4AG1A

Human chymase - fynomer complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 53
structure length 221
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A02
1DXWA 1H8DH 3BTWE 1QL9A 4RKOB 3A7YA 4HFPB 3SW2B 3I77A 1IQJA 1DWBH 4AFZA 1P2OA 2GCTB 4XBDA 1SGEE 2J38A 3KQEA 3RUOA 1DLKB 5ETXA 1C5VA 1O2VA 7LPRA 4GPGA 2HGTH 1TMTH 2A5IA 1CT0E 2B5TB 4AN7A 2Z9LA 4H6TA 2ZHFH 4WVPE 1QRWA 4MPVA 4NG9H 1PPGE 5ESBA 5E2PA 3SNEA 3GY4A 4JMYA 2PKAA 1AHTH 3GY6A 1YKTA 1TQ0B 2BDHA 1GJ4H 5GCHG 4IW4E 1MZDA 2R3UA 4MLFB 3SU3A 1DS2E 3ATIA 2AIPA 1A46H 2ZP0H 1O2HA 4AZ2B 3RP2A 1JBUH 5EXMA 9ESTA 1E37B 2VVCA 4GVUA 3VXFH 5A2MH 1SPJA 1ANBA 1EZQA 4U2WA 1SGNE 2CHAC 1IQHA 3NPSA 2FOCA 3URCA 1Y8TA 1GHBF 3RMOH 1AU8A 3VEQB 3V0XA 1DANH 1Q2WA 3C1KA 3T2NA 2RG3A 1O2LA 2O8LA 2BD4A 2J92A 3A8AA 1MU6B 1H4WA 1GJDB 5A8ZA 1L1JA 2PUQH 1GBFA 5TJXA 2G81E 5DP9A 1MTWA 1Y3WA 3MO9A 1TONA 1KXBA 3GCTG 3BEIB 2ANKH 3AAUA 1TBRH 2PW8H 2D8WA 3RLWH 3MMGA 1TIOA 3SHCH 2CHAB 2GZ9A 2BTCE 1SGFA 1GJCB 2EEKA 1AN1E 4U32A 4WMEA 1QR3E 1FY4A 2C4FH 1GL0E 5A8XA 1GJBB 1HJ8A 2P8OB 1GL1A 2G8TA 3MNSA 2FDAA 3GY3A 1INCA 2XC4A 2BXTH 5DP4A 4AFUA 4H4FA 2BD2A 1DE7H 5T6DA 2CV3A 3ZZAA 5C20A 2A4OA 4K3JA 2Y7ZA 3LH3A 4NZQA 3SJ8A 4DOQA 4UD9H 3SV2H 2P16A 4X8UH 1GMCF 1QB1A 4FUDA 1KXEA 2VGCC 3MNCA 1T31A 2GGVB 1A0LA 2FOGA 1O38A 3U8OH 3EA7A 4R8TB 3RXUA 3QZRA 1DFPA 1DICA 2P95A 1GDNA 2ZHDA 3F68H 5T6FA 3QK1A 1CQQA 5AHGH 4UFGH 3KHVA 1IQNA 3RLYH 1MCTA 1BTWA 3KF2A 1S84A 3A7VA 3F9EA 2G52A 1O5AB 2ILNA 2BX3A 2CGAA 1GG6C 1EPTC 1J8AA 1Z8GA 2O9QA 4WH8A 2VGCB 4BANB 2BDBA 1BHXF 3A7TA 5CE1A 1O2KA 2WYGA 3RXFA 1QJ6B 3DFLA 4X2WA 4D7FA 4X8SH 1GCDA 2TGTA 4FU7A 1HYLA 2OLGA 1GJ9B 1D4PB 4D9RA 2G5VA 1FZZA 1WUNH 2WPMS 4FUCA 1O2QA 1PPEE 2A7HA 3E0NB 1NFUA 3ZZ8A 1W10U 1EPTB 3M3SA 3ESTA 3MH7A 4GSOA 5ESTE 5T6GA 3LKWA 3MO3A 2CF8H 1IQEA 4KTUA 2J9NA 8GCHF 3SUGA 1FY5A 4OS2A 3RXQA 2Z3DA 5GIBA 1D3DB 3A85A 1ZRKA 1TABE 1ZTLA 3KNXA 1NFWA 1C4Y2 1GI6A 3E16B 1YCPH 1IQIA 2BDAA 1FY1A 1NFYA 3ODDA 1G37A 3TK6A 2HVXA 2STBE 4J2YB 1AE8H 1E38B 2YNAA 1GMHG 3G01A 3RXCA 1C4V2 1BT7A 1ABJH 3CENA 2FS8A 4TWYA 3TH2H 3URDA 5JBBS 1Y59T 1OS8A 2SFAA 3HKIB 2SNVA 1TB6H 2A4QA 3QGJA 4I32A 1QBOA 1BHXB 2Z9IA 1O3OA 1YLCA 1AB9B 1CHGA 4O03A 3SNBA 1MBQA 4FVDA 1VR1H 3GCNA 3QUMP 3FP8E 2BDCA 1WTHD 3PTBA 1S82A 2FYQA 4CBNA 1K1PA 1GDQA 1SB1H 3HGPA 2ZDNA 5DKMA 2RA0A 3EQ0H 4ABEA 2ZFQH 3SQEE 3NKKA 4ZHMU 2BXUH 2C8ZB 1FV9A 4R0IA 3SV6A 1KXAA 3VPKA 1HXFH 1SG8B 2FO9A 1BMNH 1QL8A 1GVLA 3SUFA 1FNIA 1C5MD 1G36A 3A7WA 1LPGB 2H1UA 1GGDC 3CS7A 1P04A 1K28D 4BAKB 4M7GA 3U8TH 1Z6EA 5C5NA 2BMGB 1MU8B 4U30A 4IS5A 2QYIA 2SGAA 4AG2A 1TPOA 1GI3A 1HJAC 6GCHG 4F4OC 1SQTA 2ALVA 3ZVAA 4ZKSU 3PM3A 1V6DA 5GDSH 1O3FA 4E06H 1JOUB 1K1IA 1KLTA 1LPKB 1BBRH 4A1TA 3T25A 2Y5HA 1O3HA 1O33A 1IAUA 1GGDB 2ZDMA 4DIIH 4ZKNU 1S85A 2BY5X 2BZ6H 3T28A 2VU8E 3GY8A 5DG6A 4CRFA 4K5ZA 2CXVA 3VGCC 1P3EA 4ABAA 1XXFA 1HJAB 3BTHE 5HYOA 1HRTH 1F0SA 1GJ5H 1O36A 1S0RA 4WXVA 3SGBE 2ZQ2A 3BN9A 5FPTA 1CSOE 1AGJA 3K2UA 3A86A 1XUFA 2ZGBH 1MTVA 1V2QT 1P10A 2VWLA 5C2ZA 1O35A 5J4QA 1TGSZ 1Z8RA 3P92A 1RFNA 1TALA 3ZZBA 1SGPE 1ANCA 1TNGA 3BF6H 4INLA 3LT3A 1KYNA 1K22H 2ZCLP 1C5WB 2FOHA 4MNWA 3Q00A 3LC5A 4Y11E 2ZIQH 4THNH 2Q6GA 4AYVB 1ARCA 3VGCB 2GDEH 1WAYB 3N7OA 1C2LA 1V2JT 2HPPH 3ZVBA 3GY5A 1SOZA 1NRNH 1OYTH 1AFEH 1BZXE 5F8TA 1PQ8A 1YLDA 2ZFRH 3F9GA 2TGAA 3A84A 1HJ9A 5C5OA 2Z7FE 1WQSA 4NA7A 4NIXA 3MI4A 1W12U 2BOKA 4OS7A 3TU7H 2B7DH 1N6YA 1UVPA 5GCHF 4B74A 3FZDA 3OY5U 3SJ9A 3GYLB 1ABIH 1JIMA 3UWJH 1DT2A 2GCHG 2XBXA 1MH0A 1QIXB 1YPKH 2WPLS 1SGDE 2DE9A 1G3BA 2ZGJA 3EA8A 1Z8IB 3SJKA 2F9BH 2V6NA 4XOJA 4MPXA 1ZMNA 1PYTC 3A87A 1C1TA 2ZHWH 3L33A 1O2NA 3RXEA 4DURA 1HCGA 1NU9A 2GZ7A 1JXPA 4D76A 1C1PA 1LKAA 5K7RA 1SL3A 2V35A 1O31A 2TRMA 2BD7A 2C90B 4AOQA 2BLOA 4D7GA 1VITH 2THFB 4RSPA 3QTVH 4GCHF 3SGAE 4ZUHA 4ZHAA 4YT6H 1O2JA 3AW0A 1FAXA 4BAHB 4AYYB 2STAE 2XCNA 3T62A 1EJMA 1P9UA 2IJOB 3ZVGA 1WSSH 2QC2A 5GWZA 1OPHB 4K8YA 3SZNA 5GJ4B 1QL7A 2ZCHP 2ZPSA 4B75A 1BJUA 1BMLA 3UQOA 3GISB 3I78A 1PQ7A 5JBAS 1SGYE 2OC8A 4FUIA 4DJZB 4ZKOU 3PB1E 4TPIZ 3OY6U 1H8IH 4CR9A 1SGIB 1HAYB 8KME2 2XBYA 4IC6A 2VWOA 4E7NA 2OINA 1O2WA 4NWLA 1LDTT 4LZ4B 4I8JA 1NFXA 1ELDE 1HLTH 2I6QA 4BAOB 1S81A 5EW2H 1GBHA 2AH4X 1EJAA 1P06A 2AMPA 1RTKA 2EC9H 1EQ9A 1WBGB 1EOLA 3H5CB 3SU6A 3ZYDA 4DIHH 1EB1H 1J14A 2PHBA 1C5PA 1MKWH 1HB0B 1HXEH 3GDSA 1GBAA 3RU4T 3Q3XA 1L0ZA 3QGNB 2A0QB 1KTTB 3M5NA 3TPIZ 1IHSH 5CHAC 4CRGA 3SNAA 2DUCA 3V13A 3SJIA 3KQBA 5EPYA 1HPGA 5DO4H 1PPFE 1T8MA 2PTCE 3M7UA 4KTCA 3SOSA 4DG4A 1HAVB 3SU5A 3UNRA 3VB4A 4AB9A 1ELFA 1O30A 1QA7A 2H6MA 2TGPZ 1UHBB 2XTTB 5LPEA 1AKSA 4ABFA 2K1QA 1S0QA 3RXMA 1O2OA 2P3UB 1V2VT 3A82A 1OWIA 5CHAB 4F49A 4I8KA 2P93A 3BV9B 1HAPH 1UK3A 2FXRA 3FANA 1XKAC 2R2MB 3E3TA 4OGXA 4X1QU 1TGCA 1C5YB 1BRCE 2ANYA 3SV8A 1F5LA 1DXPA 3FFGA 3MFJA 3D65E 4YT7H 1W11U 2ZFSA 2BLVA 4ZAEA 1ZHMA 5FPYA 3R0FA 1EAWA 3BEFB 1YC0A 1SMFE 1UK4A 1K9OE 3RXTA 4AFSA 1UVSH 1C2HA 5DP8A 5FX6A 1B5GH 3LIWA 1ETSH 4SGAE 3M5LA 3TNSA 1LVYA 1SGFG 3UOUA 1E35B 1Z1IA 3C27B 7GCHG 