4AG1A

Human chymase - fynomer complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
221
Chain Sequence
b'IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
molecule tags Hydrolase/de novo protein
source organism Homo sapiens
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
total genus 53
structure length 221
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A02
3MNXA 3SUDA 2BY6X 4U01A 1Y59T 2XCNA 1VZQH 4UFGH 1ZJDA 1IHTH 3D23A 3T25A 2A7HA 2FESH 1DITH 4ZKSU 1YCPM 1EAWA 4A1VA 1SOTA 1GI6A 5FBEA 1HAOH 1K1PA 2W3IA 3BEUA 4I33A 1Z8JB 4I8KA 2J38A 4WJG2 1NFUA 3W94A 4WXIA 3BEIB 4VGCB 1TPOA 3A8BA 1D9IA 1NRSH 5FBIA 1XUFA 4LOYH 4NG9H 1V2JT 4GLYA 1LHFH 1VJ9U 3SJIA 3VB6A 3E16B 5EODA 1TGNA 1QFKH 2FMJA 3UPEA 1MTUA 3MNBA 1TQ7B 2HOBA 1ZSJA 1QRZA 2VIOA 2Q6DA 1A61H 3BIUH 1HRTH 1FDPA 1ZLRA 2NU4E 1P2KA 1TWXB 1UTJA 1YPEH 2ANMH 3M5LA 1PPBH 4RKJB 1SL3A 4GUXA 1TMBH 2XBYA 3MI4A 1FMGA 3DFLA 1LVBA 1EP5A 2A31A 2ZIQH 2EI7A 2AMPA 1MCVA 1TRYA 3JZ1B 3RM0H 4OS4A 1V2OT 1C5UA 1CHOG 2M5TA 1PQ7A 4DW2U 2ALVA 1GI5A 3SHCH 3B23B 4J1YA 3LU9B 1BMNH 1XKAC 2A4OA 2ZKSA 1NRQH 1SGDE 5K7RA 3TH4H 3LJOA 3STIA 1QBOA 1DWCH 2ULLA 1C5QA 3PMJA 3U8RH 2ANKH 1EAUA 2Z9IA 3RXDA 4Y8YA 1FIZA 3RXVA 4BANB 1MUEB 3A87A 3FP6E 1AN1E 1P2IA 2AERH 2FLRH 3SUGA 3SGQE 1VJAU 2CJIA 1LPGB 3TH3H 1GI2A 4BTUB 1NRRH 1ELEE 1EZXC 1O3LA 1S81A 3OTJE 2OC0A 4SGAE 4Y10E 3CENA 5T3HA 4BTIB 5A8YA 3A84A 1TA2A 2V3OH 3LH1A 1GCDA 4HTCH 1A3BH 1LVOA 2XC0A 1V2ST 5E0HA 4ZUHA 3VGCB 3ZZDA 1ID5H 3GCNA 1LKAA 4XBCA 3S9AA 2QYIA 3S9BA 4ABJA 1QR3E 3HATH 3KF2A 3SNBA 1RIWB 1JWTA 1XVOA 1QL8A 3LGIA 1Q2WA 2GV7A 3A89A 3F6UH 5A8XA 1FN6A 3GY3A 4HFPB 1RXPA 4UDWH 2VJ1A 1XUKA 3QTOH 4GHQA 1BBRK 1TNGA 4X6PA 1P2QA 1MBMA 1EZUC 4GCHG 2I6QA 3GY8A 1QL7A 1K9OE 1TOCB 1V2PT 3RXBA 4CH2B 2BDBA 1JIRA 2BZAA 2C4FH 3PTBA 1HPGA 3SJ9A 1AFQC 3SJKA 4KTSA 3ZVCA 3BTDE 3L3TA 1TBRH 2B8OH 2ZFQH 3ZVDA 3UIRA 1G3EA 5JBAS 1UK4A 1O3AA 1O3PB 1F0TA 1XUIA 1XUJA 1VCWA 3MO6A 1P06A 1J14A 2OBOA 4BOHA 3BG8A 2Z6BD 3RUOA 2HLCA 4Z6AH 2A7JA 3QN7A 3EYDA 2G00A 4IMZA 2R3YA 1NC6A 2VGCB 1P3EA 3A7VA 4R0IA 1O2WA 1Z1JA 2QA9E 5F03A 1DX5M 4I7YH 2GV6A 3A7TA 3GOVB 2OD3B 1MU6B 3PLKA 2FI5E 3I77A 4LK4A 4GSOA 2SGDE 4FUJA 4IW4E 1TABE 1G37A 2SGQE 1C2JA 3QTVH 1KSNA 5FPSA 4ABIA 1ELVA 1DT2A 3BIVH 3F68H 3QDZB 1BMLA 5GCHG 3TLOA 1O3EA 1GL0E 1MKWH 1LPZB 1C1NA 1F0SA 1O2ZA 3Q3KA 1SI5H 1HXEH 3HGNA 2XBXA 1CT4E 1DFPA 1O2IA 1O5EH 2XRCA 5CHAB 3UFAA 2TBSA 1C5TA 2SNVA 3PV4A 4OGXA 1O35A 4A5TS 1O3GA 2UWOA 3KGPA 1TIOA 1IQGA 3URDA 1O2LA 2ZDKA 3KQEA 3RXQA 3E6PH 3PMHB 5FX6A 1YP9A 2F9OA 1N6XA 2ODQA 1KTSB 2D8WA 2PHBA 3BF6H 2VWOA 3NWUA 1DXWA 3BTFE 5DJ7A 1ELBA 1A5HA 4CRCA 1AB9B 4DIIH 4DT7B 2A2XH 1PPHE 4NIXA 1D3TB 2QF3A 1UCYH 1UJ1A 1YCPK 1TFXA 4MPXA 2QV1A 1Q31A 1TOMH 2WYJA 1LPKB 1P2JA 1F5KU 4AYVB 1FV9A 4BAKB 1DICA 1SSXA 4X6MA 2VWMA 4ASHA 5T6GA 2NU0E 2XWBI 1N6YA 4X2XA 4XDEA 1O2NA 1W14U 2IN2A 1E0FD 4MPWA 5PTPA 1W7GH 1ELCA 3MU8A 4X6OA 3O8CA 4O97A 5C3NA 1FI8A 3TJUA 2JKHA 2NU3E 3ATWA 3ZVFA 4INLA 2ZHQH 4CRBA 1GG6C 3SQEE 2D1JA 3RM2H 3LPRA 1EX3A 1SLXB 5BPEA 5JBBS 1WYKA 2CMYA 1NY22 1PPGE 2R2WU 1YF4A 4WMDA 3T29A 2HWLB 3OSYA 1ETTH 2WPKS 1B0EA 2FOBA 3QX5H 2DE9A 1IHSH 2ZF0H 1BQYA 2F9VA 5E2OA 3MHWU 3Q76A 1GBIA 1ZSKA 1KXAA 5A09A 1S83A 1OX1A 4NIWA 4I8JA 1O3DA 1OYTH 4XE4A 1E35B 1TNJA 1YPHC 2IPHA 2TGPZ 4ZKRU 4X1PU 1HAIH 3GY6A 1NZQH 1Y8TA 2ZPQA 1HAZB 2JH0D 5IDKA 1GHXH 1C5ZB 2AEIH 3SU4A 4IS5A 1FY3A 1XM1A 3M35A 2Z9LA 4CBNA 1AB9C 3UR6A 1O2HA 2WPMS 2BDHA 5F8ZA 4H6TA 1JRSA 1EOJA 1MD7A 3AW0A 3MU4A 3PMBB 5FCRA 1TPSA 5TCCA 1ZRBA 1YLCA 1V2LT 3MOCA 4ZHMU 2BD4A 2K1QA 1W3CA 4MNVA 3VB4A 1QRWA 3TPIZ 1BHXF 3FAOA 3SU0A 1C1TA 1CHGA 1O2GH 2QF0A 2THFB 2VIPA 2UUJB 3DA9B 5LPRA 3M3VA 2XTTB 2UUFB 1O2OA 2FZZA 4UD9H 3SV6A 1GHYH 1A46H 1D3QB 1GI9B 3MH7A 4BAHB 1MKXK 3B8JA 4JZIA 1DS2E 1DUAA 1GI7B 1PYTC 1FN8A 1IAUA 1SGQE 3P95A 1ZZZA 3MWIU 4Q80A 3ZVAA 2BD5A 1AVGH 1S0QA 3T62A 2ZHFH 2C8WB 1SR5C 3P8OA 4MTBA 1ETRH 2Y82A 1W11U 2OUAA 2OQ5A 1AHTH 1HIAA 4INKA 1V2MT 1QHRB 3NK8A 4YOJA 4X2YA 4TY7A 3S7HB 3P8NA 3TK6A 1A4WH 2ZDNA 5GIBA 3ENSB 5JPMH 1L1JA 3UOPA 3U8OH 7GCHF 2F9PA 2ZDMA 2QN5T 2QXHA 2PGBB 1HUTH 4DIHH 1IQHA 1OWJA 3UNRA 2ANYA 2BM2A 1EOLA 5I46H 4X8VH 1TRMA 1XUGA 1THSH 1O31A 3TU7H 2WUBA 3FANA 1DPOA 2O9QA 2QIQA 4IN2A 1P02A 4O9VA 1P12E 1S6HA 3LGWA 5E0GA 1MZAA 3UY9A 1KLJH 1GMDG 2O8TA 5DGJA 2ZU3A 2GTBA 4MNWA 1HV7A 5GCHF 4Y0YE 3RXGA 1FY8E 2V6NA 3GDSA 1ZGIA 3PLPA 4QT8C 1F0RA 1GG6B 1MKWK 2FTLE 1TYNA 1T8OA 1EAIA 1TX8A 1OXGA 3QUMP 3QO6A 5CHAC 1SQAA 4ABDA 4AX9H 2CGAA 3RU4D 3RXEA 1Y3WA 2Y5GA 2BXTH 2SFAA 3URCA 1K22H 1J16A 1J15A 1HNEE 1Z8GA 1NPMA 1LHEH 4F49A 2ZNKH 3T26A 2J34A 3MTYA 1ZMJA 1TMUH 3U9AH 1C5NH 1BJUA 1OYQA 3SU6A 3AW1A 1V2NT 3F9EA 5EXLA 2P59A 2TGDA 1G9IE 4K3JA 2VIWA 5AHGH 1GGDC 4MPVA 1C5OH 1D6WA 5F8TA 1GHWH 4FUDA 1G32B 4LZ1H 2VINA 1A5IA 4AOQA 1FXYA 1VR1H 3BN9A 2P95A 3FP8E 1E34B 5C2ZA 1A7SA 1O5GH 1GPZA 3E90B 4FUEA 1V2WT 1WV7H 3P6ZB 3TH2H 1BIOA 3M5OA 3VB7A 1D6RA 2WV5A 1ZRKA 2AYWA 1O3JA 1O2PA 2F91A 5BRRE 1VITG 5FAHA 1BRAA 1QRXA 5JB9S 2ODPA 1L1GA 3R0FA 4KP0A 1GL1A 