2BLQA

Elastase after a high dose x-ray "burn"
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ELASTASE 1
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blqA01
5TJXA 1VITF 4WMFA 4H6SB 3ZZ4A 4AORA 2FOGA 2PTNA 1HJAB 1SSXA 3TLOA 4I8KA 1J15A 5HM2A 1Y3VA 5FHTA 8ESTE 1H8DH 2CF9H 1A5GH 3QX5H 5EODA 1W0YH 1AUTC 2SGFE 4DG4A 1ETTH 3BIUH 4ABEA 1Q31A 1QURH 1ZSLA 2XTTB 1QGFA 1AKSB 2ZDMA 1BMNH 4ASHA 2A2QH 4FUGA 4NIWA 3BTTE 5C67A 1C1PA 2Z3CA 4Y76A 1F0RA 1B7XB 1SHYA 1SLWB 2TGAA 4CHAC 3SZNA 2JH0D 2VVUA 2FODA 2BLOA 4GPGA 1GMHG 3TH2H 2ANYA 3PLPA 4NZQA 4ABFA 3PROA 3D65E 4ZROA 1V2RT 2JH5D 1GJAB 1NPMA 3SU6A 2BVRH 1SPJA 1IOEA 2GKVE 2ZO3H 3GICB 1SLVB 4X2WA 1C5NH 1JIMA 3RC6A 2GT8A 6CHAB 1NRPH 1EASA 2ZF0H 1GHAG 2FLBH 1T8OA 1AHTH 2P59A 3GCHC 2FOFA 3MNXA 1L1GA 2OBQA 2XWBI 3A7XA 2KAIB 3TNTA 1S5SA 1XUHA 3IWMA 1K1MA 1RJXB 3VB4A 1HYLA 3OY6U 1O3LA 4UFGH 5GPIB 2GZ8A 4BTTB 6CHAC 3SQEE 3PO1B 1GBHA 3K2UA 2ZHWH 1DPOA 4JZ1A 3QZRA 4HFPB 5HXFA 2ZA5A 3V12A 1HAXB 1TONA 1MZDA 1C5YB 4NIXA 3VPKA 3E1XB 3LGTA 4OS5A 1E38B 3NK8A 3SV2H 4DIHH 3MU8A 1A7SA 2VIQA 5A8ZA 3P8FA 7KMEH 4BAKB 1GVLA 3QUMP 4BAOB 2ZFPH 1HJ9A 2J92A 2VINA 2R3UA 3BEFB 1O3BA 1W8BH 5L2YH 4MQAA 4IC6A 1M9UA 1P57B 2VH0A 3MTYA 1OP2A 2BHGA 1AUJA 1UK4A 4MNWA 1DFPA 1W7XH 2FS9A 3PTBA 1L0ZA 1QNJA 3UQVA 2A5KA 1KDQB 2J4IA 3S9CA 1DSTA 4Y8ZA 2GD4B 2PWXA 1O2LA 1SB1H 5A0AE 3WY8A 2NU4E 4GHQA 3M7TA 1TNJA 1UTQA 4WMEA 1HBTH 1HFDA 3VB6A 1LHFH 4I8JA 3U8OH 1W12U 2O9QA 1LVOA 1MTNC 1QJ1B 2GMTC 3URDA 3MO3A 4XFQA 3GOVB 2FXRA 3ZZ9A 1AVXA 1D6WA 4HI3A 1HIAA 1CHOG 4Z6AH 1ELVA 2G5VA 4O3UA 2F9OA 2H9EH 2ZFSA 2THFB 1GBIA 1A5IA 1HPGA 1O3EA 1YPHE 4TY6A 1TA2A 2TPIZ 3UPEA 1SOZA 1SMFE 3URCA 1C5XB 2ZTZA 2UUYA 2ANWA 4ZKNU 1YF4A 3A86A 2Q6GA 1O0DH 1AIXH 3PWCA 2BLQA 1IQIA 3RXTA 2VWLA 1BTPA 3SNDA 3A87A 5PTPA 2ZP0H 3EGKH 3KHVA 1FV9A 1Y3YA 2P16A 1ZRBA 1X7AC 5JBAS 1GBTA 2ZI2H 2BDAA 3GY7A 1TYNA 2ODPA 3AAVA 1WTGH 5ABWA 3RMOH 1O30A 1MAYA 1QBNA 2GCHF 1K1OA 1PPZA 1Q2WA 1CBWC 3PMJA 1HV7A 2ZC9H 2ZU2A 3RXDA 5FX6A 4OS1A 1FMGA 5TCCA 4DURA 4ABBA 2BYAX 4Q7XA 3RMLH 4CBOA 3UIRA 4O97A 3W95A 2PGBB 3PMAB 1GBJA 1LDTT 4B76A 5C1XA 1LTOA 1SGQE 3RU4T 3RMNH 4E05H 2A7HA 1DVAH 1EZSC 1IHTH 1TBZH 1V2PT 1NN6A 2V3HH 1K2I1 1YPGH 3E0PB 3A7TA 4KKDA 2R0LA 3F6UH 3E3TA 1PPEE 2ZIQH 5AHGH 1MU6B 1DITH 2WPHS 2J2UA 2P95A 1RXPA 3ZV9A 5EOKA 1SGPE 1KXAA 1O35A 4YLQH 2BD9A 3N7OA 2DUCA 5JBBS 5EQRA 5FPYA 4ZH8A 1K22H 2Z94A 1AB9C 3GY8A 2WPIS 2C8YB 2FOEA 2CHAC 1EZXC 1H8IH 1QJ7B 1ZSKA 2J94A 3M36A 5K7RA 3QK1A 1MKXK 4X1PU 3FP6E 1P09A 1V2MT 1UTJA 5B6OA 3RP2A 3QN7A 1DWCH 2WUCA 1V3XA 1C9PA 4INLA 1FJSA 1P2KA 2FO9A 2H1UA 3A7VA 1DDJA 1GI1A 3MWIU 1HRTH 1GBLA 1OSSA 2EI8A 4AN7A 2Y80A 4XBDA 1DLEA 5A0BA 1BMLA 4VGCB 2W7SA 3GCOA 1Z71A 3PO1C 1O3HA 2HNTC 3TGJE 1T7CA 2ZPQA 5FXLA 1QL7A 4FVDA 1V2JT 4K60A 2QIQA 4AFZA 2SNVA 1IQNA 1OP0A 3TK5A 2M5TA 7GCHF 4BOHA 1PJPA 4BXWA 1UK2A 1B0EA 1SLXB 1P05A 3Q77A 4RSPA 3H5CB 4K2YA 2ZCLP 2SGAA 4B2CA 1ANDA 2G81E 2O8LA 1CT0E 1L1NA 5HYOA 2WYJA 1GJ9B 4A92A 2BTCE 2FESH 3CS7A 3SNBA 2G51A 4FUIA 1ZTJA 1TX7A 3FP7E 3OY5U 4CRFA 1GBEA 1C5ZB 2CV3A 1HDTH 3A80A 1BBRK 1QHRB 3Q3KA 2V35A 3ZYEA 2VIPA 4U32A 1AD8H 4E7RG 1O3PB 1MZAA 1SVPA 1KLTA 3LT3A 3QGJA 1UVSH 4CRBA 1GHBG 3RXQA 3R3GB 1P10A 2BY9X 3VB3A 1O5FH 3SHCH 3TK9A 1O3OA 2IJOB 4X6OA 1BRUP 3SO3A 2XYAA 1LQDB 1SGIB 1QCPA 4DOQA 2A4QA 2B5TB 5EU8A 1O3NA 2D8WA 1BBRE 1EJNA 3UWJH 5IDKA 3OTJE 2TGPZ 1TMUH 3MH4A 3T26A 5GWZA 4UONA 1FIWA 1GI3A 1GJ6A 3R0FA 3G01A 4B2AA 5FPSA 2R9PA 1HGTH 4NSVA 4Z0KA 4ISNA 5A2MH 1NZQH 1DWDH 4UFFH 4D9RA 3ZZDA 5T3HA 4NIYA 4A1VA 2XRCA 2ZDAH 1YCPM 2AMPA 1P12E 3P17H 4NWKA 2VWMA 1DX5M 3MH5A 2FOMB 3LU9B 1DS2E 1AO5A 1TFXA 3HGPA 1HAOH 1H9LB 1N1LA 3DD2H 1SQTA 2FLRH 1O2ZA 2SGDE 4ZMAH 2G4TA 1MCVA 1GDNA 1XKAC 3TH4H 2PFEA 4DY7B 3SJOA 2VVCA 3V3MA 4CRDA 1O5BB 2Y5FA 3CENA 3LC5A 1ANBA 4DW2U 1MD8A 4NSYA 4FVBA 1GBMA 3TK6A 1P0SH 1ELAA 3UUZA 4DT7B 2Z3EA 4AGJA 1PPFE 1ANCA 1KYNA 1A0HB 1TNLA 3P92A 1BRAA 2NWNA 3GCNA 2Y7XA 2BLVA 1BA8B 2BX4A 1NFUA 5AFZH 2ZU1A 1YKTA 3ZZAA 4FUFA 3EA9A 4AZ2B 1V6DA 4NA7A 2BLWA 2OP9A 3QDZB 4J2YB 4KP0A 1AFEH 2PKAB 1GI0A 5C2ZA 1E0FD 5AFYH 1QBOA 1SGYE 4E7NA 2YOLA 5DP7A 2PLXA 1BUIA 4I8HA 4XDEA 1V2VT 4U30A 3RXCA 3ZZ3A 1EQ9A 2QAAA 1V2LT 1EJAA 4NA9H 1C5VA 2NU0E 3RC5A 2XBYA 1YBWA 2BDIA 3ZVBA 3KEEA 1E36B 3SJ8A 2FS8A 1RFNA 2FOAA 2NU3E 1RRKA 3QZQA 1G3CA 2J95A 5EXNA 2BXTH 2ZGBH 4CREA 1GG6B 1QRXA 2BD2A 1ZPBA 1HB0B 1MQ5A 1QL9A 3A82A 3TITA 3GCTG 1TBQH 2ASUB 1O2WA 2PV9B 5LPEA 4I8GA 2ZG0H 2A0QB 4ISLA 4XSKU 1FY1A 3PMHB 4NFFA 5A09A 1O34A 3A7YA 5C5OA 3BG4B 3LGIA 1XX9A 1QRZA 4R8TB 1GVKB 3S9BA 3SGBE 1KDQA 1Y8TA 1PPGE 4JYVH 1OXGA 4FXGH 1O2SA 1O3CA 2PSXA 1QJ6B 9LPRA 1A0LA 4BTIB 5DP8A 1VZQH 1C5WB 3ZVFA 1DUAA 1Y59T 3PMBB 3PWBA 1FXYA 4Q2KA 2FPZA 1GI6A 3KQDA 2Z9IA 2ZU4A 4CH8B 5C3NA 2GX4A 3RDZA 3ATKA 1G36A 3EAJA 4KELA 3P70B 3T2NA 1NT1A 4GCHG 3M5OA 4H42U 1NO9H 1GHZA 4ZHAA 1CE5A 5FPTA 1G2MA 3SV9A 4AG2A 2WINI 1MMJN 1LPZB 2A7JA 1LHCH 1K1PA 2FYQA 1ELEE 2ZU5A 4IS5A 2QCYA 2PUQH 1OYTH 3SU5A 4IN2A 1L4ZA 2VU8E 1ACBE 2CF8H 1O2JA 2Q1JA 