1UTPA 2W3IA 1UTNA 1WCZA 2VIPA 2FTMA 2A2QH 1FY3A 3OU0A 1K1LA 5FXLA 2FZZA 1TX6A 1IOEA 4O9VA 4TWWA 2SGFE 4ZH8A 5EOKA 1NESE 4Y8XA 1CGHA 4PROA 3LGTA 3VB5A 3SORA 3K65B 3GYMA 1YPEH 1QQUA 1TLDA 4A5TS 3TJUA 4E7RG 2BD5A 1LHFH 2BY6X 1KXFA 4OGYA 3KQDA 1ZSJA 2ZFFH 2W7SA 1ZSKA 1CU1A 3IITA 1AWFH 1C5NH 3MWIU 1OP8A 3ZZ4A 1A1RA 1LPZB 1O2MA 4KELA 1ZPCA 1SLUB 2VVVA 3PLBA 2FOEA 4FU9A 4YOJA 2QY0B 1C2EA 3LH1A 4Y10E 1D3QB 3GCHC 3GCOA 1P2KA 1O3AA 4YZUA 3S7HB 1GMDF 3M7QA 2WPHS 1A0JA 1RIWC 1HIAB 1SQAA 2ZGXH 4YTAA 4B2BA 1G9IE 3FP7E 2A2XH 2XBWA 2PFEA 1OKXA 1XX9A 5E8EH 3UFAA 3RU4D 1SGRE 3SUDA 1GI4A 3GY2A 2QN5T 3FZZA 3L3TA 2Y80A 3M5MA 2PV9B 3PMHB 1GHAF 2TPIZ 3GCHB 3SU2A 1RD3B 2P3TB 2I6SA 4Y7BA 2FYRA 1RIWB 4CR5A 1DWEH 3U1JB 1X7AC 2TIOA 3ZZ9A 2HLCA 4IBLH 3A7XA 4WMDA 3LC3A 3A89A 2BQWB 1FDPA 4NSVA 3LJJA 1O5EH 4BTUB 1TYNA 3SI3H 2P8OC 1XM1A 1YCPM 2AERH 2PSYA 1LHGH 4Y0ZE 1C9PA 1A5IA 1EAXA 3HK6B 4ISOA 1OP0A 3F1SB 1GHYH 1A2CH 2XWBI 3AW1A 2A7JA 5F8ZA 3LGIA 2QV1A 1P8VC 2XRCA 5E0HA 1T7CA 5C3NA 3LJOA 2SGEE 1O3MA 2OTVA 3SUEA 2B0FA 3RU4E 4XE4A 3P70B 1RTLA 1ZGIA 2F9NA 1Y5AT 2R9PA 1UTKA 3TJOA 2OBQA 3M7TA 1L1NA 3BTME 1O2IA 2FEQH 2NU2E 3DD2H 1H1BA 1BMAA 1HDTH 1PFXC 1CHOG 1F2SE 2ZU4A 1YPGH 3PTNA 3JZ2B 4UFDH 1TOMH 1G3CA 2A32A 1W14U 2WV5A 1SLXB 4B71A 2G4UA 5LH8A 8ESTE 1SGCA 4XSKU 1E34B 1VJAU 3MNXA 4FUEA 2H5DA 5EG4A 1V2LT 3MNBA 1Z71A 4J1YA 2BOHB 1GHVH 4OS5A 1PQAA 2ZU2A 2R2WU 1T8NA 1K1NA 1C2GA 3H7OA 2Y5GA 1DVAH 3EAJA 2BDIA 4ZHLU 2ZPRA 1NC6A 3KIDU 1O3CA 1C1QA 3S7KB 3T5FH 3PMAB 1CGIE 4IC5A 3O8CA 1Q31A 1TA6A 3MOCA 5AF9H 5A0CA 1ZR0A 1BJVA 1NM6A 1HBTH 1DM4B 2OQUA 1OWHA 1CO7E 3V3MA 2HOBA 3STJA 3E8LA 2ZDLA 1LO6A 1AKSB 1OSSA 1VZQH 4AG1A 2F9VA 3GY7A 2G55A 3PYHA 5DK1A 1MUEB 2ZZUH 4Y6DA 2QGRA 1XUHA 1GBCA 3W94A 1EAUA 1GJAB 3ATWA 1TFXA 1S6FA 4AFQA 3L6PA 5EQQA 1AB9C 1XUJA 5EU8A 1A0HB 4UFEH 1HNEE 2LNCA 1HAGE 2UWLA 2FMJA 2ANWA 2P3FH 5C1YA 4YESB 2VIOA 1BA8B 2FLRH 4CRBA 1EXFA 1FN8A 4FUFA 1VCPA 3LOXA 4YOIA 2QF0A 2F9UA 2H9HA 4OS4A 1MKXH 1HAVA 3TJVA 1ESTA 5JB9S 1NROH 2FX6A 1UMAH 1ZHRA 1JRSA 1K1MA 1P3CA 3ZZCA 2FOMB 2ZFTA 3FP6E 1HAHH 1UHBA 1O3EA 1UVUH 1P01A 3KN2A 1BRAA 3ZVFA 2FODA 3UIRA 2IOTA 1A7SA 2YNBA 4Z6AH 1F0TA 3AVZA 4ISLA 3TITA 1GBLA 1UK2A 3MU8A 1ELAA 3P6ZB 2OD3B 3T27A 1RTFB 1BTUA 3TLOA 3K6ZA 2BM2A 2ODQA 3ZZ6A 2BVXH 3I29A 3UNQA 5T3HA 2F83A 3RMNH 2C8YB 5AVDA 1FLEE 4JYTA 3U69H 5DJ7A 2HPQH 2FOFA 2J95A 3SU1A 4DCDA 2FI3E 3M35A 3V12A 3BSQA 3LGYA 4AGKA 1IQFA 4XBCA 1BMMH 3A80A 1JWTA 1EAIA 1TE0A 4ABDA 1O2TA 3MH5A 1G2MA 3TK5A 1V2WT 2WV4A 4X0WU 1P2NA 1GI8B 1TQ7B 1GI2A 4ASHA 2GV7A 1D6WA 3RXOA 2UWOA 2RCEA 4NIVA 4OS6A 1LQDB 5DP5A 4D9QA 4Y8YA 1AD8H 1NRQH 1ELEE 1NU7B 5EXLA 1G32B 2AGEX 2O8UA 4X6PA 1C1OA 5GXPA 1O3NA 2WYJA 4JK6A 4O3UA 4DY7B 4JZDH 2NU0E 3MU1A 3S9CA 4HZHA 1JRTA 4LOYH 1CA0C 2ZF0H 1C2DA 1ANDA 1BRUP 1BCUH 1O3JA 1W0YH 4WMFA 5H4IB 5EODA 3NCLA 4K8BA 2BQ6B 4U01A 2OXSA 4ZXYH 2OC7A 5E0GA 1Y3UA 1T8OA 1KDQA 4MQAA 1THPB 3PMBB 4Y0YE 4H42U 3NWUA 3M37A 1GHBG 2Z3CA 1SR5C 1EP6A 4UEHH 5BRRE 1C5XB 1W7XH 2JH0D 1MD7A 4JZFH 1FN6A 1KLIH 2ZU1A 1ELTA 1CA0B 1CE5A 1O2ZA 1HIAA 1MD8A 5CMXH 4X6MA 1C1MA 2Y7XA 4X1SU 5JBCS 1EX3A 1GHWH 1FI8A 1O5FH 4K1TA 1BTHH 4CREA 3P95A 1ZMLA 3ZZ5A 3TH4H 4A1VA 4JZIA 1LCYA 1RXPA 1C5UA 1NZQH 9LPRA 1FIZA 3UNSA 2XNIA 1YGCH 3IG6B 3M3TA 4Q2KA 2XC5A 1Y3YA 4FVBA 1PPZA 4I31A 3KCGH 4XFQA 2OC1A 4KP0A 3PV4A 1TRNA 2G5NA 3Q3KA 4BXWA 1WV7H 1C1WH 4TY6A 4WXIA 3UUZA 2UUFB 2W3KA 1DY8A 3B8JA 1RJXB 4Q7YA 1TPSA 1GBBA 4A92A 1P57B 1J9CH 3EYDA 4MDSA 3H7TA 3LGWA 1GBIA 3NZIA 2VIQA 1MKWK 1ZMJA 1NY22 2IN2A 2ZCKP 5F03A 4TYDA 3S69A 1GJ8B 2FWWA 4ZXXH 2AGGX 4UFFH 3STIA 4AGJA 1BTZA 1N8OC 1JIRA 2J2UA 1C1UH 1Y3VA 3ZV9A 1EATA 1GDUA 2ODYB 2GZ8A 2UUJB 2V3HH 1A4WH 4KTSA 3HK3B 3BTDE 1W3CA 1CA8B 4Q7XA 2A5AA 3TH3H 1AUTC 3Q3YA 2O8TA 2BY7X 3GCTF 3BG4C 5JPMH 2DE8A 1LHEH 3A83A 1TPPA 1GBKA 4X2YA 2Z94A 2FI4E 2A7CA 1YM0A 3PROA 3E1XB 1C9TA 3RM2H 4FUBA 3MU0A 4JCNA 5JYIA 1N8OB 4NFFA 3LDXH 1T4VH 5HMAA 1P2JA 1VGCC 2VB0A 2O8MA 1YPJH 5JDUB 1SHHB 3SHAH 1WU1A 5GPIB 5FPSA 3RC4A 3F6UH 2VWNA 1O3DA 2Z9GA 1ZPBA 1P2IA 3BTTE 3BG4B 4QT8C 1V2TT 4A1XA 5EW1H 3DFJA 8GCHG 3RXVA 2AMDA 2ZU3A 2OC0A 2GP9B 1YPMH 1CGJE 4ISNA 3A88A 4VGCC 1U6QA 1NRRH 1QJ1B 2FX4A 1NT1A 1W0ZU 1FIWA 4LK4A 1EOJA 1VGCB 4BNRA 1C5RA 3P8NA 1SFIA 1P09A 2ESTE 3ITIA 2W26A 3NK8A 2XC0A 4CH2B 1KXCA 1D3TB 3Q77A 1FXYA 1O5GH 2AEIH 3BTFE 1EKBB 1P05A 1XMNB 4JZEH 2FP7B 3KEEA 4WH6A 1ZZZA 3AAVA 5HM2A 5AFYH 1DITH 2Y81A 2ZA5A 2G51A 2BD9A 1AWHB 3E0PB 2FS9A 4VGCB 1UO6A 3UQVA 1N1LA 2F9PA 1TNLA 3TVJB 1V2OT 1LHDH 2XXLA 1YPHC 1TRMA 5L30H 1EZXC 1J17T 1S83A 1O2XA 2ULLA 1HAOH 3LU9B 5FBEA 2JKHA 1QB6A 2PGQB 4I8LA 1P2MA 2BD3A 2BYAX 2ZTXA 1MQ5A 3AASA 3QX5H 1EZSC 1N6XA 3BEUA 1PJPA 4IMZA 1G3EA 3QN7A 1P9SA 2SGDE 1IQMA 2JETC 4HGCA 1SLWB 4GUXA 3EE0B 1C1VH 1L2EA 1GHZA 2GX4A 1ZLRA 2BVRH 4X8VH 4FUHA 2SGPE 2VINA 2G00A 3LGVA 4DW2U 2QXJA 1BITA 2R0KA 2OBOA 5HXFA 1G30B 1K21H 1L4ZA 3CS0A 5SGAE 1C5OH 3TGIE 3ODFA 4TPYA 1TMBH 1AVWA 1UCYH 1T8LA 3A8DA 3UOPA 3TK9A 1GI0A 2UUYA 1QGFA 1GMHF 2FOBA 3R3GB 1HUTH 1K2I1 