4AG1A

Human chymase - fynomer complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 221
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A02
1C2JA 2ZTZA 3GCNA 1G2MA 2NU3E 3ZVEA 4AFUA 3TGJE 1UTQA 1LQEA 3NCLA 1SGEE 2QA9E 1EZQA 1AWFH 1FIZA 1IQFA 4WMEA 3SU1A 1FXYA 2FM2A 3U98H 3FP7E 1ABIH 1ELBA 1GI0A 1SMFE 3ZZDA 2GZ9A 2GDDA 4BTTB 1LHCH 3GCOA 2JH5D 3MH4A 2BDBA 4UD9H 3EGKH 4I8LA 4WMDA 1WCZA 2UWLA 1NRSH 2QV1A 2ZU2A 3L6PA 3OSYA 1ZMLA 5AF9H 3BEFB 3H7OA 1RD3B 2VNTA 3KF2A 1EPTA 3A81A 2UUJB 3MU8A 1TBQH 3SBKA 1MCTA 1TGNA 2FESH 3ATWA 2VGCC 5CMXH 8GCHF 2C8XB 1O5CB 1TPPA 2PKAB 2UUYA 5G4BA 1O36A 3H5CB 1WQSA 1O30A 1TE0A 2FX4A 1FN6A 1OOKB 3U69H 1DPOA 2BLQA 2OXSA 4IN2A 1C1PA 3Q00A 1VJ9U 1HJ9A 3VGCC 4JZEH 1NRQH 5EU8A 3RXEA 2BD7A 5T6DA 3GCHB 1ZRBA 1N8OC 1ZMNA 3BTME 3LONA 4O03A 3UWIA 1O2XA 1RGQA 1ZPCA 3I29A 1CQQA 2ZU5A 4OS6A 1OSSA 2A5KA 2P95A 3M61U 6LPRA 4FU9A 1T8MA 2AGIX 1ELGA 4K5ZA 3A7YA 1O2ZA 1P09A 3ODFA 2GP9B 4XBDA 5CE1A 1MAYA 3GY8A 5B6OA 4X2WA 3BTDE 1ANBA 1CT2E 1PPEE 1C9TA 1YLCA 1B5GH 1F7ZA 2CHAC 5FAHA 1HBTH 1HAOH 1GBTA 3SNCA 1HAYB 4UFDH 1GMCF 2O8MA 1FUJA 3LGVA 1GHWH 5LPEA 4AFZA 2FDAA 3ATLA 1AUTC 3MU0A 1TBRH 4J1YA 1FY8E 3ZZ3A 2BDGA 4AG2A 1AFQC 1QJ7B 3PLKA 4DIIH 1ZMJA 1TMUH 4AX9H 3HKJB 3TJOA 4AGJA 3GY2A 4K1TA 3P8GA 1SOZA 1ETTH 3Q77A 4YLUA 1QCPA 1ARCA 1KYNA 2ULLA 1W11U 2QYIA 1ORFA 1CHOF 2HPQH 5DG6A 1BUIA 2B0FA 4OS7A 3GY7A 1NO9H 1PQAA 3NWUA 3RC4A 1FDPA 1YM0A 3RC6A 4TY7A 3SGQE 1LVBA 3UNSA 3ZZ8A 1XXDA 3QWCH 1XUIA 2Z9JA 2XC0A 2ZU4A 2ZHWH 1YPHC 5T6GA 5GDSH 1GI1A 1C2FA 1V2UT 4Q7YA 1O2IA 4Y0YE 1O3AA 1K28D 2WYJA 2ZCLP 5EXLA 1P2IA 2R2WU 3VB5A 3PLPA 1D4PB 1FNIA 2AGGX 1GBEA 1TB6H 1FAXA 1ZHRA 3TK6A 1TRMA 1JIMA 3SI4H 3TIUA 2TBSA 3BTWE 3T29A 3U8OH 1QJ6B 4Z6AH 3MFJA 5EW2H 3ZVCA 1C5TA 2BXTH 1ZSLA 3ATIA 2H5CA 3M37A 1GBIA 1TQ7B 1Y3XA 3SI3H 1HV7A 1O3LA 2FIRH 1Y8TA 2VWNA 4NZQA 2BB4A 1HYLA 3DHKH 2AMDA 3V3MA 1GWAA 3PO1C 4A92A 3LC5A 5EQQA 2ZDNA 1K1LA 1SVPA 4X8TH 5ABWA 3Q3KA 3FANA 2G5VA 1DWDH 2BY7X 1THSH 3RDZA 3HK6B 2ZPSA 3GICB 1V2NT 1GI3A 2BOKA 1SHHB 4D7FA 1EAXA 2ZFPH 3ELAH 2A32A 1Y5UT 3MU5A 1THPB 2YNAA 3ATKA 1OWEA 1BTUA 4MLFB 1AGJA 1GI8B 1ZPBA 1T8NA 3LGIA 2VIQA 1OP0A 1TOMH 5GCHF 1W3CA 2BDCA 1AVWA 4I8KA 1NS3A 2A2XH 3UQVA 1YPMH 1FAKH 4CHAB 3MOCA 3SU2A 4NIVA 3E8LA 2FP7B 3ZZBA 1XM1A 1GI2A 2BHGA 1O3DA 1WTHD 4FUFA 3SU4A 1XXFA 3RLWH 1D6WA 4B73A 5LH8A 2VWOA 1O5GH 2C8ZB 1SOTA 2BXUH 2Y5GA 4X6MA 1DM4B 2ZI2H 4H42U 2PUQH 3ZZ6A 1GBJA 1O32A 3E6PH 1UVOA 3SJIA 4K69A 5GPIB 1V2JT 2XCNA 4MNVA 2H6MA 2F9PA 3UOPA 3SGAE 1JBUH 1SGFG 1V2TT 4OGXA 5A8XA 5DP9A 3D23A 4X8UH 4CH2B 4SGAE 3RMLH 3TNSA 4A1TA 1BRBE 4CRFA 1KIGH 2ANWA 2C3SA 3VB3A 3MHWU 3NXPA 4NCYA 1P9SA 3SU0A 2Z9IA 3OY6U 3E3TA 2ESTE 1AMHA 4ABJA 3GY5A 1OS8A 2ILNA 2VIDA 3FZZA 4CH8B 3RXMA 2GVFA 1GDQA 3PB1E 1F0UA 1O5AB 3IITA 1ELDE 2ZF0H 3KQDA 2BD4A 1P8VC 2R0LA 1G30B 3P6ZB 3PV4A 1NESE 4CRDA 1T8OA 2TGPZ 1NZQH 1KDQB 5SGAE 2OC8A 4M7GA 1HAZB 3TITA 5C1UA 1YYY1 2BMGB 4THNH 4K3JA 3MH7A 2O8LA 1Q31A 1W13U 4YT6H 4NIWA 1FZZA 1C2DA 3KGPA 1GBBA 1OWDA 1TA6A 1LPZB 2ZFQH 4Q7ZA 3SU6A 2TGDA 4B2BA 2OBQA 1AB9B 1GCTB 5DO4H 1DXPA 1GJAB 1HXFH 3VXFH 3PWCA 1TGTA 5JB8S 2P16A 3SGBE 3UR6A 4AFSA 4AN7A 1GBLA 4HFPB 1AHTH 2VIVA 5EODA 2J92A 2WPJS 5GXPA 1T4VH 1IQEA 2ZFRH 1QTFA 2WPLS 2BY5X 1O38A 3STIA 1GBFA 1KLIH 1MQ5A 1HRTH 2WUCA 2ZIQH 1OPHB 3RXRA 4TPIZ 4ZXXH 3LT3A 1Y5AT 1BZXE 2PV9B 2ZGBH 1P2MA 6ESTA 4TWYA 5GWZA 1K22H 1LHGH 3BF6H 1P2NA 1ESBA 4BOHA 3RXAA 1FI8A 2CMYA 2XWBI 2W3IA 2CN0H 2THFB 2B7DH 2GCTB 1CGJE 2FYRA 4XDEA 4ISLA 3ZZ7A 4B74A 1BT7A 4IC6A 1B0FA 1O3MA 1K2I1 2FWWA 2Z7FE 3F1SB 1BDAA 3CENA 1P05A 5ETXA 4MNWA 2VIOA 1Z1IA 2V0BA 1BTXA 1V2LT 3UWJH 1T4UH 1GBMA 2P3FH 1QURH 2ZTXA 3MO9A 4YOGA 1C1TA 3TGKE 3SN8A 3QTOH 1O33A 4KTSA 1DFPA 1SGCA 3I77A 1O2TA 2ODQA 3ZVGA 3LIWA 2Q1JA 1P06A 2LPRA 1TQ0B 1TPOA 4J2YB 1T32A 1MTNC 1D9IA 3HKIB 2ZCKP 1C5MD 1DWBH 1BHXF 1WV7H 4ISIH 1RIWC 2NWNA 5E0GA 1QA0A 4BAMB 1E37B 1A5IA 3M5MA 2ZCHP 1SG8B 1O2RA 3AAUA 4UE7H 1EB2A 1GHVH 2HGTH 1V2MT 1QB9A 1O2HA 3DA9B 4CBNA 4X2XA 1G3BA 2Z3CA 1A7SA 3A87A 2Y5FA 2ZFTA 1TMBH 2OUAA 1IQMA 1JOUB 1H9IE 3KN2A 4B71A 1EJNA 1A5HA 3WY8A 1W12U 1GG6B 1TFXA 5JBTA 1ZR0A 4K8BA 1DY8A 5IYTA 2F91A 1SSXA 1AU8A 3LPRA 3SOSA 4FU7A 4AYYB 4DW2U 1O2YA 1QB6A 4RN6A 1ZTLA 1S6FA 3PTBA 4Y79A 3SJ8A 1F5RA 1Z6EA 4YOIA 3SHAH 2ZDKA 3QGNB 2ANMH 5AVDA 1GHBG 2QF0A 1J15A 1O5EH 1VITG 4JYTA 3ITIA 3M7TA 2R2MB 4OS1A 1EJMA 2ZHEH 1GI4A 4WXIA 2SGEE 1J17T 1Y3WA 2R3YA 2SGPE 3G01A 2BM2A 1IAUA 1YPGH 7ESTE 1P02A 3RXGA 3U9AH 5AFYH 5DP5A 3T28A 2FI3E 2DUCA 1MKXH 1P04A 1BRAA 1VCPA 2V3OH 3A7TA 3HATH 1OWKA 3M35A 5L2YH 1MD8A 1O3PB 1UVSH 4KELA 3EQ0H 4FUJA 2BX3A 2GGVB 2AIPA 2I6SA 5C1YA 1KXEA 4Y7AA 1UO6A 4PROA 2ZU3A 1XKAC 4BTIB 1YF4A 3RM2H 3V0XA 1PYTC 3SORA 3LOXA 4NSVA 5EQSA 1GVLA 1O5FH 1MD7A 2K1QA 1A4WH 1TAWA 1GBKA 1S6HA 1AVXA 1P01A 5CHAC 1O2WA 1EOJA 3MH5A 4F4OC 1JWTA 3ZYEA 4MG3A 1V2QT 3QUMP 5HYOA 1VGCB 2Y7XA 3MI4A 1NT1A 3Q3XA 3ZZ9A 1WUNH 2GT7A 1KTSB 2JKHA 1ZLRA 1EP5A 1GHYH 1KXAA 1Z7KA 2D26C 3SV6A 1TWXB 5HGGA 4DGJA 2FS8A 4TY6A 