3SU4A 2FMJA 3M3TA 1TGBA 3M37A 3MMGA 2W5EA 1S6HA 3A83A 3I78A 4ZKRU 4CBNA 1TOMH 1ZYOA 1ELCA 1JXPA 3ZZ8A 3STIA 1F0SA 2HALA 1BIOA 1QB1A 3UTUH 3U98H 4K8BA 1CT2E 1H4WA 4ZUHA 1BB0B 1TWXB 2NU2E 2OC7A 4WH8A 2QF3A 1XUGA 1LPGB 3UNSA 4DGJA 3C1KA 3KQBA 1YCPK 1TX8A 4GCHF 5F6MA 3ITIA 4Y11E 4JZDH 3E8LA 1ETSH 1SC8U 5DP6A 1EZQA 1O2HA 4WJG2 1AI8H 3I29A 2TBSA 3OSYA 4O9VA 2GCTC 1Z8JB 1T8NA 3T62A 1GBAA 1TOCB 1GDQA 5DP4A 1QB6A 1FN6A 3NPSA 4ZHMU 1CGJE 1GI5A 4X1NU 4D9QA 1S81A 2BXUH 1O5AB 1WOFA 5CHAB 1AFQC 2ZGHA 5DJ7A 1AKSA 1FI8A 1RTLA 1Y5UT 1KLIH 3HGNA 4BAMB 3SJIA 4ESTE 3MI4A 3SUDA 1THPB 1AY6H 1W14U 4RN6A 1N6YA 3BEUA 1C5SA 2G55A 4IGDA 3MU5A 1KIGH 3EA7A 1FONA 1B0FA 3SU3A 3SNCA 2D2DA 2BM2A 4H6TA 5K0HA 2WUBA 3M5MA 1TIOA 1A46H 1DM4B 2GV6A 3VXFH 2FTLE 4ABIA 4YTAA 3LGWA 1EB1H 3GYLB 4WY3A 1GHWH 1GGDC 1TQ7B 1C1UH 4XBCA 3H7TA 1Y3WA 1LKBA 3E16B 3K65B 3ENSB 1FPCH 1H9IE 2HLCA 4DCDA 2Q6FA 1GCDA 3E0NB 1P9SA 1OWDA 4YESB 1WYKA 1P11E 3ZV8A 1AWFH 5AF9H 1ARBA 1W10U 4A1TA 3OU0A 3V13A 3RXMA 1S85A 1ESBA 3GCHB 1C2FA 2ZKSA 1SGDE 1G30B 1P2MA 4JZEH 4Y0YE 1P01A 3LKWA 2PUXB 1K1IA 2PKSB 1A5HA 3FFGA 2CMYA 1ZPZA 2W26A 1XVMA 3RUOA 2GP9B 3P8OA 1BTXA 3GDSA 1EPTC 2BD7A 4MDSA 2Z3DA 3RLWH 1SGRE 2EI6A 4XBBA 3EE0B 2ZFTA 2GZ7A 1O2YA 4ZKSU 2C4FH 2SNWA 1TGNA 3DFJA 1VITG 4CHAB 4MNXA 1YPHC 4YOIA 1TNHA 1PYTD 4YT7H 1AZZA 1O3DA 4DVAU 1BMAA 1VCWA 1WU1A 2QXIA 1O3JA 1AFQB 1GJCB 2A45B 1HAIH 4JYUH 2OD3B 1LHGH 2ILNA 1SGNE 1UCYH 4Y0ZE 1PPHE 3K6YA 1YGCH 3GISB 1SGTA 2UWLA 1LKAA 2AIQA 1F0TA 1P2JA 6GCHF 2GCTB 1O3IA 4OS7A 3ATIA 3SORA 3JZ1B 4B75A 3TNSA 3BF6H 8KME2 4AB9A 1BRCE 2PGQB 2SGEE 1UHBB 1C1QA 3F9EA 4X8VH 4MG3A 3TGIE 2O8UA 4MNVA 4TPYA 4TWWA 4GVUA 1ABIH 1GBFA 3M3VA 1O39A 1K1NA 1YYY1 4J1YA 3RXUA 1DICA 1C4U2 2PKSC 2STBE 2AGIX 1QQ4A 5FBIA 1O2PA 1SBWA 3BTME 2BDBA 3GY5A 1FIZA 1IQJA 4DIIH 2P8OB 3UFAA 8LPRA 1INCA 1CO7E 2HNTF 2C8WB 2R3YA 1KXDA 1UTPA 3LDXH 3NWUA 3T28A 1BT7A 1TQ0B 5T6DA 2D1JA 1F7ZA 4KTUA 1O2RA 3BTFE 1KXCA 4I33A 4OGXA 1EZUC 1Y3XA 3RXLA 1BJUA 1GJ5H 1ZPCA 2QXHA 2OUAA 1GWAA 3LOXA 4TWYA 1G32B 3BTKE 1OWIA 3UNRA 4K1TA 2Y5GA 3VGCB 3HKJB 1FY8E 5J4QA 3KN2A 4YO9A 2Y5HA 2FX6A 1EXFA 2I6SA 1NESE 2FOHA 2HPQH 1AB9B 1DXPA 1ID5H 3LH1A 3GY3A 3O8RA 3LONA 1NRNH 2O8TA 2CGAA 1NS3A 2FX4A 4MPUA 1O2GH 3SV8A 1CVWH 1T8LA 3U8RH 3ATMA 2SGQE 2C90B 3KF2A 1KY9A 1TPSA 1THRH 1EATA 1DLKB 1O2UA 1TMTH 1GI4A 5HMAA 2Z6BD 3V7TA 5JB9S 3E90B 4BANB 2XCNA 2YNAA 1QIXB 3HATH 1O5GH 2WV5A 1QA7A 4JYTA 3RM0H 3PM3A 2A5IA 1BTZA 1JBUH 1N8OB 3L6PA 1S0QA 5DPAA 3D49H 1Y5BT 5CHAC 1SFQB 3SUGA 1O36A 1XUIA 1AN1E 1GL1A 2ZHEH 3K6ZA 1TBRH 3PYHA 2VGCB 5GJ4B 2AMQA 1Z8GA 3QO6A 2J38A 4BTUB 2FYRA 2ZGCA 3LGYA 3MU0A 1FQ3A 1GG6C 2BD5A 1GVZA 2ZFRH 1D3QB 4I32A 1W3CA 4F4OC 4D7FA 2BZAA 1P06A 1ZRKA 3B23B 1DE7H 3GDUA 2WPJS 2P93A 1MTVA 2C3SA 3FAOA 2VNTA 1S84A 1ESAA 1LQEA 1TRMA 2XBWA 2HVXA 2TGTA 5BRRE 1UVPA 1O2KA 1MCTA 1NM6A 2ODYB 1J17T 2CJIA 2VIVA 4IBLH 1MQ6A 1OWHA 4BXSA 3E91A 2ZDKA 4UFDH 1KTSB 4NZLA 2NU1E 4U2WA 1C5QA 1G3EA 5E0HA 3RXFA 5GIBA 3DFLA 3TPIZ 1OWKA 1THSH 1VITH 1FN8A 3Q76A 4X1RU 2ZHFH 2G8TA 1GHVH 4FU9A 1H1BA 3SI3H 1IHSH 4AFQA 4AB8A 1Y3UA 2FP7B 1TGCA 4X0WU 1YCPH 2JH6D 3A8DA 5AVDA 1A4WH 2OLGA 5LPFA 1AVGH 1O2TA 4FU7A 1F0UA 1MTSA 1OS8A 4CR5A 2Z7FE 1Z7KA 5FCRA 2VJ1A 3AASA 1ZMNA 1EOLA 1O2QA 1O32A 1SHHB 2F9NA 1GI2A 1MH0A 4K8YA 2BQ7B 4THNH 1QRWA 1OYQA 3UOPA 4A5TS 4BNRA 3QTVH 1BRBE 1K28D 2R2MB 2BVSH 3RXRA 2OBOA 2GDEH 2F9BH 4MPVA 4PROA 2WPMS 1C5LH 3PLBA 2LPRA 3GDVA 1ARCA 3M35A 4H4FA 3BG4C 3F1SB 2BDGA 5F03A 2H5DA 1ZJKA 1S6FA 1SLUB 5DO4H 4ABDA 2A4GA 5E8EH 1GMDF 2FM2A 1BTUA 4BAQB 1EUFA 2B9LA 5DGJA 1HAZB 3P6ZB 4YOJA 3KQEA 4UEHH 5A8XA 4GSOA 1WQVH 3KGPA 3TJVA 1KSNA 2BDCA 2ZU3A 4ISOA 2QXGA 1C2EA 2D26C 1ABJH 2OXSA 1GCTC 4SGAE 4OGYA 4B71A 3S7HB 1XXFA 3U8TH 1VGCB 4LOYH 2F9UA 2W3IA 3F9GA 3SOSA 4XOJA 1NFYA 1LHEH 1XMNB 3K9XB 3QGNB 5L6NH 2ANKH 3QLPH 1GJ8B 1NRRH 1HJ8A 3LH3A 4I7YH 2FDAA 3U9AH 1UMAH 2ZEBA 3SBKA 5FAHA 3TH3H 1G3DA 3NUMA 3GY6A 4X6PA 5DK1A 2ZDLA 1C2GA 2BY7X 3A89A 2EA3A 3BG8A 1TX6A 1TPAE 2HRVA 1GI9B 1GMDG 2ZQ2A 2HWLB 1P3EA 1T4UH 1SGFA 2GT7A 1YPKH 7GCHG 2XC5A 1NY22 4WWYA 1EPTB 1QBVH 1S0RA 2AS9A 2F83A 1UTOA 1NC6A 2H5CA 2LNCA 2QYIA 1XUKA 3FZZA 4UDWH 3SUFA 1L4DA 1C2IA 1ZMLA 1C1NA 2RG3A 1LO6A 1A0JA 1E34B 1PYTC 5I46H 1NFXA 1HXEH 1G37A 1ZZZA 3F9HA 2BOHB 1ZR0A 5EQSA 2PW8H 3T29A 1OPHB 2ZECA 2BB4A 3BSQA 1NROH 1SR5C 1AMHA 2YNBA 3DA9B 3UQOA 3AAUA 2XCFA 2ALPA 3RXEA 1HAVA 2FTMA 1TNGA 3NCLA 1YLCA 1YPMH 3OYPA 1T32A 1BMMH 3SJKA 2OINA 1ZTLA 3T27A 4CR9A 1HJAC 2H9HA 3RU4D 3B8JA 2B7DH 1E37B 3SJ9A 2IPHA 2ZTXA 2C8ZB 2FZZA 4WF8A 5CMXH 5H4IB 1A3BH 1N8OC 1TPPA 1KXEA 1IQKA 4FUHA 1C2LA 2OQUA 1PPCE 4MPXA 3F68H 3S9AA 5SGAE 3M5LA 4NWLA 1GI8B 2P8OC 4MLFB 1UCYE 1C1MA 1YP9A 4B74A 1FLEE 1O33A 1P3CA 1BBRH 1ELTA 1KXBA 2G52A 4KGAA 2IN2A 4AGKA 3O8CA 2ZFFH 5E2PA 5FCKA 1BTWA 2FWWA 5GDSH 4A7IB 5ETXA 1UTNA 1W2KH 2G00A 5GXPA 1SOTA 2TIOA 2FOBA 2B0FA 3MO6A 3Q00A 1EP6A 1J14A 1OWJA 1BHXB 2FI5E 2O8WA 3TJNA 1QY6A 4WH6A 3U1IB 1F92A 1DSUA 2HPPH 4JK6A 1ELFA 4Y10E 2Y7ZA 5EPNA 2GCHG 2P3UB 2DE9A 