4CRCA 1NN6A 5FX5A 4H6SB 4Y71A 1DOJA 1THSH 4WJG2 1O0DH 1SC8U 1AVGH 2JETB 4NZLA 4XDEA 3O8DA 1QRZA 2VNTA 1IQGA 2ZNKH 2XBVA 4BTIB 4BTTB 5TCCA 1O2GH 1Z1JA 4WF8A 1C5TA 5LPFA 3F9FA 4NCYA 5L6NH 1O3BA 1YYY1 4OS1A 2OUAA 4SGBE 5DP6A 2PR3A 3ATKA 1RGQA 1QURH 3SO3A 4X6NA 1V2MT 2JH6D 3M36A 2SGQE 1OOKB 2VH0A 3E6PH 3EDXB 4I7YH 4NGAH 1DSTA 1XKBC 1PPBH 1SOTA 2QF3A 1KDQB 1V2UT 4K2YA 2XYAA 1CT2E 3M5OA 1THRH 3RXAA 3VXEH 1ZSLA 3RXKA 1O2PA 1V2PT 3A8CA 5K0HA 3S0NA 3OSYA 4JK5A 3GDVA 5HGGA 1LHCH 3MU5A 3B23B 4ISHH 2TBSA 2QAAA 3BTKE 5G4BA 1O3LA 3SI4H 1KY9A 3A81A 4ABBA 1TNHA 2ZHEH 4YM9A 5L2YH 1ARBA 1T32A 5TCAA 1XUKA 3PWBA 3M61U 6GCHF 5FCKA 2NU4E 1KIGH 1O2UA 3UR6A 4MTBA 3SGQE 3FVFB 1F5KU 4ZROA 1CT4E 7KMEH 3SNDA 4A6LA 2Q6FA 3ELAH 1TGBA 1VCQA 1FAKH 1Y5UT 2OQ5A 1F5RA 1GJ6A 2QXHA 2FTLE 4NIYA 1RS0A 2KAIB 1DX5M 2Q1JA 3U8RH 3BTQE 2AS9A 1MTUA 1L4DA 1LTOA 3PLPA 5C1XA 3ATLA 1LVMA 2GDDA 3ENSB 2AIQA 4NA8A 5EQRA 2F9OA 4ABGA 1ESBA 4MG3A 3NUMA 3UPEA 1B7XB 5A0BA 2PSXA 4KGAA 3CP7A 1VCWA 1DWCH 3PO1C 1H9HE 1DSUA 4ABIA 1W13U 1CVWH 3RM0H 1AUJA 4GCHG 4B2CA 4KKDA 1QRXA 2D2DA 4TY7A 1FJSA 3LPRA 5EQSA 2W5EA 3VB3A 3Q76A 2GVFA 1FUJA 1TRYA 2C8XB 1O39A 1O5BB 1V3XA 2C8WB 4MNVA 3KGPA 2C93B 3SNCA 1GI5A 1O2SA 1VJ9U 3QDZB 3QTOH 1ESAA 1WOFA 1FMGA 3PO1B 4JYVH 2A1DB 2ZDVH 1BTYA 1GHXH 1JMOH 2RA3A 1ID5H 2BD8A 1ZPZA 1C2KA 3RC6A 2PTNA 1YCPK 1FONA 3D62A 3QO6A 5DP3A 2HALA 4MPUA 1TX8A 1O2YA 4Y79A 4IN2A 1ZRBA 2BB4A 2GCHF 1C4U2 4X2XA 2ZECA 1BBRE 3SU0A 1EASA 2FI5E 3OTJE 5FBIA 2R3YA 5E0JA 2ANMH 1MCVA 1BDAA 4YLQH 3UWIA 1TBQH 1E0FD 1MKXK 1NPMA 2ZKSA 1B0EA 2AGIX 1GBMA 3QZQA 5AFZH 1F7ZA 2XW9A 2WPIS 3P8FA 2NU3E 1AQ7A 4INHA 1EZUC 1EB2A 1ORFA 3QLPH 1TOCB 2YOLA 1YPHE 1AVXA 4MNXA 2C3SA 2GTBA 4BAQB 1QTFA 1MQ6A 1NO9H 2FM2A 1ZHPA 1HV7A 2VVUA 5EXNA 5F8XA 3K9XB 1TA2A 2ZEBA 1O3GA 3RXJA 1F0UA 2ZO3H 1IQLA 2GD4B 3DHKH 1D3PB 1UTJA 3UY9A 1QBNA 1QBVH 4K69A 3DUXH 4B1TA 1LQEA 1GWAA 1BTPA 3SBKA 3VB6A 1GCTC 4X2VA 2IPHA 6ESTA 1TPAE 1F92A 2HRVA 1DDJA 4MVNA 1ELVA 3SN8A 4LXBH 3S9AA 1C5QA 2BLWA 2A5KA 1QY6A 3RMLH 1HGTH 2ZPQA 1QCPA 1ZTKA 3P8GA 1ETTH 1GG6B 1FPHH 1OWEA 1ZTJA 2VH6A 4CH8B 7ESTE 3KQCA 1C2MA 1QQ4A 2BZAA 1PPHE 4GAWA 1ZGVA 4O97A 3HATH 4GHQA 2H9EH 2PWXA 2A45B 3GOVB 4X8TH 5LGOA 1GCTB 1BBRK 1DLEA 1ANEA 4XBBA 3T26A 3QWCH 2A4RA 4RN6A 3RDZA 1D6RA 1QHRB 5IDKA 2QIQA 1VITG 2B8OH 1FPCH 3P8OA 1KSNA 1WQVH 2ZU5A 2V0BA 1LMWB 2VIDA 3V7TA 3K6YA 1NTPA 1W7GH 3ZYEA 2M5TA 3E90B 2GMTC 4YLUA 1CBWC 4DT7B 4BAMB 5DGJA 4IMQA 1UTQA 3U1IB 5C1UA 1IQKA 1HAXB 1QA0A 1V2RT 1DUEA 2Y82A 3UREA 1Z7KA 3RXRA 4X1RU 4YO9A 5EGMA 1GVZA 1ZYOA 2BLQA 4X6OA 3TJNA 1O3IA 1SLVB 4WWYA 4UONA 4LZ1H 1ZJKA 2TGDA 4YOGA 2Z6BD 1EJNA 4UDWH 5DPAA 4BXSA 5A09A 2HNTF 1MAYA 1UVOA 1YBWA 1HAZB 1C5ZB 1QFKH 3KL6A 1AO5A 2JH5D 2GMTB 3LONA 1CBWB 3M3VA 2XWAA 2FPZA 1P2QA 2OP9A 1D9IA 1Z6JH 4Y76A 2J94A 2ODPA 1K1OA 3ZZ3A 5J4SA 4NSYA 4D8NA 2BY8X 4HTCH 1V2KT 3U98H 1GMDG 1O5CB 3BTEE 3IWMA 1LKBA 4Y7AA 1O5DH 2ZWLH 1G3DA 1T4UH 1W2KH 3VB7A 3JZ1B 2PGBB 2EI7A 3UR9A 1K1JA 7GCHF 3MHWU 2GT7A 2ZTYA 4MPWA 2HWLB 1HAIH 1SGQE 3SV7A 1AE5A 1GPZA 1YPLH 5C67A 1FY8E 1G2LA 2Y5FA 1OWDA 2HNTC 4JYUH 2WINI 3SV9A 1GHAG 1TNJA 2UWPA 4DVAU 1C5LH 1V2NT 2PKAB 4CRDA 1BQYA 1OWJA 1W8BH 1UJ1A 2FIRH 2Z9KA 2A4GA 1WTGH 1TNIA 1MBMA 2NU1E 1MAXA 1DUAA 1UVTH 1O3PB 4AORA 4IGDA 1SVPA 2BHGA 2H5CA 3DA9B 5LPRA 2V3OH 1Z8JB 4Y8ZA 1RRKA 4E05H 2BDYA 1SQOA 3NXPA 3O8BA 2H2ZA 3E91A 1XVOA 2H9TH 2ZC9H 1SHYA 4NWKA 3P17H 1B0FA 5I46H 5EPNA 2FLBH 3MO6A 4X1NU 4FXGH 3ZVCA 1OX1A 1A3EH 3S9BA 1M9UA 2BY9X 3TNTA 2ZTZA 1GJ7B 2NWNA 2D26C 1BUIA 3SU4A 2WUCA 3U9AH 1ELGA 2OCVB 5PTPA 2J34A 3PLKA 1BTXA 1O34A 1Y5BT 2KAIA 3MU4A 1UTOA 1L1GA 1TGTA 4IN1A 3EGKH 4Z0KA 1NRSH 3BG8A 1P11E 1GMCG 1UCYE 4FUJA 4Q7ZA 3PWCA 3RXBA 2EA3A 2ZI2H 1GBJA 5F6MA 1UTMA 1GBEA 5A0AE 1C1SA 3RXSA 4X1PU 1C2IA 4B73A 3RXGA 6CHAC 4CRAA 1GI1A 4Q80A 1KXDA 4JZ1A 1UTLM 4FU8A 2F3CE 1GI7B 3TGJE 3BIUH 3TIUA 1J16A 3B9FH 4B76A 1FQ3A 1HFDA 1P0SH 3MTYA 3ZV8A 3F9HA 3ZZ7A 1DWDH 1ELBA 1H9IE 3RMMH 1MMJN 3TGKE 1C2FA 1S6HA 1ELCA 1AIXH 2R0LA 3O8RA 1EP5A 1C5SA 1LVBA 1WYKA 2ZFPH 2ZHQH 4ABHA 4GHTA 1SFQB 4MNYA 1QB9A 2SNWA 1ETRH 3VFEA 6CHAB 2CN0H 3LGUA 2BVSH 3A8BA 1EUFA 1TWXB 3D49H 2LPRA 3T29A 4I8GA 2QCYA 2GKVE 2F91A 5FCRA 1A5HA 2CF9H 4ISIH 3MYWA 4CBOA 4NFEA 4NIWA 1O32A 2Z9JA 1CHOF 1O2RA 4A7IB 6LPRA 1KLJH 1GVKB 4AB8A 2D1JA 2QXGA 2PKSC 4I8HA 4ESTE 1H9LB 1TAWA 1YP9A 1QNJA 1ZOMA 4BOHA 1A61H 2VJ1A 3RXPA 1DY9A 3D23A 4ABJA 5JB8S 5L2ZH 4O3TA 5IYTA 1V2ST 1ZJDA 1TMUH 2GV6A 4K1EA 4ZMAH 3GDUA 1UCYK 1BIOA 2Z3EA 1S5SA 3ATMA 2PLXA 3DT0H 1PPCE 1XVMA 4NA9H 2B9LA 1XUIA 2FOAA 5E2OA 3ZVEA 2QA9E 1TNKA 2AMQA 2BDGA 1A3BH 2VIVA 1P02A 2A31A 2PKSB 1SBWA 1MTNC 5ABWA 5A8YA 1P03A 4I33A 3ZZDA 2GT8A 1YF4A 8LPRA 4RKJB 1MZAA 3A7ZA 2ZDAH 4DGJA 4K60A 2W7UA 3W95A 4K1SA 2ZGCA 3HPTB 1AZZA 1LVOA 2Y6TA 2EI6A 2P59A 3RXLA 1QJ7B 2Q6DA 2RDLA 3GICB 2G4TA 2ZGHA 4WY3A 4ZKRU 2ASUB 4CHAC 2BQ7B 2CJIA 2ZG0H 1Y3XA 1EPTA 1MTNB 3SQHE 3OYPA 1NRPH 1AY6H 2WPKS 1SSXA 1AZ8A 1C1RA 2P94A 3SJOA 2AFQB 3BTGE 2PUXB 2O8WA 2VIWA 3RC5A 5HM9A 1GBTA 3MH4A 1OYQA 4AX9H 4INKA 3MH6A 1O3KA 1BB0B 4GLYA 1C2JA 3PMJA 1AFQC 2J4IA 2WUBA 1GI9B 2UUKB 4CHAB 2QXIA 3ZVDA 3FAOA 1BOQA 5B6OA 5JBTA 1XXDA 5DP7A 2HNTE 3RXHA 1Q3XA 1OXGA 1ACBE 1TGNA 3BIVH 2AYWA 2FESH 1GBDA 1DPOA 1MTSA 3RXIA 1O37A 3EA9A 1AI8H 1NS3A 1VITF 3HGNA 5FHTA 1OWKA 1J15A 1SGTA 3OX7U 1AFQB 1XUGA 5FAHA 5BPEA 1AMHA 1SI5H 2WPJS 4UE7H 1PQ5A 2ZDKA 1A5GH 2ALPA 1OP2A 2GCTC 1F0RA 1PYTD 2BX4A 2CMYA 1C1NA 2EI8A 1KTSB 1TBZH 3UTUH 3RXDA 5I25A 4FUGA 1IHTH 4HI3A 1TX7A 3WY8A 1E36B 1P12E 4B2AA 2ZQ1A 2VWMA 3HKJB 2XCFA 1BRBE
