1GBLA

Alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gblA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gblA01
3SV7A 4RSPA 3EQ0H 3TJOA 2ESTE 2FM2A 2GD4B 4AB8A 3ZYEA 3VB7A 4ABAA 1V2PT 1TMBH 2WPKS 2FOCA 5ESBA 7LPRA 2A5KA 2ASUB 4YOIA 1A0HB 1KXCA 2G4UA 1JMOH 1BTHH 3PTBA 1MQ5A 2GV6A 4GCHF 4B71A 4DVAU 1AFQB 3BF6H 1O5GH 4DOQA 5DP6A 2Z3EA 2A2QH 3UR9A 1EAWA 4DIIH 2O8UA 4Y8YA 3A7XA 1DVAH 3U8OH 3PLBA 1ELAA 2O8LA 1EZSC 2TGAA 4FUCA 1YPLH 4FXGH 3SGQE 5L2YH 1QJ7B 2BZAA 4XBBA 2F9UA 1B5GH 1GJ9B 1HAIH 1FIZA 4CHAC 3QTOH 4GHTA 2NU0E 1QRZA 3TH2H 2C90B 3UNQA 4PROA 4FUEA 3GY7A 2BQ6B 1UHBA 1W14U 2A4OA 1BHXB 1G30B 1S6FA 3GY4A 1FJSA 1AB9B 5F8TA 1WTHD 1CT2E 3SJKA 1FPCH 1GHXH 3ATLA 1EQ9A 3ZZ7A 2HVXA 5HGGA 2ZGBH 3C1KA 2GDEH 3PV4A 3TH3H 2B9LA 1GVZA 2QCYA 3LU9B 3TK5A 1C4V2 1GHYH 2A4QA 3P92A 1HBTH 2BX4A 3W95A 3W94A 1O2MA 2UUJB 4YLUA 3SZNA 5AHGH 4FUHA 1DWDH 4UEHH 1NU7B 1A7SA 3QGNB 3SU3A 2YNAA 1W2KH 1A1RA 1LHCH 1LVYA 2WPJS 5DPAA 5J4SA 1VITG 3U69H 1BRAA 4MTBA 4D7GA 2OC1A 1TRYA 2PTNA 3PMAB 1OWJA 2BMGB 1GJBB 1TNKA 3LJOA 4SGAE 4ISHH 1O2YA 5K0HA 1AY6H 1TNLA 2ZDNA 2ZGHA 3NZIA 1PQ8A 1TNJA 1O34A 3P8OA 5FX5A 3ZVDA 1DFPA 1O2HA 1HAGE 1CU1A 3PM3A 2RCEA 2FOGA 1K1MA 1W0ZU 3P95A 3O8BA 7GCHG 1K1IA 1HRTH 1WSSH 3MNXA 1S82A 1NPMA 1CHGA 3RUOA 3ODFA 1AVWA 1GBTA 4NA8A 1AZ8A 2J92A 3UNRA 1YBWA 4AN7A 2ZFFH 3M7QA 1SHHB 2GCHG 2ZDLA 2HALA 1NRQH 1EAXA 1O3HA 4ZH8A 1C2MA 3BG4C 1UTNA 1C1RA 1EKBB 1O2GH 2A1DB 1BTZA 2ZNKH 2Y5HA 1DXWA 1UK4A 1Z1IA 1TIOA 3VFEA 1PPCE 1O2PA 2C3SA 2V3OH 3D62A 1TMUH 1DUAA 3F9HA 1O2OA 2JH6D 1SGQE 1C5NH 4RKJB 5F03A 2D1JA 1MKXH 1THPB 4U2WA 7ESTE 1AVXA 4H6TA 5HYOA 1FY8E 1K1PA 2STBE 4WXVA 2Q6GA 1QBVH 1P0SH 1BJUA 1K1OA 5EOKA 3O8RA 3GCTF 7KMEH 1XUFA 2FEQH 4ZHLU 4RKOB 2FP7B 3ATMA 2QF0A 4ZUHA 1C5ZB 1J17T 4SGBE 5C20A 2BY6X 1BTPA 3BTHE 5C5OA 3M3TA 1C5PA 3L33A 1NO9H 1CT0E 3K2UA 3LH1A 4DW2U 2Z94A 2XBYA 2XRCA 4WMDA 2VWMA 2BDCA 1LQDB 2CF8H 2UUKB 2BQWB 1SGFG 3RLYH 3M36A 2BD5A 1D3TB 3OX7U 2Y82A 3EA8A 2HNTF 1SC8U 1JIRA 2BDAA 4MDSA 3B23B 1GMHG 1CQQA 1D3PB 1THSH 3T62A 4Y11E 1XUJA 1O5BB 2H9TH 3SOSA 1C5SA 1ESBA 1YPEH 2GP9B 5L6NH 3TK9A 4MPXA 1GI8B 3V7TA 1YM0A 3ATIA 4LZ1H 1GDUA 3LGVA 2AGEX 1GJ6A 3S7KB 1FNIA 2TBSA 1C5RA 1VR1H 1C5LH 1MKWK 3NCLA 1EZUC 4AX9H 4BXSA 1O3NA 1ABJH 6GCHG 3GCOA 4ZKRU 1AO5A 6CHAB 2ZU4A 1S83A 4ZHMU 2PKSC 1O3IA 1ZMJA 2XNIA 2V3HH 2ZHWH 4K8BA 3M7UA 2P93A 5EG4A 1VJAU 1C4U2 1YCPH 4ISLA 3SV6A 3BTGE 2NU3E 1GI4A 1F5RA 3VB4A 2BLOA 5T3HA 3M61U 1RTKA 2OBQA 3A8CA 4FUBA 4NZQA 4XBCA 3SV2H 1L4ZA 1Y3WA 2R9PA 1BMAA 1GMDG 1TGNA 3A85A 1C1QA 3A89A 2VIPA 3A8AA 1IQFA 1HLTH 2G4TA 1T4UH 2XCFA 1FN6A 1A46H 1PJPA 4BAHB 1C5OH 1MZAA 5C1UA 2XTTB 5EXNA 3LT3A 1AHTH 3G01A 2PKAA 3ZZDA 1KTTB 1NROH 2I6SA 5TCAA 3GOVB 4XSKU 4OS4A 8GCHF 1KXFA 3K6YA 1TOCB 3MU5A 3UY9A 3UWIA 4J2YB 1TB6H 1ZRBA 4TWYA 2VWOA 3Q77A 3HGPA 4B2CA 1TBZH 2ZCHP 1CGIE 4A7IB 1AFEH 2OP9A 1F5LA 1LQEA 1TAWA 2GZ7A 1L1JA 4B1TA 5GPIB 3SHAH 1UTJA 1T4VH 3P8FA 1DUEA 2UUYA 2VIWA 4D7FA 2EI6A 2D2DA 1GJDB 5DP9A 2VJ1A 4NIYA 1OOKB 2P94A 1QB1A 3K65B 1RXPA 2ZGCA 2F3CE 3QX5H 3B9FH 1O2QA 1GI9B 1C1SA 1TGCA 4FVBA 4BTTB 1QL9A 4FU8A 3MU4A 3T25A 2G8TA 3AASA 4AB9A 1O5CB 3SORA 1LVBA 1LVOA 1ZPBA 4AFUA 1ZHRA 1EAIA 1T31A 2IPHA 4OS1A 1PPHE 2H9HA 3TJVA 2VWLA 3P6ZB 1P09A 1VCQA 4WVPE 1P01A 2BYAX 2C8ZB 4R8TB 1N6YA 1O2NA 2PWXA 2HNTE 3R3GB 4TY7A 5DP4A 1P3EA 3BIVH 3TVJB 3DFLA 1LHGH 3MTYA 1EASA 1HAYB 2ANWA 2VH0A 1ABIH 5EW1H 1S84A 4YLQH 3LJJA 2ODQA 4IW4E 1GHWH 5A0AE 2VINA 4ZKSU 1HDTH 3SU1A 2DUCA 4CRAA 5BPEA 2C93B 2Z9KA 1GHAG 4FU7A 3CS7A 4AGJA 1SR5C 1CT4E 3KIDU 4WH8A 1BTUA 2PSYA 4MPWA 1J8AA 3DFJA 1L2EA 2XC5A 4NFEA 1O3JA 1GHBG 5E2PA 2ZWLH 2BXTH 2BY7X 1UMAH 3EGKH 2F9NA 4XFQA 1MCVA 5JDUB 3CENA 4AOQA 3S9BA 1BT7A 1CBWC 3OTJE 6LPRA 1S6HA 1GBLA 1KY9A 1SGYE 2BB4A 2IJOB 1O38A 1TALA 1ZTLA 2ZC9H 2QIQA 2QXGA 3OY5U 3F6UH 1VCWA 4DGJA 4K1TA 2A7JA 3ZZBA 2W3IA 1DOJA 2FESH 3OYPA 3UFAA 3U98H 2BLVA 1C2DA 4NIVA 1VITF 1FY5A 1O37A 1IQIA 2OC8A 1SGPE 3RMLH 5A0CA 1C9TA 1B0FA 2FS8A 2RA3A 3ZZ3A 1YCPM 1HPGA 1EUFA 2HRVA 4MQAA 1NFWA 1BOQA 3KHVA 3BG8A 1GBMA 2ZTXA 1SLWB 1XKAC 1AGJA 5C67A 4ABEA 4GLYA 4FU9A 2PLXA 5DG6A 3MI4A 5SGAE 1UTPA 1SQAA 5HM2A 1BTYA 2NU1E 2Q6FA 2A45B 1S5SA 1DY8A 1GBIA 1ORFA 2ZFTA 3LPRA 3RU4T 2VB0A 4Y76A 3SBKA 7GCHF 1S0RA 3E0PB 2WYJA 3LOXA 4X1NU 4O9VA 2A7HA 3A88A 1GG6B 4O97A 1LTOA 2ANKH 3KF2A 2G51A 2GCHF 1SGDE 1HXFH 3SI4H 1AD8H 1T8LA 4LK4A 2ALVA 3ZZAA 2A2XH 3ZVFA 4INHA 1MTVA 1T8MA 1EPTA 3E6PH 2P8OC 2UWPA 2ZA5A 3PO1C 4JK6A 3GY3A 1MKXK 2K1QA 2ZU1A 1XVOA 2WV4A 4K1SA 3MO6A 1FLEE 2P8OB 1IHTH 3JZ1B 3PO1B 4DCDA 4Q80A 1J16A 1NM6A 1EZQA 3PLPA 1DWEH 4F49A 4Q7YA 3SQEE 1DY9A 4UFGH 1NESE 2CJIA 2G5VA 3DD2H 5E0GA 1MTSA 1IQNA 2PV9B 3E3TA 3RXMA 4DT7B 4HZHA 1AI8H 5GXPA 1Y3XA 1P2OA 2BOKA 2ZFSA 1GBDA 1YPHE 3BEUA 1G3BA 1BIOA 9ESTA 1QHRB 3SU0A 1M9UA 1OWHA 2F83A 1AWHB 1OS8A 1UTMA 4B2AA 2JKHA 1UCYE 4B2BA 1RRKA 1DANH 3IWMA 3RC6A 1ZSJA 5EXMA 1EJMA 2ZPSA 4ABGA 1SG8B 1V2QT 1V2ST 5F6MA 2ILNA 5AFYH 4X2XA 1O3EA 2EC9H 5LPRA 5HXFA 1V2LT 5FPTA 1GJ5H 1P2JA 2QXIA 4JYTA 