4AG1A

Human chymase - fynomer complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 53
structure length 221
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A02
3ATKA 3VB6A 3BG4B 2J34A 3ZZBA 3A80A 4INKA 1SGTA 3OY5U 2XCNA 2ZG0H 1J17T 1KY9A 1PPBH 2BDHA 3LT3A 1DX5M 2BX3A 3LGVA 1BRUP 1VITH 1LVOA 4X2YA 1FIZA 1KXBA 1NT1A 3NXPA 1HPGA 2M5TA 1UMAH 1TGSZ 3ZZ9A 3CS0A 2A5IA 2BLVA 1Y5UT 3PTBA 4O9VA 1P2OA 4I32A 3TPIZ 3RXDA 4INHA 1ETRH 1SGDE 2XXLA 3KNXA 4CR5A 5CE1A 1LQDB 4WY3A 1AZZA 3SJOA 1O37A 1C2HA 4AN7A 1TAWA 2F83A 3UY9A 2Z9IA 1TOCB 4NIXA 3ZV8A 2BDCA 1ZRKA 2ZC9H 1Y3XA 5GCHG 3ZZ3A 1D9IA 2GMTB 1FN6A 2FTMA 1C5XB 2R9PA 2BLOA 3BV9B 1EB1H 1MQ5A 4CH2B 1EAUA 1N1LA 3M7QA 3ZVCA 3RP2A 4Y8YA 3RU4D 4BANB 2JETC 3K6YA 2QGRA 3U69H 4QT8C 2A45B 3A84A 1UVPA 2SGQE 1O31A 2P8OC 3T27A 8GCHF 1BRAA 3SBKA 1BZXE 5HM9A 2TBSA 5FAHA 2BD5A 2HNTC 4ZAEA 4O03A 1O2NA 3SU5A 4AX9H 2OQ5A 3GY8A 3EQ0H 1O3HA 3ZV9A 1SSXA 3LH3A 1GI1A 1Z6EA 1JOUB 1QQ4A 1ANEA 2NU1E 3TH2H 1BRCE 4NWKA 2FP7B 1PJPA 1FXYA 5F8ZA 4Y71A 4AB8A 1GWAA 4DIHH 1Z1JA 3SGQE 1GPZA 2H5CA 1SLVB 1W12U 3CP7A 1BOQA 3KIDU 4UDWH 1LVYA 2FZZA 4DT7B 1A3BH 1GHZA 1XUGA 1EJMA 4VGCC 4AZ2B 3V7TA 3RXLA 6CHAB 2A4OA 2BZAA 1Q3XA 1ESTA 4LK4A 2AERH 1ESBA 4ABBA 2XCFA 1YYY1 7LPRA 3OYPA 1QRXA 1ELFA 3ENSB 2IJOB 2XYAA 1MUEB 1K1LA 5GJ4B 3IITA 2G4TA 1JMOH 5C3NA 2VNTA 1MKXK 2VJ1A 1RRKA 1GJ6A 5LPEA 4LOYH 5I25A 5H4IB 1C4U2 4XSKU 2FS9A 4UD9H 1QNJA 2A4RA 1XMNB 1YBWA 5A8YA 1E35B 1EQ9A 1WYKA 1C2IA 4FUJA 1QB6A 1IQNA 3GY4A 2PKAB 1O36A 3RM2H 1D4PB 2FLBH 1HRTH 1TALA 1KLTA 3SI4H 1C5OH 3UWIA 1HAPH 1MD8A 1WBGB 2GCHG 4Y8ZA 1SGCA 1D6RA 2AMQA 4YESB 2DE9A 1MTWA 2Q6FA 4IC5A 4K2YA 1O2YA 3SUDA 5FXLA 1TMBH 1XKBC 1BMAA 1B5GH 1O5CB 3TNTA 3ZZAA 1GHBF 4CRAA 1OP8A 1BMNH 1LHGH 1P09A 1V2UT 2W3KA 2BMGB 1GMHG 2FYRA 3RXPA 3K2UA 1KLJH 1UTOA 1K1NA 1C5UA 3UIRA 1GMCG 1GGDC 1NRQH 3H5CB 3QO6A 1LKAA 1QA0A 3UFAA 3SHCH 1JRTA 5FPTA 3A8DA 3MNBA 1HGTH 1ZRBA 1K21H 2C8YB 3ZZDA 4MPXA 3DHKH 3SU1A 4AFQA 1RIWB 3MU4A 4XOJA 1ANBA 2YNAA 4YLUA 1J14A 2DE8A 1OYTH 2CMYA 1GMDF 3U1IB 1ZSLA 2AFQB 1SHHB 5F03A 1TPSA 1O2PA 1HAGE 1YPKH 1G37A 4ZXXH 3AAUA 2ODQA 1GJDB 1BT7A 1V2TT 1C1QA 2BVXH 3URDA 1FN8A 4BTUB 1DSUA 3STJA 1WUNH 1NU9A 1QR3E 4K3JA 4DCDA 1BTZA 1FMGA 7ESTE 4KTUA 4ABEA 3QLPH 1PQ5A 1SGFA 3NZIA 4J2YB 1ELAA 3G01A 4A1VA 1ZTJA 1UTLM 3SU6A 1P05A 1ANDA 4DY7B 4YOJA 1YLDA 2XC5A 4A1TA 2A32A 2FOGA 2AS9A 4WWYA 3KQEA 3RC6A 4BXWA 4DIIH 4JYTA 4GUXA 2CXVA 1O2OA 4K69A 1N6YA 4GCHF 4ISIH 1GI8B 1O2IA 4K1SA 4B76A 3P95A 1ARBA 1GI3A 1TGBA 1ZPCA 2XC0A 2W5EA 3MNXA 4I8KA 1D6WA 1ZGVA 2Y5FA 4I31A 1TGCA 1VCWA 3A85A 3M5MA 4AYVB 2SGDE 1VJ9U 1FPHH 3O8BA 3A89A 5C1XA 1V2NT 4ISNA 4NZQA 4BOHA 1ZHPA 3TH3H 4JMYA 1JRSA 3LC5A 1GBEA 1PPGE 1C5RA 1CGHA 1W8BH 3PMAB 3F9EA 1EZXC 1K2I1 2KAIB 3BEFB 2D26C 1IQGA 2OLGA 3UNQA 3GDSA 3S7KB 1C1RA 4VGCB 1T8MA 4IMZA 5JB8S 3O8DA 1BJVA 1KXEA 4GSOA 2PLXA 3F6UH 3R3GB 9LPRA 5J4SA 1PQAA 3ODFA 1FPCH 1VCQA 4FXGH 4D7FA 1AB9B 2ZTXA 3A86A 3RLWH 3T29A 3E91A 2HNTE 2VIPA 2XBVA 4X6MA 3TJVA 4KTCA 2TIOA 3KCGH 4X0WU 2D8WA 5EQSA 3V0XA 2QF3A 3P8NA 2G4UA 2C93B 1B0FA 3M5LA 2VB0A 1YCPH 3GY3A 1GI2A 1FLEE 4O3TA 1KTTB 3RXSA 1SQOA 1O35A 2ZFRH 3EYDA 5FX6A 1RTFB 1YLCA 5EQRA 1KIGH 1DWEH 4WF8A 4XBBA 1HV7A 1EZQA 4NIVA 1SG8B 4HFPB 2P3UB 4NA8A 1GG6C 4BAOB 2XRCA 1H9HE 2JH6D 2ZFFH 4ISOA 1DWDH 5GIBA 2FWWA 3MH7A 1CT4E 1YM0A 3FANA 4ZKRU 4R8TB 1C5MD 1FNIA 1A1RA 1TGNA 3RXIA 1ZYOA 3ITIA 1CHGA 1W11U 1MTNC 4AFUA 7KMEH 1DY9A 2TRMA 1DS2E 3M5OA 2OCVB 1GBLA 1NROH 1T8NA 4RKOB 5DP9A 3SU4A 1DVAH 1DFPA 2CJIA 2ZP0H 1GHVH 3ZZ7A 3KQBA 1QL7A 1GI0A 2GP9B 2FODA 1GL1A 1E34B 4DW2U 3LIWA 1Y5BT 4Q80A 4B74A 3D65E 4K1TA 3QX5H 5FHTA 3F9HA 5HM2A 1Y3YA 1P04A 2R0LA 1C9TA 2ASUB 2OD3B 1TBZH 3P6ZB 1BTXA 1QFKH 2A0QB 2BD9A 2W7UA 3MU1A 2PTNA 1TRMA 1MH0A 3PWBA 1MBQA 2Z9KA 1HJAB 3QZRA 2R3YA 1LO6A 4NFFA 1BRBE 1CT0E 2GZ8A 1C2DA 5A0BA 1T7CA 4Q2KA 1NRPH 1BBRE 4IW4E 1EAXA 5C1UA 2GVFA 1OP0A 1N8OB 1G32B 1THSH 3HK3B 3BTHE 2TGAA 4ABGA 1YCPK 1YPEH 1O2WA 1IQFA 4CHAC 3UOUA 1YCPM 1DUAA 1FI8A 2ZIQH 1CBWC 3GY7A 1IQHA 1KTSB 2BVRH 3I29A 3LKWA 2G5VA 1E36B 2FYQA 4DVAU 1OWJA 1FONA 1GBMA 1GBDA 2Q6GA 4KGAA 4JYUH 2DUCA 1IQMA 5EG4A 1EOLA 2ZTZA 1G2MA 5AHGH 2PSYA 4NWLA 3MWIU 2QXIA 1ZSKA 2ZO3H 2CGAA 2Y5HA 5K0HA 4Y8XA 4Y76A 4CREA 1TGTA 2TGDA 2ZHFH 3V12A 1SHYA 3M3TA 3NUMA 1IQKA 5DK1A 5GDSH 4YM9A 2AMDA 2FPZA 1HXFH 1P02A 3QZQA 3S69A 4ZUHA 2A7JA 1GBBA 1P06A 1GHXH 2BX4A 2ZPRA 4WH8A 1MZAA 3BEIB 4AG2A 5GWZA 2XNIA 4MNVA 3GDVA 4K1EA 3E6PH 1TNGA 3L6PA 3VEQB 4O97A 1ZMJA 2PGQB 1SLUB 4JZFH 5GPIB 1TYNA 2O8WA 5HGGA 4UFFH 3SU0A 4OS7A 3P70B 1DICA 2Q6DA 2QY0B 2OBQA 2ALVA 2VGCB 3V13A 3TLOA 1E0FD 1GHAF 