2VVVA 3M5NA 3LJJA 1TGSZ 4A92A 2XNIA 1Z6EA 2RCEA 1EB2A 2ZU5A 4E05H 4OS1A 1ZTLA 4UFDH 1C1MA 1GJ7B 1AU8A 1F5RA 4JK5A 2OTVA 1GBDA 1EP6A 2ZGCA 1MU8B 3M36A 3ZV9A 3MU5A 3LGYA 3UQVA 3A86A 2AS9A 4CRAA 1TX6A 5EXNA 3VGCC 1FAKH 1O2XA 1VGCB 1GHAF 1ETSH 4E7RG 2H6MA 3ZZCA 1A0LA 1NROH 1MH0A 4K1SA 2STAE 4JYTA 3LT3A 1EZSC 4ZH8A 6GCHF 3MH6A 2P8OB 1C5LH 1BZXE 4NSYA 2ZPSA 1EPTC 4YLQH 2DUCA 2FPZA 4MDSA 1BMAA 1NFXA 1DLKB 3ZVBA 1MAYA 3QWCH 1C5RA 4FU9A 3U98H 1C2HA 4JCNA 1ARCA 1MTSA 3GISB 1ZJKA 1GJAB 4ZHLU 1BTWA 4E7NA 1QJ1B 3RXPA 2QY0B 2ANWA 1BUIA 1SPJA 4NFFA 1NT1A 1HCGA 1O0DH 2EEKA 1JIMA 2O8WA 1H4WA 1GHBG 4E06H 6CHAC 4K60A 4O3UA 4X8SH 2GGVB 3A81A 4BNRA 1L4DA 2P94A 3BG4C 2C93B 3LGUA 4RN6A 1LTOA 1YPMH 3TK5A 2GX4A 3SNCA 1CBWC 4ABFA 4BAMB 3DFJA 3LONA 3SV2H 6GCHG 4TYDA 2ZDLA 2FX4A 3RLWH 2BY9X 4NIYA 4OS6A 1UMAH 1UK2A 3P17H 1LHCH 1CSOE 3ZV8A 2XYAA 1DY9A 1ESAA 1LVYA 1SGFA 1KLTA 2A7CA 1FONA 4JZDH 2W7SA 1CO7E 3ZYEA 4WVPE 4OS5A 4DURA 4IC6A 1TNIA 1QA0A 2EI8A 3ZZ6A 2R2MB 5JBCS 1HLTH 1QB9A 1GWAA 4YO9A 2KAIA 1PJPA 1W13U 1ZGVA 3JZ2B 3T2NA 1GDQA 1C5WB 1O2YA 4K8BA 2CHAB 2TGTA 3M3TA 1Y5BT 3I78A 2WPJS 5L30H 1MTVA 1GJ4H 3PROA 2HNTF 1QB1A 1Z7KA 3SV9A 5DP8A 1HJAC 3E0NB 4Y7BA 5C1XA 2BY7X 4D8NA 1UTMA 1GJ8B 2YOLA 2FOFA 2YNBA 3VXEH 3NUMA 5A0AE 1K28D 2AGIX 2V35A 1J8AA 1S82A 2OLGA 2Z9JA 3TNTA 3EDXB 3RC4A 1IQLA 1C5VA 3RXJA 5GDSH 4ZHAA 1NS3A 1GBFA 2G5VA 2GZ9A 3U69H 1ZOMA 8GCHG 1T4VH 2J95A 2LNCA 2QXGA 4DG4A 1LMWB 2Q6GA 1SHHB 3MO9A 2GMTC 3TJVA 1TPPA 1FY1A 2FIRH 1UK3A 3RXHA 1SLUB 3WY8A 3GCHC 5B6OA 5C5OA 3TGIE 3D65E 3ZZ7A 3ITIA 2G4UA 3A82A 3FVFB 1W0ZU 3FZDA 3Q77A 2XXLA 5F6MA 2P3FH 1V2VT 1YPLH 1JRTA 1P3CA 5DP5A 2CXVA 3H5CB 4XOJA 1EXFA 4H42U 4D7FA 1O3NA 2D2DA 5EG4A 3NPSA 4DJZB 3SHAH 1QQUA 2PSXA 2QC2A 1KY9A 3KNXA 3DT0H 1YKTA 1A0HB 1GCTC 1Y3XA 1PQ8A 1O30A 4Y76A 4Y79A 2Z3CA 4OS7A 1F7ZA 1GJDB 4THNH 2F9UA 4ZKOU 2HGTH 2O8LA 4BXWA 1YLDA 2GT8A 1EPTA 3GCTG 3QGNB 2GCTC 3SZNA 2H5DA 8ESTE 3S0NA 5L6NH 1DUEA 4INHA 5A0CA 2ZU2A 1TPAE 1FY4A 2UWPA 4ABHA 1P04A 2TGAA 3Q3YA 3SUFA 3TNSA 1O2JA 1O3OA 1BTYA 2FXRA 1FPCH 4UFEH 2BQ6B 3MH4A 1S6FA 4FVBA 1GMCF 3PO1C 4KELA 3IITA 5ABWA 1O32A 4XFQA 2ZC9H 3ATLA 1O5AB 3V7TA 3KQCA 2ZGHA 1HJAB 4XSKU 1DM4B 1FQ3A 3M5MA 1DWBH 3ESTA 1T8LA 2C3SA 3Q00A 5EPYA 3TJNA 2XW9A 1YC0A 2VWNA 1QJ6B 2HNTC 1EKBB 5DK1A 5TCAA 1EAXA 1O36A 3O8DA 4I8LA 1OWHA 1BTHH 1NRPH 1W12U 2BQWB 1GVZA 1KXBA 1LKBA 2J2UA 1P9UA 2G8TA 1UHBB 5HGGA 1CHOF 2EC9H 4ZXXH 3A8CA 2CN0H 3GY7A 4TPIZ 1O33A 1AE8H 1D4PB 3P8FA 2GCHG 4GVUA 5DG6A 5HYOA 2Z3DA 4HI3A 3A8DA 2A32A 5E0JA 5J4QA 4CRFA 2BD7A 3MH5A 2SGFE 4K69A 5AVDA 1NM6A 2PKSB 4AYYB 1SHYA 3I29A 2W7UA 1P0SH 1BHXB 1QTFA 2FODA 1ELGA 1LQDB 1N8OC 1C2LA 1Z6JH 1YPKH 1AQ7A 2ZWLH 3DHKH 1TLDA 3RMOH 1MCTA 3SORA 1KXFA 4AORA 1GJ5H 1T8NA 3A85A 4B76A 4B2AA 1ABIH 4ISLA 4DGJA 1P01A 1O2TA 4NGAH 2HPQH 3SI4H 2ZCKP 4JZFH 1ELDE 3M61U 3SJ8A 1GVKB 2B0FA 2Z94A 4Y6DA 1SGIB 2D26C 3ATIA 1V2TT 5JBTA 1SVPA 9LPRA 3OX7U 2GCHF 5LPEA 3C1KA 1GHBF 3LH3A 2Y7XA 1QNJA 1INCA 1FY5A 2R9PA 3F9GA 1T7CA 4KKDA 2AIPA 3UNSA 2BYAX 2HRVA 5GPIB 3T5FH 2ILNA 2BDAA 5C1YA 4CRDA 1DSUA 3ZZ4A 2XC4A 1HAGE 1HAVA 3ZZAA 1C1VH 4WF8A 2PUXB 4I31A 1THPB 2A5AA 4B2CA 1SOZA 1MQ5A 1QBNA 3RXFA 2Y7ZA 1CA0B 1TMTH 4AFQA 1CBWB 1O5DH 5ETXA 1HAXB 5JB8S 4MG3A 2FOMB 4NWKA 2BHGA 1YBWA 2YNAA 1HAVB 2ZFFH 2GT7A 2VIQA 4FXGH 2FOEA 1KLIH 1THRH 1FLEE 1SGYE 2C90B 4X1NU 1RTKA 4A7IB 4CR9A 3GY4A 2PSYA 6LPRA 3ZYDA 3RC6A 2ZP0H 4GCHF 3D62A 1ANBA 4AG1A 2FLBH 3PYHA 1TE0A 1WOFA 2TPIZ 2WPLS 1BRCE 1P2OA 1NFWA 2NU2E 3LIWA 5E2PA 4ZMAH 2PW8H 5JDUB 1A1RA 4X1RU 2F83A 1W7XH 1ZR0A 5FCKA 4AB9A 1G3DA 3NCLA 5C5NA 5CE1A 1GI3A 1NU7B 2ZCHP 2EI6A 3RXSA 3KQBA 2LPRA 2ZQ2A 3RP2A 5HMAA 4FUBA 2H9EH 4A1XA 1EPTB 2FOAA 1ELAA 2PTNA 3FZZA 1QIXB 1ZTKA 1C5PA 1CT0E 1EATA 2BDCA 1E36B 1ZMNA 1D3DB 1IQIA 1UTPA 1J9CH 2SGAA 3RC5A 2A4RA 2BQ7B 1OWIA 1Y5UT 2ZDAH 4JYVH 1H1BA 2VWLA 3SU2A 1BBRE 2GVFA 2A5IA 4Q2KA 4X1SU 2VVCA 2UUYA 2GD4B 1OPHB 1PYTD 2ESTE 1AFEH 1YPJH 1BRUP 3GY2A 1SFIA 3RMNH 1RRKA 4JMYA 2H1UA 3IWMA 3TVJB 4YOIA 1UTKA 2V3HH 1SBWA 1PPCE 3HK3B 3K2UA 3BTGE 3ZZ9A 4B73A 3DD2H 3GY5A 1CQQA 2ZFTA 4CHAB 5EXMA 4ISNA 1Y3UA 1AE5A 2BDYA 1BTXA 1C5YB 1O3IA 1Y3VA 1MTNB 3MU0A 4ESTE 1UTOA 1EJMA 5SGAE 1O2UA 2FI4E 1P9SA 4X0WU 1EUFA 4JZEH 4WWYA 2FYQA 4WH8A 3SBKA 2FYRA 1GBMA 1C2DA 3SN8A 4H6SB 2QAAA 1BCUH 2QCYA 3SGBE 1HB0B 3SV7A 1GBLA 2KAIB 1KTTB 2ZCLP 2J92A 2W26A 4KTUA 1UTNA 2QXJA 2P8OC 1EJNA 1TALA 2FI3E 4YESB 5DP6A 5CMXH 1QBVH 1WCZA 1O34A 1SGEE 1GGDB 3P8GA 4CR5A 1V2UT 2FOGA 4YT7H 8LPRA 2AFQB 1Y5AT 5EQQA 1ANCA 3T28A 1GJ6A 1O2QA 3VPKA 4X2WA 2OC1A 1H9LB 1T31A 4MLFB 1HJ8A 2OQUA 1TNLA 1K1NA 4FUHA 2BY8X 2ZFSA 1C1UH 2ZECA 5AFZH 3A80A 3UWJH 3CS0A 1GHVH 2P3TB 4HGCA 1CA0C 2HALA 2V0BA 2GZ8A 1C9TA 3HKJB 3ZVGA 1SFQB 4YLUA 3GDUA 4UFFH 1ZPZA 3M7QA 4LZ4B 3RMMH 4K1EA 1S5SA 1DE7H 3K65B 2FDAA 3OY5U 1AVWA 2C8XB 4ZKNU 5L2ZH 1PPFE 3VB3A 3A7YA 7LPRA 1AKSA 1O3HA 1P8VC 5JYIA 2WPIS 1L1NA 4Q7ZA 1GBCA 1QJ7B 1HIAB 1EJAA 1A5GH 3QLPH 4IMQA 3SO3A 4TWYA 3KQDA 5IYTA 3PO1B 3RMLH 4JZ1A 1LCYA 1O2RA 1Z8IB 1P11E 3B9FH 2OP9A 3ZZBA 3MNCA 1PPEE 