TB 2ULLA 1O3CA 3RXEA 2EEKA 1O5CB 5I25A 3S9BA 1ID5H 3OX7U 1MBMA 3M61U 3LC5A 4DT7B 1YPLH 2HPPH 1YLCA 2ZTXA 3OYPA 3KL6A 1YPGH 1GDNA 1ZMNA 4UFEH 2OK5A 1S0QA 2VBCA 4ABGA 3MH7A 4ZKSU 3UAIC 4I8HA 1BJUA 4X1PU 1XUGA 3RXHA 4FUBA 1O3NA 1NBME 1TNLA 3HGNA 2BLQA 1NC6A 4ABBA 1RGQA 2RG3A 4ZMAH 2CK3D 2HRVA 2BDHA 3MFJA 1TMBH 1JRTA 1V2LT 3SI3H 1YC0A 2XW9A 3H5CB 1MZAA 1C2EA 4YM9A 4DY7B 2ZHEH 5T6GA 4P00A 5JB9S 1ANEA 1EUFA 4X1RU 1GI3A 2Z7FE 1TBZH 3RM2H 4NZLA 1OWEA 1TGBA 5C67A 2VWNA 3BIUH 1ZTJA 2QF0A 2VIWA 3TJOA 3QLPH 3ZZ4A 1KXDA 1UVOA 3B23B 2P59A 3PV5A 1H4WA 3BIVH 4RT0A 2J95A 2VIQA 3GY6A 1THSH 1P2MA 5C1UA 3F9FA 2QGRA 1V2WT 1V2NT 1V2RT 1QB1A 4A5TS 1K9OE 1NRSH 4LOYH 2XBWA 2TRMA 4FVDA 1E79D 5LGOA 1OKXA 2FTLE 2PLXA 1TOMH 3QWCH 1OWDA 1C5SA 2AIQA 1EASA 3SO3A 4I31A 5JBAS 1NRRH 1Y3WA 3GOVB 3PLPA 4AYVB 2BVRH 2BVSH 1SGDE 3T2NA 3NRLA 1RTLA 1H8ED 1LPGB 1MTVA 5C1XA 1V2QT 3A80A 4ABJA 2VIOA 1OXGA 2CV3A 2WUCA 1WAYB 3BEUA 2W6ID 2VIVA 3PLKA 2VGCC 3N7EA 1O2MA 1P05A 4B75A 4BXWA 3M3TA 3ZYEA 2CHAB 1GI8B 4B2CA 4DG4A 4JZFH 2EI7A 2OINA 3PWBA 2EI6A 3RXTA 3ZZBA 3S9CA 5FCKA 2ZFSA 4X1NU 1ZHMA 3LGVA 2Z3EA 4H6SB 1LVBA 1O5EH 1EPTB 4X2XA 2QXIA 4GHQA 5BRRE 1A0HB 1P04A 1EZXC 3SOSA 4M7GA 4SGBE 3GCHC 1GI6A 3RC5A 2J98B 3P6ZB 4X1SU 1K2I1 2WINI 3AASA 3H7OA 2VVUA 4MPXA 1O30A 3FANA 1WQVH 1O37A 1XMNB 2BY9X 3GCTF 1TNIA 2FYQA 1TNJA 3SGBE 2ZC9H 1GJ5H 2GX4A 1BRUP 3SU3A 2UWLA 2IJD1 1IHTH 1DXWA 4J1YA 2HOBA 2AYWA 5LPRA 2O8UA 5DO4H 3ENSB 2NU4E 1PQ8A 1D3PB 4FU9A 1C1MA 1SLUB 1DY9A 2A45B 2XCNA 1QURH 2LELA 4Q7YA 5E0GA 3QUMP 5KGOA 1SG8B 3TJNA 4ZHMU 2R3YA 1NZQH 4VGCC 3SQEE 1C1RA 3EA7A 1ZTKA 2FYRA 4IN2A 1TMTH 3RXVA 4UE7H 1HAVA 1A5IA 2UUFB 3OE7D 1GBJA 1YPHC 2PW8H 2BDAA 3CENA 3E0PB 4HTCH 3P8GA 1CVWH 4YT6H 1FIWA 3WW7A 3K6ZA 3M7TA 2ZDNA 2Y5HA 2XNIA 3TGJE 2H6MA 5L30H 1K22H 1FAKH 2I6SA 3PROA 3OU0A 1DITH 1EOJA 5EJLA 3IG6B 2BX3A 1LTOA 1AU8A 1O2SA 2FOFA 5EG4A 3TGIE 3BSQA 4JK5A 1JWTA 2NU0E 2Z9LA 1WTGH 4X6OA 4XFQA 3QZQA 4CRAA 2OC0A 1NESE 3V12A 4I8JA 1O2JA 2QXHA 2GMTC 2KCAA 1YPJH 1A4WH 2JH6D 2W6JD 3M7UA 1QRWA 3U1JB 3SJ8A 3TH4H 2QA9E 1SGIB 4ABHA 4FUJA 1RXPA 1A0JA 1TPPA 2QCYA 1OP0A 5C3NA 5HIZA 1NFUA 4X8SH 4Y7BA 5EPYA 4TWWA 4NGAH 1ELAA 3RXIA 2ASUB 5DKMA 4FUGA 2A0QB 1NFYA 2ZQ2A 2Q6DA 1YPEH 2WPIS 4D9QA 4K1SA 5JB8S 3NWUA 3GDUA 4O03A 4NG9H 2GJGA 1Y5BT 3E0NB 4CHAC 2KAIB 1P3EA 3O8BA 1WBGB 2HWLB 2PGQB 3MO3A 1UTKA 2OLGA 4K8YA 5CHAC 