3CS0A 4YZUA 2FOCA 1HAVB 2F9VA 2GTBA 1SFIA 1C1RA 1GMCG 2AYWA 1DOJA 3UWIA 1CBWB 1CGIE 5J4SA 2CXVA 1LPKB 1QTFA 2AGGX 3LIWA 1AGJA 1UVUH 2WPKS 4ZHLU 3RXJA 1F2SE 4UD9H 4INKA 1NRSH 2A32A 3GY2A 5EXLA 2Z9KA 3U1JB 1RD3B 1GCTB 2RCEA 5HM9A 1A2CH 1WV7H 2XC0A 2XW9A 2ANMH 1BITA 3A8AA 3BTDE 1HIAB 2AMDA 1LVYA 1EOJA 1V2KT 4WMDA 1S83A 1Z8IB 1EP5A 1GJBB 3NZIA 5JYIA 4WXIA 1ZHMA 1LCYA 2JETB 1C5RA 2O8MA 1IQMA 1EPTA 3A81A 4ISIH 4O3TA 1AU8A 1O2XA 1AE5A 6GCHG 2PTCE 1CA0C 1SGCA 2BOKA 1BTYA 2GV7A 4TY7A 1MTWA 1V2NT 1OOKB 1ESTA 2GZ9A 1GBKA 1ZSJA 2EC9H 2BQWB 2AEIH 3LJOA 3VB7A 1GJDB 2OC8A 1IQEA 1ZOMA 3PB1E 3QTOH 1K1JA 2CHAB 1A1RA 1T8MA 2BD4A 1TRYA 1MBQA 1SQAA 3DUXH 3L33A 1MUEB 1UJ1A 4INHA 1GBBA 4M7GA 4RKJB 3M5NA 3ZYDA 1OWEA 1C1OA 2RDLA 3FANA 2GMTB 1JMOH 2VWOA 3RXIA 3BTWE 3RM2H 2OCVB 3BTGE 1HAHH 3A85A 2EI7A 1LVMA 2OTVA 2H2ZA 2FI4E 1XM1A 3PTNA 1N6XA 3TU7H 1ETRH 2UUFB 3MH6A 2ZQ1A 1C5MD 2OC1A 2Y6TA 1V2OT 2XWAA 3SUEA 1V2TT 3SQHE 2QN5T 1XVOA 3JZ2B 4A6LA 1EJMA 2GGVB 3P8NA 1UVOA 3FVFB 2BVXH 1PFXC 4OS4A 1NTPA 2PSYA 3TVJB 4HGCA 2BDHA 4MTBA 1O3FA 5JPMH 2A4RA 4IC5A 3RXHA 2KAIA 4NIVA 3S69A 1VCPA 1SGEE 3RXKA 3ZZ5A 2GDDA 2RA3A 2ZNKH 4B2BA 3H7OA 3ZVEA 1LMWB 3RXPA 2W7UA 1ANEA 1GHXH 3O8BA 1G9IE 1C2KA 1P2NA 1CT4E 4Y71A 2P94A 2AFQB 3MOCA 3LGVA 1W13U 1SGFG 4X8UH 2GVFA 1QL8A 1BQYA 3RMMH 1W11U 1L1JA 1C1WH 2ZGXH 3W94A 2BX3A 3UR6A 1IQHA 1CA0B 3S0NA 3E6PH 3A8BA 1P04A 4ABAA 2ALVA 4X2VA 3IG6B 3PV4A 4Q7YA 1K21H 2BY8X 4YM9A 3Q3YA 3RXAA 3BTEE 3A7WA 4NG9H 1B5GH 1EAWA 3TJUA 1P2QA 4AFUA 1O3MA 2QA9E 1O2VA 1GMCF 5F8XA 1GHBF 1GBCA 2ZZUH 1D9IA 1GL0E 3GYMA 2V3OH 1GMHF 3UREA 3EA8A 3HKIB 5I25A 5T6FA 1GI7B 1KLJH 3AW0A 1K1LA 3BV9B 1P2OA 5BPEA 2QY0B 2SFAA 4U01A 1C5OH 2XBXA 1AE8H 5LH8A 1EAUA 3KIDU 1F5RA 2R0KA 3I77A 2ODQA 4A1XA 2XC4A 1IAUA 3MU4A 1UVTH 1O3AA 3KNXA 3VB5A 1YLDA 1Y5AT 4VGCC 1XUFA 1RS0A 1DXWA 3BEIB 5L2ZH 5CE1A 5JBTA 1JRSA 1J9CH 3RC4A 3MO9A 4ABGA 2AGEX 2J9NA 1VGCC 1MU8B 2ZHDA 1TE0A 3NKKA 1J8AA 3RU4E 1HXFH 3MYWA 3P8GA 1PQ8A 2QGRA 1RGQA 1HAYB 1SL3A 1BZXE 5C1YA 2H6MA 1C1SA 1RIWB 4NCYA 2SGPE 1AQ7A 3ATLA 3DHKH 3RXOA 1L2EA 2Z9JA 4SGBE 4ZKOU 1P8VC 4Y79A 1G2LA 1C4Y2 2XBVA 1RTKA 1GDUA 4AYVB 2VWNA 5JDUB 3MHWU 1GHAF 4JCNA 1XUJA 1YPJH 1QFKH 2P3FH 2HOBA 1DANH 2V6NA 3RXVA 1YM0A 5ESTE 4JK5A 2G5NA 2A31A 3KQCA 1PQAA 5EG4A 5F8ZA 4LZ1H 4LK4A 4YOGA 4X1SU 2WYGA 2FEQH 2QC2A 1HAGE 2QF0A 3SW2B 1ELDE 2VH6A 4AX9H 3SU1A 9ESTA 3SNAA 3SHAH 5TCAA 1GJ4H 2JETC 2ULLA 4FUDA 5EPYA 1GHYH 3OX7U 1GJ7B 2ZCHP 2VVVA 4TPIZ 1BJVA 1SQOA 2CN0H 1VJ9U 5F8TA 1IQLA 1ZTKA 2H9TH 4X8SH 1C2MA 2W3KA 2ZHQH 4ZAEA 1TA6A 1ELBA 4NGAH 4DJZB 1EX3A 5EW2H 4UE7H 1O2MA 2VIWA 4YT6H 1C2DA 1BCUH 1CA8B 1FPHH 1FNIA 2F9PA 1ZMJA 3KL6A 3SV6A 1CU1A 3KCGH 3UY9A 5C1UA 1FY3A 5EW1H 5HGGA 1P02A 4GLYA 1BTHH 1EAIA 1C5PA 3ESTA 2R2WU 2K1QA 3VEQB 1UTMA 2BD8A 1WBGB 2BQ6B 1MTNB 1OX1A 5A8YA 1C5TA 2QV1A 2PKAA 1WTHD 2ZGJA 1AWHB 4ISHH 4LZ4B 4GUXA 4NA8A 1UCYK 3ZZ7A 1HCGA 3ELAH 3NXPA 4K69A 1IQFA 3LPRA 1WAYB 4OS2A 1WCZA 3MNBA 1GGDB 4FU8A 5JB8S 2F3CE 3SV7A 3ZVDA 1AZ8A 5C5NA 4NFEA 2ZDNA 4Y8YA 4O03A 1TRNA 4D8NA 3C27B 3UNQA 3A84A 4IW4E 2BY5X 2ZDVH 1BDAA 3HK6B 2Z9LA 2ESTE 4AFSA 3A7ZA 4GHTA 4ZXYH 1D3PB 1TNKA 3A8CA 5DKMA 2ZWLH 1RIWC 4MNYA 3RLYH 2PR3A 4B73A 1J16A 2A4OA 4UFEH 5E0JA 2A5AA 4Q80A 1FZZA 2QXJA 1NU9A 1T31A 1NU7B 1C1TA 3QWCH 2VB0A 4Y7AA 5DP3A 3BN9A 2FIRH 2BZ6H 5GCHF 1EAXA 4KTCA 1QB9A 4IMQA 1QR3E 2AERH 5DP9A 5LPRA 2Y81A 4X2XA 3SGAE 3SGQE 1TMBH 1C1VH 1D3TB 1KTTB 1V2ST 5DG6A 4AOQA 3M7QA 3SNEA 4Q7ZA 1DT2A 4I31A 1JIRA 1OKXA 1XKBC 4WVPE 1AVWA 1DUEA 4KTSA 4ABHA 4D76A 1C5UA 2PHBA 4Y6DA 1D6RA 4AG1A 1LVBA 2AIPA 2P3TB 3D62A 3LGUA 1A3EH 3SU0A 4CRAA 1ZHPA 5IYTA 2EEKA 4X6NA 3D23A 1UO6A 4HZHA 1NRQH 5T6GA 3T25A 3ZVCA 3BTQE 1HLTH 1PPBH 2UUJB 4K3JA 3DT0H 8GCHG 1HUTH 2UWOA 4E06H 5L30H 1C9TA 1OP8A 1VJAU 4X8TH 2TGDA 2A1DB 4ZXXH 1G3BA 2ZPRA 5FX5A 1E35B 5EQQA 3MFJA 1QA0A 4CRGA 2Z9GA 5GCHG 1DWBH 1MBMA 2ZFQH 5A0CA 1CHOF 6ESTA 7LPRA 4K1EA 1C2HA 4D7GA 1O2NA 1T4VH 4CH2B 3V0XA 3EQ0H 1EKBB 1BOQA 1O5EH 1XXDA 3VXEH 1YPEH 4XE4A 1O5CB 1W0ZU 5EXMA 3MNSA 1QQUA 1CQQA 1MKXH 1TAWA 2BY6X 2FI3E 1DY8A 1ZGVA 3B9FH 1TALA 1O31A 1GPZA 1O37A 1YC0A 3MH7A 1O3GA 2VIDA 1Z1JA 2F91A 8GCHF 1WUNH 3SN8A 1LHDH 4K5ZA 4R0IA 3BIVH 3UOUA 4JZFH 1C2JA 1WQSA 1TNIA 6LPRA 1V2QT 1ZHRA 4FUEA 1Q3XA 4RKOB 1V2WT 1YPLH 2C8XB 2XNIA 1CHGA 2BDYA 3VGCC 3ZVGA 1VR1H 1MKWH 4IN1A 3TJOA 2I6QA 1O2OA 1MAXA 4X2YA 4K1SA 4X1QU 3ODFA 3TIUA 1GBDA 2TRMA 3RXBA 1UTLM 1Z8RA 1HAPH 4JZIA 4WXVA 5E2OA 4ABJA 1C4V2 1MD7A 4X6MA 4B1TA 2DE8A 1WSSH 1Z6EA 4FUJA 4MVNA 1P03A 1IQGA 2Y82A 2RA0A 1UTKA 2HGTH 4Y8XA 1UHBA 1ZGIA 1PQ5A 1O38A 4GAWA 1F5LA 3TGKE 4FUCA 3ZVAA 3M7UA 4HTCH 1S82A 3AW1A 2ZTYA 1RTFB 1TGSZ 1FY4A 1O5DH 1SG8B 5DP5A 1FAKH 1FDPA 7ESTE 3P95A 3EYDA 3GY4A 3BTHE 3ZZCA 2BD3A 1FUJA 4Y7BA 1D3DB 3RXGA 3EDXB 2B8OH 4CRCA 2IOTA 1D4PB 1MTUA 2JKHA 5G4BA 2VIOA 4OS6A 1FY5A 3T5FH 1MKWK 1TABE 1O2IA 2C93B 2A7CA 5E0GA 1JRTA 1EB2A 2HNTE 3FZDA 1ZLRA 1ELGA 1DY9A 4QT8C 1P9UA 4TYDA 2ZPSA 5C20A 1KXFA 5JBCS 5EGMA 2AH4X 2VGCC 4IMZA 3ZZBA 2UUKB 1H9HE 3HPTB 3GCTF 4FUBA 1ZJDA 3MU1A 2Q6DA 1TB6H 2WPLS 3S7KB 1TPOA 2ZCKP 1Z1IA 1P2IA 1ORFA 1CSOE 2J34A 1UK3A 2G4UA 1HNEE 3PLKA 1U6QA 3STJA 5LGOA 3A88A 1JWTA 1V2UT 1VCQA 3AVZA 1CGHA 3LC3A 1K9OE 1JOUB 3VFEA 2OQ5A 3U69H 1F5KU 4YLUA 1A61H 5FBEA 1NFWA 2OC0A 4JMYA 2A2XH 4AYYB 3SU2A 5ESBA 3FP8E 1TLDA 3MNCA 1BHXF 3L3TA 3ODDA 1FAXA 3HK3B 1W7GH 2XXLA 4MPWA 2STAE 3IITA 1Z6JH 3Q3XA 4LXBH 2UWPA 3ATWA 2BMGB 3SI4H 2WV4A 3CP7A 4I8LA 3O8DA 4F49A 3LJJA 1DWEH 3UR9A 3ZZ6A 1SI5H 4BAHB 3M61U 3M3SA 3F9FA 3RXSA 1O3KA 1TGTA 2V0BA 1PQ7A