chains in the Genus database with same CATH superfamily
1DXWA 1H8DH 3BTWE 1QL9A 4RKOB 3A7YA 4HFPB 3SW2B 3I77A 1IQJA 1DWBH 4AFZA 1P2OA 2GCTB 3UAIC 4XBDA 4AC9A 1SGEE 2J38A 3KQEA 3RUOA 1DLKB 5ETXA 1C5VA 1O2VA 7LPRA 4GPGA 2HGTH 1TMTH 2A5IA 3OAAD 1CT0E 2B5TB 4AN7A 2Z9LA 3FOAA 2F4LA 4H6TA 2ZHFH 4WVPE 1QRWA 1QZ8A 3PV2A 4MPVA 4NG9H 1PPGE 5ESBA 5E2PA 3SNEA 2KZ4A 3GY4A 4JMYA 3H09A 2PKAA 1AHTH 3GY6A 1YKTA 1TQ0B 2BDHA 1GJ4H 5GCHG 4IW4E 1MZDA 2R3UA 4MLFB 3SU3A 1DS2E 3ATIA 2AIPA 1A46H 2ZP0H 1O2HA 4AZ2B 3RP2A 1JBUH 5EXMA 9ESTA 1E37B 2VVCA 4GVUA 3VXFH 5A2MH 1SPJA 1ANBA 1EZQA 4U2WA 1SGNE 2CHAC 5T1VA 1IQHA 3NPSA 2FOCA 3URCA 1Y8TA 1GHBF 3RMOH 1AU8A 3VEQB 3V0XA 1DANH 1Q2WA 3C1KA 3T2NA 2RG3A 1O2LA 2O8LA 2BD4A 2J92A 3A8AA 1MU6B 1H4WA 1GJDB 5A8ZA 1L1JA 2PUQH 1GBFA 1UW7A 5TJXA 2G81E 5DP9A 1MTWA 1Y3WA 3MO9A 1TONA 1KXBA 3GCTG 3BEIB 2ANKH 3AAUA 1TBRH 2PW8H 2D8WA 3RLWH 3MMGA 1TIOA 1EFRD 3SHCH 2CHAB 2GZ9A 2BTCE 1SGFA 1GJCB 2EEKA 1AN1E 4U32A 4WMEA 1QR3E 1FY4A 4ZCNA 2C4FH 1GL0E 1FX0B 5A8XA 1GJBB 1HJ8A 2P8OB 1GL1A 2G8TA 3MNSA 2FDAA 3GY3A 1INCA 2XC4A 2BXTH 5DP4A 4AFUA 4H4FA 2BD2A 1DE7H 5T6DA 2CV3A 3ZZAA 5C20A 2A4OA 4K3JA 2Y7ZA 3LH3A 4NZQA 3SJ8A 4DOQA 4UD9H 3SV2H 2P16A 4X8UH 1GMCF 1QB1A 4FUDA 1KXEA 2VGCC 3MNCA 1T31A 2GGVB 1A0LA 1KMHB 2FOGA 1O38A 3U8OH 3EA7A 4R8TB 3RXUA 3QZRA 1DFPA 1DICA 2P95A 1GDNA 2ZHDA 3F68H 5T6FA 3QK1A 1CQQA 3F2FA 5AHGH 4UFGH 3KHVA 1IQNA 3RLYH 1MCTA 1BTWA 3KF2A 1S84A 3A7VA 3F9EA 2G52A 1O5AB 2ILNA 2BX3A 2CGAA 1GG6C 1EPTC 1J8AA 1Z8GA 2O9QA 4WH8A 2VGCB 4BANB 2BDBA 1BHXF 3A7TA 2KCPA 5CE1A 1O2KA 2WYGA 3RXFA 1QJ6B 3DFLA 4X2WA 2RFKC 4D7FA 4X8SH 1GCDA 2TGTA 4FU7A 1HYLA 2EQNA 1GJ9B 2OLGA 1D4PB 4D9RA 2G5VA 5IK2D 1FZZA 1WUNH 2WPMS 4FUCA 1O2QA 1PPEE 2A7HA 3E0NB 1NFUA 3ZZ8A 4F48B 1W10U 5FL7D 1EPTB 3M3SA 3ESTA 3MH7A 4GSOA 5ESTE 5T6GA 3LKWA 3MO3A 2CF8H 1IQEA 4KTUA 2J9NA 8GCHF 3SUGA 3VG8A 1FY5A 4P00A 4OS2A 3RXQA 2Z3DA 5GIBA 1D3DB 3A85A 1ZRKA 1TABE 1ZTLA 3KNXA 1NFWA 1C4Y2 1GI6A 3E16B 1YCPH 1IQIA 2BDAA 1FY1A 1NFYA 3ODDA 1G37A 3TK6A 2HVXA 2STBE 4J2YB 1AE8H 1E38B 2YNAA 1GMHG 3G01A 3N7DA 3RXCA 1C4V2 1BT7A 1ABJH 3CENA 2FS8A 4TWYA 3TH2H 3URDA 5JBBS 1Y59T 1OS8A 2SFAA 3HKIB 2SNVA 1TB6H 2A4QA 3QGJA 4I32A 1QBOA 1BHXB 2Z9IA 1O3OA 1YLCA 4TT3D 1AB9B 1CHGA 4O03A 3SNBA 1MBQA 2EY4C 4FVDA 1VR1H 2KCOA 3GCNA 4YXWD 3QUMP 3FP8E 2BDCA 1WTHD 3PTBA 1S82A 2FYQA 4CBNA 1K1PA 1GDQA 1SB1H 3HGPA 2ZDNA 5DKMA 2RA0A 3EQ0H 5DN6D 4ABEA 2ZFQH 3SQEE 3NKKA 4ZHMU 2BXUH 2C8ZB 1FV9A 4R0IA 3SV6A 1KXAA 3VPKA 1HXFH 1SG8B 2FO9A 1BMNH 1QL8A 1GVLA 3SUFA 1FNIA 1C5MD 1G36A 3A7WA 1LPGB 2H1UA 1GGDC 3CS7A 1P04A 1K28D 4BAKB 4M7GA 3U8TH 1Z6EA 5C5NA 2BMGB 1MU8B 4U30A 4IS5A 2QYIA 2SGAA 4AG2A 1TPOA 4B6EA 1GI3A 1HJAC 6GCHG 4F4OC 1SQTA 2ALVA 3ZVAA 4ZKSU 3PM3A 1V6DA 5GDSH 1O3FA 4RI0A 4E06H 1K0HA 1JOUB 1K1IA 1KLTA 1LPKB 1BBRH 4A1TA 3T25A 2Y5HA 1O3HA 1O33A 1IAUA 1GGDB 2ZDMA 4DIIH 4ZKNU 1S85A 2BY5X 2BZ6H 3T28A 2VU8E 3GY8A 5DG6A 1E1QD 4CRFA 4K5ZA 3WWFA 2K0QA 2CXVA 3VGCC 1P3EA 4ABAA 1XXFA 1HJAB 3BTHE 5HYOA 1HRTH 1F0SA 1GJ5H 1O36A 1S0RA 4WXVA 3SGBE 2ZQ2A 3BN9A 5FPTA 1CSOE 1AGJA 3K2UA 3A86A 1XUFA 2ZGBH 1MTVA 1V2QT 1P10A 2VWLA 5C2ZA 1O35A 5J4QA 1TGSZ 1Z8RA 3P92A 1RFNA 1TALA 3ZZBA 1SGPE 1ANCA 1TNGA 3BF6H 5CDFE 4INLA 3LT3A 1KYNA 1K22H 2ZCLP 1C5WB 2FOHA 4MNWA 3Q00A 3LC5A 4Y11E 2ZIQH 4THNH 2Q6GA 4AYVB 1ARCA 3VGCB 2GDEH 5DSFA 1WAYB 3N7OA 1C2LA 1V2JT 2HPPH 3ZVBA 3GY5A 1SOZA 1NRNH 1OYTH 1AFEH 1BZXE 5F8TA 1PQ8A 3N99A 1YLDA 2ZFRH 3F9GA 2TGAA 3A84A 1HJ9A 5C5OA 2Z7FE 1WQSA 4NA7A 4NIXA 3MI4A 1W12U 2BOKA 4OS7A 3TU7H 2B7DH 1N6YA 2KR7A 2WZQA 1UVPA 5GCHF 4B74A 3FZDA 3SZEA 3KYGA 5HKKD 3OY5U 3SJ9A 3GYLB 1ABIH 1JIMA 3UWJH 1DT2A 2GCHG 2XBXA 1MH0A 1QIXB 1YPKH 2WPLS 1SGDE 2DE9A 1G3BA 2ZGJA 3EA8A 1Z8IB 3SJKA 2F9BH 2V6NA 4XOJA 4MPXA 1ZMNA 1PYTC 3A87A 1C1TA 2ZHWH 3L33A 1O2NA 3RXEA 4DURA 1HCGA 1NU9A 2GZ7A 2QE7D 1JXPA 4D76A 1C1PA 1LKAA 3KQ5A 1SL3A 5K7RA 2V35A 1O31A 2TRMA 2BD7A 2C90B 4AOQA 2BLOA 4D7GA 1VITH 2THFB 4RSPA 3QTVH 4GCHF 3SGAE 4ZUHA 4ZHAA 4YT6H 5EJLA 1O2JA 3AW0A 1FAXA 4BAHB 4AYYB 2STAE 2XCNA 3T62A 1EJMA 1P9UA 2IJOB 3ZVGA 1WSSH 2QC2A 5GWZA 1OPHB 4K8YA 3SZNA 5GJ4B 1QL7A 2ZCHP 2ZPSA 4B75A 1BJUA 1BMLA 3UQOA 3GISB 3I78A 1PQ7A 5JBAS 1SGYE 2OC8A 4FUIA 4DJZB 4ZKOU 3PB1E 4TPIZ 3OY6U 1H8IH 2F43B 4CR9A 1SGIB 1HAYB 8KME2 2XBYA 4IC6A 2VWOA 4E7NA 2OINA 1O2WA 4NWLA 4M9FA 1LDTT 4LZ4B 4I8JA 1NFXA 1ELDE 1HLTH 2I6QA 4BAOB 1S81A 5EW2H 1GBHA 2AH4X 1EJAA 1P06A 2AMPA 1RTKA 2EC9H 1EQ9A 1WBGB 1EOLA 3H5CB 3SU6A 3ZYDA 4DIHH 5EJ1A 1EB1H 