1GBLA

Alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gblA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gblA01
4FU7A 1K1MA 3MNCA 2VWLA 4HZHA 5K0HA 1EP5A 1SMFE 2STBE 2ZDMA 2ZF0H 3O8DA 3NPSA 1O2VA 1HXFH 3QN7A 2VGCC 1TMBH 1S83A 1YLCA 1CA0C 1F92A 1O3DA 2A31A 2ULLA 2VIPA 1LMWB 2I6SA 1INCA 2EI6A 1ZYOA 1DY8A 4ZROA 5E0HA 2ZP0H 5EG4A 2ANWA 3VB7A 4X1SU 2THFB 3SGQE 5JBTA 2O9QA 3A7TA 4CHAC 2H6MA 1E36B 5J4QA 3RXDA 3LGYA 4MNYA 4DGJA 1P2NA 1GVKB 2F91A 3GDUA 2BVRH 3QTOH 3QO6A 3ZYDA 3UOPA 3A84A 2ZHDA 1RGQA 3NK8A 4LZ4B 3BTQE 1C2JA 3T62A 2UWLA 3URDA 2C8YB 1BDAA 4X1NU 1PQ5A 1IAUA 4BAKB 1LHFH 1V2RT 2HWLB 1D3DB 3A7ZA 1ELVA 1GJ4H 4Q7XA 3TVJB 3UQOA 2BLWA 1FLEE 1FXYA 1TBZH 4FVBA 4NCYA 1EUFA 3RXCA 1EAXA 5T6FA 1RXPA 1RJXB 1A0JA 1NC6A 2ZU2A 1IQJA 2IN2A 2BOHB 1TGTA 2ZFQH 3SORA 2OXSA 2BD4A 1NY22 2A32A 1HPGA 3SNEA 4B76A 1QQUA 2XC5A 1EZXC 1NROH 1P09A 1W12U 3L6PA 4E06H 3E0PB 1N6XA 1VZQH 2TGPZ 3K6ZA 5DK1A 1VCWA 3BTDE 1DANH 2A7CA 5DP3A 1ZGIA 5FPTA 2UUJB 4X1QU 1BMNH 5EPYA 3BTWE 1TALA 2ZFRH 1C1WH 1SGNE 1HIAA 5DP7A 1KTSB 1PQAA 1W3CA 4X2WA 3SV7A 2ZA5A 1O2JA 2JETB 2FOGA 1C5ZB 1AFEH 1CT0E 3K9XB 1LKBA 3A7WA 3LKWA 5LPEA 4ZUHA 1OX1A 2C90B 3FP8E 1EQ9A 2V3OH 3Q3YA 4UFDH 1O3HA 1EJAA 1SGTA 1OWDA 2VH0A 2BXUH 5F03A 1MQ5A 2G5NA 4TYDA 4HTCH 1UTQA 4YT6H 2NU4E 4ZHLU 4WF8A 2GZ8A 1JXPA 4AFZA 1HAIH 1WYKA 2O8MA 4BTIB 3A80A 5A2MH 3GY7A 1YBWA 2OC0A 3MU5A 3ODDA 4FUIA 1SPJA 1GBLA 3BTFE 3RXSA 1C1MA 3ZVBA 4UEHH 1AFQB 3SNCA 1O2WA 2ILNA 3RU4T 1IHTH 1T4UH 3A8AA 4X6PA 4ZAEA 1GI2A 2G51A 2BYAX 2QYIA 1LVBA 3OU0A 3SV8A 1FN8A 1SGQE 1Z8RA 5GIBA 4OS5A 4Y76A 3T5FH 2EEKA 4CRDA 1TONA 4D7FA 5C3NA 3MO6A 1TRYA 3SUDA 3U1IB 5GWZA 2GT8A 1BMMH 1FY5A 1S84A 1FONA 1EATA 1F0RA 2EA3A 1A61H 3Q3KA 1MTNB 3DHKH 3SUGA 1PPEE 1DSUA 1W11U 3OY5U 1L1JA 2H9EH 5FXLA 3JZ1B 1F7ZA 2FOAA 1ZTKA 1IQIA 1B0EA 1ZPBA 3SO3A 1HAVA 1GHBG 1AVWA 2BM2A 1BB0B 4LXBH 1P02A 3VFEA 1XUJA 3ITIA 3KGPA 3HATH 3MO9A 1DWDH 4BXWA 3LH3A 3E90B 3ZZBA 1UK4A 3GY3A 3ZVDA 3TGIE 2OC7A 1J9CH 4FU8A 3PLPA 1FDPA 3MU4A 4BOHA 1WBGB 3A85A 3RXRA 2WPIS 2A5KA 1G2MA 1BA8B 1GPZA 1IOEA 4Y79A 1A0LA 1ELTA 1AE8H 3RXQA 1S82A 4PROA 1O38A 4U01A 2GCHG 3EDXB 4ISIH 4GUXA 1OPHB 3V0XA 4XBCA 1O2KA 5AFYH 1GCTB 1O35A 1YPEH 3P17H 1C2MA 2ZWLH 4NSVA 1SC8U 1XMNB 4DOQA 4MVNA 3SV2H 1S0RA 3RU4D 1HJ8A 3EYDA 4X6OA 1T8NA 2G81E 1UVOA 2OC8A 3B23B 1V2VT 1O3KA 4WMFA 3KEEA 1ACBE 1UVTH 1DUAA 1PJPA 3MH7A 2GCTB 3BV9B 4ISHH 3ZV9A 1E38B 1GI8B 1KLIH 1IQKA 1FAKH 9ESTA 1GG6B 2VNTA 1Y5UT 4MPUA 1UTKA 3RXBA 3SJIA 1EPTC 2XBYA 2G8TA 4MNXA 3TK9A 3GY2A 3QUMP 4OS4A 3LGWA 3SQHE 1GBJA 2C3SA 2F9VA 1FUJA 3A86A 1KXDA 1V6DA 2CF8H 4ZXYH 2GV6A 1YCPM 1C5SA 3DA9B 3P8FA 1GHWH 1UTJA 2OC1A 3HGPA 1DY9A 4X8TH 1WU1A 5EQRA 1SQTA 2BY9X 2BVSH 1V2JT 2J92A 5AF9H 1H9HE 4XSKU 1AB9B 2STAE 1AI8H 2Z9KA 3Q76A 5I46H 4FVDA 2BMGB 4A1TA 1A46H 1O5CB 2BDYA 1TAWA 3ZYEA 1J16A 1KXCA 4XBBA 5EW1H 3VXFH 1C5MD 2RA0A 3A81A 2QXJA 4DURA 1LHGH 1C4Y2 1G30B 4FUJA 1PYTD 1O33A 1YM0A 2SGAA 4CBOA 1IQMA 2A7JA 2R3YA 5C1XA 3RLYH 3BN9A 1C4U2 1T4VH 2BY8X 4DY7B 1V2WT 3VB4A 4BTUB 4Y11E 2A4RA 1MTVA 4ABBA 4KTCA 2V6NA 1MTNC 3ZZ7A 2OTVA 3GY6A 1H8DH 1PPBH 2FI5E 5LPFA 1C1SA 3P8GA 5HGGA 2ODQA 2W26A 4YM9A 3ZVCA 5FAHA 3M5MA 1V2TT 3P92A 4JYUH 4O3UA 1BTPA 1ELFA 4INKA 4WWYA 2PFEA 3PWBA 1GDNA 1PFXC 2Z3CA 1O3EA 1QR3E 1NRNH 1RIWC 1O2IA 2TGTA 3TNTA 4AG1A 5EXMA 1DM4B 4JZ1A 4JZIA 2TGAA 1S0QA 2C4FH 2XCNA 4I8LA 2HLCA 2B5TB 2VIDA 3LGUA 4MPWA 4BAOB 1QBNA 3E91A 8LPRA 5E0GA 2FWWA 1P8VC 1UTNA 2UUYA 5DG6A 2BVXH 2G4UA 2GP9B 1NO9H 2V0BA 3JZ2B 1Z6JH 2QIQA 5EGMA 4CRGA 3RXFA 2ZCLP 1ESTA 1LVMA 1ZMJA 2ZHQH 1D3TB 2FTMA 1O3CA 3MNSA 3RMMH 3A88A 1F2SE 4IMQA 4WXIA 4AN7A 1GHXH 2R0LA 1ANDA 4ABFA 3S9CA 1GI3A 3VPKA 1O2MA 4GLYA 4B1TA 1RTFB 2ZECA 3ZZ3A 1PPGE 1NTPA 3RMLH 1KIGH 1SGRE 1GMCG 2PSYA 1PPFE 1NRPH 1HAZB 1QURH 1K1LA 1TQ7B 2FIRH 3ZZ8A 2GMTC 2FEQH 2ANKH 2J2UA 2VWNA 4CH8B 1C5TA 2P94A 2W5EA 1O2HA 1G37A 1Z71A 2VVVA 3QX5H 5T6DA 2FO9A 1O31A 4X2XA 1GCDA 1QFKH 3MH6A 2FOMB 1BJVA 1WTGH 8KME2 2Y5HA 2AS9A 1QGFA 4O3TA 4NZQA 2XC0A 4UFGH 2AIPA 1HAXB 1VJAU 3S9AA 2Z9LA 1T32A 1FPHH 3GY4A 1YKTA 3E6PH 3KQBA 1AMHA 1GBEA 1OWHA 3BTHE 4Y8XA 3TU7H 2PKAA 5G4BA 2BD8A 4K8YA 1ESBA 5JB8S 1UVPA 4ASHA 1Y8TA 2F3CE 2W7UA 3TITA 1FN6A 3SW2B 1T8LA 2XTTB 5C1YA 3ZZ9A 1K21H 2J95A 1C9TA 2GDEH 4DG4A 3TJUA 4ABJA 2FDAA 3NKKA 5AFZH 3URCA 3O8RA 2OLGA 4GPGA 4XDEA 3RXUA 2CHAC 1ELGA 1RTLA 4BAQB 1J17T 2RG3A 1GHBF 1BMLA 5EPNA 4SGAE 1GBCA 2GCTC 4MNWA 5GJ4B 1C5PA 1O2SA 2BXTH 2QF3A 1A0HB 1C1VH 1GBKA 1LHCH 3QWCH 1GBHA 4R0IA 2TRMA 1IQNA 1C1QA 1SLWB 1MBMA 3LT3A 1GJCB 4BTTB 4K5ZA 7LPRA 1BTWA 1ZPCA 3UIRA 1IQLA 4NA7A 1XUKA 4DIHH 1SI5H 2G4TA 4TY6A 5EU8A 1ETRH 1ZMLA 1GJDB 5HXFA 3EA9A 3M36A 4MQAA 1K1PA 4WH6A 1MKXH 1MKWH 2V3HH 2OBOA 1LKAA 1TBRH 2J9NA 1GMHF 2BX4A 5JPMH 1P3CA 3A7YA 4LOYH 2A4OA 1HV7A 1S6HA 3UFAA 4I31A 4MTBA 1ANBA 4D9RA 2P3TB 1QRZA 1O32A 5E2OA 2PUQH 4UE7H 1TOMH 4RKJB 3KQCA 1SOZA 3NZIA 1P9SA 1AFQC 3BEFB 3U9AH 3NCLA 1J8AA 4TPIZ 2SGEE 3IWMA 1MCVA 1DXPA 4U30A 1P05A 1LVYA 1OP8A 1BBRK 4NWKA 1WCZA 3HGNA 4O9VA 