1GBLA

Alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gblA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gblA01
2TBSA 2FOMB 1TONA 1GBIA 3GDUA 2TGTA 5L2YH 3T25A 4INHA 4MPUA 2CXVA 1IHTH 1XXDA 1M9UA 2P3UB 3O8RA 2OUAA 3BEFB 5HM9A 2W26A 3BTME 3E6PH 3U1IB 1FXYA 1OWJA 1RTKA 4D9QA 2OINA 1EPTA 1V2NT 1TNGA 4AB8A 2LPRA 1GBJA 1SL3A 1B0FA 1LHCH 1AWFH 4DVAU 2PUXB 3EGKH 2A45B 3ZVCA 2G5VA 3JZ1B 2PGQB 1L4ZA 1QA0A 3GCOA 3Q3XA 1JRTA 1HPGA 1YF4A 4AFSA 1H1BA 1O5FH 1UCYE 3WY8A 6ESTA 1HB0B 1K2I1 4KGAA 2GMTB 1MKWK 2CMYA 3SI4H 4A6LA 8KME2 1L1JA 3HATH 2OC8A 2A2QH 3RXOA 1MUEB 2OBOA 1V2JT 5EXMA 1KYNA 3GY3A 4K1TA 4M7GA 1KLIH 3SUDA 1F92A 1P2IA 1F5LA 2BDCA 4IMZA 3M3VA 1QB9A 3ZZBA 1HCGA 2AGGX 2HNTF 1CO7E 2H5DA 1CHOF 2BY6X 1GJ5H 4AX9H 2Q6DA 3TVJB 2ZFRH 4NA9H 5L30H 1BCUH 5E2OA 2WPIS 2CF8H 3BEUA 4CRGA 1TOCB 5DP6A 1S0RA 1D6WA 1UHBA 1ZPCA 4NA8A 1VZQH 2ZI2H 2P3FH 2XC4A 3MU5A 3K6YA 3M5MA 4H6TA 5IDKA 2GCHG 1AVGH 2FYQA 3ZVGA 2FMJA 1UVSH 2ZP0H 4X1RU 1GHYH 1OS8A 4I8HA 3T2NA 5K0HA 1GJ6A 2XXLA 1GHAG 1PPGE 2FLRH 2FO9A 3BG4C 4NA7A 4VGCC 2BLVA 2FOHA 1S84A 5EQRA 1G30B 2A4OA 2QAAA 1SPJA 1CHGA 1ELAA 1A46H 3V12A 1TGTA 4HI3A 3PROA 2XYAA 1JRSA 1HGTH 3P8FA 3MU1A 1O3PB 1OX1A 3A87A 3UNSA 4AZ2B 1AD8H 1A3BH 1G32B 1D3TB 1HLTH 2CN0H 2OXSA 2FESH 1ZHPA 3RP2A 2P93A 3GICB 3HGPA 4MTBA 5DG6A 1UMAH 1SHHB 2G5NA 2ZTYA 4B2BA 2DE8A 1RFNA 5ETXA 2BD3A 2Y7XA 2FIRH 2WYGA 2BD5A 3EA9A 1IQHA 1V3XA 3NWUA 4ISHH 5F8TA 4GVUA 1CA0B 1XUIA 3LC5A 4NSYA 3TK6A 1KXBA 3SUFA 4Z6AH 3SNEA 4OS4A 1S0QA 4E06H 2QV1A 3LGYA 3NUMA 3ELAH 2ZU3A 3DD2H 1OPHB 3I77A 4NWKA 3EQ0H 5C1XA 4MVNA 1W12U 2R2MB 4K2YA 1PPCE 4D8NA 2ZKSA 4WWYA 3GDSA 2W7SA 4E7RG 2BVXH 5TCCA 1PQ7A 4A1XA 1GJCB 1C2DA 1GMHG 1TNJA 1YBWA 1DICA 1BMAA 1ZRKA 1LPZB 1TGBA 3TJNA 1SHYA 3SU5A 3ZV9A 2J92A 3HK6B 1BHXF 1K1PA 2P94A 1DVAH 3S9AA 5I46H 3GYLB 1C2KA 1K21H 2A32A 2G81E 4I8LA 3PMBB 3RC4A 1GI4A 2ZDMA 2G51A 2QIQA 4Q7ZA 3OTJE 1BTHH 5DPAA 1ELTA 1ELFA 1ARCA 1MTVA 4DJZB 1S81A 2FEQH 2NU1E 1TIOA 1W2KH 1QL7A 4X2WA 4Y8XA 2AEIH 2GGVB 3NXPA 1P3CA 2RCEA 1C5NH 3QWCH 1Y5AT 3M7UA 4ISOA 3PLBA 2QC2A 1OWDA 1SGIB 3LOXA 1H4WA 1TRMA 2FOGA 1SQAA 4X0WU 2BOKA 4JZDH 1BRBE 4PROA 3MO9A 1CT2E 4XE4A 1HNEE 1AHTH 1DWDH 2ZF0H 4ZAEA 2B8OH 4D9RA 2GV7A 4CH2B 5A0AE 2C8XB 4FUBA 3O8DA 4FU8A 1O32A 3MH4A 2TRMA 3SU2A 1EAUA 3RU4T 2ZTXA 3OY5U 3A7XA 1UVOA 1ZPBA 3QO6A 1NM6A 1SVPA 2ODQA 2JH5D 5GCHG 1ELBA 4K8BA 3L3TA 1W0ZU 1AFQC 4ISNA 2B7DH 5I25A 2VJ1A 1QQ4A 4X6NA 1BRAA 3RXAA 2F9OA 2VWMA 1P9UA 3OY6U 4ESTE 1C9TA 2BY7X 1B7XB 3BTWE 4I31A 2A7HA 5A2MH 1L4DA 1FJSA 3ZV8A 1EP6A 5DP8A 4I8JA 2B9LA 3UWJH 7KMEH 4YLUA 3ZZDA 1GI2A 3GY4A 3PO1B 1G3DA 4X2XA 5AHGH 1TPPA 1C1UH 1BT7A 1MTSA 1MZAA 4XBDA 3ATKA 1A5IA 4CREA 1FY5A 2QXGA 4ZKRU 2VWNA 1GBBA 2UUFB 1L1GA 2CV3A 2B5TB 3UIRA 2ZCHP 2RA3A 1AFQB 1P03A 1IQLA 1O2GH 1D3PB 2O8LA 1SGTA 5FCKA 4JK6A 1A7SA 1YCPK 1O38A 5E0GA 1S85A 4FVDA 3MHWU 1YCPM 4X8TH 1QY6A 4WMDA 2QXHA 1GBCA 3I78A 2J38A 1EAIA 4FUHA 1V2ST 4ABBA 1LPGB 1GG6C 2QN5T 1C5SA 2GD4B 1SLUB 1O2KA 2A31A 1C1NA 1P8VC 3ITIA 4FU7A 4X1SU 2A5KA 1DWBH 1LCYA 4IN2A 4FU9A 2UWLA 1UK4A 1GL1A 2UWPA 3UFAA 5K7RA 1C5RA 1KXAA 1SOZA 3TGKE 5C67A 3ATLA 1BHXB 1XUHA 5FPTA 2D1JA 2VB0A 2QXJA 3LGVA 3UPEA 3KIDU 2AMDA 1OYQA 1SFIA 4ABFA 1TBZH 2GTBA 3Q3YA 1YPKH 4B75A 3NPSA 4DGJA 2WUCA 5HM2A 3AAVA 4UD9H 4CHAC 3MNXA 4THNH 3HKIB 3ZZ9A 1A1RA 1MZDA 1GMDG 4K69A 1EJAA 1TA2A 3RXFA 1O5BB 1QBVH 2ZEBA 5EPYA 1Z71A 2GCTC 3A86A 1Q2WA 2M5TA 3ZZ8A 3SNAA 4F49A 3GCNA 1QRZA 1O2UA 1YM0A 3Q00A 5ABWA 4NCYA 1C1SA 2ZFQH 1KY9A 1O5AB 3UOPA 1F2SE 4BAHB 4GHTA 1AFEH 1DUEA 1ANDA 1QL8A 4NGAH 3A8AA 1XUKA 1NS3A 1TWXB 3U69H 3ZYEA 1ZGVA 1SBWA 2VU8E 1GHBG 2XRCA 1EQ9A 2ZHEH 4ISIH 3MTYA 3SO3A 1HAPH 1WTHD 1P09A 4H4FA 4CBNA 4FUFA 4TY7A 3ZZ4A 3SI3H 1OP0A 1NROH 3LDXH 3TGIE 4FUEA 2BDHA 4NIYA 4A92A 2H5CA 1GBTA 2Z6BD 3BTFE 2PR3A 4X2VA 2A5AA 3AVZA 4AFZA 3RXQA 1UO6A 4Q7XA 2J4IA 3RU4D 1Z1JA 3TJVA 1MBQA 3LU9B 1W0YH 2ZU5A 1KTSB 3URCA 1GHZA 3SHCH 2FI3E 1WTGH 5H4IB 4JCNA 2VIQA 1FY3A 1EPTB 1G37A 4AYYB 3MH7A 1O34A 3P6ZB 4KTCA 3RXUA 3BEIB 3RXKA 2DE9A 3BIUH 3CENA 5JYIA 3KQDA 1SQTA 1O5CB 1VCQA 3SJ9A 4D76A 4ZMAH 1A0JA 1O3MA 2B0FA 1YKTA 3NK8A 2BLOA 3LJJA 1UCYH 3TITA 1EKBB 1V2UT 2XC0A 1AB9B 3MOCA 2ZQ1A 1QJ7B 3QK1A 3SQHE 3M35A 3A7YA 3RM2H 2FPZA 2UWOA 2BQWB 2VGCC 1WU1A 1EJMA 2GCHF 2BOHB 2W3IA 1TPAE 3OX7U 5T6FA 1NFWA 2ZHQH 2HPQH 1WCZA 2ZDVH 2TGAA 5G4BA 2IOTA 2A7JA 1EAWA 1LHDH 1NU9A 5JBCS 1GBLA 1L1NA 1GHAF 1ANBA 1NFYA 3TPIZ 6CHAC 3PMAB 2XW9A 3L6PA 2A7CA 1O3IA 1YC0A 2FX4A 3UNRA 2BQ7B 5EPNA 1YGCH 5GPIB 3URDA 3GCHC 1DT2A 1GHVH 3A7WA 1O3GA 5AF9H 2R2WU 1MQ6A 5GDSH 4FUCA 1AVWA 1L0ZA 2AYWA 2A5IA 5JB9S 1O2HA 2GKVE 3PWBA 1SR5C 1MKWH 1GVKB 3SV8A 2BZAA 3RC6A 1DITH 1TGCA 1G3BA 6GCHG 4CH8B 3RLYH 3SNDA 1OXGA 1VJ9U 3BTTE 1Y3WA 1F0UA 1ZMNA 6CHAB 2Z9LA 3MO6A 3ZZ5A 3ZZ3A 5L2ZH 2F3CE 2AGIX 4BOHA 1A3EH 3MO3A 2XBXA 1LMWB 2VIDA 2ZG0H 3HGNA 3GCHB 5LPFA 3IG6B 1SGPE 1DE7H 1O2LA 3M5NA 3RXHA 3ZVDA 4NFFA 4JZIA 2GT8A 4CR5A 3ATMA 1RTLA 1GJDB 1LVBA 2ZECA 1A61H 1C2FA 1SGEE 3M3TA 2BY5X 2VVVA 1CSOE 5EOKA 