1J14A 2PHBA 1C5PA 1MKWH 1HB0B 1HXEH 3GDSA 1GBAA 3RU4T 3Q3XA 1L0ZA 3QGNB 2A0QB 1KTTB 3M5NA 3TPIZ 1IHSH 5CHAC 4CRGA 3SNAA 2DUCA 3V13A 3SJIA 3KQBA 5EPYA 1HPGA 5DO4H 1PPFE 1T8MA 2PTCE 3M7UA 4KTCA 3SOSA 3OFND 4DG4A 2PP6A 1HAVB 3SU5A 3UNRA 3VB4A 4AB9A 1ELFA 1O30A 1QA7A 2H6MA 2TGPZ 1UHBB 2XTTB 5LPEA 1AKSA 4ABFA 2K1QA 1S0QA 3RXMA 1O2OA 2P3UB 1V2VT 3A82A 1OWIA 5CHAB 4F49A 4I8KA 2P93A 3BV9B 1HAPH 1UK3A 2FXRA 2V3MA 3FANA 1XKAC 2W6JD 3GS9A 2R2MB 3E3TA 4OGXA 4X1QU 1TGCA 1C5YB 1BRCE 2ANYA 3SV8A 1F5LA 3WWBA 1DXPA 3KYFA 3FFGA 3MFJA 3OTPA 3D65E 4YT7H 1W11U 2ZFSA 2BLVA 4ZAEA 1ZHMA 5FPYA 3R0FA 1EAWA 3BEFB 1YC0A 1SMFE 1UK4A 1K9OE 3RXTA 4F55A 4AFSA 1UVSH 1C2HA 5DP8A 5FX6A 1B5GH 3LIWA 1ETSH 4SGAE 3M5LA 3TNSA 1LVYA 1SGFG 3UOUA 1E35B 1Z1IA 3C27B 7GCHG 1UTPA 2W3IA 1UTNA 1WCZA 2VIPA 2FTMA 2A2QH 1FY3A 3OU0A 1K1LA 5FXLA 2FZZA 4HG6A 1TX6A 1IOEA 4O9VA 4TWWA 2SGFE 2YMSC 4ZH8A 5EOKA 1NESE 4Y8XA 1CGHA 4PROA 3LGTA 3VB5A 3SORA 3K65B 3GYMA 1YPEH 1QQUA 1TLDA 4A5TS 3TJUA 4E7RG 2BD5A 1LHFH 2BY6X 1KXFA 4OGYA 3KQDA 1ZSJA 2ZFFH 1YWUA 2W7SA 1ZSKA 1CU1A 3IITA 1AWFH 1C5NH 3MWIU 1OP8A 3ZZ4A 1A1RA 1LPZB 1O2MA 4KELA 1ZPCA 1SLUB 2VVVA 3PLBA 2FOEA 4FU9A 4YOJA 2QY0B 1C2EA 2YMSB 3LH1A 4Y10E 1D3QB 3GCHC 3GCOA 1P2KA 1O3AA 4YZUA 3S7HB 1GMDF 3M7QA 2WPHS 1A0JA 1RIWC 1HIAB 1SQAA 2ZGXH 4YTAA 4B2BA 1G9IE 3FP7E 2A2XH 2XBWA 2PFEA 1OKXA 1XX9A 5E8EH 3UFAA 3RU4D 1SGRE 3SUDA 3MQKC 1GI4A 3GY2A 2QN5T 3FZZA 3L3TA 2Y80A 3M5MA 2PV9B 3PMHB 1GHAF 2TPIZ 3GCHB 3SU2A 1RD3B 2P3TB 2I6SA 4Y7BA 2FYRA 1RIWB 4CR5A 1DWEH 2WHXA 3U1JB 1X7AC 2TIOA 3ZZ9A 2HLCA 4IBLH 3A7XA 4WMDA 3LC3A 3A89A 2BQWB 1FDPA 4NSVA 3LJJA 1O5EH 4BTUB 1TYNA 3SI3H 2P8OC 1XM1A 1YCPM 2AERH 2PSYA 1LHGH 4Y0ZE 1C9PA 1A5IA 1EAXA 3HK6B 4ISOA 1OP0A 4B6FA 2KFWA 4OM9A 3F1SB 1GHYH 1A2CH 2XWBI 3AW1A 2A7JA 5F8ZA 3LGIA 2QV1A 1P8VC 2XRCA 2QF4A 5E0HA 1T7CA 5C3NA 3LJOA 2SGEE 1O3MA 2OTVA 3SUEA 2B0FA 3RU4E 4XE4A 3P70B 1RTLA 1ZGIA 2F9NA 1Y5AT 2R9PA 1UTKA 3TJOA 2OBQA 3M7TA 1L1NA 3BTME 1O2IA 2FEQH 2NU2E 1H8HD 3DD2H 1H1BA 1BMAA 1HDTH 1PFXC 1CHOG 1F2SE 2ZU4A 1YPGH 3PTNA 3JZ2B 4UFDH 1TOMH 1G3CA 2A32A 2J98B 1W14U 2WV5A 1SLXB 4B71A 2G4UA 5LH8A 8ESTE 1SGCA 4XSKU 2QF5A 1E34B 1VJAU 3MNXA 4FUEA 2H5DA 5EG4A 1V2LT 3MNBA 1Z71A 1COWD 4J1YA 2BOHB 1GHVH 4OS5A 1PQAA 2ZU2A 2R2WU 1T8NA 1K1NA 1C2GA 3CNRA 3F2GA 3H7OA 2Y5GA 1DVAH 3EAJA 2BDIA 2YMSD 4ZHLU 2ZPRA 1NC6A 3KIDU 1O3CA 1C1QA 3S7KB 3T5FH 3PMAB 1CGIE 4IC5A 3O8CA 1Q31A 1TA6A 3MOCA 5AF9H 5A0CA 1ZR0A 1BJVA 1NM6A 1HBTH 1DM4B 1OWHA 2OQUA 1CO7E 3OEED 3V3MA 2HOBA 5F53A 3STJA 3E8LA 2ZDLA 1LO6A 1AKSB 1OSSA 1VZQH 4AG1A 2F9VA 3GY7A 2G55A 3PYHA 5DK1A 1MUEB 2ZZUH 4Y6DA 2QGRA 1XUHA 1GBCA 3W94A 1EAUA 1GJAB 2HLDD 3ATWA 1TFXA 1S6FA 4AFQA 3L6PA 5EQQA 1AB9C 1XUJA 5EU8A 1A0HB 4UFEH 1HNEE 2LNCA 1HAGE 2UWLA 2FMJA 2ANWA 2P3FH 5C1YA 4YESB 2VIOA 1BA8B 3DSOA 2FLRH 4CRBA 1EXFA 1FN8A 4FUFA 1VCPA 3LOXA 4RT1A 4YOIA 2QF0A 2F9UA 2H9HA 4OS4A 1MKXH 1HAVA 3TJVA 1ESTA 5JB9S 1NROH 2FX6A 1UMAH 1ZHRA 1JRSA 1K1MA 2W6ID 1P3CA 3ZZCA 2FOMB 2ZFTA 3FP6E 1HAHH 1UHBA 1O3EA 1UVUH 1P01A 3KN2A 1BRAA 3ZVFA 2FODA 3UIRA 2IOTA 1A7SA 1VKYA 2YNBA 4Z6AH 1F0TA 3AVZA 4ISLA 3TITA 1GBLA 1UK2A 3MU8A 1ELAA 3P6ZB 3FO8D 2OD3B 3T27A 1RTFB 1BTUA 3TLOA 3W1EA 3K6ZA 2BM2A 2ODQA 3ZZ6A 2BVXH 3I29A 3UNQA 5T3HA 2F83A 3RMNH 2C8YB 5AVDA 1FLEE 2LELA 4JYTA 4RT0A 3U69H 5DJ7A 2HPQH 2FOFA 2J95A 3SU1A 4DCDA 2FI3E 3M35A 3V12A 3BSQA 3LGYA 4AGKA 1IQFA 4XBCA 1BMMH 3A80A 1JWTA 1EAIA 1TE0A 4ABDA 1O2TA 3MH5A 1G2MA 3TK5A 1V2WT 2WV4A 4X0WU 1P2NA 1GI8B 1TQ7B 1GI2A 4ASHA 2GV7A 1D6WA 3RXOA 2UWOA 2RCEA 4NIVA 4OS6A 1LQDB 5DP5A 4D9QA 4Y8YA 1AD8H 1NRQH 1ELEE 1NU7B 5EXLA 1G32B 2AGEX 2O8UA 4X6PA 1C1OA 5GXPA 1O3NA 2WYJA 4JK6A 4O3UA 4DY7B 4JZDH 2NU0E 3MU1A 3S9CA 4HZHA 1JRTA 4LOYH 1CA0C 5EIYA 2ZF0H 1C2DA 1ANDA 1BRUP 1BCUH 1O3JA 1W0YH 4WMFA 5H4IB 5EODA 3NCLA 4K8BA 2BQ6B 4I86A 4U01A 2OXSA 4ZXYH 2OC7A 5E0GA 5HIYA 1Y3UA 1T8OA 1KDQA 4MQAA 1THPB 3PMBB 4Y0YE 4H42U 3NWUA 3M37A 1GHBG 2AHME 2Z3CA 1SR5C 1EP6A 4UEHH 3SYJA 5BRRE 1C5XB 1W7XH 2JH0D 1MD7A 4JZFH 1FN6A 1KLIH 2ZU1A 1ELTA 1W0JD 1YY3A 1CA0B 1CE5A 1O2ZA 1HIAA 1MD8A 5CMXH 4X6MA 1C1MA 2Y7XA 4X1SU 5JBCS 1EX3A 1GHWH 1FI8A 1O5FH 4K1TA 1BTHH 4CREA 3P95A 1ZMLA 3ZZ5A 3TH4H 4A1VA 4JZIA 1LCYA 1RXPA 1C5UA 1NZQH 9LPRA 1FIZA 3UNSA 2XNIA 1MABB 1YGCH 3IG6B 3M3TA 4Q2KA 4ACAA 4XD7D 1NBMD 2XC5A 1Y3YA 4FVBA 1PPZA 4I31A 3KCGH 4XFQA 3F0OA 2OC1A 4KP0A 4ACBA 3PV4A 1TRNA 2G5NA 3Q3KA 4BXWA 1WV7H 1C1WH 4TY6A 4WXIA 3UUZA 2UUFB 2W3KA 1DY8A 3B8JA 1RJXB 4Q7YA 1TPSA 1GBBA 4A92A 1P57B 1J9CH 3EYDA 4MDSA 3H7TA 3LGWA 1GBIA 1W0KD 3NZIA 2VIQA 3F3BA 1MKWK 2IJD1 1ZMJA 1NY22 2IN2A 2ZCKP 5F03A 4TYDA 3S69A 1GJ8B 2FWWA 4ZXXH 2AGGX 4UFFH 3STIA 4AGJA 1BTZA 1N8OC 1JIRA 2J2UA 1C1UH 1Y3VA 3ZV9A 5C94A 1EATA 1GDUA 2ODYB 2GZ8A 2UUJB 2V3HH 1A4WH 4KTSA 3HK3B 3BTDE 1W3CA 1CA8B 2VBCA 4Q7XA 2A5AA 3TH3H 1AUTC 3Q3YA 2O8TA 2BY7X 3GCTF 3BG4C 5JPMH 2DE8A 1LHEH 3A83A 1TPPA 1NBME 1GBKA 4X2YA 2Z94A 2FI4E 2A7CA 1YM0A 3PROA 3E1XB 1C9TA 3RM2H 4FUBA 3MU0A 4JCNA 5JYIA 1N8OB 4NFFA 2J98A 3LDXH 1T4VH 5HMAA 1P2JA 