4A5TS 2FOCA 1ELCA 3H7OA 1EPTC 5TCAA 2EC9H 3TIUA 2FOFA 1KSNA 1TONA 1EAWA 3M35A 3QK1A 1DUEA 1O5EH 1TB6H 2HVXA 1SGPE 5EU8A 2NU2E 1DLKB 5C5NA 4KP0A 4ZH8A 1S6FA 2ZDNA 4NFEA 3PWCA 2OTVA 2RA3A 4AG1A 2ZQ2A 2V6NA 2C90B 1MKWH 4BTTB 4Q7XA 2RDLA 2THFB 2WPKS 4GPGA 2PSXA 1V2MT 1S84A 2SFAA 2Z94A 3STIA 2FESH 4TYDA 5L30H 4RKJB 3U1JB 1GHAG 1O3IA 4X1PU 2F9VA 4IN1A 4E7RG 2GCTC 5SGAE 1VZQH 5ESBA 4LZ1H 3EAJA 5JPMH 1OX1A 1OXGA 3C1KA 1MKWK 4JYVH 3RC5A 1O2MA 3SJKA 1AWFH 1A5IA 1LHEH 1NU7B 2IOTA 3SNAA 1C2GA 1EATA 2Y82A 1AUTC 2BD7A 1DITH 4KKDA 1EP5A 2VWMA 2BQWB 1WV7H 1O39A 2ZDAH 2ZNKH 2GZ7A 1XX9A 3MHWU 1SFIA 2SGEE 1P2NA 5LPFA 3PLBA 2STAE 2ZDKA 1L4ZA 3MNSA 2CHAB 1HBTH 1B0EA 1L4DA 4JZIA 3F68H 1C1OA 1YC0A 3BTDE 1A2CH 2GZ9A 2J92A 3C27B 4OS2A 1ELEE 1D3QB 5ETXA 3RXGA 1FY5A 4X8VH 5EPNA 5TJXA 3A7WA 1P8VC 4AB9A 2BVSH 1GHYH 1P9SA 2FX6A 1V2RT 2XW9A 2B5TB 3GCTG 6ESTA 2P59A 4I8LA 4UEHH 2ANKH 8KME2 4GCHG 1ANCA 3ZZ6A 1TMUH 4XBCA 2Z9GA 2PFEA 3TNSA 5FCKA 5BPEA 4MPVA 2ZU3A 1GI6A 5FCRA 1G3DA 3PO1B 1GDNA 3Q77A 4H6SB 3RU4T 2ZFQH 1CQQA 2OBOA 1UTPA 1TIOA 4TY7A 1HAVA 4CRGA 4DGJA 1C5PA 4RSPA 1YPMH 1GGDB 1LTOA 3NCLA 2ZCLP 2V3OH 3OTJE 3RXRA 3SQEE 2JH0D 4ZHMU 5AFYH 3RXHA 1SLXB 4D7GA 3LJJA 5EXLA 4YOGA 1S83A 1LHDH 4X6PA 2FEQH 1A4WH 2B0FA 3JZ1B 3S9CA 1T31A 4CHAB 1WQSA 1RIWC 1ZMNA 2ZGCA 1AVGH 4I8JA 1NN6A 1T4VH 2BTCE 4WXVA 4HI3A 4ABJA 1N6XA 1XUKA 1C5VA 1CSOE 2W3IA 1GBKA 2IN2A 1G3BA 3EA7A 3SW2B 2F9UA 1P57B 1C2LA 5EW2H 1O33A 4I8HA 2OP9A 2WYGA 3A7XA 1YPHE 2ZDLA 1O2TA 4DG4A 1GJCB 3KQDA 3A87A 3I77A 1NRSH 3T25A 1SVPA 2BD2A 5EW1H 3TJOA 3LH1A 3SQHE 1MMJN 4Y10E 2ZKSA 1L1NA 3ATMA 3MYWA 3RU4E 1O5DH 3TITA 4LXBH 1T8OA 1SMFE 3UR6A 3DA9B 3SJ9A 3H7TA 4NG9H 1TPAE 1D3TB 4IN2A 1SOTA 3SJIA 4X8UH 1C5WB 2ZU4A 3RXOA 1ZJKA 4IBLH 4K5ZA 1OKXA 1QA7A 4B2BA 1V6DA 3LC3A 1KXAA 4KTSA 5A8XA 8LPRA 3FZDA 2HALA 4MNWA 4K60A 4Y0ZE 3R0FA 1O3GA 1HIAA 2QA9E 2UWOA 3UQOA 5F6MA 2AH4X 1OWHA 2GD4B 1OWDA 1TA2A 4ZHAA 2H9HA 2Z3EA 1BTWA 3M36A 1BUIA 1G9IE 1ORFA 8ESTE 1UK3A 2ZFPH 4GHQA 4D9QA 2RG3A 2ZGHA 4IC6A 1GJAB 2QXJA 1JIRA 1QL8A 2GGVB 5JBTA 3MO6A 5LGOA 4MG3A 5E0GA 1HUTH 1ELGA 3O8CA 1O3OA 1K1OA 3RXJA 5L6NH 3B23B 3E0PB 1ELBA 1AMHA 1CGIE 2UUFB 2QXHA 1G3EA 4Y7AA 1ZR0A 2P16A 1QBNA 1K1PA 5JB9S 3EGKH 1P11E 2FXRA 4CR9A 2P8OB 3RXVA 1OP2A 4ISHH 1ACBE 2ZZUH 3GYLB 3F9GA 1OWEA 1FDPA 2QXGA 1L1GA 4Q7ZA 4B75A 3P92A 1IQIA 3B9FH 5DP3A 1SQTA 4MLFB 4F4OC 1CVWH 2ODYB 1ZTKA 2BD3A 3U8TH 4FU7A 1A61H 1O5FH 3QN7A 1MAYA 2R0KA 1ZHMA 1H8IH 2A4GA 1FIWA 2HOBA 1XUJA 2SNVA 2BYAX 4IGDA 2FOAA 2BDAA 3KL6A 1GBHA 1UHBA 4FUEA 3TU7H 1O5AB 1ETTH 3W94A 3BTQE 4Q7YA 2GCHF 3KHVA 1V2QT 2BY6X 1TLDA 5DP6A 3LDXH 4X1QU 1INCA 1C4Y2 1QCPA 3T5FH 1DWBH 3U9AH 1SGRE 3BG8A 1BDAA 3GCHB 1P3EA 1LVBA 5E0JA 2C4FH 2HGTH 3TJUA 1HLTH 5FPSA 4A6LA 2D1JA 2LPRA 2OQUA 4I33A 3HATH 3PM3A 1YGCH 1MQ6A 3AASA 3ZVDA 3BIVH 1HYLA 3A8CA 4NZLA 2EEKA 1MTVA 2KAIA 3L3TA 3BG4C 1TNHA 3ATLA 2ZGJA 2BY9X 2B8OH 1QIXB 3K65B 2C3SA 3GDUA 5FPYA 1NM6A 1F0UA 5C1YA 4X1NU 1C5NH 2PW8H 1U6QA 3ZZ5A 1FY1A 1C2MA 1HAZB 1Z6JH 1F92A 2GT8A 1P9UA 1S81A 1GJ7B 1NS3A 2BD8A 1OWKA 2ZU2A 2H5DA 1J16A 2OUAA 3D49H 5DP4A 1EPTA 3VFEA 3PLKA 4FUCA 1RFNA 2WV4A 1AVWA 3SU2A 2BDYA 2ZHQH 1IAUA 2ANYA 2VIVA 1C5QA 1LCYA 1S0QA 1HAIH 2VWNA 3TGJE 1C1NA 2BY8X 2Z7FE 1WCZA 2UWLA 3PTNA 1EKBB 2FIRH 1O2HA 1XM1A 1TBRH 2XBWA 4YOIA 6LPRA 5EQQA 1C5TA 1BMLA 2WPHS 1AGJA 1SB1H 3SGAE 2EI7A 1OYQA 2G55A 4FVBA 1WQVH 4MQAA 2GDDA 5AVDA 2D2DA 2WPLS 2AIPA 4FUGA 3A81A 4MPWA 2HLCA 1C2FA 3PLPA 2VIWA 1ZHRA 3A7TA 2QYIA 3RMMH 3MO3A 1TFXA 1BBRK 3CENA 3VGCB 3SNCA 1O2KA 2VIOA 2PUXB 3BIUH 3ZVBA 4OS1A 1CO7E 1YPGH 3DT0H 5K7RA 1W0ZU 1BQYA 1RS0A 1SL3A 2WUCA 3A7ZA 3SGBE 1IQJA 4ABFA 1O3JA 1O3MA 1ZGIA 3A82A 2FDAA 2HNTF 1XVOA 4O3UA 2SNWA 3UPEA 1V2LT 3HKJB 3M5NA 1S82A 1X7AC 5F8TA 1IHTH 4MDSA 1ZPZA 1NO9H 3QWCH 5LH8A 1DE7H 2YOLA 5C5OA 1CE5A 1FAXA 1GBIA 2ZCHP 2FOBA 1NFWA 1UTKA 1AQ7A 2FS8A 5DGJA 1O3PB 2J2UA 1TX8A 1UVSH 1KXCA 4TWWA 3GCOA 1NESE 1K1JA 1QL9A 4NCYA 3EA9A 4UONA 1AUJA 4OS6A 5DPAA 2H1UA 2V0BA 1T32A 5IYTA 1Y59T 4DJZB 2ZWLH 1TNLA 1GBTA 5JBBS 1QRWA 4AOQA 3O8RA 3SN8A 1NTPA 1SGIB 1C2JA 3RM0H 4CBNA 5FBIA 1TX6A 1P01A 3U8RH 3KF2A 3M3VA 2A31A 3RXBA 3SI3H 3SZNA 2FI3E 1TPPA 3MO9A 1SGEE 3ZVGA 1HAXB 4ZHLU 4JK6A 1O3EA 3AAVA 1YPLH 4CRBA 2QAAA 1O2QA 3TK5A 3VXFH 1NY22 2EI6A 3UTUH 1XVMA 1ETSH 1HJ9A 2PUQH 3MI4A 3RXAA 1FY3A 2C8WB 4AYYB 1FZZA 1TQ0B 1O34A 1SPJA 1G30B 5AF9H 1GHBG 1P03A 1EAIA 1AE5A 3M61U 2XC4A 3BTGE 4WMEA 3DD2H 4X1SU 5L2YH 1TBQH 1EB2A 2Y5GA 4X8SH 2UWPA 5DP5A 2O9QA 1TRYA 5GCHF 1CA8B 4A1XA 4TY6A 1XUFA 2J94A 1DANH 2F9NA 3MH4A 4X2VA 2AEIH 3URCA 1H4WA 1UK2A 1SFQB 2PHBA 1IHSH 1C5ZB 1GMHF 1NRRH 