chains in the Genus database with same CATH superfamily
5TJXA 1VITF 4WMFA 4H6SB 4TT3D 3ZZ4A 4AORA 2FOGA 2PTNA 1HJAB 1SSXA 3OE7D 3TLOA 4I8KA 1J15A 5HM2A 1Y3VA 5FHTA 8ESTE 1H8DH 2CF9H 1A5GH 3QX5H 5EODA 1W0YH 1AUTC 2SGFE 4DG4A 1ETTH 3BIUH 4ABEA 1Q31A 1QURH 3DSPA 1ZSLA 2XTTB 1QGFA 1AKSB 2ZDMA 1BMNH 3N99A 4ASHA 2A2QH 4FUGA 2W6JD 3BTTE 4NIWA 5C67A 1C1PA 2Z3CA 4Y76A 1F0RA 5DN6D 1B7XB 1SHYA 1SLWB 2TGAA 4CHAC 3SZNA 2JH0D 2VVUA 4XRNA 2FODA 2BLOA 3DSGA 4GPGA 1GMHG 3TH2H 2ANYA 3PLPA 4NZQA 3U28C 4ABFA 3PROA 3D65E 4ZROA 1V2RT 2JH5D 1GJAB 1NPMA 3SU6A 2BVRH 1SPJA 1IOEA 2GKVE 2ZO3H 3GICB 1SLVB 4X2WA 1C5NH 1JIMA 3RC6A 2GT8A 6CHAB 1NRPH 1EASA 2ZF0H 1GHAG 2FLBH 1T8OA 1AHTH 2P59A 3GCHC 2FOFA 3MNXA 1L1GA 2OBQA 2XWBI 3A7XA 2KAIB 3TNTA 1S5SA 1XUHA 2GJGA 3IWMA 1K1MA 1RJXB 3VB4A 1HYLA 4Q63A 3OY6U 1O3LA 4UFGH 5GPIB 2GZ8A 4BTTB 6CHAC 2EY4C 3SQEE 3PO1B 1GBHA 3K2UA 2ZHWH 1DPOA 4JZ1A 3QZRA 4HFPB 5HXFA 2ZA5A 3V12A 1HAXB 1TONA 1MZDA 1C5YB 4NIXA 3FOAA 3VPKA 3E1XB 3LGTA 4OS5A 1E38B 3NK8A 3SV2H 4DIHH 3MU8A 1A7SA 2VIQA 5A8ZA 3P8FA 7KMEH 4BAKB 1GVLA 3QUMP 4BAOB 2ZFPH 1HJ9A 2J92A 2VINA 2R3UA 3BEFB 1O3BA 1W8BH 5L2YH 4MQAA 4IC6A 1M9UA 1P57B 2VH0A 3MTYA 1OP2A 2BHGA 1AUJA 1UK4A 4MNWA 1DFPA 1W7XH 2FS9A 3PTBA 1L0ZA 2K8IA 1QNJA 3UQVA 2A5KA 1KDQB 2J4IA 2J5UA 3S9CA 1DSTA 4Y8ZA 5EJLA 2GD4B 2PWXA 1O2LA 1SB1H 3MQKC 5A0AE 3WY8A 2NU4E 4GHQA 3M7TA 1TNJA 1UTQA 4WMEA 1HBTH 1HFDA 3VB6A 1LHFH 4I8JA 3U8OH 1W12U 2O9QA 1LVOA 1MTNC 1QJ1B 2GMTC 3URDA 3MO3A 4XFQA 3GOVB 2FXRA 3ZZ9A 1AVXA 1D6WA 4Q4LA 4HI3A 1HIAA 1CHOG 4Z6AH 1ELVA 2G5VA 4O3UA 2F9OA 2H9EH 2ZFSA 2THFB 1GBIA 1A5IA 1HPGA 1O3EA 1YPHE 4TY6A 1TA2A 2TPIZ 3DCLA 3UPEA 1SOZA 1SMFE 3URCA 1C5XB 2ZTZA 2UUYA 2ANWA 4ZKNU 1YF4A 3A86A 2Q6GA 1O0DH 1AIXH 3PWCA 2BLQA 1IQIA 3RXTA 2VWLA 1BTPA 2W6ID 3SNDA 3A87A 5PTPA 2ZP0H 3EGKH 3KHVA 1FV9A 1Y3YA 2P16A 1ZRBA 1X7AC 5JBAS 1GBTA 2ZI2H 2BDAA 3GY7A 1TYNA 2ODPA 3AAVA 1WTGH 5ABWA 3RMOH 1O30A 1MAYA 1QBNA 5C17A 2GCHF 1K1OA 1PPZA 1Q2WA 1CBWC 3PMJA 1HV7A 2ZC9H 2ZU2A 3RXDA 2WZQA 4OS1A 5FX6A 1FMGA 5TCCA 1S6LA 4DURA 4ABBA 2BYAX 4Q7XA 3RMLH 4CBOA 3UIRA 4O97A 3W95A 2PGBB 3PMAB 1GBJA 1LDTT 4B76A 5C1XA 1LTOA 1SGQE 3RU4T 3RMNH 4E05H 2A7HA 3F2FA 1DVAH 1EZSC 1IHTH 1UW7A 1TBZH 1V2PT 1NN6A 2V3HH 1K2I1 1YPGH 3E0PB 3A7TA 4KKDA 2R0LA 3F6UH 3E3TA 1PPEE 2ZIQH 5AHGH 1MU6B 1DITH 1OHHD 2WPHS 2L6OA 2J2UA 2P95A 1RXPA 3ZV9A 5EOKA 1SGPE 1KXAA 3N7EA 1O35A 4YLQH 2BD9A 3N7OA 4OM9A 2DUCA 5JBBS 5EQRA 5FPYA 4ZH8A 1K22H 2Z94A 1AB9C 3GY8A 2WPIS 2C8YB 2FOEA 2CHAC 1EZXC 1H8IH 1QJ7B 1ZSKA 2J94A 3M36A 5K7RA 3QK1A 1MKXK 1E1RD 4X1PU 3FP6E 3VG8A 1P09A 1V2MT 1UTJA 2KCOA 5B6OA 3RP2A 3QN7A 1DWCH 2WUCA 1V3XA 1C9PA 4INLA 5F53A 1FJSA 1P2KA 2FO9A 2H1UA 3A7VA 1DDJA 1GI1A 3MWIU 1HRTH 1GBLA 1OSSA 2EI8A 4AN7A 2Y80A 4XBDA 1DLEA 5A0BA 1BMLA 3WWBA 4VGCB 2W7SA 3GCOA 1Z71A 3PO1C 1O3HA 3UB0A 2HNTC 3TGJE 1T7CA 2ZPQA 5FXLA 1QL7A 4FVDA 1V2JT 4K60A 2QIQA 4AFZA 2SNVA 1IQNA 1OP0A 3TK5A 2M5TA 7GCHF 4BOHA 1PJPA 4BXWA 1UK2A 1B0EA 1SLXB 1P05A 3Q77A 4RSPA 3H5CB 4K2YA 2ZCLP 2SGAA 4B2CA 1ANDA 2G81E 2O8LA 1CT0E 1L1NA 5HYOA 2WYJA 1GJ9B 4A92A 2BTCE 2FESH 3CS7A 3SNBA 2G51A 4FUIA 1ZTJA 1TX7A 3FP7E 3OY5U 4CRFA 1GBEA 2CV3A 1C5ZB 1HDTH 3A80A 1BBRK 1QHRB 3Q3KA 2V35A 3ZYEA 2VIPA 4U32A 2J98B 1AD8H 4E7RG 1O3PB 1MZAA 1SVPA 4XD7D 1KLTA 3LT3A 3QGJA 3UAIC 1UVSH 4CRBA 1GHBG 3RXQA 3R3GB 1P10A 2BY9X 3VB3A 1O5FH 3SHCH 3TK9A 1O3OA 2IJOB 2WSSD 3F0OA 4X6OA 1BRUP 3SO3A 2PP6A 2XYAA 5DSFA 1LQDB 1SGIB 1QCPA 4DOQA 2A4QA 2B5TB 5EU8A 1O3NA 2D8WA 1BBRE 1EJNA 2XOKD 3UWJH 3OTJE 5IDKA 2TGPZ 1TMUH 2L74A 3MH4A 3T26A 5GWZA 4UONA 1FIWA 3F2GA 1GI3A 1GJ6A 3R0FA 3G01A 4B2AA 5FPSA 2R9PA 1HGTH 4NSVA 4Z0KA 2YMSD 4ISNA 5A2MH 1NZQH 1DWDH 4UFFH 4D9RA 3ZZDA 5T3HA 4NIYA 4A1VA 2XRCA 2ZDAH 1YCPM 2AMPA 1P12E 3P17H 4NWKA 2VWMA 1DX5M 3MH5A 2FOMB 3LU9B 1DS2E 1AO5A 2RFKC 1TFXA 3HGPA 1HAOH 1H9LB 1N1LA 3DD2H 1SQTA 2FLRH 1O2ZA 2SGDE 4ZMAH 2G4TA 1MCVA 1GDNA 1XKAC 3TH4H 2PFEA 4DY7B 3SJOA 2VVCA 3V3MA 4CRDA 1O5BB 2Y5FA 3CENA 3LC5A 1ANBA 1YLNA 4DW2U 1MD8A 4NSYA 4FVBA 1GBMA 3TK6A 1P0SH 1ELAA 3UUZA 4DT7B 2Z3EA 4AGJA 1PPFE 1ANCA 1KYNA 1A0HB 1TNLA 3P92A 1BRAA 2NWNA 3GCNA 2Y7XA 2BLVA 1BA8B 2BX4A 2V3MA 1NFUA 5AFZH 2ZU1A 1YKTA 3ZZAA 4FUFA 3EA9A 4AZ2B 1V6DA 4NA7A 2BLWA 2OP9A 3QDZB 4J2YB 4KP0A 1AFEH 5HIYA 2PKAB 1GI0A 5C2ZA 1E0FD 5AFYH 1QBOA 1SGYE 4E7NA 2YOLA 5DP7A 2PLXA 1BUIA 4I8HA 4XDEA 1V2VT 4U30A 3RXCA 3ZZ3A 1EQ9A 2QAAA 1V2LT 1EJAA 1YWUA 4NA9H 1C5VA 2NU0E 3RC5A 2XBYA 1YBWA 2BDIA 3ZVBA 3KEEA 1E36B 2QF5A 3SJ8A 2FS8A 1RFNA 