1VGCC 2VB0A 2O8MA 1YPJH 5JDUB 1SHHB 3SHAH 1WU1A 5GPIB 5FPSA 3RC4A 3F6UH 2VWNA 1O3DA 2Z9GA 1ZPBA 1P2IA 3BTTE 3BG4B 4QT8C 1SKYE 2KX4A 1V2TT 4A1XA 5EW1H 3DFJA 8GCHG 3RXVA 2AMDA 2ZU3A 2OC0A 2GP9B 1YPMH 1CGJE 4ISNA 3A88A 4VGCC 1U6QA 1NRRH 1QJ1B 2FX4A 1NT1A 1W0ZU 1FIWA 4LK4A 1EOJA 1VGCB 4BNRA 4FOUC 1C5RA 3P8NA 1SFIA 1P09A 2ESTE 3ITIA 2W26A 3NK8A 2XC0A 4CH2B 1KXCA 1D3TB 2M2AA 3Q77A 1FXYA 1O5GH 2AEIH 3BTFE 1EKBB 1P05A 4TSFD 1XMNB 4JZEH 2FP7B 3KEEA 4WH6A 1ZZZA 3AAVA 5HM2A 3OE7D 5AFYH 1DITH 2Y81A 2ZA5A 2G51A 2BD9A 1AWHB 3E0PB 2FS9A 4Z1MD 4VGCB 1UO6A 3UQVA 1N1LA 2F9PA 1TNLA 3TVJB 1V2OT 1LHDH 2XXLA 1YPHC 1TRMA 1SQRA 5L30H 1EZXC 1J17T 1S83A 1O2XA 2ULLA 1HAOH 3LU9B 5FBEA 2JKHA 1QB6A 2PGQB 4I8LA 3PRBA 1P2MA 2BD3A 2BYAX 2ZTXA 1MQ5A 3AASA 3QX5H 1EZSC 1N6XA 3BEUA 1PJPA 4IMZA 3U28C 1G3EA 3QN7A 1P9SA 2SGDE 1IQMA 4DT4A 2JETC 4HGCA 1SLWB 4GUXA 3EE0B 1OHHD 1C1VH 1L2EA 1GHZA 2GX4A 1ZLRA 2BVRH 4X8VH 2KCAA 4FUHA 2SGPE 2VINA 2G00A 3LGVA 3UB0A 4DW2U 2QXJA 1BITA 2R0KA 2OBOA 5HXFA 1G30B 1K21H 1L4ZA 3CS0A 5SGAE 1C5OH 3TGIE 3ODFA 4TPYA 1TMBH 4P02A 1AVWA 1UCYH 1T8LA 3A8DA 3UOPA 3TK9A 1GI0A 2UUYA 1QGFA 1GMHF 2FOBA 3R3GB 1HUTH 1K2I1 4CRCA 1NN6A 5FX5A 4H6SB 4Y71A 1DOJA 1THSH 2WSSD 4WJG2 1O0DH 1SC8U 1AVGH 2JETB 4NZLA 4XDEA 3O8DA 1QRZA 2VNTA 1IQGA 2ZNKH 2XBVA 4BTIB 4BTTB 5TCCA 1O2GH 1Z1JA 4WF8A 1C5TA 5LPFA 3F9FA 4NCYA 5L6NH 1O3BA 1YYY1 4OS1A 2OUAA 4SGBE 5DP6A 2PR3A 3ATKA 1RGQA 1QURH 3WW7A 3SO3A 4X6NA 1V2MT 2JH6D 3M36A 2SGQE 1OOKB 2VH0A 3E6PH 2LP6A 3EDXB 4I7YH 4NGAH 1DSTA 1XKBC 1PPBH 1SOTA 2QF3A 1KDQB 1V2UT 4K2YA 2XYAA 1CT2E 3M5OA 1THRH 3RXAA 3VXEH 1ZSLA 2IPQX 3RXKA 5CHBA 1O2PA 1V2PT 3A8CA 3DCLA 5K0HA 3S0NA 3OSYA 4JK5A 3GDVA 5HGGA 1LHCH 3MU5A 3B23B 4ISHH 2TBSA 2QAAA 3BTKE 5G4BA 1O3LA 3SI4H 1KY9A 3A81A 4ABBA 1TNHA 2ZHEH 4YM9A 1WDIA 2K8IA 5L2YH 1ARBA 1T32A 5TCAA 1XUKA 3PWBA 3M61U 6GCHF 5FCKA 2NU4E 1KIGH 1O2UA 3UR6A 4MTBA 3SGQE 3FVFB 1F5KU 4ZROA 1CT4E 7KMEH 3SNDA 4A6LA 5KGOA 2Q6FA 3ELAH 1TGBA 1VCQA 1FAKH 1Y5UT 2OQ5A 1F5RA 5C0UA 1GJ6A 2QXHA 2FTLE 4NIYA 1RS0A 2KAIB 1DX5M 2Q1JA 3U8RH 3BTQE 2AS9A 1MTUA 1L4DA 1LTOA 3PLPA 5C1XA 3DSGA 3ATLA 1LVMA 2GDDA 3ENSB 2AIQA 4NA8A 5EQRA 2F9OA 4ABGA 1ESBA 4MG3A 3NUMA 1WXRA 3UPEA 1B7XB 5A0BA 2PSXA 4KGAA 3CP7A 1VCWA 1DWCH 3PO1C 1H9HE 1DSUA 4ABIA 1W13U 1CVWH 3RM0H 5C17A 3OEHD 1AUJA 4GCHG 4B2CA 4KKDA 1QRXA 2D2DA 4TY7A 1FJSA 3LPRA 5EQSA 2W5EA 3VB3A 3Q76A 2GVFA 1FUJA 1TRYA 2C8XB 1O39A 1O5BB 1V3XA 2C8WB 4MNVA 3KGPA 2C93B 3SNCA 1GI5A 1O2SA 1VJ9U 3QDZB 3QTOH 1ESAA 1WOFA 5HIZA 1FMGA 3PO1B 4JYVH 2A1DB 2ZDVH 1BTYA 1GHXH 1JMOH 2RA3A 1ID5H 2BD8A 1ZPZA 1H8ED 1C2KA 3RC6A 2PTNA 1YCPK 1FONA 5GNDA 3D62A 1YLNA 3QO6A 5DP3A 2HALA 4MPUA 1TX8A 1O2YA 4Y79A 4IN2A 1ZRBA 2BB4A 2GCHF 1C4U2 4X2XA 2ZECA 1BBRE 3SU0A 1EASA 2FI5E 3OTJE 5FBIA 2R3YA 5E0JA 2ANMH 1MCVA 1BDAA 4YLQH 3UWIA 1TBQH 1E0FD 1MKXK 1NPMA 2ZKSA 1B0EA 2AGIX 1GBMA 3QZQA 5AFZH 1F7ZA 2JDID 2XW9A 2WPIS 3P8FA 2NU3E 1AQ7A 4INHA 1EZUC 1EB2A 1ORFA 3QLPH 1TOCB 2YOLA 1YPHE 1AVXA 4MNXA 2C3SA 2GTBA 4FETA 4BAQB 1QTFA 1MQ6A 1NO9H 2FM2A 1ZHPA 1HV7A 2VVUA 4Q4LA 5EXNA 5F8XA 3K9XB 1TA2A 2ZEBA 1O3GA 3RXJA 1F0UA 2ZO3H 1IQLA 2GD4B 3DHKH 1D3PB 1UTJA 3UY9A 1QBNA 1QBVH 4K69A 3DUXH 4B1TA 2KM0A 1LQEA 5EJZA 1GWAA 1BTPA 3SBKA 3VB6A 1GCTC 1S6LA 4X2VA 2IPHA 2CK3D 6ESTA 1TPAE 1F92A 2HRVA 1DDJA 4MVNA 1ELVA 3SN8A 4LXBH 3S9AA 1C5QA 2BLWA 2A5KA 1QY6A 3RMLH 1HGTH 2ZPQA 2OK5A 1QCPA 1ZTKA 3P8GA 1ETTH 2HVYB 1GG6B 1FPHH 1OWEA 1ZTJA 2VH6A 4CH8B 7ESTE 3KQCA 1C2MA 1QQ4A 2BZAA 1PPHE 4GAWA 1ZGVA 4O97A 3HATH 4GHQA 2H9EH 2PWXA 2A45B 3GOVB 4X8TH 5LGOA 1GCTB 3PRDA 1BBRK 1DLEA 1ANEA 4XBBA 3F2HA 3T26A 3QWCH 2A4RA 4RN6A 3RDZA 1D6RA 1QHRB 5IDKA 2QIQA 5C0TA 1VITG 2B8OH 1FPCH 3P8OA 1KSNA 1WQVH 2ZU5A 2V0BA 1LMWB 2VIDA 3V7TA 3K6YA 1NTPA 1W7GH 3ZYEA 2M5TA 3E90B 2GMTC 4YLUA 1CBWC 4DT7B 5KEDA 4BAMB 5DGJA 4IMQA 1UTQA 3U1IB 5C1UA 1IQKA 1HAXB 1QA0A 1V2RT 1DUEA 2Y82A 3UREA 1Z7KA 3RXRA 4X1RU 4YO9A 3FN8A 5EGMA 1GVZA 1ZYOA 2BLQA 4X6OA 3TJNA 1O3IA 1SLVB 4WWYA 4UONA 4LZ1H 1ZJKA 2TGDA 2JJ2D 4YOGA 2Z6BD 1EJNA 4UDWH 5DPAA 4BXSA 5A09A 2HNTF 1MAYA 1UVOA 1YBWA 1HAZB 1C5ZB 2JIZD 4ASUD 1QFKH 3KL6A 1AO5A 2JH5D 2GMTB 3LONA 1CBWB 3M3VA 2XWAA 5B6LA 2FPZA 3FKSD 1P2QA 2OP9A 1D9IA 1Z6JH 4XRNA 4Y76A 2J94A 2ODPA 1K1OA 3ZZ3A 5J4SA 4NSYA 4D8NA 2BY8X 4HTCH 1V2KT 3U98H 1GMDG 1O5CB 3BTEE 3IWMA 1LKBA 4Y7AA 1O5DH 2ZWLH 1G3DA 1T4UH 1W2KH 3VB7A 3JZ1B 2PGBB 2EI7A 3UR9A 1K1JA 7GCHF 3MHWU 2GT7A 2ZTYA 4MPWA 2HWLB 1HAIH 1SGQE 3SV7A 1AE5A 1GPZA 1YPLH 5C67A 1FY8E 1G2LA 2Y5FA 1OWDA 2HNTC 4JYUH 2WINI 3SV9A 1GHAG 1TNJA 2UWPA 4DVAU 1C5LH 1V2NT 2PKAB 4CRDA 1BQYA 1OWJA 1W8BH 1UJ1A 2FIRH 2Z9KA 2A4GA 1WTGH 1TNIA 1BMFD 1MBMA 2NU1E 1MAXA 1DUAA 1UVTH 1O3PB 4AORA 3DSPA 4IGDA 3F0PA 1SVPA 2BHGA 2H5CA 3DA9B 5LPRA 2V3OH 1Z8JB 4Y8ZA 1RRKA 4E05H 2BDYA 1SQOA 3NXPA 3O8BA 2H2ZA 3E91A 1XVOA 2H9TH 2ZC9H 1SHYA 4NWKA 3P17H 1B0FA 5I46H 3EE7A 5EPNA 2FLBH 3MO6A 4X1NU 4FXGH 3ZVCA 1OX1A 2WV9A 1A3EH 3S9BA 1M9UA 2BY9X 3TNTA 2ZTZA 1GJ7B 2NWNA 2D26C 1BUIA 3SU4A 2WUCA 3U9AH 1ELGA 2OCVB 5PTPA 2J34A 