1QQ4A 2BD4A 1BCUH 4E06H 1FXYA 1WYKA 1Y8TA 3M5LA 1C5VA 2OBOA 3EDXB 1DLKB 3QGJA 1GMHF 1H9HE 1FY4A 1V6DA 2J34A 1MQ6A 4XOJA 1CO7E 2ZHFH 4NA7A 3RXRA 3QUMP 1OP2A 4HGCA 1JIMA 3TLOA 4VGCC 1IQLA 2SNWA 1P9UA 3UIRA 1TGBA 1F0UA 5EPNA 4NA9H 4I8JA 1HJ8A 1PPZA 1T8OA 2UUFB 3PWBA 2ZF0H 3NUMA 4VGCB 4ISNA 1BITA 1O3FA 5EODA 6GCHF 1KLJH 1YCPK 1CA0B 2B5TB 1HIAA 4BXWA 1AE5A 4X6OA 3VXFH 1L0ZA 1O3KA 3TNSA 3LONA 1BZXE 5IYTA 2J2UA 1AFQC 1XUIA 1PPFE 1ZGIA 4OGXA 3UR6A 1S0QA 1Z8GA 4KGAA 4BANB 1ELTA 3MH7A 4A92A 4YO9A 1EP5A 2R0LA 2NU2E 5GWZA 1H9IE 3A7YA 3VB6A 2OCVB 2ALPA 2XBXA 2OC7A 1YPMH 2ZIQH 3PMHB 1GMDF 1GJCB 4X8SH 4ABHA 4KP0A 3RXSA 3AVZA 1ESAA 4FUDA 4NG9H 3RXIA 3FP8E 1XKBC 2I6QA 1JWTA 3KL6A 1S81A 2CMYA 5BRRE 1HAVB 1MBMA 1OP0A 1DM4B 1BHXF 2CF9H 2CHAC 1VGCC 2ZHQH 1AB9C 4MG3A 2WPHS 3BSQA 2YOLA 1KDQB 3E0NB 2CHAB 1VGCB 2GDDA 1OWKA 2V6NA 4BAOB 1A0LA 2O8WA 4MNYA 5DK1A 1VJ9U 4LZ4B 3TJNA 4Y8ZA 2BDGA 5AFZH 4R0IA 1UTQA 1AKSB 4Y0ZE 3SUDA 3LKWA 3T26A 1C2GA 3SHCH 4WH6A 3RP2A 2AH4X 1QNJA 1QB9A 2TGTA 4JZDH 1UVUH 5EXLA 2FPZA 1ELBA 1A5GH 4UFDH 1FMGA 5IDKA 2Z6BD 1GVLA 3QO6A 2ZPRA 2VH6A 2V0BA 4UFFH 2J4IA 3SV9A 2R3UA 1THRH 5J4QA 5FX6A 2GV7A 4ZAEA 1W11U 1BDAA 2ZU2A 4KELA 3BN9A 1O5DH 1BUIA 1MU6B 2AGIX 1NRRH 5FBEA 1BA8B 1NTPA 2Z7FE 4Q7XA 3S69A 3TU7H 4GSOA 2PTCE 1ANBA 5JBAS 3QN7A 2OLGA 1QL7A 1LHFH 1TBRH 2ODYB 4KTCA 2OXSA 2Q6DA 3BTDE 1BTWA 1GDNA 1F0RA 1ZZZA 2SGPE 1SSXA 3EA7A 1L1GA 1QURH 4INLA 1DPOA 2P59A 1AWFH 1HNEE 5C1XA 1GWAA 1QTFA 1V2TT 4LOYH 1C2IA 1ZSLA 3ZZ5A 2OTVA 8ESTE 3M35A 1J14A 3TGIE 4TWWA 4ABJA 1GBKA 1ZJDA 1WTGH 1SPJA 1UK3A 2C4FH 2H5DA 3L3TA 5GJ4B 5LPEA 1QRWA 4HTCH 1O3LA 4Q7ZA 4AGKA 1GHAF 4A5TS 4KTSA 1O3GA 2Y7ZA 1P11E 1OYTH 4ISIH 4CBOA 2FYRA 1O3PB 5FCKA 4BTIB 2EI7A 1E36B 1GHBF 5A09A 1ELFA 2QXJA 2P95A 2JH0D 5TCCA 5ESTE 1VCPA 5GDSH 3P70B 1LCYA 1O5EH 5DP8A 2ZDKA 2FX6A 2A0QB 2GX4A 2W5EA 2J38A 1KTSB 2BY9X 2EEKA 1Z6EA 2QAAA 4X8VH 2GKVE 3A7TA 1K2I1 4ZXXH 4NIWA 2PGQB 4OGYA 3SUFA 1DDJA 4JYUH 2A31A 1CHOG 1GL1A 3GDUA 1EOLA 4Y7AA 1KLTA 1FDPA 1UO6A 1LPKB 1EAUA 1SGEE 2FODA 2O8MA 2QN5T 1GCDA 2FO9A 1J9CH 4WMFA 2VGCB 2FOFA 4WXIA 1JRTA 5EQSA 3U1JB 2R3YA 2CV3A 5PTPA 1D3QB 1K1NA 1P10A 1WQVH 2FLBH 1O36A 1C5TA 1QA0A 5JB9S 2LPRA 2ZDVH 5CE1A 4UONA 1F2SE 2G55A 1NT1A 1A5IA 1HJAC 3HGNA 4ABDA 1G9IE 4IGDA 1P03A 2TIOA 2W26A 1ZTKA 3ZZ9A 1YP9A 1G37A 3LGTA 2B7DH 1HAOH 4XBDA 1HJAB 1SHYA 1Q31A 2ZGXH 2ZECA 3MFJA 5A8XA 1PYTC 3K9XB 1N8OB 1LMWB 1C2KA 1FN8A 3QLPH 2OQUA 5EQQA 4X2YA 5C1YA 5L2ZH 1C2EA 3VXEH 1TLDA 1GJ8B 5FBIA 2VVUA 2VVVA 1P06A 2GMTB 4FUGA 3TPIZ 5AVDA 6CHAC 2O9QA 4O03A 2FTMA 3RC5A 3SN8A 3MHWU 5A2MH 1E35B 3LC3A 1FQ3A 4NSVA 1ELDE 2ZFPH 3SQHE 4GHQA 1OWEA 3HK6B 3U8TH 1O2WA 4X0WU 4DJZB 1G2MA 4DIHH 1SI5H 1A5HA 1K21H 2GT7A 4YTAA 1EJAA 1UTKA 1ZSKA 3RXGA 4Y10E 1O32A 1G3DA 1A3BH 1Y5AT 2YNBA 2ZQ2A 3RM2H 3UWJH 1Y5BT 1W3CA 3FAOA 3O8CA 4NCYA 2DE9A 1BBRH 4XE4A 2HOBA 1VZQH 3E8LA 2J9NA 4K3JA 3M5MA 3FZZA 5K7RA 1ELEE 3EA9A 5E0JA 4MNXA 1NFYA 1GI7B 1S85A 1FIWA 1GCTB 1D6RA 2AERH 1CGJE 1P2IA 4FUJA 3RXUA 1YGCH 8LPRA 1P02A 4TPIZ 2A32A 1TX8A 3URDA 4UD9H 1C5XB 4WWYA 5LH8A 3M7TA 3DUXH 1T8NA 2TGDA 3RMMH 1O2JA 2R0KA 1K1JA 1KXBA 3GDVA 1RS0A 2AS9A 2BVXH 1UVSH 1P2KA 1XVMA 3N7OA 2XWAA 1IQKA 1D6WA 4JZ1A 4AG1A 3CP7A 2NWNA 2ODPA 1XUKA 2BZ6H 1UCYH 1ELVA 1K22H 1TX7A 1GPZA 1TNIA 3SW2B 1Z8IB 3LGIA 4NZLA 4JZIA 1TPOA 1D4PB 1Q2WA 1W8BH 2QV1A 2A5IA 2NU4E 4MLFB 1ANEA 1ZOMA 1FV9A 2ZHEH 2B8OH 1SGTA 1ACBE 1V2JT 4OS7A 2M5TA 4U32A 5F8XA 3ZYDA 5G4BA 1GBHA 1C1NA 4CRCA 2BDIA 1WOFA 1GBFA 3A82A 3PTNA 1HB0B 3RXHA 4ABIA 1HGTH 2ZKSA 4AZ2B 3QZQA 3RXQA 2C8XB 3SNDA 4Z0KA 1BTXA 1PYTD 4GAWA 3ZZ8A 4UE7H 1TOMH 2G81E 3OY6U 3ZVGA 2ZDMA 1ARCA 2GZ9A 2WV5A 4AFQA 1GBAA 4X6NA 3VPKA 1BMLA 1C9PA 1VITH 2XCNA 1NZQH 1O35A 3S9CA 4KTUA 1SGNE 3QWCH 1ANCA 2PUQH 1F0TA 1O2LA 2PKAB 1MD7A 4D8NA 1IQEA 2FI5E 4JZEH 2Y5GA 4QT8C 1LKAA 1W12U 2J94A 3STIA 3ZVCA 3HKJB 4H42U 1SQOA 5TJXA 1BRBE 4FUFA 1GBCA 3K6ZA 3ZV8A 1C5MD 4X2WA 2FWWA 2A4GA 2VIQA 5A0BA 1IHSH 5DKMA 1A4WH 4X1RU 1TA6A 4CRBA 2J95A 1GI0A 1KLIH 3M5OA 1T32A 1O2ZA 1QR3E 1MTWA 1SGIB 2WUBA 1INCA 3V12A 3S0NA 3AW0A 4ABBA 4E7NA 1TPAE 4F4OC 3I78A 4WF8A 2BDHA 3A84A 5T6DA 1C5QA 1G3EA 3HATH 3LGUA 1SGRE 3SU6A 1P8VC 1TQ0B 5EGMA 1SGCA 3KNXA 4MPVA 1AZZA 1L4DA 4YT6H 3UOUA 2GVFA 3MH6A 4IMQA 2PUXB 3ELAH 4ABFA 1ZR0A 4JK5A 4A1VA 4I32A 4U01A 1ETSH 1GI1A 1V2UT 2B0FA 4I7YH 2FI3E 2GT8A 2SNVA 2FS9A 3BTQE 2GCTB 1HAHH 2ZFRH 4BNRA 4J1YA 1O39A 1GG6C 1H8DH 3MO9A 2THFB 1O3OA 3T28A 3U1IB 1WBGB 3KQCA 3PB1E 1PQ5A 4IN1A 2ZO3H 4B73A 5EW2H 1EATA 2VVCA 2FDAA 1H1BA 1QBOA 3KQBA 1QIXB 2Q1JA 4NGAH 1ZMLA 3HPTB 5LGOA 3ZZ4A 2SGQE 1BBRE 4TPYA 1SGFA 1KXDA 1O0DH 3ZV9A 4I33A 2P3UB 1DLEA 1O2IA 2JETC 2BTCE 3F9GA 1C2LA 3T27A 4NFFA 4AFSA 3TGJE 1FY1A 4CBNA 2TPIZ 1SL3A 2JETB 1GHVH 2IN2A 5DP3A 3PMBB 2FZZA 1C5UA 4MVNA 3RU4D 5JBTA 2VIVA 1FZZA 4Y0YE 1SLXB 2ZCLP 2EA3A 4ISOA 4AG2A 1C2JA 1OSSA 2G00A 2AFQB 1G36A 1O3CA 1YPKH 1ZHMA 1CHOF 2Z9JA 3BIUH 4AORA 1N6XA 1Z71A 2W7SA 1O3AA 2H1UA 3ZVEA 3D65E 2Y6TA 1C1WH 1MKWH 3M5NA 4BAKB 4H6SB 1GI5A 2KAIB 3ATKA 