3SZNA 4Y11E 1BDAA 2STAE 4YT6H 3TIUA 3RMLH 2XBYA 1O3FA 2GZ7A 1SLXB 1CT4E 2BD2A 2FX6A 1GCDA 2OCVB 3F9GA 4X1QU 4UFGH 1NFXA 4DY7B 2SGPE 1XKBC 2DUCA 4HZHA 4IBLH 4DURA 1TRYA 1ZOMA 3OSYA 5EQQA 3SUGA 5DJ7A 1O3LA 1GMHF 1Q31A 4WVPE 5FHTA 4UEHH 1V2KT 1ZRBA 1AN1E 1MTNC 1BRUP 1BIOA 1BMNH 3MU8A 3LONA 1O2YA 5FX5A 1OKXA 2BY9X 1AY6H 2Y6TA 2WPLS 2ZHFH 1FLEE 1LQEA 5FX6A 1IQKA 3LGTA 4KELA 3BG4B 2A0QB 2BDYA 1E0FD 5LGOA 1C4Y2 5A8YA 1MTUA 1THRH 1TNIA 3UR9A 3W95A 4DIHH 3BTEE 4X8VH 1RTFB 4MLFB 3KQCA 4B2AA 2RDLA 1ZMLA 2HLCA 2HPPH 2J2UA 2G8TA 1FIZA 5GXPA 1C2LA 1CU1A 1K22H 1MTNB 2I6QA 1WUNH 1BMLA 1KXDA 2RA0A 4KTSA 3HK3B 2Q6FA 3F1SB 2WPHS 2SGEE 2BZ6H 5LH8A 5PTPA 1AMHA 2VH6A 2ZDLA 3T26A 1OP8A 1QL9A 2PFEA 3MYWA 2ANYA 2EI7A 4JZEH 3SUEA 5GCHF 6LPRA 2QGRA 4BANB 1GDNA 1QA7A 1HRTH 2SGFE 3ATWA 4GLYA 2R9PA 2VVUA 5EODA 4Z0KA 3UQOA 3BTQE 3CS7A 1GJ7B 1MCTA 2C90B 2CGAA 1UK2A 1TFXA 2CHAC 5DP4A 2F9VA 5CMXH 1OP2A 1NC6A 1TA6A 1D4PB 3QX5H 1GJBB 3QUMP 2NU3E 2F9BH 2TGPZ 1J16A 1GBEA 1VR1H 4OGXA 4BNRA 4DCDA 2QF0A 1JBUH 1LPKB 1NN6A 2ASUB 1VITH 3P92A 5BPEA 1BTUA 1JXPA 2CF9H 2GDEH 2WPKS 1ZSLA 3IWMA 2V3HH 1LHEH 1QJ6B 3K2UA 4JZ1A 4ABJA 3E0PB 1OWHA 1RRKA 1KDQB 3VB6A 4VGCB 2W7UA 3BTKE 1GJ8B 2FM2A 2CHAB 1TAWA 2OLGA 1C5PA 3T28A 1ESAA 1O5DH 1AVXA 4AN7A 3GYMA 1HAGE 2SGAA 1C5ZB 1DSUA 3SU1A 4OS7A 1NU7B 1E34B 2TPIZ 2ZFSA 1AWHB 3PB1E 3P95A 1YPHE 1TQ7B 1EZXC 1QNJA 1DX5M 1UJ1A 1S83A 4YZUA 4AG2A 1AE5A 3R0FA 2F9UA 3GDVA 1FN6A 3EE0B 1C5VA 1HUTH 3R3GB 1DXWA 1O3KA 1XMNB 4X8SH 3IITA 1Y3XA 5SGAE 5AFZH 3PTBA 1J9CH 2PLXA 2ZFTA 1QIXB 1GMDF 4OS6A 1LTOA 1QHRB 4GCHG 1YLDA 1GDUA 5T6GA 1F0RA 1TNHA 2XBWA 1C1PA 1O2ZA 1K1OA 2PTNA 2C93B 3SN8A 4Y76A 1Y8TA 1Y5BT 3SJ8A 1O3CA 3KF2A 1T32A 5FCRA 3F9FA 3TJUA 3ZZCA 5DP3A 4BAQB 3VB3A 2ZWLH 2GX4A 4ZXYH 1YCPH 4JMYA 4UONA 3RXRA 1AQ7A 1FV9A 2H2ZA 1SGFG 4UFEH 2ZCKP 1EATA 5A0CA 1A0HB 1N6YA 3P8GA 1GHBF 2Y82A 1C1MA 1Y3UA 2GV6A 4O3TA 5C1YA 4FUDA 1W8BH 4ZXXH 1SG8B 2GZ8A 1QBOA 4O9VA 1C2IA 1FIWA 1HYLA 1E36B 1TE0A 1FUJA 3K65B 1V2VT 1MKXK 5LPEA 1A2CH 1SB1H 3EAJA 1C4U2 1ZTLA 3QGNB 1VCWA 3KN2A 4U2WA 2P16A 1EZQA 1DDJA 1O3EA 3UQVA 2OC7A 4KP0A 1XXFA 4RN6A 1EZSC 1Z1IA 5TCAA 3N7OA 3U8OH 1HAIH 3A8BA 5FAHA 3C27B 1WYKA 3RMNH 3MNBA 1PJPA 3KQBA 4DT7B 3A88A 3A8DA 5DO4H 2BXUH 2R3UA 3VXEH 2QXIA 2KAIB 4WH8A 1C1OA 1SFQB 2WPMS 4K60A 2CJIA 3BG8A 4NZLA 1KXEA 4HFPB 1HIAB 2ILNA 2JETC 1J8AA 1C1VH 1HBTH 3AW1A 1OWIA 1YPGH 4IC6A 3EDXB 3UY9A 1NPMA 1HAYB 4BTTB 1HJ8A 2FODA 2Z3CA 2AGEX 1THSH 2PW8H 4ZKSU 1KXCA 3NKKA 1GVLA 1HXEH 3A83A 3B23B 2ZU1A 3LPRA 3MFJA 1KDQA 1KTTB 3SHAH 3E91A 3O8BA 4R8TB 1F5KU 3M7TA 1IHSH 1SLVB 4I7YH 4ZHMU 2AMPA 2PGBB 2YOLA 4XSKU 1MD8A 2PKSC 1BOQA 2F91A 1GI1A 2VIOA 5F6MA 5E0JA 2XWAA 5AFYH 5E0HA 1TX6A 1ZHRA 1C5LH 2PV9B 4F4OC 1EOJA 1IQEA 4IS5A 1S6HA 1SGNE 1PFXC 2XWBI 1HDTH 1O3DA 3B9FH 1CBWC 1K1NA 1DLKB 2P95A 8LPRA 4CR9A 4JK5A 3TGJE 1GBHA 1V2OT 1GI8B 3GY2A 3NZIA 4MPVA 4GPGA 1BTZA 5GIBA 1VITG 2SNVA 2C4FH 1O2VA 2BD9A 3KHVA 1RS0A 6GCHF 1QQUA 5GJ4B 4H42U 3VB7A 2ZFPH 1CT0E 1V2LT 4YM9A 1WSSH 5JBBS 1YLCA 2ZGBH 1NO9H 1V2WT 4YESB 2C8YB 4Y7BA 2XBVA 4X1NU 4O97A 2XTTB 5EW1H 2VIVA 1AKSB 3PYHA 2GDDA 1E35B 1GI5A 2SGDE 2FS9A 3UREA 2Z3DA 2Z9KA 1MTWA 1SGRE 1MMJN 3RMOH 1HJAC 3BIVH 1O0DH 1C2GA 3P8OA 4K1SA 2BXTH 2OQUA 1GG6B 3SBKA 1J14A 3M5OA 3E3TA 1TX7A 4GHQA 1K1JA 3AASA 1P9SA 3SJOA 3SORA 1O37A 3PTNA 3FZZA 4RKJB 1L2EA 4I32A 3B8JA 2C8WB 4AYVB 5DKMA 3QDZB 3ZZ7A 4SGBE 1TRNA 5CE1A 1FY1A 2TGDA 4O03A 1XKAC 4Y79A 2O8TA 3ATIA 4ZHAA 1ELCA 2NU4E 3S0NA 1AUJA 2GP9B 2ZNKH 3MU4A 1ETSH 3VXFH 4CHAB 3RUOA 1P12E 1HAOH 1DOJA 4UFFH 1GI3A 1GI6A 3E1XB 3LGIA 5EXLA 2KAIA 4BAOB 1T8NA 2GCTB 3T5FH 2R0LA 3DUXH 3RXCA 1HIAA 2ZDAH 3SU3A 1BTXA 3SQEE 3ZVFA 1Z6EA 9LPRA 1W3CA 1K9OE 1TGSZ 3UOUA 3PM3A 5JDUB 4RSPA 3T29A 1XUFA 1PYTD 2PUQH 1O3BA 1C2JA 8GCHG 1GL0E 1P11E 1PQ5A 1C5WB 1EB1H 3D65E 2D2DA 5DP5A 3A85A 1C1TA 1XM1A 3RC5A 3FANA 3ODFA 4B73A 1P04A 4AB9A 3AAUA 3MMGA 4AG1A 1S6FA 3A8CA 1EB2A 1C2MA 3TK9A 1QBNA 2FOBA 3VPKA 1H9LB 1B0EA 5F8ZA 3SJIA 3BV9B 1EX3A 1DY8A 1DPOA 1V6DA 2VWOA 1YPMH 1AE8H 1ELVA 3RXEA 5DP9A 1QRXA 1RXPA 1OWEA 3FAOA 4NG9H 2HGTH 3PMJA 3VGCC 3AW0A 3RXJA 4ISLA 1DXPA 5AVDA 1BJVA 1T7CA 1CQQA 1GDQA 1WV7H 3K6ZA 5FBEA 2BTCE 4WMFA 3SGAE 1DM4B 2FXRA 3FP8E 2FTMA 4AOQA 1Z8IB 2P8OC 1O2MA 1SGYE 3M3SA 2ZU4A 3MNSA 4K3JA 1TX8A 3E90B 1ZTKA 1GBAA 1ANEA 1O30A 2J34A 1TNLA 1FAKH 1QR3E 4MNVA 1UTKA 4YOJA 4UE7H 1OOKB 1IAUA 3GOVB 1XVMA 1ELEE 3MH6A 3RXLA 1J15A 1O3NA 3E0NB 3SV9A 1DFPA 2FI5E 2BVSH 1T4UH 1OYTH 1S5SA 1QB6A 4Y10E 1AKSA 2JKHA 3VGCB 1QTFA 3DT0H 2NU2E 5C2ZA 4YLQH 2ZPQA 4FUIA 4AGJA 2IN2A 3F6UH 2VGCB 2JH0D 1YYY1 1DY9A 2GVFA 1GGDC 2FLBH 1YPLH 2P8OB 2BDIA 4XOJA 1O2WA 3P70B 5ESTE 1TNKA 4RKOB 2FDAA 4Y71A 3BTDE 1NRRH 1FPCH 1IQNA 3RDZA 3RXTA 2J95A 2BDAA 2A4RA 1GCTC 3BF6H 2ANWA 5FPYA 4BXWA 5JB8S 2ZA5A 3TNTA 5T6DA 3QTOH 1SI5H 5IYTA 3GY8A 2BVRH 5EXNA 3UNQA 3RXPA 1P0SH 4AGKA 1LHFH 2FS8A 1A0LA 2XCNA 1RIWC 2C8ZB 2VNTA 2V6NA 1U6QA 1K1MA 1Z6JH 3LH3A 1JIRA 2EI8A 1Y5UT 1X7AC 3PMHB 3QZRA 1YPJH 4CRFA 2QF3A 4TPYA 2Z9GA 1ETRH 1PPEE 