2IOTA 1ABJH 2NU3E 2WPJS 2P16A 4ZHMU 2VU8E 1L4DA 4MLFB 4JZEH 4X8SH 1RS0A 1YGCH 4Y6DA 1D6RA 2BB4A 4IMZA 3EAJA 1QJ7B 1THRH 1XKBC 4NIYA 1C1UH 1HJAB 1QB9A 1NFWA 2ANMH 1HAVB 2C8ZB 1ORFA 2ZU1A 3P70B 1YLDA 1L4ZA 4X8UH 1HAPH 3SUFA 3E16B 4AB9A 1LTOA 4I8GA 3M5OA 1O5AB 2WPLS 3H7TA 1QRXA 4D7GA 1CSOE 3E1XB 2Q6DA 2R0KA 2ZQ1A 3QZRA 2P93A 3NUMA 3SU6A 2FXRA 3MOCA 4JZFH 4KGAA 2XC4A 2O8UA 1G36A 3M37A 3MWIU 3KIDU 1NZQH 4AX9H 1Y5AT 1XVOA 2F9NA 2GT7A 3RXKA 2QXHA 1ARBA 3SJOA 2R3UA 3A8DA 5F8XA 3AAUA 2Y80A 3OYPA 4A5TS 5ETXA 5F8ZA 3VGCB 5EQSA 1OYQA 1MCTA 2BY6X 1GL0E 4CR9A 3KNXA 3GCHB 1P12E 3SNDA 4IW4E 1ZRBA 2PWXA 2Z9IA 3H7OA 3LOXA 1NM6A 2TGDA 3BF6H 1FY8E 1GHZA 2DE9A 2H1UA 2A2QH 1ESAA 1OS8A 2ZPRA 1C5WB 4ABGA 5C1UA 4A92A 1DX5M 2TBSA 6ESTA 1S6FA 4AFSA 4IC6A 1ANCA 3ZVAA 5ESBA 4U32A 1NRQH 3LIWA 5HYOA 3P8OA 2LNCA 1BTHH 1UVUH 2GCHF 3LGTA 1H4WA 2Y5GA 6LPRA 1CGJE 1C9PA 1OSSA 1QY6A 2PR3A 4FUHA 2ZCKP 1RIWB 1AD8H 3UWJH 4K3JA 4NSYA 1XUFA 5C5OA 3PM3A 1KLTA 2ZDNA 5LGOA 1TX7A 4ZKSU 1EKBB 1HJAC 4Y7AA 1ELBA 1MQ6A 2HOBA 2ZU4A 1UK3A 3C1KA 4H6SB 2VWMA 3VB3A 1SGDE 1XXFA 2CN0H 3NWUA 3KF2A 1O34A 4WXVA 1PQ8A 1C5YB 3GY8A 4AG2A 4FUCA 3UY9A 2OUAA 3MTYA 1K22H 1K1OA 2BHGA 4UFFH 4RN6A 1EZUC 1LHDH 2JETC 3I78A 2ZHFH 5AVDA 5LPRA 6CHAC 1WOFA 2C8WB 3GYLB 3ESTA 1MAYA 4DT7B 1FI8A 3RXTA 1PPHE 1GHAF 2B0FA 2YOLA 4F4OC 2CMYA 1W0ZU 5CHAC 4YTAA 1L2EA 4K1EA 5A0BA 2A45B 3HK6B 4X0WU 3MI4A 2H9HA 4AOQA 3F9FA 2AGEX 1O2ZA 1JWTA 2ZGCA 3T25A 2K1QA 2XBXA 4CBNA 1F5RA 1BHXF 3MNBA 1AO5A 2BY7X 1GG6C 1FZZA 3LU9B 3PMJA 3SU2A 3LPRA 1GDUA 2XWBI 2ZHWH 3A7XA 1OP0A 4MG3A 5E0JA 4I33A 3ATWA 3EGKH 1C1NA 1QB6A 8ESTE 1BUIA 4GCHG 1ZZZA 3S7HB 4VGCB 3CP7A 4NZLA 5SGAE 2Z94A 4F49A 3RXEA 2H2ZA 1QA0A 2A5IA 3PTBA 5IYTA 2YNAA 3D65E 3SNBA 2ZGXH 1ANEA 1A1RA 3EE0B 3PWCA 3H5CB 3ZZDA 2F9OA 2BD3A 3BTTE 4UONA 5A09A 2XW9A 3BEUA 1ETTH 4CREA 1G2LA 3ATMA 1TNLA 4WJG2 1MTSA 3ZVGA 1O3NA 1PYTC 1BT7A 3DFJA 3G01A 4HI3A 4KP0A 4YOJA 3TGKE 1YP9A 3P8NA 4YZUA 2XBWA 3ZV8A 1Q31A 3MH4A 7KMEH 1GGDB 2J34A 2HRVA 1OKXA 1QHRB 2WV5A 2HPPH 5BPEA 2A2XH 3ENSB 3F9GA 4LZ1H 4R8TB 3QZQA 1OYTH 3DUXH 2VIVA 3LJJA 1XX9A 1P2OA 3STIA 1E34B 3V12A 1C2EA 1BTUA 1FNIA 2QCYA 2ZDAH 1EOJA 1YPLH 3OX7U 2FP7B 2OBQA 3O8BA 1NU7B 1O30A 4ESTE 2QY0B 2FPZA 4CRAA 1VCQA 3AVZA 3M7QA 2ZFFH 3BSQA 3IITA 1YYY1 2P95A 4ABAA 1A2CH 2FOFA 2ZO3H 3SV9A 4E05H 2AFQB 1CVWH 5CHAB 1KXFA 5GDSH 1AKSB 3O8CA 1O2GH 1O2NA 2CGAA 2EI7A 4YOGA 1EB1H 1WQVH 1HUTH 1UCYH 2ASUB 1C1RA 2PTCE 1JOUB 3OSYA 1MZAA 1FMGA 1P0SH 3DT0H 3RXMA 1FY4A 5FPSA 3L3TA 4ABDA 3BTME 4CRCA 2F9BH 1GI0A 2O8WA 3M35A 2HNTE 2NU0E 1CGHA 3SU5A 1EB2A 2BTCE 3UNRA 1AU8A 1O5DH 1C5RA 1DS2E 1S81A 2BZAA 2B9LA 1GJ8B 1KY9A 1SR5C 3T2NA 1UCYE 1IQGA 2FZZA 1Q3XA 1O39A 1SFQB 2WYGA 4NA8A 3SJ8A 1KSNA 2PW8H 4WMDA 1FV9A 3I29A 4ABEA 3CS0A 5DPAA 3VEQB 4XE4A 3UREA 3U69H 2CHAB 2BQWB 1GGDC 2ZCHP 2ZZUH 2A5AA 2JH5D 2GKVE 1G3DA 1BIOA 2LPRA 1O5EH 1CA8B 1VR1H 3TGJE 1EZSC 1G3EA 3ATIA 1B0FA 4OS6A 1Y3WA 1PQ7A 1K1IA 2ZI2H 4I7YH 1BRUP 1UJ1A 1DITH 1GJ5H 1V2KT 4AYVB 4UFEH 1FJSA 2BDBA 2ZHEH 3F68H 1UHBB 1KXEA 1AVGH 3ZVEA 1HGTH 1A7SA 1DDJA 2A4QA 1LVOA 1QRWA 3AASA 1YPJH 1O2UA 1WSSH 1BITA 1C5NH 3E8LA 1AIXH 1C2GA 3HKJB 2OQUA 2ZC9H 4NFFA 5DKMA 5EXNA 1FIZA 5FX5A 2SGFE 1C5UA 1HXEH 1T31A 1QBVH 3RM2H 2BDHA 5GCHG 1TPPA 5EODA 2PTNA 3RMOH 2GMTB 1P2IA 2PLXA 1ZHPA 4H6TA 3OTJE 1UCYK 1SL3A 1H8IH 1C2KA 1Y3UA 4NIXA 1TMUH 1ABIH 1LPKB 2Z9GA 1T8MA 2WINI 2G00A 2JH6D 1V2UT 1GHYH 4B2AA 3W94A 5GPIB 1UHBA 5AHGH 2UWPA 3VB5A 1OWIA 1ZJDA 2ZU5A 2FESH 1K1JA 5FCRA 3LGVA 1CE5A 4MPXA 4SGBE 5ESTE 2RDLA 1OXGA 1W2KH 2QXGA 1C2IA 3KQDA 3M7UA 1O3BA 3N7OA 3MFJA 1V2ST 2D8WA 1UTOA 2R2WU 2A4GA 1AUJA 4XBDA 3BIUH 2EC9H 2HVXA 3LDXH 3T28A 5K7RA 3MU8A 3QGJA 2XCFA 5L30H 1AHTH 2BLQA 3SU3A 1XXDA 7ESTE 1LPZB 2Y5FA 1NRSH 1W8BH 2GTBA 2XRCA 1SOTA 3E3TA 1C1TA 4Y71A 1P06A 4IGDA 1YPMH 4X6NA 3IG6B 4ZKOU 3UOUA 3OY6U 3KCGH 1AZZA 3WY8A 1EASA 2FLBH 1GMDG 5IDKA 1VITG 3AW0A 3MNXA 3U1JB 1SG8B 1TIOA 1P04A 1PPCE 1KTTB 1NRRH 1HRTH 4IN2A 4CRFA 2WUCA 1GVZA 2F9UA 1F0SA 1NN6A 1GHAG 2VIOA 2GDDA 4XFQA 1TLDA 5EW2H 2FODA 3LH1A 1CBWC 4O97A 1SVPA 2VVUA 2VJ1A 3Q77A 1JMOH 1O2PA 2HGTH 1C5VA 3MHWU 1GJ6A 1K1NA 3S7KB 2BY5X 8GCHF 2Q1JA 3ZVFA 5DO4H 2BLVA 9LPRA 1A5HA 1RD3B 4NFEA 1P3EA 5BRRE 4DW2U 1N6YA 2CJIA 2FLRH 1FPCH 4NG9H 4CH2B 1O2OA 2ZGJA 1CU1A 2FMJA 2WYJA 2AGGX 4KTUA 3A8CA 4A7IB 1C2FA 1BZXE 4INLA 5DP5A 1TQ0B 1QQ4A 2A7HA 3F9EA 1QL8A 3V7TA 1DUEA 2OCVB 1MKXK 4TWYA 1GHVH 1A3BH 1GJ7B 3FANA 1EJMA 2F9PA 4OS7A 3SUEA 2D1JA 4ISLA 3AW1A 1AZ8A 5GCHF 1MU6B 1O0DH 1VGCB 1RRKA 4E7NA 1HAGE 4CRBA 1BBRE 2OQ5A 1V2MT 1BOQA 2OP9A 2SGDE 2SGPE 4K1TA 1C2HA 2ODYB 4FUDA 3RP2A 5PTPA 3BIVH 2Y7XA 3T27A 1Y59T 3K6YA 1BBRH 1E35B 1GBIA 1FIWA 2Q6GA 5C2ZA 1O2QA 1H1BA 1SGCA 3MMGA 1GI7B 5FX6A 1O37A 1AE5A 3SOSA 4OGYA 1HAHH 2BD7A 3B8JA 1P10A 4RKOB 1VITH 2FOCA 1O3LA 1OWJA 3PO1B 3RXAA 4VGCC 1AVXA 2V35A 1V3XA 1P2JA 4JYTA 1MU8B 1C5XB 1VJ9U 2W3KA 3SQEE 1CHOG 4AZ2B 4H42U 1LHEH 1ZJKA 1MBQA 1TPAE 4Y0YE 2QV1A 4DJZB 4D9QA 3RC5A 1GJ9B 1E37B 3TNSA 2GZ9A 1BRCE 2J94A 1TGCA 5H4IB 