2PR3A 1OWIA 2ULLA 3SJIA 3GYMA 1OPHB 1OX1A 2WPLS 3H7OA 1RTFB 1W13U 3RXFA 2OUAA 1DT2A 1ELGA 1QRXA 4U30A 3MMGA 4XDEA 4I8GA 5CMXH 3H7TA 1EXFA 4A1XA 1V2RT 1NRPH 3F9EA 1HFDA 3RXCA 1WAYB 4IC6A 1TBQH 2H9EH 2ANYA 3HKIB 4YT7H 2FOBA 3A7ZA 3WY8A 5F8ZA 4O3UA 4ZXYH 1DX5M 2CXVA 1B7XB 3SJ8A 1TGTA 2IOTA 3GYLB 2C8WB 1O3MA 2Z9GA 4Y8XA 2Z3CA 3U9AH 1HAVA 3MNSA 1AIXH 3RXTA 1GJ7B 5E8EH 5FPYA 1ZPZA 4CR9A 4CREA 1ZPCA 1UVPA 2AMQA 2AEIH 3GICB 1OKXA 2ZZUH 3Q76A 4K2YA 1CA0C 4Q2KA 1IQMA 1OP8A 1P04A 1AKSA 1EP6A 3SO3A 3PMJA 2F9BH 2ZDAH 3UOPA 1SMFE 2VIDA 4MNWA 2CGAA 2Z9LA 4K1EA 3VGCC 5LPFA 1MZDA 3KN2A 3L6PA 3R0FA 1EX3A 2FIRH 1KXAA 1AQ7A 1BB0B 3VGCB 1WU1A 4YM9A 1MMJN 5ETXA 1ZRKA 1NC6A 1GI3A 2BM2A 2SGAA 1LKBA 2ANMH 1ZHPA 2H2ZA 4I8LA 1EZXC 3RLWH 1O33A 4JZFH 4O3TA 3F1SB 1MAXA 4INKA 3UUZA 1CGHA 1P2QA 2DE8A 2QGRA 1QA7A 1QY6A 4MPUA 1GMCF 1P3CA 1GJAB 2PFEA 4KKDA 3MOCA 1GGDC 5EU8A 1TNHA 2ZGJA 3PROA 1TYNA 2UWLA 2FYQA 5GIBA 1UCYK 3QK1A 4ZMAH 1GGDB 4ZHAA 1DITH 3SNAA 3RXLA 1E37B 1P57B 3IITA 1XM1A 1GBJA 1RJXB 1XXFA 3Q3XA 4CHAB 1MCTA 5E2OA 5C2ZA 2W3KA 1Y59T 4X1SU 1K1LA 3ATWA 4B76A 4X6MA 3GCNA 1QJ1B 1RD3B 1YLDA 3BEFB 4DG4A 2ZU3A 5HMAA 2F9OA 1HIAB 2HGTH 3RXAA 1NFXA 2WUCA 2PW8H 4OS2A 3KQEA 1PQ7A 3E91A 2UWOA 3E90B 2PGBB 3P8NA 3AAVA 2BDYA 1F7ZA 1V2VT 4DY7B 2P16A 1XX9A 3SUGA 3RXVA 3KQDA 3PLKA 1AUTC 5T6FA 1P2MA 2A5AA 3MU0A 4IC5A 3TH4H 3AW1A 1G3CA 1GHZA 3SV8A 3FP6E 3SU5A 1DS2E 5EQRA 1AN1E 2AMPA 1FI8A 4FVDA 4ZKOU 1MTNC 1SFQB 2ZFQH 4B75A 1QL8A 1MBQA 1TPSA 1ZLRA 2QYIA 3Q3KA 1MD8A 2W7UA 5GCHG 1GVKB 2FOHA 3A86A 4RN6A 2SGDE 1MTNB 1HV7A 1UHBB 1TE0A 5JPMH 1TA2A 3DT0H 2F9VA 5ABWA 3EAJA 3SU2A 3LGWA 2BOHB 1O2KA 4I31A 4K8YA 5T6GA 4CH2B 4Z6AH 9LPRA 3RXJA 1TMTH 4X8UH 1QB6A 2HPQH 1RTLA 1T7CA 3RMNH 3SI3H 3BEIB 1V2WT 4D76A 3MO3A 2P3TB 3I29A 1QFKH 2XC4A 3RXDA 1YYY1 1C1VH 1N1LA 4Y7BA 4BTUB 1BQYA 4IMZA 1KIGH 2H5CA 3GY8A 1IQGA 3T29A 5C3NA 1O3DA 3UTUH 1ID5H 3RDZA 3BG4B 3RC4A 3Q3YA 1O2XA 1DWBH 1HAXB 2BLWA 2FLRH 1E34B 1AU8A 1ANDA 1UVOA 1YC0A 2SGEE 4ZKNU 2VGCC 1C4Y2 3M3VA 1QBNA 1BMMH 1LHEH 4JCNA 5FXLA 1PPGE 5JBBS 4D9QA 2VU8E 1W10U 3JZ2B 4K5ZA 1DWCH 2H6MA 1C5YB 5JYIA 2QA9E 4YZUA 2ZCKP 1O2SA 3M37A 3NXPA 1XUGA 4AYVB 3GY5A 1Y3VA 4GUXA 2BVSH 3PYHA 1IQJA 1SLVB 3ZVBA 2F91A 3V3MA 1SOTA 5AF9H 3FFGA 3A8BA 1N8OC 1LDTT 2Y80A 1ESTA 1XUHA 1CA8B 1A3EH 4K60A 2GZ8A 1QQUA 1SB1H 3F9FA 3VB5A 4K69A 3UREA 2GGVB 1E38B 1XXDA 3TK6A 1TONA 3UQOA 3TJUA 1WCZA 2BD8A 2R2WU 1W7GH 2GMTC 4AFZA 3VB3A 1WQSA 4DURA 2OC0A 2ZPQA 3KGPA 2XWBI 4BOHA 2HNTC 3GY6A 2A4RA 2RG3A 3SJ9A 2BD3A 1ZMNA 3MNBA 3PWCA 4WJG2 2AIQA 3MWIU 1BRCE 2FOMB 1NN6A 1KSNA 4BAQB 2WPMS 4X1PU 1DICA 3D23A 1JBUH 2ZTYA 4ZROA 1CVWH 3S9AA 4YOJA 3D49H 2D26C 2XBWA 5DP5A 2BXUH 3KEEA 1NFUA 1O2RA 3ZZCA 3A7VA 1B0EA 2Y5FA 3A7WA 1JOUB 2BHGA 3BTTE 3GDSA 3A83A 1FONA 1UK2A 3SNCA 2XC0A 3MH4A 4IBLH 1C1OA 4JYVH 1GBBA 3ITIA 1NRSH 3P17H 1EB2A 3BTWE 3LH3A 5DO4H 5EPYA 3A87A 3CS0A 1GI6A 1GCTC 1O3BA 2WINI 1PPEE 2ZHDA 4A6LA 3OSYA 1PQAA 1F0SA 2BDBA 1H9LB 2BLQA 2PKSB 1O30A 1QCPA 3RXKA 4E05H 3BTME 4HI3A 2BY5X 1MAYA 3V13A 2O8TA 3QZRA 3P8GA 4GCHG 3DHKH 1O2VA 4AYYB 1GDQA 1UTOA 3LC5A 1RFNA 1LPGB 1MH0A 3FVFB 1GMCG 1OXGA 4Y79A 1UVTH 1HAPH 3NK8A 2C8YB 4YOGA 1BMNH 1OWDA 2LNCA 3MNCA 1Y3YA 1G2LA 2HLCA 4X2VA 4A1TA 3QDZB 1TNGA 1DSUA 1K9OE 2TGPZ 3NKKA 1UTLM 3VEQB 1V3XA 1F5KU 4TYDA 2FX4A 4CH8B 3TITA 3SGBE 3TGKE 3NWUA 1TQ7B 2P3FH 5HM9A 5H4IB 1EB1H 1ZJKA 1O2UA 3RXPA 4X1QU 2BX3A 1P9SA 1H4WA 5JBCS 2BD2A 2SGFE 4THNH 2FOEA 3M3SA 3BTKE 1HCGA 1KXEA 3ZZ6A 1LO6A 2VIOA 2XBVA 2VWNA 3NPSA 1SBWA 1SQTA 4B74A 2XXLA 3ENSB 3FZDA 1P2NA 3UPEA 3C27B 5FAHA 1G32B 1HXEH 1MTUA 1D9IA 5L30H 1XMNB 1TGSZ 2AGGX 4GPGA 4IN2A 5DP7A 1QJ6B 3RXOA 3DA9B 1DSTA 3LIWA 2ZP0H 3UQVA 1L1NA 2ZTZA 2BVRH 1IAUA 2JH5D 1V2MT 1TX6A 1FPHH 4ESTE 1RGQA 3A80A 3GY2A 2TRMA 3H5CB 3IG6B 3V0XA 2ZI2H 3RM0H 4E7RG 2G52A 5B6OA 1H8IH 4HFPB 2Z3DA 1C2FA 1W0YH 3EE0B 4LXBH 1FAKH 5A8ZA 2RA0A 2ZG0H 5CHAC 4GVUA 2BQ7B 1YPHC 5FHTA 2VNTA 4X8TH 5CHAB 1YKTA 3GISB 1AUJA 3EYDA 4NWKA 1UJ1A 4UFEH 5C5NA 1YPJH 3I77A 3S7HB 1P12E 1PPBH 3O8DA 1FY3A 3RXBA 2F9PA 2XW9A 3RMOH 3GCHC 4CR5A 5A8YA 1EOJA 5FPSA 4CRFA 1Q3XA 4JMYA 1HYLA 1EJNA 2A7CA 2AYWA 1ARBA 1C1PA 3LDXH 3GCHB 1C5WB 3UNSA 1Y5UT 2XYAA 3MH5A 1V2OT 1TRNA 2Y7XA 4ASHA 4CRGA 2ZU5A 1O31A 4H4FA 1OYQA 4CRDA 1YLCA 2WYGA 1V2NT 1W7XH 3MYWA 1YF4A 1ZYOA 1CBWB 3GCTG 1A0JA 1NY22 5I25A 3MU8A 1KYNA 1Z8JB 1GJ4H 3A8DA 1ETRH 2FTLE 2GCTC 4OS5A 1AE8H 1DE7H 4FUIA 5FCRA 1K28D 1ZGVA 3BTFE 4Y71A 3ESTA 1MUEB 4YESB 1ELCA 2OD3B 2AMDA 4M7GA 3STJA 2KAIA 3LGYA 3ODDA 1F92A 2Y81A 5GCHF 5E0HA 1SOZA 5JB8S 2STAE 3T5FH 1C2HA 4MNVA 4NSYA 1CSOE 1CE5A 1SFIA 4BAMB 1Y3UA 2HWLB 1FAXA 1LHDH 3ZVAA 1NU9A 1HAZB 3FANA 1JXPA 2FI4E 2QC2A 1TWXB 2ZEBA 3E16B 1FUJA 1NRNH 1U6QA 1ZTJA 2FOAA 4I8HA 3Q00A 2PSXA 2OQ5A 4NIXA 4WMEA 2BD7A 8KME2 2GTBA 4X6PA 1DXPA 3TNTA 3AAUA 1QGFA 3BTEE 3KCGH 3OU0A 1X7AC 3TIUA 3RU4E 3MU1A 4OS6A 3T2NA 2G5NA 1LVMA 3QTVH 3SNEA 1SLUB 2CN0H 3SNBA 1C1TA 4TY6A 2HPPH 2EI8A 3BV9B 1Z1JA 1PFXC 1WV7H 3FP7E 1Z6JH 1JRSA 1MU8B 3RXEA 1O5FH 1GL0E 1SVPA 1P05A 3SJOA 2RDLA 1O5AB 1IOEA 1D3DB 2BY8X 3URCA 4D9RA 1TPPA 1Z7KA 2WPIS 3SUEA 1O2TA 1GI2A 1J15A 3A81A 1EPTC 3HK3B 2AIPA 2FXRA 4I8KA 3E1XB 2SFAA 1BRUP 3B8JA 6ESTA 1EPTB 1TFXA 1HJ9A 2OINA 8GCHG 2ZQ1A 1AMHA 1C1MA 2FMJA 5DGJA 1KDQA 3SU4A 1YPGH 3F68H 2QY0B 2PHBA 1BJVA 2QXHA 1IQHA 2QF3A 4NWLA 1WUNH 1AVGH 1C1UH 1GBEA 1E0FD 4UDWH 1HUTH 3U8RH 1RIWC 2Z9IA 4WY3A 1ETTH 1LPZB 1A61H 1TRMA 2BD9A 1A2CH 5I46H 4Y6DA 1TABE 1BBRK 1V2KT 5DJ7A 1RIWB 2D8WA 3SGAE 4IS5A 1NS3A 2R2MB 1Z8RA 2V35A