1GL1A 4Q7ZA 3DFLA 1K28D 4F48B 3M5OA 6ESTA 1A5GH 3P8NA 3A83A 4I33A 1ELFA 3SJKA 4BAHB 1YCPM 1W2KH 1SQOA 4O3TA 3QX5H 4BNRA 2IOTA 1SBWA 1K1JA 1G30B 1O36A 2P93A 3BTKE 1ZMLA 1LHCH 5KEDA 3H7TA 1Y59T 3RXOA 3S69A 2XNDD 3U69H 1ZR0A 3A81A 2PKAB 1EAWA 2M5TA 1BZXE 2BOKA 3RXBA 4UONA 1GBCA 3SV6A 1C5UA 2J94A 4Y8XA 2PV9B 1K1LA 2QF3A 4X8UH 4AB8A 2HLDD 2VWMA 1PPFE 2GV6A 3SUDA 2GDEH 1XUKA 2VB0A 1GBBA 2J92A 3SHAH 3OEHD 1S0RA 3PV4A 4UDWH 4B1TA 1CHGA 1L1NA 1NPMA 2XBVA 2R2MB 1QL8A 3PO1C 2VJ1A 3VXFH 4GHTA 4FUHA 3A7YA 1TPAE 3W1EA 1E0FD 3DT0H 1P2QA 3RC6A 1J15A 1LPZB 4FUDA 2ZPQA 1B0FA 3A84A 4FU7A 4YOJA 2OBQA 1MKXH 2SGPE 2P16A 1NBMD 2FDAA 4J2YB 1GI4A 5J4SA 1DDJA 1DY8A 3K6YA 4AYYB 1GHYH 1MBQA 3ATMA 1BTUA 1CT4E 2HGTH 3EGKH 2B9LA 5TJXA 2WPLS 2BDCA 4AZ2B 4K2YA 4X6PA 2ZHFH 1BMFD 1C1NA 3VB6A 1G36A 4FUEA 3HK3B 1O3MA 1DXPA 1MABB 1AO5A 1KXEA 1FY8E 1HAZB 3LGUA 5FAHA 2BVXH 5A8XA 1ARBA 2F91A 4ISHH 1FN8A 1K1PA 5JBTA 1BJVA 2ODYB 2LNCA 2ZDAH 1G32B 5EPNA 1BRBE 2Q6GA 4M9FA 1P9SA 4B2AA 2ZU1A 2FOHA 1O3PB 1FX0B 4Y10E 3B8JA 1Z8JB 1ETTH 5EOKA 1BTXA 1HYLA 3TH3H 1MKWK 3KN2A 1TLDA 2D8WA 2VINA 3ZVEA 2ZI2H 1T8MA 1RIWC 1ETSH 4NSVA 3SNCA 4YLUA 1DWEH 1WSSH 4CH2B 4DT4A 2A7JA 1HAOH 5JDUB 1E36B 2J97A 4KTCA 1IAUA 1Z6EA 2QF4A 2A4GA 1TONA 1O35A 1UVPA 3V3MA 2YOLA 3T25A 2GT7A 4LK4A 1D6WA 3IWMA 3FOAA 3PYHA 1OP8A 1QBVH 1MKXK 1MU8B 3MNSA 1T4VH 1TMUH 3UNSA 5G4BA 1OPHB 1YP9A 3F2GA 1OWKA 3Q3YA 1HNEE 3S7HB 1HJ8A 1SGTA 2C8ZB 3F1SB 3ZZ6A 3ZVDA 1KTTB 1O2NA 1GBKA 1E34B 2XWAA 1HJAB 1O3AA 1AWHB 1JRSA 2OCVB 5EXLA 2FM2A 1BTHH 3E3TA 4U2WA 1IQIA 1OWHA 1W7GH 1VGCC 1S5SA 2H9TH 3PTBA 3GY4A 1YGCH 3WY8A 3M3SA 3STJA 3DHKH 2Y5FA 1CT2E 2QE7D 2C93B 3L33A 1AMHA 4K60A 1O39A 4P02A 3O8CA 2FS9A 1O2PA 1P02A 1H8IH 3E90B 4RN6A 3I77A 3OEED 2PWXA 1NM6A 3ZVGA 1DSTA 1KTSB 1TNHA 4TWYA 5AFYH 1TFXA 4ASUD 1Y3XA 3U98H 4X2VA 5DPAA 5FX6A 2V3MA 3UNQA 1KXBA 3NCLA 1C4V2 3E6PH 3E91A 4IW4E 2XOKD 4F55A 1ZPZA 4RI0A 1Y8TA 2RFKC 3TPIZ 1F5KU 1GI9B 4Y79A 1L0ZA 1TABE 4CRCA 1CA0B 4AX9H 2FPZA 1OP2A 1MZDA 3AK5A 2FOMB 2OQ5A 3NUMA 2JIZD 1HV7A 5DK1A 4AFSA 2BMGB 1MU6B 1ZYOA 4A6LA 2IJOB 2PHBA 2VIDA 1X7AC 2WPHS 4ISNA 2LP6A 1EX3A 5DGJA 2JJ1D 1W14U 1N6YA 3GCOA 2CMYA 4ZAEA 9ESTA 1TX8A 3GDSA 1WXRA 4KGAA 4Y8ZA 1OWJA 3RXAA 5LPFA 1BTYA 3MMGA 2QXGA 3SV2H 2DE8A 1Z8RA 2V6NA 3F0PA 3BEIB 1SFIA 2A7CA 1P01A 3TITA 3PM3A 1C2JA 1SI5H 4NIYA 1VITF 2CF9H 1IQEA 3EE0B 3SJIA 4AOQA 