4ISOA 1TONA 3EYDA 1EX3A 1P2KA 1MBMA 4WVPE 1MTWA 1XUGA 3ZVBA 4Y0ZE 2OTVA 1NFWA 1H8DH 4FUBA 3I78A 1GMHF 4BXSA 2O8WA 4Z0KA 1YPEH 4NIXA 1P0SH 5JBCS 1AFEH 3TJVA 1DICA 1YP9A 3FZDA 3MYWA 2FLBH 2O9QA 1OP8A 1PPZA 3QZQA 2PHBA 4BTUB 3VXEH 5J4QA 1XKBC 1PPBH 3LC3A 2C8YB 2A4GA 5F8ZA 3GISB 5L6NH 3TPIZ 1O5BB 3MU4A 4K1SA 3BG4C 1O3KA 1FV9A 5EW1H 4GCHF 2XC5A 4MPUA 2C93B 1L0ZA 3DT0H 1GJ9B 1C1NA 3SJ9A 1PPCE 1QY6A 1DVAH 1TOCB 5IDKA 1MTUA 2RG3A 3U1JB 2QC2A 1IQNA 1J16A 1GI5A 3BIVH 3F9GA 2RDLA 3VEQB 1C5QA 2A5AA 1S0RA 3BG8A 3AW1A 4INLA 5T3HA 1LTOA 2SGQE 3QK1A 2VGCB 1ZPZA 2CGAA 5I46H 2A4RA 3QX5H 1SI5H 2YNBA 3FP8E 5DP3A 3UR9A 3ZVDA 3A85A 3KQCA 5HXFA 2XRCA 5LPFA 1IQLA 2OC0A 1C2EA 1GPZA 4Y8YA 1DDJA 2HNTF 3SQEE 5F6MA 3P8FA 5EXMA 2HWLB 1M9UA 1C5LH 3TH3H 5BRRE 3CS7A 4X8SH 1A3EH 1GHXH 3VGCB 2FODA 4YTAA 4A1XA 1SHYA 3EA7A 3BIUH 1SBWA 2ZC9H 2A45B 3KIDU 1VITH 3RXBA 1A0JA 1N8OB 1WQVH 2O8UA 2BY9X 1A61H 2BYAX 1SGNE 4X1NU 1UTPA 2PFEA 2XYAA 1V6DA 3A8BA 3SV8A 4D8NA 1TPAE 4MQAA 2FOAA 2W7SA 7LPRA 4D9RA 1P57B 1MKWH 5DJ7A 3K2UA 8ESTE 1CA0C 1EZSC 4NSYA 3A88A 2ZDAH 3GYLB 1UTNA 3HGNA 1GI6A 2P8OB 1Z1JA 2CXVA 2VH0A 3A8DA 4ZHMU 2FI5E 3MNSA 3JZ1B 1AQ7A 3ZVAA 3LKWA 1PFXC 2CHAB 2PW8H 2UUKB 1RTKA 2A4OA 4ABHA 2P94A 3S9BA 2WYGA 3UNQA 4FUEA 2PSYA 2VWMA 1K9OE 1DLEA 4NFEA 4UONA 1CGHA 1TRNA 2ASUB 1TYNA 2SGFE 1AFQB 1O2SA 1A2CH 4ABAA 4RKJB 1AD8H 1C2IA 1C4V2 1MMJN 2VJ1A 5FXLA 4X2VA 1ABJH 2HOBA 2PKSB 1F92A 3M5NA 3RMOH 1IQKA 1XUFA 1MQ6A 1IOEA 4Y11E 1O0DH 1SLXB 4XBCA 2AH4X 4U32A 1P2OA 3LGYA 1HAIH 4CRBA 2ZDLA 2GDEH 5DKMA 1D3QB 9LPRA 1BJUA 2GZ8A 3UFAA 3S7HB 1LVYA 1MU6B 4A7IB 3M3VA 2H5DA 3EAJA 1TX6A 3W94A 1UMAH 2G00A 1UHBA 2G52A 2SNWA 3MMGA 7GCHF 1BTWA 1Z8GA 1YPKH 1S5SA 1GBDA 3K6ZA 4U30A 3UPEA 1BMAA 1QL9A 1C4Y2 1SL3A 2WPKS 2G4TA 5LGOA 3D62A 1G32B 2A7HA 3PYHA 1O3OA 2ANYA 4NG9H 1AZZA 3BTEE 1TALA 3RMNH 1MH0A 2BVSH 2GV7A 1DE7H 1A46H 2JH6D 1EJAA 4RKOB 4Y8ZA 1C1QA 2PUXB 3RXPA 3PMJA 5K7RA 2D1JA 2AEIH 4NGAH 3F9FA 1EAWA 1ID5H 4Y8XA 4ABDA 3AASA 2EEKA 4KGAA 3P8NA 2ZECA 4O3UA 3HK3B 2P3UB 4YESB 2GZ7A 2V35A 2BQ6B 2ZWLH 3BTQE 4Y10E 1WSSH 3SU3A 1GMCG 1OXGA 2FOCA 4JYUH 1W0ZU 2GT8A 2SNVA 1KXFA 3QZRA 1EPTC 2J4IA 1OX1A 2R3UA 3RXFA 3QO6A 5EOKA 5TJXA 3URCA 1FJSA 3U8TH 3QGJA 5DPAA 3SO3A 4X1SU 1GBAA 4YZUA 1A1RA 1C1OA 1MTVA 4ZKNU 1ZJDA 2J34A 1HAPH 1CHOG 2CV3A 2STAE 4ZKSU 1LVMA 1NU9A 3FAOA 3D49H 3B8JA 1DS2E 1HPGA 3F68H 2G5NA 2IOTA 1LHFH 3SNBA 1VCQA 1O3CA 1K1MA 1PQ5A 1ACBE 2QGRA 1HXEH 5EXNA 1E35B 1BBRH 4CR5A 1BCUH 1FPCH 4MPWA 1YPHE 2GKVE 4TWWA 2EC9H 3TLOA 5A2MH 1O2UA 3ZV9A 1C2HA 4BAKB 1ZSKA 4DURA 4I31A 1GGDC 4IW4E 2Z3DA 1F0RA 1BMMH 1LDTT 4KKDA 1W7XH 1O3GA 4ZMAH 3RXIA 1HJAC 1IQJA 1BQYA 1AE5A 2BDYA 2R9PA 1F5KU 5JPMH 3M5LA 1EZUC 1SGDE 5TCAA 2Q6FA 1TNGA 1CU1A 2FMJA 3A86A 3F9EA 1YGCH 4JZ1A 1HCGA 3E1XB 1MAXA 3ATMA 4X0WU 3DD2H 5E2PA 1TNHA 2UWPA 3LGWA 2FEQH 1O3EA 3M7UA 4D7GA 4JZFH 1YCPM 2BX4A 3ODDA 2SGAA 4JK5A 2FS9A 1PJPA 4X1PU 1EQ9A 1CHGA 3IG6B 2H9EH 2OC7A 3ZVFA 3O8CA 2AGEX 2ZGCA 2HNTC 1O2OA 4JYVH 8LPRA 3UY9A 2BVRH 1V2WT 5JB9S 1C1MA 1ZGIA 3UUZA 1ELEE 2ZA5A 1HAGE 1O34A 1C5SA 1GL0E 1Z71A 3KCGH 2I6QA 1AI8H 3LGUA 1HFDA 1VCWA 2BD5A 1OKXA 3M36A 1NU7B 1TNJA 1ELCA 5FBIA 4TPYA 1NRPH 3A82A 5C20A 2BVXH 1P2QA 1GJ4H 1C1RA 1UK4A 5GCHG 2J38A 1SLWB 3ZZAA 1G2LA 4I32A 4H6SB 1DWEH 4Q80A 1Z8IB 1AKSA 1GHAF 1CO7E 4LZ4B 2KAIA 1RXPA 3JZ2B 3M3SA 2FTLE 1QNJA 1UTOA 1G9IE 2TIOA 1GCTC 4CRGA 3SUEA 3GCTF 4MNXA 1UTMA 5HMAA 1EUFA 4VGCC 2F83A 3P95A 2Z94A 3EA9A 3TU7H 3SV7A 3KL6A 3SW2B 2A4QA 2GV6A 4GPGA 5FPSA 2QF3A 1OP2A 2G81E 2SGDE 3C1KA 2Z9GA 1C5PA 3KEEA 2ALVA 2V6NA 5FCRA 3RU4T 1L1JA 4D76A 1J8AA 4X1RU 4CBOA 3SUGA 2ZGXH 1S82A 2GCHF 5DK1A 3RXHA 3MNXA 1F2SE 5DP4A 5DP8A 5A09A 1O2LA 3BTGE 1TLDA 4FVDA 3S7KB 3K6YA 1GJBB 1RTLA 2W3KA 3RXTA 2PGQB 3LH1A 4ABEA 3ZZ5A 1P3CA 1C2KA 4OS5A 5F8XA 1INCA 1MTNB 2JETC 1D3TB 1AY6H 1RIWB 3M3TA 2QCYA 1ZYOA 1BMLA 4E7RG 2WPHS 1L2EA 1E34B 2P59A 3GYMA 2Z9LA 6CHAC 1HB0B 1LMWB 4BXWA 1HIAB 1K1NA 2FOMB 4ABIA 1D3DB 1UCYH 1MKXK 3RXJA 4NA7A 4ABFA 1A0LA 1BB0B 1WAYB 3OU0A 2QIQA 4A5TS 1GMDF 2W5EA 2ZO3H 2BDAA 1AO5A 1C5XB 5EPNA 1ZZZA 1ELFA 1FONA 1P10A 3LJJA 4DG4A 3OX7U 1C5NH 1OYTH 3QLPH 1WYKA 1O2JA 1O39A 1UK3A 3CS0A 4CRAA 2PKAA 1C5RA 2VIWA 3FVFB 1OWJA 3A84A 2Q6GA 6GCHG 2TRMA 4IMZA 1RS0A 5PTPA 4B75A 3A7ZA 1B0EA 5DP6A 2A5IA 4ESTE 3SU5A 2A7JA 2YOLA 3MTYA 4NZLA 1HAXB 3D65E 3V7TA 1G3EA 3O8BA 1NFUA 4XOJA 3NK8A 3T62A 4FUGA 1BOQA 3FP6E 1V2RT 1G36A 4Y71A 2XBYA 2H1UA 3RUOA 1HAVB 5E8EH 5A0BA 2F3CE 3BTHE 3S9AA 3VFEA 2FTMA 4I7YH 4Q2KA 4WH8A 1WTGH 1SLUB 3KQBA 3MO6A 4NA8A 1O3IA 5EQRA 3PMHB 3O8DA 2UWOA 3SZNA 1JRTA 1HDTH 4I33A 1KY9A 4YT7H 2UUFB 3U1IB 4IN1A 4WH6A 5HM9A 1SQOA 1SGIB 2GMTC 1DLKB 1Y3VA 1FY5A 2ZGJA 2OP9A 3TH4H 1Z6JH 1EAIA 2EI8A 1UVUH 2BLOA 1QHRB 3MH6A 2V3HH 1XMNB 2F9NA 2C4FH 4B1TA 1UVTH 5GIBA 1CBWC 1LPKB 4IMQA 2FO9A 5CHAB 1ELAA 2HLCA 3MNBA 1H8IH 1DXWA 1U6QA 1LHEH 2BZAA 2FYQA 1EAUA 1B7XB 1W0YH 4JCNA 5LPRA 5ESTE 2O8TA 2RA0A 4UFFH 3GY3A 4GAWA 2XNIA 1BITA 2JH0D 4F49A 1BRUP 2B5TB 1O2KA 4JZIA 4H4FA 1YLDA 1RTFB 2ZQ2A 1RJXB 3RXDA 