3PLKA 1BTXA 1O34A 1Y5BT 2XOKD 2KAIA 3MU4A 1UTOA 1L1GA 1TGTA 4IN1A 3EGKH 4Z0KA 1NRSH 3BG8A 2V7QD 1P11E 1GMCG 1UCYE 4FUJA 4Q7ZA 3PWCA 3RXBA 2EA3A 2J5UA 1GBJA 2ZI2H 5F6MA 1UTMA 1GBEA 5A0AE 1C1SA 3RXSA 2L74A 1C2IA 4X1PU 4B73A 3RXGA 6CHAC 4CRAA 1GI1A 4Q80A 1KXDA 4JZ1A 1UTLM 4FU8A 2F3CE 1GI7B 3TGJE 3BIUH 3TIUA 1J16A 3B9FH 4B76A 1FQ3A 1HFDA 1P0SH 3MTYA 3ZV8A 3F9HA 3ZZ7A 1DWDH 1ELBA 1H9IE 3RMMH 1MMJN 3TGKE 1C2FA 1S6HA 1ELCA 1AIXH 2R0LA 3O8RA 1EP5A 1C5SA 1LVBA 1WYKA 2JJ1D 2ZFPH 2ZHQH 4ABHA 4GHTA 1SFQB 4MNYA 1QB9A 2SNWA 1ETRH 3VFEA 6CHAB 2CN0H 3LGUA 3ZIAD 2BVSH 2L6OA 3A8BA 1EUFA 1TWXB 3D49H 2LPRA 3T29A 4I8GA 2QCYA 2GKVE 2F91A 5FCRA 2WPDD 1A5HA 2CF9H 3AK5A 4ISIH 3MYWA 4CBOA 4NFEA 4NIWA 1O32A 2Z9JA 1CHOF 1O2RA 4A7IB 6LPRA 1KLJH 1GVKB 4AB8A 2D1JA 5KECA 2QXGA 2PKSC 4I8HA 4ESTE 1H9LB 1TAWA 1YP9A 1QNJA 1ZOMA 4BOHA 1A61H 2VJ1A 3RXPA 1DY9A 3D23A 4ABJA 5JB8S 2KCYA 5L2ZH 4O3TA 5IYTA 1V2ST 1ZJDA 1TMUH 2GV6A 4K1EA 4ZMAH 3GDUA 1UCYK 1BIOA 2Z3EA 1S5SA 3ATMA 2PLXA 3DT0H 1PPCE 1XVMA 4NA9H 2B9LA 1XUIA 2FOAA 5E2OA 3ZVEA 2QA9E 4Q63A 1TNKA 2AMQA 2BDGA 1A3BH 2VIVA 1P02A 2A31A 2PKSB 1SBWA 1MTNC 1E1RD 5ABWA 5A8YA 1P03A 4I33A 3ZZDA 2GT8A 1YF4A 8LPRA 4RKJB 1MZAA 2J97A 3A7ZA 2ZDAH 4DGJA 4K60A 2W7UA 3W95A 4K1SA 2ZGCA 1E79D 3HPTB 1AZZA 1LVOA 2Y6TA 2EI6A 2P59A 3RXLA 1QJ7B 2Q6DA 2RDLA 3GICB 2G4TA 2ZGHA 4WY3A 4ZKRU 2ASUB 4CHAC 2BQ7B 2CJIA 2ZG0H 1Y3XA 1EPTA 1MTNB 3SQHE 3OYPA 1NRPH 1AY6H 2WPKS 1SSXA 2XNDD 1AZ8A 1C1RA 2P94A 3SJOA 3N7EA 2AFQB 3BTGE 2PUXB 2O8WA 2VIWA 3RC5A 5HM9A 1GBTA 3MH4A 1OYQA 4AX9H 4INKA 3MH6A 1O3KA 1BB0B 2RDEA 4GLYA 1C2JA 3PMJA 1AFQC 2J4IA 2WUBA 1GI9B 2UUKB 4CHAB 2QXIA 3ZVDA 3FAOA 1BOQA 5B6OA 5JBTA 1XXDA 5DP7A 2HNTE 3RXHA 1Q3XA 1OXGA 1ACBE 1TGNA 3BIVH 2AYWA 2FESH 3NRLA 1GBDA 1DPOA 1MTSA 3RXIA 1O37A 3EA9A 1AI8H 1NS3A 1VITF 3HGNA 5FHTA 1OWKA 1J15A 1SGTA 3OX7U 1AFQB 1XUGA 5FAHA 5BPEA 1AMHA 1SI5H 2WPJS 4UE7H 1PQ5A 2ZDKA 1A5GH 2ALPA 3PV5A 1OP2A 2GCTC 1F0RA 1PYTD 2GJGA 2BX4A 2CMYA 1C1NA 2EI8A 1KTSB 1TBZH 3UTUH 3RXDA 5I25A 4FUGA 1IHTH 4HI3A 1TX7A 3WY8A 1E36B 1P12E 4B2AA 2ZQ1A 2VWMA 3HKJB 2XCFA 1BRBE
chains in the Genus database with same CATH topology
1DXWA 1H8DH 3BTWE 1QL9A 4RKOB 3A7YA 4HFPB 3SW2B 3I77A 1IQJA 1DWBH 4AFZA 1P2OA 2GCTB 4XBDA 1SGEE 2J38A 3KQEA 3RUOA 1DLKB 5ETXA 1C5VA 1O2VA 7LPRA 4GPGA 2HGTH 1TMTH 2A5IA 1CT0E 2B5TB 4AN7A 2Z9LA 4H6TA 2ZHFH 4WVPE 1QRWA 4MPVA 4NG9H 1PPGE 5ESBA 5E2PA 3SNEA 3GY4A 4JMYA 2PKAA 1AHTH 3GY6A 1YKTA 1TQ0B 2BDHA 1GJ4H 5GCHG 4IW4E 1MZDA 2R3UA 4MLFB 3SU3A 1DS2E 3ATIA 2AIPA 1A46H 2ZP0H 1O2HA 4AZ2B 3RP2A 1JBUH 5EXMA 9ESTA 1E37B 2VVCA 4GVUA 3VXFH 5A2MH 1SPJA 1ANBA 1EZQA 4U2WA 1SGNE 2CHAC 1IQHA 3NPSA 2FOCA 3URCA 1Y8TA 1GHBF 3RMOH 1AU8A 3VEQB 3V0XA 1DANH 1Q2WA 3C1KA 3T2NA 2RG3A 1O2LA 2O8LA 2BD4A 2J92A 3A8AA 1MU6B 1H4WA 1GJDB 5A8ZA 1L1JA 2PUQH 1GBFA 5TJXA 2G81E 5DP9A 1MTWA 1Y3WA 3MO9A 1TONA 1KXBA 3GCTG 3BEIB 2ANKH 3AAUA 1TBRH 2PW8H 2D8WA 3RLWH 3MMGA 1TIOA 3SHCH 2CHAB 2GZ9A 2BTCE 1SGFA 1GJCB 2EEKA 1AN1E 4U32A 4WMEA 1QR3E 1FY4A 2C4FH 1GL0E 5A8XA 1GJBB 1HJ8A 2P8OB 1GL1A 2G8TA 3MNSA 2FDAA 3GY3A 1INCA 2XC4A 2BXTH 5DP4A 4AFUA 4H4FA 2BD2A 1DE7H 5T6DA 2CV3A 3ZZAA 5C20A 2A4OA 4K3JA 2Y7ZA 3LH3A 4NZQA 3SJ8A 4DOQA 4UD9H 3SV2H 2P16A 4X8UH 1GMCF 1QB1A 4FUDA 1KXEA 2VGCC 3MNCA 1T31A 2GGVB 1A0LA 2FOGA 1O38A 3U8OH 3EA7A 4R8TB 3RXUA 3QZRA 1DFPA 1DICA 2P95A 1GDNA 2ZHDA 3F68H 5T6FA 3QK1A 1CQQA 5AHGH 4UFGH 3KHVA 1IQNA 3RLYH 1MCTA 1BTWA 3KF2A 1S84A 3A7VA 3F9EA 2G52A 1O5AB 2ILNA 2BX3A 2CGAA 1GG6C 1EPTC 1J8AA 1Z8GA 2O9QA 4WH8A 2VGCB 4BANB 2BDBA 1BHXF 3A7TA 5CE1A 1O2KA 2WYGA 3RXFA 1QJ6B 3DFLA 4X2WA 4D7FA 4X8SH 1GCDA 2TGTA 4FU7A 1HYLA 2OLGA 1GJ9B 1D4PB 4D9RA 2G5VA 1FZZA 1WUNH 2WPMS 4FUCA 1O2QA 1PPEE 2A7HA 3E0NB 1NFUA 3ZZ8A 1W10U 1EPTB 3M3SA 3ESTA 3MH7A 4GSOA 5ESTE 5T6GA 3LKWA 3MO3A 2CF8H 1IQEA 4KTUA 2J9NA 8GCHF 3SUGA 1FY5A 4OS2A 3RXQA 2Z3DA 5GIBA 1D3DB 3A85A 1ZRKA 1TABE 1ZTLA 3KNXA 1NFWA 1C4Y2 1GI6A 3E16B 1YCPH 1IQIA 2BDAA 1FY1A 1NFYA 3ODDA 1G37A 3TK6A 2HVXA 2STBE 4J2YB 1AE8H 1E38B 2YNAA 1GMHG 3G01A 3RXCA 1C4V2 1BT7A 1ABJH 3CENA 2FS8A 4TWYA 3TH2H 3URDA 5JBBS 1Y59T 1OS8A 2SFAA 3HKIB 2SNVA 1TB6H 2A4QA 3QGJA 4I32A 1QBOA 1BHXB 2Z9IA 1O3OA 1YLCA 1AB9B 1CHGA 4O03A 3SNBA 1MBQA 4FVDA 1VR1H 3GCNA 3QUMP 3FP8E 2BDCA 1WTHD 3PTBA 1S82A 2FYQA 4CBNA 1K1PA 1GDQA 1SB1H 3HGPA 2ZDNA 5DKMA 2RA0A 3EQ0H 4ABEA 2ZFQH 3SQEE 3NKKA 4ZHMU 2BXUH 2C8ZB 1FV9A 4R0IA 3SV6A 1KXAA 3VPKA 1HXFH 1SG8B 2FO9A 1BMNH 1QL8A 1GVLA 3SUFA 1FNIA 1C5MD 1G36A 3A7WA 1LPGB 2H1UA 1GGDC 3CS7A 1P04A 1K28D 4BAKB 4M7GA 3U8TH 1Z6EA 5C5NA 2BMGB 1MU8B 4U30A 4IS5A 2QYIA 2SGAA 4AG2A 1TPOA 1GI3A 1HJAC 6GCHG 4F4OC 1SQTA 2ALVA 3ZVAA 4ZKSU 3PM3A 1V6DA 5GDSH 1O3FA 4E06H 1JOUB 1K1IA 1KLTA 1LPKB 1BBRH 4A1TA 3T25A 2Y5HA 1O3HA 1O33A 1IAUA 1GGDB 2ZDMA 4DIIH 4ZKNU 1S85A 2BY5X 2BZ6H 3T28A 2VU8E 3GY8A 5DG6A 4CRFA 4K5ZA 2CXVA 3VGCC 1P3EA 4ABAA 1XXFA 1HJAB 3BTHE 5HYOA 1HRTH 1F0SA 1GJ5H 1O36A 1S0RA 4WXVA 3SGBE 2ZQ2A 3BN9A 5FPTA 1CSOE 1AGJA 3K2UA 3A86A 1XUFA 2ZGBH 1MTVA 1V2QT 1P10A 2VWLA 5C2ZA 