2B5TB 2IOTA 2ZTZA 1AWHB 1OS8A 4NIVA 1H8IH 4ABBA 1PFXC 4XBDA 4WY3A 3OU0A 1A2CH 3LGTA 1KDQA 2GCTB 2DE8A 3AVZA 2F9BH 3MU1A 1N8OB 1VCPA 5EW1H 4FU8A 2ZQ1A 2RA0A 4ABEA 3HK6B 3F9FA 1KXEA 3UOUA 3A8AA 1MAXA 1KXDA 1C2KA 1TNKA 1WTGH 1UO6A 1H8DH 1NTPA 3SNAA 2FWWA 3VFEA 3ZZ8A 9ESTA 1GDUA 3S9CA 1ESBA 1S0RA 4FUIA 4CREA 4FUGA 4MPUA 1JMOH 1UTQA 7GCHG 2GP9B 3NXPA 4IBLH 1SGFG 3RXLA 4DVAU 1IOEA 3TJOA 2ZG0H 4UONA 3GCHB 3MO3A 1DWEH 4ZROA 2W3KA 1RFNA 4AB8A 2GMTB 1ZPCA 1VITF 4A1TA 3HKIB 4B1TA 1EQ9A 2A1DB 2GZ7A 2BDGA 4DCDA 2BMGB 4M7GA 3GYLB 2BLVA 1EASA 1J17T 3RU4E 2AIQA 2WV4A 1P10A 2HVXA 1O5FH 5A2MH 1XMNB 1BTZA 1DSTA 3C27B 2VIDA 1SC8U 2AGGX 1GJCB 5T6DA 2W5EA 2J94A 3RU4T 4X1QU 3TGJE 1AUTC 3U1JB 3BTME 1UCYK 3IG6B 4J2YB 2Y81A 3U1IB 1IQMA 3BTKE 3BTWE 1TBQH 5K0HA 2VVUA 3ELAH 3UR9A 1HFDA 5FX5A 4U2WA 1GBAA 4DY7B 2CV3A 3F1SB 1S84A 1O37A 4JYUH 4U32A 3CS7A 4YZUA 2VB0A 2ZTXA 4IGDA 4ZXYH 2G51A 4X6NA 2B7DH 1IQEA 1TRNA 1ZHPA 2R0KA 2BDIA 3STJA 3QGJA 1TX7A 2ZU4A 3E8LA 5L2YH 2WINI 3EE0B 1W0YH 2BD3A 2J9NA 1WQSA 1FNIA 2TIOA 2FOHA 1LHDH 1LVMA 2H2ZA 3SI3H 1G30B 1T32A 1TGTA 3V0XA 4AGKA 2Z7FE 5DPAA 1K1IA 2JETB 1K1JA 1OP8A 1TGCA 1QA7A 3SUEA 3PLBA 1YGCH 3RLYH 1GJBB 1C1QA 1B5GH 5GWZA 3SU3A 4WH6A 3UTUH 1MMJN 1O3FA 2B9LA 2PV9B 1GVLA 1CU1A 1C5XB 1JOUB 1Y3YA 1HXFH 1HYLA 4KGAA 1MTWA 2SGEE 1G2MA 1SG8B 1RTLA 3NKKA 1ZHMA 1FAXA 4NZLA 1LQEA 1BDAA 4ABAA 1G36A 1O2SA 2SNWA 1OWKA 2BD2A 2BX4A 1RS0A 1SQOA 1AO5A 4YOGA 2Z9KA 1O38A 4ZAEA 1UTLM 2CF9H 3A7XA 2JH5D 1T8MA 4GPGA 3V12A 1SLWB 1QL9A 1WUNH 2A2QH 4CH8B 1HGTH 5FPTA 1BRBE 3MFJA 3BTQE 2G81E 4WMFA 1RD3B 3LKWA 2R3UA 2ZGXH 1OOKB 3UQOA 3V3MA 4BAQB 3ZVEA 1ELFA 5T6FA 1V2KT 1C1WH 5HXFA 1VGCC 1LDTT 4FVDA 3V13A 4D9RA 5H4IB 2BXUH 1BTUA 1K1MA 1SMFE 2WYGA 3KEEA 1G2LA 2VNTA 3SNDA 4BAOB 4NA7A 1CVWH 3QK1A 1AIXH 2PLXA 2PKAA 3BTEE 1WBGB 1TNHA 2TRMA 1EZQA 4FUCA 4BXSA 2F3CE 1XX9A 1ZHRA 1O5CB 3GYMA 5AFYH 1QB6A 3UWIA 1BA8B 3M7UA 1A0JA 3EA7A 1C4U2 3RXKA 1NU9A 1AMHA 3BG4B 1XXDA 3MYWA 2UUKB 4DOQA 5C67A 5J4SA 3SW2B 2BTCE 1NFYA 1GI1A 5EW2H 4O03A 4X8TH 1OSSA 1LO6A 1V2QT 2BVXH 4B75A 1GI0A 2J4IA 3PM3A 2ZZUH 5HM9A 1G3CA 2CF8H 3SGAE 3KL6A 1JBUH 2OINA 1V3XA 2PTCE 1UHBA 1C4Y2 2ZO3H 3G01A 4K8YA 1ZMLA 1BJVA 3FFGA 1BMMH 4B2BA 1P09A 3PMAB 3P92A 1GHAG 2Q1JA 5DP3A 3P70B 2XCFA 1IQJA 1V6DA 2FOCA 4AFZA 3FP7E 2FTMA 2FO9A 3K6ZA 1UCYE 1P2NA 3VEQB 5FXLA 5EU8A 4ISOA 3NZIA 5DP4A 1VCQA 2HNTE 3RXRA 5C20A 1O5BB 2HPPH 1XUHA 3UNQA 1ZTJA 2BLOA 3LDXH 4RSPA 1B7XB 1UVUH 2A4QA 2P16A 3PWBA 4WMEA 1DVAH 3RXUA 1CT2E 1GBJA 3LC5A 3VB5A 4OGYA 3MNSA 1GJ9B 2Z3EA 2ZFPH 1OP2A 1AFQB 4D7GA 1TA6A 4CBOA 2AH4X 5EOKA 3O8RA 6CHAB 3R3GB 3TGKE 1Z71A 3A7WA 1W10U 1HAYB 1HAHH 4AN7A 5EQRA 1YYY1 1OP0A 4UE7H 3EQ0H 1U6QA 2Y5FA 1H9HE 4Y8XA 7KMEH 2AMQA 2P93A 1OWDA 4ISHH 3PB1E 3TK9A 1HBTH 1P03A 3MMGA 4B74A 4CHAC 2BVSH 1BB0B 2G5NA 3SOSA 4Y8ZA 1XKBC 3QZRA 3L33A 3SQHE 2RA3A 3KIDU 1WQVH 2NWNA 3EAJA 4K2YA 2BD9A 1SGCA 2BLQA 2UWLA 2CHAC 1ACBE 3AAVA 1QCPA 5EPNA 1RTFB 1SGRE 1IQKA 1ZSLA 2ZGJA 3RDZA 2ZEBA 4AGJA 3BEFB 1MTNC 3SU1A 2BZ6H 4XBBA 3E0PB 1NESE 1CE5A 5G4BA 3GCOA 1FIWA 4HZHA 1L2EA 2XBWA 2OCVB 3BTTE 3RXOA 2SGPE 2I6SA 2VGCC 3H7OA 2BB4A 1CA8B 4OS2A 1AWFH 3U8TH 1BOQA 2ZDVH 1AUJA 1DY8A 4D76A 1DDJA 1C2FA 2ZFRH 1GMDF 1DANH 1C1SA 1AGJA 1O39A 1VITH 2FS8A 1GMCG 1G3BA 3T27A 4U30A 2BOKA 4YM9A 3K6YA 1SLVB 3M3SA 4NCYA 2ZHEH 2ZPRA 2ODYB 1TQ0B 5LGOA 2OC8A 5AF9H 1HDTH 1TAWA 3ZZ5A 2F9NA 1QGFA 1K1OA 1CGIE 3K9XB 4B71A 4VGCC 3GCTF 1O3MA 4IC5A 1SGPE 1K2I1 1F2SE 1X7AC 2Y6TA 2FX6A 4Y71A 2ZHDA 1C2IA 3BSQA 2G52A 3Q3XA 2XBVA 2FM2A 1T4UH 2STBE 3A88A 1RJXB 4ABGA 1MKXH 3BTHE 4YT6H 1C9PA 1PQ5A 2RG3A 3KHVA 1O2KA 1V2RT 5LPFA 1FJSA 1GBHA 4NFEA 2BY5X 4H4FA 2PKAB 1RIWC 1P2MA 3F9HA 1ARBA 4TWWA 1AVXA 2XWAA 2GDDA 2IJOB 1HJ9A 3E1XB 2XC5A 1MQ6A 8KME2 1QURH 2BD8A 2WUCA 1C1RA 3D49H 4TY6A 2BVRH 5A8ZA 2ZA5A 4MNYA 2PKSC 4YTAA 1FPHH 1BTPA 4NZQA 1GDNA 1TGBA 2ALPA 2R0LA 1D3PB 4Y7AA 3EA9A 1UVSH 2FS9A 1F0UA 3OY6U 4Y11E 4Q7XA 4BTTB 1TB6H 2H9HA 4TPYA 2GDEH 2QXIA 1C4V2 3AAUA 2O8UA 1A3EH 5ESTE 5EQSA 3SJOA 1GMHF 1O2VA 3PTNA 4I32A 4Q7YA 1Z1IA 6ESTA 5DP7A 1K1LA 1C1OA 1UVTH 1ELTA 4CRGA 1AZ8A 1C2GA 4GHTA 2PR3A 5EGMA 2ZI2H 2A45B 3RXMA 1E38B 1F92A 1YCPH 1YM0A 3EA8A 1DWDH 1XVMA 3ATKA 4I8HA 4JK6A 8GCHF 4Y0ZE 1GMHG 3VXFH 3LC3A 1M9UA 3RXTA 4SGBE 4NA9H 5DKMA 4R8TB 2BOHB 4FUFA 2JH6D 1RGQA 2GKVE 4O3TA 4A6LA 2A0QB 1YPGH 1NO9H 1MBQA 3SU5A 1NN6A 1MD8A 1LHGH 3EGKH 1S85A 1CGHA 1BT7A 1GI8B 1F5LA 1WTHD 1Z8RA 2AGEX 1O2MA 1GBBA 1C2EA 2A5KA 5HM2A 2Y80A 2QGRA 1UVPA 5DP9A 1FZZA 4I8GA 1L0ZA 5FPYA 3HPTB 2WPHS 1C5MD 4KTCA 1W8BH 1WAYB 1GCTB 2H5CA 3OYPA 5DO4H 3E3TA 1OKXA 2OBQA 4X2VA 1C2MA 4LXBH 1AI8H 1AKSB 4MVNA 1SQTA 4F4OC 3TIUA 5A0BA 2H9TH 2PFEA 1FUJA 1WU1A 1IQNA 3SNEA 1UVOA 3ODFA 1GBKA 4NWLA 1BBRH 1IQFA 1WSSH 2A4GA 3CP7A 2AMDA 2RDLA 2VH6A 3LOXA 4D9QA 1ZPBA 1MZDA 3M37A 4X8UH 3RXCA 5FHTA 1C5SA 1KIGH 1P05A 2ZU1A 1W2KH 1HAPH 3H7TA 3QZQA 5GXPA 1PPZA 3A83A 2O8MA 1EB1H 4K1TA 1GBEA 1DLEA 4PROA 1SGNE 4K5ZA 3RXAA 4RKOB 2ZTYA 5E8EH 7ESTE 1TONA 2VIVA 3DUXH 4NSVA 1GHZA 1NRNH 4AZ2B 2PUQH 3N7OA 3O8BA 1AD8H 1C1PA 4UEHH 2PGQB 2ZGBH 1DXPA 3RXIA 1GI4A 2Z9GA 4IN1A 5TJXA 5LH8A 3GICB 4AFUA 4FU7A 1H9IE 1SB1H 2OC7A 2ZHWH 3ODDA 2JETC 3LGVA 2G55A 1TBZH 1YPHE 1Q3XA 4AG2A 2BX3A 2PWXA 1N1LA 1ESTA 2FP7B 3M7TA 1DOJA 5F8XA 1K21H 1KYNA 1ORFA 1E37B 1P57B 2P3UB 3GDVA 1B0FA 2Y5HA 1L4ZA 4ISIH 1O3CA 4MQAA 2EA3A 3UREA 1AZZA 1BITA 1KDQB 1SGTA 2OXSA 3BV9B 1ANDA 3W95A 1O3BA 1XXFA 5C1UA 5I25A 3SV8A 2Q6FA 4AFSA 2VH0A 1OWEA 1ABJH 1QQ4A 2FEQH 2G4TA 1O3KA 3AASA 3HGPA 2NU1E 4MNXA 4Z0KA 2C8ZB 1CGJE 2BLWA 3PWCA 3ATMA 1ANEA 1JXPA 3UUZA 3L6PA 4GAWA 3KN2A 5ESBA 1AY6H 4NA8A 4WXVA 2ASUB 5GJ4B 2C8YB 1KXCA 3E91A 3S7KB 1ZYOA 2VU8E 1QY6A 3TITA 3ZZ3A 3S69A 1GBTA 3KCGH 1PQAA 3A7ZA