2FOAA 2NU3E 1RRKA 3OFND 3QZQA 1G3CA 2J95A 5EXNA 2BXTH 2ZGBH 4CREA 1GG6B 1QRXA 2BD2A 1ZPBA 1HB0B 1MQ5A 1QL9A 3A82A 3TITA 3GCTG 4P00A 1TBQH 2ASUB 1O2WA 2PV9B 5LPEA 4I8GA 2ZG0H 2A0QB 4ISLA 4XSKU 1FY1A 3PMHB 4NFFA 5A09A 1O34A 3A7YA 5C5OA 3BG4B 3LGIA 4ACAA 1XX9A 1QRZA 4R8TB 1GVKB 3S9BA 3SGBE 1KDQA 1Y8TA 1PPGE 4JYVH 1OXGA 4FXGH 1O2SA 3N7DA 1O3CA 2PSXA 1QJ6B 9LPRA 1A0LA 4BTIB 5DP8A 1VZQH 1C5WB 3ZVFA 1DUAA 1Y59T 3PMBB 3PWBA 1FXYA 4Q2KA 2FPZA 1GI6A 3FO8D 3KQDA 2Z9IA 2ZU4A 4CH8B 2K0QA 5C3NA 2GX4A 3RDZA 3ATKA 1G36A 3EAJA 4KELA 3P70B 3FKSD 3T2NA 1NT1A 4GCHG 3M5OA 4H42U 1NO9H 1GHZA 2OK5A 4ZHAA 1CE5A 5FPTA 1G2MA 3SV9A 4AG2A 2WINI 1MMJN 1LPZB 2A7JA 1LHCH 1K1PA 2FYQA 1ELEE 2ZU5A 4IS5A 2QCYA 2PUQH 1OYTH 3SU5A 4IN2A 1L4ZA 2VU8E 1ACBE 2CF8H 1O2JA 2Q1JA 3SU4A 4DT4A 2FMJA 3M3TA 1TGBA 3M37A 3MMGA 2W5EA 1S6HA 3A83A 3I78A 4ZKRU 4CBNA 1TOMH 1ZYOA 1ELCA 1JXPA 3ZZ8A 3STIA 1F0SA 2HALA 1BIOA 1QB1A 3UTUH 3U98H 4K8BA 1CT2E 1H4WA 4ZUHA 1BB0B 5EJ1A 1TWXB 2NU2E 2OC7A 4WH8A 2QF3A 1XUGA 1LPGB 3UNSA 4DGJA 3C1KA 3KQBA 1YCPK 1TX8A 4GCHF 5F6MA 3ITIA 4Y11E 4JZDH 3E8LA 1ETSH 1SC8U 5DP6A 1EZQA 1O2HA 4WJG2 1AI8H 3I29A 2TBSA 3KQ5A 3OSYA 4O9VA 2GCTC 1Z8JB 3H09A 1T8NA 2JDID 3T62A 1GBAA 1TOCB 1GDQA 5DP4A 5C0UA 1QB6A 1FN6A 3NPSA 4ZHMU 1CGJE 1GI5A 4X1NU 3SZEA 4D9QA 1S81A 2BXUH 1O5AB 1WOFA 5CHAB 1AFQC 2ZGHA 5DJ7A 1AKSA 1FI8A 1RTLA 1Y5UT 2CK3D 3KYGA 1KLIH 3HGNA 4BAMB 3SJIA 4ESTE 3MI4A 3SUDA 1THPB 1AY6H 1W14U 4RN6A 1N6YA 3BEUA 1C5SA 2G55A 4B6EA 4IGDA 3MU5A 3OEED 1KIGH 3EA7A 1FONA 1B0FA 3SU3A 3SNCA 2D2DA 1WDIA 2BM2A 4H6TA 5K0HA 2WUBA 3M5MA 1TIOA 1A46H 1DM4B 2GV6A 5FL7D 3VXFH 2FTLE 4ABIA 4YTAA 3LGWA 1EB1H 3GYLB 4WY3A 1GHWH 1GGDC 1TQ7B 5HIZA 1C1UH 4XBCA 2M2AA 3H7TA 1Y3WA 1LKBA 3E16B 3K65B 3ENSB 1FPCH 1H9IE 2HLCA 4DCDA 2Q6FA 1GCDA 3E0NB 1P9SA 1OWDA 4YESB 1WYKA 1P11E 3ZV8A 1AWFH 5AF9H 1ARBA 1W10U 4A1TA 3OU0A 3V13A 3RXMA 1S85A 1ESBA 3GCHB 1C2FA 2ZKSA 1SGDE 1G30B 1P2MA 4JZEH 4Y0YE 1P01A 3LKWA 2PUXB 1K1IA 2PKSB 1A5HA 3FFGA 2CMYA 1ZPZA 2W26A 1XVMA 3RUOA 2GP9B 3P8OA 1BTXA 5EIYA 3GDSA 1EPTC 2BD7A 4MDSA 2Z3DA 3RLWH 1SGRE 2EI6A 4XBBA 3EE0B 2ZFTA 2GZ7A 1O2YA 4ZKSU 2C4FH 2SNWA 1TGNA 2WV9A 3DFJA 1VITG 4CHAB 4MNXA 1YPHC 4YOIA 1TNHA 1PYTD 4YT7H 1AZZA 1O3DA 4DVAU 1BMAA 1VCWA 1WU1A 2QXIA 1O3JA 1AFQB 1GJCB 2A45B 1HAIH 4JYUH 2OD3B 1LHGH 2ILNA 1SGNE 1UCYH 3PRBA 4Y0ZE 1PPHE 3K6YA 1YGCH 3GISB 1SGTA 2UWLA 1LKAA 2AIQA 1F0TA 1P2JA 6GCHF 2GCTB 1O3IA 4OS7A 3ATIA 3SORA 3JZ1B 4B75A 5C0TA 3TNSA 3BF6H 8KME2 4AB9A 1BRCE 2PGQB 2SGEE 1UHBB 1C1QA 2WPDD 3F9EA 4X8VH 4MG3A 3TGIE 2O8UA 4MNVA 4TPYA 4TWWA 4GVUA 1ABIH 1GBFA 3M3VA 1O39A 1SQRA 1K1NA 1FX0B 4P02A 1YYY1 4J1YA 5B6LA 3RXUA 1DICA 1C4U2 2PKSC 2STBE 2AGIX 1QQ4A 5FBIA 1O2PA 1SBWA 3BTME 2BDBA 3GY5A 1FIZA 1IQJA 4DIIH 2P8OB 3UFAA 8LPRA 1INCA 1CO7E 2HNTF 2C8WB 2R3YA 1KXDA 1UTPA 2KZ4A 3LDXH 3NWUA 3T28A 1BT7A 1TQ0B 5T6DA 1KMHB 1F7ZA 2D1JA 4KTUA 1O2RA 3BTFE 1KXCA 4I33A 4OGXA 1EZUC 1Y3XA 3RXLA 1BJUA 1GJ5H 1ZPCA 2QXHA 2OUAA 3W1EA 1GWAA 3LOXA 4TWYA 1G32B 3BTKE 2HVYB 1OWIA 3UNRA 4K1TA 2Y5GA 3VGCB 3HKJB 1FY8E 5J4QA 3KN2A 4YO9A 2Y5HA 2FX6A 1EXFA 2I6SA 1NESE 2FOHA 2HPQH 1AB9B 1DXPA 1ID5H 3LH1A 3GY3A 3O8RA 3LONA 1NRNH 2O8TA 2CGAA 1NS3A 2FX4A 4MPUA 1O2GH 3SV8A 1CVWH 1T8LA 3U8RH 3ATMA 2SGQE 2C90B 2WHXA 3KF2A 1KY9A 1TPSA 1THRH 1EATA 1DLKB 1O2UA 1K0HA 1TMTH 1GI4A 5HMAA 2Z6BD 3V7TA 5JB9S 3E90B 4BANB 2XCNA 2YNAA 1QIXB 3HATH 1O5GH 2WV5A 1QA7A 4JYTA 3RM0H 3PM3A 2A5IA 1BTZA 1JBUH 1N8OB 3L6PA 1S0QA 5DPAA 3D49H 1Y5BT 5CHAC 1SFQB 3SUGA 1O36A 1XUIA 1AN1E 3FN8A 1GL1A 2ZHEH 3K6ZA 1TBRH 3PYHA 2VGCB 5GJ4B 2AMQA 1Z8GA 3QO6A 2J38A 4BTUB 2FYRA 2ZGCA 3LGYA 3MU0A 1FQ3A 1GG6C 2BD5A 1GVZA 2ZFRH 1D3QB 4I32A 1W3CA 4F4OC 4D7FA 2BZAA 1P06A 1ZRKA 3B23B 1DE7H 3GDUA 2WPJS 2P93A 1MTVA 2C3SA 3FAOA 2VNTA 1S84A 1ESAA 1LQEA 1TRMA 2XBWA 2HVXA 2TGTA 5BRRE 1UVPA 1O2KA 1MCTA 1NM6A 2ODYB 1J17T 2CJIA 2VIVA 4IBLH 1MQ6A 1OWHA 4BXSA 3E91A 2ZDKA 4UFDH 1KTSB 4NZLA 2NU1E 4U2WA 4AC9A 1C5QA 1G3EA 2LP6A 5E0HA 3RXFA 5GIBA 3DFLA 3TPIZ 1OWKA 1THSH 1VITH 1FN8A 3Q76A 4X1RU 2ZHFH 2G8TA 1GHVH 4FU9A 1H1BA 3SI3H 1IHSH 4AFQA 4AB8A 1Y3UA 2FP7B 1TGCA 4X0WU 1YCPH 2JH6D 3A8DA 5AVDA 1A4WH 4RT1A 2OLGA 5LPFA 1AVGH 2J97A 1O2TA 4FU7A 1F0UA 1MTSA 1OS8A 4CR5A 2Z7FE 1Z7KA 5FCRA 2VJ1A 3AASA 1ZMNA 1EOLA 1O2QA 1O32A 1SHHB 2F9NA 1GI2A 1MH0A 4K8YA 2BQ7B 4THNH 1QRWA 1OYQA 3UOPA 4A5TS 4BNRA 2KM0A 3QTVH 1BRBE 1K28D 2R2MB 4ACBA 2BVSH 3RXRA 2JJ2D 2OBOA 2GDEH 2F9BH 4MPVA 4PROA 2WPMS 1C5LH 3PLBA 2LPRA 3GDVA 1ARCA 3M35A 4H4FA 3BG4C 3F1SB 2BDGA 5F03A 2H5DA 1ZJKA 1S6FA 1SLUB 5DO4H 2RDEA 4ABDA 2A4GA 5E8EH 1GMDF 2FM2A 1BTUA 4BAQB 1EUFA 2B9LA 4HG6A 5DGJA 1HAZB 3P6ZB 4YOJA 3KQEA 1H8HD 4UEHH 5A8XA 4GSOA 1WQVH 2KCYA 3KGPA 3TJVA 1KSNA 2BDCA 2ZU3A 3OEHD 4ISOA 2QXGA 1C2EA 2D26C 1ABJH 2OXSA 1GCTC 4SGAE 4OGYA 4B71A 3S7HB 1XXFA 3U8TH 1VGCB 4LOYH 2F9UA 2W3IA 3F9GA 3SOSA 2KCPA 4XOJA 1NFYA 1LHEH 1XMNB 3K9XB 3QGNB 5L6NH 2ANKH 3QLPH 1GJ8B 1NRRH 1HJ8A 3LH3A 4I7YH 2FDAA 3U9AH 1UMAH 2ZEBA 3SBKA 5FAHA 3TH3H 1G3DA 3NUMA 3GY6A 4X6PA 5DK1A 2ZDLA 1C2GA 2BY7X 