chains in the Genus database with same CATH superfamily
3SV7A 4RSPA 3EQ0H 3TJOA 1H8ED 2ESTE 2FM2A 2GD4B 4AB8A 3ZYEA 2WPDD 3VB7A 4ABAA 1V2PT 1TMBH 2WPKS 3PRBA 2FOCA 5ESBA 3F0OA 7LPRA 2A5KA 2ASUB 4YOIA 1A0HB 1KXCA 2G4UA 1JMOH 1BTHH 3PTBA 1MQ5A 2GV6A 4GCHF 2WHXA 4B71A 4DVAU 1AFQB 1WDIA 3CNRA 3BF6H 1O5GH 4DOQA 2WSSD 5DP6A 2Z3EA 2A2QH 3UR9A 1EAWA 4DIIH 1SKYE 2O8UA 4Y8YA 3A7XA 1DVAH 3U8OH 3ZIAD 3PLBA 1ELAA 2O8LA 1EZSC 2TGAA 4FUCA 1YPLH 4FXGH 3SGQE 5L2YH 1QJ7B 2BZAA 3FO8D 3EE7A 4XBBA 2F9UA 1B5GH 1GJ9B 1HAIH 1FIZA 4DT4A 4CHAC 3QTOH 4GHTA 2NU0E 4RT1A 1QRZA 3TH2H 2C90B 3UNQA 4PROA 4FUEA 3GY7A 2BQ6B 1UHBA 1W14U 2A4OA 1BHXB 1MABB 1G30B 1S6FA 3GY4A 1FJSA 1AB9B 5F8TA 5C0TA 1WTHD 1CT2E 3SJKA 1FPCH 1GHXH 3ATLA 1EQ9A 3ZZ7A 2HVXA 5HGGA 2ZGBH 3C1KA 2GDEH 3PV4A 3TH3H 2KCPA 2B9LA 1GVZA 2QCYA 3LU9B 3TK5A 1C4V2 1GHYH 2A4QA 3P92A 1HBTH 2BX4A 3W95A 3W94A 1O2MA 2UUJB 2KZ4A 4YLUA 3SZNA 5C17A 5AHGH 4FUHA 1DWDH 4UEHH 1NU7B 1A7SA 3QGNB 3SU3A 2YNAA 1W2KH 1A1RA 1LHCH 1LVYA 1W0JD 2WPJS 5DPAA 5J4SA 1VITG 3U69H 1BRAA 4MTBA 4D7GA 2OC1A 1TRYA 2F4LA 2PTNA 1OWJA 2BMGB 1GJBB 3PMAB 1TNKA 3LJOA 4SGAE 4ISHH 1O2YA 5K0HA 1AY6H 1TNLA 2ZDNA 2ZGHA 3NZIA 1PQ8A 2K8IA 1TNJA 1O34A 3P8OA 5FX5A 3ZVDA 1DFPA 1O2HA 1HAGE 1CU1A 3PM3A 2RCEA 2FOGA 1K1MA 1W0ZU 3P95A 3O8BA 7GCHG 1K1IA 1HRTH 1WSSH 3MNXA 1S82A 2J5UA 1COWD 1NPMA 1CHGA 3RUOA 3ODFA 1AVWA 1GBTA 4NA8A 1AZ8A 2J92A 3UNRA 1YBWA 2KR7A 4AN7A 2ZFFH 3M7QA 1SHHB 2GCHG 2ZDLA 2HALA 1NRQH 1EAXA 1O3HA 4ZH8A 1C2MA 3BG4C 5FL7D 1UTNA 1C1RA 1EKBB 1O2GH 2A1DB 4TT3D 1BTZA 2ZNKH 2Y5HA 1DXWA 1UK4A 1Z1IA 1TIOA 3VFEA 1PPCE 1O2PA 2C3SA 2V3OH 3D62A 1TMUH 1DUAA 3F9HA 1O2OA 2JH6D 1SGQE 2W6JD 1C5NH 4RKJB 5F03A 2D1JA 1MKXH 1THPB 4U2WA 7ESTE 1AVXA 4H6TA 5HYOA 1FY8E 1K1PA 2STBE 4WXVA 2Q6GA 1QBVH 1P0SH 1BJUA 1K1OA 5EOKA 3O8RA 3GCTF 2XOKD 7KMEH 1XUFA 2FEQH 4ZHLU 4RKOB 2FP7B 2L6OA 3ATMA 2QF0A 4ZUHA 1C5ZB 1NBMD 1J17T 4SGBE 5C20A 2BY6X 2IPQX 1BTPA 3BTHE 5C5OA 3M3TA 1C5PA 3L33A 1NO9H 1CT0E 3K2UA 3LH1A 4DW2U 2Z94A 1VKYA 2XBYA 2XRCA 4WMDA 2VWMA 2BDCA 1LQDB 2CF8H 2UUKB 2BQWB 1SGFG 3RLYH 5C94A 3M36A 2BD5A 1D3TB 3OX7U 2Y82A 3EA8A 5GNDA 2HNTF 1SC8U 1JIRA 2BDAA 4MDSA 3B23B 1GMHG 1CQQA 5EJLA 1D3PB 1THSH 3T62A 4Y11E 1XUJA 1O5BB 2H9TH 3SOSA 1C5SA 1ESBA 1YPEH 2GP9B 5L6NH 3TK9A 4MPXA 1GI8B 3V7TA 1YM0A 3ATIA 4LZ1H 1GDUA 3LGVA 2AGEX 1GJ6A 3S7KB 1FNIA 2TBSA 1C5RA 1VR1H 1C5LH 1MKWK 3NCLA 4ASUD 1EZUC 4AX9H 4BXSA 1O3NA 1ABJH 6GCHG 3GCOA 4ZKRU 1AO5A 6CHAB 2ZU4A 1S83A 4ZHMU 2PKSC 1O3IA 1ZMJA 2XNIA 2V3HH 2ZHWH 4K8BA 3M7UA 2P93A 5EG4A 1VJAU 1C4U2 1YCPH 4ISLA 3SV6A 3BTGE 2NU3E 1GI4A 1F5RA 3VB4A 2BLOA 5T3HA 3M61U 1RTKA 3N7DA 2OBQA 3A8CA 4FUBA 3F3BA 4NZQA 4XBCA 3SV2H 1L4ZA 1Y3WA 2R9PA 1BMAA 1GMDG 1TGNA 3MQKC 3A85A 1C1QA 3A89A 2VIPA 3A8AA 3FKSD 1IQFA 1HLTH 2G4TA 1T4UH 2XCFA 1FN6A 1A46H 1PJPA 4BAHB 1C5OH 1MZAA 5C1UA 2XTTB 5EXNA 3LT3A 1AHTH 3G01A 2PKAA 3ZZDA 1KTTB 1H8HD 1NROH 2I6SA 5TCAA 3GOVB 4XSKU 4OS4A 8GCHF 1KXFA 3K6YA 1TOCB 3MU5A 3UY9A 3UWIA 4J2YB 1TB6H 1ZRBA 4TWYA 2VWOA 3Q77A 3HGPA 4B2CA 1TBZH 2ZCHP 1CGIE 4A7IB 1AFEH 2OP9A 1F5LA 1LQEA 1TAWA 2GZ7A 1L1JA 4B1TA 5GPIB 3SHAH 1UTJA 1T4VH 2JJ1D 1DUEA 3P8FA 2UUYA 2VIWA 4D7FA 2EI6A 2D2DA 1GJDB 5DP9A 2VJ1A 4NIYA 1OOKB 2P94A 1QB1A 3K65B 1RXPA 2ZGCA 2F3CE 3QX5H 3B9FH 1O2QA 1GI9B 1C1SA 1TGCA 4FVBA 4BTTB 1QL9A 4FU8A 3MU4A 3T25A 2G8TA 3AASA 4AB9A 1O5CB 4I86A 3SORA 1LVBA 1LVOA 1ZPBA 4AFUA 1ZHRA 1EAIA 1T31A 2IPHA 4OS1A 1PPHE 2H9HA 4P02A 3TJVA 2VWLA 2V3MA 3OFND 3P6ZB 1P09A 1VCQA 1EFRD 4WVPE 1P01A 2BYAX 2C8ZB 4R8TB 1N6YA 1O2NA 2PWXA 2HNTE 3R3GB 4TY7A 5DP4A 5CDFE 1P3EA 3BIVH 3TVJB 3DFLA 1LHGH 3MTYA 1EASA 4B6FA 1HAYB 3NRLA 2ANWA 2VH0A 3KYGA 1ABIH 5EW1H 5EIYA 1S84A 4YLQH 3LJJA 2ODQA 4IW4E 1GHWH 5A0AE 2VINA 4ZKSU 1HDTH 3SU1A 2DUCA 4CRAA 5BPEA 2C93B 2Z9KA 1GHAG 4FU7A 3CS7A 4AGJA 1SR5C 1CT4E 3KIDU 4WH8A 1BTUA 2PSYA 4MPWA 1J8AA 3DFJA 1L2EA 2XC5A 4NFEA 1O3JA 1GHBG 5E2PA 2ZWLH 2BXTH 2BY7X 1UMAH 3EGKH 2F9NA 4XFQA 1MCVA 5JDUB 3CENA 4AOQA 3S9BA 1BT7A 1CBWC 3OTJE 5DSFA 6LPRA 1S6HA 1GBLA 1KY9A 1SGYE 2BB4A 2IJOB 1O38A 1TALA 1ZTLA 2LP6A 2ZC9H 2QIQA 2QXGA 3OY5U 3F6UH 1VCWA 4DGJA 4K1TA 2A7JA 3ZZBA 2W3IA 1DOJA 2FESH 2J98A 3OYPA 3UFAA 3U98H 2BLVA 1C2DA 4NIVA 1VITF 1FY5A 1O37A 1IQIA 2OC8A 1SGPE 3RMLH 5A0CA 1C9TA 1B0FA 2FS8A 2RA3A 3ZZ3A 1YCPM 1HPGA 1EUFA 2HRVA 4MQAA 1NFWA 1BOQA 3KHVA 3BG8A 1GBMA 2ZTXA 1SLWB 1XKAC 1AGJA 5C67A 4ABEA 4GLYA 4FU9A 2PLXA 5DG6A 3MI4A 5SGAE 1UTPA 1SQAA 5HM2A 1BTYA 2NU1E 2Q6FA 2A45B 1S5SA 1DY8A 2W6ID 1GBIA 1ORFA 2ZFTA 3LPRA 3RU4T 2VB0A 