3SUEA 2NU0E 4ABAA 3M37A 4Z0KA 4U2WA 4GVUA 4MVNA 1A0LA 1VITF 2AGEX 2WPMS 3SV8A 2BB4A 1C5LH 1P2MA 1PPCE 1PQ7A 1F0RA 5E2OA 1SQAA 2F9PA 4TWYA 2R2MB 3CS7A 1O2SA 2BOHB 5FX5A 4X1RU 1PYTD 2QCYA 3KGPA 2BHGA 1LHFH 3ATWA 1HDTH 3PROA 1V2OT 3TK9A 4B1TA 2ZU5A 3AVZA 2A1DB 2Z9LA 5T6GA 1W10U 3OY6U 3SNDA 1GL0E 3RXCA 1F0TA 1VITG 2BXTH 3UNRA 4RN6A 1EUFA 1V3XA 3KEEA 4NSVA 1THPB 2PGBB 1HAVB 1PQ8A 2NU3E 1ARCA 3E3TA 9ESTA 1TE0A 1O5BB 3TGIE 1MKXH 3EDXB 2A5AA 5EPYA 1CGJE 5DP8A 3KN2A 4DOQA 1C2EA 6GCHG 2G52A 1XUHA 1AKSB 1AY6H 1J8AA 1O2ZA 1HIAB 4MNXA 5HXFA 1K28D 4FUDA 5EODA 2R2WU 1KYNA 1S85A 1P2KA 1HXEH 1V2WT 1NFXA 2Y6TA 1ZMLA 3FP7E 1EZSC 2ZQ1A 4WMFA 2A2QH 3PO1C 3UUZA 2GT7A 1A0HB 1P10A 4OGYA 5F8XA 5DO4H 3E1XB 4BAHB 3FP8E 3ZZ8A 4CRFA 3ZVEA 1F0SA 1OPHB 1LDTT 3S9AA 1TWXB 1W0YH 3SOSA 5I46H 1O3BA 4WXIA 1ELDE 4UE7H 5HYOA 1QGFA 2V35A 3ZZCA 1V2JT 1UTNA 1W7GH 1UTJA 2ALPA 4NA9H 1V2VT 1VR1H 1BIOA 1ZLRA 1TMTH 2CN0H 5LPRA 1WAYB 1Z7KA 1MU8B 3RMLH 2FI4E 1HAOH 4FUBA 2C8ZB 1CHOF 1XKAC 1PPEE 1G36A 1UVOA 2G8TA 2VU8E 3FP6E 1LPGB 4U32A 3SUFA 3TH4H 3VB4A 4CRCA 5EOKA 3SV6A 3UREA 1Y3VA 1GBCA 1O3AA 1H8DH 1DXPA 2BDGA 1W3CA 2OC7A 2SGAA 2P3FH 4E05H 7GCHF 3SJ8A 3VPKA 2BQ7B 1YP9A 2NWNA 3UQVA 4ZMAH 1HJ8A 1WTHD 3LU9B 1EX3A 3ODDA 4XDEA 1DOJA 1GJ5H 3SV9A 4SGAE 1NFUA 1KLIH 3PMBB 4X2WA 1WSSH 5JBAS 1UHBB 2WV5A 4NSYA 1SC8U 1RXPA 3MNCA 5T6DA 4BXSA 4FU8A 2B7DH 4CH8B 1Z71A 3K6ZA 2NU4E 1H9IE 3M3SA 3MFJA 3UNSA 4X2XA 2A4QA 1NPMA 1SOZA 2VVVA 4UFEH 4B2CA 3N7OA 1GCDA 3K9XB 3P8OA 2A7CA 1GJ9B 5HMAA 1O2UA 1UCYK 3FZZA 1HCGA 2ZECA 1SGYE 3SO3A 6CHAC 4ZKNU 1O2GH 1T8LA 4YZUA 3MU8A 5A2MH 4JZ1A 1Q31A 2Y80A 1W2KH 2G00A 3S9BA 1ZOMA 4HZHA 1NFYA 4Y79A 4MNYA 2TGTA 3A88A 3ESTA 4BTIB 3BN9A 1LVMA 3RXKA 4FU9A 1TRNA 1BTPA 1DLEA 1EASA 1LMWB 5PTPA 1XXDA 4YLQH 3GCHC 1GHWH 1UCYH 4Z6AH 1RJXB 4Y6DA 1SLWB 1YF4A 3HKIB 2ZF0H 5JDUB 1DT2A 1CA0B 4UFDH 1AN1E 2ZDMA 1Z8RA 1O5GH 3T62A 1HAHH 3QDZB 1MCTA 3VB5A 3LPRA 4H4FA 1VJAU 1GCTB 2AGGX 2BZ6H 1Z1IA 1PPFE 3ELAH 1MTNB 4ISLA 5JBCS 2J38A 1BMMH 1AO5A 1FY8E 1GBJA 3E0NB 1CU1A 1IQLA 4F49A 4KELA 2WPIS 5DJ7A 3T2NA 1K9OE 3A7VA 2AGIX 4M7GA 3BTEE 2I6QA 1ABJH 2QIQA 1BBRH 3SORA 3GCNA 1GJ8B 1J9CH 1CA0C 1MAXA 2O8MA 1QBOA 1O3LA 2J95A 4FUHA 4Y0YE 5A0CA 1BCUH 1PYTC 3EE0B 1PPHE 4H6TA 1TQ7B 1NC6A 2BLQA 1G3CA 2BLWA 2K1QA 1DXWA 2Q1JA 1DSTA 3RXMA 1O3FA 4ASHA 1MZDA 2WUBA 4A7IB 1HB0B 1JIMA 3ATIA 1EJNA 1S0RA 4D8NA 3P8FA 1O0DH 1OWIA 3GOVB 4YTAA 1HAYB 2G5NA 2GTBA 3TGKE 1UK4A 1C1PA 2ZFTA 4FUIA 1GI4A 2GDEH 3Q3XA 4JZDH 2OXSA 3SNEA 1C5YB 1JBUH 1DM4B 3RXTA 1AU8A 1YKTA 2XWAA 2VINA 2ZHWH 3SHAH 2FOEA 3ZVFA 1JXPA 5A8ZA 8GCHG 5EXNA 2PTCE 4XBDA 3B8JA 2J9NA 2VWOA 3A83A 3Q00A 1WOFA 2FMJA 4CBOA 1F2SE 4Y7BA 1JWTA 3QTVH 1Y3UA 3PMJA 1C1UH 2UUYA 4NIWA 2UUKB 3E90B 2V3HH 3IWMA 2ZI2H 5B6OA 2BQ6B 2GV7A 2O8TA 1D3DB 1BB0B 1QJ1B 3SV2H 1UTMA 4ZROA 1O3CA 1V2ST 3LGIA 2FOMB 1NZQH 1C1WH 4MPUA 1WTGH 5G4BA 5A09A 1O2JA 1QTFA 1Y3WA 3ZZ4A 1W7XH 1UVUH 2UUJB 3QUMP 5EGMA 4PROA 2A5KA 3VXEH 2H2ZA 5T6FA 2GV6A 2W7SA 4OS5A 1C9PA 1GMDG 1P2JA 5BRRE 3RXEA 2ULLA 1V2PT 2FTLE 3A7YA 1QHRB 3TK6A 4I8GA 1O3DA 5E0HA 1GVZA 3PV4A 3SU3A 2AMPA 4X8TH 5ESTE 1F5LA 2OINA 1EPTB 3GY5A 1AE8H 3P8GA 1NRNH 2PKAA 1L0ZA 4HGCA 5E8EH 5T3HA 2Z9JA 1GI9B 3BTME 3MH6A 1QB9A 1XUIA 1PPZA 4E7NA 4H42U 2ZHDA 1C5SA 2OC1A 3RMNH 1ZZZA 3UR9A 2ZGBH 1EP6A 3LGUA 1QY6A 2GMTC 3LOXA 5JYIA 1XXFA 1P12E 1QBVH 4DURA 2RCEA 2ODPA 2JETB 1L2EA 1SI5H 1UJ1A 3GY6A 2TGPZ 1UCYE 3Q3KA 4FUFA 4HTCH 3Q76A 4JK5A 2PV9B 2H9EH 1IQEA 2ANWA 2GCTB 2HPQH 3MH5A 1ZJDA 3QTOH 1ESAA 2O8UA 1YPJH 1F5RA 2QN5T 2YNBA 1PFXC 1T4UH 1WU1A 1HFDA 1AI8H 2A7HA 3DFLA 1H1BA 1QQUA 1TABE 3QGNB 1QB1A 1GI7B 2BOKA 3BF6H 1LPZB 1ELTA 4ABDA 4BAMB 1TNKA 2ZEBA 2H9TH 4J1YA 4INLA 1O30A 2CF9H 3I78A 1O2XA 2AYWA 2TPIZ 4XFQA 1Z8JB 2FM2A 1J15A 4BNRA 2AIQA 1VGCC 3HGNA 1SGQE 1AWHB 1FV9A 2Y81A 5EXMA 3W95A 3TJNA 2ESTE 1TNJA 2Y7XA 4WH6A 5GXPA 1BJUA 3AW1A 1A7SA 1DPOA 3E8LA 1MBMA 1FAKH 2H6MA 3EA8A 2QC2A 4YT7H 4SGBE 4JCNA 2EI8A 1BHXB 2VVUA 1SGNE 3VGCC 1ZTLA 1P2IA 3PYHA 1AIXH 2ANMH 4GAWA 1GMCF 2ZU1A 3OX7U 3LONA 3NKKA 3RC4A 2P93A 4A92A 1GJBB 1B7XB 2O8LA 1K1IA 2EA3A 2HWLB 3HGPA 1UO6A 1A3EH 1Y5AT 4AORA 1IOEA 1O2LA 1W13U 1GVLA 1S6HA 3KQCA 4YT6H 4CRDA 1O32A 1QJ6B 3NPSA 3UWJH 1THRH 5DG6A 2F9OA 4ABHA 1C1VH 2PKSC 1SGFG 1TNIA 2GKVE 3L33A 1ELVA 5J4QA 1FUJA 2JKHA 4NA7A 1E37B 4ESTE 2OC8A 3DUXH 4R0IA 2C8XB 1LPKB 2VVCA 5TCCA 2F91A 3VB3A 1Z8IB 1K1MA 1EXFA 5E2PA 2BM2A 3T26A 1P0SH 4GHTA 4E06H 3LGWA 3IG6B 3SNBA 4D76A 2BDIA 3HPTB 4X6OA 4OS4A 3U98H 3RLYH 2ZHEH 3VB7A 2QV1A 2PWXA 4X6NA 1G2LA 1DDJA 1HNEE 1EJAA 1O3NA 3P17H 2ZPQA 4TPYA 1RGQA 1GBFA 1LKBA 2CHAC 4WJG2 4AGKA 1RTKA 3NK8A 