4JZDH 2W26A 1NFXA 1BTPA 2ODPA 1FY1A 1C1UH 1LKBA 4XSKU 2IJOB 1YC0A 3PMBB 1AWHB 2ZG0H 3RM0H 1UTLM 4K1EA 3P92A 1Z8RA 1NFYA 1GBHA 1UTKA 1SFIA 3W95A 1V3XA 2OC1A 2ANKH 1N6XA 4LXBH 4IC5A 1LVOA 2P93A 3A80A 1LHDH 3QTVH 3RXOA 1ZOMA 3RXUA 3AW0A 1SPJA 1ZGVA 1LCYA 2F9OA 2PTNA 3BG4B 3A89A 1UK2A 5C5NA 1FY3A 2OQ5A 4DY7B 1Y5BT 1UTJA 1E38B 3F9HA 1SGQE 1QIXB 1QJ1B 2NU4E 1OWHA 4RSPA 2NU0E 1ZJKA 1VZQH 4AORA 2M5TA 4AGKA 1NROH 4O97A 1MTSA 1O3BA 1XUKA 1ZRKA 4UFEH 5C67A 4IGDA 3B23B 3SHCH 1MKWK 1C1SA 2Y82A 4NFFA 5A8YA 1GBCA 3P70B 4D9QA 1SR5C 2Y5HA 2WUBA 4WF8A 5T6FA 1FMGA 2CF9H 3GDVA 1MCVA 1SC8U 4ZHAA 2XTTB 1YPJH 1F5LA 4U2WA 1W10U 2VWLA 1GJ7B 1DOJA 1IHSH 2ZU1A 2Y80A 3UOUA 1YCPH 2GD4B 1DITH 2FOGA 1L1NA 3E90B 4U01A 2AIQA 1GL1A 2PR3A 1GJ6A 4ZUHA 2EI6A 2FOFA 1KXBA 3SNDA 2PGBB 2ZTYA 1XUHA 1Y3UA 3GDSA 1ETRH 8KME2 4ZH8A 1K1JA 1CA8B 1C5OH 1NM6A 4ZXYH 1H1BA 1BTYA 2ZGHA 1TNIA 2HRVA 1V2ST 2Y81A 1GDUA 2W7UA 1S85A 1TPSA 2AMPA 3RP2A 1C5UA 3RXLA 4ZKOU 2ZPRA 1D6RA 1BA8B 2FX6A 3DFJA 1CA0B 3ENSB 1O3JA 1AIXH 1FQ3A 1GMHG 1QL8A 1ANDA 3H7TA 1O5DH 3RXCA 1ZHPA 1O2NA 3BSQA 1LKAA 4IS5A 4WMFA 1EZXC 3MO3A 1DSTA 4XFQA 5TCCA 3S9CA 1TBZH 2WV4A 5I25A 5ESBA 4GSOA 1CVWH 1QFKH 4I8HA 3O8RA 4ISHH 3VB6A 4GUXA 4QT8C 1XVMA 4X1QU 1LQDB 3L3TA 3BV9B 1ELVA 3GCHC 4ZHLU 3SJKA 1XVOA 3T26A 1THRH 5GJ4B 4AG1A 2ZHQH 4GCHG 5A0AE 4OS4A 1ANCA 4X6PA 3SV2H 1O31A 4AB8A 2AERH 1BHXB 1C2GA 4X8VH 2FI4E 1QR3E 1KLJH 2J9NA 2A0QB 2P8OC 4Y7BA 1TMTH 2A7CA 1A0HB 3RLYH 3EA8A 1TNKA 1AVGH 2FXRA 4XE4A 1J14A 1W14U 2ZP0H 3V12A 3M5OA 1T31A 4GLYA 1MU8B 1ZSJA 8GCHG 3QDZB 1NRNH 1BTHH 4NIYA 4BAOB 3S69A 3T27A 2WPMS 2J94A 1KXDA 4KTUA 1KDQA 1ZTJA 3FFGA 2B8OH 2CF8H 2XWAA 3R0FA 4WJG2 2PKSC 1G37A 2BD2A 1BIOA 3A8AA 1BMNH 1K21H 1DWCH 4FUDA 3NKKA 1TIOA 9ESTA 3A7XA 2OBOA 3ZZCA 2P3TB 4MPVA 1T8LA 3A7VA 4IBLH 1GDNA 4BANB 1S0QA 1Y3YA 1GJCB 1H9LB 1SLVB 3AVZA 3QN7A 4LK4A 1C5VA 1P3EA 2GX4A 3RXVA 3BEUA 4B2AA 1RFNA 3RXSA 4BNRA 1K1OA 1GVKB 1IQHA 5EGMA 4OS2A 5F8TA 3TJUA 4FVBA 2F9VA 1GCDA 1C1VH 5DP7A 1IHTH 3OTJE 1ANEA 1L1GA 1NRRH 1BBRK 1P03A 1V2VT 1QA7A 1O2QA 1C5WB 1SGRE 4FU8A 1QBNA 3S0NA 1C5YB 3PO1B 2HVXA 2F9BH 2LNCA 4I8JA 2H9HA 1V2KT 4CREA 1EPTB 1KXCA 4TYDA 3B9FH 1VJAU 1TX8A 4FXGH 2RCEA 2XXLA 3MU1A 1YPLH 5AFZH 5HM2A 3TGIE 3GY4A 1O2MA 2G4UA 2OD3B 4GHQA 1SQTA 2TPIZ 1CSOE 1K1PA 1S84A 1ESTA 1O3FA 1DANH 4INHA 1WU1A 3F6UH 2SFAA 2RA3A 3DUXH 3RXKA 5JYIA 3EDXB 3K65B 4O3TA 3BEIB 1QBOA 3GOVB 2VVCA 1KLTA 1X7AC 3RMMH 2VVVA 3UIRA 2DE8A 1AN1E 4AOQA 1JXPA 5C2ZA 2H2ZA 2ZKSA 1AZ8A 4R8TB 4A6LA 1J9CH 2A2QH 1P9UA 1FPHH 7GCHG 2BY8X 3A83A 1WBGB 3BTTE 1HIAA 1KSNA 5BPEA 1FLEE 3ZZ4A 1GGDB 2ALPA 2ZDMA 3C27B 4MPXA 1O2GH 4Y6DA 2XBXA 2VINA 1HJAB 1A3BH 2FOEA 4CHAC 2BOHB 4KTCA 2J2UA 1QQ4A 1QGFA 2NU1E 4HZHA 4X6NA 1HAHH 3DFLA 4AB9A 4H6TA 5DGJA 1YBWA 1SGFA 1SGYE 2QY0B 1G3DA 4E06H 2PLXA 1NY22 1H4WA 2VB0A 4NWLA 3R3GB 4UFGH 4GHTA 1MBQA 4CRCA 1JRSA 1BJVA 2BZ6H 3P8OA 3HPTB 1TA2A 3K9XB 1QRWA 2GTBA 1MZAA 3LGTA 4ISNA 3LU9B 1ZHMA 2FOBA 2QN5T 5FX5A 1FY4A 2J95A 1L4ZA 2STBE 4BAHB 2OLGA 3VB4A 1DUEA 5C1XA 3V13A 3SNAA 3E0PB 3E0NB 4K60A 1ESAA 4E05H 4FUCA 2CJIA 1HAVA 1NPMA 1AUJA 4WXVA 1TNLA 4B76A 1A5GH 3TK5A 1HNEE 1C9PA 5FBEA 5FHTA 3MNCA 1QRXA 2BY6X 4NWKA 3URDA 1W2KH 1P12E 1L4DA 2BD3A 5E2OA 3GY6A 2WINI 2WPIS 1EP6A 4ASHA 1OYQA 4FUHA 1QQUA 2QXGA 5FX6A 2QXJA 4UEHH 1SGTA 1UHBB 3E16B 3IWMA 4DT7B 3UTUH 4MTBA 2B9LA 1ELTA 2ZFFH 1CT0E 5FCKA 4ABBA 3OY5U 2AFQB 1CE5A 1CGIE 1EB1H 1S83A 1AB9C 1BBRE 2C8WB 2A1DB 4VGCB 2IN2A 1UCYK 1TRYA 1DY9A 2Z6BD 2BQ7B 1GI7B 3P17H 4OGYA 1GJDB 2PTCE 4WY3A 3A7WA 4FUIA 1EATA 1V2OT 1EKBB 1BRCE 1T7CA 6GCHF 2PSXA 2BD9A 1UVPA 1P11E 4LZ1H 7KMEH 1XX9A 1JMOH 1Q2WA 2OQUA 5F03A 2Z3EA 4YO9A 1QL7A 1PQ8A 2ZPQA 4YLQH 1MZDA 1RRKA 4AZ2B 4E7NA 1GHBF 1Z8JB 3LH3A 1ETSH 2VVUA 5EG4A 5C3NA 1HUTH 1VITF 1SQAA 3T2NA 2QAAA 1FIWA 1QRZA 2ZQ1A 3T25A 3PWBA 1O2PA 4Y76A 2FOHA 4CR9A 1VR1H 3KHVA 1PPHE 2BLWA 1TGBA 3RC5A 2Z9KA 2JETB 5JDUB 3BN9A 1PQ7A 1Y59T 3RU4D 2ZFSA 4JMYA 2GCTC 3SJOA 3VPKA 1E36B 2HNTE 2PWXA 1NTPA 2AYWA 2VU8E 5FPTA 6CHAB 4AFQA 1DX5M 2ZZUH 1C5ZB 2FLRH 3UQOA 1EXFA 2BDHA 5L30H 2XBWA 2DE9A 3CP7A 1ZTKA 2VIPA 2ZDVH 1GI9B 1DUAA 5H4IB 1LPGB 3U8RH 2F9UA 2FPZA 4ABGA 3LDXH 1DSUA 4ZKRU 1EASA 3OYPA 2BQWB 3L33A 4R0IA 3RXQA 5J4SA 1HGTH 2R0KA 2ZNKH 4DVAU 4YM9A 4HTCH 3Q76A 3UREA 1GHAG 5A8ZA 3E91A 1N6YA 3SNEA 4MNYA 4MVNA 5JBAS 3TNTA 1GVZA 3NPSA 2G55A 2ZEBA 3UNRA 1HLTH 1JIRA 2FZZA 1NN6A 1O2VA 3AAVA 1SGPE 1W8BH 1GHZA 3GCTG 3VB7A 3ZYDA 3A8CA 1NC6A 4ZAEA 3T5FH 2EA3A 3SQHE 1KTTB 1O37A 1TGCA 1O3NA 2BDIA 2ODYB 3N7OA 1Q3XA 1MUEB 2G8TA 5AHGH 1C2LA 1C2MA 3KNXA 4X2YA 4LOYH 4I8GA 2XW9A 4HGCA 1GG6C 3NZIA 1YKTA 1WOFA 2H9TH 3KQEA 2EI7A 1HJ8A 3ESTA 1H9HE 3LJOA 3TVJB 1GJ8B 4DCDA 3M7QA 4X6OA 2GCHG 3RU4E 2HPPH 4O9VA 1E0FD 2ZHFH 3TJNA 2GMTB 4AYVB 2TGTA 2XCFA 5E0HA 2XC4A 3SV9A 5EPYA 3TH2H 1PPGE 1D3PB 2OCVB 1CBWB 1XUJA 2G51A 4JK6A 1C1WH 3BTFE 1N1LA 1O3HA 1ARBA 4HI3A 1F0SA 1EOLA 5FPYA 1LO6A 4KP0A 2Y7ZA 3EE0B 4K8YA 2D2DA 3PMAB 1SB1H 1K1IA 5L2ZH 1AE8H 3Q3YA 2NU2E 1V2PT 2TGAA 3ZV8A 4INKA 5E0JA 5K0HA 1IQIA 1TX7A 4MDSA 1IQGA 1P2JA 4WWYA 1PYTD 5JBBS 5C5OA 3PROA 1PPFE 5A0CA 1TGSZ 3GDUA 4B2CA 3STJA 2VH6A 1F0TA 2Q6DA 1AKSB 1UCYE 4Q7XA 2D8WA 3HGPA 1GMDG 2KAIB 1UJ1A 1GJ5H 3BTKE 3SUDA 2Y6TA 4BAQB 2OINA 1DT2A 3PTNA 1G3CA 1FN8A 4DJZB 2XBVA 2BLVA 1YCPK 3PLBA 4K2YA 3MWIU 1CT4E 4GVUA 2ZHDA 3NUMA 1C4U2 1VGCC 1BTZA 4SGBE 4YOJA 4DOQA 2WV5A 2AS9A 2BD8A 1QBVH 2QXHA 1SFQB 4A1VA 1O35A 2A31A 2QXIA 1W7GH 2AMQA 1OWIA 4NA9H 3SUFA 2IPHA 1QB1A 4XBBA 4UDWH 1TABE 2BTCE 2HALA 4ZROA 4DIHH 3TK9A 2C90B 1S81A 3PM3A