4Y76A 3SBKA 7GCHF 1S0RA 3DSGA 3E0PB 2WYJA 2KCOA 3LOXA 4X1NU 4O9VA 2A7HA 3A88A 1GG6B 4O97A 2GJGA 1LTOA 2ANKH 3KF2A 2G51A 2GCHF 1SGDE 1HXFH 3SI4H 1AD8H 1T8LA 4LK4A 2ALVA 3ZZAA 2A2XH 3ZVFA 4INHA 1MTVA 1T8MA 1EPTA 3E6PH 2P8OC 2UWPA 2ZA5A 3PO1C 4JK6A 3GY3A 1MKXK 2K1QA 2ZU1A 1XVOA 2WV4A 4K1SA 3MO6A 1FLEE 2KX4A 2EQNA 2P8OB 1IHTH 3JZ1B 3PO1B 4DCDA 4Q80A 1J16A 1NM6A 1EZQA 3PLPA 1DWEH 4F49A 4Q7YA 3SQEE 1DY9A 4UFGH 1NESE 2CJIA 2G5VA 3DD2H 5E0GA 1MTSA 2XNDD 1IQNA 2PV9B 3E3TA 3RXMA 4DT7B 4HZHA 1AI8H 5GXPA 1Y3XA 1P2OA 2BOKA 2ZFSA 1GBDA 1YPHE 3BEUA 1G3BA 1BIOA 9ESTA 1QHRB 3SU0A 1M9UA 1OWHA 2F83A 1AWHB 1OS8A 1UTMA 4B2AA 2JKHA 1UCYE 4B2BA 1RRKA 1DANH 3IWMA 3RC6A 1ZSJA 1S6LA 5EXMA 1EJMA 2ZPSA 4ABGA 1SG8B 1V2QT 1V2ST 5F6MA 2ILNA 5AFYH 4X2XA 1O3EA 2EC9H 5LPRA 5HXFA 1V2LT 5FPTA 1GJ5H 2RDEA 1P2JA 2QXIA 4JYTA 1QQ4A 2BD4A 3SZEA 1BCUH 4E06H 1FXYA 1WYKA 1Y8TA 3M5LA 1C5VA 2OBOA 3EDXB 1DLKB 3QGJA 1GMHF 1H9HE 1FY4A 1V6DA 2J34A 1MQ6A 4XOJA 1CO7E 2ZHFH 4NA7A 3RXRA 3QUMP 2OK5A 1OP2A 4HGCA 1JIMA 3TLOA 4VGCC 1IQLA 2SNWA 1P9UA 3UIRA 1TGBA 1F0UA 5EPNA 4NA9H 4I8JA 1HJ8A 1PPZA 1T8OA 2UUFB 3PWBA 5HIYA 2ZF0H 3NUMA 4VGCB 4ISNA 1BITA 1O3FA 5EODA 2KCYA 6GCHF 1KLJH 1YCPK 1CA0B 2B5TB 3F2FA 1HIAA 4BXWA 1AE5A 4X6OA 3VXFH 1L0ZA 1O3KA 3TNSA 3LONA 1BZXE 5IYTA 2J2UA 1AFQC 1XUIA 1PPFE 1ZGIA 4OGXA 3UR6A 1S0QA 1Z8GA 4KGAA 4BANB 1ELTA 3MH7A 4A92A 4YO9A 1EP5A 2R0LA 2NU2E 5GWZA 1H9IE 3A7YA 3VB6A 2OCVB 2ALPA 2XBXA 2OC7A 1YPMH 2ZIQH 3PMHB 1GMDF 1GJCB 4X8SH 4ABHA 4KP0A 3N99A 3RXSA 3AVZA 1ESAA 4FUDA 4NG9H 3RXIA 3FP8E 1XKBC 2I6QA 1JWTA 3KL6A 1S81A 2CMYA 5BRRE 1HAVB 1MBMA 1OP0A 4ACBA 1DM4B 1BHXF 2KM0A 2CF9H 2CHAC 1VGCC 2ZHQH 1AB9C 4MG3A 2WPHS 3BSQA 2YOLA 1KDQB 3E0NB 2CHAB 1VGCB 2GDDA 1OWKA 2V6NA 4BAOB 1A0LA 2O8WA 4MNYA 5DK1A 1VJ9U 4LZ4B 3TJNA 4Y8ZA 2BDGA 5AFZH 4R0IA 1UTQA 1AKSB 4Y0ZE 3SUDA 1SQRA 3LKWA 3T26A 1C2GA 3SHCH 4WH6A 3RP2A 2AH4X 1QNJA 1QB9A 2TGTA 4JZDH 1UVUH 5EXLA 4XD7D 2FPZA 1ELBA 1A5GH 4UFDH 1FMGA 5IDKA 2Z6BD 1GVLA 3QO6A 2ZPRA 2VH6A 2V0BA 4UFFH 2J4IA 3SV9A 2R3UA 1THRH 5J4QA 5FX6A 2GV7A 4ZAEA 1W11U 1BDAA 2ZU2A 4KELA 3BN9A 1O5DH 1BUIA 1MU6B 2AGIX 1NRRH 5FBEA 1BA8B 1NTPA 2Z7FE 4Q7XA 3WWBA 3S69A 3TU7H 4GSOA 2PTCE 3F2HA 1ANBA 5JBAS 2QE7D 3QN7A 2OLGA 1QL7A 1LHFH 1TBRH 2ODYB 4KTCA 2OXSA 2Q6DA 3BTDE 1BTWA 1GDNA 1F0RA 1ZZZA 2SGPE 3PRDA 1SSXA 3EA7A 1L1GA 1QURH 4INLA 1DPOA 2P59A 5KGOA 1AWFH 1HNEE 5C1XA 1GWAA 1QTFA 1V2TT 4LOYH 1C2IA 1ZSLA 3ZZ5A 2OTVA 8ESTE 3M35A 1J14A 3TGIE 4TWWA 4ABJA 1GBKA 1ZJDA 1WTGH 1SPJA 1UK3A 2C4FH 2H5DA 3L3TA 5GJ4B 5LPEA 1QRWA 4HTCH 1O3LA 4Q7ZA 4AGKA 1GHAF 4A5TS 4KTSA 1O3GA 2Y7ZA 1P11E 1OYTH 4ISIH 4CBOA 2FYRA 1O3PB 5FCKA 4BTIB 2EI7A 1E36B 1GHBF 5A09A 1K0HA 1ELFA 2QXJA 4P00A 2P95A 2JH0D 5TCCA 5ESTE 1VCPA 5GDSH 3P70B 1LCYA 1O5EH 5DP8A 2ZDKA 2FX6A 2A0QB 2GX4A 2W5EA 2J38A 1KTSB 2BY9X 2EEKA 3F0PA 1Z6EA 2QAAA 4X8VH 2GKVE 3A7TA 1K2I1 4ZXXH 4NIWA 2PGQB 4OGYA 3SUFA 1DDJA 4JYUH 2A31A 1CHOG 1GL1A 3GDUA 1EOLA 4Y7AA 1KLTA 1FDPA 1UO6A 1LPKB 1EAUA 1SGEE 2FODA 2O8MA 2QN5T 1GCDA 2FO9A 1J9CH 4WMFA 2VGCB 2FOFA 4WXIA 1JRTA 5EQSA 3U1JB 2R3YA 2CV3A 5PTPA 1D3QB 1NBME 1K1NA 1P10A 1WQVH 2FLBH 1O36A 4M9FA 1C5TA 1QA0A 5JB9S 2LPRA 2ZDVH 5CE1A 4UONA 1F2SE 2G55A 1NT1A 1A5IA 1HJAC 3HGNA 4ABDA 1G9IE 1BMFD 4IGDA 1P03A 2TIOA 2W26A 1ZTKA 3ZZ9A 1YP9A 1G37A 2LELA 2B7DH 3LGTA 4XBDA 1HAOH 1HJAB 1SHYA 1Q31A 2ZGXH 2ZECA 3MFJA 5A8XA 1PYTC 3K9XB 1N8OB 2YMSC 3DCLA 1LMWB 3OTPA 1C2KA 1FN8A 3QLPH 2OQUA 5EQQA 4X2YA 5C1YA 5L2ZH 1C2EA 3VXEH 1TLDA 1FX0B 1GJ8B 5FBIA 2VVUA 2VVVA 2YMSB 1P06A 2GMTB 4FUGA 3TPIZ 5AVDA 6CHAC 2O9QA 4O03A 2FTMA 3DSOA 3RC5A 3SN8A 3MHWU 5A2MH 1E35B 3LC3A 1FQ3A 4NSVA 1ELDE 2ZFPH 3SQHE 4GHQA 2V7QD 1OWEA 3HK6B 4Q4LA 3U8TH 4RI0A 1O2WA 4X0WU 4DJZB 1G2MA 4DIHH 1SI5H 1A5HA 1K21H 2GT7A 4YTAA 1EJAA 1UTKA 1ZSKA 3RXGA 4Y10E 1O32A 1G3DA 1A3BH 3U28C 1Y5AT 2YNBA 2ZQ2A 3RM2H 3UWJH 1Y5BT 1W3CA 3FAOA 3O8CA 5C0UA 4NCYA 2DE9A 1BBRH 4XE4A 2HOBA 1VZQH 3E8LA 2J9NA 4K3JA 3M5MA 3FZZA 5K7RA 1ELEE 3EA9A 5E0JA 4MNXA 1NFYA 1GI7B 1S85A 1FIWA 1GCTB 1D6RA 2AERH 1CGJE 1P2IA 4FUJA 3RXUA 1YGCH 3N7EA 8LPRA 1P02A 4TPIZ 2A32A 1TX8A 3URDA 4UD9H 1C5XB 4WWYA 5LH8A 3M7TA 3DUXH 1T8NA 2TGDA 3RMMH 2F43B 1O2JA 2R0KA 1K1JA 1KXBA 5F53A 3GDVA 1RS0A 2AS9A 2BVXH 1UVSH 1P2KA 3WWFA 1XVMA 3N7OA 2XWAA 1IQKA 1D6WA 4JZ1A 4AG1A 3CP7A 2NWNA 2ODPA 1XUKA 2BZ6H 1UCYH 1ELVA 1K22H 1TX7A 1GPZA 1TNIA 1UW7A 3SW2B 4F48B 1Z8IB 3LGIA 4NZLA 4JZIA 1TPOA 1D4PB 1Q2WA 1W8BH 2QV1A 2A5IA 2NU4E 4MLFB 1ANEA 1ZOMA 1FV9A 2ZHEH 2B8OH 1SGTA 1ACBE 1V2JT 4OS7A 2M5TA 4U32A 5F8XA 3ZYDA 5G4BA 1GBHA 1C1NA 4CRCA 2BDIA 1WOFA 1GBFA 3A82A 3PTNA 1HB0B 3RXHA 4ABIA 1HGTH 2ZKSA 4AZ2B 3QZQA 3RXQA 2C8XB 3SNDA 4Z0KA 1BTXA 1PYTD 4GAWA 3ZZ8A 4UE7H 3OEHD 1TOMH 2G81E 3OY6U 3ZVGA 2ZDMA 1ARCA 2GZ9A 2WV5A 4TSFD 4AFQA 1GBAA 4X6NA 3VPKA 1BMLA 1C9PA 1VITH 2XCNA 1NZQH 1O35A 3S9CA 4KTUA 1SGNE 3QWCH 1ANCA 2PUQH 1F0TA 1O2LA 2PKAB 1MD7A 4D8NA 1IQEA 2FI5E 4JZEH 2Y5GA 4QT8C 1LKAA 1W12U 2J94A 3STIA 3ZVCA 3HKJB 4H42U 1SQOA 5TJXA 1BRBE 4FUFA 2HVYB 1GBCA 3K6ZA 3ZV8A 