4ZKRU

The crystal structure of upain-1-w3a in complex with upa at ph9.0
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkrU01
1UTJA 3K2UA 4NIVA 3LGWA 1IQNA 1NRNH 1O2VA 2DE9A 3A87A 5EODA 3DFJA 2FPZA 3ZZBA 1V6DA 1VCPA 1W3CA 3U1JB 3PV4A 3V3MA 1Z6JH 1O35A 2QY0B 4K1EA 1BRUP 2FTMA 3UNQA 1ELGA 3SHCH 1P12E 3LH3A 2FOAA 1EPTC 1KDQA 4JYVH 2P16A 1QNJA 1GJDB 1P2IA 2XNIA 3QTOH 1C5VA 1UTMA 2FOCA 1QB1A 3D65E 3BG8A 1YCPM 1M9UA 2ZZUH 4D7FA 3BTEE 2ZP0H 2QN5T 3ZZ4A 1MAYA 4O03A 1OP2A 1FLEE 1IQGA 1P2QA 2BD8A 2BDGA 1B0EA 3ZZ9A 1A7SA 1NFWA 1FDPA 1GI6A 1OWEA 1EB2A 2BD7A 2Z9KA 1K9OE 1WV7H 5DGJA 1RTLA 5DP7A 2SGFE 3S69A 3U69H 5AVDA 3RMOH 2OQUA 3NWUA 3S9BA 1OS8A 4AX9H 2G4TA 4JMYA 2QIQA 1KIGH 1TGCA 3SUDA 1O2PA 4CH8B 4Y79A 3GCTG 3NKKA 1MUEB 2VB0A 4BOHA 1D3TB 4UFGH 1AMHA 3BTDE 1IQLA 4TWYA 3PB1E 4K1TA 1Z6EA 2BX4A 1Y5BT 1WU1A 4YOIA 4I8JA 1FAXA 5A8YA 2P94A 4NZQA 4O9VA 4XE4A 4BXSA 2XTTB 5A0AE 1WQSA 1MBQA 2C8ZB 4D9QA 3T26A 1P09A 4YT6H 6CHAB 1FN8A 1Y3VA 1RIWC 2KAIB 3HATH 1C9TA 1PPEE 1HJAB 1SQTA 1O2RA 3BIVH 1GBMA 4WH8A 3MNBA 4X1SU 3KN2A 1CA8B 1BRBE 1RXPA 4I8KA 3TGIE 1CHOG 1TNJA 3O8DA 1BDAA 1KSNA 3SZNA 1C1PA 1S0QA 4HTCH 5ABWA 1ZOMA 3U8RH 1BMLA 1L2EA 3GDVA 3M5LA 1EP5A 2BD5A 1PQ5A 4O3UA 4Q2KA 1YPEH 1IQKA 4ZUHA 2ZU1A 3JZ1B 2P59A 3PO1C 3GY5A 1TA6A 1MU8B 1C5MD 5EOKA 1TRMA 1C5WB 1HBTH 1L1JA 1SL3A 1K2I1 2VWMA 3SNBA 1HAVB 1O2XA 1XKBC 4XSKU 1A0LA 3UUZA 2F9VA 1NPMA 1UTQA 3P6ZB 1PQAA 2YOLA 1O3NA 1L4DA 1EOJA 2Q6GA 3BIUH 3TK6A 1AHTH 1SLXB 1C1QA 1UVOA 2BVXH 1FXYA 1H9IE 1T4VH 4X6OA 4Z6AH 1H4WA 1ZSJA 2ZGXH 1W2KH 1QURH 1EJAA 4X2VA 1L1NA 1JWTA 1BB0B 5AHGH 1O2TA 1ZZZA 1JXPA 8ESTE 3RU4T 4TPYA 1BMMH 2FWWA 3RMNH 4JZEH 4UE7H 4Z0KA 1S0RA 2SGEE 4OS5A 3KIDU 1ZSKA 5EXMA 3SU2A 4M7GA 5DG6A 1UHBA 5A09A 1GBAA 3GDSA 3QWCH 1F0TA 1H8DH 3MH7A 1V2VT 4NFEA 1Z1JA 1F2SE 1FJSA 3RP2A 1GBJA 1ACBE 1UTOA 5JBTA 2QA9E 3SI3H 5L6NH 5LPFA 4O97A 4AYVB 2LNCA 1PQ7A 1EZSC 1SMFE 1C2FA 1ORFA 3E8LA 3IWMA 3KQBA 5C1XA 5HM2A 3ATWA 1GMHG 1BHXB 1O34A 1Y3YA 1SGPE 5C1YA 3NK8A 2G51A 3SUGA 3SGAE 5GWZA 1K1PA 3DA9B 3B9FH 2DUCA 2BY6X 3AW1A 1C2JA 3IG6B 5AFYH 2A7JA 2CGAA 4ZHLU 1Z8RA 2SNWA 1AFQB 2Z9GA 3NXPA 2BQ6B 4I31A 4OS1A 1W12U 4ABFA 1ELDE 4K2YA 2Z3EA 4QT8C 1QBNA 4DT7B 1TE0A 2AGIX 5IDKA 2ZFPH 3SGQE 2PKAB 1XUKA 4X8VH 3AASA 1RTFB 1AY6H 1K22H 1WOFA 1ARCA 3TJVA 1P2KA 4K69A 4YOGA 1EJMA 2FMJA 5FBIA 2D1JA 5GXPA 1ZJKA 1P57B 2CN0H 4R0IA 4R8TB 1YCPH 1QQ4A 2O8TA 3URDA 1TBZH 1EUFA 2G81E 1QB6A 3S7KB 4ZMAH 1S5SA 4HFPB 4UD9H 3FP7E 1GI0A 2VH0A 5A0BA 1MQ6A 1P3EA 1BIOA 1VGCB 4Y6DA 1THRH 2QXIA 1V3XA 1WUNH 3U8OH 4AGKA 1DLKB 2FOEA 1A3BH 3LGUA 1O2JA 2FP7B 4MDSA 1G36A 1GJCB 1Y59T 2HPQH 1TPOA 2TBSA 3D62A 4CH2B 3A7WA 3BTGE 4B71A 1O5CB 5JBCS 1NS3A 2ZGBH 4NZLA 5F8ZA 3GYMA 3TK5A 6CHAC 2XXLA 1GBKA 4B2AA 2P3FH 4Y0YE 5FXLA 2STAE 2D26C 3A7TA 1LHCH 2VWNA 1TNHA 2QAAA 2BY9X 2VGCB 1P2MA 4INLA 3FFGA 1GI1A 2ZGJA 5E2PA 1Z7KA 1TNLA 1XUJA 3MO6A 1ZPZA 1MZAA 4FUCA 1VITG 2HNTE 4DGJA 4ZHAA 4E06H 2BTCE 3TIUA 3UNRA 4TWWA 2BDIA 2STBE 2A4RA 1S6HA 1SC8U 1SGYE 2EC9H 1EATA 3TITA 1T8NA 1TPSA 4Y8ZA 2Z9IA 2PW8H 2B5TB 4IN2A 1PPFE 2ANKH 4MPVA 4Y76A 3PMJA 1BMNH 1EOLA 1YPMH 4MG3A 3F68H 2WPIS 4JK5A 4A7IB 1UJ1A 2BQWB 1HXFH 4LK4A 1O2LA 3E3TA 4AORA 3GICB 3CS7A 3RXQA 5I25A 1JRTA 2FEQH 1MTSA 1C1OA 1FIZA 1GBFA 1QJ1B 2VIWA 3RXKA 1WBGB 3A81A 4PROA 1HFDA 2D8WA 1ZJDA 4WMDA 4A1VA 1Z71A 1LHFH 5DP9A 1TGTA 1RD3B 5GCHF 2V35A 4WWYA 3UOPA 1GHZA 1ZLRA 4MNXA 1PYTD 4AG1A 1PPHE 4FVDA 1O3BA 2V3OH 5TCAA 2ZQ2A 1GWAA 2OINA 4NWKA 1KXDA 4A5TS 1EPTB 3BTWE 3K9XB 1V2JT 3MFJA 4ZXXH 1U6QA 1GBBA 1G30B 2UUJB 3ELAH 3TJNA 4FUDA 1BUIA 1IHSH 3P8GA 3P95A 1NU9A 2H5DA 2C93B 2OC1A 1O3OA 1TBRH 2OCVB 3CS0A 1UO6A 3FP6E 2IJOB 1LVBA 1E0FD 1TOCB 1ESTA 2CXVA 1W11U 1UTKA 3M61U 5J4QA 2FX4A 1O3KA 5C5OA 2WINI 3MH5A 4CRDA 1D4PB 1ETRH 1L0ZA 4U01A 1HAPH 2VIDA 1GCTB 1A5IA 3M7QA 3SGBE 3EE0B 3GY7A 4Q80A 4CREA 5LPRA 2XCNA 1DLEA 1BTPA 3LH1A 2AMDA 4X6NA 3VB4A 2FS9A 3TU7H 3RMLH 1P2OA 2ANMH 2Y81A 3V7TA 1DFPA 1MCTA 2FIRH 1OPHB 4GHQA 4MNWA 4X8UH 2EI7A 4YZUA 3GY8A 2CJIA 1J9CH 4JK6A 1C5TA 3G01A 5AF9H 1BTYA 3VXEH 3SU5A 5EPNA 5G4BA 1TQ7B 3RM2H 1BTHH 3RXVA 3A85A 2Z9LA 1ZHMA 1NROH 2B9LA 4UONA 4ABBA 2WV4A 2ZCKP 1G3BA 4MLFB 5GDSH 3ATMA 3SV8A 2Y5HA 1MU6B 1RIWB 2WPLS 2VIQA 4YTAA 2OP9A 2AFQB 9ESTA 1ELVA 2ZTZA 4Y0ZE 1GJ9B 2BLQA 3LDXH 2CF8H 2A5IA 1Q3XA 3RXJA 3OYPA 4X1PU 2XRCA 2G55A 5EW1H 1T7CA 1DICA 3W95A 3AW0A 4TPIZ 3UREA 3ZZCA 4WVPE 4MNYA 1GBIA 2IPHA 3RXOA 1LTOA 1O3DA 1HLTH 8LPRA 4X1RU 5EW2H 2QC2A 1IQHA 2A5KA 2C3SA 5FAHA 1NRPH 4ZROA 4XBDA 3PO1B 1DUAA 1CE5A 1D9IA 2OBQA 2NU2E 4J1YA 5TCCA 4JZ1A 4IW4E 1SQOA 1EAXA 3ZVFA 2ZA5A 3U9AH 1GHYH 1O38A 2DE8A 1TYNA 2FTLE 3SNAA 3DD2H 3B8JA 3RU4D 1PJPA 2A31A 4MPUA 2TRMA 1SOTA 2VGCC 2QYIA 3LGYA 4ESTE 1ABJH 2Z3CA 2H9EH 4K8BA 6GCHG 1QL8A 4MQAA 2Y6TA 1AU8A 1P02A 1O2NA 3SU6A 2HALA 1GI4A 4GCHG 1DOJA 1O3IA 1MMJN 2BXUH 2BZAA 3QGNB 2FM2A 1HRTH 2FI3E 1ZGIA 4WY3A 1D3PB 3S9AA 4ISOA 1DS2E 1GMCF 2J94A 2TPIZ 1V2PT 1EJNA 1FQ3A 3RXRA 1O39A 3ZZ6A 1W0ZU 5HXFA 3B23B 3T29A 1UK4A 1OWKA 4A92A 2SGPE 1TMBH 