2KCAA 2EA3A 3A89A 1TX6A 3BG8A 1TPAE 2HRVA 1GI9B 1GMDG 2ZQ2A 2HWLB 1P3EA 1T4UH 1SGFA 2GT7A 5KGOA 1YPKH 7GCHG 2XC5A 1NY22 4WWYA 1EPTB 1QBVH 1S0RA 2AS9A 2F83A 1UTOA 1NC6A 2H5CA 2LNCA 2QYIA 1XUKA 3FZZA 4UDWH 3SUFA 1L4DA 1C2IA 1ZMLA 1C1NA 4FETA 2RG3A 1LO6A 1A0JA 1E34B 1PYTC 5I46H 1NFXA 1HXEH 1G37A 1ZZZA 3F9HA 2BOHB 1ZR0A 5EQSA 2PW8H 3T29A 1OPHB 2ZECA 2KR7A 2BB4A 3BSQA 1NROH 1SR5C 1AMHA 2YNBA 3DA9B 3UQOA 3AAUA 2XCFA 2ALPA 3RXEA 1HAVA 2FTMA 1TNGA 3NCLA 1YLCA 1YPMH 3OYPA 1T32A 2VBCA 1BMMH 3SJKA 2OINA 1ZTLA 3T27A 4CR9A 1HJAC 2H9HA 3OTPA 3RU4D 3B8JA 2B7DH 1E37B 3SJ9A 2IPHA 2ZTXA 2C8ZB 2FZZA 2IPQX 4WF8A 5CMXH 5H4IB 1A3BH 1N8OC 1TPPA 2QE7D 1KXEA 1IQKA 4FUHA 1C2LA 2OQUA 1PPCE 2HLDD 4MPXA 3F68H 3S9AA 5SGAE 3M5LA 4NWLA 1GI8B 2P8OC 4MLFB 1UCYE 1C1MA 1YP9A 4B74A 1FLEE 1O33A 1P3CA 1BBRH 1ELTA 1KXBA 2G52A 4KGAA 2IN2A 4AGKA 3O8CA 2ZFFH 5E2PA 5FCKA 1BTWA 2FWWA 5T1VA 5GDSH 4A7IB 5ETXA 1VKYA 1UTNA 1W2KH 2G00A 5GXPA 1SOTA 2TIOA 2FOBA 2B0FA 3MO6A 3Q00A 1EP6A 1J14A 1OWJA 1BHXB 2FI5E 2O8WA 3TJNA 1QY6A 4WH6A 3U1IB 1F92A 1DSUA 2HPPH 4JK6A 1ELFA 4Y10E 2Y7ZA 5EPNA 2GCHG 2P3UB 2DE9A 3CS0A 4YZUA 2FOCA 1HAVB 2F9VA 2GTBA 1SFIA 1C1RA 1GMCG 2AYWA 1DOJA 2QF4A 3UWIA 1CBWB 1CGIE 5J4SA 2CXVA 1LPKB 1QTFA 2AGGX 3LIWA 1AGJA 1UVUH 2WPKS 4ZHLU 3RXJA 1F2SE 5CHBA 4UD9H 4INKA 1NRSH 2A32A 3GY2A 5EXLA 2Z9KA 3U1JB 1RD3B 1GCTB 2RCEA 5HM9A 1A2CH 1WV7H 2XC0A 2XW9A 2ANMH 1NBMD 1BITA 3A8AA 3BTDE 1HIAB 2AMDA 1LVYA 1EOJA 1V2KT 4WMDA 1S83A 1Z8IB 1EP5A 1GJBB 3NZIA 5JYIA 4WXIA 1ZHMA 1LCYA 2JETB 1C5RA 2O8MA 4F48B 1IQMA 1EPTA 3A81A 4ISIH 4O3TA 1AU8A 1O2XA 1AE5A 6GCHG 2PTCE 1CA0C 1SGCA 2BOKA 1BTYA 2GV7A 4TY7A 1MTWA 1V2NT 1OOKB 1ESTA 2GZ9A 1GBKA 1ZSJA 2KX4A 2EC9H 2BQWB 2AEIH 3LJOA 3VB7A 1GJDB 2OC8A 1IQEA 1ZOMA 3PB1E 3QTOH 1W0KD 1K1JA 2CHAB 1A1RA 1H8ED 1T8MA 2BD4A 1TRYA 1MBQA 1SQAA 3DUXH 3L33A 1MUEB 1UJ1A 4INHA 1GBBA 4M7GA 4RKJB 3M5NA 3ZYDA 1OWEA 1C1OA 2RDLA 4B6FA 3FANA 2GMTB 1JMOH 2VWOA 3RXIA 3BTWE 3RM2H 2OCVB 3BTGE 1HAHH 3A85A 2EI7A 1LVMA 2OTVA 2H2ZA 2FI4E 1XM1A 3PTNA 1N6XA 3TU7H 1ETRH 2UUFB 3MH6A 2ZQ1A 1C5MD 2OC1A 2Y6TA 1V2OT 2XWAA 3SUEA 3PV2A 1V2TT 1SKYE 3SQHE 2LELA 2QN5T 1XVOA 1QZ8A 3JZ2B 1EJMA 4A6LA 2GGVB 3P8NA 1UVOA 3FVFB 2BVXH 1PFXC 4OS4A 1NTPA 2PSYA 4Z1MD 3TVJB 4HGCA 2BDHA 4MTBA 1O3FA 5JPMH 2A4RA 4IC5A 3RXHA 2KAIA 4NIVA 1YY3A 3S69A 1VCPA 1SGEE 3RXKA 3ZZ5A 2GDDA 2RA3A 2ZNKH 4B2BA 3H7OA 3ZVEA 1LMWB 3F2HA 3RXPA 2W7UA 1ANEA 1GHXH 3O8BA 1G9IE 1C2KA 1P2NA 1CT4E 4Y71A 2P94A 2AFQB 3MOCA 3LGVA 1W13U 1SGFG 4X8UH 2GVFA 1QL8A 1BQYA 3RMMH 1W11U 1L1JA 3KYFA 1C1WH 2ZGXH 3W94A 2BX3A 3UR6A 1IQHA 1CA0B 3S0NA 3E6PH 3A8BA 1P04A 4ABAA 2ALVA 4X2VA 3IG6B 3PV4A 4Q7YA 1K21H 2BY8X 2EQNA 4YM9A 3Q3YA 3RXAA 3BTEE 3A7WA 4NG9H 1B5GH 1EAWA 3TJUA 1P2QA 4AFUA 5CDFE 1O3MA 2QA9E 1O2VA 1GMCF 5HKKD 5F8XA 1GHBF 1GBCA 2ZZUH 1D9IA 4ASUD 1GL0E 3GYMA 1W0JD 2V3OH 1GMHF 3UREA 3EA8A 3HKIB 5I25A 5T6FA 1GI7B 1KLJH 3AW0A 1K1LA 3BV9B 5GNDA 1P2OA 5BPEA 2QY0B 2SFAA 4U01A 1C5OH 5C94A 1AE8H 2XBXA 5LH8A 1EAUA 3KIDU 1F5RA 2R0KA 3I77A 2ODQA 4A1XA 4F55A 2XC4A 1IAUA 3MU4A 1UVTH 4YXWD 1O3AA 3KNXA 3VB5A 1YLDA 1Y5AT 4VGCC 1XUFA 1RS0A 1DXWA 3BEIB 5L2ZH 5CE1A 5JBTA 1JRSA 1J9CH 3RC4A 3MO9A 4ABGA 2AGEX 2J9NA 1VGCC 1MU8B 2ZHDA 1TE0A 3NKKA 1J8AA 3RU4E 1HXFH 1COWD 3MYWA 3P8GA 1PQ8A 2QGRA 1RGQA 1HAYB 1SL3A 1BZXE 5C1YA 2H6MA 1C1SA 1RIWB 4NCYA 2SGPE 1AQ7A 3ATLA 3DHKH 3RXOA 1L2EA 3PV5A 4RI0A 2Z9JA 5KECA 4SGBE 4ZKOU 2YMSC 2YMSB 1P8VC 4Y79A 1G2LA 1C4Y2 3NRLA 2XBVA 1RTKA 1GDUA 4AYVB 2VWNA 5JDUB 3MHWU 1NBME 1GHAF 4JCNA 1XUJA 1YPJH 1MABB 1QFKH 2P3FH 2HOBA 1DANH 2V6NA 3RXVA 1YM0A 5ESTE 4JK5A 2G5NA 2A31A 3KQCA 1PQAA 5EG4A 5F8ZA 4LZ1H 4LK4A 4YOGA 4X1SU 2WYGA 2FEQH 2QC2A 1HAGE 2QF0A 3F0PA 3SW2B 1ELDE 2VH6A 4AX9H 3SU1A 9ESTA 3SNAA 3SHAH 5TCAA 1GJ4H 2JETC 2ULLA 4FUDA 5EPYA 1GHYH 3OX7U 1GJ7B 2ZCHP 2VVVA 4TPIZ 1BJVA 1SQOA 2CN0H 1VJ9U 5F8TA 1IQLA 1ZTKA 2H9TH 4X8SH 1C2MA 2W3KA 2ZHQH 4ZAEA 1TA6A 1ELBA 4NGAH 4DJZB 1EX3A 5EW2H 4UE7H 1O2MA 2VIWA 4YT6H 1C2DA 1BCUH 1CA8B 1FPHH 1FNIA 2F9PA 1ZMJA 3KL6A 3SV6A 1CU1A 3KCGH 3UY9A 5C1UA 1FY3A 5EW1H 5HGGA 1P02A 4GLYA 1BTHH 1EAIA 1C5PA 3ESTA 2R2WU 2K1QA 4TSFD 3VEQB 1UTMA 2BD8A 1WBGB 2BQ6B 1MTNB 1OX1A 5A8YA 2IJD1 5EJZA 1C5TA 2QV1A 2PKAA 1WTHD 2ZGJA 1AWHB 4ISHH 4LZ4B 4GUXA 4NA8A 1UCYK 3ZZ7A 1HCGA 3ELAH 3NXPA 4K69A 1IQFA 3LPRA 1WAYB 4OS2A 1WCZA 3MNBA 1GGDB 4FU8A 5JB8S 2F3CE 3SV7A 3ZVDA 1AZ8A 4FOUC 5C5NA 4NFEA 2ZDNA 4Y8YA 4O03A 1E79D 2KFWA 1TRNA 4D8NA 3C27B 3UNQA 3A84A 4IW4E 2BY5X 2ZDVH 1BDAA 2F43B 3HK6B 2Z9LA 2ESTE 4RT0A 4AFSA 3A7ZA 2J98A 3SYJA 4GHTA 4ZXYH 1D3PB 1TNKA 3A8CA 5DKMA 2ZWLH 1RIWC 4MNYA 3RLYH 2PR3A 4B73A 1J16A 2A4OA 4UFEH 5E0JA 3EE7A 2A5AA 4Q80A 5IK2D 1FZZA 2QXJA 1NU9A 1T31A 1NU7B 1C1TA 3QWCH 2VB0A 4Y7AA 5DP3A 3BN9A 2FIRH 2BZ6H 5GCHF 1EAXA 4KTCA 1E1QD 1QB9A 4IMQA 3WW7A 1QR3E 2AERH 5DP9A 5LPRA 2Y81A 4X2XA 3SGAE 3SGQE 1TMBH 1C1VH 1D3TB 4I86A 1KTTB 1V2ST 4M9FA 5DG6A 4AOQA 3M7QA 3SNEA 4Q7ZA 1DT2A 4I31A 1JIRA 1OKXA 1XKBC 4WVPE 1AVWA 1DUEA 4KTSA 4ABHA 4D76A 1C5UA 2PHBA 4Y6DA 1D6RA 4AG1A 1LVBA 