1C5MD 4X2WA 2FWWA 2A4GA 2VIQA 5A0BA 1IHSH 5DKMA 1A4WH 4X1RU 3PV2A 1TA6A 4CRBA 2J95A 3KQ5A 1GI0A 1KLIH 3M5OA 1T32A 1O2ZA 1QR3E 1MTWA 1SGIB 2WUBA 1INCA 3V12A 3S0NA 3AW0A 4ABBA 4E7NA 1TPAE 4F4OC 3I78A 4WF8A 2BDHA 3A84A 5T6DA 1C5QA 1G3EA 3HATH 3LGUA 1SGRE 3SU6A 1P8VC 1TQ0B 5EGMA 3F2GA 1SGCA 3KNXA 4OM9A 4MPVA 1AZZA 5B6LA 1L4DA 4YT6H 3UOUA 2GVFA 3MH6A 4IMQA 2PUXB 3ELAH 4ABFA 1ZR0A 4JK5A 4A1VA 4I32A 4U01A 1ETSH 1GI1A 1V2UT 2B0FA 4I7YH 2FI3E 2GT8A 2SNVA 2FS9A 3BTQE 2GCTB 1HAHH 2ZFRH 4BNRA 4J1YA 1O39A 1GG6C 1H8DH 3MO9A 2THFB 1O3OA 3PV5A 3T28A 3U1IB 1WBGB 3KQCA 3PB1E 1PQ5A 2VBCA 2ZO3H 4IN1A 4B73A 5EW2H 1EATA 2VVCA 2FDAA 1H1BA 1QBOA 3KQBA 1QIXB 3UAIC 2WZQA 2Q1JA 1QZ8A 4NGAH 1ZMLA 3HPTB 5LGOA 3ZZ4A 2SGQE 1BBRE 4TPYA 1SGFA 2PP6A 1KXDA 1O0DH 3ZV9A 4I33A 2P3UB 1DLEA 1O2IA 2JETC 2BTCE 3F9GA 1C2LA 3T27A 4NFFA 4AFSA 3TGJE 1FY1A 4CBNA 2TPIZ 1E79D 1SL3A 2JETB 3AK5A 1GHVH 2IN2A 5DP3A 2K0QA 2QF4A 3PMBB 2FZZA 1C5UA 3VG8A 4MVNA 3RU4D 5JBTA 2VIVA 1FZZA 4Y0YE 1SLXB 2J98B 2ZCLP 2EA3A 4ISOA 4AG2A 1C2JA 1OSSA 2G00A 2AFQB 1G36A 1O3CA 1YPKH 1ZHMA 1CHOF 2Z9JA 3BIUH 4AORA 1N6XA 1Z71A 2W7SA 1O3AA 2H1UA 3ZVEA 3D65E 2Y6TA 1C1WH 1MKWH 3M5NA 4BAKB 4H6SB 1GI5A 2KAIB 3ATKA 2PR3A 1OWIA 2ULLA 3SJIA 3GYMA 1OPHB 1OX1A 2WPLS 3H7OA 1RTFB 1W13U 3RXFA 2OUAA 1DT2A 1ELGA 1QRXA 4U30A 3MMGA 4XDEA 4I8GA 5CMXH 3H7TA 1EXFA 4A1XA 1V2RT 1NRPH 3F9EA 1HFDA 3RXCA 1WAYB 4IC6A 1TBQH 2H9EH 2ANYA 4AC9A 3HKIB 4YT7H 2FOBA 3A7ZA 3WY8A 5F8ZA 4O3UA 4ZXYH 1DX5M 2CXVA 1B7XB 3SJ8A 1TGTA 2IOTA 3GYLB 2C8WB 1O3MA 2Z9GA 4Y8XA 2HLDD 2Z3CA 1HAVA 3U9AH 3MNSA 1AIXH 3RXTA 1GJ7B 5E8EH 5FPYA 1ZPZA 4CR9A 4CREA 1ZPCA 1UVPA 2AMQA 2AEIH 3GICB 2JDID 1OKXA 2ZZUH 3Q76A 4K2YA 1CA0C 4Q2KA 1IQMA 4FOUC 1OP8A 1P04A 1AKSA 5KECA 1EP6A 3SO3A 3PMJA 2F9BH 2ZDAH 3UOPA 1SMFE 2VIDA 4MNWA 2CGAA 2Z9LA 4K1EA 3VGCC 5LPFA 5HIZA 1MZDA 3KN2A 3L6PA 3R0FA 4B6EA 1EX3A 2FIRH 1KXAA 1AQ7A 1BB0B 3VGCB 1WU1A 4YM9A 1MMJN 5ETXA 1ZRKA 1NC6A 1GI3A 2BM2A 2SGAA 1LKBA 2ANMH 1ZHPA 2H2ZA 4I8LA 1EZXC 3OAAD 3RLWH 1O33A 2KFWA 4JZFH 4O3TA 3F1SB 1MAXA 4INKA 3UUZA 1CGHA 1P2QA 2DE8A 2QGRA 1QA7A 1QY6A 1YLNA 4MPUA 1GMCF 1P3CA 1GJAB 2PFEA 4KKDA 2KCAA 3MOCA 1GGDC 5EU8A 1TNHA 2ZGJA 3PROA 1TYNA 2UWLA 2FYQA 3KYFA 5GIBA 1UCYK 3QK1A 4ZMAH 1GGDB 4ZHAA 1DITH 3SNAA 3RXLA 1E37B 1P57B 3IITA 1XM1A 1GBJA 1RJXB 1XXFA 3Q3XA 4CHAB 1MCTA 5E2OA 5C2ZA 2W3KA 3OE7D 1Y59T 4X1SU 1K1LA 3ATWA 4B76A 4X6MA 3GCNA 1QJ1B 3OEED 1RD3B 1YLDA 3BEFB 4DG4A 2ZU3A 5HMAA 2F9OA 1HIAB 2HGTH 3RXAA 1NFXA 2WUCA 2PW8H 4OS2A 3KQEA 1PQ7A 3E91A 3W1EA 2UWOA 3E90B 2PGBB 3P8NA 3AAVA 2BDYA 1F7ZA 1V2VT 4DY7B 5EJ1A 2P16A 1XX9A 3SUGA 5EJZA 3RXVA 3KQDA 3PLKA 1AUTC 5T6FA 1P2MA 2A5AA 3MU0A 4IC5A 3TH4H 3AW1A 1G3CA 1GHZA 3SV8A 3FP6E 3SU5A 1DS2E 5EQRA 1AN1E 2AMPA 1FI8A 4FVDA 4ZKOU 1MTNC 1SFQB 2ZFQH 4B75A 1QL8A 1MBQA 1TPSA 1ZLRA 2QYIA 3Q3KA 5CHBA 1MD8A 2W7UA 5GCHG 1GVKB 2FOHA 3A86A 4RN6A 2SGDE 1MTNB 4XRNA 1HV7A 1UHBB 1TE0A 5JPMH 1TA2A 3DT0H 2F9VA 5ABWA 3EAJA 3SU2A 3LGWA 2BOHB 1O2KA 4I31A 4K8YA 5T6GA 4CH2B 4Z6AH 9LPRA 3RXJA 2RFKC 1TMTH 4X8UH 1QB6A 2HPQH 2WV9A 2QF5A 1RTLA 1T7CA 5T1VA 3RMNH 3SI3H 3BEIB 1V2WT 4D76A 5IK2D 3MO3A 2P3TB 3I29A 1QFKH 2XC4A 3RXDA 1YYY1 1C1VH 1N1LA 2AHME 4Y7BA 1BQYA 4IMZA 4BTUB 1KIGH 2H5CA 3GY8A 2M2AA 1IQGA 3T29A 5C3NA 1O3DA 3UTUH 1ID5H 3RDZA 3BG4B 3RC4A 3Q3YA 1O2XA 1DWBH 1HAXB 2BLWA 2FLRH 1E34B 1AU8A 1ANDA 1UVOA 1YC0A 2SGEE 4ZKNU 2VGCC 1C4Y2 3M3VA 1QBNA 1BMMH 1LHEH 4JCNA 5FXLA 1PPGE 5JBBS 4D9QA 2VU8E 1W10U 3JZ2B 4K5ZA 4ZCNA 1DWCH 2H6MA 4Z1MD 1C5YB 5JYIA 2QA9E 4YZUA 2ZCKP 1O2SA 3M37A 3NXPA 1XUGA 4AYVB 3GY5A 1Y3VA 4GUXA 2BVSH 3PYHA 1IQJA 1SLVB 3ZVBA 2F91A 3V3MA 1SOTA 5AF9H 3FFGA 3A8BA 1N8OC 1LDTT 2Y80A 1ESTA 1XUHA 2IJD1 1CA8B 1A3EH 4K60A 2GZ8A 1QQUA 1SB1H 2L74A 3F9FA 4K69A 3VB5A 3UREA 2GGVB 1E38B 1XXDA 3TK6A 1TONA 3UQOA 3TJUA 1WCZA 2BD8A 2R2WU 1W7GH 2GMTC 4AFZA 3VB3A 1WQSA 4DURA 2OC0A 2ZPQA 3KGPA 2XWBI 4BOHA 2HNTC 3GY6A 2A4RA 2RG3A 3SJ9A 2BD3A 1ZMNA 3MNBA 3PWCA 4WJG2 2AIQA 3MWIU 1BRCE 2FOMB 1NN6A 1KSNA 4BAQB 2WPMS 4X1PU 4HG6A 1DICA 3D23A 1JBUH 2ZTYA 4ZROA 1CVWH 3S9AA 4YOJA 4RT0A 3D49H 2D26C 2XBWA 5DP5A 2BXUH 3KEEA 1NFUA 1O2RA 3ZZCA 3A7VA 1B0EA 2Y5FA 3A7WA 1JOUB 2BHGA 3BTTE 4FETA 3GDSA 3A83A 1FONA 1UK2A 3SNCA 2XC0A 3MH4A 4IBLH 1C1OA 4JYVH 1GBBA 3ITIA 1NRSH 3P17H 1EB2A 3BTWE 3LH3A 5DO4H 5EPYA 3A87A 3CS0A 3WW7A 1GI6A 1GCTC 1O3BA 2WINI 1PPEE 2ZHDA 4A6LA 3OSYA 1PQAA 1F0SA 2BDBA 1H9LB 2BLQA 2PKSB 1O30A 1QCPA 3RXKA 4E05H 3BTME 4HI3A 2BY5X 1MAYA 3V13A 2O8TA 3QZRA 3P8GA 4GCHG 3DHKH 1O2VA 4AYYB 1GDQA 1UTOA 3LC5A 1RFNA 1LPGB 1MH0A 3FVFB 1GMCG 1OXGA 4Y79A 1UVTH 1HAPH 3NK8A 2C8YB 4YOGA 1BMNH 2JIZD 1OWDA 2LNCA 3MNCA 1Y3YA 1G2LA 2HLCA 4X2VA 4A1TA 3QDZB 1TNGA 1DSUA 1K9OE 2TGPZ 3NKKA 1UTLM 3VEQB 1V3XA 1F5KU 4TYDA 2FX4A 4CH8B 3TITA 3SGBE 3TGKE 3NWUA 1W0KD 1TQ7B 2P3FH 5HM9A 5H4IB 1EB1H 1ZJKA 1O2UA 3RXPA 4X1QU 2BX3A 1P9SA 1H4WA 5JBCS 2EY4C 2BD2A 2SGFE 4THNH 2FOEA 3M3SA 3BTKE 1HCGA 1KXEA 3ZZ6A 1LO6A 2VIOA 2XBVA 2VWNA 3NPSA 1SBWA 1SQTA 4B74A 2XXLA 3ENSB 3FZDA 1P2NA 3UPEA 3C27B 