1CBWB 2RA0A 1AB9B 1C5XB 2Y5GA 3FKSD 1C5TA 4OS6A 2ZGBH 4OS5A 4BXSA 1MAXA 2O9QA 2ZHDA 1LQDB 3I29A 2HVXA 1SPJA 3Q3KA 3MU4A 1WOFA 4X2WA 2D2DA 1OYQA 2GV7A 4IC6A 4BTUB 3ATWA 1TX6A 3G01A 2VIPA 1LKAA 3N7DA 1C5MD 3MNCA 2D1JA 3EQ0H 1Y3UA 4AG1A 4KELA 2GCTC 3DA9B 5EXMA 4XE4A 2BM2A 3L3TA 3QTVH 2BQ6B 3PMAB 1CA8B 1UHBB 1O3OA 1ELGA 2C8WB 1KDQB 1KY9A 1CHOG 2GVFA 3PRBA 1GI5A 5GCHG 2VH0A 2BDYA 2ZTZA 2STAE 2ZGXH 5EXNA 6CHAC 2BY7X 3BN9A 3PV2A 1K21H 3SJOA 2J2UA 1VR1H 1P2JA 1SLXB 1C5NH 1SGFG 4Y7AA 1HIAA 1A46H 4GCHG 3SU4A 9LPRA 3LH1A 4ABDA 2WSSD 3E16B 1GHAG 2KM0A 2WV9A 1Z1JA 2ZNKH 1O3IA 1O2LA 2BDBA 2UWPA 2ZGJA 5EQQA 3SNBA 3Q3XA 2AGEX 1UCYH 1SFQB 3SU6A 2FOEA 1TNKA 1ZTLA 1G9IE 1V2UT 5EJ1A 1ORFA 2ZCKP 1GHBF 3A85A 1DX5M 3VB4A 1C1VH 1ZGVA 3RC4A 4A7IB 3FP6E 1DWBH 3M35A 3RXRA 1W8BH 1EP5A 1HUTH 1AVGH 1O2IA 3URDA 1MAYA 1GMCF 3TNSA 4GLYA 2ANWA 5GCHF 1OYTH 5EIYA 1LCYA 3L6PA 3RP2A 2VWOA 1RFNA 3UREA 2BXUH 1FIZA 7LPRA 1ZSJA 1BHXB 4WMFA 3OAAD 1UVUH 1C5RA 4MPVA 1OS8A 1P11E 1VCQA 4K5ZA 1O5FH 3VGCC 5LPEA 1VJ9U 1O2OA 2O8MA 4RT1A 3ZVBA 2F9OA 1F7ZA 1GG6B 4GCHF 5A2MH 5C94A 3NK8A 4JYUH 1E35B 1GHZA 1A3BH 2FOBA 2W26A 3T27A 4Q2KA 1UCYE 2FODA 5LH8A 3K2UA 5A0CA 1TOCB 3A88A 1C5PA 1PQAA 1PYTD 1DUAA 2EY4C 1PQ7A 3D65E 1UCYK 4TT3D 5C0TA 3STIA 1IQKA 1UTOA 1W3CA 2XCFA 2Z9KA 3UTUH 1IQMA 1QQUA 2A32A 3URCA 4I8LA 4OGYA 1MQ6A 1H8HD 1HFDA 2QXJA 3DUXH 5HKKD 3KYGA 1V2JT 4WH8A 4ZROA 2OP9A 3SGQE 1SGEE 5FPTA 3RXMA 5EODA 4MTBA 2YNAA 4BANB 1IQNA 1ABJH 3KQCA 2A31A 3DFJA 3HATH 2F9UA 2A4QA 2LPRA 3OTPA 5I46H 1LMWB 3MU1A 1AY6H 1GDUA 1RJXB 1T8LA 5HYOA 1GBFA 1QIXB 4UFGH 3U8RH 1BB0B 1NY22 4XRNA 4B73A 4A1XA 1SOTA 4WXIA 2WV4A 3ZZ5A 1CSOE 2QN5T 3A7VA 4R0IA 3SNAA 4FUIA 3QZRA 1SB1H 1PFXC 3UB0A 2AS9A 2FS8A 4CRGA 2JDID 1QL9A 1L4ZA 2KX4A 1GGDB 2C8XB 1BQYA 4ZHLU 2WPKS 1LO6A 4JZIA 3LJOA 1Q3XA 5CHBA 4X6NA 3PB1E 2P8OB 1ESBA 4ESTE 1J9CH 5A09A 2P3FH 1C1OA 2BLOA 3O8DA 3KF2A 3RMOH 1W0JD 4WF8A 2TGPZ 2XBYA 2H9HA 1UVSH 2L6OA 3EE7A 4YZUA 1BTZA 3A7XA 1FZZA 1C1UH 4WH6A 5JYIA 2F9VA 2A1DB 1YLDA 5AHGH 3F9GA 2JJ2D 2P95A 2ZTYA 2FOAA 2UWOA 3RXDA 2H9EH 3DD2H 1LHEH 4ABEA 2ILNA 3SORA 1V2ST 3GY2A 3MNBA 4Q7XA 5FL7D 1GJ4H 1HAXB 3CS7A 4UEHH 1THPB 4X6MA 1SQRA 1AUTC 2OUAA 2F9PA 1BBRE 1LHGH 4ZKOU 4XSKU 2A4RA 2PUXB 1DLKB 4OS4A 2Z9JA 1BBRK 1DICA 3KQEA 3MO9A 1FUJA 2BDIA 1HCGA 3KGPA 3E1XB 4Q4LA 3SZEA 2FMJA 2XBXA 3VFEA 1HDTH 5JPMH 3GY5A 4O9VA 2BY5X 1F0SA 