3MOCA 2BY5X 3RDZA 2ZCKP 3TVJB 2HPPH 2SGPE 4U01A 3U8OH 2A2XH 1FJSA 1Z8GA 1LHCH 4MTBA 2BY7X 5C2ZA 3Q3YA 3NWUA 1MCVA 3BTFE 1V2KT 1GVKB 4JZEH 1Q2WA 1ZPBA 3ZYEA 1FY4A 1EOJA 1VGCB 2P95A 1GG6B 2WYJA 4I7YH 5DP7A 1A0JA 2R3UA 4TPIZ 1RTLA 2G51A 4Y11E 4OGXA 1MU6B 1K22H 4BAKB 4GLYA 1AFQC 1D3PB 1SR5C 3LGYA 3SV7A 1MTSA 3GY2A 1E38B 1BHXF 3OU0A 2JH5D 3S0NA 7GCHG 1C2KA 1BTUA 1GDQA 3GCTF 1L1JA 1O3KA 2RA0A 5CHAC 1KXFA 2Z3CA 1MD7A 5L2ZH 4ZKOU 2XWBI 1GJ4H 2ILNA 2Z6BD 2ZA5A 4YO9A 1F5KU 1TX7A 2STBE 3BSQA 4B73A 1C1SA 2P3TB 3JZ2B 3F1SB 5ABWA 2F9BH 2HRVA 3BEUA 5DKMA 4NGAH 2PR3A 3GICB 3QGJA 1AD8H 1DY8A 3RXUA 2WPJS 1C1MA 1LQEA 5CHAB 1GBAA 1UVTH 3M7UA 1QJ7B 1TA6A 1M9UA 3WY8A 3MU5A 4AGJA 2SGFE 3BTWE 4FVDA 1QRZA 1ID5H 1AFQB 1ZSJA 3ZYDA 2QF0A 1OSSA 1TOMH 1YPHC 2FO9A 4WVPE 2ZPSA 1EZUC 2XBYA 1CBWB 2ZGXH 2FOHA 1VCPA 2F3CE 1F7ZA 2VH0A 2J4IA 1CT2E 4B71A 1O2RA 2CF8H 1KDQA 4UFGH 1RD3B 5AFZH 3E16B 2VH6A 3ZVAA 4AFZA 4XE4A 1S5SA 3MU0A 4THNH 1ABIH 2Z3DA 1A46H 2ZFSA 4IMQA 5C20A 2VGCC 2B9LA 3V3MA 2VIQA 1AKSA 4U30A 4WMDA 2P94A 3T28A 1GDUA 1OS8A 3SUGA 5IDKA 1O38A 3RXFA 3D23A 1BITA 2VIDA 1A5GH 3GISB 1MTUA 5C67A 1BA8B 2VWLA 2XTTB 4K8YA 1QURH 4ABIA 1AHTH 2FX4A 1DWCH 1C4V2 2BD4A 3M7TA 2IPHA 1TPOA 1AZ8A 2OC0A 1AB9C 2Y7ZA 1AVXA 2ZTYA 3BTKE 2PKSB 3RMOH 3RUOA 2FI5E 5A0AE 1HJAC 3FVFB 6GCHF 3PMHB 4ZKSU 3GYMA 1P2QA 4AFSA 3D62A 3HK6B 3LGTA 3MTYA 3AW0A 3BTTE 4D9RA 3S7HB 1O2VA 2BXUH 1A5HA 1GI5A 3MMGA 1CHOG 4NIYA 2I6SA 3OSYA 3RXQA 3PB1E 5FBEA 1BTYA 1KXDA 1H9LB 1UTQA 2CV3A 2GX4A 1W14U 1GCTC 4ZXYH 5CMXH 4K8BA 3F9FA 3UOPA 1KDQB 1OOKB 2ZDVH 3FAOA 3A8BA 2LNCA 4LZ4B 1SBWA 3LJOA 3DFJA 3A8AA 2BDBA 1N8OC 1P3CA 2XBXA 2W26A 2FLRH 1Y8TA 3FFGA 4BAQB 2G81E 2WINI 4B2AA 1C1TA 1BTHH 1FQ3A 1AFEH 4IS5A
chains in the Genus database with same CATH superfamily
3ATKA 3VB6A 3BG4B 2J34A 3ZZBA 3A80A 4INKA 1SGTA 3OY5U 2XCNA 2ZG0H 1J17T 1KY9A 5KEDA 1PPBH 2BDHA 3LT3A 1DX5M 2BX3A 3LGVA 1BRUP 1VITH 1LVOA 4X2YA 1FIZA 1KXBA 1NT1A 3NXPA 1HPGA 2M5TA 1UMAH 1TGSZ 3ZZ9A 3CS0A 2A5IA 2BLVA 2KCOA 1Y5UT 3PTBA 4O9VA 1P2OA 4I32A 3TPIZ 3RXDA 4INHA 1ETRH 1SGDE 2XXLA 3KNXA 5KECA 4CR5A 5CE1A 1LQDB 4WY3A 1AZZA 3SJOA 1O37A 1C2HA 4AN7A 1TAWA 2F83A 3UY9A 2Z9IA 1TOCB 4NIXA 3ZV8A 2BDCA 1ZRKA 2ZC9H 1Y3XA 5GCHG 3ZZ3A 1D9IA 3VG8A 2GMTB 1FN6A 2FTMA 1C5XB 2R9PA 2BLOA 5C0TA 3BV9B 1EB1H 1MQ5A 4CH2B 1EAUA 1N1LA 3M7QA 3ZVCA 3EE7A 3RP2A 3U28C 4Y8YA 3RU4D 4BANB 2JETC 3K6YA 2QGRA 3U69H 4QT8C 2A45B 3A84A 1UVPA 2SGQE 1O31A 2P8OC 3T27A 8GCHF 1BRAA 3SBKA 1BZXE 5HM9A 2TBSA 5FAHA 2BD5A 2HNTC 4ZAEA 4O03A 1O2NA 3SU5A 4AX9H 2OQ5A 3GY8A 3EQ0H 1O3HA 3ZV9A 1SSXA 3LH3A 1GI1A 1Z6EA 1JOUB 1QQ4A 1ANEA 2NU1E 3TH2H 1BRCE 4NWKA 2FP7B 1PJPA 1FXYA 3N7DA 5F8ZA 4Y71A 4AB8A 1GWAA 4DIHH 1Z1JA 3SGQE 1GPZA 2H5CA 1SLVB 1W12U 3CP7A 1BOQA 3KIDU 4UDWH 1LVYA 2FZZA 2J5UA 4DT7B 1E1RD 1A3BH 1GHZA 1XUGA 1S6LA 1EJMA 4VGCC 4AZ2B 3V7TA 1WXRA 3RXLA 6CHAB 2A4OA 2BZAA 1Q3XA 1ESTA 4LK4A 2AERH 3N7EA 1ESBA 4ABBA 2XCFA 1YYY1 7LPRA 3OYPA 1QRXA 1ELFA 2KCYA 3ENSB 3OTPA 2IJOB 2XYAA 1MUEB 1K1LA 5GJ4B 3IITA 2G4TA 1JMOH 5C3NA 2VNTA 5EJLA 1MKXK 2VJ1A 2JDID 1RRKA 1GJ6A 5LPEA 4LOYH 5I25A 5H4IB 2J98A 1C4U2 4XSKU 2FS9A 4UD9H 1QNJA 2A4RA 1XMNB 1YBWA 5A8YA 1E35B 1EQ9A 1WYKA 1C2IA 4FUJA 1QB6A 1IQNA 5CDFE 3GY4A 2PKAB 1O36A 3RM2H 1D4PB 2FLBH 1HRTH 1TALA 1KLTA 3SI4H 1C5OH 3UWIA 1HAPH 1MD8A 1WBGB 2GCHG 2PP6A 4Y8ZA 1SGCA 1D6RA 2AMQA 4YESB 1QZ8A 2DE9A 1MTWA 2Q6FA 4IC5A 4K2YA 1O2YA 3SUDA 3WWBA 5FXLA 1TMBH 1XKBC 1BMAA 2KCAA 4ACAA 1B5GH 1O5CB 3TNTA 3ZZAA 1GHBF 3F2HA 4CRAA 1OP8A 1BMNH 1LHGH 1P09A 1V2UT 2W3KA 2BMGB 1GMHG 2FYRA 3RXPA 3K2UA 1KLJH 1UTOA 1K1NA 4ACBA 1C5UA 3UIRA 1GMCG 1GGDC 1NRQH 3H5CB 3QO6A 1LKAA 1QA0A 3UFAA 3SHCH 1JRTA 5FPTA 3A8DA 3MNBA 1HGTH 1ZRBA 1K21H 2C8YB 3ZZDA 4MPXA 3DHKH 3SU1A 4AFQA 1RIWB 3MU4A 4XOJA 5EIYA 1ANBA 2YNAA 4YLUA 1J14A 2DE8A 1OYTH 2CMYA 1GMDF 3U1IB 1ZSLA 2AFQB 1SHHB 5F03A 1TPSA 1O2PA 1HAGE 1YPKH 1G37A 4ZXXH 3AAUA 2ODQA 1GJDB 1BT7A 1V2TT 1C1QA 2BVXH 3URDA 1FN8A 4BTUB 1DSUA 3STJA 1WUNH 1NU9A 1QR3E 4K3JA 4DCDA 1BTZA 1FMGA 7ESTE 4KTUA 4ABEA 3QLPH 1PQ5A 1SGFA 5B6LA 3NZIA 3F2FA 4J2YB 1ELAA 3G01A 4A1VA 1ZTJA 1UTLM 3SU6A 1P05A 1ANDA 4DY7B 4YOJA 1YLDA 2XC5A 4A1TA 2A32A 2FOGA 2AS9A 4WWYA 3KQEA 3RC6A 4BXWA 4DIIH 2IJD1 4JYTA 4GUXA 2CXVA 1O2OA 4K69A 1N6YA 4GCHF 4ISIH 1YWUA 1GI8B 2JJ1D 1O2IA 4K1SA 4B76A 3P95A 1ARBA 2WSSD 1GI3A 1TGBA 1ZPCA 2XC0A 2W5EA 3MNXA 4I8KA 1D6WA 1ZGVA 2Y5FA 4I31A 1TGCA 1VCWA 3A85A 3M5MA 4AYVB 2SGDE 1VJ9U 1FPHH 1K0HA 3O8BA 3A89A 5C1XA 1V2NT 4ISNA 4NZQA 4BOHA 1ZHPA 3TH3H 4JMYA 1JRSA 3LC5A 1GBEA 1PPGE 1C5RA 1CGHA 1W8BH 3PMAB 3F9EA 1EZXC 1K2I1 2KAIB 3BEFB 2D26C 1IQGA 2OLGA 