1YPHE 1TGBA 2FX4A 3QLPH 3FP7E 1L1GA 1TX8A 3GDVA 1GI4A 1BCUH 1U6QA 1GI5A 2GD4B 2O8TA 4WMEA 1SFIA 3R0FA 4Z0KA 1CHGA 3EA8A 2FX6A 1QJ6B 3RXIA 3LJOA 1HB0B 1SGFG 1EP6A 2PKAB 1DWCH 3RDZA 1Y5BT 3EA7A 1MD8A 2FTLE 2ZTYA 1GBTA 1A3EH 1XKAC 4Q80A 3RXPA 6GCHF 4GHQA 3QDZB 2BOKA 2WV4A 3GCTF 3A87A 3ZZCA 3LC5A 3UTUH 1OP2A 4JCNA 1AUTC 3ATKA 3FFGA 2ZFPH 2FI4E 1NFYA 1X7AC 1UMAH 2HPQH 1KDQB 1UVSH 1O5BB 3BEIB 1K28D 1TABE 1M9UA 2D2DA 3A82A 4GCHF 4Q7ZA 1KLJH 5A0AE 2B7DH 1F0TA 3AAVA 3ODFA 1A5IA 2BDGA 1OWKA 2VIWA 2PKSB 1RFNA 2WUBA 1ARCA 2Z3DA 2BX3A 1Z8IB 3PB1E 5HM2A 1BHXB 2BZ6H 2R2MB 3ATLA 3SHAH 4KKDA 1D4PB 2ZEBA 2FS8A 2KAIB 1Y3XA 2R9PA 2RA3A 1QL9A 1YPKH 4BANB 2A1DB 1TRMA 4IBLH 5JB9S 2ZDKA 1E0FD 5JBAS 1T8OA 1FQ3A 1O36A 3UPEA 1QA7A 2ALPA 3TH4H 3STJA 3D62A 1VITF 2BDAA 1TB6H 1TA2A 3GCNA 4X2VA 3F6UH 2QF0A 2ZIQH 2UWOA 4YT7H 1GBAA 3TJNA 1YC0A 3PO1C 1O5GH 1SGPE 4FU9A 1C4V2 5JBBS 3V13A 4B2CA 4JMYA 3M61U 4J1YA 3HK3B 2WPKS 3SU4A 1HLTH 3SI3H 1FY1A 1IQHA 2H9TH 1O5FH 4LK4A 1OOKB 2BD5A 3TPIZ 2H5DA 1ZSJA 1TNKA 2QC2A 1KYNA 1NPMA 1G3BA 4D76A 1EPTB 5C67A 3KN2A 1AN1E 2PSXA 2ZGBH 4ZHAA 1BTXA 1P01A 1ZLRA 2ZTXA 4YESB 2H5CA 2Y82A 1W13U 4YLUA 1GWAA 3TH3H 1XUIA 1ELAA 4ZKNU 5CE1A 2ZPQA 1QBOA 2BQ6B 1NS3A 1ZTJA 1HNEE 4Z6AH 1AY6H 1K9OE 4A1XA 2AGIX 1XUHA 3U8TH 1SQAA 1TYNA 3RXGA 3ZZ4A 4X6MA 1DLEA 1UTPA 3CS7A 3I77A 4JZDH 1QL7A 4BAMB 1GBDA 3ZZAA 6GCHG 1Y3YA 5FPYA 1Z8GA 1GBFA 1LQEA 1IQFA 1UTLM 5A0CA 3SV6A 3VB6A 1TGSZ 1C2DA 1PPZA 3GOVB 3ZZ5A 1RTKA 5FCKA 2G52A 1GBMA 2C93B 3GICB 4WVPE 2W7SA 4D8NA 1DE7H 5EXLA 1TNGA 1NT1A 1UK2A 2F83A 3MU0A 4OS2A 3RC6A 2P8OB 1LDTT 4X1PU 2AYWA 1VGCC 5C20A 1O2TA 3RXLA 1MUEB 1C5LH 4AGKA 2NU1E 1JBUH 1BRBE 1TPOA 1XUGA 1A4WH 1SGEE 2BDCA 1OWEA 1W0YH 1NU9A 1ZHRA 3UNSA 1TX6A 2D26C 3P95A 3ZZ6A 3QGNB 3UWIA 4ZKRU 3TLOA 5E8EH 3TK5A 2Y7ZA 4I8JA 2XNIA 1LO6A 5FBIA 2OD3B 4ISNA 1O3MA 1QIXB 1SBWA 1JIRA 4JK5A 3GISB 2XWAA 2FYRA 3M3SA 5DJ7A 2A0QB 1O2YA 1IQEA 2SGQE 3LC3A 1T7CA 1TA6A 4ABIA 2PHBA 1THPB 4YOIA 4E7RG 1EAUA 1C1OA 3DD2H 1WTHD 2DUCA 2ZFSA 2WPHS 3NXPA 4O03A 4GAWA 1MH0A 2SNVA 4RSPA 3U8OH 1KXBA 1JRSA 4OGXA 1YCPK 2O8LA 1DICA 1DOJA 1BRAA 3BG8A 1NFUA 2AMPA 2AERH 4AFQA 1EX3A 3SN8A 1SGIB 4UDWH 4K1SA 2ZFTA 2P3FH 1NFXA 2SFAA 3A89A 2AMDA 3PMHB 1O3GA 1V2QT 2AMQA 2QAAA 4WH8A 4K69A 2ZU3A 4B71A 1BMAA 1HJ9A 1O3FA 3T26A 2VB0A 4KTSA 3TJVA 3RLWH 3FP6E 1CA0B 1ZMNA 1L0ZA 4WY3A 3QTVH 1H9IE 5GXPA 2HNTC 1J15A 3PROA 3GY5A 2VWOA 1WQSA 4FXGH 4A1VA 3S9BA 3EQ0H 1C2LA 2FI3E 2FOHA 3SJKA 1K2I1 3E0NB 1SGFA 1HDTH 4GVUA 3F1SB 4X2YA 2SNWA 4AORA 2QA9E 1O3PB 2YNBA 1GMCF 3R3GB 1P2KA 1IHSH 7GCHG 1YF4A 2HALA 3LONA 1V2NT 4B75A 1N1LA 1JRTA 3RXHA 2PGBB 2PUXB 1SB1H 1V2PT 3L33A 3PTNA 3SBKA 3TJOA 5DP9A 2ZQ2A 1O2RA 2Y6TA 4NGAH 3BTKE 3RC4A 2IPHA 1QCPA 1MTUA 5L6NH 4TWWA 1G3CA 4B73A 1SHYA 1P2QA 1ZRKA 4ZXXH 3SU0A 2JH0D 2UUFB 3D23A 1TPSA 2WPMS 1H9LB 1F5LA 3PLBA 5DP6A 2FOBA 1EAIA 1D3PB 1DLKB 4FUFA 3SU1A 3SNAA 4TPYA 3S0NA 2ESTE 1DVAH 1P57B 5TCAA 1GI1A 3VGCC 4DVAU 3Q00A 1Z8JB 1UTMA 3HKIB 3GCHC 5HMAA 2FM2A 1ZSLA 3C27B 1EPTA 4MNVA 4MPVA 3U8RH 5A8ZA 1SQOA 4INHA 1W7XH 4K8BA 3UR6A 2XXLA 4YLQH 1YCPH 3RM0H 3TH2H 3A8BA 1CT2E 3K65B 2Z7FE 2CV3A 4HFPB 3RUOA 3A7VA 4QT8C 4B2BA 1ELCA 3SJ9A 5LH8A 2XBVA 4K2YA 3KL6A 1SLUB 3PMAB 1TBQH 3GCTG 1AB9C 1QTFA 3SGAE 2PKSC 3ELAH 1TFXA 3FVFB 5J4SA 3GCOA 5F8TA 2JKHA 1O3JA 2GV7A 2ZDVH 1O3OA 1ID5H 4FUGA 5HM9A 5EQQA 2FOEA 3KHVA 1ELDE 3BTGE 2GX4A 3BTEE 1D9IA 2KAIA 2VINA 2Z3EA 1MAXA 1WAYB 2Y81A 1C1PA 1BTYA 4H4FA 1ZHMA 3UUZA 5A8YA 1QNJA 3W95A 2J38A 3MH5A 2M5TA 1GMHG 1JIMA 1ZTLA 5DGJA 2QN5T 1ZSKA 2EI8A 3M7TA 1DFPA 1CBWB 1ELEE 5TCCA 1O3IA 2ZDLA 1DWBH 3B9FH 3K2UA 1DXWA 5B6OA 2ZGHA 1EXFA 1THSH 3RMNH 1D6WA 1ETSH 1HIAB 2VIQA 1KDQA 4IN1A 1A5GH 1VCPA 6CHAB 1BJUA 1C5QA 1B7XB 2QXIA 1ZR0A 4JK6A 3VXEH 4M7GA 1EAWA 3S69A 1EOLA 3CENA 4YO9A 5L2ZH 1DSTA 3T29A 4ISOA 5EOKA 5JBCS 1DPOA 2G5VA 1LQDB 4AB8A 2Z6BD 1N8OB 4I8KA 3DFLA 4K60A 2BD2A 5L2YH 1DT2A 2BQ7B 2CXVA 3F9HA 2CF9H 5DP4A 3RXJA 1V2OT 1SLXB 2P59A 1EJNA 1ZGVA 4GHTA 1F5KU 1AWHB 4IS5A 1XVMA 3SHCH 3M5NA 5FBEA 4NIVA 1FAXA 3UNQA 5A8XA 1O3AA 3TK6A 1GDQA 1G32B 4NWLA 1ZOMA 1HBTH 2VH6A 2G55A 2ZKSA 4FUBA 5T6GA 4UD9H 2PV9B 1CGIE 3A83A 1L1NA 1BTZA 2P8OC 3D49H 1D3QB 2TIOA 5ABWA 2RCEA 2AH4X 3PYHA 1GCTC 1F0UA 1Z1JA 1WUNH 2BD9A 4Y8YA 1Q2WA 1TNIA 5JYIA 5E2PA 1S85A 3HPTB 1W10U 4NA9H 2B8OH 1TNHA 5FHTA 2ZTZA 1TWXB 5C5NA 2GVFA 4Q2KA 1MD7A 2J4IA 4CHAB 1HCGA 1J14A 3SZNA 4TY7A 3BG4B 3P6ZB 1W14U 1DWEH 2TPIZ 7GCHF 1YPHC 4AFUA 5I25A 1YPGH 4Y10E 3QK1A 1P03A 1SSXA 4J2YB 2HNTF 1AWFH 5TJXA 4NIWA 1GI6A 3LGIA 3PLKA 1Z7KA 2W3IA 1TRNA 2AEIH 2ODPA 4BAHB 2VGCB 1MTWA 3FZDA 1MZDA 2XYAA 4DIIH 4JYVH 1TNJA 2FYQA 2ANYA 1GVLA 4MDSA 1QB1A 2ZPSA 1HFDA 3M5LA 2Z9JA 4KELA 2BDIA 1AKSA 1NESE 1Z6EA 3UQVA 3UR9A 1BQYA 3MU1A 3PMBB 4XOJA 5CMXH 1SHHB 2GZ7A 1UO6A 2ALVA 3M3TA 1P11E 1LPGB 1SLVB 2FS9A 2PGQB 1CO7E 3GDSA 4Y7BA 2I6QA 3V3MA 1Z1IA 4OS1A 3RXVA 2OINA 3PV4A 4CR5A 1O2XA 1WV7H 4Y0ZE 4HGCA 1AQ7A 1TGNA 2IJOB 4IC5A 3RU4E 3SGBE 1HAOH 3MYWA 1CHOF 1GJBB 5DP8A 1TE0A 1G9IE 1V2LT 2Q6FA 4AGJA 4ZH8A 1Y3VA 1LCYA 3RXOA 1GI9B 1QJ1B 4GSOA 4Q7YA 4Y8ZA 4THNH 3MO3A 1MMJN 1S5SA 1MKWK 1CT4E 1N8OC 2AIQA 1HYLA 4B74A 2C8XB 1XM1A 1FY3A 3KQEA 5T3HA 3U98H 4X1RU 4BXSA 4ZMAH 1EZQA 1C5OH 2NU2E 2NWNA 3TIUA 2QGRA 2P3UB 4AYYB 3BG4C 4DCDA 2ZNKH 1CQQA 3Q3XA 3SI4H 5JDUB 4I8HA 1SGYE 1ZPZA 3M3VA 1B5GH 1O2LA 4FUEA 3FZZA 1W7GH 4BNRA 1P2MA 2UUKB 1TMTH 2ZG0H 1GL1A 1GJAB 1TOCB 2BLOA 2GGVB 4U2WA 1GMDF 2VVCA 4ABHA 3FAOA 4I32A 1GBBA 8GCHG 1AGJA 2DE8A 3GYMA 4X8VH 1HAYB 4A6LA 1KXAA 5F6MA 1P9UA