1Y59T 2BMGB 3T27A 2G55A 2NU0E 1D3DB 1MQ5A 1C1RA 1CE5A 3ENSB 4WJG2 1B5GH 3ZZ6A 5EW2H 1GMCG 1SLWB 4GCHF 5HGGA 1ID5H 5J4QA 2NWNA 3SV6A 1PPZA 1YP9A 1SQOA 5C1UA 1V2QT 2FOEA 1TPOA 2ZTZA 4OS5A 1BBRK 3QN7A 2GMTC 1QCPA 2ZQ2A 1RIWB 5F03A 8ESTE 2D8WA 4J2YB 3SOSA 3GY5A 1LVOA 4TYDA 1IQGA 5ESBA 4AORA 1RJXB 1Z8JB 2O8MA 1V2TT 2HWLB 3LJOA 2W3KA 3SV7A 1EP5A 4DG4A 1UTOA 2VVCA 4A5TS 7GCHG 3TH3H 1GI7B 1O3JA 2FOFA 2ZHDA 1OSSA 1HV7A 2OP9A 4WF8A 2ZGJA 4XDEA 4NIWA 3V7TA 2V35A 4XBCA 4TY6A 3EA8A 1C2EA 2OC0A 4B71A 2C3SA 1P01A 4Y8YA 2STBE 2ZO3H 2A4QA 2VWLA 1O2QA 4E05H 2BDGA 3D49H 1QJ1B 2K1QA 1G36A 1LVYA 1PQ8A 1EUFA 3SU6A 1DWEH 1G3CA 3M36A 4ZKOU 7ESTE 3TLOA 2Y5GA 1SC8U 1WQVH 1BBRE 4Y8ZA 4YT7H 3SNBA 5BRRE 1KLJH 3KGPA 1ZR0A 1GBMA 1T8OA 3H7OA 1ETTH 1KIGH 1VJAU 4FXGH 3QGJA 1BQYA 3LC3A 1JIMA 2EI6A 1K28D 1C5YB 2ALVA 3LKWA 2BLQA 5B6OA 1F7ZA 1P02A 3JZ2B 2FP7B 4MNXA 2VH0A 1E38B 2Z94A 1NTPA 1IQIA 3DFLA 4ABGA 1G2MA 2BB4A 4KKDA 3P17H 1ARBA 1O2PA 3SNCA 3A80A 1UTPA 2WINI 4FUJA 2G4UA 2ZC9H 2Y5FA 2BX3A 2A1DB 3C1KA 4X6OA 1W10U 4B74A 2P3TB 2IJOB 3ZYDA 2WV5A 2BY8X 1GPZA 1Z7KA 4U32A 3E8LA 3VB4A 2AIQA 4Y0ZE 4TWWA 1MH0A 5DP7A 4LZ1H 1WAYB 3KNXA 4D7GA 1DANH 1GVZA 4FUGA 5EG4A 4CRBA 2FI4E 1CA0C 1N6XA 1NESE 4WH6A 3V3MA 1INCA 1ZHMA 1AUTC 1MKXH 1GHXH 1K1LA 4UDWH 1HAVB 1T4VH 1ACBE 2ZIQH 4KTUA 5E2PA 2ZHWH 1O2JA 4QT8C 4B76A 1F5RA 1WQSA 2XC5A 1BITA 2AFQB 2OTVA 3STJA 2PKAB 2ZCLP 3W94A 1G9IE 2F9PA 1JOUB 1ZLRA 3TH2H 4GAWA 4AFUA 3TU7H 1W14U 1W13U 1YPHC 4Q7YA 4ABHA 1P3EA 1VITF 4X6MA 1FQ3A 1IQMA 5DGJA 1O2NA 1BB0B 3U1JB 5C3NA 5A0BA 3DHKH 1Z8GA 2IPHA 3S9CA 2PHBA 3PLKA 3SJKA 4MPWA 3O8CA 1AI8H 5CHAC 4YOGA 3SU4A 1MD7A 2XNIA 4IC5A 3M37A 1ZYOA 3G01A 1CGIE 3RXVA 3A7TA 1KXFA 1P2NA 1NRSH 3GISB 1XX9A 4ABIA 5HYOA 3H7TA 1P2JA 1SGCA 1O2SA 2OBQA 5FPSA 3OYPA 1NZQH 1UTMA 2HNTC 3KL6A 1QFKH 3GCTG 4U01A 2H9EH 2Z7FE 1D3QB 5J4SA 1PPHE 4DW2U 4NZQA 2AIPA 2HNTE 3Q76A 4WXVA 3TH4H 2WPJS 2O9QA 1TGNA 1PPFE 3UTUH 2BLWA 5CHAB 3U98H 5EQSA 1W7XH 4E7NA 4BXSA 2SGQE 1ANCA 1AZZA 1WOFA 3K9XB 1GJ9B 1C5TA 1GJ4H 2FTLE 1DSTA 1GBKA 1H9IE 4IGDA 3LGUA 3FP7E 2QY0B 2ANKH 2BD4A 4XFQA 4R0IA 2ANMH 3MI4A 5F8XA 1D9IA 3LH1A 3DFJA 3PLPA 4ZHLU 1NRPH 3Q3KA 2OD3B 1LKBA 4K5ZA 3U9AH 3MWIU 3E16B 3S9BA 1TB6H 5L6NH 4TPIZ 4IMQA 1F0TA 2F83A 4MPXA 2AERH 3LIWA 2BD7A 1NT1A 3QZQA 2ESTE 1ZGIA 3FP6E 1FAXA 1IQFA 4YO9A 8GCHF 5GWZA 1MU8B 1ABIH 3D23A 2EC9H 3EYDA 2HRVA 4CRAA 1FZZA 1O5EH 9ESTA 3RXGA 3RMMH 3A84A 3RXSA 4ASHA 1HFDA 3PO1C 1CHOG 1ELGA 3EA7A 2OQ5A 2Y81A 2HVXA 3UR6A 2Z9IA 1NFUA 1AGJA 2GZ9A 2ODYB 1BUIA 1FY8E 3SGQE 1BRCE 1O31A 2QCYA 2YNAA 4UFDH 2OC1A 4GUXA 2YNBA 2D26C 2UUJB 2AMQA 5FXLA 1H8DH 1UTNA 1HAVA 2BX4A 2PKAA 5EU8A 3F9EA 1BJUA 1QRWA 1XUJA 1T31A 1FONA 2EA3A 1XVOA 2Z3EA 4I8GA 3P8NA 2WV4A 1C9PA 1ZMJA 2THFB 4O3UA 3KQEA 1C2HA 3S7HB 2FOCA 2ZPRA 4XBBA 1O35A 1OWKA 3T62A 2JETB 2WYJA 1O2IA 1P2OA 1BZXE 1G2LA 1TQ0B 1QURH 3MNCA 1SGQE 1O3HA 3FFGA 1ABJH 1O2RA 1ZPZA 3L33A 3FVFB 4OS1A 3V0XA 1HAZB 3Q77A 2EEKA 3M61U 4LZ4B 3BTHE 3HKJB 3ZVBA 4FVBA 1IQJA 4BTIB 1S82A 3CP7A 3I29A 5C5NA 1CA8B 1CVWH 4GSOA 1NY22 2V0BA 2ZDKA 3BSQA 1SGFA 1LKAA 2UUYA 4MDSA 1CGJE 2BYAX 3RXIA 4BAMB 2PKSB 1UK3A 1TMBH 1FDPA 4AFQA 1JMOH 3NCLA 3A89A 5C5OA 1N1LA 3LT3A 4NFEA 2J9NA 4X8UH 1PQAA 2LNCA 1AIXH 4NIXA 1A5HA 2O8WA 1IOEA 2Y80A 3A7ZA 1CBWB 1FPHH 4A1TA 2GT7A 5FBIA 3ODDA 3RXDA 1QB1A 2ALPA 2BHGA 1CGHA 1EZUC 1C1WH 4YOIA 1EASA 2JH6D 4IW4E 3BTGE 5JPMH 4JYTA 4ABAA 1THPB 1N8OC 1LQDB 3VB5A 5A8ZA 1Z8RA 1TOMH 3PWCA 3TJOA 1EXFA 4DIIH 4Y7AA 5HXFA 1LDTT 2G00A 1G3EA 4ZH8A 3LGWA 2G52A 2FWWA 3SU0A 2RG3A 3BN9A 4INLA 4TWYA 1H9HE 4DOQA 2I6SA 1ZSKA 2P59A 3MH5A 1C5UA 5DK1A 3OU0A 4JYUH 4ABEA 3S7KB 4Y0YE 3U8RH 1P2KA 1ZJKA 3FZDA 1Y3VA 1DUAA 1TLDA 1GMCF 4B2CA 1MAYA 1TABE 1HJAB 1UTLM 1WBGB 3ESTA 1TMUH 2H6MA 2XCFA 3PV4A 1VCPA 1BTPA 4WXIA 3U8TH 1RD3B 5TJXA 4D7FA 1N8OB 1TBQH 1LO6A 1O36A 1ZTJA 5EGMA 4ZUHA 1QGFA 1SMFE 1MAXA 1P2QA 5HMAA 1EPTC 4LK4A 3V13A 2AS9A 2VIWA 1VGCC 1HAHH 2QA9E 4H6SB 1ESTA 2VINA 3M7QA 4CRCA 2SFAA 1HAXB 2BQ6B 1P06A 5A09A 1DS2E 3STIA 7GCHF 3GY6A 4IN1A 2ULLA 1C1QA 2UUKB 3QLPH 1F0SA 1FNIA 1O39A 1UTJA 4X2YA 4Q2KA 1EOLA 3ZVAA 1FY4A 1C5MD 2BDBA 1UVUH 3QTVH 1SSXA 1GJAB 1BA8B 2PSXA 1RGQA 3TK5A 3RXMA 2BD8A 4LXBH 1AB9C 1Y3YA 1O3AA 4K8YA 1E37B 1TBRH 4I33A 2ODPA 1ZSJA 2ZGCA 1UVTH 1P05A 3RLWH 4K1EA 2V3OH 1ORFA 1PYTC 2PTCE 1KSNA 1LHGH 2Q6GA 1AO5A 2J94A 4YTAA 1VGCB 1V2PT 2QYIA 3KEEA 4U30A 3CS0A 2WUBA 3F9HA 1C5XB 1UVPA 2H9TH 1O5GH 2G4TA 4MNWA 4Q80A 7LPRA 1W11U 3MU0A 1ZZZA 1GHWH 4OS2A 2SNWA 1Q3XA 2Q1JA 1AU8A 2PWXA 1J17T 4INKA 1SGDE 1O33A 1AZ8A 1K1IA 1LVMA 1T8MA 3RU4E 2ZGXH 1A4WH 2HALA 4ZKNU 1BBRH 1W7GH 4NWLA 3A7VA 4Y6DA 1H8IH 1O2XA 4B1TA 1TMTH 4HGCA 4JYVH 2ZZUH 4CRDA 1A5GH 1TYNA 3A81A 2ZFFH 2W5EA 4BTUB 1TPSA 1ELDE 1HJ9A 4MNYA 2ZDNA 4HTCH 3ZVEA 2FZZA 5T3HA 2ZGHA 4A1VA 2A2XH 3M5LA 1GI0A 5JBAS 1EAXA 2O8UA 3HPTB 4I8KA 3UUZA 4BAKB 3TNSA 1UHBB 4ABDA 1UTQA 2F9NA 4SGAE 2PSYA 1EJNA 5JBTA 1P10A 1FMGA 1V2MT 1BTYA 1GBFA 2TIOA 3RM0H 3VEQB 4MG3A 3SGBE 3SV2H 4X1PU 3F68H 1C5QA 1XUGA 2BM2A 5E8EH 1FN8A 1DWCH 3SW2B 2R0KA 2FYRA 2AH4X 1GBDA 2HOBA 4J1YA 3UWIA 1ESBA 3VFEA 1T8LA 3RXBA 1KLTA 3S69A 4MQAA 2ZPSA 3D62A 5C20A 1MBMA 3GY7A 4NSVA 4JZFH 1PPBH 4NIVA 1P57B 1FI8A 4LOYH 1C4V2 1GGDB 2FOAA 4CBOA 1O3OA 5LPRA 3DA9B 1JWTA 2Y7ZA 1O2OA 1BTWA 4WY3A 1NRNH 2R3YA 2A4GA 3KCGH 1V2RT 2H9HA 4X6PA 2Y5HA 1O2TA 1P2MA 1GWAA 1YPEH 3ZZAA 1DLEA 1GCTB 4A7IB 4WMEA 1MU6B 2H1UA 1C5OH 3H5CB 4ZROA 1GI9B 1BMMH 5A8XA 1ZJDA 1D6RA 1UCYK 2Z9JA 3A82A 1HXFH 1TALA 2VIPA 4OGYA 1NRQH 3GCTF 1MCVA 2ZU2A 1SOTA