5FAHA 5HKKD 1G32B 1HXEH 1MTUA 1D9IA 5L30H 1XMNB 1TGSZ 2AGGX 4GPGA 4IN2A 5DP7A 1QJ6B 3RXOA 3DA9B 1DSTA 3LIWA 2ZP0H 3UQVA 1L1NA 2YMSD 2ZTZA 2BVRH 1IAUA 2JH5D 1V2MT 1TX6A 1OHHD 1FPHH 4ESTE 1RGQA 3A80A 3GY2A 2TRMA 3H5CB 3IG6B 3UB0A 3V0XA 2ZI2H 3RM0H 4E7RG 3SYJA 2G52A 4F55A 1H8IH 5B6OA 4ACAA 4HFPB 2Z3DA 3DSPA 1C2FA 1W0YH 3EE0B 3H09A 4LXBH 1FAKH 5A8ZA 2RA0A 2ZG0H 5CHAC 4GVUA 2BQ7B 1YPHC 5FHTA 5DN6D 2VNTA 1WXRA 4X8TH 5CHAB 1YKTA 3GISB 1AUJA 3EYDA 4NWKA 1UJ1A 4UFEH 5C5NA 1YPJH 3I77A 3S7HB 1P12E 1PPBH 3O8DA 1FY3A 3RXBA 2F9PA 2XW9A 3RMOH 3GCHC 4CR5A 5A8YA 1EOJA 5FPSA 4CRFA 1Q3XA 4JMYA 1HYLA 1EJNA 2A7CA 2AYWA 1ARBA 1C1PA 3LDXH 3GCHB 1C5WB 3GS9A 3UNSA 1YWUA 1Y5UT 2XYAA 3MH5A 1V2OT 2CK3D 1TRNA 2Y7XA 4ASHA 4CRGA 2ZU5A 1O31A 4H4FA 1OYQA 4CRDA 1YLCA 2WYGA 1V2NT 1W7XH 3MYWA 1YF4A 1ZYOA 1CBWB 3GCTG 1A0JA 1NY22 5I25A 3FN8A 3MU8A 1KMHB 1KYNA 1Z8JB 1GJ4H 3A8DA 1ETRH 2FTLE 2GCTC 4OS5A 1AE8H 1DE7H 4FUIA 5FCRA 1K28D 1ZGVA 3BTFE 4Y71A 3ESTA 1MUEB 4YESB 1ELCA 2OD3B 2AMDA 4Q63A 4M7GA 3STJA 2KAIA 3LGYA 3ODDA 1F92A 2Y81A 5GCHF 5E0HA 1SOZA 5JB8S 2STAE 3T5FH 1C2HA 4MNVA 4NSYA 1CSOE 1CE5A 2JJ2D 1SFIA 4BAMB 1Y3UA 2HWLB 1E1RD 1FAXA 1LHDH 3ZVAA 1NU9A 1HAZB 3FANA 4YXWD 1JXPA 2FI4E 2QC2A 1TWXB 2ZEBA 3E16B 1FUJA 1NRNH 1U6QA 1ZTJA 2FOAA 4I8HA 3Q00A 2PSXA 2OQ5A 4NIXA 4WMEA 2BD7A 8KME2 2GTBA 4X6PA 1DXPA 3TNTA 3AAUA 1QGFA 3BTEE 3KCGH 3OU0A 1X7AC 3TIUA 3RU4E 3MU1A 4OS6A 3T2NA 5KEDA 2G5NA 1LVMA 3QTVH 3SNEA 1SLUB 2CN0H 3SNBA 1C1TA 4TY6A 2HPPH 2EI8A 3BV9B 1Z1JA 1PFXC 1WV7H 3FP7E 1YY3A 1Z6JH 1JRSA 1MU8B 3RXEA 1O5FH 1GL0E 2J97A 1SVPA 1P05A 3SJOA 2RDLA 1O5AB 1IOEA 1D3DB 2BY8X 3URCA 4D9RA 1TPPA 1Z7KA 2WPIS 3FOAA 3SUEA 1O2TA 1GI2A 1J15A 3A81A 1EPTC 3HK3B 2AIPA 2FXRA 4I8KA 3E1XB 2SFAA 1BRUP 3B8JA 6ESTA 1EPTB 1TFXA 1HJ9A 2OINA 8GCHG 2ZQ1A 1AMHA 1C1MA 2FMJA 5DGJA 1KDQA 3SU4A 1YPGH 3F68H 2QY0B 2PHBA 1BJVA 2QXHA 1IQHA 2QF3A 4NWLA 1WUNH 1AVGH 1C1UH 1GBEA 1E0FD 4UDWH 1E1QD 1HUTH 3U8RH 1RIWC 2Z9IA 4WY3A 1ETTH 1LPZB 1A61H 1TRMA 2BD9A 1A2CH 5I46H 4Y6DA 1TABE 1BBRK 1V2KT 5DJ7A 1RIWB 2D8WA 3SGAE 4IS5A 1NS3A 2R2MB 1Z8RA 2V35A
chains in the Genus database with same CATH topology
3SV7A 4RSPA 3EQ0H 3TJOA 2ESTE 2FM2A 2GD4B 4AB8A 3ZYEA 3VB7A 4ABAA 1V2PT 1TMBH 2WPKS 2FOCA 5ESBA 7LPRA 2A5KA 2ASUB 4YOIA 1A0HB 1KXCA 2G4UA 1JMOH 1BTHH 3PTBA 1MQ5A 2GV6A 4GCHF 4B71A 4DVAU 1AFQB 3BF6H 1O5GH 4DOQA 5DP6A 2Z3EA 2A2QH 3UR9A 1EAWA 4DIIH 2O8UA 4Y8YA 3A7XA 1DVAH 3U8OH 3PLBA 1ELAA 2O8LA 1EZSC 2TGAA 4FUCA 1YPLH 4FXGH 3SGQE 5L2YH 1QJ7B 2BZAA 4XBBA 2F9UA 1B5GH 1GJ9B 1HAIH 1FIZA 4CHAC 3QTOH 4GHTA 2NU0E 1QRZA 3TH2H 2C90B 3UNQA 4PROA 4FUEA 3GY7A 2BQ6B 1UHBA 1W14U 2A4OA 1BHXB 1G30B 1S6FA 3GY4A 1FJSA 1AB9B 5F8TA 1WTHD 1CT2E 3SJKA 1FPCH 1GHXH 3ATLA 1EQ9A 3ZZ7A 2HVXA 5HGGA 2ZGBH 3C1KA 2GDEH 3PV4A 3TH3H 2B9LA 1GVZA 2QCYA 3LU9B 3TK5A 1C4V2 1GHYH 2A4QA 3P92A 1HBTH 2BX4A 3W95A 3W94A 1O2MA 2UUJB 4YLUA 3SZNA 5AHGH 4FUHA 1DWDH 4UEHH 1NU7B 1A7SA 3QGNB 3SU3A 2YNAA 1W2KH 1A1RA 1LHCH 1LVYA 2WPJS 5DPAA 5J4SA 1VITG 3U69H 1BRAA 4MTBA 4D7GA 2OC1A 1TRYA 2PTNA 3PMAB 1OWJA 2BMGB 1GJBB 1TNKA 3LJOA 4SGAE 4ISHH 1O2YA 5K0HA 1AY6H 1TNLA 2ZDNA 2ZGHA 3NZIA 1PQ8A 1TNJA 1O34A 3P8OA 5FX5A 3ZVDA 1DFPA 1O2HA 1HAGE 1CU1A 3PM3A 2RCEA 2FOGA 1K1MA 1W0ZU 3P95A 3O8BA 7GCHG 1K1IA 1HRTH 1WSSH 3MNXA 1S82A 1NPMA 1CHGA 3RUOA 3ODFA 1AVWA 1GBTA 4NA8A 1AZ8A 2J92A 3UNRA 1YBWA 4AN7A 2ZFFH 3M7QA 1SHHB 2GCHG 2ZDLA 2HALA 1NRQH 1EAXA 1O3HA 4ZH8A 1C2MA 3BG4C 1UTNA 1C1RA 1EKBB 1O2GH 2A1DB 1BTZA 2ZNKH 2Y5HA 1DXWA 1UK4A 1Z1IA 1TIOA 3VFEA 1PPCE 1O2PA 2C3SA 2V3OH 3D62A 1TMUH 1DUAA 3F9HA 1O2OA 2JH6D 1SGQE 1C5NH 4RKJB 5F03A 2D1JA 1MKXH 1THPB 4U2WA 7ESTE 1AVXA 4H6TA 5HYOA 1FY8E 1K1PA 2STBE 4WXVA 2Q6GA 1QBVH 1P0SH 1BJUA 1K1OA 5EOKA 3O8RA 3GCTF 7KMEH 1XUFA 2FEQH 4ZHLU 4RKOB 2FP7B 3ATMA 2QF0A 4ZUHA 1C5ZB 1J17T 4SGBE 5C20A 2BY6X 1BTPA 3BTHE 5C5OA 3M3TA 1C5PA 3L33A 1NO9H 1CT0E 3K2UA 3LH1A 4DW2U 2Z94A 2XBYA 2XRCA 4WMDA 2VWMA 2BDCA 1LQDB 2CF8H 2UUKB 2BQWB 1SGFG 3RLYH 3M36A 2BD5A 1D3TB 3OX7U 2Y82A 3EA8A 2HNTF 1SC8U 1JIRA 2BDAA 4MDSA 3B23B 1GMHG 1CQQA 1D3PB 1THSH 3T62A 4Y11E 1XUJA 1O5BB 2H9TH 3SOSA 1C5SA 1ESBA 1YPEH 2GP9B 5L6NH 3TK9A 4MPXA 1GI8B 3V7TA 1YM0A 3ATIA 4LZ1H 1GDUA 3LGVA 2AGEX 1GJ6A 3S7KB 1FNIA 2TBSA 1C5RA 1VR1H 1C5LH 1MKWK 3NCLA 1EZUC 4AX9H 4BXSA 1O3NA 1ABJH 6GCHG 3GCOA 4ZKRU 1AO5A 6CHAB 2ZU4A 1S83A 4ZHMU 2PKSC 1O3IA 1ZMJA 2XNIA 2V3HH 2ZHWH 4K8BA 3M7UA 2P93A 5EG4A 1VJAU 1C4U2 1YCPH 4ISLA 3SV6A 3BTGE 2NU3E 1GI4A 1F5RA 3VB4A 2BLOA 5T3HA 3M61U 1RTKA 2OBQA 3A8CA 4FUBA 4NZQA 4XBCA 3SV2H 1L4ZA 1Y3WA 2R9PA 1BMAA 1GMDG 1TGNA 3A85A 1C1QA 3A89A 2VIPA 3A8AA 1IQFA 1HLTH 2G4TA 1T4UH 2XCFA 1FN6A 1A46H 1PJPA 4BAHB 1C5OH 1MZAA 5C1UA 2XTTB 5EXNA 3LT3A 1AHTH 3G01A 2PKAA 3ZZDA 1KTTB 1NROH 2I6SA 5TCAA 3GOVB 4XSKU 4OS4A 8GCHF 1KXFA 3K6YA 1TOCB 3MU5A 3UY9A 3UWIA 4J2YB 1TB6H 1ZRBA 4TWYA 2VWOA 3Q77A 3HGPA 4B2CA 1TBZH 2ZCHP 1CGIE 4A7IB 1AFEH 2OP9A 1F5LA 1LQEA 1TAWA 2GZ7A 1L1JA 4B1TA 5GPIB 3SHAH 1UTJA 1T4VH 3P8FA 1DUEA 2UUYA 2VIWA 4D7FA 2EI6A 2D2DA 1GJDB 