chains in the Genus database with same CATH superfamily
3MNXA 3FOAA 3SUDA 2BY6X 4F55A 4U01A 1Y59T 2XCNA 1VZQH 3AK5A 4UFGH 1ZJDA 1IHTH 3D23A 3T25A 2A7HA 2FESH 1DITH 4ZKSU 5T1VA 4XRNA 1YCPM 1EAWA 4A1VA 1SOTA 1GI6A 2AHME 5FBEA 1HAOH 3PV5A 1K1PA 2W3IA 1BMFD 2V3MA 3BEUA 4I33A 1Z8JB 4I8KA 2J38A 4WJG2 1NFUA 3W94A 4WXIA 3BEIB 4VGCB 1TPOA 3A8BA 1D9IA 1NRSH 5FBIA 1XUFA 4LOYH 4NG9H 1V2JT 4GLYA 1LHFH 1VJ9U 3SJIA 3VB6A 3E16B 5EODA 1TGNA 1QFKH 2FMJA 3UPEA 1MTUA 3MNBA 1TQ7B 2HOBA 1ZSJA 1QRZA 2VIOA 2Q6DA 1A61H 3BIUH 1HRTH 2EY4C 1FDPA 1ZLRA 2NU4E 3F3BA 2WV9A 1P2KA 1TWXB 1UTJA 1YPEH 2ANMH 3M5LA 1PPBH 4RKJB 1SL3A 4GUXA 4M9FA 1TMBH 2XBYA 3MI4A 1FMGA 3DFLA 1LVBA 1EP5A 2A31A 2ZIQH 2EI7A 2AMPA 1MCVA 1TRYA 3JZ1B 3RM0H 4OS4A 1V2OT 1C5UA 1CHOG 2M5TA 1PQ7A 4DW2U 2ALVA 1GI5A 1S6LA 2KFWA 3SHCH 3B23B 4J1YA 3LU9B 1BMNH 1XKAC 5KECA 2A4OA 2ZKSA 1SKYE 1NRQH 1SGDE 5K7RA 3TH4H 3LJOA 3STIA 1QBOA 1DWCH 2ULLA 1C5QA 3PMJA 3U8RH 1H8ED 2ANKH 1EAUA 2Z9IA 3RXDA 4Y8YA 1FIZA 3RXVA 4BANB 1MUEB 3A87A 3FP6E 1AN1E 1P2IA 2AERH 2FLRH 3SUGA 3SGQE 1VJAU 2CJIA 4Q63A 1LPGB 3TH3H 1GI2A 4BTUB 1NRRH 1ELEE 1EZXC 1O3LA 1S81A 3OTJE 2OC0A 4SGAE 4Y10E 3CENA 5T3HA 4BTIB 5A8YA 3A84A 1TA2A 2V3OH 3LH1A 3OEHD 1GCDA 5C94A 4HTCH 1A3BH 1LVOA 2XC0A 1V2ST 5E0HA 4ZUHA 3VGCB 3ZZDA 1ID5H 3GCNA 1LKAA 4XBCA 3S9AA 2QYIA 3S9BA 4ABJA 1QR3E 3HATH 3KF2A 3SNBA 1RIWB 1JWTA 1XVOA 1QL8A 3LGIA 1Q2WA 2GV7A 3A89A 3F6UH 5A8XA 1FN6A 3GY3A 4ACBA 4HFPB 1RXPA 4UDWH 2VJ1A 1XUKA 3QTOH 4GHQA 1BBRK 1TNGA 4X6PA 1P2QA 1MBMA 1EZUC 4GCHG 2I6QA 3GY8A 1QL7A 1K9OE 1TOCB 1V2PT 3RXBA 4CH2B 2BDBA 2WZQA 1JIRA 2BZAA 2C4FH 3PTBA 1HPGA 3SJ9A 1AFQC 3SJKA 4KTSA 3ZVCA 3BTDE 3L3TA 1TBRH 2B8OH 2ZFQH 3ZVDA 3UIRA 1G3EA 5JBAS 1UK4A 1O3AA 1O3PB 1F0TA 1XUIA 1XUJA 1VCWA 3MO6A 1P06A 1J14A 2OBOA 4BOHA 3BG8A 2Z6BD 3RUOA 2HLCA 4Z6AH 2A7JA 3QN7A 3EYDA 2G00A 4IMZA 2R3YA 1NC6A 2VGCB 1P3EA 3A7VA 4R0IA 1O2WA 1Z1JA 2QA9E 5F03A 1DX5M 4I7YH 2W6ID 2GV6A 3A7TA 3GOVB 5HIZA 2OD3B 1MU6B 3PLKA 2FI5E 3I77A 4LK4A 4GSOA 2SGDE 4FUJA 4IW4E 3W1EA 1TABE 1G37A 2SGQE 1C2JA 3QTVH 2PP6A 1KSNA 5FPSA 4ABIA 1ELVA 1DT2A 3BIVH 3F68H 3QDZB 1BMLA 1FX0B 5GCHG 3TLOA 1O3EA 1GL0E 1MKWH 1LPZB 1C1NA 1F0SA 1O2ZA 3Q3KA 1SI5H 1HXEH 5HKKD 3HGNA 2XBXA 1CT4E 1DFPA 1O2IA 1O5EH 2XRCA 3DSOA 5CHAB 3UFAA 2TBSA 1C5TA 2SNVA 3PV4A 4OGXA 1O35A 4A5TS 1O3GA 2UWOA 3KGPA 1TIOA 1IQGA 3URDA 1O2LA 2ZDKA 3KQEA 3RXQA 3E6PH 3PMHB 5FX6A 1YP9A 2F9OA 3MQKC 1N6XA 2ODQA 1KTSB 2D8WA 2PHBA 3BF6H 2VWOA 3NWUA 1DXWA 3BTFE 5DJ7A 1UW7A 1ELBA 1A5HA 2J98B 4CRCA 1AB9B 4DIIH 4DT7B 2A2XH 1PPHE 4NIXA 3ZIAD 5DN6D 1D3TB 2QF3A 1UCYH 1UJ1A 1YCPK 1TFXA 4MPXA 2QV1A 1Q31A 1TOMH 2WYJA 1LPKB 1P2JA 3OAAD 1F5KU 4AYVB 1FV9A 4BAKB 1DICA 1SSXA 4X6MA 2VWMA 4ASHA 5T6GA 2NU0E 2XWBI 1N6YA 4X2XA 4XDEA 3F0OA 1O2NA 1W14U 2IN2A 1E0FD 4MPWA 5HIYA 5PTPA 1W7GH 1ELCA 3MU8A 4X6OA 3O8CA 4O97A 5C3NA 1FI8A 3TJUA 2JKHA 2NU3E 3ATWA 3ZVFA 4INLA 2ZHQH 4CRBA 1GG6C 3SQEE 2D1JA 5FL7D 3RM2H 3LPRA 1EX3A 1SLXB 5BPEA 5JBBS 1WYKA 2CMYA 1NY22 1PPGE 2R2WU 3FKSD 1YF4A 4WMDA 3T29A 2HWLB 3OSYA 1ETTH 2WPKS 1B0EA 2FOBA 3QX5H 2DE9A 1IHSH 2ZF0H 1BQYA 2F9VA 3WWFA 5E2OA 3MHWU 3Q76A 2XOKD 1GBIA 1ZSKA 1KXAA 5A09A 1S83A 1OX1A 4NIWA 4I8JA 1O3DA 1OYTH 4XE4A 1E35B 1TNJA 2LP6A 1YPHC 2IPHA 2TGPZ 4ZKRU 4X1PU 1HAIH 3GY6A 1NZQH 1Y8TA 2ZPQA 1HAZB 2JH0D 5IDKA 1GHXH 1C5ZB 2AEIH 3SU4A 4IS5A 1FY3A 1XM1A 3M35A 2Z9LA 4CBNA 1AB9C 3UR6A 1O2HA 2BDHA 2WPMS 5F8ZA 4H6TA 1JRSA 1EOJA 1MD7A 3AW0A 3MU4A 3PMBB 5FCRA 1TPSA 5TCCA 1ZRBA 1YLCA 1V2LT 3MOCA 4ZHMU 2BD4A 2K1QA 1OHHD 1W3CA 4MNVA 3VB4A 1QRWA 3TPIZ 3F2GA 1BHXF 3FAOA 3SU0A 1C1TA 1CHGA 1O2GH 2QF0A 2THFB 2VIPA 2UUJB 3DA9B 5LPRA 3M3VA 2XTTB 1E79D 2UUFB 1O2OA 2FZZA 4UD9H 2W6JD 3SV6A 1GHYH 1A46H 1D3QB 1W0JD 1GI9B 3MH7A 4BAHB 1MKXK 3B8JA 5CHBA 4JZIA 1DS2E 1DUAA 1GI7B 1PYTC 1FN8A 1IAUA 1SGQE 3P95A 1ZZZA 3MWIU 4Q80A 3ZVAA 2BD5A 1AVGH 1S0QA 3T62A 2ZHFH 2C8WB 2J5UA 1SR5C 3P8OA 4MTBA 1ETRH 2Y82A 1W11U 2OUAA 2OQ5A 1AHTH 1HIAA 4INKA 1V2MT 1QHRB 3NK8A 4YOJA 4X2YA 4TY7A 3S7HB 3P8NA 3TK6A 1A4WH 2ZDNA 5GIBA 3ENSB 5JPMH 1L1JA 3UOPA 3U8OH 7GCHF 2F9PA 2ZDMA 2QN5T 2QXHA 2PGBB 5KEDA 1HUTH 4DIHH 1IQHA 1OWJA 3UNRA 2ANYA 2BM2A 1EOLA 3OFND 5I46H 5IK2D 4X8VH 1TRMA 1XUGA 4ASUD 1THSH 1O31A 3TU7H 2WUBA 3FANA 1DPOA 2O9QA 2QIQA 4IN2A 1P02A 4O9VA 1P12E 1S6HA 3LGWA 5E0GA 1MZAA 3UY9A 1KLJH 1GMDG 2O8TA 5DGJA 2ZU3A 2GTBA 2JDID 1HV7A 1YWUA 4MNWA 4Y0YE 5GCHF 