chains in the Genus database with same CATH superfamily
2TBSA 2FOMB 1TONA 1GBIA 3GDUA 2TGTA 5L2YH 3T25A 4INHA 4MPUA 2CXVA 1IHTH 1XXDA 1M9UA 2P3UB 3O8RA 2OUAA 1W0KD 3BEFB 2M2AA 5HM9A 2W26A 3BTME 3E6PH 3U1IB 1FXYA 1OWJA 1RTKA 4D9QA 2OINA 1EPTA 1V2NT 1TNGA 4AB8A 2LPRA 1GBJA 1SL3A 1B0FA 1LHCH 1AWFH 4DVAU 2PUXB 3EGKH 2A45B 1E1RD 3ZVCA 2G5VA 3JZ1B 2PGQB 1L4ZA 1QA0A 3GCOA 2QF5A 1WXRA 3Q3XA 1JRTA 1HPGA 3PRBA 1YF4A 4AFSA 1H1BA 1O5FH 1UCYE 3WY8A 6ESTA 1HB0B 1K2I1 4KGAA 2GMTB 1MKWK 2CMYA 3SI4H 4A6LA 8KME2 1L1JA 3HATH 2OC8A 2A2QH 3RXOA 1MUEB 2OBOA 2GJGA 1V2JT 5EXMA 4F48B 1KYNA 3GY3A 4K1TA 4M7GA 1KLIH 3SUDA 1F92A 1BMFD 1F5LA 1P2IA 2BDCA 3OFND 3M3VA 4IMZA 1QB9A 3ZZBA 1HCGA 2AGGX 2HNTF 1CO7E 2H5DA 1CHOF 2BY6X 1GJ5H 4AX9H 2Q6DA 3TVJB 2ZFRH 4NA9H 5L30H 1BCUH 5E2OA 2WPIS 2CF8H 2W6JD 3BEUA 4CRGA 1TOCB 5DP6A 1S0RA 1D6WA 1UHBA 1ZPCA 4NA8A 1VZQH 2ZI2H 2P3FH 2XC4A 3MU5A 3DSPA 3K6YA 3M5MA 4H6TA 5IDKA 2GCHG 1AVGH 2FYQA 3ZVGA 1EFRD 2FMJA 1UVSH 2ZP0H 4X1RU 1GHYH 1OS8A 4I8HA 3T2NA 5K0HA 1GJ6A 2J98B 2XXLA 1GHAG 1PPGE 2FLRH 2FO9A 3BG4C 4NA7A 4VGCC 2BLVA 2FOHA 1S84A 5EQRA 1G30B 2A4OA 4YXWD 2QAAA 1SPJA 1CHGA 1ELAA 1A46H 3V12A 1TGTA 4HI3A 3PROA 2XYAA 1JRSA 1HGTH 3P8FA 3MU1A 1O3PB 5T1VA 1OX1A 3A87A 3UNSA 4AZ2B 1AD8H 1A3BH 1G32B 1D3TB 1HLTH 2CN0H 2OXSA 2FESH 1ZHPA 3RP2A 2P93A 3GICB 3HGPA 4MTBA 5DG6A 1UMAH 1SHHB 2G5NA 2ZTYA 4B2BA 2DE8A 1RFNA 5ETXA 2BD3A 2Y7XA 2FIRH 2WYGA 2BD5A 3EA9A 2RDEA 1IQHA 1V3XA 3NWUA 4ISHH 5F8TA 5EJLA 4GVUA 1CA0B 1XUIA 3LC5A 4NSYA 3TK6A 1KXBA 3SUFA 4Z6AH 3SNEA 4OS4A 1S0QA 4E06H 2QV1A 3LGYA 3NUMA 3ELAH 2ZU3A 3DD2H 1OPHB 3I77A 4NWKA 3EQ0H 5C1XA 4MVNA 3F3BA 1W12U 2R2MB 4K2YA 1PPCE 4RI0A 4D8NA 2ZKSA 4WWYA 3GDSA 2W7SA 4E7RG 2BVXH 5TCCA 1PQ7A 4A1XA 1GJCB 1C2DA 1GMHG 1TNJA 1YBWA 1DICA 1BMAA 1ZRKA 1LPZB 1TGBA 2WHXA 3TJNA 1SHYA 3SU5A 3ZV9A 5C0UA 2J92A 3HK6B 1BHXF 1K1PA 2P94A 1DVAH 3MQKC 3S9AA 5I46H 3GYLB 1C2KA 1K21H 2A32A 2G81E 4I8LA 3PMBB 3RC4A 1GI4A 2ZDMA 2G51A 2QIQA 4Q7ZA 3OTJE 1BTHH 5DPAA 1ELTA 1ELFA 1ARCA 1MTVA 4DJZB 1S81A 2FEQH 2NU1E 1TIOA 1W2KH 1QL7A 4X2WA 4Y8XA 2AEIH 2GGVB 3F2GA 3NXPA 1P3CA 2RCEA 1C5NH 3QWCH 1Y5AT 3M7UA 4ISOA 3PLBA 2QC2A 1OWDA 1SGIB 3LOXA 1H4WA 1TRMA 2FOGA 1SQAA 4X0WU 3WWBA 2BOKA 3FKSD 4JZDH 1BRBE 4PROA 3MO9A 1CT2E 4XE4A 1HNEE 1AHTH 1DWDH 2ZF0H 4ZAEA 2B8OH 4D9RA 2GV7A 4CH2B 5A0AE 2C8XB 2J98A 4FUBA 3O8DA 4FU8A 1O32A 3MH4A 2TRMA 3SU2A 1EAUA 3RU4T 2ZTXA 3OY5U 3A7XA 1UVOA 1ZPBA 3QO6A 4HG6A 1NM6A 1SVPA 2ODQA 2JH5D 5GCHG 1ELBA 4K8BA 1FX0B 4Z1MD 3L3TA 1W0ZU 1AFQC 4ISNA 2B7DH 5I25A 2VJ1A 1QQ4A 4X6NA 1BRAA 3RXAA 2F9OA 5DSFA 1E79D 2VWMA 1P9UA 3OY6U 4ESTE 1C9TA 2BY7X 1B7XB 3BTWE 1E1QD 4I31A 2A7HA 5A2MH 1L4DA 2EY4C 1FJSA 3ZV8A 1EP6A 5DP8A 4I8JA 2B9LA 3UWJH 7KMEH 4YLUA 3ZZDA 1GI2A 3GY4A 3PO1B 1G3DA 4X2XA 5AHGH 1TPPA 1C1UH 1BT7A 1MTSA 1MZAA 4XBDA 3ATKA 1A5IA 4CREA 1FY5A 2QXGA 4ZKRU 2VWNA 1GBBA 2UUFB 1L1GA 2K8IA 2CV3A 2B5TB 3UIRA 2ZCHP 4OM9A 2RA3A 2KM0A 1AFQB 1P03A 1IQLA 1O2GH 1D3PB 2O8LA 1SGTA 5FCKA 1H8ED 3SYJA 4JK6A 1A7SA 1YCPK 1O38A 5E0GA 1S85A 4FVDA 3MHWU 1YCPM 4X8TH 1QY6A 4WMDA 2QXHA 1GBCA 3I78A 2J38A 1EAIA 4FUHA 1V2ST 4ABBA 4P02A 1LPGB 1GG6C 2QN5T 1C5SA 2GD4B 1SLUB 1O2KA 2A31A 1C1NA 1P8VC 3ITIA 4FU7A 1UW7A 4X1SU 2A5KA 1DWBH 1LCYA 4IN2A 4FU9A 2UWLA 2LP6A 1UK4A 1GL1A 2UWPA 3UFAA 5K7RA 1C5RA 1KXAA 1SOZA 3TGKE 5C67A 3ATLA 1BHXB 1XUHA 5FPTA 2D1JA 2VB0A 2QXJA 3LGVA 3UPEA 3KIDU 2AMDA 3KQ5A 1OYQA 1SFIA 4ABFA 1TBZH 2GTBA 3Q3YA 1YPKH 4B75A 3NPSA 4DGJA 3DCLA 2WUCA 5HM2A 3AAVA 4UD9H 4CHAC 3MNXA 4THNH 3HKIB 3ZZ9A 1A1RA 1MZDA 1GMDG 4K69A 1EJAA 1TA2A 3RXFA 1O5BB 1QBVH 2ZEBA 5EPYA 2GCTC 1Z71A 2L6OA 3A86A 1Q2WA 2M5TA 3ZZ8A 3SNAA 4F49A 3GCNA 1QRZA 1O2UA 1YM0A 3Q00A 5ABWA 4NCYA 1C1SA 2ZFQH 1KY9A 1O5AB 3UOPA 1F2SE 4BAHB 4GHTA 1AFEH 1DUEA 1ANDA 1QL8A 4NGAH 3A8AA 1XUKA 1NS3A 1TWXB 3U69H 3ZYEA 1ZGVA 1SBWA 2VU8E 3F2FA 1GHBG 2XRCA 1EQ9A 2ZHEH 4ISIH 3MTYA 3SO3A 1HAPH 1WTHD 1P09A 4H4FA 4CBNA 4FUFA 4TY7A 3ZZ4A 3SI3H 1OP0A 1NROH 3LDXH 3TGIE 4FUEA 2BDHA 4NIYA 4Q4LA 4A92A 2H5CA 1GBTA 2Z6BD 3BTFE 2PR3A 4X2VA 2A5AA 3AVZA 4AFZA 3RXQA 1UO6A 4Q7XA 2J4IA 3RU4D 1Z1JA 2PP6A 3TJVA 2CK3D 5C0TA 1MBQA 3LU9B 1W0YH 2ZU5A 1KTSB 3URCA 1GHZA 3SHCH 2FI3E 1WTGH 5H4IB 4JCNA 2VIQA 1FY3A 1EPTB 1G37A 4AYYB 3MH7A 1O34A 3P6ZB 4KTCA 3RXUA 3BEIB 3RXKA 2DE9A 3BIUH 3CENA 5JYIA 3KQDA 1SQTA 1O5CB 1VCQA 3SJ9A 4D76A 4ZMAH 1A0JA 1O3MA 2B0FA 1YKTA 3NK8A 2BLOA 4M9FA 3LJJA 1UCYH 3TITA 3N7DA 1EKBB 1V2UT 2XC0A 1AB9B 3MOCA 2ZQ1A 1QJ7B 3QK1A 2OK5A 3SQHE 3M35A 3A7YA 3RM2H 2FPZA 2UWOA 2BQWB 