4NA8A 2F91A 1X7AC 3ZVAA 2W5EA 1THSH 4AFQA 3QGJA 1MD7A 3SHAH 4A1TA 1O3GA 4OGYA 1AWHB 1BZXE 3BTHE 3SORA 5FX5A 2FO9A 3VB3A 1GVLA 1A1RA 2GKVE 1A0JA 4ABIA 5SGAE 1IQEA 2GCHG 5DK1A 1C1UH 1SBWA 4I8GA 1EAUA 1MKWK 2PLXA 3U1IB 4CBNA 2BB4A 3UR9A 1NFXA 4IN1A 1BA8B 2AGEX 3ZYEA 5C3NA 5EU8A 4WXVA 2ZFQH 5DP8A 4INHA 1C4V2 1DSTA 1Q31A 1SPJA 2B0FA 3RMMH 1TPAE 3M5MA 1DT2A 3ATIA 3FZDA 2OC7A 1SGCA 2O8LA 1CGIE 2ZU3A 3E6PH 3LGVA 2Y7ZA 3RXFA 4NA7A 1LKBA 2PGBB 1HAHH 3F9HA 1GMDF 3ATLA 1EPTA 1HGTH 4NSYA 1GHWH 1O2ZA 1TOMH 2VWOA 3C1KA 4GHTA 2J95A 3STJA 2AMQA 2I6QA 2ALVA 1OWHA 2A7HA 2A5AA 2OXSA 1IAUA 4NFFA 4LOYH 1GGDC 2A2QH 2P95A 5E0GA 3VB5A 1GCTC 3RXAA 8GCHF 4FUEA 4AZ2B 3P70B 4X1NU 3GCHB 9LPRA 1BTUA 1FY5A 4BXWA 4CHAB 1EXFA 1S83A 3EA8A 1XX9A 2AH4X 1A4WH 1SVPA 2ZFSA 3M3VA 2GZ7A 3Q76A 1BTZA 3PWBA 2J2UA 4DW2U 1CQQA 2SFAA 2TGDA 1QGFA 4B74A 2GV6A 1C2IA 4KTSA 1DWCH 1YGCH 1ESBA 3MU5A 3BTQE 1MTUA 2ZF0H 3SU0A 3M5NA 2ZO3H 2ZDAH 1PFXC 1GBHA 1P3CA 3QTVH 1JOUB 2BOHB 2ZPSA 4MNVA 2ZDVH 4H4FA 4TY6A 3ESTA 4AGJA 4FUHA 1ZHPA 1TABE 4Q7YA 2ZGCA 3PLKA 2XBVA 1MBMA 1NRRH 1GJ7B 3RXGA 1LHGH 5J4SA 1AVXA 1SI5H 3A82A 2NU4E 1P8VC 3M5OA 4CBOA 4I8HA 1CBWC 2A45B 3HKJB 4RKOB 2PFEA 1TAWA 1W7XH 4AG2A 3KF2A 3N7OA 1YLDA 2BDHA 1BMAA 3RC6A 2WUBA 1DX5M 2BY5X 2ZFFH 3P92A 1S82A 2FYQA 1P2JA 1P05A 1QJ7B 2JETB 3Q3XA 1HNEE 1AE8H 3ODFA 1K1NA 1HIAA 1SGDE 3MYWA 2R3YA 1JIMA 4INKA 3BN9A 4OGXA 1SSXA 3LIWA 3SUEA 5L2YH 2ZIQH 5F03A 1CA0B 1RGQA 3SNEA 1P9SA 2B8OH 3UIRA 4FXGH 2CHAC 2P3TB 2ASUB 1UVUH 5HMAA 1PPZA 1QL9A 3ODDA 1P01A 1HAYB 2FS8A 1HAOH 3M7UA 2ZHQH 1QIXB 3S7HB 2J4IA 1P03A 1V2QT 1EZUC 4ISIH 1O3JA 2HVXA 1GBCA 4U2WA 1V2LT 3VXFH 2HNTF 1OP8A 1AB9C 1P2NA 1GBTA 2AERH 1J14A 1B7XB 3RUOA 4I7YH 2BX3A 2GT7A 2VNTA 2ZNKH 2J92A 1VR1H 2M5TA 3E16B 1ZHRA 4CR9A 2HNTC 4BNRA 2ZU5A 1YPKH 4LZ1H 1O2QA 1MTNC 1ZMLA 2ZGHA 2VIPA 1C1MA 2I6SA 2ZPQA 4E7RG 3BV9B 1SGEE 1G3EA 1GI7B 1ANEA 2A4OA 1G37A 1Z8JB 2QF3A 4IC5A 4RSPA 1XMNB 1AVWA 1OOKB 5DKMA 4O3TA 1ELAA 2FLRH 4SGBE 1VZQH 2BZ6H 5JB9S 2Q1JA 1KXAA 3A89A 1QB9A 2BVSH 1DY9A 1QY6A 2WPJS 4ZKOU 1GHBG 3RXTA 1AN1E 1LPKB 1YF4A 4ZXYH 3T27A 3GCTF 1TALA 5ETXA 5CMXH 1WTHD 1TX7A 1D3QB 3LU9B 4X8SH 3SJIA 3SQHE 3PTNA 4HI3A 3ZVCA 2ILNA 4DY7B 3D49H 3RXIA 2TGTA 2XWBI 4NA9H 2QXJA 1GDUA 4K8YA 1TRNA 2ZFRH 1GL1A 3KQCA 4I32A 1EB1H 3UWJH 5JBAS 1O37A 2C4FH 4XBCA 2XW9A 7ESTE 3GDUA 3EYDA 4X8TH 5JPMH 2H9TH 4BAHB 1UCYK 1C2LA 2PSXA 3I78A 4YOJA 1O2UA 1SFQB 1SB1H 2ZU4A 4KTUA 2XC4A 4XOJA 3UNSA 2VVCA 3AAUA 3E1XB 1CU1A 2PTCE 1P10A 1CHOF 3GCHC 1IHTH 4GVUA 2FOHA 5FHTA 5I46H 3SUFA 1F5RA 1ARBA 3AVZA 4CHAC 1HXEH 2ZTXA 3BTTE 1S85A 1UK2A 3GCNA 2ZKSA 3A7ZA 2PWXA 1JBUH 4X0WU 3TPIZ 3R0FA 2VWLA 2BQ7B 4ISLA 5ESBA 5ESTE 3MNSA 3KGPA 3BG4B 1XUHA 4FUBA 4ZKSU 1P04A 4BAQB 2ZECA 4NSVA 1YPGH 2FI4E 5L30H 5L2ZH 1A5HA 4X1QU 4IGDA 3TGJE 1ZMNA 3LJOA 1YC0A 1Y5AT 3EA9A 4F4OC 4DIIH 1O2KA 1O5EH 4FVBA 1G2LA 4YLQH 4E7NA 1XXDA 3A86A 1ELCA 3RLWH 2A7CA 4KKDA 5DP3A 1ZTJA 1NFUA 3F9GA 1OX1A 2F3CE 1V2MT 2W3KA 3GY6A 2KAIA 1W0YH 1SLVB 1K1JA 4NG9H 4UFFH 3E0PB 2GT8A 4Y7AA 2QV1A 3ENSB 3ZZAA 5GJ4B 1C5XB 2W3IA 4A1XA 1SLWB 1O3FA 1NFYA 5EQRA 2JETC 1LQDB 1EASA 2H5CA 4CRFA 3GY3A 1O5AB 3BF6H 2BDYA 1GI5A 1RRKA 1UCYE 4X2WA 4RKJB 1ETSH 3ZVBA 3RXPA 3BTKE 2WPMS 1O5FH 1HJ8A 1YBWA 1TA2A 1O5GH 1XVMA 1CA0C 1J8AA 1GG6C 1MKWH 1PPGE 1WSSH 3DFLA 1T31A 5EQSA 2F9PA 1CGHA 1ZGVA 4KP0A 6LPRA 1HAVA 3EAJA 1O3HA 1O30A 1GI3A 3QLPH 4DOQA 5DPAA 3P8FA 1GMHF 3SV7A 4IBLH 5T6GA 4BTTB 1S81A 2OTVA 5C1UA 4B76A 2W7UA 3MMGA 2PUXB 1UTLM 4AB9A 3LGTA 1K1MA 1PQ8A 3A7YA 2ULLA 2C8XB 2WYJA 3P8NA 3UWIA 1A61H 5E2OA 1B0FA 2ZFTA 1SHHB 1EKBB 2BDCA 1P9UA 1V2ST 3EQ0H 1O5DH 5FCRA 4FUFA 1BT7A 1QJ6B 1YKTA 3I29A 3ZZ7A 3SBKA 1N1LA 2TGPZ 2R9PA 2FYRA 1GMCG 2PTNA 1TMUH 1J15A 7LPRA 1MAXA 2G00A 3S9CA 2SGDE 2GP9B 1NTPA 1PPBH 1GGDB 2GX4A 2VH6A 2GVFA 4YLUA 3Q3YA 1ESAA 1THPB 3ZYDA 2H9HA 2BOKA 1KLTA 4X2XA 1CSOE 2Z9JA 4OS4A 1AWFH 2O9QA 7GCHG 4AN7A 1O2GH 2PKSC 1N8OC 1TPPA 4VGCC 3O8CA 1C5OH 2ZDLA 5JBBS 3RU4E 5C67A 1QRZA 1AD8H 4H42U 3DT0H 1AZZA 8KME2 3VGCC 2R0KA 1GHAF 5A8ZA 2AIQA 1UTNA 1MH0A 2VIVA 3HKIB 1V2RT 3STIA 4U32A 2PHBA 4DIHH 2GD4B 2HWLB 4ZH8A 2PKAA 1XUFA 4XDEA 1E38B 4K60A 4FU8A 3F9EA 5FPTA 4IMQA 1DITH 1ELFA 1HV7A 2IN2A 2O8UA 4MPWA 3KQDA 1K28D 3MNXA 1CBWB 3GY2A 3A83A 4AFSA 3ZZDA 2Z6BD 1F92A 3QX5H 1VITF 3HGNA 3SNCA 3RXDA 5BRRE 2R0LA 1TNKA 4Y8YA 2ZI2H 3ZVDA 1TNIA 1T8LA 1NC6A 3MWIU 3UR6A 1AIXH 5EXNA 2ZCLP 3BG4C 3U98H 1ZSLA 2H2ZA 2EA3A 3UFAA 3V0XA 3OX7U 3RLYH 1DDJA 1EAWA 3SV9A 3OY5U 5EXLA 3F6UH 1ELEE 2BYAX 1TLDA 2NU1E 4GLYA 4B75A 2J9NA 3TJUA 1QQUA 1Z8IB 2FDAA 2V3HH 3TGKE 3MO9A 2Y5GA 1AUTC 3F1SB 2FOMB 3TJOA 2ZC9H 2G5VA 2CHAB 3RXHA 4CR5A 1ZPCA 3PMAB 4D8NA 5C2ZA 3RDZA 4TYDA 1HDTH 4DG4A 3TVJB 1NESE 3NUMA 2AYWA 2NU0E 2Y7XA 2SGQE 5E0HA 2CF9H 1AFEH 1CT4E 1GPZA 1FAKH 2FODA 5FBEA 1TIOA 1C2HA 1TGNA 4BTUB 4GSOA 1AB9B 4SGAE 1K1IA 4RN6A 4D9RA 1MD8A 1CHGA 3QK1A 4BANB 1NRQH 4FU9A 1AZ8A 1CO7E 1SGQE 1GVZA 1HPGA 3LC3A 3LKWA 2FOGA 5EGMA 1W14U 1DWBH 1L1GA 1MTNB 2QCYA 1O5BB 3SJOA 1K1LA 1C5SA 1FY1A 1Z8GA 5LH8A 2C8YB 