3RXGA 1FY8E 2V6NA 3GDSA 3F0PA 1ZGIA 3PLPA 4QT8C 1F0RA 1GG6B 1MKWK 3SYJA 2FTLE 1TYNA 1T8OA 1EAIA 1TX8A 1OXGA 3QUMP 3QO6A 5CHAC 1SQAA 4ABDA 4AX9H 2CGAA 3RU4D 3RXEA 1Y3WA 1K0HA 1E1QD 2Y5GA 2BXTH 2SFAA 3URCA 1K22H 1J16A 1J15A 4RT1A 1HNEE 1Z8GA 1EFRD 1NPMA 1LHEH 4F49A 2ZNKH 3T26A 2J34A 3MTYA 1ZMJA 1TMUH 3U9AH 1C5NH 1BJUA 1OYQA 2RFKC 3SU6A 3AW1A 1V2NT 3F9EA 5EXLA 5EJ1A 2P59A 2TGDA 1G9IE 4K3JA 2KZ4A 2VIWA 5AHGH 1GGDC 4MPVA 1C5OH 1D6WA 5F8TA 1GHWH 4FUDA 1G32B 4LZ1H 5F53A 2VINA 1A5IA 4AOQA 1FXYA 3PV2A 1VR1H 3BN9A 2P95A 3FP8E 1E34B 5C2ZA 1A7SA 1O5GH 1GPZA 3E90B 4FUEA 1V2WT 1WV7H 3P6ZB 2YMSC 3TH2H 1BIOA 3M5OA 3VB7A 1D6RA 2WV5A 1ZRKA 2AYWA 1O3JA 1O2PA 2F91A 5BRRE 1VITG 5FAHA 1BRAA 1QRXA 2XNDD 1KMHB 5JB9S 2ODPA 1L1GA 3R0FA 2HVYB 2IPQX 4KP0A 1GL1A 2VVVA 3M5NA 3LJJA 1TGSZ 4A92A 2XNIA 2KX4A 1Z6EA 2RCEA 4FOUC 1EB2A 2ZU5A 4E05H 4OS1A 1WXRA 1ZTLA 4UFDH 1C1MA 1GJ7B 1AU8A 1F5RA 4JK5A 2OTVA 1GBDA 1EP6A 2ZGCA 1MU8B 3KYGA 3M36A 3ZV9A 3MU5A 4TT3D 3PRDA 3LGYA 3UQVA 3A86A 2AS9A 4CRAA 1TX6A 5EXNA 3VGCC 1FAKH 1O2XA 1VGCB 1GHAF 1ETSH 4E7RG 2H6MA 3ZZCA 1A0LA 1NROH 1MH0A 4K1SA 2STAE 4JYTA 3LT3A 1EZSC 4ZH8A 6GCHF 3MH6A 2P8OB 1C5LH 1BZXE 4NSYA 2ZPSA 1EPTC 4YLQH 2DUCA 1NBME 2FPZA 4MDSA 1BMAA 1NFXA 1DLKB 3ZVBA 1MAYA 1YLNA 3QWCH 1C5RA 4FU9A 3U98H 1C2HA 4JCNA 1ARCA 1MTSA 3GISB 1ZJKA 1GJAB 4ZHLU 1BTWA 4E7NA 1QJ1B 3RXPA 2WHXA 2QY0B 2ANWA 5C17A 1BUIA 1SPJA 4NFFA 1NT1A 1HCGA 1O0DH 2EEKA 1JIMA 2O8WA 1H4WA 1GHBG 4E06H 6CHAC 4K60A 4O3UA 4X8SH 2GGVB 3A81A 4BNRA 1L4DA 2P94A 3BG4C 2C93B 3LGUA 4RN6A 1LTOA 1YPMH 3TK5A 2GX4A 3SNCA 1CBWC 4ABFA 4BAMB 2KCPA 3DFJA 3LONA 3SV2H 6GCHG 4TYDA 2ZDLA 2FX4A 3RLWH 2BY9X 4NIYA 4OS6A 1UMAH 1UK2A 3P17H 1LHCH 1CSOE 1E1RD 3ZV8A 2XYAA 1DY9A 1ESAA 1LVYA 1SGFA 1KLTA 2A7CA 1FONA 4JZDH 2W7SA 4B6FA 1CO7E 3ZYEA 4WVPE 5C0UA 4OS5A 4DURA 4IC6A 1TNIA 1QA0A 2EI8A 3ZZ6A 2R2MB 5JBCS 1HLTH 1QB9A 1GWAA 4YO9A 2KAIA 1PJPA 1W13U 1ZGVA 3JZ2B 3T2NA 1GDQA 2KCAA 1C5WB 1O2YA 4K8BA 2CHAB 2TGTA 3M3TA 1Y5BT 3I78A 2WPJS 2KCOA 5L30H 1MTVA 1GJ4H 3PROA 2HNTF 1QB1A 1Z7KA 3SV9A 5DP8A 1HJAC 3E0NB 4Y7BA 2F43B 1YY3A 5C1XA 2BY7X 4D8NA 1UTMA 1GJ8B 2YOLA 2FOFA 2YNBA 3VXEH 3NUMA 5A0AE 1K28D 2AGIX 2V35A 1J8AA 1S82A 2OLGA 2Z9JA 3TNTA 3EDXB 3RC4A 2WPDD 1IQLA 1C5VA 3RXJA 5GDSH 4ZHAA 1NS3A 4XD7D 1GBFA 2G5VA 2GZ9A 3U69H 1ZOMA 8GCHG 1T4VH 2J95A 2LNCA 2QXGA 4DG4A 1LMWB 2Q6GA 1SHHB 3MO9A 2GMTC 3TJVA 1TPPA 1FY1A 2FIRH 1UK3A 3RXHA 1SLUB 3WY8A 3GCHC 5B6OA 5C5OA 3TGIE 3D65E 3ZZ7A 3ITIA 2G4UA 3A82A 3FVFB 1W0ZU 3FZDA 3Q77A 2XXLA 5F6MA 2P3FH 1V2VT 1YPLH 1JRTA 1P3CA 3FN8A 5DP5A 2CXVA 3H5CB 4XOJA 1EXFA 4H42U 4D7FA 1O3NA 2D2DA 5EG4A 3NPSA 4DJZB 3SHAH 1QQUA 2PSXA 2QC2A 1KY9A 3KNXA 3DT0H 2KM0A 1YKTA 1A0HB 1GCTC 1Y3XA 1PQ8A 1O30A 4Y76A 4Y79A 2Z3CA 4OS7A 3WW7A 1F7ZA 1GJDB 4RT0A 2F9UA 4THNH 2HGTH 4ZKOU 2O8LA 4BXWA 1YLDA 2GT8A 1EPTA 3GCTG 3QGNB 2GCTC 2QF4A 3SZNA 2H5DA 8ESTE 3S0NA 5L6NH 1DUEA 4INHA 5A0CA 2ZU2A 1TPAE 1FY4A 2UWPA 4ABHA 1P04A 2TGAA 3Q3YA 3SUFA 3TNSA 2HLDD 1O2JA 1O3OA 1BTYA 2FXRA 1FPCH 4UFEH 2BQ6B 3MH4A 1S6FA 4FVBA 1GMCF 3PO1C 4KELA 3IITA 5ABWA 1O32A 4XFQA 2ZC9H 3ATLA 1O5AB 3V7TA 3KQCA 2ZGHA 1HJAB 4XSKU 1DM4B 1FQ3A 3M5MA 3DCLA 1DWBH 3ESTA 1T8LA 2M2AA 2C3SA 3Q00A 5EPYA 3TJNA 1QZ8A 2XW9A 1YC0A 3PRBA 2VWNA 1QJ6B 2HNTC 5DSFA 1EKBB 5DK1A 5TCAA 1EAXA 1O36A 3O8DA 4I8LA 1OWHA 1BTHH 1NRPH 1W12U 2BQWB 1GVZA 1KXBA 1LKBA 2J2UA 1P9UA 2G8TA 1UHBB 4Q4LA 5HGGA 1CHOF 2EC9H 4ZXXH 3A8CA 3DSPA 2CN0H 3GY7A 4TPIZ 1O33A 1AE8H 1D4PB 3P8FA 2GCHG 4GVUA 5DG6A 5HYOA 2Z3DA 4HI3A 3A8DA 2A32A 5E0JA 5J4QA 4CRFA 2BD7A 3MH5A 2SGFE 4K69A 5AVDA 1NM6A 2PKSB 4AYYB 1SHYA 2QF5A 3I29A 2W7UA 1P0SH 2QE7D 1BHXB 1QTFA 2FODA 1ELGA 1LQDB 1N8OC 1C2LA 1Z6JH 1YPKH 1AQ7A 2ZWLH 3DHKH 1TLDA 3RMOH 1MCTA 3CNRA 3SORA 1KXFA 4AORA 1GJ5H 1T8NA 3A85A 4B76A 4B2AA 1ABIH 4ISLA 4DGJA 1P01A 1O2TA 4NGAH 2HPQH 3SI4H 2ZCKP 4JZFH 1ELDE 3M61U 3SJ8A 1GVKB 2B0FA 2Z94A 4Y6DA 4HG6A 1SGIB 2D26C 3ATIA 1V2TT 5JBTA 1SVPA 9LPRA 3OX7U 2GCHF 5LPEA 3C1KA 1GHBF 3LH3A 2Y7XA 1QNJA 1INCA 1FY5A 2R9PA 3F9GA 1T7CA 4KKDA 2AIPA 3UNSA 2BYAX 2HRVA 5GPIB 3T5FH 2ILNA 2BDAA 4ACAA 5C1YA 4CRDA 1DSUA 3ZZ4A 2XC4A 1HAGE 1HAVA 3ZZAA 1C1VH 4WF8A 2PUXB 4I31A 1THPB 2A5AA 1COWD 4B2CA 1SOZA 1MQ5A 1QBNA 3RXFA 2Y7ZA 1CA0B 1TMTH 4AFQA 1CBWB 1O5DH 5ETXA 1HAXB 5JB8S 4MG3A 2FOMB 4NWKA 2BHGA 1YBWA 2YNAA 1HAVB 2ZFFH 2GT7A 2VIQA 4FXGH 2FOEA 1KLIH 1THRH 1FLEE 1SGYE 2C90B 4X1NU 1RTKA 4A7IB 4CR9A 3GY4A 2PSYA 6LPRA 3ZYDA 3RC6A 2ZP0H 4GCHF 3D62A 1ANBA 4AG1A 2FLBH 3PYHA 1TE0A 1WOFA 2TPIZ 2WPLS 1BRCE 1P2OA 1NFWA 2NU2E 3LIWA 5E2PA 4ZMAH 2PW8H 5JDUB 1A1RA 4X1RU 2F83A 1W7XH 1ZR0A 5FCKA 4AB9A 3UAIC 1G3DA 3NCLA 5C5NA 5CE1A 1GI3A 1NU7B 2ZCHP 2EI6A 3RXSA 3DSGA 3KQBA 2LPRA 2ZQ2A 3RP2A 5HMAA 4FUBA 2H9EH 4A1XA 1EPTB 5GNDA 2FOAA 1ELAA 2PTNA 3FZZA 1QIXB 1ZTKA 1C5PA 1CT0E 1EATA 2BDCA 1E36B 1ZMNA 4TSFD 1D3DB 1IQIA 2F4LA 1UTPA 1J9CH 2SGAA 3RC5A 2A4RA 2BQ7B 1OWIA 1Y5UT 2ZDAH 5EIYA 4JYVH 1H1BA 2VWLA 3SU2A 1BBRE 2GVFA 2A5IA 4Q2KA 4X1SU 2VVCA 2UUYA 2GD4B 1OPHB 1PYTD 2ESTE 1AFEH 3NRLA 1YPJH 5CDFE 1BRUP 3GY2A 1SFIA 3RMNH 1RRKA 