chains in the Genus database with same CATH superfamily
4FU7A 1UW7A 1K1MA 3MNCA 4FETA 2VWLA 4HZHA 5K0HA 1EP5A 1SMFE 2STBE 2ZDMA 2ZF0H 3O8DA 3NPSA 1O2VA 1HXFH 3QN7A 2VGCC 1TMBH 1S83A 1YLCA 1CA0C 1F92A 1O3DA 1QZ8A 2A31A 2ULLA 2VIPA 1LMWB 2EY4C 2I6SA 5GNDA 1INCA 2EI6A 1ZYOA 1DY8A 4ZROA 5E0HA 2ZP0H 5EG4A 2ANWA 3FO8D 3VB7A 4X1SU 2THFB 3SGQE 5JBTA 2O9QA 3A7TA 4CHAC 2H6MA 1E36B 5J4QA 3RXDA 3LGYA 4MNYA 4DGJA 1P2NA 1GVKB 2F91A 3GDUA 2BVRH 3QTOH 3QO6A 3ZYDA 3UOPA 3A84A 2ZHDA 3OE7D 1RGQA 3NK8A 4LZ4B 3BTQE 1C2JA 3T62A 2UWLA 3URDA 2C8YB 1BDAA 4X1NU 1PQ5A 1IAUA 4BAKB 1LHFH 2F43B 1V2RT 2HWLB 1D3DB 3A7ZA 1ELVA 1GJ4H 4Q7XA 3TVJB 3UQOA 2KFWA 2BLWA 1FLEE 1FXYA 1NBME 1TBZH 4FVBA 4NCYA 1EUFA 3RXCA 4HG6A 1EAXA 5T6FA 1RXPA 1RJXB 1A0JA 1NC6A 2ZU2A 1IQJA 2IN2A 2BOHB 1TGTA 2ZFQH 3SORA 2OXSA 2BD4A 1NY22 2A32A 1HPGA 3SNEA 4B76A 1QQUA 2XC5A 1EZXC 1NROH 1P09A 1W12U 3L6PA 4E06H 3E0PB 1N6XA 1VZQH 2TGPZ 3K6ZA 5DK1A 1VCWA 3BTDE 1DANH 2A7CA 5DP3A 1ZGIA 5FPTA 2UUJB 4X1QU 1BMNH 5EPYA 3BTWE 1TALA 2ZFRH 1C1WH 1SGNE 1HIAA 5DP7A 1KTSB 1PQAA 1W3CA 4X2WA 3SV7A 2ZA5A 1O2JA 3PV5A 2JETB 2FOGA 1C5ZB 1AFEH 1E79D 1CT0E 3K9XB 1LKBA 3A7WA 3LKWA 5LPEA 4ZUHA 1OX1A 2C90B 3FP8E 1EQ9A 2V3OH 3Q3YA 4UFDH 1O3HA 1EJAA 4RI0A 1SGTA 1OWDA 2VH0A 2BXUH 5F03A 1MQ5A 2G5NA 4TYDA 4HTCH 1UTQA 4YT6H 2NU4E 4ZHLU 4WF8A 2AHME 2GZ8A 1JXPA 4AFZA 1HAIH 1K0HA 1WYKA 2O8MA 4BTIB 3A80A 5A2MH 3GY7A 1YBWA 2OC0A 3MU5A 3ODDA 4FUIA 1SPJA 1GBLA 3BTFE 3RXSA 1C1MA 3ZVBA 4UEHH 1AFQB 3SNCA 1O2WA 2ILNA 3RU4T 1IHTH 1T4UH 3A8AA 4X6PA 4ZAEA 1GI2A 2G51A 2BYAX 2QYIA 1LVBA 3OU0A 3SV8A 1FN8A 1SGQE 1Z8RA 5GIBA 3UB0A 4OS5A 4Y76A 3T5FH 2EEKA 4CRDA 1TONA 4D7FA 5C3NA 3MO6A 1TRYA 3SUDA 3U1IB 5B6LA 5GWZA 2GT8A 1BMMH 1FY5A 1S84A 1FONA 1EATA 1F0RA 2EA3A 1A61H 3Q3KA 1MTNB 3DHKH 3PRBA 3SUGA 1PPEE 1DSUA 1W11U 3OY5U 1L1JA 2H9EH 3FKSD 5FXLA 3JZ1B 3U28C 1F7ZA 2FOAA 1ZTKA 1IQIA 1B0EA 1ZPBA 3SO3A 1HAVA 1GHBG 1AVWA 1E1QD 1BB0B 2BM2A 4LXBH 1P02A 3VFEA 1XUJA 2KX4A 3ITIA 3KGPA 3HATH 3MO9A 1DWDH 4BXWA 3LH3A 3E90B 1W0JD 3ZZBA 1UK4A 3GY3A 3ZVDA 3TGIE 2OC7A 1J9CH 4FU8A 3PLPA 1FDPA 3MU4A 4BOHA 1WBGB 3A85A 3RXRA 2WPIS 2A5KA 1G2MA 1BA8B 1GPZA 1IOEA 4Y79A 1A0LA 1ELTA 1AE8H 3RXQA 1S82A 4PROA 1O38A 4U01A 2GCHG 3EDXB 4ISIH 4GUXA 1OPHB 3V0XA 4XBCA 3MQKC 1O2KA 5AFYH 1GCTB 1O35A 2LELA 1YPEH 3P17H 1C2MA 2ZWLH 4NSVA 1SC8U 1XMNB 4DOQA 4MVNA 3SV2H 1S0RA 3RU4D 1HJ8A 3EYDA 4X6OA 1H8HD 1T8NA 2G81E 1UVOA 2OC8A 3B23B 1V2VT 1O3KA 4WMFA 3KEEA 1ACBE 1UVTH 1DUAA 1PJPA 3MH7A 5CHBA 2GCTB 3BV9B 4ISHH 3ZV9A 1E38B 1GI8B 1KLIH 4TT3D 1IQKA 1FAKH 9ESTA 1GG6B 2VNTA 1Y5UT 4MPUA 1UTKA 3RXBA 3SJIA 1EPTC 2XBYA 2G8TA 4MNXA 3TK9A 3GY2A 3QUMP 4OS4A 3LGWA 3SQHE 1GBJA 2C3SA 2F9VA 1FUJA 3A86A 1KXDA 1V6DA 2CF8H 4ZXYH 2GV6A 1YCPM 1C5SA 3DA9B 3P8FA 1GHWH 1UTJA 2OC1A 3HGPA 5KGOA 1YWUA 1DY9A 4X8TH 3KQ5A 1WU1A 5EQRA 1SQTA 2BY9X 2BVSH 1V2JT 2J92A 5AF9H 1H9HE 2KM0A 4XSKU 1AB9B 2STAE 1AI8H 2Z9KA 3Q76A 5I46H 4FVDA 2BMGB 3N7DA 4A1TA 1A46H 1O5CB 2BDYA 1TAWA 3EE7A 1W0KD 3GS9A 1J16A 1KXCA 4XRNA 3ZYEA 4XBBA 5EW1H 3VG8A 3VXFH 1C5MD 2RA0A 3A81A 2QXJA 4DURA 1LHGH 1C4Y2 1G30B 4FUJA 1PYTD 1O33A 1YM0A 3KYFA 2SGAA 4CBOA 1IQMA 2A7JA 2R3YA 5C1XA 3RLYH 3BN9A 1C4U2 1T4VH 2BY8X 4DY7B 1V2WT 1YY3A 4Q4LA 3VB4A 4BTUB 3W1EA 4Y11E 2A4RA 1MTVA 4ABBA 4KTCA 2V6NA 1MTNC 3ZZ7A 2OTVA 3GY6A 1H8DH 1PPBH 2FI5E 5LPFA 2WPDD 1C1SA 3P8GA 5HGGA 2ODQA 2W26A 4YM9A 3ZVCA 5FAHA 3M5MA 1V2TT 3P92A 4JYUH 4O3UA 1BTPA 1ELFA 4INKA 4WWYA 2PFEA 3PWBA 3F2GA 1GDNA 1PFXC 2Z3CA 1O3EA 1QR3E 1NRNH 1RIWC 1O2IA 2TGTA 3TNTA 4AG1A 4Z1MD 5EXMA 1DM4B 4JZ1A 4JZIA 2TGAA 1S0QA 2C4FH 2XCNA 4I8LA 2HLCA 2B5TB 2VIDA 3LGUA 4MPWA 4BAOB 1QBNA 3E91A 8LPRA 5E0GA 2FWWA 1P8VC 1UTNA 2UUYA 5DG6A 2BVXH 2G4UA 2GP9B 1NO9H 2V0BA 3JZ2B 1Z6JH 2QIQA 5EGMA 4CRGA 3RXFA 2ZCLP 1ESTA 1LVMA 1ZMJA 2ZHQH 1D3TB 2FTMA 1O3CA 3MNSA 3RMMH 3A88A 1F2SE 4IMQA 4WXIA 4AN7A 1GHXH 2R0LA 1ANDA 4ABFA 3S9CA 1GI3A 3VPKA 1O2MA 4GLYA 3OEED 4B1TA 1RTFB 2ZECA 3ZZ3A 1PPGE 3DCLA 1NTPA 3RMLH 1KIGH 1SGRE 1GMCG 2PSYA 1PPFE 1NRPH 1HAZB 1QURH 1K1LA 1TQ7B 2FIRH 3ZZ8A 2GMTC 2FEQH 2ANKH 2J2UA 2VWNA 4CH8B 1C5TA 2P94A 2W5EA 1O2HA 1G37A 1Z71A 2VVVA 3QX5H 5T6DA 2FO9A 1O31A 4X2XA 1GCDA 1QFKH 3MH6A 2FOMB 1BJVA 1WTGH 8KME2 2Y5HA 2AS9A 2CK3D 1QGFA 4O3TA 4NZQA 2XC0A 4UFGH 2AIPA 1HAXB 1VJAU 3S9AA 2Z9LA 1T32A 1FPHH 3GY4A 1YKTA 3E6PH 3KQBA 1AMHA 1GBEA 1OWHA 3BTHE 4Y8XA 3TU7H 2PKAA 5G4BA 2BD8A 4K8YA 1ESBA 5JB8S 1UVPA 4ASHA 1Y8TA 2F3CE 2W7UA 3TITA 1FN6A 3SW2B 5DSFA 1T8LA 2XTTB 2J98A 5C1YA 3ZZ9A 1K21H 2J95A 1C9TA 2GDEH 