2P93A 3A8DA 4B1TA 1YPHE 2AGGX 2O8WA 3MHWU 3MNCA 1LHEH 4FU7A 4WF8A 3SU3A 2NWNA 1A46H 3CENA 2JH6D 1Z1IA 2BD3A 4AFUA 5CHAB 1T32A 3QZRA 4A6LA 2UUYA 1AUJA 1MKXK 1O2HA 2F9OA 3PROA 4WMFA 1O31A 1O3AA 3A7XA 5LPEA 3SO3A 1BCUH 3ZZ5A 1OWDA 1UCYH 2FLBH 5GIBA 3UQVA 1HJ9A 1D6WA 1FIWA 3PM3A 3PLBA 3M35A 3PMHB 4IMZA 4ISNA 1C1SA 3KNXA 3PWCA 1P11E 2HLCA 2OBOA 1QRWA 1C2MA 4BAMB 4NWLA 5K0HA 1CT2E 2G8TA 1LPGB 2XWAA 4KELA 1GBEA 5PTPA 1QA7A 1RJXB 1P06A 1XM1A 4UFDH 2G5NA 3A88A 2VVUA 1V2NT 3T5FH 4OS6A 2CMYA 3ZV9A 4CRBA 1E37B 3SV2H 3URCA 3O8RA 2ODYB 3M37A 1D3DB 2FX6A 2ZEBA 3SJ8A 4YM9A 1FI8A 2BD2A 3RXMA 3KQEA 1B5GH 2OC8A 4AB8A 3ATKA 3ZV8A 1ANCA 2OUAA 3HPTB 1UMAH 3TNSA 1FY8E 1LVMA 4U30A 1SGIB 1F0UA 1NRSH 1MTVA 5JDUB 5K7RA 3LT3A 3UY9A 1HUTH 4NIWA 1FMGA 1ZTKA 2QF0A 3ZZ3A 2BD4A 1QTFA 1KXFA 1Y8TA 3QZQA 4D76A 4JZIA 3TH3H 6ESTA 1HAXB 1YPLH 1LQEA 1EP6A 3I77A 1N6YA 3MO3A 3Q77A 4ASHA 3MU1A 1IQFA 1FN6A 2K1QA 4KTCA 3ZVEA 1C5LH 1A0HB 1O2IA 2UWOA 4I33A 2IOTA 4THNH 2RCEA 4MPXA 1GCDA 4WXIA 3MU0A 4CRAA 6GCHF 1F0RA 3RC5A 4IS5A 3UPEA 2J34A 1FNIA 3SU4A 4ISHH 1UVTH 1YLCA 3LC5A 4GCHF 2OLGA 1O2YA 1GJ8B 2XC0A 1KTTB 3SI4H 3WY8A 1VJAU 1WYKA 2EI8A 3C27B 5HYOA 3PYHA 4GPGA 5DO4H 2GCTB 3TH4H 3OTJE 5F8TA 4GUXA 1C1RA 3CP7A 2JH5D 3UOUA 1KTSB 1MQ5A 3P8OA 3ZVGA 1NU7B 4WMEA 5T6FA 2EI6A 4JZFH 1GL0E 1DE7H 4I8LA 3TLOA 2ZDKA 5E0JA 3TH2H 3VB6A 1DSUA 1GG6B 1TGBA 1QRXA 1BTWA 1F0SA 1N6XA 2PV9B 1DANH 2WYGA 2AS9A 5FX6A 1KLJH 3S0NA 3MI4A 2GZ8A 2GCHF 4B2CA 3SNDA 2PR3A 1BTXA 3HK3B 2BMGB 3OY6U 5GPIB 2FESH 3HGPA 5FPSA 1GHVH 1GVKB 1PYTC 3GYLB 1G3CA 1DXPA 1H9LB 2GTBA 2BD9A 2F9BH 1SOZA 1BBRK 1EZXC 2WUCA 1H8IH 3D23A 3M3TA 3M3SA 5FCKA 2BLOA 1BITA 1UTPA 2BY8X 4JZDH 2GMTC 1C4U2 1XKAC 3RC4A 4ZKRU 5A0CA 1OYQA 1ZRKA 3KL6A 5IYTA 3LOXA 2YNAA 4H6SB 1ABIH 4HZHA 1O3EA 1F7ZA 2BLVA 3L6PA 3E91A 2UUKB 1O33A 2ALPA 2CV3A 3IITA 3BEIB 3T62A 1S84A 2UWLA 2ZHFH 3L33A 1OYTH 4WJG2 1O2WA 4Y11E 2PSYA 3QDZB 5CHAC 3R3GB 1INCA 4JYTA 1SLUB 3F9FA 3KEEA 1LKAA 1HAIH 1SQAA 4B2BA 1ID5H 2PKSB 3K65B 1N8OB 4VGCB 2Z7FE 4Y7BA 3RXCA 1S6FA 4Q7XA 1JMOH 2A4QA 3VGCB 1DXWA 5H4IB 1T4UH 5F8XA 1ANBA 1SGTA 4WH6A 3RXSA 3GCOA 2VIOA 1SGFG 2A1DB 3MTYA 1GJAB 3VB7A 1DM4B 1OP0A 3FZZA 1TMTH 2WPKS 3SJ9A 5GCHG 4XBBA 3PMBB 1T8OA 1NM6A 1XUGA 4UDWH 1C1TA 4NGAH 5A2MH 3K6YA 2VVVA 4MTBA 4FUIA 1BBRE 3T28A 2BXTH 2A32A 4YT7H 3U8TH 3GOVB 1GDQA 2C8WB 1LMWB 4D7GA 1AO5A 3A80A 3M36A 3A8CA 3HK6B 2YNBA 4OS7A 2ZQ1A 5F6MA 1GI9B 4ABHA 1TX8A 1O3LA 5DJ7A 2BM2A 2GV7A 2Y82A 2TIOA 1ANDA 1OWJA 2FOFA 2ZU2A 1AKSB 1UVPA 1H1BA 2HRVA 4GAWA 1V2OT 4Y71A 2XBWA 1ZYOA 2EEKA 1O2MA 4FUGA 1L4ZA 1QFKH 1TWXB 4OS2A 2LPRA 2Q6DA 1TBQH 1DUEA 5FPYA 3GY4A 2R2WU 3SN8A 1IQJA 1J17T 1O3MA 2Y5FA 1XVOA 1FUJA 4ZKNU 2OC0A 1TQ0B 1GHAG 1J16A 1Y3UA 4K1SA 1KY9A 1VCWA 3O8BA 3OSYA 4ABAA 4DJZB 1VITH 3SV6A 2ANYA 3V12A 4UEHH 1GDNA 2OQ5A 2BDBA 1O2SA 3EA7A 2PUQH 3PLPA 2ZDNA 2P8OB 1ELTA 4F49A 4YESB 5EPYA 1QBVH 4KGAA 1FPHH 4JCNA 1HJAC 1OKXA 1C2GA 2GCTC 1C5RA 2ZG0H 4AYYB 2THFB 3LPRA 1DY8A 1UVSH 1LO6A 1SHYA 1GJ6A 2ZHEH 1A2CH 2Y80A 1AVGH 5C20A 2SGAA 1EQ9A 1GHXH 4ZAEA 2AIPA 4Q7ZA 3SW2B 3BSQA 1HAZB 1GBDA 1G3DA 1ZTLA 1V2TT 1OWIA 2BVRH 1MKXH 2PGQB 2F83A 2G4UA 2XCFA 3UTUH 1W13U 3H7TA 2V6NA 1E34B 1XXFA 4AOQA 1VJ9U 5C5NA 4YO9A 3NPSA 1RFNA 1BJVA 2HGTH 1SGRE 5T3HA 4BAKB 1WQVH 3RXEA 1CVWH 3T2NA 1Y3WA 1ZMJA 1C5NH 1TGSZ 1GHBF 2F9NA 3RXLA 1C2EA 4X2YA 1BRAA 1QR3E 5E8EH 1NY22 1OSSA 3A7VA 5LGOA 1QCPA 3NZIA 1RS0A 2H1UA 1EX3A 3FAOA 1T8MA 1NT1A 1FONA 2JH0D 2VJ1A 3SU1A 2FI5E 3H7OA 4Y8XA 2R2MB 1V2UT 2XYAA 2O8MA 1NO9H 5HGGA 2FOBA 1O0DH 3JZ2B 1ETTH 1XUIA 1HB0B 2G52A 2BY7X 2V0BA 1YYY1 4DURA 2ZTYA 1FV9A 1KXEA 2ZCHP 2NU3E 1IQMA 1QA0A 1C9PA 1KDQB 5AFZH 2ANWA 1SFIA 1O36A 1MZDA 1WAYB 2Z94A 3BEFB 1HCGA 3GISB 4K5ZA 2QXGA 1SGFA 1C1WH 3RM0H 3VPKA 3A8AA 2H6MA 5HM9A 2UWPA 1A3EH 1BQYA 4X6PA 2ODPA 1OXGA 3BTFE 1FZZA 2Q6FA 2HOBA 5T6DA 1YP9A 1G32B 2TGAA 4Y10E 4ABGA 2SNVA 4K3JA 1KXCA 2VINA 1BHXF 3P17H 1O32A 1FY4A 1O3PB 1BOQA 1RTKA 1LVOA 2UUFB 4AFZA 2ZHWH 1DVAH 1TRYA 1YPHC 4NIXA 1ZPBA 3OU0A 3A84A 3NCLA 1E36B 1P0SH 1Y3XA 3QUMP 2F9UA 1AQ7A 5DP6A 1HAGE 1C5PA 1NN6A 4ABEA 1IOEA 1LPZB 4BAOB 1O2OA 4DCDA 1BJUA 4ABDA 2BDAA 5BPEA 1SGNE 5JB8S 3M7TA 1W8BH 1DWEH 1QHRB 3K6ZA 1D6RA 3A8BA 3TNTA 2ZWLH 1SR5C 4UFEH 1JRSA 1C5YB 2AEIH 1G9IE 1UK3A 4HGCA 3KHVA 1AFQC 5DP5A 2JKHA 2R3UA 2ZPRA 1LCYA 4IC6A 2A4GA 1G2MA 4JYUH 1QBOA 3DUXH 5EQQA 3RXBA 1FY3A 1WCZA 2A2XH 1SG8B 3MH4A 3AAVA 2B7DH 3H5CB 1MCVA 1C2KA 3E0NB 7KMEH 1KYNA 3FVFB 2QXHA 3LONA 4NCYA 3V13A 1GMDG 1F5KU 4ZHMU 2D2DA 2XC5A 1DPOA 1O3CA 1JIRA 1CT0E 1W7GH 2HPPH 2W26A 2RA0A 4DVAU 3VEQB 4H6TA 1HYLA 2BHGA 1C1VH 3LJJA 1LDTT 4ABJA 2C90B 2J38A 1A5GH 3LGIA 1C5QA 1TFXA 4FUJA 4J2YB 1Y5UT 4X6MA 8GCHG 1V2WT 1C4Y2 1PPCE 2FXRA 1VGCC 3L3TA 1CGJE 2RA3A 3RXUA 1TONA 3FANA 3SJKA 3W94A 1Q2WA 1HIAB 3DHKH 1YCPK 3VFEA 1AE5A 2GZ9A 2GDEH 3QN7A 1VCQA 2Z3DA 4MVNA 5JYIA 1KXBA 1AKSA 1EAIA 2WPHS 3KCGH 4BTIB 1AI8H 3PTBA 5EG4A 1TB6H 4LZ4B 1GJ4H 2AMPA 5A8XA 1BBRH 3EDXB 2BLWA 3FP8E 3SOSA 1H9HE 4XFQA 1WTGH 1ELBA 1AGJA 2P3UB 1YPJH 1LHDH 4E05H 1GJ5H 1QL7A 4TY7A 2P8OC 3SQEE 1BRCE 2QGRA 5CE1A 1NZQH 2XBXA 4B73A 1IQIA 1F5LA 1E35B 1YM0A 2OD3B 1V2KT 2RDLA 2ZDMA 1GBLA 2ZHDA 3MH6A 3Q3KA 3MU4A 5DP4A 4LXBH 2GGVB 5B6OA 2GDDA 2XBYA 2W7SA 1FPCH 3ZZ8A 3UQOA 1GI2A 1DWDH 2GMTB 1LVYA 1K21H 1KLIH 3BTME 3Q00A 1UHBB 1ZRBA 1K1OA 2RG3A 1TX6A 3BEUA 2ODQA 3E90B 4CRCA 3ITIA 1EZQA 1TNGA 2FZZA 5TJXA 1C1NA 3MOCA 3MU8A 1MTWA 1W10U 2A0QB 3EGKH 1C5UA 2ESTE 2VU8E 1ZR0A 1C2DA 7GCHF 3QO6A 4NIYA 3TK9A 4CRGA 2WV5A 1GI8B 1GJBB 1C5ZB 3T25A