4JMYA 2H1UA 3IWMA 3TVJB 4YOIA 1UTKA 2V3HH 1SBWA 1PPCE 3HK3B 3K2UA 3BTGE 3ZZ9A 4B73A 3DD2H 3GY5A 1CQQA 2ZFTA 4CHAB 5EXMA 4ISNA 1SQRA 1Y3UA 1AE5A 2BDYA 1BTXA 1C5YB 1O3IA 1Y3VA 1MTNB 3MU0A 4ESTE 1UTOA 1EJMA 5SGAE 1O2UA 2FI4E 1P9SA 4X0WU 1EUFA 2JJ1D 4JZEH 4WWYA 2FYQA 4WH8A 3SBKA 2FYRA 1GBMA 1C2DA 3SN8A 4H6SB 2QAAA 1BCUH 2QCYA 3SGBE 1HB0B 3SV7A 1GBLA 2KAIB 1KTTB 2ZCLP 2J92A 2W26A 4KTUA 1UTNA 2KR7A 2QXJA 2P8OC 1EJNA 1TALA 2FI3E 4YESB 5DP6A 5CMXH 1QBVH 1WCZA 1O34A 1SGEE 2YMSB 1GGDB 3P8GA 4CR5A 1V2UT 2FOGA 4YT7H 8LPRA 2AFQB 1Y5AT 5EQQA 1ANCA 2RDEA 3T28A 1GJ6A 2JIZD 1O2QA 3VPKA 4X2WA 2OC1A 1H9LB 1T31A 4MLFB 1HJ8A 2OQUA 1TNLA 1K1NA 4FUHA 2BY8X 2ZFSA 4OM9A 1C1UH 2ZECA 5AFZH 3A80A 3UWJH 3CS0A 1GHVH 2P3TB 4HGCA 1CA0C 2HALA 2V0BA 2GZ8A 1C9TA 3HKJB 3ZVGA 1SFQB 4YLUA 3GDUA 4UFFH 1ZPZA 3M7QA 4LZ4B 3RMMH 4K1EA 1S5SA 1DE7H 3K65B 2FDAA 3OY5U 3N7DA 1AVWA 2C8XB 4ZKNU 5L2ZH 1PPFE 3VB3A 3A7YA 7LPRA 1AKSA 1O3HA 1P8VC 5JYIA 2WPIS 1L1NA 4Q7ZA 1GBCA 1QJ7B 1HIAB 1EJAA 1A5GH 3QLPH 4IMQA 3SO3A 4TWYA 3KQDA 5IYTA 3PO1B 3RMLH 4JZ1A 1LCYA 1O2RA 1Z8IB 1P11E 3B9FH 2OP9A 3ZZBA 3MNCA 1PPEE 3H09A 2B5TB 2IOTA 4ZCNA 2ZTZA 1AWHB 1OS8A 4NIVA 1H8IH 4ABBA 1PFXC 4XBDA 4F48B 4WY3A 3OU0A 4I86A 1A2CH 3LGTA 1KDQA 2GCTB 2DE8A 3AVZA 2F9BH 3MU1A 1N8OB 1VCPA 1MABB 5EW1H 4FU8A 2ZQ1A 2RA0A 4ABEA 3HK6B 3F9FA 2KCYA 4YXWD 1KXEA 3UOUA 3A8AA 1MAXA 1KXDA 1C2KA 1TNKA 1WTGH 1UO6A 1H8DH 1NTPA 4ISIH 2FWWA 3SNAA 3VFEA 3ZZ8A 1GDUA 9ESTA 3S9CA 1ESBA 1S0RA 4FUIA 4CREA 4FUGA 4MPUA 1JMOH 1UTQA 7GCHG 2GP9B 3NXPA 4IBLH 1SGFG 3RXLA 4DVAU 1IOEA 3TJOA 2ZG0H 4UONA 3GCHB 1WDIA 3MO3A 1DWEH 4ZROA 3VG8A 2W3KA 1RFNA 4AB8A 2GMTB 1ZPCA 1VITF 4A1TA 3HKIB 4B1TA 1EQ9A 2A1DB 2GZ7A 2BDGA 4DCDA 2BMGB 4M7GA 3GYLB 2BLVA 1EASA 2OK5A 1J17T 5EJZA 3RU4E 2AIQA 2WV4A 1P10A 2HVXA 1O5FH 5A2MH 1XMNB 1BTZA 1DSTA 3C27B 2VIDA 1SC8U 2AGGX 3N99A 1GJCB 5T6DA 2W5EA 2J94A 2LELA 3RU4T 4X1QU 3TGJE 1AUTC 2IJD1 3U1JB 3BTME 1UCYK 3IG6B 4J2YB 2Y81A 3U1IB 1IQMA 3BTKE 3BTWE 1TBQH 5K0HA 2VVUA 3ELAH 3UR9A 1HFDA 5FX5A 2K8IA 4U2WA 1GBAA 4DY7B 2CV3A 3F1SB 1S84A 1O37A 4JYUH 4U32A 3CS7A 4YZUA 2VB0A 2ZTXA 4IGDA 4ZXYH 2G51A 4X6NA 2B7DH 1IQEA 1TRNA 1ZHPA 2R0KA 2BDIA 3STJA 3QGJA 1TX7A 2ZU4A 3E8LA 5L2YH 2WINI 3EE0B 1W0YH 2BD3A 2J9NA 1WQSA 1FNIA 2TIOA 2FOHA 1LHDH 1LVMA 2H2ZA 3SI3H 1G30B 1T32A 1TGTA 3V0XA 4AGKA 2Z7FE 5DPAA 1K1IA 2JETB 1K1JA 3KYFA 1OP8A 1TGCA 1QA7A 3SUEA 3PLBA 1YGCH 3RLYH 1GJBB 1C1QA 1B5GH 5GWZA 3SU3A 4WH6A 3UTUH 1MMJN 1O3FA 2B9LA 2PV9B 4AC9A 1GVLA 1CU1A 1C5XB 1JOUB 1Y3YA 1HXFH 1HYLA 4KGAA 1MTWA 2SGEE 2K0QA 1G2MA 1SG8B 1RTLA 3NKKA 1ZHMA 1FAXA 4NZLA 1LQEA 1BDAA 4ABAA 1G36A 1O2SA 2SNWA 1OWKA 2BD2A 2BX4A 1RS0A 1SQOA 1AO5A 4YOGA 2Z9KA 1O38A 4ZAEA 1UTLM 2CF9H 3A7XA 2JH5D 1T8MA 4GPGA 3V12A 1SLWB 1QL9A 1WUNH 2A2QH 4CH8B 1HGTH 5FPTA 1BRBE 3MFJA 3BTQE 2G81E 4WMFA 1RD3B 3LKWA 3UB0A 4DT4A 2R3UA 2ZGXH 1OOKB 3UQOA 3V3MA 4BAQB 3ZVEA 1ELFA 5T6FA 1V2KT 1C1WH 5HXFA 1VGCC 1LDTT 4FVDA 3V13A 4D9RA 5H4IB 2BXUH 1BTUA 1K1MA 1SMFE 2WYGA 3KEEA 1G2LA 2VNTA 3SNDA 3WWBA 4BAOB 4NA7A 1CVWH 3QK1A 1AIXH 2PLXA 2PKAA 3BTEE 1WBGB 1TNHA 2TRMA 1EZQA 4FUCA 4BXSA 2F3CE 1XX9A 1ZHRA 1O5CB 3GYMA 5AFYH 1QB6A 3UWIA 1BA8B 3M7UA 1A0JA 2CK3D 4Z1MD 3EA7A 1C4U2 3RXKA 1NU9A 1AMHA 3BG4B 1XXDA 2J98A 3MYWA 2UUKB 4DOQA 5C67A 5J4SA 3SW2B 2BTCE 1NFYA 1GI1A 5EW2H 4O03A 4X8TH 1OSSA 1LO6A 1V2QT 2BVXH 4B75A 1GI0A 2J4IA 3PM3A 2ZZUH 5HM9A 1G3CA 2CF8H 3SGAE 3KQ5A 3KL6A 1JBUH 2OINA 1V3XA 2PTCE 1UHBA 1C4Y2 2ZO3H 3G01A 4K8YA 1ZMLA 1BJVA 3FFGA 1BMMH 4B2BA 1P09A 3PMAB 3P92A 1GHAG 2Q1JA 5DP3A 3P70B 2XCFA 1IQJA 1V6DA 2FOCA 4AFZA 3FP7E 2FTMA 2FO9A 3K6ZA 1UCYE 1P2NA 3VEQB 5FXLA 5EU8A 4ISOA 3NZIA 5DP4A 1VCQA 2HNTE 3RXRA 5C20A 1O5BB 2HPPH 1XUHA 3UNQA 1ZTJA 2BLOA 3LDXH 4RSPA 1B7XB 1UVUH 2A4QA 2P16A 3PWBA 2L6OA 3F2FA 4WMEA 1DVAH 3RXUA 1CT2E 1GBJA 3LC5A 3VB5A 4OGYA 5KGOA 3MNSA 1GJ9B 2Z3EA 2ZFPH 1OP2A 1AFQB 4D7GA 1TA6A 4CBOA 2AH4X 5EOKA 3O8RA 6CHAB 3R3GB 3TGKE 1Z71A 3A7WA 2WSSD 1W10U 2V7QD 1HAYB 1HAHH 4AN7A 5EQRA 1YYY1 1OP0A 4UE7H 3EQ0H 1U6QA 2Y5FA 1H9HE 4Y8XA 7KMEH 2AMQA 4B6EA 2P93A 1OWDA 4ISHH 3PB1E 3TK9A 1HBTH 3OTPA 1P03A 3MMGA 4B74A 4CHAC 2BVSH 1BB0B 2G5NA 2L74A 3SOSA 4Y8ZA 1XKBC 3QZRA 3L33A 3SQHE 2RA3A 3KIDU 1WQVH 2NWNA 3EAJA 4K2YA 2BD9A 1SGCA 3N7EA 2BLQA 2UWLA 2CHAC 1ACBE 3AAVA 1QCPA 5EPNA 1RTFB 1SGRE 1IQKA 1ZSLA 2ZGJA 3RDZA 2ZEBA 4AGJA 3BEFB 1MTNC 3SU1A 2BZ6H 4XBBA 3E0PB 1NESE 1CE5A 5G4BA 3GCOA 1FIWA 4RI0A 4HZHA 2GJGA 1L2EA 2XBWA 2OCVB 3BTTE 3RXOA 2SGPE 2I6SA 2VBCA 2VGCC 3H7OA 2BB4A 1CA8B 4OS2A 1AWFH 3U8TH 1BOQA 2ZDVH 1AUJA 1DY8A 4D76A 1DDJA 1C2FA 2ZFRH 1GMDF 1DANH 1C1SA 1AGJA 1O39A 1VITH 2FS8A 1GMCG 1G3BA 3T27A 4U30A 2BOKA 4YM9A 3K6YA 1SLVB 3M3SA 4NCYA 2ZHEH 2ZPRA 2ODYB 1TQ0B 5LGOA 2OC8A 5AF9H 1HDTH 1TAWA 3ZZ5A 2F9NA 1NBMD 1QGFA 1K1OA 1CGIE 3K9XB 4B71A 4VGCC 3GCTF 5C0TA 1O3MA 4IC5A 1SGPE 1K2I1 1F2SE 1X7AC 2Y6TA 2FX6A 4Y71A 2ZHDA 1C2IA 3BSQA 2G52A 3Q3XA 2XBVA 2FM2A 1T4UH 2STBE 3A88A 1RJXB 4ABGA 1MKXH 3BTHE 4YT6H 1C9PA 3OEED 1PQ5A 2RG3A 3KHVA 1O2KA 5B6LA 1V2RT 5LPFA 1FJSA 1GBHA 4NFEA 2BY5X 4H4FA 