4DG4A 3TJUA 4ABJA 2FDAA 3NKKA 4AC9A 5AFZH 3URCA 3O8RA 2OLGA 4GPGA 4XDEA 3RXUA 2CHAC 1ELGA 1RTLA 4BAQB 1J17T 2RG3A 1GHBF 1BMLA 5EPNA 4SGAE 1GBCA 2GCTC 4MNWA 5GJ4B 1C5PA 1O2SA 2BXTH 2QF3A 1A0HB 1C1VH 1GBKA 1LHCH 3QWCH 1GBHA 4R0IA 2TRMA 1IQNA 1C1QA 1SLWB 1MBMA 3LT3A 1GJCB 4BTTB 4K5ZA 1KMHB 7LPRA 1BTWA 1ZPCA 2WSSD 1IQLA 4NA7A 3UIRA 1XUKA 4DIHH 1SI5H 2G4TA 4TY6A 5EU8A 1ETRH 1ZMLA 1GJDB 1EFRD 3EA9A 5HXFA 3M36A 4MQAA 1K1PA 4WH6A 1MKXH 1MKWH 2V3HH 2OBOA 1LKAA 1TBRH 2J9NA 1GMHF 2M2AA 2BX4A 5JPMH 1P3CA 3A7YA 4LOYH 2A4OA 1HV7A 1S6HA 3UFAA 4I31A 4MTBA 1ANBA 4D9RA 2P3TB 1QRZA 1O32A 5E2OA 2PUQH 4UE7H 1TOMH 4RKJB 3KQCA 1SOZA 3NZIA 1P9SA 1AFQC 2K0QA 3BEFB 3U9AH 2V3MA 3NCLA 1J8AA 4TPIZ 2SGEE 3IWMA 1MCVA 1DXPA 4U30A 1P05A 1LVYA 1OP8A 4B6FA 1BBRK 4NWKA 1WCZA 3HGNA 4O9VA 2IOTA 1ABJH 2NU3E 2WPJS 2P16A 4ZHMU 2VU8E 1L4DA 4MLFB 4JZEH 4X8SH 1RS0A 1YGCH 4Y6DA 1D6RA 2BB4A 4IMZA 3EAJA 1QJ7B 1THRH 1XKBC 4NIYA 1C1UH 1HJAB 1QB9A 1NFWA 2ANMH 5C94A 1HAVB 2C8ZB 1ORFA 2ZU1A 3P70B 1YLDA 1L4ZA 4ACAA 4X8UH 1HAPH 3SUFA 3E16B 4AB9A 1LTOA 4I8GA 3M5OA 1O5AB 2WPLS 4P00A 3H7TA 5DN6D 1QRXA 4D7GA 1CSOE 3E1XB 2Q6DA 2R0KA 2ZQ1A 3QZRA 2P93A 3NUMA 3SU6A 2FXRA 3MOCA 4JZFH 4KGAA 2XC4A 2O8UA 1G36A 3M37A 1SKYE 3MWIU 3KIDU 1NZQH 4AX9H 1Y5AT 1XVOA 2F9NA 2GT7A 3RXKA 2QXHA 1ARBA 3SJOA 2R3UA 3A8DA 5F8XA 3AAUA 2Y80A 3OYPA 4A5TS 5ETXA 2F4LA 2JJ2D 5F8ZA 3VGCB 5EQSA 1OYQA 1MCTA 2BY6X 1GL0E 4CR9A 3KNXA 3GCHB 1P12E 3SNDA 4IW4E 4P02A 1ZRBA 2PWXA 2Z9IA 3H7OA 3LOXA 1NM6A 2TGDA 3BF6H 1FY8E 1GHZA 2DE9A 2H1UA 2A2QH 1ESAA 1OS8A 2ZPRA 3CNRA 1C5WB 4ABGA 5C1UA 4A92A 1DX5M 2TBSA 6ESTA 1S6FA 4AFSA 2YMSD 4IC6A 1ANCA 3ZVAA 5ESBA 4U32A 1NRQH 3LIWA 5HYOA 3P8OA 2LNCA 1BTHH 1UVUH 2GCHF 3LGTA 1H4WA 2Y5GA 6LPRA 1CGJE 1C9PA 1OSSA 1QY6A 2PR3A 4FUHA 2OK5A 2ZCKP 1RIWB 1AD8H 3UWJH 4K3JA 4NSYA 1XUFA 5C5OA 3PM3A 1KLTA 2ZDNA 5LGOA 1TX7A 4ZKSU 1EKBB 1HJAC 4Y7AA 1ELBA 1MQ6A 2HOBA 2ZU4A 1UK3A 3C1KA 4H6SB 2VWMA 3VB3A 1SGDE 1XXFA 2CN0H 3NWUA 3KF2A 1O34A 4WXVA 1PQ8A 1C5YB 3GY8A 4AG2A 4FUCA 3UY9A 2OUAA 3MTYA 1K22H 1K1OA 4B6EA 2BHGA 4UFFH 4RN6A 1EZUC 1LHDH 2JETC 3I78A 2ZHFH 5AVDA 5LPRA 6CHAC 1WOFA 2C8WB 3GYLB 3ESTA 1MAYA 4DT7B 1FI8A 3F2HA 3RXTA 1PPHE 1GHAF 2B0FA 2YOLA 4F4OC 5CDFE 2CMYA 1W0ZU 5CHAC 4YTAA 1L2EA 4K1EA 5A0BA 2A45B 3HK6B 4X0WU 3MI4A 2H9HA 4AOQA 3F9FA 2AGEX 1O2ZA 1JWTA 2ZGCA 3OAAD 3T25A 2K1QA 2XBXA 4CBNA 1F5RA 1BHXF 3MNBA 1AO5A 2BY7X 1GG6C 1FZZA 3LU9B 3PMJA 3SU2A 3LPRA 1GDUA 2XWBI 2ZHWH 3A7XA 1OP0A 4MG3A 5E0JA 4I33A 3ATWA 3EGKH 1C1NA 1QB6A 8ESTE 1BUIA 4GCHG 1ZZZA 3S7HB 4VGCB 3CP7A 4NZLA 5SGAE 2Z94A 4F49A 3RXEA 2H2ZA 1QA0A 2A5IA 3PTBA 5IYTA 2YNAA 3D65E 3SNBA 2ZGXH 1ANEA 2YMSB 1A1RA 3EE0B 3PWCA 3H5CB 3ZZDA 2F9OA 2BD3A 3BTTE 2J5UA 4UONA 5A09A 2XW9A 2HVYB 3BEUA 1ETTH 4CREA 1G2LA 3ATMA 1TNLA 4WJG2 1MTSA 3ZVGA 1O3NA 1PYTC 1BT7A 3DFJA 3G01A 4HI3A 4KP0A 4YOJA 3TGKE 1YP9A 3P8NA 4YZUA 2XBWA 3ZV8A 1Q31A 3MH4A 7KMEH 1GGDB 2J34A 2HRVA 1OKXA 1QHRB 3WWBA 2WV5A 2HPPH 3F0OA 5BPEA 2A2XH 3ENSB 3F9GA 4LZ1H 4R8TB 3QZQA 1OYTH 3DUXH 2VIVA 3LJJA 1XX9A 1P2OA 3STIA 1E34B 3V12A 1C2EA 1BTUA 1FNIA 2QCYA 2ZDAH 1EOJA 1YPLH 3OX7U 2FP7B 2OBQA 3O8BA 1NU7B 1O30A 4ESTE 2QY0B 2FPZA 4CRAA 1VCQA 2XNDD 3AVZA 2IPQX 3M7QA 2ZFFH 3BSQA 3IITA 1YYY1 3OEHD 2P95A 4ABAA 1A2CH 2FOFA 2ZO3H 3SV9A 4E05H 2AFQB 1CVWH 5CHAB 1KXFA 5GDSH 1AKSB 3O8CA 1O2GH 1O2NA 2CGAA 2EI7A 4YOGA 1EB1H 1WQVH 1HUTH 1UCYH 2ASUB 1C1RA 2PTCE 1JOUB 3OSYA 1MZAA 1FMGA 1P0SH 3DT0H 3RXMA 1FY4A 2WZQA 5FPSA 3L3TA 4ABDA 3BTME 5EJ1A 4CRCA 2F9BH 1GI0A 2O8WA 3M35A 2HNTE 2NU0E 1CGHA 3SU5A 1EB2A 2BTCE 3UNRA 1AU8A 1O5DH 1C5RA 1DS2E 4DT4A 1S81A 2BZAA 2B9LA 1GJ8B 1KY9A 1SR5C 2KCYA 3T2NA 1UCYE 1IQGA 2FZZA 1Q3XA 1O39A 1SFQB 2WYGA 4NA8A 3SJ8A 1KSNA 2PW8H 4WMDA 1FV9A 3I29A 4ABEA 3CS0A 5DPAA 2W6JD 3VEQB 4XE4A 3UREA 3U69H 2CHAB 2BQWB 1GGDC 2ZCHP 2ZZUH 2A5AA 2JH5D 2GKVE 1G3DA 1BIOA 2LPRA 1O5EH 1CA8B 1VR1H 3TGJE 1EZSC 1G3EA 3ATIA 1B0FA 4OS6A 1Y3WA 1PQ7A 1K1IA 2ZI2H 5IK2D 4I7YH 1BRUP 1UJ1A 4RT0A 1DITH 1GJ5H 1V2KT 4XD7D 4AYVB 4UFEH 1FJSA 2BDBA 2ZHEH 3F68H 1UHBB 1KXEA 1AVGH 3ZVEA 1HGTH 1A7SA 1DDJA 2A4QA 1LVOA 1QRWA 3AASA 1YPJH 1O2UA 1WSSH 1BITA 1C5NH 5EIYA 3E8LA 1AIXH 1C2GA 3HKJB 2OQUA 2ZC9H 4NFFA 5DKMA 5EXNA 1FIZA 5FX5A 2SGFE 1C5UA 1HXEH 1T31A 1QBVH 3RM2H 2BDHA 5GCHG 1TPPA 5EODA 2PTNA 3RMOH 2GMTB 1P2IA 2PLXA 1ZHPA 4H6TA 3OTJE 3FN8A 1UCYK 1SL3A 1H8IH 1C2KA 1Y3UA 1YLNA 4NIXA 1TMUH 5HKKD 1ABIH 1LPKB 2Z9GA 1T8MA 2WINI 2G00A 2JH6D 1V2UT 1GHYH 4B2AA 3W94A 5GPIB 1UHBA 5AHGH 3PRDA 2UWPA 3VB5A 1OWIA 1ZJDA 2ZU5A 2FESH 1K1JA 5FCRA 3LGVA 1CE5A 4MPXA 4SGBE 5ESTE 2RDLA 1OXGA 1W2KH 2QXGA 1C2IA 3KQDA 3M7UA 1O3BA 3N7OA 3MFJA 1V2ST 2D8WA 1UTOA 2R2WU 2A4GA 1AUJA 4XBDA 2RFKC 2EQNA 3BIUH 2EC9H 2HVXA 3LDXH 3T28A 5K7RA 3MU8A 3QGJA 2XCFA 5L30H 1AHTH 2BLQA 3SU3A 1XXDA 7ESTE 1LPZB 2Y5FA 3N7EA 1NRSH 1W8BH 2GTBA 2XRCA 1SOTA 3E3TA 1C1TA 4Y71A 1P06A 4IGDA 5F53A 1YPMH 4X6NA 3IG6B 4ZKOU 3UOUA 3OY6U 3KCGH 1AZZA 3WY8A 1EASA 2FLBH 1GMDG 5IDKA 1VITG 3AW0A 3MNXA 3U1JB 1SG8B 1TIOA 1P04A 1PPCE 1KTTB 1NRRH 1HRTH 