chains in the Genus database with same CATH superfamily
1C2JA 2ZTZA 3GCNA 1G2MA 2NU3E 3ZVEA 4AFUA 3TGJE 1UTQA 1LQEA 3NCLA 1SGEE 2QA9E 1NBME 1EZQA 1AWFH 1FIZA 1IQFA 4WMEA 3SU1A 1FXYA 2FM2A 3U98H 3FP7E 1ABIH 1ELBA 1GI0A 1SMFE 3ZZDA 2GZ9A 2GDDA 4BTTB 1LHCH 3GCOA 2JH5D 3MH4A 2BDBA 4UD9H 3EGKH 4I8LA 4WMDA 1WCZA 2UWLA 1NRSH 2QV1A 2ZU2A 3L6PA 3OSYA 1ZMLA 5AF9H 2VBCA 3BEFB 3H7OA 1RD3B 2VNTA 3KF2A 1EPTA 2F43B 3A81A 2UUJB 3MU8A 1TBQH 3SBKA 1MCTA 1TGNA 2FESH 3ATWA 4DT4A 2VGCC 5CMXH 8GCHF 2C8XB 1O5CB 1TPPA 2PKAB 4I86A 2UUYA 3F0OA 5G4BA 1O36A 3H5CB 1WQSA 3MQKC 1O30A 1TE0A 2FX4A 1FN6A 1OOKB 3U69H 1DPOA 2BLQA 2EQNA 2OXSA 4IN2A 4ACAA 1C1PA 5IK2D 3Q00A 1VJ9U 1HJ9A 3VGCC 4JZEH 1NRQH 5EU8A 3RXEA 2BD7A 5T6DA 3GCHB 1ZRBA 1N8OC 1ZMNA 3BTME 3LONA 4O03A 3UWIA 1O2XA 1RGQA 1ZPCA 3I29A 3F0PA 1CQQA 2IJD1 2ZU5A 4OS6A 1OSSA 2A5KA 2P95A 3M61U 6LPRA 4FU9A 1T8MA 2AGIX 1ELGA 4K5ZA 3A7YA 1O2ZA 1P09A 3ODFA 2GP9B 4XBDA 5CE1A 3DSPA 1MAYA 3GY8A 5B6OA 4X2WA 3BTDE 1ANBA 1CT2E 1PPEE 3F2FA 1C9TA 1YLCA 1B5GH 1F7ZA 2CHAC 5FAHA 1HBTH 1HAOH 1GBTA 3SNCA 3PV5A 1HAYB 4UFDH 1GMCF 2O8MA 1FUJA 3LGVA 1GHWH 5LPEA 4AFZA 2FDAA 3ATLA 1AUTC 3MU0A 1TBRH 4J1YA 1FY8E 3ZZ3A 2BDGA 4AG2A 1AFQC 1QJ7B 3PLKA 4DIIH 1ZMJA 1TMUH 4AX9H 1VKYA 4ASUD 3HKJB 3TJOA 4AGJA 3GY2A 4K1TA 3P8GA 1SOZA 1ETTH 3Q77A 4YLUA 1QCPA 1ARCA 1KYNA 2ULLA 1W11U 2QYIA 3OEHD 1ORFA 1CHOF 2HPQH 5DG6A 1BUIA 2B0FA 3KYFA 4OS7A 3GY7A 1NO9H 1PQAA 3NWUA 1EFRD 3KQ5A 3RC4A 1FDPA 1YM0A 3RC6A 4TY7A 3SGQE 1LVBA 3UNSA 3ZZ8A 3H09A 5DSFA 1XXDA 3QWCH 1XUIA 2Z9JA 2XC0A 2ZU4A 2ZHWH 1YPHC 5T6GA 5GDSH 1GI1A 1C2FA 1V2UT 4Q7YA 2YMSB 1O2IA 4Y0YE 1O3AA 1K28D 2WYJA 2ZCLP 5EXLA 1P2IA 2R2WU 3VB5A 3PLPA 1D4PB 1FNIA 2AGGX 1GBEA 1TB6H 1FAXA 1ZHRA 4AC9A 4ACBA 3TK6A 1TRMA 4TSFD 1JIMA 3DCLA 3SI4H 3TIUA 2TBSA 3BTWE 3T29A 3U8OH 3FO8D 2KM0A 1QJ6B 4Z6AH 3MFJA 3PRBA 5EW2H 3ZVCA 1C5TA 2BXTH 1ZSLA 2XOKD 3ATIA 2H5CA 3M37A 1GBIA 1TQ7B 1Y3XA 3SI3H 1HV7A 1O3LA 2FIRH 1Y8TA 2VWNA 4NZQA 2BB4A 1HYLA 3DHKH 2AMDA 3V3MA 1GWAA 3PO1C 4A92A 3LC5A 5EQQA 2ZDNA 1K1LA 1SVPA 4X8TH 5ABWA 3Q3KA 3FANA 2G5VA 1DWDH 2BY7X 1THSH 3RDZA 3HK6B 2ZPSA 3GICB 1V2NT 1GI3A 2BOKA 1SHHB 4D7FA 1EAXA 2ZFPH 3ELAH 2A32A 1Y5UT 3MU5A 1THPB 2YNAA 3ATKA 1OWEA 1BTUA 4MLFB 1AGJA 1GI8B 1ZPBA 1T8NA 3LGIA 2VIQA 1OP0A 1TOMH 4FETA 5GCHF 1W3CA 2BDCA 1AVWA 4I8KA 1NS3A 2A2XH 3UQVA 1YPMH 1FAKH 4CHAB 3MOCA 3SU2A 4NIVA 3E8LA 1W0JD 2FP7B 3ZZBA 1XM1A 1GI2A 2BHGA 4Z1MD 1O3DA 1WTHD 4FUFA 3SU4A 1XXFA 3RLWH 1D6WA 4B73A 5LH8A 2VWOA 1O5GH 2C8ZB 1SOTA 2BXUH 2Y5GA 4X6MA 1DM4B 4RI0A 2ZI2H 4H42U 2PUQH 3ZZ6A 1GBJA 1O32A 3E6PH 1UVOA 3SJIA 4K69A 5GPIB 1V2JT 2XCNA 4MNVA 2H6MA 2F9PA 3UOPA 3SGAE 2KZ4A 1JBUH 1SGFG 1V2TT 4OGXA 5A8XA 5DP9A 3D23A 4X8UH 4CH2B 4SGAE 3RMLH 3TNSA 4A1TA 1BRBE 4CRFA 1KIGH 2ANWA 2C3SA 3VB3A 3MHWU 3NXPA 4NCYA 1P9SA 3SU0A 2Z9IA 3OY6U 3E3TA 2ESTE 1AMHA 4ABJA 3GY5A 1OS8A 2ILNA 2VIDA 3FZZA 4CH8B 3RXMA 2GVFA 1GDQA 3PB1E 1F0UA 1O5AB 3IITA 1ELDE 2ZF0H 3KQDA 2BD4A 1P8VC 2R0LA 1G30B 3P6ZB 3PV4A 1NESE 4CRDA 1T8OA 2TGPZ 1NZQH 1KDQB 5SGAE 2OC8A 4M7GA 1HAZB 3TITA 5C1UA 1YYY1 2BMGB 4THNH 4K3JA 3MH7A 2O8LA 1Q31A 1W13U 4YT6H 4NIWA 1FZZA 1C2DA 3KGPA 1GBBA 1OWDA 1TA6A 1LPZB 2ZFQH 4Q7ZA 4ZCNA 3SU6A 2TGDA 4B2BA 2OBQA 1AB9B 3NRLA 1GCTB 5C0TA 5DO4H 1DXPA 1GJAB 1HXFH 3VXFH 3PWCA 1TGTA 5JB8S 2P16A 3SGBE 2K8IA 3UAIC 3UR6A 4AFSA 4AN7A 1GBLA 4HFPB 1AHTH 2VIVA 5EODA 2J92A 2WPJS 5GXPA 1T4VH 1IQEA 2ZFRH 1QTFA 2WPLS 2BY5X 2J97A 1COWD 1O38A 3STIA 1GBFA 1KLIH 1MQ5A 1HRTH 2WUCA 2ZIQH 1OPHB 3RXRA 4TPIZ 4ZXXH 3LT3A 1Y5AT 1BZXE 2PV9B 2ZGBH 1P2MA 6ESTA 4TWYA 5GWZA 1K22H 1LHGH 3BF6H 1P2NA 1ESBA 4BOHA 3RXAA 1FI8A 1E1QD 2CMYA 2XWBI 2W3IA 2CN0H 2THFB 2B7DH 2GCTB 1CGJE 2FYRA 4XDEA 4ISLA 3ZZ7A 4B74A 1BT7A 2RDEA 4IC6A 1B0FA 1O3MA 1K2I1 2FWWA 2Z7FE 5EJ1A 3F1SB 1BDAA 3CENA 1P05A 5ETXA 4MNWA 2VIOA 1Z1IA 2V0BA 5C17A 1BTXA 1V2LT 3UWJH 1T4UH 1GBMA 2P3FH 1QURH 2ZTXA 3MO9A 4YOGA 1C1TA 3TGKE 3SN8A 3QTOH 1O33A 4KTSA 1DFPA 1SGCA 3I77A 1O2TA 2ODQA 3ZVGA 3LIWA 2Q1JA 2LP6A 1P06A 2LPRA 1TQ0B 1TPOA 4J2YB 1T32A 1MTNC 1D9IA 3HKIB 2ZCKP 1C5MD 1DWBH 1BHXF 1WV7H 4ISIH 1RIWC 2NWNA 5E0GA 1QA0A 4BAMB 1E37B 1A5IA 3M5MA 2ZCHP 1SG8B 1O2RA 3AAUA 4UE7H 1EB2A 1GHVH 2HGTH 1V2MT 5T1VA 1QB9A 1O2HA 3DA9B 4CBNA 4X2XA 3EE7A 1G3BA 2Z3CA 1A7SA 3A87A 2Y5FA 3N7DA 2ZFTA 1TMBH 2OUAA 1IQMA 1JOUB 1H9IE 3KN2A 4B71A 1EJNA 1A5HA 3WY8A 1W12U 1GG6B 1TFXA 5JBTA 1ZR0A 4K8BA 1DY8A 5IYTA 2F91A 1SSXA 1AU8A 3LPRA 3SOSA 4FU7A 4AYYB 4DW2U 1O2YA 1QB6A 4RN6A 1ZTLA 1S6FA 3PTBA 4Y79A 3OTPA 3SJ8A 1F5RA 