3UNQA 3GDSA 3S7KB 2HVYB 3OFND 1C1RA 4VGCB 1T8MA 4IMZA 5JB8S 3O8DA 1BJVA 1KXEA 4GSOA 2PLXA 3F6UH 3R3GB 9LPRA 5J4SA 1PQAA 3ODFA 1FPCH 1VCQA 4FXGH 4D7FA 1AB9B 2ZTXA 3A86A 3RLWH 3T29A 3E91A 2HNTE 2VIPA 2XBVA 3OE7D 4X6MA 3TJVA 4KTCA 2TIOA 3KCGH 4X0WU 2D8WA 5EQSA 3V0XA 2QF3A 3FN8A 3P8NA 2G4UA 2C93B 1B0FA 3M5LA 2VB0A 1YCPH 3GY3A 1GI2A 1FLEE 4O3TA 1KTTB 3RXSA 1SQOA 1O35A 2ZFRH 3EYDA 5FX6A 1RTFB 1YLCA 5EQRA 1KIGH 1DWEH 4WF8A 4XBBA 1HV7A 1EZQA 4NIVA 1SG8B 4HFPB 2P3UB 4NA8A 1GG6C 4BAOB 2XRCA 1H9HE 2JH6D 2ZFFH 3N99A 4ISOA 1DWDH 5GIBA 2FWWA 3MH7A 1CT4E 1YM0A 3FANA 4ZKRU 4R8TB 1C5MD 1FNIA 1A1RA 1TGNA 3RXIA 1ZYOA 3ITIA 1CHGA 1W11U 1MTNC 4AFUA 7KMEH 1DY9A 2TRMA 1DS2E 3M5OA 2OCVB 1GBLA 1OHHD 1NROH 1T8NA 4RKOB 5DP9A 3SU4A 1DVAH 1DFPA 2CJIA 2ZP0H 1GHVH 3ZZ7A 3KQBA 1QL7A 1GI0A 2GP9B 2FODA 1GL1A 1E34B 4DW2U 3LIWA 1Y5BT 4Q80A 4B74A 3D65E 4K1TA 3QX5H 5FHTA 3F9HA 5HM2A 1Y3YA 1P04A 2R0LA 1C9TA 2ASUB 2OD3B 1TBZH 3P6ZB 1BTXA 1QFKH 2A0QB 2BD9A 2W7UA 3MU1A 2PTNA 1TRMA 1MH0A 3PWBA 1MBQA 2Z9KA 1HJAB 3QZRA 2R3YA 1LO6A 4NFFA 1BRBE 1CT0E 2GZ8A 1C2DA 5A0BA 1T7CA 4Q2KA 1NRPH 1BBRE 4IW4E 1EAXA 5C1UA 2GVFA 1OP0A 1N8OB 4B6EA 1G32B 3UAIC 1THSH 3HK3B 3BTHE 2TGAA 4ABGA 1YCPK 1YPEH 1O2WA 1IQFA 4CHAC 3UOUA 1YCPM 1DUAA 1FI8A 2ZIQH 1CBWC 3GY7A 2LELA 1IQHA 2RDEA 1KTSB 2BVRH 3I29A 3LKWA 2G5VA 1E36B 2FYQA 4DVAU 1OWJA 1FONA 1GBMA 1GBDA 2Q6GA 4KGAA 4JYUH 2DUCA 1IQMA 5EG4A 1EOLA 2ZTZA 1G2MA 5AHGH 2PSYA 4NWLA 3MWIU 2QXIA 1ZSKA 2ZO3H 2CGAA 2Y5HA 5K0HA 4Y8XA 4Y76A 4CREA 1TGTA 2TGDA 2ZHFH 3V12A 4HG6A 1SHYA 3M3TA 3NUMA 1IQKA 5DK1A 5GDSH 4YM9A 2AMDA 2FPZA 1HXFH 1P02A 3QZQA 3S69A 4ZUHA 2A7JA 1GBBA 1P06A 1GHXH 2BX4A 2ZPRA 4WH8A 1MZAA 3BEIB 3KQ5A 4AG2A 5GWZA 2XNIA 4MNVA 3GDVA 4K1EA 2W6ID 3E6PH 1TNGA 3L6PA 3VEQB 4O97A 1ZMJA 2PGQB 1SLUB 4JZFH 5GPIB 1TYNA 2O8WA 2QE7D 5HGGA 4UFFH 3SU0A 4OS7A 3P70B 1DICA 2Q6DA 2QY0B 2OBQA 2ALVA 2VGCB 3V13A 3TLOA 1E0FD 1GHAF 4A5TS 2FOCA 1ELCA 3H7OA 1EPTC 5TCAA 2EC9H 3TIUA 2FOFA 1KSNA 1TONA 1EAWA 3M35A 3QK1A 1DUEA 1O5EH 1TB6H 2HVXA 1SGPE 5EU8A 2NU2E 1DLKB 5C5NA 4KP0A 4ZH8A 1S6FA 2ZDNA 4NFEA 4M9FA 4F55A 3PWCA 2OTVA 1NBMD 2YMSC 2RA3A 4AG1A 2ZQ2A 2V6NA 3UB0A 2C90B 2EQNA 1MKWH 4BTTB 4Q7XA 2RDLA 2THFB 2WPKS 4GPGA 2PSXA 1V2MT 1S84A 4RT0A 2SFAA 2Z94A 3STIA 2FESH 4TYDA 5L30H 4RKJB 3U1JB 1GHAG 1O3IA 4X1PU 2F9VA 4IN1A 4E7RG 2GCTC 5SGAE 1VZQH 5ESBA 4F48B 4LZ1H 3EAJA 5JPMH 2RFKC 1OX1A 5FL7D 1OXGA 1MABB 3C1KA 1MKWK 4JYVH 3RC5A 1O2MA 3SJKA 1AWFH 1A5IA 1LHEH 4FETA 1NU7B 2IOTA 3SNAA 1C2GA 1EATA 2Y82A 1AUTC 2BD7A 1DITH 4KKDA 1EP5A 1W0JD 2VWMA 2BQWB 1WV7H 1O39A 2ZDAH 2ZNKH 2GZ7A 1XX9A 3MHWU 1SFIA 2SGEE 1P2NA 5LPFA 3PLBA 2STAE 2ZDKA 1L4ZA 3MNSA 2CHAB 1HBTH 1B0EA 1L4DA 4JZIA 3F68H 1C1OA 1KMHB 1YC0A 3BTDE 1A2CH 2GZ9A 2J92A 3C27B 4OS2A 1ELEE 1D3QB 5ETXA 3RXGA 1FY5A 4X8VH 5EPNA 5TJXA 3A7WA 1P8VC 4AB9A 2BVSH 1GHYH 1P9SA 2FX6A 4B6FA 1V2RT 2XW9A 2B5TB 3GCTG 6ESTA 2P59A 4I8LA 4UEHH 2ANKH 8KME2 4GCHG 1ANCA 3ZZ6A 1TMUH 4XBCA 2Z9GA 2PFEA 3TNSA 5FCKA 5BPEA 4MPVA 2ZU3A 1GI6A 5F53A 5FCRA 1G3DA 3PO1B 1GDNA 4Z1MD 5EJZA 5HIYA 3Q77A 4H6SB 2QF4A 3RU4T 2ZFQH 1CQQA 2OBOA 1UTPA 1TIOA 4TY7A 1HAVA 4CRGA 4DGJA 1C5PA 4RSPA 1YPMH 1GGDB 1LTOA 4FOUC 3NCLA 2ZCLP 2V3OH 3OTJE 3RXRA 3SQEE 2JH0D 4ZHMU 5AFYH 3RXHA 1SLXB 4D7GA 3LJJA 5EXLA 2YMSD 1H8ED 4YOGA 1S83A 1LHDH 4X6PA 2FEQH 1A4WH 2B0FA 3JZ1B 3S9CA 1T31A 4CHAB 1WQSA 1RIWC 1ZMNA 2ZGCA 1AVGH 4I8JA 1NN6A 1T4VH 2BTCE 4WXVA 4HI3A 4ABJA 2JJ2D 1N6XA 1XUKA 1C5VA 1CSOE 2W3IA 4Q4LA 1GBKA 2IN2A 1G3BA 3EA7A 3SW2B 2F9UA 1P57B 1C2LA 5EW2H 1O33A 4I8HA 2OP9A 2WYGA 3A7XA 1YPHE 2ZDLA 1O2TA 4DG4A 1GJCB 3KQDA 3A87A 3I77A 1NRSH 3T25A 1SVPA 2BD2A 5EW1H 3TJOA 3LH1A 3SQHE 1MMJN 4Y10E 2ZKSA 1L1NA 3ATMA 3MYWA 3RU4E 1O5DH 3TITA 4LXBH 1T8OA 1SMFE 3UR6A 3DA9B 3SJ9A 3H7TA 4NG9H 1TPAE 1D3TB 4IN2A 1SOTA 3SJIA 4X8UH 1C5WB 2ZU4A 2M2AA 3RXOA 1ZJKA 4IBLH 4K5ZA 1OKXA 1QA7A 4B2BA 1V6DA 3LC3A 1KXAA 4KTSA 5A8XA 8LPRA 3FZDA 2HALA 4MNWA 4K60A 4Y0ZE 3R0FA 1O3GA 1HIAA 2QA9E 2UWOA 3UQOA 5F6MA 2AH4X 1OWHA 2GD4B 1OWDA 1TA2A 4ZHAA 2H9HA 2Z3EA 1BTWA 3M36A 1BUIA 1G9IE 1ORFA 8ESTE 1UK3A 2ZFPH 4GHQA 4D9QA 2RG3A 2ZGHA 4IC6A 1GJAB 2QXJA 1JIRA 1QL8A 2GGVB 5JBTA 3MO6A 5LGOA 4MG3A 5E0GA 1HUTH 1ELGA 3O8CA 1O3OA 1K1OA 3RXJA 5L6NH 3B23B 3E0PB 1ELBA 1AMHA 2J97A 1CGIE 2UUFB 2QXHA 1G3EA 4Y7AA 1ZR0A 2P16A 1QBNA 1K1PA 5JB9S 3EGKH 1P11E 2FXRA 4CR9A 2P8OB 3RXVA 1OP2A 4ISHH 1ACBE 2ZZUH 3GYLB 3F9GA 4P02A 1OWEA 2QXGA 1FDPA 1L1GA 4Q7ZA 4B75A 3NRLA 1IQIA 3B9FH 2IPQX 3P92A 5DP3A 1SQTA 4XD7D 4MLFB 1BMFD 4F4OC 1CVWH 1EFRD 2ODYB 1ZTKA 2BD3A 3U8TH 4FU7A 1A61H 1O5FH 3QN7A 1MAYA 2R0KA 1ZHMA 1H8IH 2A4GA 1FIWA 2HOBA 1XUJA 2SNVA 