4IN2A 4CRFA 4F48B 2WUCA 1GVZA 2F9UA 1F0SA 1NN6A 1GHAG 2VIOA 2GDDA 4XFQA 3SYJA 1TLDA 5EW2H 2FODA 3LH1A 1CBWC 4O97A 1SVPA 2VVUA 2VJ1A 3Q77A 1JMOH 1O2PA 2HGTH 1C5VA 1S6LA 3MHWU 1GJ6A 1K1NA 3S7KB 2BY5X 8GCHF 2Q1JA 3ZVFA 5DO4H 2BLVA 9LPRA 1A5HA 1RD3B 4NFEA 1P3EA 5BRRE 4DW2U 1N6YA 2CJIA 2FLRH 3DSGA 1FPCH 4NG9H 4CH2B 1O2OA 2WHXA 2ZGJA 1CU1A 2FMJA 2WYJA 2AGGX 4KTUA 3A8CA 4A7IB 1C2FA 1BZXE 4INLA 3NRLA 5DP5A 1TQ0B 1QQ4A 2A7HA 3F9EA 1QL8A 3V7TA 1DUEA 2OCVB 1MKXK 4TWYA 1GHVH 1A3BH 1GJ7B 3FANA 1EJMA 2F9PA 4OS7A 3SUEA 2D1JA 4ISLA 3AW1A 1AZ8A 5GCHF 1MU6B 1O0DH 1VGCB 1RRKA 4E7NA 1HAGE 4CRBA 1BBRE 2OQ5A 5FL7D 1V2MT 1BOQA 2OP9A 2SGDE 2SGPE 4K1TA 1C2HA 2ODYB 4FUDA 3RP2A 5PTPA 1OHHD 3BIVH 2V7QD 2Y7XA 3T27A 1Y59T 3K6YA 1BBRH 1E35B 1GBIA 1FIWA 2Q6GA 5C2ZA 1O2QA 1H1BA 1SGCA 3MMGA 1GI7B 5FX6A 1O37A 1AE5A 3SOSA 4OGYA 1HAHH 2BD7A 2IJD1 1P10A 3B8JA 4RKOB 1VITH 2FOCA 1O3LA 1OWJA 3PO1B 3RXAA 4VGCC 1AVXA 2K8IA 2V35A 1V3XA 1P2JA 4JYTA 1MU8B 1C5XB 1VJ9U 2W3KA 3SQEE 1CHOG 4AZ2B 4H42U 1LHEH 1ZJKA 1MBQA 1TPAE 4Y0YE 2QV1A 4DJZB 5KECA 4D9QA 3RC5A 1GJ9B 1E37B 3TNSA 2GZ9A 1BRCE 2J94A 1TGCA 5H4IB 1YPHE 1TGBA 2FX4A 3QLPH 2J97A 3FP7E 1L1GA 4ZCNA 1TX8A 3GDVA 1GI4A 1BCUH 1U6QA 1GI5A 2GD4B 2O8TA 4WMEA 1SFIA 3R0FA 4Z0KA 1CHGA 3EA8A 2FX6A 1QJ6B 3RXIA 3LJOA 1HB0B 1SGFG 1EP6A 2PKAB 1DWCH 3RDZA 1Y5BT 3EA7A 1MD8A 2FTLE 2ZTYA 1GBTA 1A3EH 1XKAC 4Q80A 3RXPA 6GCHF 4GHQA 3QDZB 2BOKA 2J98B 2WV4A 3GCTF 3OFND 3A87A 3ZZCA 3LC5A 3UTUH 1OP2A 4JCNA 1AUTC 3ATKA 3FFGA 2ZFPH 2FI4E 1NFYA 1X7AC 1UMAH 2HPQH 1KDQB 1UVSH 1O5BB 3BEIB 1K28D 1TABE 1M9UA 2D2DA 3A82A 4GCHF 4Q7ZA 1KLJH 5A0AE 2B7DH 1F0TA 3AAVA 3ODFA 1A5IA 2BDGA 1OWKA 2VIWA 1SQRA 2PKSB 1RFNA 2WUBA 1ARCA 2Z3DA 2BX3A 1Z8IB 3PB1E 5HM2A 1BHXB 2BZ6H 5HIYA 2R2MB 3ATLA 3SHAH 1BMFD 4KKDA 1D4PB 2ZEBA 2FS8A 2RA3A 1Y3XA 2KAIB 2R9PA 1QL9A 1YPKH 4BANB 2A1DB 1TRMA 4IBLH 5JB9S 2ZDKA 1E0FD 5JBAS 3KYGA 1T8OA 1FQ3A 1O36A 3UPEA 1QA7A 2ALPA 3TH4H 3STJA 3D62A 1VITF 2BDAA 2JJ1D 1TB6H 1TA2A 3GCNA 4X2VA 3F6UH 2QF0A 2ZIQH 2UWOA 4YT7H 1GBAA 3TJNA 1YC0A 3PO1C 1MABB 1O5GH 1SGPE 4FU9A 1C4V2 5JBBS 3V13A 4B2CA 4JMYA 3M61U 4J1YA 3HK3B 2WPKS 3SU4A 1HLTH 3SI3H 1FY1A 1IQHA 2H9TH 1O5FH 4LK4A 1OOKB 2BD5A 3TPIZ 2H5DA 1ZSJA 1TNKA 2QC2A 1KYNA 1NPMA 1G3BA 4D76A 1EPTB 5C67A 3KN2A 1AN1E 2PSXA 2ZGBH 4ZHAA 1BTXA 1P01A 1ZLRA 2ZTXA 4YESB 2H5CA 2Y82A 1W13U 4YLUA 1GWAA 3TH3H 1XUIA 1ELAA 4ZKNU 5CE1A 2ZPQA 1QBOA 2BQ6B 1NS3A 1NBMD 1ZTJA 1HNEE 4Z6AH 1AY6H 1K9OE 4A1XA 2AGIX 1XUHA 5T1VA 3U8TH 1SQAA 1TYNA 3RXGA 3ZZ4A 4X6MA 1DLEA 1UTPA 3CS7A 3I77A 4JZDH 1QL7A 4BAMB 1GBDA 3ZZAA 6GCHG 1Y3YA 5FPYA 1Z8GA 1GBFA 1LQEA 1IQFA 1UTLM 5A0CA 3SV6A 3VB6A 4ACBA 1TGSZ 1C2DA 1PPZA 3GOVB 3ZZ5A 1RTKA 5FCKA 2G52A 1GBMA 2C93B 3GICB 4WVPE 2W7SA 4D8NA 1DE7H 5EXLA 1TNGA 1NT1A 1UK2A 2F83A 3MU0A 4OS2A 3RC6A 2P8OB 5C0TA 1LDTT 4X1PU 2AYWA 1VGCC 5C20A 1O2TA 3RXLA 1MUEB 1C5LH 4AGKA 2NU1E 1JBUH 1BRBE 2JIZD 1TPOA 1XUGA 1A4WH 1SGEE 2BDCA 1OWEA 1W0YH 1NU9A 1ZHRA 2VBCA 3UNSA 1TX6A 2D26C 3P95A 3ZZ6A 3DSOA 3QGNB 3UWIA 4ZKRU 1VKYA 3TLOA 5E8EH 3TK5A 2Y7ZA 4I8JA 2XNIA 1LO6A 4FOUC 5FBIA 2OD3B 4ISNA 1O3MA 1QIXB 3WWFA 1SBWA 1JIRA 2QF5A 4JK5A 3GISB 2XWAA 2FYRA 3M3SA 5DJ7A 2A0QB 1O2YA 1IQEA 2SGQE 3LC3A 1T7CA 1TA6A 4ABIA 2PHBA 1THPB 4YOIA 2KR7A 4E7RG 1EAUA 1C1OA 3DD2H 2KCPA 1WTHD 2DUCA 2ZFSA 2WPHS 3NXPA 4O03A 4GAWA 1MH0A 2SNVA 4RSPA 3U8OH 1KXBA 1JRSA 4OGXA 1YCPK 2O8LA 1DICA 1DOJA 1BRAA 3BG8A 1NFUA 2AMPA 2AERH 4AFQA 1EX3A 3SN8A 2KCAA 1E1RD 1SGIB 4UDWH 4K1SA 2ZFTA 2P3FH 1NFXA 2SFAA 3A89A 2AMDA 3PMHB 1O3GA 1V2QT 2AMQA 2QAAA 4WH8A 4K69A 2ZU3A 4B71A 1BMAA 1HJ9A 3OTPA 1O3FA 4RT1A 3T26A 2VB0A 4KTSA 1COWD 3TJVA 3RLWH 3FP6E 1CA0B 1ZMNA 1L0ZA 4WY3A 3QTVH 1H9IE 5GXPA 2HNTC 1J15A 3PROA 3GY5A 2VWOA 1WQSA 4FXGH 4A1VA 3S9BA 3EQ0H 1C2LA 2FI3E 2FOHA 5EJZA 3SJKA 1K2I1 3E0NB 1SGFA 1HDTH 4GVUA 3F1SB 4X2YA 2SNWA 4AORA 2QA9E 1O3PB 2YNBA 1GMCF 3R3GB 1P2KA 1IHSH 5EJLA 7GCHG 1YF4A 2HALA 3LONA 1V2NT 4B75A 1N1LA 4YXWD 1JRTA 3RXHA 2PGBB 2PUXB 1SB1H 1V2PT 3L33A 3PTNA 3SBKA 3TJOA 5DP9A 2ZQ2A 1H8ED 1O2RA 2Y6TA 4NGAH 3BTKE 3RC4A 1WDIA 2LP6A 2IPHA 1QCPA 4I86A 1MTUA 5L6NH 4TWWA 1G3CA 4B73A 1SHYA 1P2QA 1ZRKA 4ZXXH 3SU0A 2JH0D 2UUFB 3D23A 1TPSA 2WPMS 1H9LB 1F5LA 3PLBA 5DP6A 2FOBA 1EAIA 1D3PB 1DLKB 4FUFA 3SU1A 3SNAA 4TPYA 3S0NA 2ESTE 2KCOA 1DVAH 1P57B 5TCAA 3H09A 1GI1A 3VGCC 3UAIC 4DVAU 3Q00A 1Z8JB 1UTMA 3HKIB 3GCHC 5HMAA 2FM2A 1ZSLA 3C27B 1EPTA 4MNVA 4MPVA 3U8RH 5A8ZA 1SQOA 4INHA 1W7XH 4K8BA 2QE7D 3UR6A 2XXLA 4YLQH 1YCPH 3RM0H 3TH2H 3A8BA 1CT2E 3K65B 2Z7FE 2CV3A 3DSPA 4HFPB 3RUOA 3A7VA 4QT8C 4B2BA 1ELCA 3SJ9A 5LH8A 2XBVA 4K2YA 3KL6A 4OM9A 1SLUB 3PMAB 1TBQH 3GCTG 1AB9C 1QTFA 3FOAA 2XOKD 3SGAE 2PKSC 3ELAH 1TFXA 4M9FA 3FVFB 3PV2A 3GCOA 5J4SA 5F8TA 2JKHA 2RDEA 1O3JA 2GV7A 2ZDVH 3ZIAD 1O3OA 1ID5H 4FUGA 5HM9A 5EQQA 2FOEA 3KHVA 1ELDE 3BTGE 2GX4A 3BTEE 1D9IA 2KAIA 5C17A 2VINA 2Z3EA 1MAXA 1WAYB 2Y81A 1C1PA 1BTYA 4H4FA 1ZHMA 3UUZA 5A8YA 1QNJA 2L6OA 3W95A 2J38A 3MH5A 2M5TA 1GMHG 1JIMA 1ZTLA 5DGJA 2QN5T 1ZSKA 2EI8A 3M7TA 1DFPA 1CBWB 1ELEE 