2VGCC 1WU1A 3WWFA 1EJMA 2GCHF 2BOHB 2W3IA 1TPAE 3OX7U 5T6FA 1NFWA 2ZHQH 2HPQH 1WCZA 2ZDVH 2TGAA 5G4BA 2IOTA 2A7JA 1EAWA 1LHDH 1NU9A 3GS9A 1GBLA 1L1NA 1GHAF 1ANBA 1NFYA 3TPIZ 4DT4A 5JBCS 6CHAC 3PMAB 2XW9A 3L6PA 2A7CA 1O3IA 1YC0A 2FX4A 3KYGA 2BQ7B 3UNRA 5EPNA 1YLNA 1YGCH 5GPIB 3URDA 3GCHC 1DT2A 1GHVH 3A7WA 1O3GA 5AF9H 2R2WU 1MQ6A 5GDSH 4FUCA 1AVWA 1L0ZA 2AYWA 2A5IA 5JB9S 1O2HA 2GKVE 3PWBA 1SR5C 1MKWH 1GVKB 3SV8A 2BZAA 5EIYA 3RC6A 2WZQA 1DITH 1TGCA 1G3BA 6GCHG 4CH8B 3PV5A 3RLYH 3SNDA 1OXGA 1VJ9U 3BTTE 1Y3WA 1F0UA 1ZMNA 6CHAB 2Z9LA 3MO6A 3ZZ5A 3ZZ3A 2RFKC 5L2ZH 2F3CE 2AGIX 4BOHA 1A3EH 3MO3A 2XBXA 1LMWB 2VIDA 2ZG0H 3HGNA 3GCHB 5LPFA 3IG6B 1SGPE 1DE7H 1O2LA 3M5NA 3RXHA 3ZVDA 4NFFA 4JZIA 2GT8A 4CR5A 3ATMA 1RTLA 1GJDB 1LVBA 2KCOA 2ZECA 1A61H 1C2FA 1SGEE 3M3TA 2BY5X 2VVVA 1CSOE 5EOKA 3SZNA 4Y11E 1BDAA 2STAE 4YT6H 3TIUA 3RMLH 2XBYA 1O3FA 2GZ7A 1SLXB 1CT4E 2BD2A 2FX6A 1GCDA 2OCVB 3F9GA 4X1QU 4UFGH 1NFXA 4DY7B 5EJZA 2SGPE 1XKBC 2DUCA 4HZHA 4IBLH 4DURA 1TRYA 1ZOMA 3OSYA 5EQQA 3SUGA 5DJ7A 1O3LA 1GMHF 1Q31A 4WVPE 5FHTA 3PRDA 4UEHH 1V2KT 1ZRBA 1AN1E 1MTNC 1BRUP 1BIOA 1BMNH 3MU8A 3LONA 1O2YA 5FX5A 1OKXA 2BY9X 1AY6H 2Y6TA 2WPLS 2ZHFH 3AK5A 1FLEE 1LQEA 5FX6A 1MABB 4ASUD 1IQKA 3LGTA 4KELA 3BG4B 2A0QB 2BDYA 1E0FD 5LGOA 1C4Y2 5A8YA 1MTUA 1THRH 1TNIA 3UR9A 3W95A 4DIHH 3BTEE 4X8VH 1RTFB 4MLFB 3KQCA 4B2AA 3OEED 2RDLA 1ZMLA 2HLCA 2HPPH 2J2UA 2G8TA 1FIZA 5GXPA 1C2LA 1CU1A 1K22H 1MTNB 2I6QA 1WUNH 2HLDD 1BMLA 1KXDA 2RA0A 4KTSA 3HK3B 2Q6FA 3F1SB 2WPHS 2SGEE 2BZ6H 5LH8A 5PTPA 1AMHA 2VH6A 2ZDLA 3T26A 1OP8A 1QL9A 2PFEA 3MYWA 2ANYA 2EI7A 4JZEH 3SUEA 5GCHF 6LPRA 2QGRA 4BANB 1GDNA 1QA7A 1HRTH 2SGFE 3ATWA 4GLYA 2R9PA 2VVUA 5EODA 4Z0KA 3UQOA 3BTQE 3CS7A 1GJ7B 3F0PA 1MCTA 2C90B 2CGAA 1UK2A 2V3MA 1TFXA 2CHAC 5DP4A 2F9VA 5CMXH 1OP2A 1NC6A 1TA6A 1D4PB 3QX5H 1GJBB 3QUMP 4TT3D 4ACBA 2NU3E 3CNRA 2F9BH 2TGPZ 1J16A 1GBEA 1VR1H 4OGXA 4BNRA 4DCDA 2QF0A 1JBUH 1LPKB 1NN6A 2ASUB 1VITH 3P92A 5BPEA 1BTUA 1JXPA 2CF9H 2GDEH 2WPKS 1ZSLA 3IWMA 2V3HH 1LHEH 1QJ6B 3K2UA 4JZ1A 4ABJA 3E0PB 1OWHA 1RRKA 1KDQB 3VB6A 4VGCB 2W7UA 3BTKE 1GJ8B 2FM2A 2CHAB 1TAWA 2OLGA 1C5PA 3T28A 1ESAA 1O5DH 1AVXA 4AN7A 3GYMA 1HAGE 2SGAA 1C5ZB 1DSUA 3SU1A 4OS7A 1NU7B 1E34B 2TPIZ 2ZFSA 1AWHB 3PB1E 3P95A 1YPHE 1TQ7B 1EZXC 1QNJA 1DX5M 1UJ1A 1S83A 4YZUA 4AG2A 1AE5A 3R0FA 2F9UA 3GDVA 1FN6A 1KMHB 3EE0B 1C5VA 1HUTH 3R3GB 1DXWA 1O3KA 1XMNB 4X8SH 3IITA 2KCAA 1Y3XA 5SGAE 5AFZH 3PTBA 1J9CH 2PLXA 2ZFTA 1QIXB 1GMDF 4OS6A 1LTOA 2YMSD 1QHRB 4GCHG 1YLDA 1GDUA 5T6GA 1F0RA 1TNHA 2XBWA 1C1PA 1O2ZA 3NRLA 1K1OA 2PTNA 2C93B 3SN8A 4Y76A 3W1EA 1Y8TA 1Y5BT 3SJ8A 1O3CA 3F2HA 3KF2A 1T32A 5FCRA 3F9FA 3TJUA 3ZZCA 5DP3A 4BAQB 3VB3A 2ZWLH 2GX4A 4ZXYH 1YCPH 4JMYA 4UONA 3RXRA 1AQ7A 1FV9A 2H2ZA 1SGFG 4UFEH 2ZCKP 1EATA 5A0CA 1A0HB 1N6YA 3P8GA 1GHBF 4F55A 2Y82A 2JJ2D 1C1MA 1Y3UA 2GV6A 2YMSC 1NBMD 4O3TA 5C1YA 4FUDA 1W8BH 3N7EA 4ZXXH 1SG8B 2GZ8A 1QBOA 4O9VA 1C2IA 1FIWA 1HYLA 1E36B 1TE0A 1FUJA 3K65B 1V2VT 1MKXK 5LPEA 1A2CH 1SB1H 3EAJA 1C4U2 1ZTLA 2KX4A 3QGNB 1VCWA 3KN2A 4U2WA 2P16A 4ZCNA 1EZQA 1DDJA 1O3EA 3UQVA 5CDFE 2OC7A 4KP0A 1XXFA 4RN6A 1EZSC 1Z1IA 5TCAA 3N7OA 3U8OH 2WPDD 1HAIH 3A8BA 5FAHA 3C27B 1WYKA 3RMNH 3MNBA 1PJPA 3KQBA 4DT7B 3A88A 3A8DA 4P00A 5DO4H 2BXUH 2R3UA 3VXEH 2QXIA 2KAIB 4WH8A 1C1OA 1SFQB 1NBME 2WPMS 4K60A 2CJIA 3BG8A 4NZLA 1KXEA 4HFPB 1HIAB 2ILNA 2JETC 1J8AA 1C1VH 1HBTH 3AW1A 1OWIA 1YPGH 4IC6A 3EDXB 3UY9A 1NPMA 1HAYB 4BTTB 1HJ8A 2FODA 2Z3CA 2AGEX 1THSH 1YY3A 2PW8H 4ZKSU 1KXCA 3NKKA 1GVLA 1HXEH 3A83A 3B23B 2ZU1A 3LPRA 3U28C 3MFJA 1KDQA 1KTTB 3SHAH 3E91A 3O8BA 2J97A 2JDID 4R8TB 1F5KU 3M7TA 1IHSH 1SLVB 4I7YH 4ZHMU 2AMPA 2PGBB 2YOLA 4XSKU 1MD8A 2PKSC 1BOQA 2F91A 1GI1A 2VIOA 5F6MA 5E0JA 2XWAA 5AFYH 5E0HA 1TX6A 1ZHRA 3OEHD 1C5LH 2PV9B 4F4OC 1EOJA 1IQEA 4IS5A 1S6HA 1SGNE 1PFXC 2XWBI 1HDTH 1O3DA 3B9FH 1CBWC 1K1NA 1DLKB 2P95A 8LPRA 4CR9A 4JK5A 3TGJE 1S6LA 1GBHA 1V2OT 1GI8B 3GY2A 3NZIA 4MPVA 4GPGA 1BTZA 4FOUC 5GIBA 1VITG 2SNVA 2C4FH 1O2VA 2BD9A 3KHVA 1RS0A 6GCHF 1QQUA 5GJ4B 4H42U 3VB7A 2ZFPH 1CT0E 1V2LT 4YM9A 1WSSH 5JBBS 1YLCA 2ZGBH 1V2WT 1NO9H 4YESB 2C8YB 4Y7BA 2XBVA 4X1NU 4O97A 5EJ1A 5CHBA 2XTTB 5EW1H 2VIVA 1AKSB 3PYHA 2GDDA 1E35B 3H09A 1GI5A 2SGDE 1COWD 2FS9A 3UREA 2Z3DA 2Z9KA 1MTWA 1SGRE 1MMJN 3RMOH 1HJAC 3BIVH 1O0DH 1C2GA 3P8OA 4K1SA 2BXTH 2OQUA 1GG6B 3SBKA 1J14A 3M5OA 3N99A 3E3TA 1TX7A 4GHQA 1K1JA 3AASA 1P9SA 3SJOA 3SORA 1O37A 3PTNA 3FZZA 3UAIC 4RKJB 1L2EA 4I32A 3B8JA 2C8WB 4AYVB 5DKMA 3QDZB 3ZZ7A 4SGBE 1TRNA 2KR7A 5CE1A 1FY1A 2TGDA 4O03A 1XKAC 4Y79A 2O8TA 3ATIA 3F0OA 4ZHAA 1ELCA 2NU4E 3S0NA 1AUJA 2GP9B 2ZNKH 3MU4A 1ETSH 3VXFH 4CHAB 3RUOA 1P12E 1HAOH 1DOJA 4UFFH 1GI3A 1GI6A 3E1XB 3LGIA 5EXLA 2KAIA 4BAOB 3WW7A 1T8NA 2GCTB 4FETA 3T5FH 2R0LA 3DUXH 3RXCA 1HIAA 2ZDAH 3SU3A 1BTXA 3SQEE 3ZVFA 1Z6EA 9LPRA 2W6ID 1W3CA 1K9OE 1TGSZ 3UOUA 3PM3A 5JDUB 4RSPA 3T29A 1XUFA 1PYTD 4XD7D 2PUQH 1O3BA 1C2JA 8GCHG 1GL0E 1P11E 1PQ5A 1C5WB 1EB1H 3D65E 2D2DA 5DP5A 3A85A 1C1TA 1XM1A 3RC5A 3FANA 3ODFA 4B73A 1P04A 2LELA 