chains in the Genus database with same CATH superfamily
1UTJA 3OFND 3K2UA 4NIVA 3LGWA 1IQNA 1NRNH 1O2VA 2DE9A 3A87A 5EODA 3DFJA 2FPZA 3ZZBA 1V6DA 1VCPA 1W3CA 3U1JB 3PV4A 3V3MA 1Z6JH 1O35A 2QY0B 4K1EA 1BRUP 2FTMA 3UNQA 1ELGA 3SHCH 1P12E 3LH3A 1YWUA 2FOAA 1EPTC 1KDQA 4JYVH 2P16A 1QNJA 1GJDB 1P2IA 2XNIA 3QTOH 1C5VA 1UTMA 2FOCA 1QB1A 3D65E 3BG8A 1YCPM 1M9UA 2ZZUH 4D7FA 3BTEE 2ZP0H 2QN5T 3ZZ4A 1MAYA 4O03A 1OP2A 1FLEE 1IQGA 1P2QA 2BD8A 2BDGA 1B0EA 3ZZ9A 1A7SA 1NFWA 1FDPA 1GI6A 1OWEA 1EB2A 2BD7A 2Z9KA 1K9OE 1WV7H 5DGJA 1RTLA 5DP7A 2SGFE 3S69A 3U69H 5AVDA 3RMOH 2OQUA 3NWUA 3S9BA 1OS8A 4AX9H 2G4TA 4JMYA 2QIQA 1KIGH 1TGCA 3SUDA 1O2PA 4CH8B 4Y79A 3GCTG 3NKKA 1MUEB 2VB0A 4BOHA 1D3TB 4FOUC 4UFGH 3F0PA 1AMHA 3BTDE 1IQLA 4TWYA 3PB1E 4K1TA 1Z6EA 2BX4A 1Y5BT 1WU1A 4YOIA 4ZCNA 4I8JA 1FAXA 2WPDD 5A8YA 2P94A 4NZQA 4O9VA 4XE4A 4HG6A 4BXSA 2XTTB 5A0AE 1WQSA 3F2GA 1MBQA 2C8ZB 4D9QA 3T26A 1P09A 4YT6H 6CHAB 1FN8A 1Y3VA 1RIWC 2KAIB 3HATH 1C9TA 1PPEE 1HJAB 1SQTA 3GS9A 1O2RA 3BIVH 1GBMA 4WH8A 3MNBA 4X1SU 3KN2A 1CA8B 1BRBE 1RXPA 4I8KA 3TGIE 1CHOG 1TNJA 3O8DA 1BDAA 1KSNA 3SZNA 1C1PA 1S0QA 1QZ8A 4HTCH 5ABWA 1ZOMA 3U8RH 1BMLA 1L2EA 3GDVA 3M5LA 1EP5A 2BD5A 1PQ5A 4O3UA 4Q2KA 1YPEH 1IQKA 4ZUHA 2ZU1A 3JZ1B 2P59A 3PO1C 3GY5A 1TA6A 1MU8B 1C5MD 5EOKA 1TRMA 1C5WB 1HBTH 1L1JA 1SL3A 1K2I1 2VWMA 3SNBA 1HAVB 1O2XA 1XKBC 4XSKU 1A0LA 3UUZA 2F9VA 1NPMA 1UTQA 3P6ZB 1PQAA 2YOLA 1O3NA 1L4DA 1EOJA 2Q6GA 3BIUH 3KYFA 3TK6A 1AHTH 1SLXB 1C1QA 1UVOA 2BVXH 1FXYA 1H9IE 1T4VH 4X6OA 4Z6AH 1H4WA 1ZSJA 2ZGXH 1W2KH 1QURH 1EJAA 4X2VA 1L1NA 1JWTA 1BB0B 5AHGH 1O2TA 1ZZZA 1JXPA 8ESTE 3RU4T 3NRLA 4TPYA 1BMMH 2FWWA 2WSSD 4JZEH 4UE7H 4Z0KA 3RMNH 1S0RA 2SGEE 4OS5A 3KIDU 1ZSKA 5EXMA 3SU2A 4M7GA 5DG6A 1UHBA 5A09A 1GBAA 3GDSA 3QWCH 1F0TA 1H8DH 3MH7A 1V2VT 4NFEA 1Z1JA 1F2SE 1FJSA 3KQ5A 3RP2A 1GBJA 1ACBE 2L74A 1UTOA 4P00A 2QA9E 3SI3H 5JBTA 5L6NH 5LPFA 4O97A 4AYVB 2LNCA 1PQ7A 1EZSC 1SMFE 1C2FA 1ORFA 3E8LA 3IWMA 3KQBA 5C1XA 5HM2A 3ATWA 1GMHG 1BHXB 1O34A 1Y3YA 1SGPE 5C1YA 3NK8A 3W1EA 2G51A 3SUGA 3SGAE 5GWZA 1K1PA 3DA9B 3B9FH 2DUCA 2BY6X 3AW1A 1C2JA 3IG6B 5AFYH 2A7JA 2CGAA 4ZHLU 1Z8RA 2SNWA 1AFQB 2Z9GA 3NXPA 2BQ6B 4I31A 4OS1A 1W12U 2V7QD 4ABFA 1ELDE 4K2YA 2Z3EA 4QT8C 1QBNA 4DT7B 1TE0A 2AGIX 5IDKA 2ZFPH 3SGQE 2PKAB 1XUKA 4X8VH 3AASA 1RTFB 1AY6H 1K22H 1WOFA 1ARCA 3TJVA 1P2KA 4K69A 4YOGA 1EJMA 2FMJA 5FBIA 2D1JA 5GXPA 5C0UA 1ZJKA 1P57B 2CN0H 4R0IA 4R8TB 1YCPH 1QQ4A 2O8TA 3URDA 1TBZH 5EJ1A 1EUFA 2G81E 1QB6A 3S7KB 4ZMAH 1S5SA 4HFPB 4UD9H 3FP7E 1GI0A 2VH0A 2KZ4A 2W6JD 5A0BA 3PV2A 1MQ6A 1P3EA 1BIOA 1VGCB 4Y6DA 1THRH 2QXIA 1V3XA 1WUNH 3U8OH 4AGKA 1DLKB 2FOEA 1A3BH 3LGUA 1O2JA 2FP7B 4MDSA 1G36A 1GJCB 1Y59T 2HPQH 1TPOA 3DSOA 2TBSA 3D62A 4CH2B 3A7WA 3BTGE 4B71A 1O5CB 5JBCS 1NS3A 2ZGBH 4NZLA 5F8ZA 3GYMA 3TK5A 6CHAC 2XXLA 1GBKA 4B2AA 2P3FH 4Y0YE 5FXLA 2STAE 2D26C 3A7TA 1LHCH 2VWNA 1TNHA 2QAAA 2BY9X 2VGCB 1P2MA 4INLA 3FFGA 1GI1A 2ZGJA 5E2PA 1Z7KA 1TNLA 1XUJA 3MO6A 1ZPZA 1MZAA 4FUCA 1VITG 2HNTE 4DGJA 4ZHAA 4E06H 2BTCE 3TIUA 3UNRA 4TWWA 2BDIA 2STBE 2A4RA 1S6HA 1SC8U 1SGYE 2EC9H 1EATA 3TITA 1T8NA 1TPSA 4Y8ZA 2Z9IA 2PW8H 2B5TB 4IN2A 4B6FA 1PPFE 2ANKH 4MPVA 4Y76A 3PMJA 1BMNH 1EOLA 1YPMH 4MG3A 1H8ED 3F68H 2WPIS 4JK5A 4A7IB 1UJ1A 2BQWB 1HXFH 4LK4A 1O2LA 3E3TA 4AORA 3GICB 3CS7A 3RXQA 5I25A 2KCPA 1JRTA 2FEQH 1YY3A 1MTSA 1C1OA 1FIZA 1GBFA 1QJ1B 2VIWA 3RXKA 1WBGB 3A81A 4PROA 1HFDA 2D8WA 1ZJDA 2WHXA 4WMDA 4A1VA 1Z71A 1LHFH 5DP9A 1TGTA 1RD3B 5GCHF 2L6OA 2V35A 4WWYA 3UOPA 2WV9A 1GHZA 1ZLRA 4MNXA 1PYTD 4AG1A 1PPHE 4FVDA 1O3BA 2V3OH 5TCAA 2ZQ2A 1GWAA 2OINA 4NWKA 1KXDA 4A5TS 1EPTB 3BTWE 3K9XB 1V2JT 3MFJA 5T1VA 4ZXXH 1U6QA 1GBBA 1G30B 2UUJB 3ELAH 3TJNA 4FUDA 1BUIA 1IHSH 3P8GA 3P95A 3ZIAD 1NU9A 2H5DA 2C93B 2OC1A 1O3OA 1TBRH 2OCVB 3CS0A 1UO6A 3FP6E 2IJOB 1LVBA 1E0FD 1TOCB 1ESTA 2CXVA 1W11U 1UTKA 3M61U 5J4QA 2FX4A 1O3KA 5C5OA 2WINI 3MH5A 4CRDA 1D4PB 1ETRH 1L0ZA 4U01A 1HAPH 2VIDA 1GCTB 1A5IA 3M7QA 3SGBE 3EE0B 3GY7A 4Q80A 4CREA 5LPRA 2XCNA 1DLEA 1BTPA 3LH1A 2AMDA 4X6NA 3VB4A 2FS9A 3TU7H 3RMLH 1P2OA 2ANMH 2Y81A 3V7TA 1DFPA 1MCTA 2FIRH 1OPHB 4GHQA 4MNWA 4X8UH 2EI7A 4TSFD 4YZUA 3GY8A 2CJIA 1J9CH 4JK6A 1C5TA 3G01A 5AF9H 1BTYA 3VXEH 3SU5A 5EPNA 5G4BA 1TQ7B 3RM2H 1BTHH 3RXVA 2RDEA 3A85A 2Z9LA 1ZHMA 1NROH 2B9LA 4UONA 4ABBA 2WV4A 2ZCKP 1G3BA 4MLFB 5GDSH 3ATMA 3SV8A 2Y5HA 1MU6B 1RIWB 2WPLS 1WXRA 2VIQA 4YTAA 2OP9A 2AFQB 9ESTA 1ELVA 2ZTZA 5HIYA 4Y0ZE 5HIZA 5KECA 1GJ9B 2BLQA 3LDXH 2CF8H 2A5IA 1Q3XA 3RXJA 3OYPA 4X1PU 2XRCA 2G55A 5EW1H 1T7CA 1DICA 