2TGTA 1ZSKA 3AW1A 3Q00A 4E7NA 4D7FA 2AH4X 3ZV8A 1Y3VA 3KQ5A 3P70B 3ZZ8A 1XVOA 1C2GA 3IITA 2F4LA 3SNDA 2HNTE 2ODPA 2AMPA 3QGNB 4U32A 2RDEA 1GVKB 1ELDE 1YYY1 3RUOA 4Z1MD 4YOIA 4BOHA 1YM0A 6LPRA 1DUEA 1YF4A 3SQHE 1TE0A 3MNXA 3SNEA 1C4U2 1CE5A 1O3LA 1GJAB 3SV8A 3DSGA 7GCHG 1C5QA 4YXWD 3ZVFA 1O3JA 5F8TA 3BTQE 4CR9A 2M2AA 2HVYB 3CNRA 2TBSA 3RLWH 1B7XB 4NFEA 3ITIA 3LKWA 2AGIX 4WJG2 5GIBA 3NKKA 3HPTB 2PKSC 1EJMA 2Z3DA 5SGAE 4IS5A 1QBNA 1QY6A 1T32A 4CBNA 4GPGA 5DP8A 3ZZ9A 8KME2 1E37B 4CRDA 1SSXA 2VVVA 1P03A 5F8ZA 5CMXH 1V3XA 1O3FA 1D4PB 4WY3A 1C2KA 1FPHH 1D6RA 1BT7A 2G81E 1G3DA 4ZKNU 2R3UA 3LGIA 1EJNA 1HAGE 4HI3A 1Z71A 1ZJKA 4TSFD 3TJVA 2OC1A 1S83A 4BAQB 2XYAA 4X2YA 2J9NA 3LONA 6GCHG 5C1YA 1GJ6A 3RXUA 4AFUA 1SGFA 3ODFA 1Y5UT 2QF5A 4OS7A 4JZEH 5DJ7A 1EP6A 1INCA 1UTLM 3F3BA 1GJ8B 1FXYA 7GCHF 2YNBA 4X0WU 1YCPK 3U8TH 1C2FA 3GCHB 3OFND 2EC9H 1G3CA 2BD5A 1KXAA 1AVXA 3SJ9A 1PPCE 2G8TA 4JYVH 4K69A 4LZ1H 1RD3B 3C1KA 1JIRA 2CGAA 1A0LA 1LKBA 5DG6A 1HAYB 1EJAA 1EZQA 3EAJA 2G51A 1ABIH 1QJ6B 1GL0E 4AFQA 2H5DA 3W94A 1DS2E 2F3CE 4FU8A 1XUHA 1HJAC 3A7ZA 5DSFA 1GCTC 2I6QA 2ZDMA 1FNIA 3JZ1B 1QBOA 2Y7ZA 1AE5A 2H2ZA 4ZXYH 5L2ZH 1ANBA 1BCUH 4DIIH 2ALPA 1WYKA 3SGAE 1VZQH 2JETB 1C2LA 1OSSA 2A2XH 2W5EA 1MKWH 3BTGE 4DOQA 5K0HA 4B71A 5EQSA 3A8DA 1DFPA 4TYDA 3F68H 1FQ3A 2OC7A 1N8OC 1TQ7B 1V2MT 3LJJA 1KYNA 1EFRD 3KEEA 6GCHF 2W3KA 3AAUA 1FJSA 4Y0ZE 4GAWA 3T62A 3UR9A 2Y82A 5EU8A 3KIDU 5HIYA 1QFKH 3AVZA 4VGCB 1LPKB 1QR3E 1CGIE 1O3DA 2BD7A 2BYAX 1ARCA 1EPTA 1GCDA 1O3HA 2J5UA 2UUJB 4GSOA 3SUEA 1MD7A 2FX4A 3DSPA 2SNVA 1GI2A 2J4IA 1OX1A 3K9XB 1GJCB 2GZ8A 1HAHH 1UK3A 1CA0C 2J98A 3EA8A 1BMNH 2BD9A 1FN6A 2ZECA 2GTBA 1O34A 1B0EA 1NU9A 2DE9A 1A1RA 3LIWA 1ELBA 1T4UH 2W7SA 5L6NH 1S6HA 4XOJA 5AVDA 1C5VA 2O8WA 5E0JA 1SGYE 4AN7A 1QRZA 1EATA 1YKTA 2FLBH 2WHXA 3HKIB 3F9EA 3TGKE 1EXFA 1QA0A 4U30A 4UFFH 3SUFA 1O2WA 3UWIA 1BRCE 1W0YH 2GMTB 4NA9H 1AKSB 2TGDA 3FP7E 1ZMJA 2JH0D 3FZDA 4E06H 1PPHE 4AG2A 1QB6A 2PTNA 2FI5E 4ACBA 4HG6A 1UMAH 1O38A 1TGCA 3UOPA 1P06A 1AB9C 4WMDA 3GCNA 2WPDD 1C2HA 1XUFA 1GWAA 1BMLA 1O3GA 4CRBA 3LGYA 1QA7A 1AVWA 4ABAA 1ANDA 1AUJA 1G3EA 2ESTE 4DIHH 2OC8A 1O2RA 1P9UA 2ZHWH 1AFQB 1QHRB 1RRKA 2XC5A 1Z8IB 3A86A 3KYFA 4NWKA 5CHAB 1PJPA 3W95A 1D3QB 1C9PA 4JZ1A 4B74A 1O2VA 1F5RA 1S85A 1Z1IA 2BB4A 1ZGIA 1ZHRA 2ZEBA 3HK6B 3A82A 2G4TA 1G37A 1P3CA 3Q76A 1A5HA 1GBDA 1GHXH 2PUQH 