4AB9A 3AAUA 3MMGA 4AG1A 1S6FA 3A8CA 1EB2A 1C2MA 3TK9A 1QBNA 2FOBA 3VPKA 1H9LB 1B0EA 5F8ZA 3SJIA 3BV9B 1EX3A 1DY8A 1DPOA 4TSFD 1V6DA 2VWOA 1YPMH 1AE8H 1ELVA 3RXEA 5DP9A 1QRXA 1RXPA 1OWEA 3FAOA 4NG9H 2HGTH 3PMJA 3VGCC 3AW0A 3RXJA 4ISLA 1DXPA 5AVDA 1BJVA 1T7CA 1CQQA 1GDQA 1WV7H 3K6ZA 5FBEA 2BTCE 4WMFA 3SGAE 1DM4B 2FXRA 3FP8E 2FTMA 4AOQA 1Z8IB 2P8OC 1O2MA 1SGYE 3M3SA 5HIYA 2ZU4A 3MNSA 4K3JA 1TX8A 3E90B 1ZTKA 1GBAA 1ANEA 1O30A 2J34A 1TNLA 1FAKH 1QR3E 4MNVA 1UTKA 4YOJA 4UE7H 1OOKB 1IAUA 3OAAD 3GOVB 1XVMA 1ELEE 3MH6A 3RXLA 1J15A 1O3NA 3E0NB 3SV9A 1DFPA 2FI5E 2BVSH 1T4UH 1OYTH 1S5SA 1QB6A 4Y10E 1AKSA 2JKHA 3VGCB 1QTFA 3DT0H 2NU2E 5KECA 1VKYA 5C2ZA 4YLQH 2ZPQA 4FUIA 4RT0A 4AGJA 2IN2A 3F6UH 2VGCB 2JH0D 1YYY1 1DY9A 2GVFA 5DN6D 1GGDC 2FLBH 1YPLH 2P8OB 2BDIA 4XOJA 1O2WA 3P70B 5ESTE 1TNKA 4RKOB 2FDAA 2J5UA 4Y71A 3BTDE 2KCPA 1NRRH 4XRNA 1FPCH 1IQNA 3RDZA 3RXTA 2J95A 3FN8A 2BDAA 2A4RA 1GCTC 1SQRA 3BF6H 2ANWA 5FPYA 4BXWA 5JB8S 2ZA5A 3TNTA 5T6DA 3QTOH 1SI5H 5IYTA 3GY8A 2BVRH 5EXNA 4B6FA 3UNQA 3RXPA 1P0SH 4AGKA 1LHFH 2FS8A 1A0LA 2XCNA 1WDIA 1RIWC 2C8ZB 2VNTA 2V6NA 1U6QA 1K1MA 1Z6JH 3LH3A 1JIRA 2EI8A 1Y5UT 1X7AC 3PMHB 3QZRA 1YPJH 4CRFA 2QF3A 4TPYA 2Z9GA 4Q63A 1ETRH 1PPEE 1Y59T 2BMGB 3T27A 2G55A 2NU0E 1D3DB 1MQ5A 1C1RA 1CE5A 3ENSB 4WJG2 1B5GH 3ZZ6A 5EW2H 1GMCG 1SLWB 4GCHF 5HGGA 1ID5H 5J4QA 2NWNA 3SV6A 1PPZA 1YP9A 1SQOA 5C1UA 1V2QT 2FOEA 1TPOA 2ZTZA 4OS5A 1BBRK 3QN7A 2GMTC 1QCPA 2ZQ2A 1RIWB 5F03A 8ESTE 2D8WA 4J2YB 3SOSA 3GY5A 1LVOA 4TYDA 1IQGA 5ESBA 4AORA 1RJXB 4I86A 1Z8JB 2F4LA 2WV9A 2O8MA 3SZEA 1V2TT 2HWLB 3LJOA 2W3KA 3SV7A 1EP5A 4DG4A 1UTOA 2VVCA 4A5TS 7GCHG 3TH3H 1GI7B 1O3JA 2FOFA 2ZHDA 1OSSA 1HV7A 2OP9A 4WF8A 2ZGJA 4XDEA 4NIWA 3V7TA 2V35A 4XBCA 4TY6A 3EA8A 1K0HA 1C2EA 2OC0A 4B71A 2C3SA 1P01A 4Y8YA 2STBE 2ZO3H 2A4QA 2VWLA 1O2QA 4E05H 2BDGA 3D49H 1QJ1B 2K1QA 1G36A 1LVYA 1PQ8A 1EUFA 3SU6A 1DWEH 1G3CA 3M36A 4ZKOU 7ESTE 3TLOA 2Y5GA 1SC8U 1WQVH 1BBRE 4Y8ZA 4YT7H 3SNBA 5BRRE 2L74A 1KLJH 3KGPA 1ZR0A 5GNDA 1GBMA 1T8OA 3H7OA 1ETTH 1KIGH 1VJAU 4FXGH 3QGJA 1BQYA 3LC3A 1JIMA 2EI6A 1K28D 1C5YB 2ALVA 3LKWA 2BLQA 5B6OA 1F7ZA 1P02A 3JZ2B 2FP7B 4MNXA 2VH0A 1E38B 2Z94A 4AC9A 1NTPA 1IQIA 3DFLA 4ABGA 1G2MA 2BB4A 4KKDA 3P17H 4RT1A 1ARBA 1H8HD 1O2PA 3SNCA 3A80A 1UTPA 1W0JD 2WINI 4FUJA 2G4UA 1QZ8A 2ZC9H 2Y5FA 2BX3A 3FO8D 2A1DB 3C1KA 4X6OA 1W10U 4B74A 2P3TB 2IJOB 3DSGA 3ZYDA 2WV5A 5KEDA 2BY8X 1GPZA 1Z7KA 4U32A 3E8LA 3VB4A 2AIQA 4Y0ZE 4TWWA 1MH0A 5DP7A 4LZ1H 1WAYB 3KNXA 4D7GA 5HIZA 1DANH 1GVZA 4FUGA 5EG4A 4CRBA 2FI4E 1CA0C 1N6XA 1NESE 4WH6A 3V3MA 1INCA 1ZHMA 1AUTC 1MKXH 1GHXH 1K1LA 4UDWH 1HAVB 1T4VH 1ACBE 2ZIQH 4KTUA 5E2PA 2ZHWH 1O2JA 4QT8C 4B76A 1F5RA 1WQSA 2XC5A 1BITA 2AFQB 2OTVA 3STJA 2PKAB 2ZCLP 3W94A 1G9IE 5IK2D 2F9PA 1JOUB 1ZLRA 3TH2H 4GAWA 2QE7D 3TU7H 4AFUA 1W14U 1W13U 1YPHC 4Q7YA 4ABHA 1P3EA 1VITF 4X6MA 1FQ3A 1IQMA 5DGJA 1O2NA 1BB0B 3U1JB 5C3NA 5A0BA 3DHKH 1Z8GA 1OHHD 2IPHA 3S9CA 2PHBA 3PLKA 3SJKA 4MPWA 3O8CA 1AI8H 5CHAC 2EQNA 4YOGA 3SU4A 1MD7A 2XNIA 4IC5A 3M37A 1ZYOA 3EE7A 1YWUA 3G01A 1CGIE 3RXVA 3A7TA 1KXFA 1P2NA 1NRSH 3GISB 1XX9A 4ABIA 3VG8A 5HYOA 2KFWA 3H7TA 1P2JA 1SGCA 2K0QA 1O2SA 2OBQA 5FPSA 3OYPA 1NZQH 1UTMA 2HNTC 3KL6A 1QFKH 3GCTG 4U01A 2H9EH 2Z7FE 1D3QB 5J4SA 1PPHE 4DW2U 4NZQA 2AIPA 2HNTE 3Q76A 4WXVA 3TH4H 2WPJS 2O9QA 1TGNA 1PPFE 3UTUH 2BLWA 5CHAB 3U98H 5EQSA 1W7XH 4E7NA 4BXSA 2SGQE 1ANCA 1AZZA 1WOFA 3K9XB 1GJ9B 1C5TA 1GJ4H 2FTLE 1DSTA 1GBKA 1H9IE 4IGDA 3LGUA 3FP7E 3ZIAD 2QY0B 2ANKH 2BD4A 4XFQA 4R0IA 2ANMH 3MI4A 5F8XA 1D9IA 3LH1A 3DFJA 3PLPA 4ZHLU 1NRPH 3Q3KA 2OD3B 1LKBA 4K5ZA 2JJ1D 3U9AH 3MWIU 3E16B 3S9BA 1TB6H 5L6NH 4TPIZ 4IMQA 1F0TA 2F83A 4MPXA 2AERH 3LIWA 2BD7A 1NT1A 3QZQA 2ESTE 1ZGIA 3FP6E 2WSSD 1FAXA 1IQFA 3DSOA 4YO9A 8GCHF 5GWZA 1MU8B 1ABIH 3D23A 2EC9H 3EYDA 2HRVA 4CRAA 1FZZA 1O5EH 9ESTA 3RXGA 3RMMH 3A84A 3RXSA 4B6EA 4ASHA 1HFDA 2YMSB 3PO1C 1CHOG 1ELGA 3EA7A 2OQ5A 2Y81A 2HVXA 3UR6A 2Z9IA 1NFUA 1AGJA 2GZ9A 2ODYB 1BUIA 1FY8E 3UB0A 3SGQE 1BRCE 1O31A 2QCYA 2YNAA 4UFDH 2OC1A 4GUXA 2YNBA 2D26C 2UUJB 2AMQA 5FXLA 1H8DH 1UTNA 1HAVA 2BX4A 2PKAA 5EU8A 3F9EA 1BJUA 1QRWA 1XUJA 1T31A 1FONA 2EA3A 1XVOA 2Z3EA 4I8GA 3P8NA 2WV4A 1C9PA 1ZMJA 2THFB 4O3UA 3KQEA 1C2HA 3S7HB 2FOCA 2ZPRA 4XBBA 1O35A 2XOKD 1OWKA 3T62A 2JETB 2WYJA 1O2IA 1P2OA 1BZXE 1G2LA 1TQ0B 1QURH 3MNCA 1SGQE 1O3HA 3FFGA 1ABJH 1O2RA 1ZPZA 3L33A 3FVFB 3OE7D 4OS1A 3V0XA 1HAZB 3Q77A 2EEKA 3M61U 4LZ4B 3BTHE 3HKJB 3ZVBA 2IJD1 4FVBA 1IQJA 4BTIB 1S82A 3CP7A 3I29A 5C5NA 1CA8B 1CVWH 4GSOA 1NY22 2V0BA 2ZDKA 3BSQA 1SGFA 1LKAA 2UUYA 4MDSA 1CGJE 2BYAX 3RXIA 4BAMB 2PKSB 1UK3A 5C17A 1TMBH 1FDPA 4AFQA 1JMOH 3NCLA 3A89A 5C5OA 1N1LA 3LT3A 3PV2A 4NFEA 2J9NA 2JIZD 4X8UH 1PQAA 2LNCA 1AIXH 4NIXA 1A5HA 2O8WA 1IOEA 2Y80A 3A7ZA 1CBWB 1FPHH 4A1TA 2GT7A 5FBIA 3ODDA 3RXDA 1QB1A 2ALPA 2BHGA 1CGHA 1EZUC 1C1WH 4YOIA 1EASA 2JH6D 4IW4E 3BTGE 5JPMH 4JYTA 4ABAA 1THPB 1N8OC 1LQDB 3VB5A 5A8ZA 1Z8RA 1TOMH 3PWCA 3TJOA 1EXFA 4DIIH 4Y7AA 5HXFA 1LDTT 2G00A 1G3EA 4ZH8A 3LGWA 2G52A 2FWWA 3SU0A 2RG3A 