2BYAX 4IGDA 2FOAA 2BDAA 3KL6A 1GBHA 1UHBA 4FUEA 3TU7H 1O5AB 1ETTH 3W94A 3BTQE 4Q7YA 2GCHF 3KHVA 1V2QT 2BY6X 1TLDA 5DP6A 3LDXH 3OEED 4X1QU 1INCA 1C4Y2 1QCPA 3T5FH 1DWBH 3U9AH 1SGRE 3BG8A 3ZIAD 1BDAA 3GCHB 1P3EA 1LVBA 5E0JA 2C4FH 2F4LA 2HGTH 3TJUA 1HLTH 5FPSA 4A6LA 2D1JA 2LPRA 2OQUA 4I33A 3HATH 3PM3A 1YGCH 1MQ6A 3AASA 3ZVDA 3BIVH 1HYLA 3A8CA 4NZLA 4YXWD 2EEKA 1MTVA 2KAIA 3L3TA 3BG4C 1TNHA 3ATLA 2ZGJA 2BY9X 2B8OH 1QIXB 3K65B 2C3SA 3GDUA 5FPYA 1NM6A 5C0UA 1F0UA 5C1YA 4X1NU 1C5NH 2PW8H 1U6QA 3ZZ5A 3DSGA 1FY1A 1C2MA 2KM0A 1HAZB 1Z6JH 1F92A 2GT8A 1P9UA 1S81A 1GJ7B 1NS3A 2BD8A 3F2GA 1OWKA 2ZU2A 2H5DA 1J16A 2OUAA 3D49H 5DP4A 1EPTA 2CK3D 3VFEA 3PLKA 4FUCA 1RFNA 2WV4A 1AVWA 3SU2A 2BDYA 2ZHQH 1IAUA 2ANYA 4Q63A 2VIVA 1C5QA 1LCYA 1S0QA 1HAIH 2VWNA 3TGJE 1C1NA 2BY8X 2Z7FE 1WCZA 2UWLA 3WWFA 3PTNA 1EKBB 2FIRH 1O2HA 3DSPA 1XM1A 1TBRH 2XBWA 4YOIA 6LPRA 5EQQA 1C5TA 1BMLA 2WPHS 1AGJA 1SB1H 3SGAE 2EI7A 1OYQA 2G55A 4FVBA 1WQVH 4MQAA 2GDDA 5AVDA 2D2DA 2WPLS 2AIPA 4FUGA 3A81A 4MPWA 2QF5A 2HLCA 1C2FA 3PLPA 2VIWA 1ZHRA 3A7TA 2QYIA 3RMMH 3MO3A 1TFXA 1BBRK 3CENA 3VGCB 3SNCA 1O2KA 2VIOA 2PUXB 3BIUH 3ZVBA 4OS1A 1CO7E 1YPGH 3DT0H 5K7RA 1W0ZU 1BQYA 1RS0A 1SL3A 2WUCA 3A7ZA 3SGBE 1IQJA 4ABFA 3GS9A 1O3JA 1O3MA 1ZGIA 3A82A 2FDAA 2HNTF 1XVOA 4P00A 4O3UA 2SNWA 3UPEA 1V2LT 3HKJB 3M5NA 1S82A 1X7AC 5F8TA 1IHTH 4MDSA 1ZPZA 1NO9H 3QWCH 5LH8A 1DE7H 2YOLA 5C5OA 1CE5A 1FAXA 1H8HD 1GBIA 2ZCHP 3SZEA 2FOBA 1NFWA 2XOKD 1UTKA 1AQ7A 2FS8A 5DGJA 1O3PB 2J2UA 1TX8A 1UVSH 1KXCA 2LP6A 4TWWA 3GCOA 1NESE 1K1JA 1QL9A 4NCYA 3EA9A 4UONA 1AUJA 4OS6A 5DPAA 2H1UA 2V0BA 1T32A 5IYTA 1Y59T 4AC9A 4DJZB 2ZWLH 1TNLA 5KGOA 1GBTA 5JBBS 1QRWA 4AOQA 3O8RA 3SN8A 1NTPA 1SGIB 1C2JA 3RM0H 4CBNA 1E1QD 1TX6A 5FBIA 1P01A 3U8RH 3KF2A 3M3VA 2A31A 3RXBA 3SI3H 4RT1A 3SZNA 2FI3E 1TPPA 3MO9A 1SGEE 3ZVGA 1HAXB 4ZHLU 3KYGA 1O3EA 4JK6A 3AAVA 1YPLH 3PV5A 4CRBA 2QAAA 1O2QA 3TK5A 3VXFH 1NY22 2EI6A 3UTUH 1XVMA 1ETSH 1HJ9A 2PUQH 3MI4A 3RXAA 1FY3A 2C8WB 4AYYB 1FZZA 1TQ0B 1O34A 1SPJA 1G30B 5AF9H 1GHBG 1P03A 1EAIA 1AE5A 3M61U 2XC4A 3BTGE 4WMEA 3DD2H 4X1SU 5L2YH 1TBQH 1EB2A 2Y5GA 4X8SH 2UWPA 3KYFA 5DP5A 2O9QA 3OEHD 1TRYA 5GCHF 1CA8B 4A1XA 4TY6A 1XUFA 2J94A 1DANH 2F9NA 3MH4A 4X2VA 2AEIH 3URCA 1H4WA 1UK2A 1SFQB 2PHBA 1IHSH 1C5ZB 1GMHF 1NRRH 3SUEA 2NU0E 4ABAA 2EY4C 3AK5A 3M37A 4Z0KA 4U2WA 4GVUA 4MVNA 1A0LA 1VITF 2AGEX 2WPMS 3SV8A 2BB4A 1C5LH 1P2MA 1PPCE 1PQ7A 1F0RA 5E2OA 1SQAA 2F9PA 4TWYA 2R2MB 3CS7A 1O2SA 2BOHB 5FX5A 4X1RU 1PYTD 2QCYA 3KGPA 2BHGA 1LHFH 3ATWA 1HDTH 3PROA 1V2OT 3TK9A 4B1TA 2ZU5A 3AVZA 2A1DB 2Z9LA 5T6GA 1FX0B 1W10U 3OY6U 3SNDA 1GL0E 3RXCA 1F0TA 1VITG 2BXTH 3UNRA 4RN6A 1EUFA 1V3XA 3KEEA 4NSVA 1THPB 2PGBB 1HAVB 1PQ8A 2NU3E 1ARCA 3E3TA 9ESTA 3PRDA 1TE0A 1O5BB 3TGIE 1MKXH 3EDXB 2A5AA 5EPYA 1CGJE 5DP8A 3KN2A 4DOQA 1C2EA 6GCHG 2XNDD 5GNDA 2G52A 1XUHA 1AKSB 1AY6H 1J8AA 1O2ZA 1HIAB 4MNXA 5HXFA 1K28D 4FUDA 5EODA 2R2WU 1KYNA 1S85A 1P2KA 1HXEH 1V2WT 1NFXA 2Y6TA 1ZMLA 3FP7E 1EZSC 2ZQ1A 4WMFA 2A2QH 3PO1C 3UUZA 2GT7A 1A0HB 1P10A 3OAAD 4OGYA 5F8XA 5DO4H 3E1XB 4BAHB 3DSOA 3FP8E 3ZZ8A 4CRFA 3ZVEA 1F0SA 1OPHB 1LDTT 3S9AA 3CNRA 1TWXB 1W0YH 3SOSA 5I46H 1O3BA 4WXIA 1ELDE 4UE7H 5HYOA 1QGFA 1SQRA 2V35A 3ZZCA 5HKKD 1V2JT 1UTNA 1W7GH 1UTJA 2ALPA 4NA9H 1V2VT 1VR1H 1BIOA 1ZLRA 1TMTH 2CN0H 5LPRA 1WAYB 1Z7KA 1MU8B 3RMLH 2FI4E 1YY3A 1HAOH 4FUBA 2C8ZB 1CHOF 1XKAC 2K0QA 1PPEE 1G36A 1UVOA 2G8TA 2VU8E 3FP6E 1LPGB 4U32A 3SUFA 3TH4H 3VB4A 4CRCA 5EOKA 3SV6A 3UREA 1Y3VA 1GBCA 1O3AA 3F3BA 1H8DH 1DXPA 2BDGA 1W3CA 2OC7A 2SGAA 2P3FH 3W1EA 4DT4A 4E05H 7GCHF 3SJ8A 3VPKA 2BQ7B 1YP9A 2NWNA 3UQVA 4ZMAH 1HJ8A 1WTHD 3LU9B 1EX3A 3ODDA 4XDEA 1DOJA 1GJ5H 3SV9A 4SGAE 1NFUA 2L74A 1KLIH 3PMBB 4X2WA 1WSSH 5JBAS 1UHBB 2WV5A 4NSYA 1SC8U 1RXPA 3MNCA 5T6DA 4BXSA 4FU8A 2B7DH 4CH8B 1Z71A 3K6ZA 2NU4E 1W0KD 1H9IE 3M3SA 3MFJA 3UNSA 4X2XA 2A4QA 1NPMA 1SOZA 2VVVA 4UFEH 4B2CA 3N7OA 1GCDA 3K9XB 3P8OA 2A7CA 1GJ9B 5HMAA 1O2UA 1UCYK 3FZZA 1HCGA 2ZECA 1SGYE 3SO3A 6CHAC 4ZKNU 1O2GH 1T8LA 4YZUA 3MU8A 5A2MH 4JZ1A 1Q31A 2Y80A 1W2KH 2G00A 3S9BA 1ZOMA 4HZHA 1NFYA 4Y79A 4MNYA 2TGTA 3A88A 3ESTA 4BTIB 3BN9A 1LVMA 3RXKA 4FU9A 1TRNA 3FOAA 1BTPA 1DLEA 1EASA 1LMWB 5PTPA 1XXDA 4YLQH 3GCHC 1GHWH 1UCYH 4Z6AH 1RJXB 2KR7A 4Y6DA 1SLWB 1YF4A 3HKIB 2VBCA 2ZF0H 5JDUB 1DT2A 1CA0B 4UFDH 1AN1E 2ZDMA 1Z8RA 1O5GH 3T62A 1HAHH 3QDZB 1MCTA 1WDIA 3VB5A 3LPRA 4H4FA 1VJAU 1GCTB 2AGGX 2BZ6H 1Z1IA 1PPFE 3SYJA 3ELAH 1MTNB 4ISLA 5JBCS 2J38A 1BMMH 1AO5A 1FY8E 1GBJA 3E0NB 1CU1A 1IQLA 4F49A 4KELA 2WPIS 5DJ7A 3T2NA 1K9OE 3A7VA 2AGIX 4M7GA 3BTEE 2QIQA 1ABJH 2I6QA 1BBRH 3SORA 3GCNA 1GJ8B 1J9CH 1CA0C 1MAXA 2O8MA 