5TCCA 1O3IA 2ZDLA 1DWBH 3B9FH 3K2UA 1DXWA 5B6OA 2ZGHA 1EXFA 1THSH 3RMNH 1D6WA 1ETSH 1HIAB 2VIQA 1KDQA 4IN1A 1A5GH 1VCPA 6CHAB 1BJUA 1C5QA 1B7XB 2QXIA 1ZR0A 4JK6A 3VXEH 4M7GA 1EAWA 3S69A 1EOLA 3CENA 4YO9A 5L2ZH 1DSTA 2GJGA 3T29A 4ISOA 5EOKA 5JBCS 1DPOA 2G5VA 1LQDB 4AB8A 2Z6BD 1N8OB 4I8KA 3DFLA 4K60A 2BD2A 5L2YH 1DT2A 2BQ7B 2CXVA 3F9HA 2CF9H 5C0UA 5DP4A 3RXJA 1V2OT 1SLXB 2P59A 1EJNA 1ZGVA 4GHTA 1F5KU 1AWHB 4IS5A 3F0PA 1XVMA 3SHCH 3M5NA 5FBEA 3WW7A 4NIVA 1FAXA 3UNQA 5A8XA 1O3AA 3TK6A 1GDQA 4TSFD 1G32B 4NWLA 1ZOMA 1HBTH 2VH6A 2YMSC 3F3BA 2G55A 2JDID 2ZKSA 4FUBA 5T6GA 2W6ID 5HIZA 4UD9H 2PV9B 1CGIE 1FX0B 3A83A 1L1NA 1BTZA 2P8OC 3D49H 1D3QB 2TIOA 5ABWA 2RCEA 2AH4X 2PP6A 3PYHA 1GCTC 1F0UA 1Z1JA 1WUNH 2BD9A 4Y8YA 1Q2WA 1TNIA 5JYIA 5E2PA 1S85A 3HPTB 1W10U 4NA9H 2B8OH 1TNHA 5FHTA 2ZTZA 1TWXB 5C5NA 2GVFA 4Q2KA 1MD7A 2J4IA 4CHAB 1HCGA 1WXRA 1J14A 3SZNA 4TY7A 3BG4B 3P6ZB 1W14U 3SZEA 1DWEH 2TPIZ 7GCHF 1YPHC 4AFUA 5I25A 1YPGH 4Y10E 3QK1A 1P03A 3AK5A 1SSXA 4J2YB 2HNTF 1AWFH 5TJXA 4NIWA 1GI6A 3LGIA 3PLKA 1Z7KA 2W3IA 5KEDA 1TRNA 2HLDD 2L74A 2AEIH 2ODPA 4BAHB 2VGCB 1MTWA 3FZDA 1MZDA 2XYAA 4DIIH 4JYVH 1TNJA 4F55A 2FYQA 2ANYA 1GVLA 4MDSA 1QB1A 2ZPSA 1HFDA 3M5LA 2Z9JA 4KELA 2BDIA 1AKSA 2WV9A 1NESE 1Z6EA 3UQVA 3UR9A 1BQYA 3MU1A 3PMBB 4XOJA 5CMXH 1SHHB 2GZ7A 1UO6A 2ALVA 3M3TA 1P11E 1LPGB 1SLVB 2FS9A 2PGQB 1CO7E 3GDSA 4Y7BA 2I6QA 3V3MA 1Z1IA 4OS1A 4Q63A 3RXVA 2KZ4A 2OINA 3PV4A 4CR5A 1O2XA 1WV7H 4Y0ZE 4HGCA 1AQ7A 1TGNA 2IJOB 4IC5A 3RU4E 3SGBE 1HAOH 3MYWA 1CHOF 1GJBB 5DP8A 1TE0A 1G9IE 1V2LT 2Q6FA 4AGJA 4ZH8A 1Y3VA 1LCYA 3RXOA 1GI9B 1QJ1B 4GSOA 4Q7YA 4Y8ZA 4THNH 3MO3A 1MMJN 1S5SA 1MKWK 1CT4E 1N8OC 2AIQA 1HYLA 4B74A 2C8XB 1XM1A 1FY3A 3KQEA 5T3HA 3U98H 4X1RU 4BXSA 4ZMAH 1EZQA 1C5OH 2NU2E 2NWNA 3TIUA 2QF4A 2P3UB 2QGRA 4AYYB 3BG4C 4DCDA 2ZNKH 1CQQA 3Q3XA 3SI4H 5JDUB 4I8HA 1SGYE 1ZPZA 3M3VA 4ASUD 1B5GH 1O2LA 4FUEA 3FZZA 1W7GH 4BNRA 1P2MA 2UUKB 1TMTH 2ZG0H 1GL1A 3N99A 1GJAB 1TOCB 2BLOA 2GGVB 3F2FA 4U2WA 1GMDF 2VVCA 4ABHA 3FAOA 4I32A 1GBBA 8GCHG 1AGJA 2DE8A 3GYMA 4X8VH 1HAYB 4A6LA 1KXAA 5F6MA 1P9UA
chains in the Genus database with same CATH topology
4FU7A 1K1MA 3MNCA 2VWLA 4HZHA 5K0HA 1EP5A 1SMFE 2STBE 2ZDMA 2ZF0H 3O8DA 3NPSA 1O2VA 1HXFH 3QN7A 2VGCC 1TMBH 1S83A 1YLCA 1CA0C 1F92A 1O3DA 2A31A 2ULLA 2VIPA 1LMWB 2I6SA 1INCA 2EI6A 1ZYOA 1DY8A 4ZROA 5E0HA 2ZP0H 5EG4A 2ANWA 3VB7A 4X1SU 2THFB 3SGQE 5JBTA 2O9QA 3A7TA 4CHAC 2H6MA 1E36B 5J4QA 3RXDA 3LGYA 4MNYA 4DGJA 1P2NA 1GVKB 2F91A 3GDUA 2BVRH 3QTOH 3QO6A 3ZYDA 3UOPA 3A84A 2ZHDA 1RGQA 3NK8A 4LZ4B 3BTQE 1C2JA 3T62A 2UWLA 3URDA 2C8YB 1BDAA 4X1NU 1PQ5A 1IAUA 4BAKB 1LHFH 1V2RT 2HWLB 1D3DB 3A7ZA 1ELVA 1GJ4H 4Q7XA 3TVJB 3UQOA 2BLWA 1FLEE 1FXYA 1TBZH 4FVBA 4NCYA 1EUFA 3RXCA 1EAXA 5T6FA 1RXPA 1RJXB 1A0JA 1NC6A 2ZU2A 1IQJA 2IN2A 2BOHB 1TGTA 2ZFQH 3SORA 2OXSA 2BD4A 1NY22 2A32A 1HPGA 3SNEA 4B76A 1QQUA 2XC5A 1EZXC 1NROH 1P09A 1W12U 3L6PA 4E06H 3E0PB 1N6XA 1VZQH 2TGPZ 3K6ZA 5DK1A 1VCWA 3BTDE 1DANH 2A7CA 5DP3A 1ZGIA 5FPTA 2UUJB 4X1QU 1BMNH 5EPYA 3BTWE 1TALA 2ZFRH 1C1WH 1SGNE 1HIAA 5DP7A 1KTSB 1PQAA 1W3CA 4X2WA 3SV7A 2ZA5A 1O2JA 2JETB 2FOGA 1C5ZB 1AFEH 1CT0E 3K9XB 1LKBA 3A7WA 3LKWA 5LPEA 4ZUHA 1OX1A 2C90B 3FP8E 1EQ9A 2V3OH 3Q3YA 4UFDH 1O3HA 1EJAA 1SGTA 1OWDA 2VH0A 2BXUH 5F03A 1MQ5A 2G5NA 4TYDA 4HTCH 1UTQA 4YT6H 2NU4E 4ZHLU 4WF8A 2GZ8A 1JXPA 4AFZA 1HAIH 1WYKA 2O8MA 4BTIB 3A80A 5A2MH 3GY7A 1YBWA 2OC0A 3MU5A 3ODDA 4FUIA 1SPJA 1GBLA 3BTFE 3RXSA 1C1MA 3ZVBA 4UEHH 1AFQB 3SNCA 1O2WA 2ILNA 3RU4T 1IHTH 1T4UH 3A8AA 4X6PA 4ZAEA 1GI2A 2G51A 2BYAX 2QYIA 1LVBA 3OU0A 3SV8A 1FN8A 1SGQE 1Z8RA 5GIBA 4OS5A 4Y76A 3T5FH 2EEKA 4CRDA 1TONA 4D7FA 5C3NA 3MO6A 1TRYA 3SUDA 3U1IB 5GWZA 2GT8A 1BMMH 1FY5A 1S84A 1FONA 1EATA 1F0RA 2EA3A 1A61H 3Q3KA 1MTNB 3DHKH 3SUGA 1PPEE 1DSUA 1W11U 3OY5U 1L1JA 2H9EH 5FXLA 3JZ1B 1F7ZA 2FOAA 1ZTKA 1IQIA 1B0EA 1ZPBA 3SO3A 1HAVA 1GHBG 1AVWA 2BM2A 1BB0B 4LXBH 1P02A 3VFEA 1XUJA 3ITIA 3KGPA 3HATH 3MO9A 1DWDH 4BXWA 3LH3A 3E90B 3ZZBA 1UK4A 3GY3A 3ZVDA 3TGIE 2OC7A 1J9CH 4FU8A 3PLPA 1FDPA 3MU4A 4BOHA 1WBGB 3A85A 3RXRA 2WPIS 2A5KA 1G2MA 1BA8B 1GPZA 1IOEA 4Y79A 1A0LA 1ELTA 1AE8H 3RXQA 1S82A 4PROA 1O38A 4U01A 2GCHG 3EDXB 4ISIH 4GUXA 1OPHB 3V0XA 4XBCA 1O2KA 5AFYH 1GCTB 1O35A 1YPEH 3P17H 1C2MA 2ZWLH 4NSVA 1SC8U 1XMNB 4DOQA 4MVNA 3SV2H 1S0RA 3RU4D 1HJ8A 3EYDA 4X6OA 1T8NA 2G81E 1UVOA 2OC8A 3B23B 1V2VT 1O3KA 4WMFA 3KEEA 1ACBE 1UVTH 1DUAA 1PJPA 3MH7A 2GCTB 3BV9B 4ISHH 3ZV9A 1E38B 1GI8B 1KLIH 1IQKA 1FAKH 9ESTA 1GG6B 2VNTA 1Y5UT 4MPUA 1UTKA 3RXBA 3SJIA 1EPTC 2XBYA 2G8TA 4MNXA 3TK9A 3GY2A 3QUMP 4OS4A 3LGWA 3SQHE 1GBJA 2C3SA 2F9VA 1FUJA 3A86A 1KXDA 1V6DA 2CF8H 4ZXYH 2GV6A 1YCPM 1C5SA 3DA9B 3P8FA 1GHWH 1UTJA 2OC1A 3HGPA 1DY9A 4X8TH 1WU1A 5EQRA 1SQTA 2BY9X 2BVSH 1V2JT 2J92A 5AF9H 1H9HE 4XSKU 1AB9B 2STAE 1AI8H 2Z9KA 3Q76A 5I46H 4FVDA 2BMGB 4A1TA 1A46H 1O5CB 2BDYA 1TAWA 3ZYEA 1J16A 1KXCA 4XBBA 5EW1H 3VXFH 1C5MD 2RA0A 3A81A 2QXJA 4DURA 1LHGH 1C4Y2 1G30B 4FUJA 1PYTD 1O33A 1YM0A 2SGAA 4CBOA 1IQMA 2A7JA 2R3YA 5C1XA 