5DP9A 2VJ1A 4NIYA 1OOKB 2P94A 1QB1A 3K65B 1RXPA 2ZGCA 2F3CE 3QX5H 3B9FH 1O2QA 1GI9B 1C1SA 1TGCA 4FVBA 4BTTB 1QL9A 4FU8A 3MU4A 3T25A 2G8TA 3AASA 4AB9A 1O5CB 3SORA 1LVBA 1LVOA 1ZPBA 4AFUA 1ZHRA 1EAIA 1T31A 2IPHA 4OS1A 1PPHE 2H9HA 3TJVA 2VWLA 3P6ZB 1P09A 1VCQA 4WVPE 1P01A 2BYAX 2C8ZB 4R8TB 1N6YA 1O2NA 2PWXA 2HNTE 3R3GB 4TY7A 5DP4A 1P3EA 3BIVH 3TVJB 3DFLA 1LHGH 3MTYA 1EASA 1HAYB 2ANWA 2VH0A 1ABIH 5EW1H 1S84A 4YLQH 3LJJA 2ODQA 4IW4E 1GHWH 5A0AE 2VINA 4ZKSU 1HDTH 3SU1A 2DUCA 4CRAA 5BPEA 2C93B 2Z9KA 1GHAG 4FU7A 3CS7A 4AGJA 1SR5C 1CT4E 3KIDU 4WH8A 1BTUA 2PSYA 4MPWA 1J8AA 3DFJA 1L2EA 2XC5A 4NFEA 1O3JA 1GHBG 5E2PA 2ZWLH 2BXTH 2BY7X 1UMAH 3EGKH 2F9NA 4XFQA 1MCVA 5JDUB 3CENA 4AOQA 3S9BA 1BT7A 1CBWC 3OTJE 6LPRA 1S6HA 1GBLA 1KY9A 1SGYE 2BB4A 2IJOB 1O38A 1TALA 1ZTLA 2ZC9H 2QIQA 2QXGA 3OY5U 3F6UH 1VCWA 4DGJA 4K1TA 2A7JA 3ZZBA 2W3IA 1DOJA 2FESH 3OYPA 3UFAA 3U98H 2BLVA 1C2DA 4NIVA 1VITF 1FY5A 1O37A 1IQIA 2OC8A 1SGPE 3RMLH 5A0CA 1C9TA 1B0FA 2FS8A 2RA3A 3ZZ3A 1YCPM 1HPGA 1EUFA 2HRVA 4MQAA 1NFWA 1BOQA 3KHVA 3BG8A 1GBMA 2ZTXA 1SLWB 1XKAC 1AGJA 5C67A 4ABEA 4GLYA 4FU9A 2PLXA 5DG6A 3MI4A 5SGAE 1UTPA 1SQAA 5HM2A 1BTYA 2NU1E 2Q6FA 2A45B 1S5SA 1DY8A 1GBIA 1ORFA 2ZFTA 3LPRA 3RU4T 2VB0A 4Y76A 3SBKA 7GCHF 1S0RA 3E0PB 2WYJA 3LOXA 4X1NU 4O9VA 2A7HA 3A88A 1GG6B 4O97A 1LTOA 2ANKH 3KF2A 2G51A 2GCHF 1SGDE 1HXFH 3SI4H 1AD8H 1T8LA 4LK4A 2ALVA 3ZZAA 2A2XH 3ZVFA 4INHA 1MTVA 1T8MA 1EPTA 3E6PH 2P8OC 2UWPA 2ZA5A 3PO1C 4JK6A 3GY3A 1MKXK 2K1QA 2ZU1A 1XVOA 2WV4A 4K1SA 3MO6A 1FLEE 2P8OB 1IHTH 3JZ1B 3PO1B 4DCDA 4Q80A 1J16A 1NM6A 1EZQA 3PLPA 1DWEH 4F49A 4Q7YA 3SQEE 1DY9A 4UFGH 1NESE 2CJIA 2G5VA 3DD2H 5E0GA 1MTSA 1IQNA 2PV9B 3E3TA 3RXMA 4DT7B 4HZHA 1AI8H 5GXPA 1Y3XA 1P2OA 2BOKA 2ZFSA 1GBDA 1YPHE 3BEUA 1G3BA 1BIOA 9ESTA 1QHRB 3SU0A 1M9UA 1OWHA 2F83A 1AWHB 1OS8A 1UTMA 4B2AA 2JKHA 1UCYE 4B2BA 1RRKA 1DANH 3IWMA 3RC6A 1ZSJA 5EXMA 1EJMA 2ZPSA 4ABGA 1SG8B 1V2QT 1V2ST 5F6MA 2ILNA 5AFYH 4X2XA 1O3EA 2EC9H 5LPRA 5HXFA 1V2LT 5FPTA 1GJ5H 1P2JA 2QXIA 4JYTA 1QQ4A 2BD4A 1BCUH 4E06H 1FXYA 1WYKA 1Y8TA 3M5LA 1C5VA 2OBOA 3EDXB 1DLKB 3QGJA 1GMHF 1H9HE 1FY4A 1V6DA 2J34A 1MQ6A 4XOJA 1CO7E 2ZHFH 4NA7A 3RXRA 3QUMP 1OP2A 4HGCA 1JIMA 3TLOA 4VGCC 1IQLA 2SNWA 1P9UA 3UIRA 1TGBA 1F0UA 5EPNA 4NA9H 4I8JA 1HJ8A 1PPZA 1T8OA 2UUFB 3PWBA 2ZF0H 3NUMA 4VGCB 4ISNA 1BITA 1O3FA 5EODA 6GCHF 1KLJH 1YCPK 1CA0B 2B5TB 1HIAA 4BXWA 1AE5A 4X6OA 3VXFH 1L0ZA 1O3KA 3TNSA 3LONA 1BZXE 5IYTA 2J2UA 1AFQC 1XUIA 1PPFE 1ZGIA 4OGXA 3UR6A 1S0QA 1Z8GA 4KGAA 4BANB 1ELTA 3MH7A 4A92A 4YO9A 1EP5A 2R0LA 2NU2E 5GWZA 1H9IE 3A7YA 3VB6A 2OCVB 2ALPA 2XBXA 2OC7A 1YPMH 2ZIQH 3PMHB 1GMDF 1GJCB 4X8SH 4ABHA 4KP0A 3RXSA 3AVZA 1ESAA 4FUDA 4NG9H 3RXIA 3FP8E 1XKBC 2I6QA 1JWTA 3KL6A 1S81A 2CMYA 5BRRE 1HAVB 1MBMA 1OP0A 1DM4B 1BHXF 2CF9H 2CHAC 1VGCC 2ZHQH 1AB9C 4MG3A 2WPHS 3BSQA 2YOLA 1KDQB 3E0NB 2CHAB 1VGCB 2GDDA 1OWKA 2V6NA 4BAOB 1A0LA 2O8WA 4MNYA 5DK1A 1VJ9U 4LZ4B 3TJNA 4Y8ZA 2BDGA 5AFZH 4R0IA 1UTQA 1AKSB 4Y0ZE 3SUDA 3LKWA 3T26A 1C2GA 3SHCH 4WH6A 3RP2A 2AH4X 1QNJA 1QB9A 2TGTA 4JZDH 1UVUH 5EXLA 2FPZA 1ELBA 1A5GH 4UFDH 1FMGA 5IDKA 2Z6BD 1GVLA 3QO6A 2ZPRA 2VH6A 2V0BA 4UFFH 2J4IA 3SV9A 2R3UA 1THRH 5J4QA 5FX6A 2GV7A 4ZAEA 1W11U 1BDAA 2ZU2A 4KELA 3BN9A 1O5DH 1BUIA 1MU6B 2AGIX 1NRRH 5FBEA 1BA8B 1NTPA 2Z7FE 4Q7XA 3S69A 3TU7H 4GSOA 2PTCE 1ANBA 5JBAS 3QN7A 2OLGA 1QL7A 1LHFH 1TBRH 2ODYB 4KTCA 2OXSA 2Q6DA 3BTDE 1BTWA 1GDNA 1F0RA 1ZZZA 2SGPE 1SSXA 3EA7A 1L1GA 1QURH 4INLA 1DPOA 2P59A 1AWFH 1HNEE 5C1XA 1GWAA 1QTFA 1V2TT 4LOYH 1C2IA 1ZSLA 3ZZ5A 2OTVA 8ESTE 3M35A 1J14A 3TGIE 4TWWA 4ABJA 1GBKA 1ZJDA 1WTGH 1SPJA 1UK3A 2C4FH 2H5DA 3L3TA 5GJ4B 5LPEA 1QRWA 4HTCH 1O3LA 4Q7ZA 4AGKA 1GHAF 4A5TS 4KTSA 1O3GA 2Y7ZA 1P11E 1OYTH 4ISIH 4CBOA 2FYRA 1O3PB 5FCKA 4BTIB 2EI7A 1E36B 1GHBF 5A09A 1ELFA 2QXJA 2P95A 2JH0D 5TCCA 5ESTE 1VCPA 5GDSH 3P70B 1LCYA 1O5EH 5DP8A 2ZDKA 2FX6A 2A0QB 2GX4A 2W5EA 2J38A 1KTSB 2BY9X 2EEKA 1Z6EA 2QAAA 4X8VH 2GKVE 3A7TA 1K2I1 4ZXXH 4NIWA 2PGQB 4OGYA 3SUFA 1DDJA 4JYUH 2A31A 1CHOG 1GL1A 3GDUA 1EOLA 4Y7AA 1KLTA 1FDPA 1UO6A 1LPKB 1EAUA 1SGEE 2FODA 2O8MA 2QN5T 1GCDA 2FO9A 1J9CH 4WMFA 2VGCB 2FOFA 4WXIA 1JRTA 5EQSA 3U1JB 2R3YA 2CV3A 5PTPA 1D3QB 1K1NA 1P10A 1WQVH 2FLBH 1O36A 1C5TA 1QA0A 5JB9S 2LPRA 2ZDVH 5CE1A 4UONA 1F2SE 2G55A 1NT1A 1A5IA 1HJAC 3HGNA 4ABDA 1G9IE 4IGDA 1P03A 2TIOA 2W26A 1ZTKA 3ZZ9A 1YP9A 1G37A 3LGTA 2B7DH 1HAOH 4XBDA 1HJAB 1SHYA 1Q31A 2ZGXH 2ZECA 3MFJA 5A8XA 1PYTC 3K9XB 1N8OB 1LMWB 1C2KA 1FN8A 3QLPH 2OQUA 5EQQA 4X2YA 5C1YA 5L2ZH 1C2EA 3VXEH 1TLDA 1GJ8B 5FBIA 2VVUA 2VVVA 1P06A 2GMTB 4FUGA 3TPIZ 5AVDA 6CHAC 2O9QA 4O03A 2FTMA 3RC5A 3SN8A 3MHWU 5A2MH 1E35B 3LC3A 1FQ3A 4NSVA 1ELDE 2ZFPH 3SQHE 4GHQA 1OWEA 3HK6B 3U8TH 1O2WA 4X0WU 4DJZB 1G2MA 4DIHH 1SI5H 1A5HA 1K21H 2GT7A 4YTAA 1EJAA 1UTKA 1ZSKA 3RXGA 4Y10E 1O32A 1G3DA 1A3BH 1Y5AT 2YNBA 2ZQ2A 3RM2H 3UWJH 1Y5BT 1W3CA 3FAOA 3O8CA 4NCYA 2DE9A 1BBRH 4XE4A 2HOBA 1VZQH 3E8LA 2J9NA 4K3JA 3M5MA 3FZZA 5K7RA 1ELEE 3EA9A 5E0JA 4MNXA 1NFYA 1GI7B 1S85A 1FIWA 1GCTB 1D6RA 2AERH 1CGJE