1QBOA 1O3LA 2J95A 4FUHA 4Y0YE 5A0CA 1BCUH 1COWD 1PYTC 3EE0B 1PPHE 4H6TA 1NBME 1TQ7B 1NC6A 2BLQA 1G3CA 2BLWA 2K1QA 1DXWA 2Q1JA 1DSTA 1YLNA 2WHXA 3RXMA 1O3FA 4ASHA 1MZDA 2WUBA 4A7IB 1HB0B 1JIMA 3ATIA 1EJNA 1S0RA 4D8NA 3P8FA 1O0DH 1OWIA 3GOVB 2J98B 4YTAA 1HAYB 2G5NA 2GTBA 3TGKE 1UK4A 1C1PA 2ZFTA 4FUIA 1GI4A 2GDEH 3Q3XA 4JZDH 2OXSA 3SNEA 1C5YB 1JBUH 1DM4B 3RXTA 2F43B 1AU8A 1YKTA 2XWAA 2VINA 2ZHWH 3SHAH 2FOEA 3ZVFA 1JXPA 5A8ZA 8GCHG 5EXNA 2PTCE 4XBDA 3B8JA 2J9NA 2VWOA 3A83A 3Q00A 1WOFA 2FMJA 4TSFD 4CBOA 1F2SE 4Y7BA 2W6JD 1JWTA 3QTVH 1Y3UA 3PMJA 1C1UH 2UUYA 4NIWA 2UUKB 3E90B 2V3HH 3IWMA 2V7QD 2ZI2H 5B6OA 2BQ6B 2GV7A 2O8TA 1D3DB 1BB0B 1QJ1B 5EJ1A 3SV2H 1UTMA 3DCLA 4ZROA 1O3CA 1V2ST 3LGIA 2FOMB 1NZQH 1C1WH 4MPUA 1WTGH 5G4BA 5A09A 1O2JA 1QTFA 1Y3WA 3ZZ4A 1W7XH 1UVUH 2UUJB 3QUMP 5EGMA 4PROA 2A5KA 3VXEH 2H2ZA 3F0PA 5T6FA 2GV6A 2W7SA 4OS5A 1C9PA 1GMDG 1P2JA 4ASUD 5BRRE 3RXEA 2ULLA 1V2PT 2FTLE 3A7YA 1QHRB 3TK6A 4I8GA 1O3DA 5E0HA 1GVZA 3PV4A 3SU3A 2AMPA 4X8TH 2WZQA 5ESTE 1F5LA 2OINA 1EPTB 3GY5A 4XRNA 1AE8H 3P8GA 1NRNH 2PKAA 1L0ZA 4HGCA 2KFWA 5E8EH 5T3HA 2Z9JA 1GI9B 1UW7A 3BTME 3MH6A 1QB9A 1XUIA 1PPZA 4E7NA 4H42U 2ZHDA 1C5SA 2OC1A 3RMNH 1ZZZA 3UR9A 2ZGBH 1EP6A 3LGUA 1QY6A 2GMTC 3LOXA 5JYIA 1XXFA 1P12E 1QBVH 4DURA 2RCEA 2ODPA 2JETB 1L2EA 1SI5H 1UJ1A 3GY6A 2TGPZ 1UCYE 3Q3KA 4FUFA 4HTCH 3Q76A 4JK5A 2PV9B 2H9EH 1IQEA 2ANWA 2GCTB 2HPQH 3MH5A 1ZJDA 3QTOH 4OM9A 1ESAA 2O8UA 1YPJH 1F5RA 2QN5T 2YNBA 1PFXC 1T4UH 1WU1A 1HFDA 4RI0A 1VKYA 1AI8H 2A7HA 3DFLA 1H1BA 1QQUA 1TABE 3QGNB 1QB1A 1GI7B 2BOKA 3BF6H 1LPZB 1ELTA 4ABDA 4BAMB 1TNKA 2ZEBA 2H9TH 4J1YA 4INLA 1O30A 2CF9H 3I78A 1O2XA 2AYWA 2TPIZ 4XFQA 1Z8JB 2FM2A 1J15A 4BNRA 2AIQA 4TT3D 2YMSB 1VGCC 3HGNA 1SGQE 1AWHB 1FV9A 2Y81A 5EXMA 3W95A 3TJNA 2ESTE 1TNJA 2KX4A 2Y7XA 2L6OA 4WH6A 5GXPA 1BJUA 2KZ4A 3AW1A 1A7SA 1DPOA 3E8LA 1MBMA 1FAKH 2H6MA 3EA8A 2QC2A 4YT7H 1E79D 4SGBE 4JCNA 2EI8A 1BHXB 2VVUA 1SGNE 3VGCC 1ZTLA 1P2IA 3PYHA 1AIXH 2ANMH 4GAWA 1GMCF 2ZU1A 3OX7U 3LONA 3NKKA 3RC4A 2P93A 4A92A 1GJBB 1B7XB 2O8LA 1K1IA 2EA3A 2HWLB 3HGPA 1UO6A 1A3EH 1Y5AT 4AORA 1IOEA 1O2LA 1W13U 1GVLA 1S6HA 3KQCA 4YT6H 4CRDA 1O32A 1QJ6B 3NPSA 3UWJH 1THRH 5DG6A 2F9OA 4ABHA 1C1VH 2PKSC 2HLDD 1SGFG 1TNIA 3F0OA 4I86A 2GKVE 3L33A 1ELVA 5J4QA 1FUJA 2JKHA 4NA7A 1E37B 4ESTE 2OC8A 3DUXH 4R0IA 2C8XB 1LPKB 2VVCA 5TCCA 2F91A 3VB3A 1Z8IB 1K1MA 1EXFA 5E2PA 2BM2A 3T26A 1P0SH 4GHTA 4E06H 3LGWA 3IG6B 3SNBA 4D76A 2BDIA 3HPTB 4X6OA 4OS4A 3U98H 3RLYH 4ZCNA 2ZHEH 3VB7A 5C94A 1SKYE 2QV1A 2KCPA 2PWXA 4X6NA 1G2LA 1DDJA 1HNEE 1EJAA 1O3NA 3P17H 2ZPQA 4TPYA 1RGQA 2GJGA 1GBFA 2V3MA 1LKBA 2CHAC 4WJG2 4AGKA 1RTKA 3NK8A 3MOCA 2BY5X 3RDZA 2ZCKP 3TVJB 2HPPH 2SGPE 4U01A 3U8OH 2A2XH 1FJSA 1Z8GA 1LHCH 4MTBA 2BY7X 5C2ZA 3Q3YA 3NWUA 1MCVA 3BTFE 1V2KT 1GVKB 4JZEH 1Q2WA 1ZPBA 3WW7A 1FY4A 1EOJA 3ZYEA 1VGCB 2P95A 1GG6B 2WYJA 4I7YH 2OK5A 5DP7A 1A0JA 2R3UA 4TPIZ 2G51A 1RTLA 4Y11E 4OGXA 1MU6B 1K22H 4BAKB 4GLYA 1AFQC 1D3PB 1SR5C 3LGYA 3SV7A 1MTSA 3GY2A 1E38B 1BHXF 3OU0A 2JH5D 3S0NA 7GCHG 1C2KA 1BTUA 1GDQA 3GCTF 1L1JA 1O3KA 2RA0A 5CHAC 1KXFA 2Z3CA 1MD7A 5L2ZH 4ZKOU 2XWBI 1GJ4H 2ILNA 5C17A 2Z6BD 2ZA5A 4YO9A 3FO8D 1F5KU 1TX7A 2STBE 3BSQA 4B73A 1C1SA 2P3TB 3JZ2B 3F1SB 5ABWA 5DSFA 2F9BH 2HRVA 3BEUA 5DKMA 4NGAH 2WV9A 2PR3A 3GICB 3QGJA 1AD8H 1DY8A 3RXUA 2WPJS 5IK2D 1C1MA 1LQEA 5CHAB 1GBAA 1UVTH 3M7UA 1QJ7B 1TA6A 1M9UA 2K8IA 3WY8A 3MU5A 4AGJA 2SGFE 3BTWE 4FVDA 1QRZA 1ID5H 1AFQB 1ZSJA 3ZYDA 2QF0A 1OSSA 1TOMH 1YPHC 2FO9A 4WVPE 2ZPSA 1EZUC 2XBYA 1CBWB 2ZGXH 2FOHA 1VCPA 2F3CE 1F7ZA 2VH0A 2J4IA 1CT2E 4B71A 1O2RA 2CF8H 1KDQA 4UFGH 1RD3B 5AFZH 3E16B 2VH6A 3ZVAA 4AFZA 4XE4A 2JIZD 1S5SA 3MU0A 4THNH 1ABIH 2Z3DA 1A46H 2ZFSA 4IMQA 5C20A 5CHBA 2VGCC 2B9LA 3V3MA 2VIQA 1AKSA 4U30A 3FKSD 4WMDA 2P94A 3T28A 1GDUA 1OS8A 3SUGA 5IDKA 1O38A 3RXFA 3D23A 1BITA 2VIDA 1A5GH 3H09A 3MQKC 2WPDD 3GISB 1MTUA 5C67A 1BA8B 2VWLA 2XTTB 4K8YA 1QURH 4ABIA 5DN6D 1AHTH 2FX4A 1DWCH 1C4V2 2BD4A 5HIZA 3PV2A 3M7TA 2IPHA 1TPOA 1AZ8A 2OC0A 1AB9C 2Y7ZA 1AVXA 2ZTYA 3BTKE 2PKSB 3RMOH 2AHME 3RUOA 2FI5E 5A0AE 1HJAC 3FVFB 6GCHF 3PMHB 4ZKSU 3GYMA 1P2QA 4AFSA 3D62A 3HK6B 3LGTA 3MTYA 3AW0A 3BTTE 4D9RA 3S7HB 1O2VA 2BXUH 1A5HA 1GI5A 3MMGA 1CHOG 4NIYA 2I6SA 3OSYA 5T1VA 3RXQA 3PB1E 5FBEA 1BTYA 1KXDA 1H9LB 1UTQA 3PRBA 2CV3A 2GX4A 1W14U 1GCTC 4ZXYH 5CMXH 4K8BA 3F9FA 3UOPA 1KDQB 1OOKB 2ZDVH 3FAOA 3A8BA 2LNCA 4LZ4B 1SBWA 3LJOA 3DFJA 3A8AA 2BDBA 1N8OC 1P3CA 2FLRH 2W26A 2XBXA 1Y8TA 3FFGA 4BAQB 2G81E 2WINI 4B2AA 1C1TA 1BTHH 1FQ3A 1AFEH 4IS5A
chains in the Genus database with same CATH topology