2PKAB 1RIWC 1P2MA 3F9HA 5EJLA 1ARBA 4TWWA 1AVXA 2XWAA 2GDDA 2IJOB 1HJ9A 3E1XB 2XC5A 1MQ6A 8KME2 1QURH 2BD8A 2WUCA 1C1RA 3D49H 4TY6A 2BVRH 5A8ZA 2ZA5A 4MNYA 2PKSC 4YTAA 1FPHH 1BTPA 2YMSD 3EE7A 4NZQA 1GDNA 1TGBA 2ALPA 2R0LA 1D3PB 4Y7AA 4P00A 3EA9A 1UVSH 2FS9A 1F0UA 3OY6U 4Y11E 4Q7XA 4BTTB 1TB6H 2H9HA 4TPYA 2GDEH 2QXIA 1C4V2 3AAUA 2O8UA 1A3EH 3SZEA 5ESTE 5EQSA 3SJOA 1GMHF 1O2VA 3PTNA 4I32A 4Q7YA 1Z1IA 6ESTA 5DP7A 1K1LA 1C1OA 1UVTH 1ELTA 4CRGA 1AZ8A 1C2GA 4GHTA 2PR3A 5EGMA 2ZI2H 2A45B 3RXMA 1E38B 1F92A 1YCPH 1YM0A 3EA8A 1DWDH 1XVMA 3ATKA 4I8HA 4JK6A 8GCHF 4Y0ZE 1GMHG 3VXFH 3LC3A 1M9UA 3RXTA 4SGBE 4NA9H 5DKMA 4R8TB 2BOHB 4FUFA 2JH6D 1RGQA 2GKVE 4O3TA 4A6LA 2A0QB 1YPGH 1NO9H 1MBQA 3SU5A 1NN6A 1MD8A 1LHGH 3EGKH 1S85A 1CGHA 1BT7A 1GI8B 1F5LA 1WTHD 1Z8RA 2AGEX 1O2MA 1GBBA 4P02A 1C2EA 2A5KA 5HM2A 2Y80A 2QGRA 1UVPA 5DP9A 1FZZA 4I8GA 1L0ZA 5FPYA 3HPTB 2WPHS 1C5MD 4KTCA 1W8BH 1WAYB 1GCTB 2H5CA 3OYPA 5DO4H 3E3TA 1OKXA 2OBQA 4X2VA 1C2MA 4LXBH 1AI8H 1AKSB 4MVNA 1SQTA 4F4OC 3TIUA 5A0BA 2H9TH 2PFEA 1FUJA 1WU1A 1IQNA 3SNEA 1UVOA 3ODFA 1GBKA 4NWLA 1BBRH 1IQFA 1WSSH 2A4GA 3CP7A 2AMDA 2RDLA 2VH6A 3LOXA 4D9QA 1ZPBA 1MZDA 3M37A 4X8UH 3RXCA 5FHTA 1C5SA 1KIGH 1P05A 1W0KD 2ZU1A 1W2KH 1HAPH 3H7TA 3QZQA 5GXPA 1PPZA 3A83A 2O8MA 1EB1H 4K1TA 1GBEA 1DLEA 4PROA 1SGNE 4K5ZA 3RXAA 4RKOB 2ZTYA 5E8EH 7ESTE 1TONA 2VIVA 3DUXH 4NSVA 1GHZA 1NRNH 4AZ2B 2PUQH 3N7OA 3O8BA 1AD8H 1C1PA 4UEHH 2PGQB 2ZGBH 1DXPA 4FETA 1GI4A 3RXIA 2Z9GA 4IN1A 5TJXA 5LH8A 3GICB 4AFUA 4FU7A 1H9IE 1SB1H 2OC7A 3GS9A 2ZHWH 3ODDA 2JETC 3LGVA 2G55A 1TBZH 1YPHE 1Q3XA 4AG2A 2BX3A 2PWXA 1N1LA 1ESTA 3OE7D 2FP7B 3M7TA 1DOJA 5F8XA 1K21H 1KYNA 2P3UB 1ORFA 1E37B 1P57B 3GDVA 1B0FA 2Y5HA 1L4ZA 2JJ2D 1O3CA 4MQAA 2EA3A 3F2HA 3UREA 1AZZA 1BITA 1KDQB 1SGTA 2OXSA 3BV9B 1ANDA 3W95A 1O3BA 1XXFA 5C1UA 5I25A 3SV8A 2Q6FA 4AFSA 2VH0A 1OWEA 1ABJH 1QQ4A 2FEQH 2G4TA 2EQNA 1O3KA 3AASA 3HGPA 2NU1E 4MNXA 4Z0KA 1VKYA 2C8ZB 2J97A 1CGJE 2BLWA 3PWCA 3ATMA 1H8HD 1ANEA 1JXPA 3UUZA 3FO8D 3L6PA 4GAWA 3KN2A 5ESBA 3U28C 1AY6H 4NA8A 4WXVA 2ASUB 5GJ4B 2C8YB 1KXCA 3E91A 3S7KB 1ZYOA 2VU8E 1QY6A 3TITA 3ZZ3A 3S69A 1GBTA 3KCGH 1PQAA 3A7ZA
chains in the Genus database with same CATH topology
3MNXA 3SUDA 2BY6X 4U01A 1Y59T 2XCNA 1VZQH 4UFGH 1ZJDA 1IHTH 3D23A 3T25A 2A7HA 2FESH 1DITH 4ZKSU 1YCPM 1EAWA 4A1VA 1SOTA 1GI6A 5FBEA 1HAOH 1K1PA 2W3IA 3BEUA 4I33A 1Z8JB 4I8KA 2J38A 4WJG2 1NFUA 3W94A 4WXIA 3BEIB 4VGCB 1TPOA 3A8BA 1D9IA 1NRSH 5FBIA 1XUFA 4LOYH 4NG9H 1V2JT 4GLYA 1LHFH 1VJ9U 3SJIA 3VB6A 3E16B 5EODA 1TGNA 1QFKH 2FMJA 3UPEA 1MTUA 3MNBA 1TQ7B 2HOBA 1ZSJA 1QRZA 2VIOA 2Q6DA 1A61H 3BIUH 1HRTH 1FDPA 1ZLRA 2NU4E 1P2KA 1TWXB 1UTJA 1YPEH 2ANMH 3M5LA 1PPBH 4RKJB 1SL3A 4GUXA 1TMBH 2XBYA 3MI4A 1FMGA 3DFLA 1LVBA 1EP5A 2A31A 2ZIQH 2EI7A 2AMPA 1MCVA 1TRYA 3JZ1B 3RM0H 4OS4A 1V2OT 1C5UA 1CHOG 2M5TA 1PQ7A 4DW2U 2ALVA 1GI5A 3SHCH 3B23B 4J1YA 3LU9B 1BMNH 1XKAC 2A4OA 2ZKSA 1NRQH 1SGDE 5K7RA 3TH4H 3LJOA 3STIA 1QBOA 1DWCH 2ULLA 1C5QA 3PMJA 3U8RH 2ANKH 1EAUA 2Z9IA 3RXDA 4Y8YA 1FIZA 3RXVA 4BANB 1MUEB 3A87A 3FP6E 1AN1E 1P2IA 2AERH 2FLRH 3SUGA 3SGQE 1VJAU 2CJIA 1LPGB 3TH3H 1GI2A 4BTUB 1NRRH 1ELEE 1EZXC 1O3LA 1S81A 3OTJE 2OC0A 4SGAE 4Y10E 3CENA 5T3HA 4BTIB 5A8YA 3A84A 1TA2A 2V3OH 3LH1A 1GCDA 4HTCH 1A3BH 1LVOA 2XC0A 1V2ST 5E0HA 4ZUHA 3VGCB 3ZZDA 1ID5H 3GCNA 1LKAA 4XBCA 3S9AA 2QYIA 3S9BA 4ABJA 1QR3E 3HATH 3KF2A 3SNBA 1RIWB 1JWTA 1XVOA 1QL8A 3LGIA 1Q2WA 2GV7A 3A89A 3F6UH 5A8XA 1FN6A 3GY3A 4HFPB 1RXPA 4UDWH 2VJ1A 1XUKA 3QTOH 4GHQA 1BBRK 1TNGA 4X6PA 1P2QA 1MBMA 1EZUC 4GCHG 2I6QA 3GY8A 1QL7A 1K9OE 1TOCB 1V2PT 3RXBA 4CH2B 2BDBA 1JIRA 2BZAA 2C4FH 3PTBA 1HPGA 3SJ9A 1AFQC 3SJKA 4KTSA 3ZVCA 3BTDE 3L3TA 1TBRH 2B8OH 2ZFQH 3ZVDA 3UIRA 1G3EA 5JBAS 1UK4A 1O3AA 1O3PB 1F0TA 1XUIA 1XUJA 1VCWA 3MO6A 1P06A 1J14A 2OBOA 4BOHA 3BG8A 2Z6BD 3RUOA 2HLCA 4Z6AH 2A7JA 3QN7A 3EYDA 2G00A 4IMZA 2R3YA 1NC6A 2VGCB 1P3EA 3A7VA 4R0IA 1O2WA 1Z1JA 2QA9E 5F03A 1DX5M 4I7YH 2GV6A 3A7TA 3GOVB 2OD3B 1MU6B 3PLKA 2FI5E 3I77A 4LK4A 4GSOA 2SGDE 4FUJA 4IW4E 1TABE 1G37A 2SGQE 1C2JA 3QTVH 1KSNA 5FPSA 4ABIA 1ELVA 1DT2A 3BIVH 3F68H 3QDZB 1BMLA 5GCHG 3TLOA 1O3EA 1GL0E 1MKWH 1LPZB 1C1NA 1F0SA 1O2ZA 3Q3KA 1SI5H 1HXEH 3HGNA 2XBXA 1CT4E 1DFPA 1O2IA 1O5EH 2XRCA 5CHAB 3UFAA 2TBSA 1C5TA 2SNVA 3PV4A 4OGXA 1O35A 4A5TS 1O3GA 2UWOA 3KGPA 1TIOA 1IQGA 3URDA 1O2LA 2ZDKA 3KQEA 3RXQA 3E6PH 3PMHB 5FX6A 1YP9A 2F9OA 1N6XA 2ODQA 1KTSB 2D8WA 2PHBA 3BF6H 2VWOA 3NWUA 1DXWA 3BTFE 5DJ7A 1ELBA 1A5HA 4CRCA 1AB9B 4DIIH 4DT7B 2A2XH 1PPHE 4NIXA 1D3TB 2QF3A 1UCYH 1UJ1A 1YCPK 1TFXA 4MPXA 2QV1A 1Q31A 1TOMH 2WYJA 1LPKB 1P2JA 1F5KU 4AYVB 1FV9A 4BAKB 1DICA 1SSXA 4X6MA 2VWMA 4ASHA 5T6GA 2NU0E 2XWBI 1N6YA 4X2XA 4XDEA 1O2NA 1W14U 2IN2A 1E0FD 4MPWA 5PTPA 1W7GH 1ELCA 3MU8A 4X6OA 3O8CA 4O97A 5C3NA 1FI8A 3TJUA 2JKHA 2NU3E 3ATWA 3ZVFA 4INLA 2ZHQH 4CRBA 1GG6C 3SQEE 2D1JA 3RM2H 3LPRA 1EX3A 1SLXB 5BPEA 5JBBS 1WYKA 2CMYA 1NY22 1PPGE 2R2WU 1YF4A 4WMDA 3T29A 2HWLB 3OSYA 1ETTH 2WPKS 1B0EA 2FOBA 3QX5H 2DE9A 1IHSH 2ZF0H 1BQYA 2F9VA 5E2OA 3MHWU 3Q76A 1GBIA 1ZSKA 