3W95A 3AW0A 4TPIZ 3UREA 3ZZCA 3N7EA 4WVPE 4MNYA 3DSGA 1GBIA 2IPHA 3RXOA 1LTOA 4TT3D 1O3DA 1HLTH 8LPRA 4X1RU 5EW2H 2QC2A 1IQHA 2A5KA 2C3SA 5FAHA 1NRPH 2YMSC 4ZROA 4XBDA 3PO1B 1DUAA 1CE5A 1D9IA 2OBQA 2AHME 2NU2E 4J1YA 5TCCA 4JZ1A 4IW4E 1SQOA 1EAXA 5C94A 3ZVFA 2ZA5A 3U9AH 1GHYH 1O38A 2DE8A 1TYNA 2FTLE 3SNAA 3PRDA 3DD2H 3B8JA 3RU4D 1PJPA 2A31A 2HLDD 4MPUA 2TRMA 1SOTA 2VGCC 2QYIA 3LGYA 4ESTE 1ABJH 2Z3CA 2H9EH 4K8BA 6GCHG 1QL8A 4MQAA 2Y6TA 1AU8A 1P02A 1O2NA 3SU6A 2HALA 1GI4A 4GCHG 1DOJA 1O3IA 1MMJN 2BXUH 2BZAA 3QGNB 2FM2A 1HRTH 2FI3E 1ZGIA 4WY3A 1D3PB 3S9AA 4RT1A 4ISOA 1DS2E 1GMCF 1SQRA 2J94A 2TPIZ 1V2PT 1EJNA 1FQ3A 3RXRA 4B6EA 1O39A 3ZZ6A 1W0ZU 5HXFA 3B23B 3T29A 1UK4A 1OWKA 4A92A 2SGPE 1TMBH 4NA8A 2F91A 1X7AC 3ZVAA 2W5EA 1THSH 4AFQA 3QGJA 1MD7A 3SHAH 4A1TA 1O3GA 4OGYA 1AWHB 1BZXE 3BTHE 3SORA 5FX5A 2FO9A 2M2AA 3VB3A 1GVLA 1A1RA 2GKVE 1A0JA 4ABIA 5SGAE 1IQEA 2GCHG 5DK1A 1COWD 1MABB 1C1UH 1SBWA 4I8GA 1EAUA 1MKWK 4RI0A 2PLXA 3U1IB 4CBNA 3FOAA 3OEHD 2BB4A 3UR9A 1NFXA 4IN1A 1BA8B 2AGEX 3ZYEA 5C3NA 5EU8A 4WXVA 2ZFQH 5DP8A 4INHA 1C4V2 1DSTA 1Q31A 1SPJA 2B0FA 3RMMH 1TPAE 3M5MA 1DT2A 3ATIA 3FZDA 2OC7A 1SGCA 2O8LA 1CGIE 2ZU3A 5KEDA 3E6PH 3LGVA 2Y7ZA 3RXFA 4NA7A 3N99A 1LKBA 2PGBB 1HAHH 3F9HA 1GMDF 5CHBA 3ATLA 1EPTA 1HGTH 4NSYA 1GHWH 1O2ZA 1TOMH 2VWOA 3C1KA 4GHTA 2J95A 3STJA 2AMQA 2I6QA 2ALVA 1OWHA 2A7HA 2A5AA 2OXSA 1IAUA 4NFFA 4LOYH 1GGDC 2A2QH 2XNDD 2P95A 5E0GA 3VB5A 1GCTC 3RXAA 8GCHF 4FUEA 4AZ2B 3P70B 4X1NU 3GCHB 9LPRA 1BTUA 1FY5A 4BXWA 4CHAB 1EXFA 1S83A 3EA8A 1XX9A 2AH4X 1A4WH 1SVPA 2ZFSA 3M3VA 2GZ7A 3Q76A 1BTZA 3PWBA 2J2UA 4DW2U 1CQQA 2SFAA 2TGDA 1QGFA 4B74A 2GV6A 1C2IA 4KTSA 1DWCH 1YGCH 1ESBA 3MU5A 3BTQE 1MTUA 2ZF0H 2QF4A 3SU0A 3M5NA 2ZO3H 2ZDAH 1PFXC 1GBHA 1P3CA 3QTVH 1JOUB 2BOHB 2ZPSA 4MNVA 2ZDVH 4H4FA 4TY6A 3ESTA 4AGJA 4FUHA 1NBMD 1ZHPA 1TABE 4Q7YA 2ZGCA 3PLKA 4Z1MD 2XBVA 1MBMA 1NRRH 1GJ7B 3RXGA 1LHGH 5J4SA 1AVXA 3DSPA 1SI5H 3A82A 2NU4E 1P8VC 3M5OA 4CBOA 4I8HA 1CBWC 2IPQX 2A45B 3HKJB 4RKOB 2PFEA 1TAWA 1W7XH 4AG2A 3KF2A 3N7OA 1YLDA 2BDHA 1BMAA 3RC6A 2WUBA 1DX5M 2BY5X 3U28C 2ZFFH 3P92A 1S82A 2FYQA 1P2JA 1P05A 1QJ7B 2JETB 3Q3XA 1HNEE 1AE8H 3ODFA 1K1NA 1HIAA 1SGDE 3MYWA 2R3YA 1JIMA 4INKA 3BN9A 4OGXA 1SSXA 3LIWA 3SUEA 5L2YH 2ZIQH 5F03A 1CA0B 5DN6D 1RGQA 3SNEA 1P9SA 2LP6A 2B8OH 3UIRA 4FXGH 2CHAC 2P3TB 2ASUB 1UVUH 5HMAA 1PPZA 1QL9A 3ODDA 1P01A 1HAYB 2FS8A 1HAOH 3M7UA 2ZHQH 2JJ1D 1QIXB 3S7HB 1W0KD 2J4IA 1P03A 1V2QT 1EZUC 4ISIH 1O3JA 2HVXA 1GBCA 4U2WA 1V2LT 3VXFH 3EE7A 2HNTF 1OP8A 1AB9C 1P2NA 1GBTA 2AERH 1J14A 1B7XB 3RUOA 4I7YH 2J5UA 2BX3A 2GT7A 2VNTA 2ZNKH 2J92A 1VR1H 2M5TA 3E16B 1ZHRA 2F43B 4CR9A 2HNTC 4BNRA 2ZU5A 1YPKH 4LZ1H 1O2QA 1MTNC 1ZMLA 2ZGHA 2VIPA 1C1MA 2I6SA 2ZPQA 4E7RG 3BV9B 1SGEE 1G3EA 1GI7B 1ANEA 2A4OA 1G37A 1Z8JB 2QF3A 2J98B 4IC5A 4RSPA 1XMNB 1AVWA 1OOKB 5DKMA 4O3TA 1ELAA 2FLRH 4SGBE 1VZQH 2BZ6H 5JB9S 2Q1JA 1KXAA 3A89A 1QB9A 2BVSH 1DY9A 1QY6A 2WPJS 4ZKOU 1GHBG 3RXTA 1AN1E 1LPKB 1YF4A 3PRBA 4ZXYH 3T27A 3GCTF 1TALA 5ETXA 5CMXH 1WTHD 1TX7A 1D3QB 3LU9B 4X8SH 3SJIA 3SQHE 3PTNA 5F53A 4HI3A 2WZQA 3ZVCA 2ILNA 4DY7B 3D49H 3RXIA 2TGTA 2XWBI 4NA9H 2QXJA 1GDUA 4K8YA 1TRNA 2ZFRH 1GL1A 3KQCA 4I32A 1EB1H 3UWJH 5JBAS 1O37A 2C4FH 4XBCA 2XW9A 7ESTE 3GDUA 3EYDA 4X8TH 5JPMH 2H9TH 4BAHB 1UCYK 1C2LA 2PSXA 3I78A 4YOJA 1O2UA 1SFQB 1SB1H 2ZU4A 4KTUA 2XC4A 4XOJA 3UNSA 2VVCA 3AAUA 3E1XB 1CU1A 2PTCE 1P10A 1CHOF 3GCHC 1IHTH 4GVUA 2FOHA 5FHTA 5I46H 3SUFA 1F5RA 1ARBA 3AVZA 1H8HD 4CHAC 1HXEH 2ZTXA 3BTTE 3F0OA 1S85A 1UK2A 4AC9A 3GCNA 2ZKSA 3A7ZA 2PWXA 1JBUH 4X0WU 3TPIZ 3R0FA 2VWLA 2BQ7B 4ISLA 5ESBA 5ESTE 3MNSA 3KGPA 3BG4B 1XUHA 2YMSB 4FUBA 4ZKSU 1P04A 4BAQB 2ZECA 4NSVA 1YPGH 2FI4E 5L30H 5L2ZH 1A5HA 4X1QU 4IGDA 3TGJE 1ZMNA 3LJOA 1YC0A 1Y5AT 3EA9A 4F4OC 4DIIH 1O2KA 2QF5A 1O5EH 4FVBA 1G2LA 4YLQH 4E7NA 1XXDA 3A86A 1ELCA 3RLWH 2A7CA 4KKDA 5DP3A 1ZTJA 1NFUA 3F9GA 1OX1A 2F3CE 1V2MT 2W3KA 3GY6A 2KAIA 1W0YH 1SLVB 1K1JA 4NG9H 4UFFH 3E0PB 2GT8A 4Y7AA 2QV1A 3ENSB 3SYJA 3ZZAA 5GJ4B 1C5XB 2W3IA 4A1XA 1SLWB 1O3FA 1NFYA 5EQRA 2JETC 1LQDB 1EASA 2H5CA 4CRFA 3GY3A 1O5AB 3BF6H 2BDYA 1GI5A 1RRKA 1UCYE 4X2WA 4RKJB 1ETSH 3ZVBA 3FN8A 3RXPA 3BTKE 2WPMS 1O5FH 1HJ8A 1YBWA 1TA2A 1O5GH 1XVMA 1CA0C 1J8AA 1GG6C 1MKWH 1PPGE 1WSSH 3DFLA 1T31A 5EQSA 2F9PA 1CGHA 1ZGVA 4KP0A 6LPRA 1HAVA 3EAJA 1O3HA 1O30A 1GI3A 3QLPH 4DOQA 5DPAA 3P8FA 1GMHF 3SV7A 4IBLH 5T6GA 4BTTB 1S81A 2OTVA 5C1UA 4B76A 2W7UA 3MMGA 2PUXB 1UTLM 4AB9A 3LGTA 1K1MA 1PQ8A 3A7YA 2ULLA 3UB0A 2C8XB 2WYJA 3P8NA 3UWIA 1A61H 5E2OA 1B0FA 2ZFTA 4ACAA 2KM0A 1SHHB 1EKBB 2BDCA 1P9UA 3WWFA 1V2ST 3EQ0H 1O5DH 5FCRA 4FUFA 1BT7A 1QJ6B 1YKTA 3I29A 3ZZ7A 3SBKA 1N1LA 2TGPZ 1BMFD 2R9PA 2FYRA 1GMCG 2PTNA 1TMUH 1J15A 7LPRA 1MAXA 2G00A 3S9CA 2SGDE 2GP9B 1NTPA 1PPBH 1GGDB 2GX4A 2VH6A 2GVFA 4YLUA 3Q3YA 1ESAA 3SZEA 1THPB 3ZYDA 2J98A 2H9HA 2BOKA 1KLTA 4X2XA 1CSOE 4ASUD 2Z9JA 4OS4A 1AWFH 2O9QA 7GCHG 4AN7A 1O2GH 2PKSC 1N8OC 1TPPA 4VGCC 3O8CA 1C5OH 1W0JD 2ZDLA 5JBBS 3RU4E 5C67A 1QRZA 1AD8H 2V3MA 4H42U 3DT0H 1AZZA 8KME2 3VGCC 