1O35A 5J4QA 1TGSZ 1Z8RA 3P92A 1RFNA 1TALA 3ZZBA 1SGPE 1ANCA 1TNGA 3BF6H 4INLA 3LT3A 1KYNA 1K22H 2ZCLP 1C5WB 2FOHA 4MNWA 3Q00A 3LC5A 4Y11E 2ZIQH 4THNH 2Q6GA 4AYVB 1ARCA 3VGCB 2GDEH 1WAYB 3N7OA 1C2LA 1V2JT 2HPPH 3ZVBA 3GY5A 1SOZA 1NRNH 1OYTH 1AFEH 1BZXE 5F8TA 1PQ8A 1YLDA 2ZFRH 3F9GA 2TGAA 3A84A 1HJ9A 5C5OA 2Z7FE 1WQSA 4NA7A 4NIXA 3MI4A 1W12U 2BOKA 4OS7A 3TU7H 2B7DH 1N6YA 1UVPA 5GCHF 4B74A 3FZDA 3OY5U 3SJ9A 3GYLB 1ABIH 1JIMA 3UWJH 1DT2A 2GCHG 2XBXA 1MH0A 1QIXB 1YPKH 2WPLS 1SGDE 2DE9A 1G3BA 2ZGJA 3EA8A 1Z8IB 3SJKA 2F9BH 2V6NA 4XOJA 4MPXA 1ZMNA 1PYTC 3A87A 1C1TA 2ZHWH 3L33A 1O2NA 3RXEA 4DURA 1HCGA 1NU9A 2GZ7A 1JXPA 4D76A 1C1PA 1LKAA 5K7RA 1SL3A 2V35A 1O31A 2TRMA 2BD7A 2C90B 4AOQA 2BLOA 4D7GA 1VITH 2THFB 4RSPA 3QTVH 4GCHF 3SGAE 4ZUHA 4ZHAA 4YT6H 1O2JA 3AW0A 1FAXA 4BAHB 4AYYB 2STAE 2XCNA 3T62A 1EJMA 1P9UA 2IJOB 3ZVGA 1WSSH 2QC2A 5GWZA 1OPHB 4K8YA 3SZNA 5GJ4B 1QL7A 2ZCHP 2ZPSA 4B75A 1BJUA 1BMLA 3UQOA 3GISB 3I78A 1PQ7A 5JBAS 1SGYE 2OC8A 4FUIA 4DJZB 4ZKOU 3PB1E 4TPIZ 3OY6U 1H8IH 4CR9A 1SGIB 1HAYB 8KME2 2XBYA 4IC6A 2VWOA 4E7NA 2OINA 1O2WA 4NWLA 1LDTT 4LZ4B 4I8JA 1NFXA 1ELDE 1HLTH 2I6QA 4BAOB 1S81A 5EW2H 1GBHA 2AH4X 1EJAA 1P06A 2AMPA 1RTKA 2EC9H 1EQ9A 1WBGB 1EOLA 3H5CB 3SU6A 3ZYDA 4DIHH 1EB1H 1J14A 2PHBA 1C5PA 1MKWH 1HB0B 1HXEH 3GDSA 1GBAA 3RU4T 3Q3XA 1L0ZA 3QGNB 2A0QB 1KTTB 3M5NA 3TPIZ 1IHSH 5CHAC 4CRGA 3SNAA 2DUCA 3V13A 3SJIA 3KQBA 5EPYA 1HPGA 5DO4H 1PPFE 1T8MA 2PTCE 3M7UA 4KTCA 3SOSA 4DG4A 1HAVB 3SU5A 3UNRA 3VB4A 4AB9A 1ELFA 1O30A 1QA7A 2H6MA 2TGPZ 1UHBB 2XTTB 5LPEA 1AKSA 4ABFA 2K1QA 1S0QA 3RXMA 1O2OA 2P3UB 1V2VT 3A82A 1OWIA 5CHAB 4F49A 4I8KA 2P93A 3BV9B 1HAPH 1UK3A 2FXRA 3FANA 1XKAC 2R2MB 3E3TA 4OGXA 4X1QU 1TGCA 1C5YB 1BRCE 2ANYA 3SV8A 1F5LA 1DXPA 3FFGA 3MFJA 3D65E 4YT7H 1W11U 2ZFSA 2BLVA 4ZAEA 1ZHMA 5FPYA 3R0FA 1EAWA 3BEFB 1YC0A 1SMFE 1UK4A 1K9OE 3RXTA 4AFSA 1UVSH 1C2HA 5DP8A 5FX6A 1B5GH 3LIWA 1ETSH 4SGAE 3M5LA 3TNSA 1LVYA 1SGFG 3UOUA 1E35B 1Z1IA 3C27B 7GCHG 1UTPA 2W3IA 1UTNA 1WCZA 2VIPA 2FTMA 2A2QH 1FY3A 3OU0A 1K1LA 5FXLA 2FZZA 1TX6A 1IOEA 4O9VA 4TWWA 2SGFE 4ZH8A 5EOKA 1NESE 4Y8XA 1CGHA 4PROA 3LGTA 3VB5A 3SORA 3K65B 3GYMA 1YPEH 1QQUA 1TLDA 4A5TS 3TJUA 4E7RG 2BD5A 1LHFH 2BY6X 1KXFA 4OGYA 3KQDA 1ZSJA 2ZFFH 2W7SA 1ZSKA 1CU1A 3IITA 1AWFH 1C5NH 3MWIU 1OP8A 3ZZ4A 1A1RA 1LPZB 1O2MA 4KELA 1ZPCA 1SLUB 2VVVA 3PLBA 2FOEA 4FU9A 4YOJA 2QY0B 1C2EA 3LH1A 4Y10E 1D3QB 3GCHC 3GCOA 1P2KA 1O3AA 4YZUA 3S7HB 1GMDF 3M7QA 2WPHS 1A0JA 1RIWC 1HIAB 1SQAA 2ZGXH 4YTAA 4B2BA 1G9IE 3FP7E 2A2XH 2XBWA 2PFEA 1OKXA 1XX9A 5E8EH 3UFAA 3RU4D 1SGRE 3SUDA 1GI4A 3GY2A 2QN5T 3FZZA 3L3TA 2Y80A 3M5MA 2PV9B 3PMHB 1GHAF 2TPIZ 3GCHB 3SU2A 1RD3B 2P3TB 2I6SA 4Y7BA 2FYRA 1RIWB 4CR5A 1DWEH 3U1JB 1X7AC 2TIOA 3ZZ9A 2HLCA 4IBLH 3A7XA 4WMDA 3LC3A 3A89A 2BQWB 1FDPA 4NSVA 3LJJA 1O5EH 4BTUB 1TYNA 3SI3H 2P8OC 1XM1A 1YCPM 2AERH 2PSYA 1LHGH 4Y0ZE 1C9PA 1A5IA 1EAXA 3HK6B 4ISOA 1OP0A 3F1SB 1GHYH 1A2CH 2XWBI 3AW1A 2A7JA 5F8ZA 3LGIA 2QV1A 1P8VC 2XRCA 5E0HA 1T7CA 5C3NA 3LJOA 2SGEE 1O3MA 2OTVA 3SUEA 2B0FA 3RU4E 4XE4A 3P70B 1RTLA 1ZGIA 2F9NA 1Y5AT 2R9PA 1UTKA 3TJOA 2OBQA 3M7TA 1L1NA 3BTME 1O2IA 2FEQH 2NU2E 3DD2H 1H1BA 1BMAA 1HDTH 1PFXC 1CHOG 1F2SE 2ZU4A 1YPGH 3PTNA 3JZ2B 4UFDH 1TOMH 1G3CA 2A32A 1W14U 2WV5A 1SLXB 4B71A 2G4UA 5LH8A 8ESTE 1SGCA 4XSKU 1E34B 1VJAU 3MNXA 4FUEA 2H5DA 5EG4A 1V2LT 3MNBA 1Z71A 4J1YA 2BOHB 1GHVH 4OS5A 1PQAA 2ZU2A 2R2WU 1T8NA 1K1NA 1C2GA 3H7OA 2Y5GA 1DVAH 3EAJA 2BDIA 4ZHLU 2ZPRA 1NC6A 3KIDU 1O3CA 1C1QA 3S7KB 3T5FH 3PMAB 1CGIE 4IC5A 3O8CA 1Q31A 1TA6A 3MOCA 5AF9H 5A0CA 1ZR0A 1BJVA 1NM6A 1HBTH 1DM4B 2OQUA 1OWHA 1CO7E 3V3MA 2HOBA 3STJA 3E8LA 2ZDLA 1LO6A 1AKSB 1OSSA 1VZQH 4AG1A 2F9VA 3GY7A 2G55A 3PYHA 5DK1A 1MUEB 2ZZUH 4Y6DA 2QGRA 1XUHA 1GBCA 3W94A 1EAUA 1GJAB 3ATWA 1TFXA 1S6FA 4AFQA 3L6PA 5EQQA 1AB9C 1XUJA 5EU8A 1A0HB 4UFEH 1HNEE 2LNCA 1HAGE 2UWLA 2FMJA 2ANWA 2P3FH 5C1YA 4YESB 2VIOA 1BA8B 2FLRH 4CRBA 1EXFA 1FN8A 4FUFA 1VCPA 3LOXA 4YOIA 2QF0A 2F9UA 2H9HA 4OS4A 1MKXH 1HAVA 3TJVA 1ESTA 5JB9S 1NROH 2FX6A 1UMAH 1ZHRA 1JRSA 1K1MA 1P3CA 3ZZCA 2FOMB 2ZFTA 3FP6E 1HAHH 1UHBA 1O3EA 1UVUH 1P01A 3KN2A 1BRAA 3ZVFA 2FODA 3UIRA 2IOTA 1A7SA 2YNBA 4Z6AH 1F0TA 3AVZA 4ISLA 3TITA 1GBLA 1UK2A 3MU8A 1ELAA 3P6ZB 2OD3B 3T27A 1RTFB 1BTUA 3TLOA 3K6ZA 2BM2A 2ODQA 3ZZ6A 2BVXH 3I29A 3UNQA 5T3HA 2F83A 3RMNH 2C8YB 5AVDA 1FLEE 4JYTA 3U69H 5DJ7A 2HPQH 2FOFA 2J95A 3SU1A 4DCDA 2FI3E 3M35A 3V12A 3BSQA 3LGYA 4AGKA 1IQFA 4XBCA 1BMMH 3A80A 1JWTA 1EAIA 1TE0A 4ABDA 1O2TA 3MH5A 1G2MA 3TK5A 1V2WT 2WV4A 4X0WU 1P2NA 1GI8B 1TQ7B 1GI2A 4ASHA 2GV7A 1D6WA 3RXOA 2UWOA 2RCEA 4NIVA 4OS6A 1LQDB 5DP5A 4D9QA 4Y8YA 1AD8H 1NRQH 1ELEE 1NU7B 5EXLA 1G32B 2AGEX 2O8UA 4X6PA 1C1OA 5GXPA 1O3NA 2WYJA 4JK6A 4O3UA 4DY7B 4JZDH 2NU0E 3MU1A 3S9CA 4HZHA 1JRTA 4LOYH 1CA0C 2ZF0H 1C2DA 1ANDA 1BRUP 1BCUH 1O3JA 1W0YH 4WMFA 5H4IB 5EODA 3NCLA 4K8BA 2BQ6B 4U01A 2OXSA 4ZXYH 2OC7A 5E0GA 1Y3UA 1T8OA 1KDQA 4MQAA 1THPB 3PMBB 4Y0YE 4H42U 3NWUA 3M37A 1GHBG 2Z3CA 1SR5C 1EP6A 4UEHH 5BRRE 1C5XB 1W7XH 2JH0D 1MD7A 4JZFH 1FN6A 1KLIH