2FLRH 1C4Y2 2AEIH 2F43B 1K1OA 1U6QA 5BPEA 1H9HE 2ZPSA 1T8NA 1YPHE 4MDSA 1P2OA 2GZ7A 1BIOA 4O3UA 1WQSA 1GBHA 2R0LA 1GHWH 1BUIA 4RKJB 1GBIA 2QYIA 3A8BA 1SR5C 2Y81A 1DANH 2IPQX 1TPOA 1C5LH 1BOQA 2WYJA 4XBBA 3CP7A 1TRNA 2ZKSA 4KTUA 1C5YB 2GGVB 1SLWB 5H4IB 1LDTT 2WZQA 1TYNA 1L2EA 5CE1A 2ZP0H 3BG4B 1S81A 4F49A 5ABWA 2KAIA 1IQHA 4K8BA 3SI4H 1UVTH 1JMOH 5C20A 1BDAA 3BTWE 5AFZH 1IOEA 3UWJH 1V2OT 5IDKA 1MUEB 3RXCA 1DSUA 4YLQH 2YMSB 2ZPRA 2ZGCA 3ZZCA 2BY6X 1O5BB 2C4FH 2BDGA 1SLVB 1ESTA 4NIVA 4TY6A 2ZCHP 1D3TB 4I7YH 1CGJE 1GBTA 4HFPB 3U9AH 1A7SA 4NFFA 1HPGA 2PR3A 1FY5A 2KCOA 3ZZ3A 2ZO3H 3SW2B 4K3JA 3ZIAD 3SV9A 5PTPA 3MU5A 3BG8A 1O33A 4ZHAA 2FI4E 2ZFTA 4AORA 3M37A 1XXFA 3GY7A 2PKAA 1YPKH 1NS3A 1D3DB 3LT3A 1KXCA 4DCDA 1O32A 3TK9A 5IYTA 3TU7H 1QGFA 2B0FA 1O31A 1TGNA 4OS2A 2ZFPH 4H42U 3MH4A 4MQAA 2KR7A 2W7UA 1NRQH 1FPCH 3U1IB 3RMMH 3U8OH 3LGWA 3M5LA 3A7TA 5DP6A 2G55A 5A0BA 5EJZA 3E8LA 1IQGA 1Z8GA 1NT1A 1TPSA 1DM4B 3VEQB 1SHYA 1KLIH 1TB6H 3BTTE 1MTWA 2V35A 3HKJB 4DW2U 5FX5A 3F2HA 2A7HA 2BZAA 3BTEE 2SGQE 1O2GH 2XXLA 1K1NA 2NU1E 3QDZB 2F83A 2Z3CA 2ZFFH 3RDZA 4KTSA 1CT0E 2AIPA 1OWIA 1C5OH 2B8OH 3OTJE 1TA2A 1ZLRA 2CJIA 4AC9A 5JBCS 4IN1A 1PQ5A 3MTYA 3MU8A 3BV9B 4Z6AH 1BRAA 4MPWA 2CHAC 1JXPA 3TK6A 3B9FH 3ZYDA 4Y8YA 2P94A 1VGCB 3FZZA 4BTTB 4NWLA 1BITA 2DUCA 3UY9A 3LC3A 2ZU5A 2AFQB 4MNXA 1P12E 3S7KB 1TIOA 1C5ZB 1EPTC 5DP9A 1HAVB 3LPRA 3AAVA 2P8OC 2SGAA 2AMDA 1E1QD 1W7XH 1W12U 1WUNH 3SU1A 1W0ZU 1QJ7B 3KNXA 3PLBA 4Q63A 1IQFA 2GT8A 3VB7A 5KECA 1O3KA 4K1EA 3A87A 1C5WB 2VVCA 1GJDB 4WXVA 1BHXF 3T28A 4FUFA 4H6TA 1O3EA 3M5MA 4FETA
chains in the Genus database with same CATH topology
1KIGH 4CRFA 1CHOF 4MLFB 4NA8A 1J14A 1ELEE 1L4DA 1HAPH 3M3VA 1F5LA 1PPBH 2FTMA 1FDPA 3KHVA 2BQ7B 1EZUC 3UFAA 1T8OA 1IQLA 5L2YH 4THNH 3RXJA 5HXFA 3P8FA 1GMDG 1TBRH 4CH8B 2SGDE 2ZU3A 3K65B 4DJZB 2Z9IA 4TY7A 1C1QA 1GHAF 2BTCE 2AGGX 4TPYA 3GYLB 1EZSC 3NXPA 1MQ5A 3RU4E 1KSNA 1UJ1A 3M7QA 1BTPA 5B6OA 3ZV9A 1T31A 5T3HA 1SGNE 1C1WH 1ZPCA 1GVLA 1L1JA 4RSPA 3UOUA 1AI8H 1E38B 2ZDKA 2ZFQH 3T29A 4TPIZ 3VPKA 3GDVA 3GYMA 5A0AE 4AB9A 2TGAA 4B2BA 1GI1A 1MCTA 3PWCA 4WVPE 3SV7A 1QRXA 4SGAE 2AERH 4YESB 1OOKB 4BAOB 1QQ4A 1J17T 5HM9A 1DWCH 1GJ9B 2HNTF 2NU2E 1NRNH 1GJBB 5FBEA 8GCHG 3GICB 4NIXA 1SC8U 1P2IA 2FP7B 1ESAA 1QB9A 2Z94A 1CU1A 1NN6A 5F03A 1UTPA 3ATLA 1Q31A 1GMDF 2GCTB 3I78A 3SN8A 4HZHA 2J34A 2GKVE 1GJ7B 