2AIPA 2P3TB 3D62A 3LGUA 1A3EH 3SU0A 4CRAA 1ZHPA 5IYTA 2EEKA 4X6NA 3D23A 1UO6A 4HZHA 1NRQH 5T6GA 2F4LA 3T25A 3ZVCA 3BTQE 1HLTH 1PPBH 2UUJB 4K3JA 3DT0H 8GCHG 1HUTH 2UWOA 4E06H 5L30H 1C9TA 1VJAU 1OP8A 4X8TH 2TGDA 2A1DB 4ZXXH 1G3BA 2ZPRA 5FX5A 1E35B 5EQQA 3MFJA 1QA0A 4CRGA 2Z9GA 5GCHG 1DWBH 1MBMA 2XNDD 2ZFQH 5A0CA 1CHOF 6ESTA 7LPRA 4K1EA 1C2HA 4D7GA 1O2NA 3OAAD 1T4VH 4CH2B 3V0XA 3EQ0H 1EKBB 1BOQA 1O5EH 1XXDA 3VXEH 1YPEH 4XE4A 1O5CB 1W0ZU 5EXMA 3MNSA 1QQUA 1CQQA 1MKXH 1TAWA 2BY6X 2FI3E 1DY8A 1ZGVA 3B9FH 1TALA 1O31A 1GPZA 1O37A 1YC0A 3MH7A 1O3GA 2VIDA 1Z1JA 2F91A 8GCHF 1WUNH 3SN8A 1LHDH 3PRDA 4K5ZA 4R0IA 3BIVH 3UOUA 1BMFD 4JZFH 1C2JA 1WQSA 1TNIA 6LPRA 1V2QT 1ZHRA 4FUEA 1Q3XA 4RKOB 1V2WT 1YPLH 2C8XB 2XNIA 1CHGA 2BDYA 3VGCC 3ZVGA 1VR1H 1MKWH 4IN1A 2AHME 3TJOA 3F3BA 2I6QA 1O2OA 1MAXA 4X2YA 4K1SA 4X1QU 3ODFA 3TIUA 1GBDA 2TRMA 3RXBA 1UTLM 1Z8RA 3WWFA 1HAPH 4JZIA 4WXVA 1EFRD 5E2OA 4ABJA 1C4V2 1MD7A 4X6MA 4B1TA 2DE8A 1WSSH 1Z6EA 4FUJA 4MVNA 1P03A 1IQGA 2Y82A 2RA0A 1UTKA 2HGTH 4Y8XA 1UHBA 1ZGIA 1PQ5A 1O38A 4GAWA 1F5LA 3TGKE 4FUCA 3ZVAA 2JIZD 3M7UA 4HTCH 1S82A 2V7QD 3AW1A 2ZTYA 1RTFB 1TGSZ 1FY4A 1O5DH 1SG8B 5DP5A 1FAKH 1FDPA 7ESTE 3P95A 3EYDA 3GY4A 3BTHE 3ZZCA 2BD3A 1FUJA 4Y7BA 1D3DB 3RXGA 3EDXB 2B8OH 4CRCA 2IOTA 1D4PB 1MTUA 2JKHA 5G4BA 2VIOA 4OS6A 1FY5A 3T5FH 1MKWK 1TABE 1O2IA 2C93B 2A7CA 3GS9A 5E0GA 1JRTA 1EB2A 2HNTE 3FZDA 1ZLRA 1ELGA 1DY9A 4QT8C 1P9UA 4TYDA 2ZPSA 5C20A 3CNRA 1KXFA 5JBCS 1WXRA 3AK5A 5EGMA 2AH4X 2VGCC 4IMZA 3ZZBA 2UUKB 1H9HE 3HPTB 3GCTF 4FUBA 1ZJDA 3MU1A 2Q6DA 1TB6H 2WPLS 3S7KB 5KEDA 1TPOA 2ZCKP 1Z1IA 1P2IA 1ORFA 1CSOE 2J34A 1UK3A 2G4UA 1HNEE 3PLKA 1U6QA 3STJA 5LGOA 3A88A 1JWTA 1V2UT 1VCQA 3AVZA 1CGHA 3LC3A 1K9OE 1JOUB 3VFEA 2OQ5A 3U69H 1F5KU 4YLUA 1A61H 5FBEA 1NFWA 2OC0A 3DSOA 4JMYA 2A2XH 4AYYB 3SU2A 5ESBA 3FP8E 1TLDA 3MNCA 1BHXF 4ZCNA 3L3TA 3ODDA 1FAXA 3HK3B 1W7GH 2XXLA 4MPWA 2STAE 3IITA 1Z6JH 3Q3XA 4LXBH 2UWPA 3ATWA 2BMGB 3SI4H 2WV4A 3CP7A 4I8LA 3O8DA 4F49A 3LJJA 1DWEH 3UR9A 3ZZ6A 1SI5H 2JJ1D 3ZIAD 4BAHB 3M61U 3M3SA 3F9FA 3RXSA 1O3KA 1TGTA 2V0BA 1PQ7A
chains in the Genus database with same CATH topology
5TJXA 1VITF 4WMFA 4H6SB 3ZZ4A 4AORA 2FOGA 2PTNA 1HJAB 1SSXA 3TLOA 4I8KA 1J15A 5HM2A 1Y3VA 5FHTA 8ESTE 1H8DH 2CF9H 1A5GH 3QX5H 5EODA 1W0YH 1AUTC 2SGFE 4DG4A 1ETTH 3BIUH 4ABEA 1Q31A 1QURH 1ZSLA 2XTTB 1QGFA 1AKSB 2ZDMA 1BMNH 4ASHA 2A2QH 4FUGA 4NIWA 3BTTE 5C67A 1C1PA 2Z3CA 4Y76A 1F0RA 1B7XB 1SHYA 1SLWB 2TGAA 4CHAC 3SZNA 2JH0D 2VVUA 2FODA 2BLOA 4GPGA 1GMHG 3TH2H 2ANYA 3PLPA 4NZQA 4ABFA 3PROA 3D65E 4ZROA 1V2RT 2JH5D 1GJAB 1NPMA 3SU6A 2BVRH 1SPJA 1IOEA 2GKVE 2ZO3H 3GICB 1SLVB 4X2WA 1C5NH 1JIMA 3RC6A 2GT8A 6CHAB 1NRPH 1EASA 2ZF0H 1GHAG 2FLBH 1T8OA 1AHTH 2P59A 3GCHC 2FOFA 3MNXA 1L1GA 2OBQA 2XWBI 3A7XA 2KAIB 3TNTA 1S5SA 1XUHA 3IWMA 1K1MA 1RJXB 3VB4A 1HYLA 3OY6U 1O3LA 4UFGH 5GPIB 2GZ8A 4BTTB 6CHAC 3SQEE 3PO1B 1GBHA 3K2UA 2ZHWH 1DPOA 4JZ1A 3QZRA 4HFPB 5HXFA 2ZA5A 3V12A 1HAXB 1TONA 1MZDA 1C5YB 4NIXA 3VPKA 3E1XB 3LGTA 4OS5A 1E38B 3NK8A 3SV2H 4DIHH 3MU8A 1A7SA 2VIQA 5A8ZA 3P8FA 7KMEH 4BAKB 1GVLA 3QUMP 4BAOB 2ZFPH 1HJ9A 2J92A 2VINA 2R3UA 3BEFB 1O3BA 1W8BH 5L2YH 4MQAA 4IC6A 1M9UA 1P57B 2VH0A 3MTYA 1OP2A 2BHGA 1AUJA 1UK4A 4MNWA 1DFPA 1W7XH 2FS9A 3PTBA 1L0ZA 1QNJA 3UQVA 2A5KA 1KDQB 2J4IA 3S9CA 1DSTA 4Y8ZA 2GD4B 2PWXA 1O2LA 1SB1H 5A0AE 3WY8A 2NU4E 4GHQA 3M7TA 1TNJA 1UTQA 4WMEA 1HBTH 1HFDA 3VB6A 1LHFH 4I8JA 3U8OH 1W12U 2O9QA 1LVOA 1MTNC 1QJ1B 2GMTC 3URDA 3MO3A 4XFQA 3GOVB 2FXRA 3ZZ9A 1AVXA 1D6WA 4HI3A 1HIAA 1CHOG 4Z6AH 1ELVA 2G5VA 4O3UA 2F9OA 2H9EH 2ZFSA 2THFB 1GBIA 1A5IA 1HPGA 1O3EA 1YPHE 4TY6A 1TA2A 2TPIZ 3UPEA 1SOZA 1SMFE 3URCA 1C5XB 2ZTZA 2UUYA 2ANWA 4ZKNU 1YF4A 3A86A 2Q6GA 1O0DH 1AIXH 3PWCA 2BLQA 1IQIA 3RXTA 2VWLA 1BTPA 3SNDA 3A87A 5PTPA 2ZP0H 3EGKH 3KHVA 1FV9A 1Y3YA 2P16A 1ZRBA 1X7AC 5JBAS 1GBTA 2ZI2H 2BDAA 3GY7A 1TYNA 2ODPA 3AAVA 1WTGH 5ABWA 3RMOH 1O30A 1MAYA 1QBNA 2GCHF 1K1OA 1PPZA 1Q2WA 1CBWC 3PMJA 1HV7A 2ZC9H 2ZU2A 3RXDA 5FX6A 4OS1A 1FMGA 5TCCA 4DURA 4ABBA 2BYAX 4Q7XA 3RMLH 4CBOA 3UIRA 4O97A 3W95A 2PGBB 3PMAB 1GBJA 1LDTT 4B76A 5C1XA 1LTOA 1SGQE 3RU4T 3RMNH 4E05H 2A7HA 1DVAH 1EZSC 1IHTH 1TBZH 1V2PT 1NN6A 2V3HH 1K2I1 1YPGH 3E0PB 3A7TA 4KKDA 2R0LA 3F6UH 3E3TA 1PPEE 2ZIQH 5AHGH 1MU6B 1DITH 2WPHS 2J2UA 2P95A 1RXPA 3ZV9A 5EOKA 1SGPE 1KXAA 1O35A 4YLQH 2BD9A 3N7OA 2DUCA 5JBBS 5EQRA 5FPYA 4ZH8A 1K22H 2Z94A 1AB9C 3GY8A 2WPIS 2C8YB 2FOEA 2CHAC 1EZXC 1H8IH 1QJ7B 1ZSKA 2J94A 3M36A 5K7RA 3QK1A 1MKXK 4X1PU 3FP6E 1P09A 1V2MT 1UTJA 5B6OA 3RP2A 3QN7A 1DWCH 2WUCA 1V3XA 1C9PA 4INLA 1FJSA 1P2KA 2FO9A 2H1UA 3A7VA 1DDJA 1GI1A 3MWIU 1HRTH 1GBLA 1OSSA 2EI8A 4AN7A 2Y80A 4XBDA 1DLEA 5A0BA 1BMLA 4VGCB 2W7SA 3GCOA 1Z71A 3PO1C 1O3HA 2HNTC 3TGJE 1T7CA 2ZPQA 5FXLA 1QL7A 4FVDA 1V2JT 4K60A 2QIQA 4AFZA 2SNVA 1IQNA 1OP0A 3TK5A 2M5TA 7GCHF 4BOHA 1PJPA 4BXWA 1UK2A 1B0EA 1SLXB 1P05A 3Q77A 4RSPA 3H5CB 4K2YA 2ZCLP 2SGAA 4B2CA 1ANDA 2G81E 2O8LA 1CT0E 1L1NA 5HYOA 2WYJA 1GJ9B 4A92A 2BTCE 2FESH 3CS7A 3SNBA 2G51A 4FUIA 1ZTJA 1TX7A 3FP7E 3OY5U 