2R0KA 1GHAF 2OK5A 5A8ZA 2AIQA 1UTNA 2QE7D 1MH0A 2VIVA 3HKIB 1V2RT 3STIA 4U32A 2PHBA 4DIHH 2GD4B 2HWLB 4ZH8A 2PKAA 1XUFA 4XDEA 1E38B 4K60A 4FU8A 3F9EA 5FPTA 4IMQA 1DITH 1ELFA 1HV7A 2F4LA 2IN2A 2O8UA 4MPWA 3KQDA 1K28D 3MNXA 1CBWB 3GY2A 3A83A 4AFSA 3ZZDA 2Z6BD 1F92A 3QX5H 1VITF 3HGNA 3SNCA 4I86A 3RXDA 5BRRE 2R0LA 1TNKA 4Y8YA 2ZI2H 3ZVDA 1TNIA 1T8LA 1NC6A 3MWIU 3UR6A 1AIXH 5EXNA 2ZCLP 3BG4C 3F2FA 3U98H 1ZSLA 2H2ZA 2EA3A 3UFAA 3V0XA 5EJZA 3OX7U 3RLYH 1DDJA 1EAWA 3SV9A 3OY5U 5EXLA 3F6UH 1ELEE 2BYAX 1TLDA 2NU1E 4GLYA 4B75A 2J9NA 3TJUA 1QQUA 1Z8IB 2FDAA 2V3HH 3TGKE 3MO9A 2Y5GA 1AUTC 3F1SB 2FOMB 3TJOA 2ZC9H 2G5VA 2CHAB 3RXHA 4CR5A 1ZPCA 3PMAB 4D8NA 5C2ZA 3RDZA 4TYDA 1HDTH 4DG4A 3TVJB 1NESE 3NUMA 2AYWA 2NU0E 2Y7XA 2SGQE 5E0HA 2CF9H 2KCYA 1AFEH 1E1RD 1CT4E 1GPZA 1FAKH 2FODA 5FBEA 1TIOA 1C2HA 1TGNA 4BTUB 4GSOA 2KCAA 1AB9B 4SGAE 1K1IA 4RN6A 4D9RA 1MD8A 1CHGA 3QK1A 4BANB 1NRQH 4FU9A 5DSFA 3FO8D 1AZ8A 1CO7E 1SGQE 1GVZA 1HPGA 3LC3A 3LKWA 2FOGA 5EGMA 1W14U 1DWBH 1L1GA 1MTNB 2QCYA 1O5BB 3SJOA 1K1LA 1C5SA 1FY1A 1Z8GA 1KMHB 5LH8A 2C8YB 2P93A 3A8DA 4B1TA 1YPHE 2AGGX 2O8WA 3MHWU 1YLNA 3MNCA 1LHEH 4FU7A 4WF8A 3SU3A 2NWNA 1A46H 3CENA 2JH6D 1Z1IA 3OE7D 2BD3A 4AFUA 5CHAB 1T32A 3QZRA 4A6LA 2UUYA 1AUJA 1MKXK 1O2HA 2F9OA 3PROA 4WMFA 1O31A 2KCOA 1O3AA 3A7XA 4Q63A 5LPEA 1NBME 3SO3A 1BCUH 3ZZ5A 2XOKD 1OWDA 1UCYH 2FLBH 5GIBA 3UQVA 1HJ9A 1D6WA 1FIWA 3PM3A 3PLBA 3M35A 3PMHB 4IMZA 4ISNA 1C1SA 3KNXA 3PWCA 1P11E 2HLCA 2OBOA 1QRWA 1C2MA 4BAMB 4NWLA 5K0HA 1CT2E 2G8TA 1LPGB 2XWAA 4KELA 1GBEA 5PTPA 1QA7A 1RJXB 1P06A 1XM1A 4UFDH 2G5NA 3A88A 2VVUA 1V2NT 3T5FH 4OS6A 2CMYA 3ZV9A 4CRBA 1E37B 3SV2H 3URCA 3O8RA 2ODYB 3M37A 1D3DB 2FX6A 2ZEBA 3SJ8A 4YM9A 1FI8A 2BD2A 3RXMA 3KQEA 4RT0A 1B5GH 2OC8A 4AB8A 1E79D 3ATKA 3ZV8A 1ANCA 2OUAA 4Q4LA 3HPTB 1UMAH 3TNSA 2J97A 1FY8E 1LVMA 4U30A 1SGIB 1F0UA 1NRSH 1MTVA 5JDUB 5K7RA 3LT3A 3UY9A 1HUTH 4NIWA 1FMGA 1ZTKA 2QF0A 3ZZ3A 2BD4A 1QTFA 1KXFA 1Y8TA 3QZQA 4D76A 4JZIA 3TH3H 6ESTA 1HAXB 1YPLH 1LQEA 1EP6A 1WDIA 3FKSD 3I77A 1N6YA 3MO3A 3Q77A 4ASHA 3MU1A 1IQFA 1FN6A 2K1QA 2JIZD 4KTCA 3ZVEA 1C5LH 1A0HB 1O2IA 2UWOA 4I33A 2IOTA 4THNH 2RCEA 4MPXA 1GCDA 4WXIA 2KFWA 3MU0A 4CRAA 6GCHF 1F0RA 3RC5A 4IS5A 3UPEA 4OM9A 2J34A 1FNIA 3SU4A 4ISHH 1UVTH 1YLCA 1UW7A 3LC5A 4GCHF 2OLGA 1O2YA 1GJ8B 2XC0A 1KTTB 3SI4H 3WY8A 1VJAU 1WYKA 2EI8A 3C27B 5HYOA 3PYHA 4GPGA 5DO4H 2GCTB 3TH4H 3OTJE 5F8TA 4GUXA 1C1RA 3CP7A 2JH5D 3UOUA 1KTSB 1MQ5A 3P8OA 3ZVGA 1NU7B 4WMEA 5T6FA 2EI6A 4JZFH 1GL0E 1DE7H 4I8LA 3TLOA 2ZDKA 5E0JA 3TH2H 3VB6A 1DSUA 1GG6B 1TGBA 1QRXA 1BTWA 1F0SA 1N6XA 2PV9B 1DANH 2WYGA 2AS9A 2KX4A 5FX6A 1KLJH 3S0NA 3MI4A 2GZ8A 2GCHF 3N7DA 4B2CA 2YMSD 3SNDA 2PR3A 4DT4A 1BTXA 3HK3B 2BMGB 3OY6U 5GPIB 2FESH 3HGPA 5FPSA 1GHVH 1GVKB 1PYTC 5B6LA 3GYLB 1G3CA 3OTPA 1DXPA 1H9LB 2GTBA 2BD9A 2F9BH 1SOZA 1BBRK 1EZXC 2WUCA 1H8IH 3D23A 3M3TA 3M3SA 5FCKA 2BLOA 1BITA 1UTPA 2BY8X 4JZDH 2GMTC 1C4U2 1XKAC 3RC4A 3KYGA 4ZKRU 5A0CA 1OYQA 1ZRKA 5CDFE 3KL6A 5IYTA 3LOXA 2YNAA 4H6SB 1ABIH 4HZHA 1O3EA 1F7ZA 2BLVA 3L6PA 3E91A 2UUKB 1O33A 2JDID 2ALPA 2CV3A 3IITA 3BEIB 3T62A 1S84A 2UWLA 2RFKC 2ZHFH 3L33A 1OYTH 4WJG2 1O2WA 4Y11E 2PSYA 3QDZB 5CHAC 1VKYA 3R3GB 1INCA 4JYTA 1SLUB 3F9FA 3KEEA 1LKAA 1HAIH 1SQAA 4B2BA 1ID5H 2PKSB 3K65B 1N8OB 4VGCB 2CK3D 2Z7FE 4Y7BA 3RXCA 1S6FA 4Q7XA 1JMOH 2A4QA 3VGCB 1DXWA 5H4IB 1T4UH 5F8XA 1ANBA 1SGTA 4WH6A 3RXSA 3GCOA 2VIOA 1SGFG 2A1DB 3MTYA 1GJAB 3VB7A 1DM4B 5FL7D 1OP0A 3FZZA 1TMTH 2WPKS 3SJ9A 5GCHG 4XBBA 3PMBB 1T8OA 1NM6A 1XUGA 4UDWH 1C1TA 4NGAH 5A2MH 3K6YA 2VVVA 4MTBA 4FUIA 1BBRE 3T28A 5HKKD 2BXTH 4P02A 2A32A 4YT7H 3U8TH 3GOVB 1GDQA 2C8WB 1LMWB 4D7GA 1AO5A 3A80A 3M36A 3A8CA 3HK6B 2YNBA 4OS7A 2ZQ1A 3H09A 5F6MA 1GI9B 4ABHA 2VBCA 1TX8A 1O3LA 5DJ7A 2BM2A 2GV7A 2Y82A 2TIOA 1ANDA 1OWJA 2FOFA 2ZU2A 1AKSB 1UVPA 1H1BA 2HRVA 4GAWA 1V2OT 4Y71A 2XBWA 1ZYOA 2EEKA 3WW7A 1O2MA 4FUGA 1L4ZA 1QFKH 1TWXB 4OS2A 2LPRA 2Q6DA 1TBQH 1DUEA 5FPYA 3GY4A 2R2WU 3SN8A 1IQJA 1J17T 1O3MA 2Y5FA 1XVOA 2PP6A 1FUJA 4ZKNU 2OC0A 1TQ0B 3DCLA 1GHAG 4ACBA 1J16A 1Y3UA 4XD7D 1FX0B 4K1SA 1KY9A 1VCWA 3O8BA 3OSYA 3VG8A 4ABAA 1VITH 4DJZB 2ANYA 3SV6A 4F55A 3V12A 4UEHH 1GDNA 2OQ5A 2BDBA 3MQKC 1O2SA 3EA7A 2JJ2D 2PUQH 3PLPA 2ZDNA 2P8OB 1ELTA 4F49A 4YESB 5EPYA 1QBVH 4KGAA 1FPHH 4JCNA 1HJAC 1OKXA 1C2GA 2GCTC 1C5RA 2ZG0H 2EY4C 4AYYB 2THFB 3LPRA 1DY8A 1UVSH 5EJLA 1LO6A 1SHYA 1GJ6A 2ZHEH 1A2CH 2Y80A 1AVGH 5C20A 2SGAA 1EQ9A 1GHXH 4ZAEA 2AIPA 4Q7ZA 3SW2B 3BSQA 1HAZB 1GBDA 1G3DA 1ZTLA 5IK2D 1V2TT 1OWIA 2BVRH 1MKXH 2LELA 4XRNA 2PGQB 2F83A 2G4UA 2XCFA 3UTUH 1W13U 3H7TA 2V6NA 2HVYB 1E34B 1XXFA 4AOQA 1VJ9U 5C5NA 4YO9A 3NPSA 1RFNA 1BJVA 2HGTH 1SGRE 5T3HA 4BAKB 1WQVH 3RXEA 1CVWH 3T2NA 4F48B 1Y3WA 1ZMJA 1C5NH 1TGSZ 1GHBF 2F9NA 3RXLA 3F2HA 1C2EA 4X2YA 1BRAA 1QR3E 5E8EH 1NY22 1OSSA 3A7VA 5LGOA 1QCPA 3NZIA 1RS0A 2H1UA 1EX3A 3FAOA 1T8MA 1NT1A 1FONA 2JH0D 2VJ1A 3SU1A 2FI5E 3H7OA 4Y8XA 2R2MB 1V2UT 2XYAA 2O8MA 1NO9H 5HGGA 2FOBA 1O0DH 3JZ2B 1ETTH 1XUIA 1HB0B 2G52A 2BY7X 2V0BA 1YYY1 4DURA 2ZTYA 1FV9A 