2F9NA 2ANKH 1EAUA 1XM1A 4JZDH 3TIUA 2Y7XA 2IN2A 1TALA 2CXVA 1PYTC 4YTAA 4JK6A 1AWFH 1BBRH 3GCTG 3ZZDA 2GP9B 3LH3A 4ZH8A 1DVAH 2WYGA 3RMLH 3TJUA 2BX4A 1MMJN 6CHAB 1MTUA 4MG3A 1NFWA 2O8TA 1F0TA 2VH6A 3ATKA 5ESBA 3UQOA 4F4OC 3MHWU 4AFZA 1EB2A 5GXPA 1Y5AT 1AZ8A 3R3GB 3TLOA 4YO9A 3UUZA 3BTFE 1O3BA 4MNVA 1MTNB 2GDDA 2H1UA 3MU0A 1UO6A 1VCWA 3UQVA 1BMAA 2QIQA 4I32A 2FX6A 2WV5A 4INKA 2OXSA 3BTHE 1GMHG 1QTFA 4CBOA 2Y80A 4KKDA 2BXTH 1UTJA 1C9TA 2BLWA 1SL3A 2BLVA 2OD3B 2ZHQH 1O0DH 1G2LA 2PSYA 4Y11E 1GBAA 8GCHF 2UUYA 1Y3YA 1TNGA 2ZDLA 1SHHB 2A5AA 1BA8B 1J8AA 4WWYA 4BAKB 1HXEH 1LVYA 2ZGHA 3RXLA 3UR6A 5C5NA 5F8XA 2R9PA 2RA3A 1LHDH 3RU4T 3RXQA 3OY5U 2P3UB 4IMQA 1W13U 1AE8H 4UD9H 1C1SA 1UHBA 4IBLH 3P95A 1KDQA 1MTSA 1SOZA 3QO6A 3PMJA 4Q80A 5GWZA 1GI7B 5HMAA 2FOGA 1PPEE 5ESTE 3PMBB 3UNRA 1RTFB 4D7GA 3GY8A 4X8TH 1GBLA 3VGCB 3MH6A 2JETC 1O2TA 1SQTA 3P92A 1EAXA 3EDXB 1ZRBA 3C27B 4IC5A 5FXLA 4GVUA 1J16A 1DLEA 4JMYA 1GMHF 4HGCA 1B5GH 2K1QA 1ELVA 3JZ2B 5EQRA 1KLTA 1SGRE 1P2KA 2WPMS 1VJAU 5GJ4B 4H4FA 1LHFH 1YCPH 1GPZA 4FUCA 1EOLA 3V7TA 3R0FA 2BD3A 2PGBB 2A5IA 1ANCA 3SZNA 4Y76A 4OS1A 1K1MA 1S6FA 1TQ0B 1ZOMA 4Z0KA 3SU0A 3FFGA 3MO6A 1XUJA 1HXFH 3SHCH 3D23A 4E7RG 3QN7A 1SMFE 5ETXA 3KCGH 1YBWA 2FESH 3TVJB 1JIMA 3MWIU 1F92A 4RKOB 2SGFE 4DGJA 2C3SA 5FCRA 4X1QU 5C2ZA 4CR5A 3LOXA 1QJ1B 3RM0H 5HGGA 2G00A 2VGCB 1TAWA 4X8VH 1FMGA 2Z9GA 3RXGA 2W3IA 2JH5D 2ZCLP 3O8RA 3RMNH 1QL7A 2GCHG 4ABFA 2FWWA 1C1PA 5T6FA 2ODQA 3ODDA 1ACBE 5GPIB 3PTNA 1TBQH 1AD8H 1XKBC 1O2XA 2H5CA 2V0BA 3A8CA 2ALVA 3GISB 3QGJA 2G52A 2B5TB 2QC2A 1AQ7A 1DT2A 1AFQC 1DOJA 1UK2A 2TPIZ 2OQUA 4INHA 4BTIB 2BD4A 2BHGA 1SGPE 5T6DA 1SQAA 4DURA 1LVOA 4CREA 1GI0A 1H8DH 2FO9A 4Y0YE 4AGJA 2G4UA 1AGJA 3QTOH 1AIXH 2FI3E 8LPRA 3MI4A 4A1TA 2HALA 2JKHA 3AW0A 1FY3A 4BAMB 1EQ9A 1SGCA 1ZSLA 2XC4A 3P8OA 3MYWA 2ZZUH 5DP5A 4ISLA 1S84A 1EB1H 1S82A 2RDLA 3BTDE 5FBIA 1MD8A 1TRMA 5TCCA 1TRYA 4U01A 2ZU4A 2PSXA 2GCHF 2HLCA 4ABIA 1KXFA 5AF9H 1Z6JH 5A8ZA 1G2MA 1ETRH 4IMZA 1UTMA 1V6DA 1V2PT 1FY4A 2VWLA 1F2SE 3VXEH 1BMMH 1W10U 2G5VA 4QT8C 1JBUH 1TWXB 3BG4C 1XVMA 4Y71A 1P0SH 1XUIA 2ZQ1A 2XWBI 2V3OH 1AHTH 3LDXH 4NZQA 1ELTA 2A5KA 2XRCA 3CS0A 3ELAH 3UIRA 2AMQA 1A2CH 1NROH 1NFXA 3OSYA 3RXFA 3MOCA 5E0HA 5FHTA 3RU4D 3F9HA 1GBMA 2STBE 3MH5A 1P57B 3S9AA 2QV1A 3T5FH 2NU3E 1HIAB 1XX9A 1C2IA 3ESTA 2R0KA 2PKSB 2ZA5A 1SVPA 1CGHA 4ISOA 1CO7E 1C2DA 