3RLYH 3BN9A 1C4U2 1T4VH 2BY8X 4DY7B 1V2WT 3VB4A 4BTUB 4Y11E 2A4RA 1MTVA 4ABBA 4KTCA 2V6NA 1MTNC 3ZZ7A 2OTVA 3GY6A 1H8DH 1PPBH 2FI5E 5LPFA 1C1SA 3P8GA 5HGGA 2ODQA 2W26A 4YM9A 3ZVCA 5FAHA 3M5MA 1V2TT 3P92A 4JYUH 4O3UA 1BTPA 1ELFA 4INKA 4WWYA 2PFEA 3PWBA 1GDNA 1PFXC 2Z3CA 1O3EA 1QR3E 1NRNH 1RIWC 1O2IA 2TGTA 3TNTA 4AG1A 5EXMA 1DM4B 4JZ1A 4JZIA 2TGAA 1S0QA 2C4FH 2XCNA 4I8LA 2HLCA 2B5TB 2VIDA 3LGUA 4MPWA 4BAOB 1QBNA 3E91A 8LPRA 5E0GA 2FWWA 1P8VC 1UTNA 2UUYA 5DG6A 2BVXH 2G4UA 2GP9B 1NO9H 2V0BA 3JZ2B 1Z6JH 2QIQA 5EGMA 4CRGA 3RXFA 2ZCLP 1ESTA 1LVMA 1ZMJA 2ZHQH 1D3TB 2FTMA 1O3CA 3MNSA 3RMMH 3A88A 1F2SE 4IMQA 4WXIA 4AN7A 1GHXH 2R0LA 1ANDA 4ABFA 3S9CA 1GI3A 3VPKA 1O2MA 4GLYA 4B1TA 1RTFB 2ZECA 3ZZ3A 1PPGE 1NTPA 3RMLH 1KIGH 1SGRE 1GMCG 2PSYA 1PPFE 1NRPH 1HAZB 1QURH 1K1LA 1TQ7B 2FIRH 3ZZ8A 2GMTC 2FEQH 2ANKH 2J2UA 2VWNA 4CH8B 1C5TA 2P94A 2W5EA 1O2HA 1G37A 1Z71A 2VVVA 3QX5H 5T6DA 2FO9A 1O31A 4X2XA 1GCDA 1QFKH 3MH6A 2FOMB 1BJVA 1WTGH 8KME2 2Y5HA 2AS9A 1QGFA 4O3TA 4NZQA 2XC0A 4UFGH 2AIPA 1HAXB 1VJAU 3S9AA 2Z9LA 1T32A 1FPHH 3GY4A 1YKTA 3E6PH 3KQBA 1AMHA 1GBEA 1OWHA 3BTHE 4Y8XA 3TU7H 2PKAA 5G4BA 2BD8A 4K8YA 1ESBA 5JB8S 1UVPA 4ASHA 1Y8TA 2F3CE 2W7UA 3TITA 1FN6A 3SW2B 1T8LA 2XTTB 5C1YA 3ZZ9A 1K21H 2J95A 1C9TA 2GDEH 4DG4A 3TJUA 4ABJA 2FDAA 3NKKA 5AFZH 3URCA 3O8RA 2OLGA 4GPGA 4XDEA 3RXUA 2CHAC 1ELGA 1RTLA 4BAQB 1J17T 2RG3A 1GHBF 1BMLA 5EPNA 4SGAE 1GBCA 2GCTC 4MNWA 5GJ4B 1C5PA 1O2SA 2BXTH 2QF3A 1A0HB 1C1VH 1GBKA 1LHCH 3QWCH 1GBHA 4R0IA 2TRMA 1IQNA 1C1QA 1SLWB 1MBMA 3LT3A 1GJCB 4BTTB 4K5ZA 7LPRA 1BTWA 1ZPCA 3UIRA 1IQLA 4NA7A 1XUKA 4DIHH 1SI5H 2G4TA 4TY6A 5EU8A 1ETRH 1ZMLA 1GJDB 5HXFA 3EA9A 3M36A 4MQAA 1K1PA 4WH6A 1MKXH 1MKWH 2V3HH 2OBOA 1LKAA 1TBRH 2J9NA 1GMHF 2BX4A 5JPMH 1P3CA 3A7YA 4LOYH 2A4OA 1HV7A 1S6HA 3UFAA 4I31A 4MTBA 1ANBA 4D9RA 2P3TB 1QRZA 1O32A 5E2OA 2PUQH 4UE7H 1TOMH 4RKJB 3KQCA 1SOZA 3NZIA 1P9SA 1AFQC 3BEFB 3U9AH 3NCLA 1J8AA 4TPIZ 2SGEE 3IWMA 1MCVA 1DXPA 4U30A 1P05A 1LVYA 1OP8A 1BBRK 4NWKA 1WCZA 3HGNA 4O9VA 2IOTA 1ABJH 2NU3E 2WPJS 2P16A 4ZHMU 2VU8E 1L4DA 4MLFB 4JZEH 4X8SH 1RS0A 1YGCH 4Y6DA 1D6RA 2BB4A 4IMZA 3EAJA 1QJ7B 1THRH 1XKBC 4NIYA 1C1UH 1HJAB 1QB9A 1NFWA 2ANMH 1HAVB 2C8ZB 1ORFA 2ZU1A 3P70B 1YLDA 1L4ZA 4X8UH 1HAPH 3SUFA 3E16B 4AB9A 1LTOA 4I8GA 3M5OA 1O5AB 2WPLS 3H7TA 1QRXA 4D7GA 1CSOE 3E1XB 2Q6DA 2R0KA 2ZQ1A 3QZRA 2P93A 3NUMA 3SU6A 2FXRA 3MOCA 4JZFH 4KGAA 2XC4A 2O8UA 1G36A 3M37A 3MWIU 3KIDU 1NZQH 4AX9H 1Y5AT 1XVOA 2F9NA 2GT7A 3RXKA 2QXHA 1ARBA 3SJOA 2R3UA 3A8DA 5F8XA 3AAUA 2Y80A 3OYPA 4A5TS 5ETXA 5F8ZA 3VGCB 5EQSA 1OYQA 1MCTA 2BY6X 1GL0E 4CR9A 3KNXA 3GCHB 1P12E 3SNDA 4IW4E 1ZRBA 2PWXA 2Z9IA 3H7OA 3LOXA 1NM6A 2TGDA 3BF6H 1FY8E 1GHZA 2DE9A 2H1UA 2A2QH 1ESAA 1OS8A 2ZPRA 1C5WB 4ABGA 5C1UA 4A92A 1DX5M 2TBSA 6ESTA 1S6FA 4AFSA 4IC6A 1ANCA 3ZVAA 5ESBA 4U32A 1NRQH 3LIWA 5HYOA 3P8OA 2LNCA 1BTHH 1UVUH 2GCHF 3LGTA 1H4WA 2Y5GA 6LPRA 1CGJE 1C9PA 1OSSA 1QY6A 2PR3A 4FUHA 2ZCKP 1RIWB 1AD8H 3UWJH 4K3JA 4NSYA 1XUFA 5C5OA 3PM3A 1KLTA 2ZDNA 5LGOA 1TX7A 4ZKSU 1EKBB 1HJAC 4Y7AA 1ELBA 1MQ6A 2HOBA 2ZU4A 1UK3A 3C1KA 4H6SB 2VWMA 3VB3A 1SGDE 1XXFA 2CN0H 3NWUA 3KF2A 1O34A 4WXVA 1PQ8A 1C5YB 3GY8A 4AG2A 4FUCA 3UY9A 2OUAA 3MTYA 1K22H 1K1OA 2BHGA 4UFFH 4RN6A 1EZUC 1LHDH 2JETC 3I78A 2ZHFH 5AVDA 5LPRA 6CHAC 1WOFA 2C8WB 3GYLB 3ESTA 1MAYA 4DT7B 1FI8A 3RXTA 1PPHE 1GHAF 2B0FA 2YOLA 4F4OC 2CMYA 1W0ZU 5CHAC 4YTAA 1L2EA 4K1EA 5A0BA 2A45B 3HK6B 4X0WU 3MI4A 2H9HA 4AOQA 3F9FA 2AGEX 1O2ZA 1JWTA 2ZGCA 3T25A 2K1QA 2XBXA 4CBNA 1F5RA 1BHXF 3MNBA 1AO5A 2BY7X 1GG6C 1FZZA 3LU9B 3PMJA 3SU2A 3LPRA 1GDUA 2XWBI 2ZHWH 3A7XA 1OP0A 4MG3A 5E0JA 4I33A 3ATWA 3EGKH 1C1NA 1QB6A 8ESTE 1BUIA 4GCHG 1ZZZA 3S7HB 4VGCB 3CP7A 4NZLA 5SGAE 2Z94A 4F49A 3RXEA 2H2ZA 1QA0A 2A5IA 3PTBA 5IYTA 2YNAA 3D65E 3SNBA 2ZGXH 1ANEA 1A1RA 3EE0B 3PWCA 3H5CB 3ZZDA 2F9OA 2BD3A 3BTTE 4UONA 5A09A 2XW9A 3BEUA 1ETTH 4CREA 1G2LA 3ATMA 1TNLA 4WJG2 1MTSA 3ZVGA 1O3NA 1PYTC 1BT7A 3DFJA 3G01A 4HI3A 4KP0A 4YOJA 3TGKE 1YP9A 3P8NA 4YZUA 2XBWA 3ZV8A 1Q31A 3MH4A 7KMEH 1GGDB 2J34A 2HRVA 1OKXA 1QHRB 2WV5A 2HPPH 5BPEA 2A2XH 3ENSB 3F9GA 4LZ1H 4R8TB 3QZQA 1OYTH 3DUXH 2VIVA 3LJJA 1XX9A 1P2OA 3STIA 1E34B 3V12A 1C2EA 1BTUA 1FNIA 2QCYA 2ZDAH 1EOJA 1YPLH 3OX7U 2FP7B 2OBQA 3O8BA 1NU7B 1O30A 4ESTE 2QY0B 2FPZA 4CRAA 1VCQA 3AVZA 3M7QA 2ZFFH 3BSQA 3IITA 1YYY1 2P95A 4ABAA 1A2CH 2FOFA 2ZO3H 3SV9A 4E05H 2AFQB 1CVWH 5CHAB 1KXFA 5GDSH 1AKSB 3O8CA 1O2GH 1O2NA 2CGAA 2EI7A 4YOGA 1EB1H 1WQVH 1HUTH 1UCYH 2ASUB 1C1RA 2PTCE 1JOUB 3OSYA 1MZAA 1FMGA 1P0SH 3DT0H 3RXMA 1FY4A 5FPSA 3L3TA 4ABDA 3BTME 4CRCA 2F9BH 1GI0A 2O8WA 3M35A 2HNTE 2NU0E 1CGHA 3SU5A 1EB2A 2BTCE 3UNRA 1AU8A 1O5DH 1C5RA 1DS2E 1S81A 2BZAA 2B9LA 1GJ8B 1KY9A 1SR5C 3T2NA 1UCYE 1IQGA 2FZZA 1Q3XA 1O39A 1SFQB 2WYGA 4NA8A 3SJ8A 1KSNA 2PW8H 4WMDA 1FV9A 3I29A 4ABEA 3CS0A 5DPAA 3VEQB 4XE4A 3UREA 3U69H 2CHAB 2BQWB 1GGDC 2ZCHP 2ZZUH 2A5AA 2JH5D 2GKVE 1G3DA 1BIOA 2LPRA 1O5EH 1CA8B 1VR1H 3TGJE 1EZSC 1G3EA 3ATIA 1B0FA 4OS6A 1Y3WA 1PQ7A 1K1IA 2ZI2H 4I7YH 1BRUP 1UJ1A 1DITH 1GJ5H <