1KXEA 2ZCHP 1IQMA 1QA0A 2NU3E 2W6ID 1C9PA 1KDQB 5AFZH 2ANWA 1SFIA 1O36A 1MZDA 1WAYB 2Z94A 3BEFB 1HCGA 3GISB 4K5ZA 2QXGA 1SGFA 1C1WH 3RM0H 3VPKA 3A8AA 2H6MA 5HM9A 3AK5A 2UWPA 3WWBA 2K0QA 1A3EH 1BQYA 4X6PA 2ODPA 1OXGA 3BTFE 1FZZA 2Q6FA 2HOBA 5T6DA 1YP9A 1G32B 2TGAA 4Y10E 4ABGA 2SNVA 4K3JA 1KXCA 2VINA 1BHXF 3P17H 1O32A 1FY4A 1O3PB 1BOQA 3OAAD 1RTKA 1LVOA 2UUFB 4AFZA 2ZHWH 1DVAH 1TRYA 1YPHC 1E1QD 4NIXA 1ZPBA 3OU0A 3A84A 3NCLA 1E36B 1P0SH 1Y3XA 3QUMP 2F9UA 4YXWD 1AQ7A 5DP6A 3UAIC 1HAGE 1C5PA 1NN6A 4M9FA 4ABEA 1IOEA 1LPZB 4BAOB 1O2OA 4DCDA 1BJUA 4ABDA 2BDAA 5BPEA 1SGNE 4FETA 5JB8S 3M7TA 1W8BH 1DWEH 1QHRB 1EFRD 3K6ZA 5C0TA 1D6RA 3A8BA 3TNTA 3F3BA 2ZWLH 1OHHD 1SR5C 4UFEH 1JRSA 1C5YB 2AEIH 1G9IE 1UK3A 4HGCA 3KHVA 1AFQC 5DP5A 2JKHA 2R3UA 2ZPRA 1LCYA 4IC6A 2A4GA 1G2MA 4JYUH 1QBOA 3DUXH 5EQQA 3RXBA 1FY3A 1WCZA 2A2XH 1SG8B 3MH4A 3AAVA 2B7DH 3H5CB 1MCVA 1C2KA 3E0NB 5EIYA 7KMEH 1KYNA 3FVFB 2QXHA 3LONA 4NCYA 3V13A 1GMDG 1F5KU 4ZHMU 2D2DA 3PV5A 2XC5A 1DPOA 1O3CA 1JIRA 1CT0E 1W7GH 2HPPH 2W26A 2RA0A 4DVAU 3VEQB 4H6TA 1HYLA 2BHGA 1C1VH 3LJJA 1K0HA 1LDTT 4ABJA 2C90B 2J38A 1A5GH 3LGIA 1C5QA 2EQNA 1TFXA 4FUJA 4J2YB 1Y5UT 4X6MA 8GCHG 1V2WT 1C4Y2 1PPCE 2FXRA 1VGCC 3L3TA 1CGJE 2RA3A 3RXUA 1TONA 3CNRA 3FANA 3SJKA 3W94A 1Q2WA 5C17A 1HIAB 3DHKH 1YCPK 3VFEA 1AE5A 2GZ9A 2GDEH 3QN7A 1VCQA 2GJGA 2Z3DA 1SKYE 4MVNA 5JYIA 1KXBA 1AKSA 1EAIA 2WPHS 3KCGH 4BTIB 1AI8H 3PTBA 1S6LA 5EG4A 1TB6H 4LZ4B 1GJ4H 2AMPA 5A8XA 1BBRH 3EDXB 2BLWA 3FP8E 3SOSA 1H9HE 4XFQA 1WTGH 1ELBA 1AGJA 2P3UB 5KGOA 1YPJH 1LHDH 4E05H 1GJ5H 1QL7A 3OEED 4TY7A 2P8OC 3SQEE 1BRCE 2QGRA 5CE1A 1NZQH 2XBXA 4B73A 1IQIA 1F5LA 1E35B 1YM0A 2OD3B 1V2KT 2RDLA 2ZDMA 1GBLA 2ZHDA 3MH6A 3Q3KA 3MU4A 5DP4A 4LXBH 2GGVB 2K8IA 5B6OA 2GDDA 2XBYA 2W7SA 1FPCH 3ZZ8A 3UQOA 1GI2A 1DWDH 2GMTB 1LVYA 1K21H 2KR7A 1KLIH 3BTME 3Q00A 1UHBB 2IJD1 1ZRBA 1K1OA 2RG3A 1TX6A 3BEUA 2ODQA 3E90B 4CRCA 3ITIA 1EZQA 1TNGA 2FZZA 5TJXA 1C1NA 5GNDA 3MOCA 3MU8A 1MTWA 1W10U 2A0QB 3EGKH 1C5UA 2ESTE 2VU8E 1ZR0A 1C2DA 7GCHF 3QO6A 4NIYA 3TK9A 4CRGA 2WV5A 1GI8B 1GJBB 1C5ZB 3T25A
chains in the Genus database with same CATH topology
1UTJA 3K2UA 4NIVA 3LGWA 1IQNA 1NRNH 1O2VA 2DE9A 3A87A 5EODA 3DFJA 2FPZA 3ZZBA 1V6DA 1VCPA 1W3CA 3U1JB 3PV4A 3V3MA 1Z6JH 1O35A 2QY0B 4K1EA 1BRUP 2FTMA 3UNQA 1ELGA 3SHCH 1P12E 3LH3A 2FOAA 1EPTC 1KDQA 4JYVH 2P16A 1QNJA 1GJDB 1P2IA 2XNIA 3QTOH 1C5VA 1UTMA 2FOCA 1QB1A 3D65E 3BG8A 1YCPM 1M9UA 2ZZUH 4D7FA 3BTEE 2ZP0H 2QN5T 3ZZ4A 1MAYA 4O03A 1OP2A 1FLEE 1IQGA 1P2QA 2BD8A 2BDGA 1B0EA 3ZZ9A 1A7SA 1NFWA 1FDPA 1GI6A 1OWEA 1EB2A 2BD7A 2Z9KA 1K9OE 1WV7H 5DGJA 1RTLA 5DP7A 2SGFE 3S69A 3U69H 5AVDA 3RMOH 2OQUA 3NWUA 3S9BA 1OS8A 4AX9H 2G4TA 4JMYA 2QIQA 1KIGH 1TGCA 3SUDA 1O2PA 4CH8B 4Y79A 3GCTG 3NKKA 1MUEB 2VB0A 4BOHA 1D3TB 4UFGH 1AMHA 3BTDE 1IQLA 4TWYA 3PB1E 4K1TA 1Z6EA 2BX4A 1Y5BT 1WU1A 4YOIA 4I8JA 1FAXA 5A8YA 2P94A 4NZQA 4O9VA 4XE4A 4BXSA 2XTTB 5A0AE 1WQSA 1MBQA 2C8ZB 4D9QA 3T26A 1P09A 4YT6H 6CHAB 1FN8A 1Y3VA 1RIWC 2KAIB 3HATH 1C9TA 1PPEE 1HJAB 1SQTA 1O2RA 3BIVH 1GBMA 4WH8A 3MNBA 4X1SU 3KN2A 1CA8B 1BRBE 1RXPA 4I8KA 3TGIE 1CHOG 1TNJA 3O8DA 1BDAA 1KSNA 3SZNA 1C1PA 1S0QA 4HTCH 5ABWA 1ZOMA 3U8RH 1BMLA 1L2EA 3GDVA 3M5LA 1EP5A 2BD5A 1PQ5A 4O3UA 4Q2KA 1YPEH 1IQKA 4ZUHA 2ZU1A 3JZ1B 2P59A 3PO1C 3GY5A 1TA6A 1MU8B 1C5MD 5EOKA 1TRMA 1C5WB 1HBTH 1L1JA 1SL3A 1K2I1 2VWMA 3SNBA 1HAVB 1O2XA 1XKBC 4XSKU 1A0LA 3UUZA 2F9VA 1NPMA 1UTQA 3P6ZB 1PQAA 2YOLA 1O3NA 1L4DA 1EOJA 2Q6GA 3BIUH 3TK6A 1AHTH 1SLXB 1C1QA 1UVOA 2BVXH 1FXYA 1H9IE 1T4VH 4X6OA 4Z6AH 1H4WA 1ZSJA 2ZGXH 1W2KH 1QURH 1EJAA 4X2VA 1L1NA 1JWTA 1BB0B 5AHGH 1O2TA 1ZZZA 1JXPA 8ESTE 3RU4T 4TPYA 1BMMH 2FWWA 3RMNH 4JZEH 4UE7H 4Z0KA 1S0RA 2SGEE 4OS5A 3KIDU 1ZSKA 5EXMA 3SU2A 4M7GA 5DG6A 1UHBA 5A09A 1GBAA 3GDSA 3QWCH 1F0TA 1H8DH 3MH7A 1V2VT 4NFEA 1Z1JA 1F2SE 1FJSA 3RP2A 1GBJA 1ACBE 1UTOA 5JBTA 2QA9E 3SI3H 5L6NH 5LPFA 4O97A 4AYVB 2LNCA 1PQ7A 1EZSC 1SMFE 1C2FA 1ORFA 3E8LA 3IWMA 3KQBA 5C1XA 5HM2A 3ATWA 1GMHG 1BHXB 1O34A 1Y3YA 1SGPE 5C1YA 3NK8A 2G51A 3SUGA 3SGAE 5GWZA 1K1PA 3DA9B 3B9FH 2DUCA 2BY6X 3AW1A 1C2JA 3IG6B 5AFYH 2A7JA 2CGAA 4ZHLU 1Z8RA 2SNWA 1AFQB 2Z9GA 3NXPA 2BQ6B 4I31A 4OS1A 1W12U 4ABFA 1ELDE 4K2YA 2Z3EA 4QT8C 1QBNA 4DT7B 1TE0A 2AGIX 5IDKA 2ZFPH 3SGQE 2PKAB 1XUKA 4X8VH 3AASA 1RTFB 1AY6H 1K22H 1WOFA 1ARCA 3TJVA 1P2KA 4K69A 4YOGA 1EJMA 2FMJA 5FBIA 2D1JA 5GXPA 1ZJKA 1P57B 2CN0H 4R0IA 4R8TB 1YCPH 1QQ4A 2O8TA 3URDA 1TBZH 1EUFA 2G81E 1QB6A 3S7KB 4ZMAH 1S5SA 4HFPB 4UD9H 3FP7E 1GI0A 2VH0A 5A0BA 1MQ6A 1P3EA 1BIOA 1VGCB 4Y6DA 1THRH 2QXIA 1V3XA 1WUNH 3U8OH 4AGKA 1DLKB 2FOEA 1A3BH 3LGUA 1O2JA 2FP7B 4MDSA 1G36A 1GJCB 1Y59T 2HPQH 1TPOA 2TBSA 3D62A 4CH2B 3A7WA 3BTGE 4B71A 1O5CB 5JBCS 1NS3A 2ZGBH 4NZLA 5F8ZA 3GYMA 3TK5A 6CHAC 2XXLA 1GBKA 4B2AA 2P3FH 4Y0YE 5FXLA 2STAE 2D26C 3A7TA 1LHCH 2VWNA 1TNHA 2QAAA 2BY9X 2VGCB 1P2MA 4INLA 3FFGA 1GI1A 2ZGJA 5E2PA 1Z7KA 1TNLA 1XUJA 3MO6A 1ZPZA 1MZAA 4FUCA 1VITG 2HNTE 4DGJA 4ZHAA 4E06H 2BTCE 3TIUA 3UNRA 4TWWA 2BDIA 2STBE 2A4RA 1S6HA 1SC8U 1SGYE 2EC9H 