3BN9A 4INLA 4TWYA 1H9HE 4DOQA 2I6SA 1ZSKA 2P59A 3MH5A 1C5UA 5DK1A 3OU0A 4JYUH 4ABEA 3S7KB 4Y0YE 3U8RH 1P2KA 1ZJKA 3FZDA 1Y3VA 1DUAA 1TLDA 2V7QD 1GMCF 4B2CA 1MAYA 1TABE 1HJAB 1UTLM 2VBCA 1WBGB 3ESTA 1TMUH 2H6MA 2XCFA 3PV4A 5B6LA 1VCPA 1BTPA 4WXIA 3U8TH 1RD3B 5TJXA 4D7FA 1N8OB 1TBQH 1LO6A 1O36A 1ZTJA 5EGMA 4ZUHA 1QGFA 1SMFE 1MAXA 1P2QA 5HMAA 1EPTC 4LK4A 3V13A 2KCYA 2AS9A 2VIWA 1VGCC 1HAHH 2QA9E 4H6SB 1ESTA 2VINA 3M7QA 4CRCA 2SFAA 1HAXB 2BQ6B 5KGOA 1P06A 5A09A 1DS2E 3STIA 7GCHF 3GY6A 4IN1A 2ULLA 1C1QA 2UUKB 3QLPH 1F0SA 1FNIA 1O39A 1UTJA 4X2YA 4Q2KA 1EOLA 3ZVAA 1FY4A 1C5MD 2BDBA 1UVUH 3QTVH 1SSXA 1GJAB 1BA8B 2PSXA 1RGQA 3TK5A 3RXMA 2BD8A 4LXBH 1AB9C 1Y3YA 1O3AA 4K8YA 3OTPA 1E37B 1TBRH 4I33A 2ODPA 1ZSJA 2ZGCA 1UVTH 1P05A 3RLWH 4K1EA 2F43B 2V3OH 1ORFA 1PYTC 2PTCE 1KSNA 1LHGH 2Q6GA 1AO5A 2J94A 4YTAA 2XNDD 1VGCB 1V2PT 2QYIA 3KEEA 4U30A 3CS0A 2WUBA 3F9HA 1C5XB 1UVPA 2H9TH 1O5GH 2G4TA 4MNWA 4Q80A 7LPRA 1W11U 3MU0A 1ZZZA 1GHWH 4OS2A 2SNWA 2AHME 1Q3XA 2Q1JA 1AU8A 2PWXA 1J17T 4INKA 1SGDE 1O33A 1AZ8A 1K1IA 2IPQX 1LVMA 1T8MA 3RU4E 2ZGXH 1A4WH 2HALA 4ZKNU 1BBRH 1W7GH 4NWLA 2QF4A 3A7VA 4Y6DA 1H8IH 1O2XA 4B1TA 1TMTH 3FOAA 4HGCA 4JYVH 2ZZUH 4CRDA 1A5GH 1TYNA 3A81A 2ZFFH 2W5EA 4BTUB 1TPSA 1ELDE 5C94A 1HJ9A 4MNYA 2ZDNA 4HTCH 3ZVEA 2FZZA 5T3HA 2ZGHA 4A1VA 2A2XH 3M5LA 1GI0A 5JBAS 1EAXA 2KZ4A 2O8UA 3HPTB 4I8KA 3UUZA 4BAKB 3TNSA 1UHBB 4ABDA 1UTQA 2F9NA 4SGAE 1SKYE 2PSYA 1EJNA 5JBTA 1P10A 1FMGA 1V2MT 1BTYA 1GBFA 2TIOA 3RM0H 3VEQB 4MG3A 3SGBE 3SV2H 4X1PU 3F68H 1C5QA 1XUGA 2BM2A 5E8EH 1FN8A 5F53A 5FL7D 1DWCH 3SW2B 2R0KA 2FYRA 2AH4X 1GBDA 2HOBA 4J1YA 3UWIA 1ESBA 3VFEA 1T8LA 3RXBA 1KLTA 3S69A 4MQAA 2ZPSA 3D62A 5C20A 1MBMA 3GY7A 4NSVA 4JZFH 1PPBH 4NIVA 1P57B 1FI8A 4LOYH 4ACAA 1C4V2 1GGDB 2FOAA 4CBOA 1O3OA 5LPRA 3DA9B 1JWTA 2Y7ZA 1O2OA 3KYFA 1BTWA 4WY3A 1NRNH 2R3YA 2A4GA 3KCGH 1V2RT 2H9HA 4X6PA 2Y5HA 1O2TA 1P2MA 1GWAA 5HKKD 1YPEH 3ZZAA 1DLEA 2HVYB 1GCTB 4A7IB 4WMEA 1MU6B 2H1UA 1C5OH 3H5CB 4ZROA 1GI9B 1BMMH 5A8XA 1ZJDA 1D6RA 1UCYK 2Z9JA 3A82A 1HXFH 1TALA 2VIPA 4OGYA 1NRQH 3GCTF 1MCVA 2ZU2A 1SOTA
chains in the Genus database with same CATH topology
2TBSA 2FOMB 1TONA 1GBIA 3GDUA 2TGTA 5L2YH 3T25A 4INHA 4MPUA 2CXVA 1IHTH 1XXDA 1M9UA 2P3UB 3O8RA 2OUAA 3BEFB 5HM9A 2W26A 3BTME 3E6PH 3U1IB 1FXYA 1OWJA 1RTKA 4D9QA 2OINA 1EPTA 1V2NT 1TNGA 4AB8A 2LPRA 1GBJA 1SL3A 1B0FA 1LHCH 1AWFH 4DVAU 2PUXB 3EGKH 2A45B 3ZVCA 2G5VA 3JZ1B 2PGQB 1L4ZA 1QA0A 3GCOA 3Q3XA 1JRTA 1HPGA 1YF4A 4AFSA 1H1BA 1O5FH 1UCYE 3WY8A 6ESTA 1HB0B 1K2I1 4KGAA 2GMTB 1MKWK 2CMYA 3SI4H 4A6LA 8KME2 1L1JA 3HATH 2OC8A 2A2QH 3RXOA 1MUEB 2OBOA 1V2JT 5EXMA 1KYNA 3GY3A 4K1TA 4M7GA 1KLIH 3SUDA 1F92A 1P2IA 1F5LA 2BDCA 4IMZA 3M3VA 1QB9A 3ZZBA 1HCGA 2AGGX 2HNTF 1CO7E 2H5DA 1CHOF 2BY6X 1GJ5H 4AX9H 2Q6DA 3TVJB 2ZFRH 4NA9H 5L30H 1BCUH 5E2OA 2WPIS 2CF8H 3BEUA 4CRGA 1TOCB 5DP6A 1S0RA 1D6WA 1UHBA 1ZPCA 4NA8A 1VZQH 2ZI2H 2P3FH 2XC4A 3MU5A 3K6YA 3M5MA 4H6TA 5IDKA 2GCHG 1AVGH 2FYQA 3ZVGA 2FMJA 1UVSH 2ZP0H 4X1RU 1GHYH 1OS8A 4I8HA 3T2NA 5K0HA 1GJ6A 2XXLA 1GHAG 1PPGE 2FLRH 2FO9A 3BG4C 4NA7A 4VGCC 2BLVA 2FOHA 1S84A 5EQRA 1G30B 2A4OA 2QAAA 1SPJA 1CHGA 1ELAA 1A46H 3V12A 1TGTA 4HI3A 3PROA 2XYAA 1JRSA 1HGTH 3P8FA 3MU1A 1O3PB 1OX1A 3A87A 3UNSA 4AZ2B 1AD8H 1A3BH 1G32B 1D3TB 1HLTH 2CN0H 2OXSA 2FESH 1ZHPA 3RP2A 2P93A 3GICB 3HGPA 4MTBA 5DG6A 1UMAH 1SHHB 2G5NA 2ZTYA 4B2BA 2DE8A 1RFNA 5ETXA 2BD3A 2Y7XA 2FIRH 2WYGA 2BD5A 3EA9A 1IQHA 1V3XA 3NWUA 4ISHH 5F8TA 4GVUA 1CA0B 1XUIA 3LC5A 4NSYA 3TK6A 1KXBA 3SUFA 4Z6AH 3SNEA 4OS4A 1S0QA 4E06H 2QV1A 3LGYA 3NUMA 3ELAH 2ZU3A 3DD2H 1OPHB 3I77A 4NWKA 3EQ0H 5C1XA 4MVNA 1W12U 2R2MB 4K2YA 1PPCE 4D8NA 2ZKSA 4WWYA 3GDSA 2W7SA 4E7RG 2BVXH 5TCCA 1PQ7A 4A1XA 1GJCB 1C2DA 1GMHG 1TNJA 1YBWA 1DICA 1BMAA 1ZRKA 1LPZB 1TGBA 3TJNA 1SHYA 3SU5A 3ZV9A 2J92A 3HK6B 1BHXF 1K1PA 2P94A 1DVAH 3S9AA 5I46H 3GYLB 1C2KA 1K21H 2A32A 2G81E 4I8LA 3PMBB 3RC4A 1GI4A 2ZDMA 2G51A 2QIQA 4Q7ZA 3OTJE 1BTHH 5DPAA 1ELTA 1ELFA 1ARCA 1MTVA 4DJZB 1S81A 2FEQH 2NU1E 1TIOA 1W2KH 1QL7A 4X2WA 4Y8XA 2AEIH 2GGVB 3NXPA 1P3CA 2RCEA 1C5NH 3QWCH 1Y5AT 3M7UA 4ISOA 3PLBA 2QC2A 1OWDA 1SGIB 3LOXA 1H4WA 1TRMA 2FOGA 1SQAA 4X0WU 2BOKA 4JZDH 1BRBE 4PROA 3MO9A 1CT2E 4XE4A 1HNEE 1AHTH 1DWDH 2ZF0H 4ZAEA 2B8OH 4D9RA 2GV7A 4CH2B 5A0AE 2C8XB 4FUBA 3O8DA 4FU8A 1O32A 3MH4A 2TRMA 3SU2A 1EAUA 3RU4T 2ZTXA 3OY5U 3A7XA 1UVOA 1ZPBA 3QO6A 1NM6A 1SVPA 2ODQA 2JH5D 5GCHG 1ELBA 4K8BA 3L3TA 1W0ZU 1AFQC 4ISNA 2B7DH 5I25A 2VJ1A 1QQ4A 4X6NA 1BRAA 3RXAA 2F9OA 2VWMA 1P9UA 3OY6U 4ESTE 1C9TA 2BY7X 1B7XB 3BTWE 4I31A 2A7HA 5A2MH 1L4DA 1FJSA 3ZV8A 1EP6A 5DP8A 4I8JA 2B9LA 3UWJH 7KMEH 4YLUA 3ZZDA 1GI2A 3GY4A 3PO1B 1G3DA 4X2XA 5AHGH 1TPPA 1C1UH 1BT7A 1MTSA 1MZAA 4XBDA 3ATKA 1A5IA 4CREA 1FY5A 2QXGA 4ZKRU 2VWNA 1GBBA 2UUFB 1L1GA 2CV3A 2B5TB 3UIRA 2ZCHP 2RA3A 1AFQB 1P03A 1IQLA 1O2GH 1D3PB 2O8LA 1SGTA 5FCKA 4JK6A 1A7SA 1YCPK 1O38A 5E0GA 1S85A 4FVDA 3MHWU 1YCPM 4X8TH 1QY6A 4WMDA 2QXHA 1GBCA 3I78A 2J38A 1EAIA 4FUHA 1V2ST 4ABBA 1LPGB 1GG6C 2QN5T 1C5SA 2GD4B 1SLUB 