1KXAA 5A09A 1S83A 1OX1A 4NIWA 4I8JA 1O3DA 1OYTH 4XE4A 1E35B 1TNJA 1YPHC 2IPHA 2TGPZ 4ZKRU 4X1PU 1HAIH 3GY6A 1NZQH 1Y8TA 2ZPQA 1HAZB 2JH0D 5IDKA 1GHXH 1C5ZB 2AEIH 3SU4A 4IS5A 1FY3A 1XM1A 3M35A 2Z9LA 4CBNA 1AB9C 3UR6A 1O2HA 2WPMS 2BDHA 5F8ZA 4H6TA 1JRSA 1EOJA 1MD7A 3AW0A 3MU4A 3PMBB 5FCRA 1TPSA 5TCCA 1ZRBA 1YLCA 1V2LT 3MOCA 4ZHMU 2BD4A 2K1QA 1W3CA 4MNVA 3VB4A 1QRWA 3TPIZ 1BHXF 3FAOA 3SU0A 1C1TA 1CHGA 1O2GH 2QF0A 2THFB 2VIPA 2UUJB 3DA9B 5LPRA 3M3VA 2XTTB 2UUFB 1O2OA 2FZZA 4UD9H 3SV6A 1GHYH 1A46H 1D3QB 1GI9B 3MH7A 4BAHB 1MKXK 3B8JA 4JZIA 1DS2E 1DUAA 1GI7B 1PYTC 1FN8A 1IAUA 1SGQE 3P95A 1ZZZA 3MWIU 4Q80A 3ZVAA 2BD5A 1AVGH 1S0QA 3T62A 2ZHFH 2C8WB 1SR5C 3P8OA 4MTBA 1ETRH 2Y82A 1W11U 2OUAA 2OQ5A 1AHTH 1HIAA 4INKA 1V2MT 1QHRB 3NK8A 4YOJA 4X2YA 4TY7A 3S7HB 3P8NA 3TK6A 1A4WH 2ZDNA 5GIBA 3ENSB 5JPMH 1L1JA 3UOPA 3U8OH 7GCHF 2F9PA 2ZDMA 2QN5T 2QXHA 2PGBB 1HUTH 4DIHH 1IQHA 1OWJA 3UNRA 2ANYA 2BM2A 1EOLA 5I46H 4X8VH 1TRMA 1XUGA 1THSH 1O31A 3TU7H 2WUBA 3FANA 1DPOA 2O9QA 2QIQA 4IN2A 1P02A 4O9VA 1P12E 1S6HA 3LGWA 5E0GA 1MZAA 3UY9A 1KLJH 1GMDG 2O8TA 5DGJA 2ZU3A 2GTBA 4MNWA 1HV7A 5GCHF 4Y0YE 3RXGA 1FY8E 2V6NA 3GDSA 1ZGIA 3PLPA 4QT8C 1F0RA 1GG6B 1MKWK 2FTLE 1TYNA 1T8OA 1EAIA 1TX8A 1OXGA 3QUMP 3QO6A 5CHAC 1SQAA 4ABDA 4AX9H 2CGAA 3RU4D 3RXEA 1Y3WA 2Y5GA 2BXTH 2SFAA 3URCA 1K22H 1J16A 1J15A 1HNEE 1Z8GA 1NPMA 1LHEH 4F49A 2ZNKH 3T26A 2J34A 3MTYA 1ZMJA 1TMUH 3U9AH 1C5NH 1BJUA 1OYQA 3SU6A 3AW1A 1V2NT 3F9EA 5EXLA 2P59A 2TGDA 1G9IE 4K3JA 2VIWA 5AHGH 1GGDC 4MPVA 1C5OH 1D6WA 5F8TA 1GHWH 4FUDA 1G32B 4LZ1H 2VINA 1A5IA 4AOQA 1FXYA 1VR1H 3BN9A 2P95A 3FP8E 1E34B 5C2ZA 1A7SA 1O5GH 1GPZA 3E90B 4FUEA 1V2WT 1WV7H 3P6ZB 3TH2H 1BIOA 3M5OA 3VB7A 1D6RA 2WV5A 1ZRKA 2AYWA 1O3JA 1O2PA 2F91A 5BRRE 1VITG 5FAHA 1BRAA 1QRXA 5JB9S 2ODPA 1L1GA 3R0FA 4KP0A 1GL1A 2VVVA 3M5NA 3LJJA 1TGSZ 4A92A 2XNIA 1Z6EA 2RCEA 1EB2A 2ZU5A 4E05H 4OS1A 1ZTLA 4UFDH 1C1MA 1GJ7B 1AU8A 1F5RA 4JK5A 2OTVA 1GBDA 1EP6A 2ZGCA 1MU8B 3M36A 3ZV9A 3MU5A 3LGYA 3UQVA 3A86A 2AS9A 4CRAA 1TX6A 5EXNA 3VGCC 1FAKH 1O2XA 1VGCB 1GHAF 1ETSH 4E7RG 2H6MA 3ZZCA 1A0LA 1NROH 1MH0A 4K1SA 2STAE 4JYTA 3LT3A 1EZSC 4ZH8A 6GCHF 3MH6A 2P8OB 1C5LH 1BZXE 4NSYA 2ZPSA 1EPTC 4YLQH 2DUCA 2FPZA 4MDSA 1BMAA 1NFXA 1DLKB 3ZVBA 1MAYA 3QWCH 1C5RA 4FU9A 3U98H 1C2HA 4JCNA 1ARCA 1MTSA 3GISB 1ZJKA 1GJAB 4ZHLU 1BTWA 4E7NA 1QJ1B 3RXPA 2QY0B 2ANWA 1BUIA 1SPJA 4NFFA 1NT1A 1HCGA 1O0DH 2EEKA 1JIMA 2O8WA 1H4WA 1GHBG 4E06H 6CHAC 4K60A 4O3UA 4X8SH 2GGVB 3A81A 4BNRA 1L4DA 2P94A 3BG4C 2C93B 3LGUA 4RN6A 1LTOA 1YPMH 3TK5A 2GX4A 3SNCA 1CBWC 4ABFA 4BAMB 3DFJA 3LONA 3SV2H 6GCHG 4TYDA 2ZDLA 2FX4A 3RLWH 2BY9X 4NIYA 4OS6A 1UMAH 1UK2A 3P17H 1LHCH 1CSOE 3ZV8A 2XYAA 1DY9A 1ESAA 1LVYA 1SGFA 1KLTA 2A7CA 1FONA 4JZDH 2W7SA 1CO7E 3ZYEA 4WVPE 4OS5A 4DURA 4IC6A 1TNIA 1QA0A 2EI8A 3ZZ6A 2R2MB 5JBCS 1HLTH 1QB9A 1GWAA 4YO9A 2KAIA 1PJPA 1W13U 1ZGVA 3JZ2B 3T2NA 1GDQA 1C5WB 1O2YA 4K8BA 2CHAB 2TGTA 3M3TA 1Y5BT 3I78A 2WPJS 5L30H 1MTVA 1GJ4H 3PROA 2HNTF 1QB1A 1Z7KA 3SV9A 5DP8A 1HJAC 3E0NB 4Y7BA 5C1XA 2BY7X 4D8NA 1UTMA 1GJ8B 2YOLA 2FOFA 2YNBA 3VXEH 3NUMA 5A0AE 1K28D 2AGIX 2V35A 1J8AA 1S82A 2OLGA 2Z9JA 3TNTA 3EDXB 3RC4A 1IQLA 1C5VA 3RXJA 5GDSH 4ZHAA 1NS3A 1GBFA 2G5VA 2GZ9A 3U69H 1ZOMA 8GCHG 1T4VH 2J95A 2LNCA 2QXGA 4DG4A 1LMWB 2Q6GA 1SHHB 3MO9A 2GMTC 3TJVA 1TPPA 1FY1A 2FIRH 1UK3A 3RXHA 1SLUB 3WY8A 3GCHC 5B6OA 5C5OA 3TGIE 3D65E 3ZZ7A 3ITIA 2G4UA 3A82A 3FVFB 1W0ZU 3FZDA 3Q77A 2XXLA 5F6MA 2P3FH 1V2VT 1YPLH 1JRTA 1P3CA 5DP5A 2CXVA 3H5CB 4XOJA 1EXFA 4H42U 4D7FA 1O3NA 2D2DA 5EG4A 3NPSA 4DJZB 3SHAH 1QQUA 2PSXA 2QC2A 1KY9A 3KNXA 3DT0H 1YKTA 1A0HB 1GCTC 1Y3XA 1PQ8A 1O30A 4Y76A 4Y79A 2Z3CA 4OS7A 1F7ZA 1GJDB 4THNH 2F9UA 4ZKOU 2HGTH 2O8LA 4BXWA 1YLDA 2GT8A 1EPTA 3GCTG 3QGNB 2GCTC 3SZNA 2H5DA 8ESTE 3S0NA 5L6NH 1DUEA 4INHA 5A0CA 2ZU2A 1TPAE 1FY4A 2UWPA 4ABHA 1P04A 2TGAA 3Q3YA 3SUFA 3TNSA 1O2JA 1O3OA 1BTYA 2FXRA 1FPCH 4UFEH 2BQ6B 3MH4A 1S6FA 4FVBA 1GMCF 3PO1C 4KELA 3IITA 5ABWA 1O32A 4XFQA 2ZC9H 3ATLA 1O5AB 3V7TA 3KQCA 2ZGHA 1HJAB 4XSKU 1DM4B 1FQ3A 3M5MA 1DWBH 3ESTA 1T8LA 2C3SA 3Q00A 5EPYA 3TJNA 2XW9A 1YC0A 2VWNA 1QJ6B 2HNTC 1EKBB 5DK1A 5TCAA 1EAXA 1O36A 3O8DA 4I8LA 1OWHA 1BTHH 1NRPH 1W12U 2BQWB 1GVZA 1KXBA 1LKBA 2J2UA 1P9UA 2G8TA 1UHBB 5HGGA 1CHOF 2EC9H 4ZXXH 3A8CA 2CN0H 3GY7A 4TPIZ 1O33A 1AE8H 1D4PB 3P8FA 2GCHG 4GVUA 5DG6A 5HYOA 2Z3DA 4HI3A 3A8DA 2A32A 5E0JA 5J4QA 4CRFA 2BD7A 3MH5A 2SGFE 4K69A 5AVDA 1NM6A 2PKSB 4AYYB 1SHYA 3I29A 2W7UA 1P0SH 1BHXB 1QTFA 2FODA 1ELGA 1LQDB 1N8OC 1C2LA 1Z6JH 1YPKH 1AQ7A 2ZWLH 3DHKH 1TLDA 3RMOH 1MCTA 3SORA 1KXFA 4AORA 1GJ5H 1T8NA 3A85A 4B76A 4B2AA 1ABIH 4ISLA 4DGJA 1P01A 1O2TA 4NGAH 2HPQH 3SI4H 2ZCKP 4JZFH 1ELDE 3M61U 3SJ8A 1GVKB 2B0FA 2Z94A 4Y6DA 1SGIB 2D26C 3ATIA 1V2TT 5JBTA 1SVPA 9LPRA 3OX7U 2GCHF 5LPEA 3C1KA 1GHBF 3LH3A 2Y7XA 1QNJA 1INCA 1FY5A 2R9PA 3F9GA 1T7CA 4KKDA 2AIPA 3UNSA 2BYAX 2HRVA 5GPIB 3T5FH 2ILNA 2BDAA 5C1YA 4CRDA 1DSUA 3ZZ4A 2XC4A 1HAGE 1HAVA 3ZZAA 1C1VH 4WF8A 2PUXB 4I31A 1THPB 2A5AA 4B2CA 1SOZA 1MQ5A 1QBNA 3RXFA 2Y7ZA 1CA0B 1TMTH 4AFQA 1CBWB 1O5DH 5ETXA