1Z6EA 2GJGA 1FX0B 4YOIA 3SHAH 2ZDKA 3QGNB 2ANMH 5AVDA 1GHBG 2QF0A 1J15A 1O5EH 1VITG 4JYTA 3ITIA 3M7TA 2R2MB 4OS1A 3N7EA 1EJMA 2ZHEH 1GI4A 4WXIA 2SGEE 1J17T 1Y3WA 2R3YA 2SGPE 3G01A 2BM2A 1IAUA 1YPGH 7ESTE 1P02A 3RXGA 3U9AH 5AFYH 5DP5A 3T28A 2FI3E 2DUCA 3FOAA 1MKXH 1P04A 1BRAA 1VCPA 2V3OH 3A7TA 3HATH 1OWKA 3M35A 5L2YH 1MD8A 1O3PB 1UVSH 4KELA 3EQ0H 4FUJA 2BX3A 2GGVB 2AIPA 2I6SA 5C1YA 1KXEA 4Y7AA 1UO6A 4PROA 2ZU3A 1XKAC 4BTIB 1YF4A 3RM2H 3V0XA 1PYTC 3SORA 3LOXA 4NSVA 5EQSA 1GVLA 1O5FH 1MD7A 2K1QA 1A4WH 1TAWA 1GBKA 1S6HA 5HIZA 1AVXA 1P01A 5CHAC 1O2WA 1EOJA 3MH5A 4F4OC 1JWTA 3ZYEA 4MG3A 1V2QT 3QUMP 5HYOA 1VGCB 2Y7XA 3MI4A 1NT1A 3Q3XA 3ZZ9A 1WUNH 2GT7A 1KTSB 2JKHA 1ZLRA 1EP5A 1GHYH 1KXAA 1Z7KA 2D26C 3SV6A 1TWXB 5HGGA 4DGJA 2FS8A 4TY6A 4ISOA 1TONA 3EYDA 1EX3A 1P2KA 1MBMA 4WVPE 1MTWA 1XUGA 3ZVBA 4Y0ZE 2OTVA 1NFWA 1E1RD 1H8DH 4FUBA 3I78A 1GMHF 4BXSA 2O8WA 5C94A 4Z0KA 1WDIA 1YPEH 4NIXA 1P0SH 5JBCS 1AFEH 3TJVA 1DICA 1YP9A 3FZDA 3MYWA 2FLBH 2O9QA 1OP8A 1PPZA 3QZQA 2PHBA 4BTUB 3VXEH 5J4QA 1XKBC 1PPBH 5GNDA 3LC3A 2C8YB 2A4GA 5F8ZA 3GISB 5L6NH 3TPIZ 1O5BB 3MU4A 5C0UA 3WWBA 4K1SA 3BG4C 1O3KA 1FV9A 2F4LA 5EW1H 4GCHF 2XC5A 4MPUA 2C93B 1L0ZA 3DT0H 1GJ9B 1C1NA 3SJ9A 1PPCE 1QY6A 1DVAH 1TOCB 5IDKA 1MTUA 2RG3A 3U1JB 2QC2A 1IQNA 1J16A 1GI5A 3BIVH 3F9GA 2RDLA 3VEQB 1C5QA 2A5AA 1S0RA 3BG8A 3AW1A 4INLA 5T3HA 3CNRA 1LTOA 2SGQE 3QK1A 2VGCB 4OM9A 1ZPZA 2CGAA 5I46H 2A4RA 3QX5H 1SI5H 2YNBA 3FP8E 5DP3A 3UR9A 3ZVDA 3A85A 3KQCA 3UB0A 2XRCA 5HXFA 5LPFA 1IQLA 2OC0A 1C2EA 1GPZA 4Y8YA 1DDJA 2HNTF 3SQEE 5F6MA 3P8FA 5EXMA 2J98A 2HWLB 1M9UA 1C5LH 3TH3H 5BRRE 3CS7A 4X8SH 1A3EH 1GHXH 3VGCB 2FODA 4YTAA 4A1XA 1SHYA 3EA7A 3BIUH 1SBWA 2ZC9H 2A45B 3KIDU 1VITH 3RXBA 1A0JA 1N8OB 1WQVH 2O8UA 2BY9X 1A61H 2BYAX 3VG8A 1SGNE 4X1NU 1UTPA 2PFEA 2XYAA 1V6DA 3A8BA 3SV8A 4D8NA 1TPAE 4MQAA 2FOAA 2W7SA 7LPRA 4D9RA 1P57B 1MKWH 5DJ7A 3K2UA 3KYGA 8ESTE 1CA0C 1EZSC 4NSYA 2RFKC 3A88A 2ZDAH 3GYLB 4TT3D 1UTNA 3HGNA 1GI6A 4XRNA 2P8OB 1Z1JA 2CXVA 2VH0A 3A8DA 4ZHMU 2FI5E 3MNSA 3JZ1B 1AQ7A 3ZVAA 3LKWA 1PFXC 2CHAB 2PW8H 2UUKB 1RTKA 2A4OA 4ABHA 2P94A 3S9BA 2WYGA 3UNQA 4FUEA 2PSYA 2VWMA 1K9OE 1DLEA 4NFEA 4UONA 1CGHA 1TRNA 2ASUB 1TYNA 2SGFE 2J5UA 1AFQB 1O2SA 1A2CH 4ABAA 4RKJB 1AD8H 1C2IA 1C4V2 1MMJN 2VJ1A 5FXLA 4X2VA 1ABJH 2HOBA 2PKSB 1F92A 3M5NA 3RMOH 1IQKA 1XUFA 1MQ6A 3FKSD 1IOEA 4Y11E 1O0DH 1SLXB 4XBCA 2AH4X 4U32A 5HIYA 1P2OA 3LGYA 1HAIH 4CRBA 2ZDLA 2GDEH 5DKMA 1D3QB 9LPRA 1BJUA 2GZ8A 3UFAA 3S7HB 1LVYA 1MU6B 4A7IB 3M3VA 2H5DA 3EAJA 1TX6A 3PV2A 3W94A 1UMAH 2G00A 1UHBA 4Q63A 2G52A 2SNWA 3MMGA 7GCHF 1BTWA 1Z8GA 1YPKH 1S5SA 1GBDA 3K6ZA 4Q4LA 4U30A 3UPEA 1BMAA 1QL9A 1C4Y2 1SL3A 2WPKS 4F55A 2G4TA 5LGOA 3D62A 1G32B 2A7HA 3PYHA 1O3OA 2ANYA 4NG9H 1AZZA 3BTEE 3F2HA 1TALA 3RMNH 5KEDA 1MH0A 2BVSH 2GV7A 1DE7H 1A46H 2JH6D 1EJAA 4RKOB 4Y8ZA 1C1QA 2PUXB 3RXPA 2YMSD 3PMJA 5K7RA 2D1JA 2AEIH 4NGAH 3F9FA 1EAWA 1ID5H 1YLNA 4Y8XA 4ABDA 3AASA 2EEKA 4KGAA 3P8NA 1S6LA 2ZECA 4O3UA 3HK3B 2P3UB 4YESB 2GZ7A 2V35A 2BQ6B 2ZWLH 3BTQE 4Y10E 3W1EA 1WSSH 3SU3A 1GMCG 1OXGA 2FOCA 4JYUH 1W0ZU 2GT8A 2SNVA 1KXFA 5CHBA 1YY3A 3QZRA 1EPTC 2J4IA 1OX1A 2R3UA 3RXFA 3QO6A 5EOKA 5TJXA 3URCA 1FJSA 3U8TH 3QGJA 5DPAA 3SO3A 4X1SU 1GBAA 4YZUA 1A1RA 1C1OA 1MTVA 4ZKNU 3GS9A 1ZJDA 2J34A 1HAPH 1CHOG 2CV3A 2STAE 4ZKSU 1LVMA 1NU9A 3FAOA 3D49H 3B8JA 1DS2E 1HPGA 3F68H 2G5NA 2IOTA 1LHFH 2JDID 3SNBA 1VCQA 1O3CA 1K1MA 1PQ5A 1ACBE 2QGRA 1HXEH 5EXNA 1E35B 1BBRH 4CR5A 1BCUH 1FPCH 4MPWA 1YPHE 2GKVE 4TWWA 3OE7D 2EC9H 3TLOA 4HG6A 5A2MH 1O2UA 2IPQX 3ZV9A 1C2HA 4BAKB 1ZSKA 4DURA 4I31A 1GGDC 2L6OA 4IW4E 5FL7D 2Z3DA 1F0RA 1BMMH 1LDTT 4KKDA 1W7XH 1O3GA 4ZMAH 3RXIA 1HJAC 1IQJA 1BQYA 2WPDD 1AE5A 2BDYA 2R9PA 1F5KU 5JPMH 3M5LA 1EZUC 1SGDE 5TCAA 2Q6FA 1TNGA 1CU1A 2FMJA 3A86A 3F9EA 1YGCH 4JZ1A 1HCGA 3E1XB 1MAXA 3ATMA 4X0WU 3DD2H 5E2PA 1TNHA 2UWPA 3LGWA 2FEQH 1O3EA 3M7UA 4D7GA 4JZFH 1YCPM 2BX4A 3ODDA 2CK3D 2SGAA 4JK5A 5CDFE 2FS9A 1PJPA 2V7QD 4X1PU 1EQ9A 1CHGA 3IG6B 2H9EH 2OC7A 3ZVFA 3O8CA 2AGEX 2ZGCA 2HNTC 1O2OA 4JYVH 8LPRA 3UY9A 2BVRH 1V2WT 5JB9S 1C1MA 1ZGIA 3UUZA 1ELEE 2ZA5A 3N99A 1HAGE 2EY4C 1O34A 1C5SA 1GL0E 1Z71A 3KCGH 2I6QA 1AI8H 3LGUA 1HFDA 1VCWA 2BD5A 1OKXA 3M36A 1NU7B 1TNJA 1ELCA 2JJ2D 5FBIA 4TPYA 1NRPH 3A82A 5C20A 2BVXH 1P2QA 1GJ4H 1C1RA 1UK4A 2M2AA 5GCHG 2J38A 1SLWB 3ZZAA 1G2LA 4I32A 4H6SB 1DWEH 4Q80A 4FOUC 5EJZA 1Z8IB 1AKSA 1GHAF 1CO7E 4LZ4B 2KAIA 1RXPA 3JZ2B 3M3SA 2FTLE 1UW7A 5KGOA 1QNJA 1UTOA 1G9IE 2TIOA 1GCTC 2W6ID 4CRGA 3SUEA 2HVYB 3GCTF 4MNXA 1UTMA 5HMAA 1EUFA 4VGCC 2F83A 3P95A 2Z94A 3EA9A 3TU7H 3DSGA 2JIZD 3KL6A 3SV7A 3SW2B 2A4QA 2GV6A 4GPGA 5FPSA 2QF3A 1OP2A 2G81E 2SGDE 3C1KA 2Z9GA 1C5PA 3KEEA 2ALVA 2V6NA 5FCRA 3RU4T 1L1JA 4D76A 1J8AA 4X1RU 4CBOA 2K0QA 3OEED 3SUGA 2ZGXH 1S82A 2GCHF 5DK1A 3RXHA 3MNXA 1F2SE 5DP4A 5DP8A 5A09A 1O2LA 1H8ED 3BTGE 1TLDA 4FVDA 3S7KB 1QZ8A 3K6YA 1GJBB 1RTLA 2W3KA 3RXTA 2PGQB 3LH1A 4ABEA 2WSSD 3ZZ5A 1P3CA 1C2KA 2KCPA 4OS5A 5F8XA 1INCA 1MTNB 2JETC 1D3TB 1AY6H 1RIWB 3M3TA 4RT1A 2QCYA 1ZYOA 1BMLA 