1O2KA 2A31A 1C1NA 1P8VC 3ITIA 4FU7A 4X1SU 2A5KA 1DWBH 1LCYA 4IN2A 4FU9A 2UWLA 1UK4A 1GL1A 2UWPA 3UFAA 5K7RA 1C5RA 1KXAA 1SOZA 3TGKE 5C67A 3ATLA 1BHXB 1XUHA 5FPTA 2D1JA 2VB0A 2QXJA 3LGVA 3UPEA 3KIDU 2AMDA 1OYQA 1SFIA 4ABFA 1TBZH 2GTBA 3Q3YA 1YPKH 4B75A 3NPSA 4DGJA 2WUCA 5HM2A 3AAVA 4UD9H 4CHAC 3MNXA 4THNH 3HKIB 3ZZ9A 1A1RA 1MZDA 1GMDG 4K69A 1EJAA 1TA2A 3RXFA 1O5BB 1QBVH 2ZEBA 5EPYA 1Z71A 2GCTC 3A86A 1Q2WA 2M5TA 3ZZ8A 3SNAA 4F49A 3GCNA 1QRZA 1O2UA 1YM0A 3Q00A 5ABWA 4NCYA 1C1SA 2ZFQH 1KY9A 1O5AB 3UOPA 1F2SE 4BAHB 4GHTA 1AFEH 1DUEA 1ANDA 1QL8A 4NGAH 3A8AA 1XUKA 1NS3A 1TWXB 3U69H 3ZYEA 1ZGVA 1SBWA 2VU8E 1GHBG 2XRCA 1EQ9A 2ZHEH 4ISIH 3MTYA 3SO3A 1HAPH 1WTHD 1P09A 4H4FA 4CBNA 4FUFA 4TY7A 3ZZ4A 3SI3H 1OP0A 1NROH 3LDXH 3TGIE 4FUEA 2BDHA 4NIYA 4A92A 2H5CA 1GBTA 2Z6BD 3BTFE 2PR3A 4X2VA 2A5AA 3AVZA 4AFZA 3RXQA 1UO6A 4Q7XA 2J4IA 3RU4D 1Z1JA 3TJVA 1MBQA 3LU9B 1W0YH 2ZU5A 1KTSB 3URCA 1GHZA 3SHCH 2FI3E 1WTGH 5H4IB 4JCNA 2VIQA 1FY3A 1EPTB 1G37A 4AYYB 3MH7A 1O34A 3P6ZB 4KTCA 3RXUA 3BEIB 3RXKA 2DE9A 3BIUH 3CENA 5JYIA 3KQDA 1SQTA 1O5CB 1VCQA 3SJ9A 4D76A 4ZMAH 1A0JA 1O3MA 2B0FA 1YKTA 3NK8A 2BLOA 3LJJA 1UCYH 3TITA 1EKBB 1V2UT 2XC0A 1AB9B 3MOCA 2ZQ1A 1QJ7B 3QK1A 3SQHE 3M35A 3A7YA 3RM2H 2FPZA 2UWOA 2BQWB 2VGCC 1WU1A 1EJMA 2GCHF 2BOHB 2W3IA 1TPAE 3OX7U 5T6FA 1NFWA 2ZHQH 2HPQH 1WCZA 2ZDVH 2TGAA 5G4BA 2IOTA 2A7JA 1EAWA 1LHDH 1NU9A 5JBCS 1GBLA 1L1NA 1GHAF 1ANBA 1NFYA 3TPIZ 6CHAC 3PMAB 2XW9A 3L6PA 2A7CA 1O3IA 1YC0A 2FX4A 3UNRA 2BQ7B 5EPNA 1YGCH 5GPIB 3URDA 3GCHC 1DT2A 1GHVH 3A7WA 1O3GA 5AF9H 2R2WU 1MQ6A 5GDSH 4FUCA 1AVWA 1L0ZA 2AYWA 2A5IA 5JB9S 1O2HA 2GKVE 3PWBA 1SR5C 1MKWH 1GVKB 3SV8A 2BZAA 3RC6A 1DITH 1TGCA 1G3BA 6GCHG 4CH8B 3RLYH 3SNDA 1OXGA 1VJ9U 3BTTE 1Y3WA 1F0UA 1ZMNA 6CHAB 2Z9LA 3MO6A 3ZZ5A 3ZZ3A 5L2ZH 2F3CE 2AGIX 4BOHA 1A3EH 3MO3A 2XBXA 1LMWB 2VIDA 2ZG0H 3HGNA 3GCHB 5LPFA 3IG6B 1SGPE 1DE7H 1O2LA 3M5NA 3RXHA 3ZVDA 4NFFA 4JZIA 2GT8A 4CR5A 3ATMA 1RTLA 1GJDB 1LVBA 2ZECA 1A61H 1C2FA 1SGEE 3M3TA 2BY5X 2VVVA 1CSOE 5EOKA 3SZNA 4Y11E 1BDAA 2STAE 4YT6H 3TIUA 3RMLH 2XBYA 1O3FA 2GZ7A 1SLXB 1CT4E 2BD2A 2FX6A 1GCDA 2OCVB 3F9GA 4X1QU 4UFGH 1NFXA 4DY7B 2SGPE 1XKBC 2DUCA 4HZHA 4IBLH 4DURA 1TRYA 1ZOMA 3OSYA 5EQQA 3SUGA 5DJ7A 1O3LA 1GMHF 1Q31A 4WVPE 5FHTA 4UEHH 1V2KT 1ZRBA 1AN1E 1MTNC 1BRUP 1BIOA 1BMNH 3MU8A 3LONA 1O2YA 5FX5A 1OKXA 2BY9X 1AY6H 2Y6TA 2WPLS 2ZHFH 1FLEE 1LQEA 5FX6A 1IQKA 3LGTA 4KELA 3BG4B 2A0QB 2BDYA 1E0FD 5LGOA 1C4Y2 5A8YA 1MTUA 1THRH 1TNIA 3UR9A 3W95A 4DIHH 3BTEE 4X8VH 1RTFB 4MLFB 3KQCA 4B2AA 2RDLA 1ZMLA 2HLCA 2HPPH 2J2UA 2G8TA 1FIZA 5GXPA 1C2LA 1CU1A 1K22H 1MTNB 2I6QA 1WUNH 1BMLA 1KXDA 2RA0A 4KTSA 3HK3B 2Q6FA 3F1SB 2WPHS 2SGEE 2BZ6H 5LH8A 5PTPA 1AMHA 2VH6A 2ZDLA 3T26A 1OP8A 1QL9A 2PFEA 3MYWA 2ANYA 2EI7A 4JZEH 3SUEA 5GCHF 6LPRA 2QGRA 4BANB 1GDNA 1QA7A 1HRTH 2SGFE 3ATWA 4GLYA 2R9PA 2VVUA 5EODA 4Z0KA 3UQOA 3BTQE 3CS7A 1GJ7B 1MCTA 2C90B 2CGAA 1UK2A 1TFXA 2CHAC 5DP4A 2F9VA 5CMXH 1OP2A 1NC6A 1TA6A 1D4PB 3QX5H 1GJBB 3QUMP 2NU3E 2F9BH 2TGPZ 1J16A 1GBEA 1VR1H 4OGXA 4BNRA 4DCDA 2QF0A 1JBUH 1LPKB 1NN6A 2ASUB 1VITH 3P92A 5BPEA 1BTUA 1JXPA 2CF9H 2GDEH 2WPKS 1ZSLA 3IWMA 2V3HH 1LHEH 1QJ6B 3K2UA 4JZ1A 4ABJA 3E0PB 1OWHA 1RRKA 1KDQB 3VB6A 4VGCB 2W7UA 3BTKE 1GJ8B 2FM2A 2CHAB 1TAWA 2OLGA 1C5PA 3T28A 1ESAA 1O5DH 1AVXA 4AN7A 3GYMA 1HAGE 2SGAA 1C5ZB 1DSUA 3SU1A 4OS7A 1NU7B 1E34B 2TPIZ 2ZFSA 1AWHB 3PB1E 3P95A 1YPHE 1TQ7B 1EZXC 1QNJA 1DX5M 1UJ1A 1S83A 4YZUA 4AG2A 1AE5A 3R0FA 2F9UA 3GDVA 1FN6A 3EE0B 1C5VA 1HUTH 3R3GB 1DXWA 1O3KA 1XMNB 4X8SH 3IITA 1Y3XA 5SGAE 5AFZH 3PTBA 1J9CH 2PLXA 2ZFTA 1QIXB 1GMDF 4OS6A 1LTOA 1QHRB 4GCHG 1YLDA 1GDUA 5T6GA 1F0RA 1TNHA 2XBWA 1C1PA 1O2ZA 1K1OA 2PTNA 2C93B 3SN8A 4Y76A 1Y8TA 1Y5BT 3SJ8A 1O3CA 3KF2A 1T32A 5FCRA 3F9FA 3TJUA 3ZZCA 5DP3A 4BAQB 3VB3A 2ZWLH 2GX4A 4ZXYH 1YCPH 4JMYA 4UONA 3RXRA 1AQ7A 1FV9A 2H2ZA 1SGFG 4UFEH 2ZCKP 1EATA 5A0CA 1A0HB 1N6YA 3P8GA 1GHBF 2Y82A 1C1MA 1Y3UA 2GV6A 4O3TA 5C1YA 4FUDA 1W8BH 4ZXXH 1SG8B 2GZ8A 1QBOA 4O9VA 1C2IA 1FIWA 1HYLA 1E36B 1TE0A 1FUJA 3K65B 1V2VT 1MKXK 5LPEA 1A2CH 1SB1H 3EAJA 1C4U2 1ZTLA 3QGNB 1VCWA 3KN2A 4U2WA 2P16A 1EZQA 1DDJA 1O3EA 3UQVA 2OC7A 4KP0A 1XXFA 4RN6A 1EZSC 1Z1IA 5TCAA 3N7OA 3U8OH 1HAIH 3A8BA 5FAHA 3C27B 1WYKA 3RMNH 3MNBA 1PJPA 3KQBA 4DT7B 3A88A 3A8DA 5DO4H 2BXUH 2R3UA 3VXEH 2QXIA 2KAIB 4WH8A 1C1OA 1SFQB 2WPMS 4K60A 2CJIA 3BG8A 4NZLA 1KXEA 4HFPB 1HIAB 2ILNA 2JETC 1J8AA 1C1VH 1HBTH 3AW1A 1OWIA 1YPGH 4IC6A 3EDXB 3UY9A 1NPMA 1HAYB 4BTTB 1HJ8A 2FODA 2Z3CA 2AGEX 1THSH 2PW8H 4ZKSU 1KXCA 3NKKA 1GVLA 1HXEH 3A83A 3B23B 2ZU1A 3LPRA 3MFJA 1KDQA 1KTTB 3SHAH 3E91A 3O8BA 4R8TB 1F5KU 3M7TA 1IHSH 1SLVB 4I7YH 4ZHMU 2AMPA 2PGBB 2YOLA 4XSKU 1MD8A 2PKSC 1BOQA 2F91A 1GI1A 2VIOA 5F6MA 5E0JA 2XWAA 5AFYH 5E0HA 1TX6A 1ZHRA 1C5LH 2PV9B 4F4OC 1EOJA 1IQEA 4IS5A 1S6HA 1SGNE 1PFXC 2XWBI 1HDTH 1O3DA 3B9FH 1CBWC 1K1NA 1DLKB 2P95A 8LPRA 4CR9A 4JK5A 3TGJE 1GBHA 1V2OT 1GI8B 3GY2A 3NZIA 4MPVA 4GPGA 1BTZA 5GIBA 1VITG 2SNVA 2C4FH 1O2VA 2BD9A 3KHVA 1RS0A 6GCHF 1QQUA 5GJ4B 4H42U 3VB7A 2ZFPH