1EATA 3TITA 1T8NA 1TPSA 4Y8ZA 2Z9IA 2PW8H 2B5TB 4IN2A 1PPFE 2ANKH 4MPVA 4Y76A 3PMJA 1BMNH 1EOLA 1YPMH 4MG3A 3F68H 2WPIS 4JK5A 4A7IB 1UJ1A 2BQWB 1HXFH 4LK4A 1O2LA 3E3TA 4AORA 3GICB 3CS7A 3RXQA 5I25A 1JRTA 2FEQH 1MTSA 1C1OA 1FIZA 1GBFA 1QJ1B 2VIWA 3RXKA 1WBGB 3A81A 4PROA 1HFDA 2D8WA 1ZJDA 4WMDA 4A1VA 1Z71A 1LHFH 5DP9A 1TGTA 1RD3B 5GCHF 2V35A 4WWYA 3UOPA 1GHZA 1ZLRA 4MNXA 1PYTD 4AG1A 1PPHE 4FVDA 1O3BA 2V3OH 5TCAA 2ZQ2A 1GWAA 2OINA 4NWKA 1KXDA 4A5TS 1EPTB 3BTWE 3K9XB 1V2JT 3MFJA 4ZXXH 1U6QA 1GBBA 1G30B 2UUJB 3ELAH 3TJNA 4FUDA 1BUIA 1IHSH 3P8GA 3P95A 1NU9A 2H5DA 2C93B 2OC1A 1O3OA 1TBRH 2OCVB 3CS0A 1UO6A 3FP6E 2IJOB 1LVBA 1E0FD 1TOCB 1ESTA 2CXVA 1W11U 1UTKA 3M61U 5J4QA 2FX4A 1O3KA 5C5OA 2WINI 3MH5A 4CRDA 1D4PB 1ETRH 1L0ZA 4U01A 1HAPH 2VIDA 1GCTB 1A5IA 3M7QA 3SGBE 3EE0B 3GY7A 4Q80A 4CREA 5LPRA 2XCNA 1DLEA 1BTPA 3LH1A 2AMDA 4X6NA 3VB4A 2FS9A 3TU7H 3RMLH 1P2OA 2ANMH 2Y81A 3V7TA 1DFPA 1MCTA 2FIRH 1OPHB 4GHQA 4MNWA 4X8UH 2EI7A 4YZUA 3GY8A 2CJIA 1J9CH 4JK6A 1C5TA 3G01A 5AF9H 1BTYA 3VXEH 3SU5A 5EPNA 5G4BA 1TQ7B 3RM2H 1BTHH 3RXVA 3A85A 2Z9LA 1ZHMA 1NROH 2B9LA 4UONA 4ABBA 2WV4A 2ZCKP 1G3BA 4MLFB 5GDSH 3ATMA 3SV8A 2Y5HA 1MU6B 1RIWB 2WPLS 2VIQA 4YTAA 2OP9A 2AFQB 9ESTA 1ELVA 2ZTZA 4Y0ZE 1GJ9B 2BLQA 3LDXH 2CF8H 2A5IA 1Q3XA 3RXJA 3OYPA 4X1PU 2XRCA 2G55A 5EW1H 1T7CA 1DICA 3W95A 3AW0A 4TPIZ 3UREA 3ZZCA 4WVPE 4MNYA 1GBIA 2IPHA 3RXOA 1LTOA 1O3DA 1HLTH 8LPRA 4X1RU 5EW2H 2QC2A 1IQHA 2A5KA 2C3SA 5FAHA 1NRPH 4ZROA 4XBDA 3PO1B 1DUAA 1CE5A 1D9IA 2OBQA 2NU2E 4J1YA 5TCCA 4JZ1A 4IW4E 1SQOA 1EAXA 3ZVFA 2ZA5A 3U9AH 1GHYH 1O38A 2DE8A 1TYNA 2FTLE 3SNAA 3DD2H 3B8JA 3RU4D 1PJPA 2A31A 4MPUA 2TRMA 1SOTA 2VGCC 2QYIA 3LGYA 4ESTE 1ABJH 2Z3CA 2H9EH 4K8BA 6GCHG 1QL8A 4MQAA 2Y6TA 1AU8A 1P02A 1O2NA 3SU6A 2HALA 1GI4A 4GCHG 1DOJA 1O3IA 1MMJN 2BXUH 2BZAA 3QGNB 2FM2A 1HRTH 2FI3E 1ZGIA 4WY3A 1D3PB 3S9AA 4ISOA 1DS2E 1GMCF 2J94A 2TPIZ 1V2PT 1EJNA 1FQ3A 3RXRA 1O39A 3ZZ6A 1W0ZU 5HXFA 3B23B 3T29A 1UK4A 1OWKA 4A92A 2SGPE 1TMBH 4NA8A 2F91A 1X7AC 3ZVAA 2W5EA 1THSH 4AFQA 3QGJA 1MD7A 3SHAH 4A1TA 1O3GA 4OGYA 1AWHB 1BZXE 3BTHE 3SORA 5FX5A 2FO9A 3VB3A 1GVLA 1A1RA 2GKVE 1A0JA 4ABIA 5SGAE 1IQEA 2GCHG 5DK1A 1C1UH 1SBWA 4I8GA 1EAUA 1MKWK 2PLXA 3U1IB 4CBNA 2BB4A 3UR9A 1NFXA 4IN1A 1BA8B 2AGEX 3ZYEA 5C3NA 5EU8A 4WXVA 2ZFQH 5DP8A 4INHA 1C4V2 1DSTA 1Q31A 1SPJA 2B0FA 3RMMH 1TPAE 3M5MA 1DT2A 3ATIA 3FZDA 2OC7A 1SGCA 2O8LA 1CGIE 2ZU3A 3E6PH 3LGVA 2Y7ZA 3RXFA 4NA7A 1LKBA 2PGBB 1HAHH 3F9HA 1GMDF 3ATLA 1EPTA 1HGTH 4NSYA 1GHWH 1O2ZA 1TOMH 2VWOA 3C1KA 4GHTA 2J95A 3STJA 2AMQA 2I6QA 2ALVA 1OWHA 2A7HA 2A5AA 2OXSA 1IAUA 4NFFA 4LOYH 1GGDC 2A2QH 2P95A 5E0GA 3VB5A 1GCTC 3RXAA 8GCHF 4FUEA 4AZ2B 3P70B 4X1NU 3GCHB 9LPRA 1BTUA 1FY5A 4BXWA 4CHAB 1EXFA 1S83A 3EA8A 1XX9A 2AH4X 1A4WH 1SVPA 2ZFSA 3M3VA 2GZ7A 3Q76A 1BTZA 3PWBA 2J2UA 4DW2U 1CQQA 2SFAA 2TGDA 1QGFA 4B74A 2GV6A 1C2IA 4KTSA 1DWCH 1YGCH 1ESBA 3MU5A 3BTQE 1MTUA 2ZF0H 3SU0A 3M5NA 2ZO3H 2ZDAH 1PFXC 1GBHA 1P3CA 3QTVH 1JOUB 2BOHB 2ZPSA 4MNVA 2ZDVH 4H4FA 4TY6A 3ESTA 4AGJA 4FUHA 1ZHPA 1TABE 4Q7YA 2ZGCA 3PLKA 2XBVA 1MBMA 1NRRH 1GJ7B 3RXGA 1LHGH 5J4SA 1AVXA 1SI5H 3A82A 2NU4E 1P8VC 3M5OA 4CBOA 4I8HA 1CBWC 2A45B 3HKJB 4RKOB 2PFEA 1TAWA 1W7XH 4AG2A 3KF2A 3N7OA 1YLDA 2BDHA 1BMAA 3RC6A 2WUBA 1DX5M 2BY5X 2ZFFH 3P92A 1S82A 2FYQA 1P2JA 1P05A 1QJ7B 2JETB 3Q3XA 1HNEE 1AE8H 3ODFA 1K1NA 1HIAA 1SGDE 3MYWA 2R3YA 1JIMA 4INKA 3BN9A 4OGXA 1SSXA 3LIWA 3SUEA 5L2YH 2ZIQH 5F03A 1CA0B 1RGQA 3SNEA 1P9SA 2B8OH 3UIRA 4FXGH 2CHAC 2P3TB 2ASUB 1UVUH 5HMAA 1PPZA 1QL9A 3ODDA 1P01A 1HAYB 2FS8A 1HAOH 3M7UA 2ZHQH 1QIXB 3S7HB 2J4IA 1P03A 1V2QT 1EZUC 4ISIH 1O3JA 2HVXA 1GBCA 4U2WA 1V2LT 3VXFH 2HNTF 1OP8A 1AB9C 1P2NA 1GBTA 2AERH 1J14A 1B7XB 3RUOA 4I7YH 2BX3A 2GT7A 2VNTA 2ZNKH 2J92A 1VR1H 2M5TA 3E16B 1ZHRA 4CR9A 2HNTC 4BNRA 2ZU5A 1YPKH 4LZ1H 1O2QA 1MTNC 1ZMLA 2ZGHA 2VIPA 1C1MA 2I6SA 2ZPQA 4E7RG 3BV9B 1SGEE 1G3EA 1GI7B 1ANEA 2A4OA 1G37A 1Z8JB 2QF3A 4IC5A 4RSPA 1XMNB 1AVWA 1OOKB 5DKMA 4O3TA 1ELAA 2FLRH 4SGBE 1VZQH 2BZ6H 5JB9S 2Q1JA 1KXAA 3A89A 1QB9A 2BVSH 1DY9A 1QY6A 2WPJS 4ZKOU 1GHBG 3RXTA 1AN1E 1LPKB 1YF4A 4ZXYH 3T27A 3GCTF 1TALA 5ETXA 5CMXH 1WTHD 1TX7A 1D3QB 3LU9B 4X8SH 3SJIA 3SQHE 3PTNA 4HI3A 3ZVCA 2ILNA 4DY7B 3D49H 3RXIA 2TGTA 2XWBI 4NA9H 2QXJA 1GDUA 4K8YA 1TRNA 2ZFRH 1GL1A 3KQCA 4I32A 1EB1H 3UWJH 5JBAS 1O37A 2C4FH 4XBCA 2XW9A 7ESTE 3GDUA 3EYDA 4X8TH 5JPMH 2H9TH 4BAHB 1UCYK 1C2LA 2PSXA 3I78A 4YOJA 1O2UA 1SFQB 1SB1H 2ZU4A 4KTUA 2XC4A 4XOJA 3UNSA 2VVCA 3AAUA 3E1XB 1CU1A 2PTCE 1P10A 1CHOF 3GCHC 1IHTH 4GVUA 2FOHA 5FHTA 5I46H 3SUFA 1F5RA 1ARBA 3AVZA 4CHAC 1HXEH 2ZTXA 3BTTE 1S85A 1UK2A 3GCNA 2ZKSA 3A7ZA 2PWXA 1JBUH 4X0WU 3TPIZ 3R0FA 2VWLA 2BQ7B 4ISLA 5ESBA 5ESTE 3MNSA 3KGPA 3BG4B 1XUHA 4FUBA 4ZKSU 1P04A 4BAQB 2ZECA 4NSVA 1YPGH 2FI4E 5L30H 5L2ZH 1A5HA 4X1QU 4IGDA 3TGJE 1ZMNA 3LJOA 1YC0A 1Y5AT 3EA9A 4F4OC 4DIIH 1O2KA 1O5EH 4FVBA 1G2LA 4YLQH 4E7NA 1XXDA 3A86A 1ELCA 3RLWH 2A7CA 4KKDA 5DP3A 1ZTJA 1NFUA 3F9GA 1OX1A 2F3CE 1V2MT 2W3KA 3GY6A 2KAIA 1W0YH 1SLVB 1K1JA 4NG9H 4UFFH <