4CRFA 1GBEA 1C5ZB 2CV3A 1HDTH 3A80A 1BBRK 1QHRB 3Q3KA 2V35A 3ZYEA 2VIPA 4U32A 1AD8H 4E7RG 1O3PB 1MZAA 1SVPA 1KLTA 3LT3A 3QGJA 1UVSH 4CRBA 1GHBG 3RXQA 3R3GB 1P10A 2BY9X 3VB3A 1O5FH 3SHCH 3TK9A 1O3OA 2IJOB 4X6OA 1BRUP 3SO3A 2XYAA 1LQDB 1SGIB 1QCPA 4DOQA 2A4QA 2B5TB 5EU8A 1O3NA 2D8WA 1BBRE 1EJNA 3UWJH 5IDKA 3OTJE 2TGPZ 1TMUH 3MH4A 3T26A 5GWZA 4UONA 1FIWA 1GI3A 1GJ6A 3R0FA 3G01A 4B2AA 5FPSA 2R9PA 1HGTH 4NSVA 4Z0KA 4ISNA 5A2MH 1NZQH 1DWDH 4UFFH 4D9RA 3ZZDA 5T3HA 4NIYA 4A1VA 2XRCA 2ZDAH 1YCPM 2AMPA 1P12E 3P17H 4NWKA 2VWMA 1DX5M 3MH5A 2FOMB 3LU9B 1DS2E 1AO5A 1TFXA 3HGPA 1HAOH 1H9LB 1N1LA 3DD2H 1SQTA 2FLRH 1O2ZA 2SGDE 4ZMAH 2G4TA 1MCVA 1GDNA 1XKAC 3TH4H 2PFEA 4DY7B 3SJOA 2VVCA 3V3MA 4CRDA 1O5BB 2Y5FA 3CENA 3LC5A 1ANBA 4DW2U 1MD8A 4NSYA 4FVBA 1GBMA 3TK6A 1P0SH 1ELAA 3UUZA 4DT7B 2Z3EA 4AGJA 1PPFE 1ANCA 1KYNA 1A0HB 1TNLA 3P92A 1BRAA 2NWNA 3GCNA 2Y7XA 2BLVA 1BA8B 2BX4A 1NFUA 5AFZH 2ZU1A 1YKTA 3ZZAA 4FUFA 3EA9A 4AZ2B 1V6DA 4NA7A 2BLWA 2OP9A 3QDZB 4J2YB 4KP0A 1AFEH 2PKAB 1GI0A 5C2ZA 1E0FD 5AFYH 1QBOA 1SGYE 4E7NA 2YOLA 5DP7A 2PLXA 1BUIA 4I8HA 4XDEA 1V2VT 4U30A 3RXCA 3ZZ3A 1EQ9A 2QAAA 1V2LT 1EJAA 4NA9H 1C5VA 2NU0E 3RC5A 2XBYA 1YBWA 2BDIA 3ZVBA 3KEEA 1E36B 3SJ8A 2FS8A 1RFNA 2FOAA 2NU3E 1RRKA 3QZQA 1G3CA 2J95A 5EXNA 2BXTH 2ZGBH 4CREA 1GG6B 1QRXA 2BD2A 1ZPBA 1HB0B 1MQ5A 1QL9A 3A82A 3TITA 3GCTG 1TBQH 2ASUB 1O2WA 2PV9B 5LPEA 4I8GA 2ZG0H 2A0QB 4ISLA 4XSKU 1FY1A 3PMHB 4NFFA 5A09A 1O34A 3A7YA 5C5OA 3BG4B 3LGIA 1XX9A 1QRZA 4R8TB 1GVKB 3S9BA 3SGBE 1KDQA 1Y8TA 1PPGE 4JYVH 1OXGA 4FXGH 1O2SA 1O3CA 2PSXA 1QJ6B 9LPRA 1A0LA 4BTIB 5DP8A 1VZQH 1C5WB 3ZVFA 1DUAA 1Y59T 3PMBB 3PWBA 1FXYA 4Q2KA 2FPZA 1GI6A 3KQDA 2Z9IA 2ZU4A 4CH8B 5C3NA 2GX4A 3RDZA 3ATKA 1G36A 3EAJA 4KELA 3P70B 3T2NA 1NT1A 4GCHG 3M5OA 4H42U 1NO9H 1GHZA 4ZHAA 1CE5A 5FPTA 1G2MA 3SV9A 4AG2A 2WINI 1MMJN 1LPZB 2A7JA 1LHCH 1K1PA 2FYQA 1ELEE 2ZU5A 4IS5A 2QCYA 2PUQH 1OYTH 3SU5A 4IN2A 1L4ZA 2VU8E 1ACBE 2CF8H 1O2JA 2Q1JA 3SU4A 2FMJA 3M3TA 1TGBA 3M37A 3MMGA 2W5EA 1S6HA 3A83A 3I78A 4ZKRU 4CBNA 1TOMH 1ZYOA 1ELCA 1JXPA 3ZZ8A 3STIA 1F0SA 2HALA 1BIOA 1QB1A 3UTUH 3U98H 4K8BA 1CT2E 1H4WA 4ZUHA 1BB0B 1TWXB 2NU2E 2OC7A 4WH8A 2QF3A 1XUGA 1LPGB 3UNSA 4DGJA 3C1KA 3KQBA 1YCPK 1TX8A 4GCHF 5F6MA 3ITIA 4Y11E 4JZDH 3E8LA 1ETSH 1SC8U 5DP6A 1EZQA 1O2HA 4WJG2 1AI8H 3I29A 2TBSA 3OSYA 4O9VA 2GCTC 1Z8JB 1T8NA 3T62A 1GBAA 1TOCB 1GDQA 5DP4A 1QB6A 1FN6A 3NPSA 4ZHMU 1CGJE 1GI5A 4X1NU 4D9QA 1S81A 2BXUH 1O5AB 1WOFA 5CHAB 1AFQC 2ZGHA 5DJ7A 1AKSA 1FI8A 1RTLA 1Y5UT 1KLIH 3HGNA 4BAMB 3SJIA 4ESTE 3MI4A 3SUDA 1THPB 1AY6H 1W14U 4RN6A 1N6YA 3BEUA 1C5SA 2G55A 4IGDA 3MU5A 1KIGH 3EA7A 1FONA 1B0FA 3SU3A 3SNCA 2D2DA 2BM2A 4H6TA 5K0HA 2WUBA 3M5MA 1TIOA 1A46H 1DM4B 2GV6A 3VXFH 2FTLE 4ABIA 4YTAA 3LGWA 1EB1H 3GYLB 4WY3A 1GHWH 1GGDC 1TQ7B 1C1UH 4XBCA 3H7TA 1Y3WA 1LKBA 3E16B 3K65B 3ENSB 1FPCH 1H9IE 2HLCA 4DCDA 2Q6FA 1GCDA 3E0NB 1P9SA 1OWDA 4YESB 1WYKA 1P11E 3ZV8A 1AWFH 5AF9H 1ARBA 1W10U 4A1TA 3OU0A 3V13A 3RXMA 1S85A 1ESBA 3GCHB 1C2FA 2ZKSA 1SGDE 1G30B 1P2MA 4JZEH 4Y0YE 1P01A 3LKWA 2PUXB 1K1IA 2PKSB 1A5HA 3FFGA 2CMYA 1ZPZA 2W26A 1XVMA 3RUOA 2GP9B 3P8OA 1BTXA 3GDSA 1EPTC 2BD7A 4MDSA 2Z3DA 3RLWH 1SGRE 2EI6A 4XBBA 3EE0B 2ZFTA 2GZ7A 1O2YA 4ZKSU 2C4FH 2SNWA 1TGNA 3DFJA 1VITG 4CHAB 4MNXA 1YPHC 4YOIA 1TNHA 1PYTD 4YT7H 1AZZA 1O3DA 4DVAU 1BMAA 1VCWA 1WU1A 2QXIA 1O3JA 1AFQB 1GJCB 2A45B 1HAIH 4JYUH 2OD3B 1LHGH 2ILNA 1SGNE 1UCYH 4Y0ZE 1PPHE 3K6YA 1YGCH 3GISB 1SGTA 2UWLA 1LKAA 2AIQA 1F0TA 1P2JA 6GCHF 2GCTB 1O3IA 4OS7A 3ATIA 3SORA 3JZ1B 4B75A 3TNSA 3BF6H 8KME2 4AB9A 1BRCE 2PGQB 2SGEE 1UHBB 1C1QA 3F9EA 4X8VH 4MG3A 3TGIE 2O8UA 4MNVA 4TPYA 4TWWA 4GVUA 1ABIH 1GBFA 3M3VA 1O39A 1K1NA 1YYY1 4J1YA 3RXUA 1DICA 1C4U2 2PKSC 2STBE 2AGIX 1QQ4A 5FBIA 1O2PA 1SBWA 3BTME 2BDBA 3GY5A 1FIZA 1IQJA 4DIIH 2P8OB 3UFAA 8LPRA 1INCA 1CO7E 2HNTF 2C8WB 2R3YA 1KXDA 1UTPA 3LDXH 3NWUA 3T28A 1BT7A 1TQ0B 5T6DA 2D1JA 1F7ZA 4KTUA 1O2RA 3BTFE 1KXCA 4I33A 4OGXA 1EZUC 1Y3XA 3RXLA 1BJUA 1GJ5H 1ZPCA 2QXHA 2OUAA 1GWAA 3LOXA 4TWYA 1G32B 3BTKE 1OWIA 3UNRA 4K1TA 2Y5GA 3VGCB 3HKJB 1FY8E 5J4QA 3KN2A 4YO9A 2Y5HA 2FX6A 1EXFA 2I6SA 1NESE 2FOHA 2HPQH 1AB9B 1DXPA 1ID5H 3LH1A 3GY3A 3O8RA 3LONA 1NRNH 2O8TA 2CGAA 1NS3A 2FX4A 4MPUA 1O2GH 3SV8A 1CVWH 1T8LA 3U8RH 3ATMA 2SGQE 2C90B 3KF2A 1KY9A 1TPSA 1THRH 1EATA 1DLKB 1O2UA 1TMTH 1GI4A 5HMAA 2Z6BD 3V7TA 5JB9S 3E90B 4BANB 2XCNA 2YNAA 1QIXB 3HATH 1O5GH 2WV5A 1QA7A 4JYTA 3RM0H 3PM3A 2A5IA 1BTZA 1JBUH 1N8OB 3L6PA 1S0QA 5DPAA 3D49H 1Y5BT 5CHAC 1SFQB 3SUGA 1O36A 1XUIA 1AN1E 1GL1A 2ZHEH 3K6ZA 1TBRH 3PYHA 2VGCB 5GJ4B 2AMQA 1Z8GA 3QO6A 2J38A 4BTUB 2FYRA 2ZGCA 3LGYA 3MU0A 1FQ3A 1GG6C 2BD5A 1GVZA 2ZFRH 1D3QB 4I32A 1W3CA 4F4OC 4D7FA 2BZAA 1P06A 1ZRKA 3B23B 1DE7H 3GDUA 2WPJS 2P93A 1MTVA 2C3SA 3FAOA 2VNTA 1S84A 1ESAA 1LQEA 1TRMA 2XBWA 2HVXA 2TGTA 5BRRE 1UVPA 1O2KA 1MCTA 1NM6A 2ODYB 1J17T 2CJIA 2VIVA 4IBLH 1MQ6A 1OWHA 4BXSA 3E91A 2ZDKA 4UFDH 1KTSB 4NZLA 2NU1E 4U2WA 1C5QA 1G3EA 5E0HA 3RXFA 5GIBA 3DFLA 3TPIZ 1OWKA 1THSH 1VITH 1FN8A 3Q76A 4X1RU 2ZHFH 2G8TA