7ESTE 4OGXA 1TGSZ 1QNJA 1TX7A 5C5OA 2ZFRH 1CBWC 2B7DH 4O97A 4YOGA 1FI8A 2EA3A 1O2YA 2ZIQH 1L1GA 1ZRKA 2FXRA 2GZ9A 3RLYH 4NA7A 1F0RA 1HBTH 3ZVCA 4CHAB 2G5NA 1XXDA 4INLA 4E05H 3BEFB 2PTCE 1ZZZA 4D8NA 2VU8E 4UFDH 3RXPA 3T26A 1P2NA 1AZZA 4JCNA 3FVFB 1GBEA 4YT7H 3N7OA 1EAIA 1RTKA 4B76A 5DP4A 5TCAA 2V3HH 2Q6FA 3A8AA 4A1VA 1NO9H 4D76A 1LVMA 2BZ6H 4NSYA 3FP8E 4AGKA 3A89A 2Z6BD 3P17H 3S0NA 2VNTA 2ZU2A 1FONA 1WV7H 4PROA 2CF8H 2ZF0H 1BTWA 1D9IA 2ANYA 1T7CA 1GCTB 2IPHA 2BY8X 1A61H 1MCVA 1AFEH 1W11U 1NU7B 1V2TT 3BTME 3FAOA 1FLEE 3Q77A 1FAXA 1H9IE 4Y6DA 1C1TA 1O5AB 2CN0H 4D9RA 1V2KT 2OBOA 3GY3A 8ESTE 1SGQE 1DPOA 2THFB 5FPSA 1FV9A 2ZG0H 1N6XA 3V0XA 1M9UA 1ZHPA 2BD2A 3KQDA 1N8OB 3EYDA 1NTPA 3PO1B 4ZXXH 3TH2H 1VITG 1GHVH 1O2UA 2ANMH 4MVNA 1H1BA 2GD4B 5GDSH 2PFEA 1C2MA 1N1LA 1UTQA 2A2QH 2OTVA 2RCEA 4ASHA 2WUBA 4WMEA 2EI8A 5F6MA 1P8VC 2SNWA 1DWDH 1WCZA 3EA9A 3SU5A 1Z7KA 1ELCA 1TGTA 1MH0A 1ZPBA 4FVBA 1GVZA 1UTNA 2O8LA 1WU1A 1O5GH 4K1TA 4NIWA 1O2HA 3HGPA 2D26C 2FZZA 4JYTA 1DE7H 3LGTA 1GG6C 1VCPA 2ZWLH 1ZJDA 2HPQH 3SU2A 2BD8A 2R2WU 2ZDVH 5E2PA 4I8KA 1NRPH 1XKAC 2BQWB 1JOUB 3A7WA 3NZIA 1QCPA 2FEQH 3OY6U 5E2OA 2QAAA 1F0UA 2QY0B 1PPGE 3M36A 2SGEE 5FPYA 5J4QA 2P3TB 1AN1E 3VB5A 1UK4A 4A92A 4LXBH 2F9BH 5EW1H 2WPJS 4ZUHA 1YPMH 5HM2A 3RXKA 1IHSH 1CQQA 3V13A 1RS0A 3ATIA 2FOCA 3SUGA 3ZZAA 1TA6A 4XBCA 1RIWB 2C90B 4XBDA 1FY1A 2A4OA 3UPEA 1Q2WA 3D62A 3KQBA 4MNWA 1HJ9A 4ZKRU 1K1IA 3VB3A 5EW2H 1O2KA 4ISIH 2C8YB 2XTTB 2XC0A 4I8GA 3BF6H 2UUKB 4GUXA 4XDEA 1GHBG 1A3EH 1THRH 3ZZ7A 3PMHB 3RXSA 3F6UH 1O2ZA 1IQJA 1WTHD 1HAIH 1O5DH 2HNTC 3QK1A 1PPZA 2Q1JA 5JBBS 2J38A 1GMCG 3D49H 4KP0A 2FIRH 1G3BA 4MPUA 4DVAU 1HB0B 1V2VT 2TIOA 4MNYA 7KMEH 1GGDC 3LU9B 2Y6TA 5E8EH 1HGTH 1O2QA 3ZVAA 5A8YA 1AKSA 1LQEA 1HRTH 2NWNA 1HLTH 4FXGH 3TK5A 3NPSA 1GDQA 3SBKA 1P10A 3M5NA 1VITH 1MTNC 4LZ4B 4IGDA 1KLJH 5EGMA 1H9LB 1P09A 5DP3A 1EKBB 3TNTA 5DP7A 2BOHB 4NCYA 5K7RA 2SFAA 4R8TB 2ULLA 1O3CA 3RXEA 2EEKA 1O5CB 5I25A 3S9BA 1ID5H 3OX7U 1MBMA 3M61U 3LC5A 4DT7B 1YPLH 2HPPH 1YLCA 2ZTXA 3OYPA 3KL6A 1YPGH 1GDNA 1ZMNA 4UFEH 1S0QA 4ABGA 3MH7A 4ZKSU 4I8HA 1BJUA 4X1PU 1XUGA 3RXHA 4FUBA 1O3NA 1TNLA 3HGNA 2BLQA 1NC6A 4ABBA 1RGQA 2RG3A 4ZMAH 2HRVA 3MFJA 2BDHA 1TMBH 1JRTA 1V2LT 3SI3H 1YC0A 2XW9A 3H5CB 1MZAA 1C2EA 4YM9A 4DY7B 2ZHEH 5T6GA 5JB9S 1ANEA 1EUFA 4X1RU 1GI3A 2Z7FE 1TBZH 3RM2H 4NZLA 1OWEA 1TGBA 5C67A 2VWNA 3BIUH 