4E7RG 2WPHS 1L2EA 1E34B 2P59A 3GYMA 2Z9LA 6CHAC 5B6LA 1HB0B 1LMWB 2WV9A 4BXWA 1HIAB 1K1NA 2FOMB 4ABIA 1D3DB 1UCYH 1MKXK 3RXJA 4NA7A 4ABFA 1A0LA 1BB0B 1WAYB 3OU0A 2QIQA 4A5TS 1GMDF 2W5EA 2ZO3H 2BDAA 1AO5A 1C5XB 5EPNA 1ZZZA 1ELFA 1FONA 1P10A 4P02A 3LJJA 4DG4A 3OX7U 1C5NH 1OYTH 3QLPH 1WYKA 1O2JA 1O39A 1UK3A 3CS0A 4CRAA 2PKAA 1C5RA 2VIWA 3FVFB 1OWJA 3A84A 2Q6GA 6GCHG 2TRMA 4IMZA 1RS0A 5PTPA 4B75A 3A7ZA 1B0EA 5DP6A 2A5IA 3AK5A 4ESTE 3SU5A 2A7JA 2YOLA 3MTYA 4NZLA 1HAXB 3D65E 3V7TA 1G3EA 3O8BA 1NFUA 4XOJA 3NK8A 3T62A 4FUGA 1BOQA 3FP6E 1V2RT 1G36A 4Y71A 2XBYA 1W0KD 2H1UA 3RUOA 1HAVB 5E8EH 5A0BA 2F3CE 3BTHE 3S9AA 3VFEA 2FTMA 4I7YH 4Q2KA 4WH8A 1WTGH 2KR7A 1SLUB 3KQBA 3MO6A 4NA8A 1O3IA 5EQRA 3PMHB 3O8DA 2UWOA 3SZNA 1JRTA 1HDTH 4I33A 1KY9A 4YT7H 2UUFB 3U1IB 4IN1A 4WH6A 5HM9A 1SQOA 1SGIB 2GMTC 1DLKB 1Y3VA 1FY5A 2ZGJA 2OP9A 4RT0A 3TH4H 1Z6JH 1EAIA 2EI8A 1UVUH 2BLOA 1QHRB 3MH6A 2V3HH 1XMNB 2F9NA 2C4FH 4B1TA 1UVTH 5GIBA 1CBWC 1LPKB 4IMQA 2FO9A 5CHAB 1ELAA 2HLCA 3MNBA 1H8IH 2OK5A 1DXWA 1U6QA 1LHEH 2BZAA 2FYQA 1EAUA 1B7XB 1W0YH 4JCNA 1E79D 5ESTE 3WWFA 2O8TA 2RA0A 4UFFH 5LPRA 3GY3A 4GAWA 2XNIA 1BITA 2JH0D 4F49A 1BRUP 2B5TB 1O2KA 4JZIA 4H4FA 1YLDA 1RTFB 2ZQ2A 1RJXB 3RXDA 4JZDH 2W26A 1NFXA 1BTPA 2ODPA 1FY1A 1C1UH 1LKBA 4XSKU 2IJOB 1YC0A 3PMBB 1AWHB 2ZG0H 3RM0H 1UTLM 4K1EA 3P92A 1Z8RA 1NFYA 4XD7D 1GBHA 1UTKA 1SFIA 3W95A 1V3XA 2OC1A 2ANKH 1N6XA 4LXBH 4IC5A 1LVOA 2P93A 3A80A 1LHDH 3QTVH 3RXOA 1ZOMA 3RXUA 3AW0A 1SPJA 1ZGVA 1LCYA 2F9OA 2PTNA 3BG4B 3A89A 1UK2A 5C5NA 1FY3A 2OQ5A 4DY7B 1Y5BT 1UTJA 1E38B 3F9HA 1SGQE 1QIXB 1QJ1B 2NU4E 1OWHA 4RSPA 2NU0E 1ZJKA 1VZQH 4AORA 2M5TA 4AGKA 1NROH 4O97A 1MTSA 1O3BA 1XUKA 1ZRKA 4UFEH 5C67A 4IGDA 3B23B 5F53A 3SHCH 1MKWK 1C1SA 2Y82A 4NFFA 5A8YA 1GBCA 3P70B 4D9QA 1SR5C 2Y5HA 2WUBA 4WF8A 5T6FA 1FMGA 2CF9H 3GDVA 1MCVA 1SC8U 4ZHAA 2XTTB 1YPJH 1F5LA 4U2WA 1W10U 2VWLA 1GJ7B 1DOJA 1IHSH 2ZU1A 2Y80A 3UOUA 1YCPH 2GD4B 1DITH 2FOGA 1L1NA 3E90B 4U01A 2AIQA 1GL1A 2PR3A 1GJ6A 4ZUHA 2EI6A 2FOFA 1KXBA 3F2GA 3SNDA 2PGBB 3OFND 2ZTYA 2QF5A 1XUHA 1Y3UA 3GDSA 1ETRH 8KME2 4ZH8A 1K1JA 1CA8B 1C5OH 1NM6A 4ZXYH 1H1BA 1BTYA 2ZGHA 1TNIA 2HRVA 1KMHB 1V2ST 2Y81A 1GDUA 1H8HD 2W7UA 1S85A 1TPSA 2AMPA 3RP2A 1C5UA 3RXLA 4ZKOU 2ZPRA 1D6RA 1BA8B 2FX6A 3DFJA 1CA0B 3ENSB 1O3JA 1AIXH 1FQ3A 1GMHG 1QL8A 2V3MA 1ANDA 3H7TA 1O5DH 5HKKD 3RXCA 1ZHPA 1O2NA 3BSQA 1LKAA 4IS5A 4WMFA 1EZXC 3MO3A 1DSTA 4XFQA 5TCCA 3S9CA 1TBZH 2WV4A 5I25A 5ESBA 2KCAA 4GSOA 1CVWH 1QFKH 4I8HA 3O8RA 4ISHH 3VB6A 4GUXA 4QT8C 1XVMA 4X1QU 2AHME 1LQDB 3L3TA 3BV9B 1ELVA 3GCHC 4ZHLU 3SJKA 1XVOA 3T26A 1THRH 5GJ4B 4AG1A 2ZHQH 4GCHG 5A0AE 4OS4A 1ANCA 4X6PA 3SV2H 1O31A 4AB8A 2AERH 1BHXB 4F48B 1C2GA 4X8VH 2FI4E 2KX4A 1QR3E 1KLJH 2J9NA 2A0QB 2P8OC 4Y7BA 1TMTH 2A7CA 2WZQA 1A0HB 3RLYH 3EA8A 1TNKA 1AVGH 2FXRA 4XE4A 1J14A 1W14U 2ZP0H 3V12A 3M5OA 1T31A 4GLYA 1MU8B 1ZSJA 8GCHG 3QDZB 1NRNH 1BTHH 4NIYA 4BAOB 3S69A 3T27A 2WPMS 3WW7A 2J94A 1KXDA 4KTUA 1KDQA 1ZTJA 3FFGA 2JJ1D 2B8OH 2CF8H 2XWAA 3R0FA 4WJG2 2PKSC 1G37A 2BD2A 1BIOA 3A8AA 1BMNH 1K21H 3SYJA 1DWCH 4FUDA 3NKKA 1TIOA 9ESTA 3A7XA 2OBOA 3ZZCA 2P3TB 4MPVA 1T8LA 3A7VA 4IBLH 1GDNA 4BANB 1S0QA 1Y3YA 1GJCB 1H9LB 1SLVB 3AVZA 3QN7A 4LK4A 1C5VA 1P3EA 2GX4A 3RXVA 3BEUA 4B2AA 1RFNA 3RXSA 4BNRA 1K1OA 1GVKB 1IQHA 5EGMA 4OS2A 5F8TA 3TJUA 3SZEA 4FVBA 2F9VA 1GCDA 1C1VH 5DP7A 1IHTH 3OTJE 2YMSC 1ANEA 1L1GA 1NRRH 1BBRK 1P03A 1V2VT 1QA7A 1O2QA 1C5WB 1SGRE 4FU8A 1QBNA 4YXWD 3S0NA 1C5YB 3PO1B 2HVXA 2F9BH 2LNCA 4I8JA 2H9HA 1V2KT 5EJLA 4CREA 1EPTB 1KXCA 4TYDA 3B9FH 1VJAU 1TX8A 4FXGH 2RCEA 2XXLA 3MU1A 1YPLH 5AFZH 5HM2A 3TGIE 3GY4A 1O2MA 2G4UA 2OD3B 4GHQA 1SQTA 2TPIZ 1CSOE 1K1PA 1S84A 1ESTA 1O3FA 1DANH 4INHA 1WU1A 3F6UH 2SFAA 2RA3A 3DUXH 3RXKA 4M9FA 5JYIA 3EDXB 3K65B 4O3TA 3BEIB 1QBOA 2J98B 2VVCA 1KLTA 1X7AC 3GOVB 2VVVA 3RMMH 3UIRA 1SQRA 2DE8A 1AN1E 4AOQA 1JXPA 5C2ZA 2H2ZA 2ZKSA 1AZ8A 4R8TB 2PP6A 4A6LA 1J9CH 2A2QH 1P9UA 1FPHH 7GCHG 2BY8X 3A83A 1WBGB 3BTTE 1HIAA 1KSNA 5BPEA 1FLEE 3ZZ4A 1GGDB 2ALPA 2ZDMA 3C27B 2HLDD 4MPXA 1O2GH 4Y6DA 2XBXA 2VINA 1HJAB 1A3BH 2FOEA 2XNDD 4CHAC 2BOHB 4KTCA 2J2UA 1QQ4A 1QGFA 2NU1E 4HZHA 4X6NA 1HAHH 3DFLA 4AB9A 4H6TA 5DGJA 1YBWA 1SGFA 1SGYE 2QY0B 1G3DA 4E06H 2PLXA 1NY22 1H4WA 2VB0A 4NWLA 3R3GB 4UFGH 4GHTA 1MBQA 4CRCA 1JRSA 1BJVA 2BZ6H 3P8OA 3HPTB 1TA2A 3K9XB 1QRWA 2GTBA 1MZAA 3LGTA 4ISNA 3LU9B 1ZHMA 2FOBA 2QN5T 5FX5A 2WHXA 1FY4A 2J95A 1L4ZA 2STBE 4BAHB 2OLGA 3VB4A 1DUEA 5C1XA 3V13A 3SNAA 3E0PB 3E0NB 4K60A 1ESAA 2QF4A 4E05H 4FUCA 2CJIA 1HAVA 1NPMA 1AUJA 4WXVA 1TNLA 4B76A 1A5GH 3DSOA 3TK5A 1HNEE 1C9PA 5FBEA 5FHTA 3MNCA 1QRXA 2BY6X 4NWKA 3URDA 1W2KH 1P12E 1L4DA 2BD3A 5E2OA 3GY6A 2WINI 2WPIS 1EP6A 4ASHA 1OYQA 4FUHA 1QQUA 2QXGA 5FX6A 2QXJA 4UEHH 1SGTA 1UHBB 3E16B 3IWMA 4DT7B 3UTUH 4MTBA 3PRDA 2B9LA 1ELTA 2ZFFH 1CT0E 5FCKA 4ABBA 4B6EA 3OY5U 2AFQB 1CE5A 1CGIE 1EB1H 1S83A 1AB9C 1BBRE 2C8WB 2A1DB 5EIYA 4VGCB 2IN2A 1UCYK 1TRYA 1DY9A 2Z6BD 2BQ7B 1GI7B 3FN8A 3OAAD 3P17H 4OGYA 1GJDB 2PTCE 4WY3A 3A7WA 4FUIA 1EATA 1V2OT 1EKBB 1BRCE 