1ZTJA 2QF0A 2VIWA 3TJOA 3QLPH 3ZZ4A 1KXDA 1UVOA 3B23B 2P59A 1H4WA 3BIVH 2J95A 2VIQA 3GY6A 1THSH 1P2MA 5C1UA 3F9FA 2QGRA 1V2WT 1V2NT 1V2RT 1QB1A 4A5TS 1K9OE 1NRSH 4LOYH 2XBWA 2TRMA 4FVDA 5LGOA 1OKXA 2FTLE 2PLXA 1TOMH 3QWCH 1OWDA 1C5SA 2AIQA 1EASA 3SO3A 4I31A 5JBAS 1NRRH 1Y3WA 3GOVB 3PLPA 4AYVB 2BVRH 2BVSH 1SGDE 3T2NA 1RTLA 1LPGB 1MTVA 5C1XA 1V2QT 3A80A 4ABJA 2VIOA 1OXGA 2CV3A 2WUCA 1WAYB 3BEUA 2VIVA 3PLKA 2VGCC 1O2MA 1P05A 4B75A 4BXWA 3M3TA 3ZYEA 2CHAB 1GI8B 4B2CA 4DG4A 4JZFH 2EI7A 2OINA 3PWBA 2EI6A 3RXTA 3ZZBA 3S9CA 5FCKA 2ZFSA 4X1NU 1ZHMA 3LGVA 2Z3EA 4H6SB 1LVBA 1O5EH 1EPTB 4X2XA 2QXIA 4GHQA 5BRRE 1A0HB 1P04A 1EZXC 3SOSA 4M7GA 4SGBE 3GCHC 1GI6A 3RC5A 3P6ZB 4X1SU 1K2I1 2WINI 3AASA 3H7OA 2VVUA 4MPXA 1O30A 3FANA 1WQVH 1O37A 1XMNB 2BY9X 3GCTF 1TNIA 2FYQA 1TNJA 3SGBE 2ZC9H 1GJ5H 2GX4A 1BRUP 3SU3A 2UWLA 1IHTH 1DXWA 4J1YA 2HOBA 2AYWA 5LPRA 2O8UA 5DO4H 3ENSB 2NU4E 1PQ8A 1D3PB 4FU9A 1C1MA 1SLUB 1DY9A 2A45B 2XCNA 1QURH 4Q7YA 5E0GA 3QUMP 1SG8B 3TJNA 4ZHMU 2R3YA 1NZQH 4VGCC 3SQEE 1C1RA 3EA7A 1ZTKA 2FYRA 4IN2A 1TMTH 3RXVA 4UE7H 1HAVA 1A5IA 2UUFB 1GBJA 1YPHC 2PW8H 2BDAA 3CENA 3E0PB 4HTCH 3P8GA 1CVWH 4YT6H 1FIWA 3K6ZA 3M7TA 2ZDNA 2Y5HA 2XNIA 3TGJE 2H6MA 5L30H 1K22H 1FAKH 2I6SA 3PROA 3OU0A 1DITH 1EOJA 3IG6B 2BX3A 1LTOA 1AU8A 1O2SA 2FOFA 5EG4A 3TGIE 3BSQA 4JK5A 1JWTA 2NU0E 2Z9LA 1WTGH 4X6OA 4XFQA 3QZQA 4CRAA 2OC0A 1NESE 3V12A 4I8JA 1O2JA 2QXHA 2GMTC 1YPJH 1A4WH 2JH6D 3M7UA 1QRWA 3U1JB 3SJ8A 3TH4H 2QA9E 1SGIB 4ABHA 4FUJA 1RXPA 1A0JA 1TPPA 2QCYA 1OP0A 5C3NA 1NFUA 4X8SH 4Y7BA 5EPYA 4TWWA 4NGAH 1ELAA 3RXIA 2ASUB 5DKMA 4FUGA 2A0QB 1NFYA 2ZQ2A 2Q6DA 1YPEH 2WPIS 4D9QA 4K1SA 5JB8S 3NWUA 3GDUA 4O03A 4NG9H 1Y5BT 3E0NB 4CHAC 2KAIB 1P3EA 3O8BA 1WBGB 2HWLB 2PGQB 3MO3A 1UTKA 2OLGA 4K8YA 5CHAC 1GL1A 4Q7ZA 3DFLA 1K28D 3M5OA 6ESTA 1A5GH 3P8NA 3A83A 4I33A 1ELFA 3SJKA 4BAHB 1YCPM 1W2KH 1SQOA 4O3TA 3QX5H 4BNRA 2IOTA 1SBWA 1K1JA 1G30B 1O36A 2P93A 3BTKE 1ZMLA 1LHCH 3H7TA 1Y59T 3RXOA 3S69A 3U69H 1ZR0A 3A81A 2PKAB 1EAWA 2M5TA 1BZXE 2BOKA 3RXBA 4UONA 1GBCA 3SV6A 1C5UA 2J94A 4Y8XA 2PV9B 1K1LA 2QF3A 4X8UH 4AB8A 2VWMA 1PPFE 2GV6A 3SUDA 2GDEH 1XUKA 2VB0A 1GBBA 2J92A 3SHAH 1S0RA 3PV4A 4UDWH 4B1TA 1CHGA 1L1NA 1NPMA 2XBVA 2R2MB 1QL8A 3PO1C 2VJ1A 3VXFH 4GHTA 4FUHA 3A7YA 1TPAE 1E0FD 3DT0H 1P2QA 3RC6A 1J15A 1LPZB 4FUDA 2ZPQA 1B0FA 3A84A 4FU7A 4YOJA 2OBQA 1MKXH 2SGPE 2P16A 2FDAA <