1T7CA 6GCHF 2PSXA 2BD9A 1UVPA 1P11E 4LZ1H 7KMEH 1XX9A 1JMOH 1Q2WA 2OQUA 5F03A 2Z3EA 4YO9A 1QL7A 1PQ8A 2ZPQA 1K0HA 4YLQH 1MZDA 1RRKA 4AZ2B 4E7NA 1GHBF 1Z8JB 3LH3A 1ETSH 2VVUA 5EG4A 5C3NA 1HUTH 1VITF 1SQAA 3T2NA 2QAAA 1FIWA 1QRZA 2ZQ1A 3T25A 3PWBA 1O2PA 4Y76A 2FOHA 4CR9A 1VR1H 2W6JD 1PPHE 3KHVA 5KECA 2BLWA 1TGBA 3RC5A 2Z9KA 2JETB 5JDUB 3BN9A 1PQ7A 1Y59T 3RU4D 2ZFSA 4JMYA 2GCTC 3SJOA 3VPKA 1E36B 2HNTE 2PWXA 1NTPA 2AYWA 2VU8E 5FPTA 6CHAB 4AFQA 1DX5M 2ZZUH 1C5ZB 2FLRH 3UQOA 1EXFA 2BDHA 5L30H 2XBWA 2DE9A 3CP7A 1ZTKA 2VIPA 2ZDVH 1GI9B 1DUAA 5H4IB 1LPGB 3U8RH 2F9UA 2FPZA 4ABGA 3LDXH 1DSUA 2KFWA 1EASA 4ZKRU 3OYPA 2BQWB 3L33A 4R0IA 3RXQA 3ZIAD 4B6FA 5J4SA 1HGTH 2R0KA 2ZNKH 4DVAU 4YM9A 4HTCH 3Q76A 3UREA 1GHAG 5A8ZA 3E91A 1N6YA 3SNEA 4MNYA 4MVNA 5JBAS 3TNTA 1GVZA 4P00A 3NPSA 2G55A 2ZEBA 3UNRA 1HLTH 1JIRA 2FZZA 1NN6A 1O2VA 3AAVA 1SGPE 1W8BH 1GHZA 3GCTG 3VB7A 3ZYDA 3A8CA 1NC6A 4ZAEA 3T5FH 2EA3A 3SQHE 1KTTB 1O37A 1TGCA 1O3NA 2BDIA 2ODYB 3N7OA 1Q3XA 1MUEB 2G8TA 5AHGH 1C2LA 1C2MA 3KNXA 4X2YA 4LOYH 4I8GA 2XW9A 4HGCA 1GG6C 1MABB 3NZIA 1YKTA 1WOFA 2H9TH 3KQEA 3F3BA 1OHHD 2EI7A 1HJ8A 3ESTA 1H9HE 3LJOA 3TVJB 1GJ8B 4DCDA 2KCYA 5DN6D 3M7QA 4X6OA 2GCHG 3RU4E 2HPPH 4O9VA 1E0FD 2ZHFH 3TJNA 2GMTB 4AYVB 2TGTA 2XCFA 2KCOA 5E0HA 2XC4A 3SV9A 5EPYA 3TH2H 1PPGE 1D3PB 2OCVB 1CBWB 1XUJA 2G51A 4JK6A 1C1WH 1SKYE 3BTFE 1N1LA 1O3HA 1ARBA 1NBMD 4HI3A 1F0SA 1EOLA 5FPYA 1LO6A 4KP0A 2Y7ZA 3EE0B 4K8YA 2D2DA 1WXRA 3PMAB 1SB1H 1K1IA 3U28C 5L2ZH 1AE8H 3Q3YA 2NU2E 1V2PT 2TGAA 3ZV8A 4INKA 2QE7D 5E0JA 5K0HA 1IQIA 1TX7A 4MDSA 1IQGA 1P2JA 4WWYA 1BMFD 1PYTD 5JBBS 5C5OA 3PROA 1PPFE 5A0CA 1TGSZ 3GDUA 4B2CA 3STJA 2VH6A 2LELA 1F0TA 2Q6DA 1AKSB 1UCYE 4Q7XA 2D8WA 3HGPA 1GMDG 2KAIB 1UJ1A 1GJ5H 3BTKE 3SUDA 2Y6TA 4BAQB 2OINA 1DT2A 3PTNA 1G3CA 1FN8A 4DJZB 2XBVA 2BLVA 1YCPK 3PLBA 4K2YA 3MWIU 1CT4E 4GVUA 2ZHDA 3NUMA 1C4U2 1VGCC 1BTZA 1YWUA 4SGBE 4YOJA 4DOQA 2WV5A 2AS9A 2BD8A 1QBVH 2QXHA 1SFQB 2L74A 4A1VA 1O35A 2A31A 2QXIA 1W7GH 2AMQA 1OWIA 4NA9H 3SUFA 2IPHA 1QB1A 4XBBA 4UDWH 1TABE 2BTCE 2HALA 4ZROA 4DIHH 3TK9A 2C90B 1S81A 3PM3A
chains in the Genus database with same CATH topology
1C2JA 2ZTZA 3GCNA 1G2MA 2NU3E 3ZVEA 4AFUA 3TGJE 1UTQA 1LQEA 3NCLA 1SGEE 2QA9E 1EZQA 1AWFH 1FIZA 1IQFA 4WMEA 3SU1A 1FXYA 2FM2A 3U98H 3FP7E 1ABIH 1ELBA 1GI0A 1SMFE 3ZZDA 2GZ9A 2GDDA 4BTTB 1LHCH 3GCOA 2JH5D 3MH4A 2BDBA 4UD9H 3EGKH 4I8LA 4WMDA 1WCZA 2UWLA 1NRSH 2QV1A 2ZU2A 3L6PA 3OSYA 1ZMLA 5AF9H 3BEFB 3H7OA 1RD3B 2VNTA 3KF2A 1EPTA 3A81A 2UUJB 3MU8A 1TBQH 3SBKA 1MCTA 1TGNA 2FESH 3ATWA 2VGCC 5CMXH 8GCHF 2C8XB 1O5CB 1TPPA 2PKAB 2UUYA 5G4BA 1O36A 3H5CB 1WQSA 1O30A 1TE0A 2FX4A 1FN6A 1OOKB 3U69H 1DPOA 2BLQA 2OXSA 4IN2A 1C1PA 3Q00A 1VJ9U 1HJ9A 3VGCC 4JZEH 1NRQH 5EU8A 3RXEA 2BD7A 5T6DA 3GCHB 1ZRBA 1N8OC 1ZMNA 3BTME 3LONA 4O03A 3UWIA 1O2XA 1RGQA 1ZPCA 3I29A 1CQQA 2ZU5A 4OS6A 1OSSA 2A5KA 2P95A 3M61U 6LPRA 4FU9A 1T8MA 2AGIX 1ELGA 4K5ZA 3A7YA 1O2ZA 1P09A 3ODFA 2GP9B 4XBDA 5CE1A 1MAYA 3GY8A 5B6OA 4X2WA 3BTDE 1ANBA 1CT2E 1PPEE 1C9TA 1YLCA 1B5GH 1F7ZA 2CHAC 5FAHA 1HBTH 1HAOH 1GBTA 3SNCA 1HAYB 4UFDH 1GMCF 2O8MA 1FUJA 3LGVA 1GHWH 5LPEA 4AFZA 2FDAA 3ATLA 1AUTC 3MU0A 1TBRH 4J1YA 1FY8E 3ZZ3A 2BDGA 4AG2A 1AFQC 1QJ7B 3PLKA 4DIIH 1ZMJA 1TMUH 4AX9H 3HKJB 3TJOA 4AGJA 3GY2A 4K1TA 3P8GA 1SOZA 1ETTH 3Q77A 4YLUA 1QCPA 1ARCA 1KYNA 2ULLA 1W11U 2QYIA 1ORFA 1CHOF 2HPQH 5DG6A 1BUIA 2B0FA 4OS7A 3GY7A 1NO9H 1PQAA 3NWUA 3RC4A 1FDPA 1YM0A 3RC6A 4TY7A 3SGQE 1LVBA 3UNSA 3ZZ8A 1XXDA 3QWCH 1XUIA 2Z9JA 2XC0A 2ZU4A 2ZHWH 1YPHC 5T6GA 5GDSH 1GI1A 1C2FA 1V2UT 4Q7YA 1O2IA 4Y0YE 1O3AA 1K28D 2WYJA 2ZCLP 5EXLA 1P2IA 2R2WU 3VB5A 3PLPA 1D4PB 1FNIA 2AGGX 1GBEA 1TB6H 1FAXA 1ZHRA 3TK6A 1TRMA 1JIMA 3SI4H 3TIUA 2TBSA 3BTWE 3T29A 3U8OH 1QJ6B 4Z6AH 3MFJA 5EW2H 3ZVCA 1C5TA 2BXTH 1ZSLA 3ATIA 2H5CA 3M37A 1GBIA 1TQ7B 1Y3XA 3SI3H 1HV7A 1O3LA 2FIRH 1Y8TA 2VWNA 4NZQA 2BB4A 1HYLA 3DHKH 2AMDA 3V3MA 1GWAA 3PO1C 4A92A 3LC5A 5EQQA 2ZDNA 1K1LA 1SVPA 4X8TH 5ABWA 3Q3KA 3FANA 2G5VA 1DWDH 2BY7X 1THSH 3RDZA 3HK6B 2ZPSA 3GICB 1V2NT 1GI3A 2BOKA 1SHHB 4D7FA 1EAXA 2ZFPH 3ELAH 2A32A 1Y5UT 3MU5A 1THPB 2YNAA 3ATKA 1OWEA 1BTUA 4MLFB 1AGJA 1GI8B 1ZPBA 1T8NA 3LGIA 2VIQA 1OP0A 1TOMH 5GCHF 1W3CA 2BDCA 1AVWA 4I8KA 1NS3A 2A2XH 3UQVA 1YPMH 1FAKH 4CHAB 3MOCA 3SU2A 4NIVA 3E8LA 2FP7B 3ZZBA 1XM1A 1GI2A 2BHGA 1O3DA 1WTHD 4FUFA 3SU4A 1XXFA 3RLWH 1D6WA 4B73A 5LH8A 2VWOA 1O5GH 2C8ZB 1SOTA 2BXUH 2Y5GA 4X6MA 1DM4B 2ZI2H 4H42U 2PUQH 3ZZ6A 1GBJA 1O32A 3E6PH 1UVOA 3SJIA 4K69A 5GPIB 1V2JT 2XCNA 4MNVA 2H6MA 2F9PA 3UOPA 3SGAE 1JBUH 1SGFG 1V2TT 4OGXA 5A8XA 5DP9A 3D23A 4X8UH 4CH2B 4SGAE 3RMLH 3TNSA 4A1TA 1BRBE 4CRFA 1KIGH 2ANWA 2C3SA 3VB3A 3MHWU 3NXPA 4NCYA 1P9SA 3SU0A 2Z9IA 3OY6U 3E3TA 2ESTE 1AMHA 4ABJA 3GY5A 1OS8A 2ILNA 2VIDA 3FZZA 4CH8B 3RXMA 2GVFA 1GDQA 3PB1E 1F0UA 1O5AB 3IITA 1ELDE 2ZF0H 3KQDA 2BD4A 1P8VC 2R0LA 1G30B 3P6ZB 3PV4A 1NESE 4CRDA 1T8OA 2TGPZ 1NZQH 1KDQB 5SGAE 2OC8A 4M7GA 1HAZB 3TITA 5C1UA 1YYY1 2BMGB 4THNH 4K3JA 3MH7A 2O8LA 1Q31A 1W13U 4YT6H 4NIWA 1FZZA 1C2DA 3KGPA 1GBBA 1OWDA 1TA6A 1LPZB 2ZFQH 4Q7ZA 3SU6A 2TGDA 4B2BA 2OBQA 1AB9B 1GCTB 5DO4H 1DXPA 1GJAB 1HXFH 3VXFH 3PWCA 1TGTA 5JB8S 2P16A 3SGBE 3UR6A 4AFSA 4AN7A 1GBLA 4HFPB 1AHTH 2VIVA 5EODA 2J92A 2WPJS 5GXPA 1T4VH 1IQEA 2ZFRH 1QTFA 2WPLS 2BY5X 1O38A 3STIA 1GBFA 1KLIH 1MQ5A 1HRTH 2WUCA 2ZIQH 1OPHB 3RXRA 4TPIZ 4ZXXH 3LT3A 1Y5AT 1BZXE 2PV9B 2ZGBH 1P2MA 6ESTA 4TWYA 5GWZA 1K22H 1LHGH 3BF6H 1P2NA 1ESBA 4BOHA 3RXAA 1FI8A 2CMYA 2XWBI 2W3IA 2CN0H 2THFB 2B7DH 2GCTB 1CGJE 2FYRA 4XDEA 4ISLA 3ZZ7A 4B74A 1BT7A 4IC6A 1B0FA 1O3MA 1K2I1 2FWWA 2Z7FE 3F1SB 1BDAA 3CENA 1P05A 5ETXA 4MNWA 2VIOA 1Z1IA 2V0BA 1BTXA 1V2LT 3UWJH 1T4UH 1GBMA 2P3FH 1QURH 2ZTXA 3MO9A 4YOGA 1C1TA 3TGKE 3SN8A 3QTOH 1O33A 4KTSA 1DFPA 1SGCA 3I77A 1O2TA 2ODQA 3ZVGA 3LIWA 2Q1JA 1P06A 2LPRA 1TQ0B 1TPOA 4J2YB 1T32A 1MTNC 1D9IA 3HKIB 2ZCKP 1C5MD 1DWBH 1BHXF 1WV7H 4ISIH 1RIWC 2NWNA 5E0GA 1QA0A 4BAMB 1E37B 1A5IA 3M5MA 2ZCHP 1SG8B 1O2RA 3AAUA 4UE7H 1EB2A 1GHVH 2HGTH 1V2MT 1QB9A 1O2HA 3DA9B 4CBNA 4X2XA 1G3BA 2Z3CA 1A7SA 3A87A 2Y5FA 2ZFTA 1TMBH 2OUAA 1IQMA 1JOUB 1H9IE 3KN2A 4B71A 1EJNA 1A5HA 3WY8A 1W12U 1GG6B 1TFXA 5JBTA 1ZR0A 4K8BA 1DY8A 5IYTA 2F91A 1SSXA 1AU8A 3LPRA 3SOSA 4FU7A 4AYYB 4DW2U 1O2YA 1QB6A 4RN6A 1ZTLA 1S6FA 3PTBA 4Y79A 3SJ8A 1F5RA 1Z6EA 4YOIA 3SHAH 2ZDKA 3QGNB 2ANMH 5AVDA 1GHBG 2QF0A 1J15A 1O5EH 1VITG 4JYTA 3ITIA 3M7TA 2R2MB 4OS1A 1EJMA 2ZHEH 1GI4A 4WXIA 2SGEE 1J17T 1Y3WA 2R3YA 2SGPE 3G01A 2BM2A 1IAUA 1YPGH 7ESTE 1P02A 3RXGA 3U9AH 5AFYH 5DP5A 3T28A 2FI3E 2DUCA 1MKXH 1P04A 1BRAA 1VCPA 2V3OH 3A7TA 3HATH 1OWKA 3M35A 5L2YH 1MD8A 1O3PB 1UVSH 4KELA 3EQ0H 4FUJA 2BX3A 2GGVB 2AIPA 2I6SA 5C1YA 1KXEA 4Y7AA 1UO6A 4PROA 2ZU3A 1XKAC 4BTIB 1YF4A 3RM2H 3V0XA 1PYTC 3SORA 3LOXA 4NSVA 5EQSA 1GVLA 1O5FH 1MD7A 2K1QA 1A4WH 1TAWA 1GBKA 1S6HA 1AVXA 1P01A 5CHAC 1O2WA 1EOJA 3MH5A 4F4OC 1JWTA 3ZYEA 4MG3A 1V2QT 3QUMP 5HYOA 1VGCB 2Y7XA 3MI4A 1NT1A 3Q3XA 3ZZ9A 1WUNH 2GT7A 1KTSB 2JKHA 1ZLRA 1EP5A 1GHYH 1KXAA 1Z7KA 2D26C 3SV6A 1TWXB 5HGGA 4DGJA 2FS8A 4TY6A 4ISOA 1TONA 3EYDA 1EX3A 1P2KA 1MBMA 4WVPE 1MTWA 1XUGA 3ZVBA 4Y0ZE 2OTVA 1NFWA 1H8DH 4FUBA 3I78A 1GMHF 4BXSA 2O8WA 4Z0KA 1YPEH 4NIXA 1P0SH 5JBCS 1AFEH 3TJVA 1DICA 1YP9A 3FZDA 3MYWA 2FLBH 2O9QA 1OP8A 1PPZA 3QZQA 2PHBA 4BTUB 3VXEH 5J4QA 1XKBC 1PPBH 3LC3A 2C8YB 2A4GA 5F8ZA 3GISB 5L6NH 3TPIZ 1O5BB 3MU4A 4K1SA 3BG4C 1O3KA 1FV9A 5EW1H 4GCHF 2XC5A 4MPUA 2C93B 1L0ZA 3DT0H 1GJ9B 1C1NA 3SJ9A 1PPCE 1QY6A 1DVAH 1TOCB 5IDKA 1MTUA 2RG3A 3U1JB 2QC2A 1IQNA 1J16A 1GI5A 3BIVH 3F9GA 2RDLA 3VEQB 1C5QA 2A5AA 1S0RA 3BG8A 3AW1A 4INLA 5T3HA 1LTOA 2SGQE 3QK1A 2VGCB 1ZPZA 2CGAA 5I46H 2A4RA 3QX5H 1SI5H 2YNBA 3FP8E 5DP3A 3UR9A 3ZVDA 3A85A 3KQCA 5HXFA 2XRCA 5LPFA 1IQLA 2OC0A 1C2EA 1GPZA 4Y8YA 1DDJA 2HNTF 3SQEE 5F6MA 3P8FA 5EXMA 2HWLB 1M9UA 1C5LH 3TH3H 5BRRE 3CS7A 4X8SH 1A3EH 1GHXH 3VGCB 2FODA 4YTAA 4A1XA 1SHYA 3EA7A 3BIUH 1SBWA 2ZC9H 2A45B 3KIDU 1VITH 3RXBA 1A0JA 1N8OB 1WQVH 2O8UA 2BY9X 1A61H 2BYAX 1SGNE 4X1NU 1UTPA 2PFEA 2XYAA 1V6DA 3A8BA 3SV8A 4D8NA 1TPAE 4MQAA 2FOAA 2W7SA 7LPRA 4D9RA 1P57B 1MKWH 5DJ7A 3K2UA 8ESTE 1CA0C 1EZSC 4NSYA 3A88A 2ZDAH 3GYLB 1UTNA 3HGNA 1GI6A 2P8OB 1Z1JA 2CXVA 2VH0A 3A8DA 4ZHMU 2FI5E 3MNSA 3JZ1B 1AQ7A 3ZVAA 3LKWA 1PFXC 2CHAB 2PW8H 2UUKB 1RTKA 2A4OA 4ABHA 2P94A 3S9BA 2WYGA 3UNQA 4FUEA 2PSYA 2VWMA 1K9OE 1DLEA 4NFEA 4UONA 1CGHA 1TRNA 2ASUB 1TYNA 2SGFE 1AFQB 1O2SA 1A2CH 4ABAA 4RKJB 1AD8H 1C2IA 1C4V2 1MMJN 2VJ1A 5FXLA 4X2VA 1ABJH 2HOBA 2PKSB 1F92A 3M5NA 3RMOH 1IQKA 1XUFA 1MQ6A 1IOEA 4Y11E 1O0DH 1SLXB 4XBCA 2AH4X 4U32A 1P2OA 3LGYA 1HAIH 4CRBA 2ZDLA 2GDEH 5DKMA 1D3QB 9LPRA 1BJUA 2GZ8A 3UFAA 3S7HB 1LVYA 1MU6B 4A7IB 3M3VA 2H5DA 3EAJA 1TX6A 3W94A 1UMAH 2G00A 1UHBA 2G52A 2SNWA 3MMGA 7GCHF 1BTWA 1Z8GA 1YPKH 1S5SA 1GBDA 3K6ZA 4U30A 3UPEA 1BMAA 1QL9A 1C4Y2 1SL3A 2WPKS 2G4TA 5LGOA 3D62A 1G32B 2A7HA 3PYHA 1O3OA 2ANYA 4NG9H 1AZZA 3BTEE 1TALA 3RMNH 1MH0A 2BVSH 2GV7A 1DE7H 1A46H 2JH6D 1EJAA 4RKOB 4Y8ZA 1C1QA 2PUXB 3RXPA 3PMJA 5K7RA 2D1JA 2AEIH 4NGAH 3F9FA 1EAWA 1ID5H 4Y8XA 4ABDA 3AASA 2EEKA 4KGAA 3P8NA 2ZECA 4O3UA 3HK3B 2P3UB 4YESB 2GZ7A 2V35A 2BQ6B 2ZWLH 3BTQE 4Y10E 1WSSH 3SU3A 1GMCG 1OXGA 2FOCA 4JYUH 1W0ZU 2GT8A 2SNVA 1KXFA 3QZRA 1EPTC 2J4IA 1OX1A 2R3UA 3RXFA 3QO6A 5EOKA 5TJXA 3URCA 1FJSA 3U8TH 3QGJA 5DPAA 3SO3A 4X1SU 1GBAA 4YZUA 1A1RA 1C1OA 1MTVA 4ZKNU 1ZJDA 2J34A 1HAPH 1CHOG 2CV3A 2STAE 4ZKSU 1LVMA 1NU9A 3FAOA 3D49H 3B8JA 1DS2E 1HPGA 3F68H 2G5NA 2IOTA 1LHFH 3SNBA 1VCQA 1O3CA 1K1MA 1PQ5A 1ACBE 2QGRA 1HXEH 5EXNA 1E35B 1BBRH 4CR5A 1BCUH 1FPCH 4MPWA 1YPHE 2GKVE 4TWWA 2EC9H 3TLOA 5A2MH 1O2UA 3ZV9A 1C2HA 4BAKB 1ZSKA 4DURA 4I31A 1GGDC 4IW4E 2Z3DA 1F0RA 1BMMH 1LDTT 4KKDA 1W7XH 1O3GA 4ZMAH 3RXIA 1HJAC 1IQJA 1BQYA 1AE5A 2BDYA 2R9PA 1F5KU 5JPMH 3M5LA 1EZUC 1SGDE 5TCAA 2Q6FA 1TNGA 1CU1A 2FMJA 3A86A 3F9EA 1YGCH 4JZ1A 1HCGA 3E1XB 1MAXA 3ATMA 4X0WU 3DD2H 5E2PA 1TNHA 2UWPA 3LGWA 2FEQH 1O3EA 3M7UA 4D7GA 4JZFH 1YCPM 2BX4A 3ODDA 2SGAA 4JK5A 2FS9A 1PJPA 4X1PU 1EQ9A 1CHGA 3IG6B 2H9EH 2OC7A 3ZVFA 3O8CA 2AGEX 2ZGCA 2HNTC 1O2OA 4JYVH 8LPRA 3UY9A 2BVRH 1V2WT 5JB9S<