3ATKA 3VB6A 3BG4B 2J34A 3ZZBA 3A80A 4INKA 1SGTA 3OY5U 2XCNA 2ZG0H 1J17T 1KY9A 1PPBH 2BDHA 3LT3A 1DX5M 2BX3A 3LGVA 1BRUP 1VITH 1LVOA 4X2YA 1FIZA 1KXBA 1NT1A 3NXPA 1HPGA 2M5TA 1UMAH 1TGSZ 3ZZ9A 3CS0A 2A5IA 2BLVA 1Y5UT 3PTBA 4O9VA 1P2OA 4I32A 3TPIZ 3RXDA 4INHA 1ETRH 1SGDE 2XXLA 3KNXA 4CR5A 5CE1A 1LQDB 4WY3A 1AZZA 3SJOA 1O37A 1C2HA 4AN7A 1TAWA 2F83A 3UY9A 2Z9IA 1TOCB 4NIXA 3ZV8A 2BDCA 1ZRKA 2ZC9H 1Y3XA 5GCHG 3ZZ3A 1D9IA 2GMTB 1FN6A 2FTMA 1C5XB 2R9PA 2BLOA 3BV9B 1EB1H 1MQ5A 4CH2B 1EAUA 1N1LA 3M7QA 3ZVCA 3RP2A 4Y8YA 3RU4D 4BANB 2JETC 3K6YA 2QGRA 3U69H 4QT8C 2A45B 3A84A 1UVPA 2SGQE 1O31A 2P8OC 3T27A 8GCHF 1BRAA 3SBKA 1BZXE 5HM9A 2TBSA 5FAHA 2BD5A 2HNTC 4ZAEA 4O03A 1O2NA 3SU5A 4AX9H 2OQ5A 3GY8A 3EQ0H 1O3HA 3ZV9A 1SSXA 3LH3A 1GI1A 1Z6EA 1JOUB 1QQ4A 1ANEA 2NU1E 3TH2H 1BRCE 4NWKA 2FP7B 1PJPA 1FXYA 5F8ZA 4Y71A 4AB8A 1GWAA 4DIHH 1Z1JA 3SGQE 1GPZA 2H5CA 1SLVB 1W12U 3CP7A 1BOQA 3KIDU 4UDWH 1LVYA 2FZZA 4DT7B 1A3BH 1GHZA 1XUGA 1EJMA 4VGCC 4AZ2B 3V7TA 3RXLA 6CHAB 2A4OA 2BZAA 1Q3XA 1ESTA 4LK4A 2AERH 1ESBA 4ABBA 2XCFA 1YYY1 7LPRA 3OYPA 1QRXA 1ELFA 3ENSB 2IJOB 2XYAA 1MUEB 1K1LA 5GJ4B 3IITA 2G4TA 1JMOH 5C3NA 2VNTA 1MKXK 2VJ1A 1RRKA 1GJ6A 5LPEA 4LOYH 5I25A 5H4IB 1C4U2 4XSKU 2FS9A 4UD9H 1QNJA 2A4RA 1XMNB 1YBWA 5A8YA 1E35B 1EQ9A 1WYKA 1C2IA 4FUJA 1QB6A 1IQNA 3GY4A 2PKAB 1O36A 3RM2H 1D4PB 2FLBH 1HRTH 1TALA 1KLTA 3SI4H 1C5OH 3UWIA 1HAPH 1MD8A 1WBGB 2GCHG 4Y8ZA 1SGCA 1D6RA 2AMQA 4YESB 2DE9A 1MTWA 2Q6FA 4IC5A 4K2YA 1O2YA 3SUDA 5FXLA 1TMBH 1XKBC 1BMAA 1B5GH 1O5CB 3TNTA 3ZZAA 1GHBF 4CRAA 1OP8A 1BMNH 1LHGH 1P09A 1V2UT 2W3KA 2BMGB 1GMHG 2FYRA 3RXPA 3K2UA 1KLJH 1UTOA 1K1NA 1C5UA 3UIRA 1GMCG 1GGDC 1NRQH 3H5CB 3QO6A 1LKAA 1QA0A 3UFAA 3SHCH 1JRTA 5FPTA 3A8DA 3MNBA 1HGTH 1ZRBA 1K21H 2C8YB 3ZZDA 4MPXA 3DHKH 3SU1A 4AFQA 1RIWB 3MU4A 4XOJA 1ANBA 2YNAA 4YLUA 1J14A 2DE8A 1OYTH 2CMYA 1GMDF 3U1IB 1ZSLA 2AFQB 1SHHB 5F03A 1TPSA 1O2PA 1HAGE 1YPKH 1G37A 4ZXXH 3AAUA 2ODQA 1GJDB 1BT7A 1V2TT 1C1QA 2BVXH 3URDA 1FN8A 4BTUB 1DSUA 3STJA 1WUNH 1NU9A 1QR3E 4K3JA 4DCDA 1BTZA 1FMGA 7ESTE 4KTUA 4ABEA 3QLPH 1PQ5A 1SGFA 3NZIA 4J2YB 1ELAA 3G01A 4A1VA 1ZTJA 1UTLM 3SU6A 1P05A 1ANDA 4DY7B 4YOJA 1YLDA 2XC5A 4A1TA 2A32A 2FOGA 2AS9A 4WWYA 3KQEA 3RC6A 4BXWA 4DIIH 4JYTA 4GUXA 2CXVA 1O2OA 4K69A 1N6YA 4GCHF 4ISIH 1GI8B 1O2IA 4K1SA 4B76A 3P95A 1ARBA 1GI3A 1TGBA 1ZPCA 2XC0A 2W5EA 3MNXA 4I8KA 1D6WA 1ZGVA 2Y5FA 4I31A 1TGCA 1VCWA 3A85A 3M5MA 4AYVB 2SGDE 1VJ9U 1FPHH 3O8BA 3A89A 5C1XA 1V2NT 4ISNA 4NZQA 4BOHA 1ZHPA 3TH3H 4JMYA 1JRSA 3LC5A 1GBEA 1PPGE 1C5RA 1CGHA 1W8BH 3PMAB 3F9EA 1EZXC 1K2I1 2KAIB 3BEFB 2D26C 1IQGA 2OLGA 3UNQA 3GDSA 3S7KB 1C1RA 4VGCB 1T8MA 4IMZA 5JB8S 3O8DA 1BJVA 1KXEA 4GSOA 2PLXA 3F6UH 3R3GB 9LPRA 5J4SA 1PQAA 3ODFA 1FPCH 1VCQA 4FXGH 4D7FA 1AB9B 2ZTXA 3A86A 3RLWH 3T29A 3E91A 2HNTE 2VIPA 2XBVA 4X6MA 3TJVA 4KTCA 2TIOA 3KCGH 4X0WU 2D8WA 5EQSA 3V0XA 2QF3A 3P8NA 2G4UA 2C93B 1B0FA 3M5LA 2VB0A 1YCPH 3GY3A 1GI2A 1FLEE 4O3TA 1KTTB 3RXSA 1SQOA 1O35A 2ZFRH 3EYDA 5FX6A 1RTFB 1YLCA 5EQRA 1KIGH 1DWEH 4WF8A 4XBBA 1HV7A 1EZQA 4NIVA 1SG8B 4HFPB 2P3UB 4NA8A 1GG6C 4BAOB 2XRCA 1H9HE 2JH6D 2ZFFH 4ISOA 1DWDH 5GIBA 2FWWA 3MH7A 1CT4E 1YM0A 3FANA 4ZKRU 4R8TB 1C5MD 1FNIA 1A1RA 1TGNA 3RXIA 1ZYOA 3ITIA 1CHGA 1W11U 1MTNC 4AFUA 7KMEH 1DY9A 2TRMA 1DS2E 3M5OA 2OCVB 1GBLA 1NROH 1T8NA 4RKOB 5DP9A 3SU4A 1DVAH 1DFPA 2CJIA 2ZP0H 1GHVH 3ZZ7A 3KQBA 1QL7A 1GI0A 2GP9B 2FODA 1GL1A 1E34B 4DW2U 3LIWA 1Y5BT 4Q80A 4B74A 3D65E 4K1TA 3QX5H 5FHTA 3F9HA 5HM2A 1Y3YA 1P04A 2R0LA 1C9TA 2ASUB 2OD3B 1TBZH 3P6ZB 1BTXA 1QFKH 2A0QB 2BD9A 2W7UA 3MU1A 2PTNA 1TRMA 1MH0A 3PWBA 1MBQA 2Z9KA 1HJAB 3QZRA 2R3YA 1LO6A 4NFFA 1BRBE 1CT0E 2GZ8A 1C2DA 5A0BA 1T7CA 4Q2KA 1NRPH 1BBRE 4IW4E 1EAXA 5C1UA 2GVFA 1OP0A 1N8OB 1G32B 1THSH 3HK3B 3BTHE 2TGAA 4ABGA 1YCPK 1YPEH 1O2WA 1IQFA 4CHAC 3UOUA 1YCPM 1DUAA 1FI8A 2ZIQH 1CBWC 3GY7A 1IQHA 1KTSB 2BVRH 3I29A 3LKWA 2G5VA 1E36B 2FYQA 4DVAU 1OWJA 1FONA 1GBMA 1GBDA 2Q6GA 4KGAA 4JYUH 2DUCA 1IQMA 5EG4A 1EOLA 2ZTZA 1G2MA 5AHGH 2PSYA 4NWLA 3MWIU 2QXIA 1ZSKA 2ZO3H 2CGAA 2Y5HA 5K0HA 4Y8XA 4Y76A 4CREA 1TGTA 2TGDA 2ZHFH 3V12A 1SHYA 3M3TA 3NUMA 1IQKA 5DK1A 5GDSH 4YM9A 2AMDA 2FPZA 1HXFH 1P02A 3QZQA 3S69A 4ZUHA 2A7JA 1GBBA 1P06A 1GHXH 2BX4A 2ZPRA 4WH8A 1MZAA 3BEIB 4AG2A 5GWZA 2XNIA 4MNVA 3GDVA 4K1EA 3E6PH 1TNGA 3L6PA 3VEQB 4O97A 1ZMJA 2PGQB 1SLUB 4JZFH 5GPIB 1TYNA 2O8WA 5HGGA 4UFFH 3SU0A 4OS7A 3P70B 1DICA 2Q6DA 2QY0B 2OBQA 2ALVA 2VGCB 3V13A 3TLOA 1E0FD 1GHAF 4A5TS 2FOCA 1ELCA 3H7OA 1EPTC 5TCAA 2EC9H 3TIUA 2FOFA 1KSNA 1TONA 1EAWA 3M35A 3QK1A 1DUEA 1O5EH 1TB6H 2HVXA 1SGPE 5EU8A 2NU2E 1DLKB 5C5NA 4KP0A 4ZH8A 1S6FA 2ZDNA 4NFEA 3PWCA 2OTVA 2RA3A 4AG1A 2ZQ2A 2V6NA 2C90B 1MKWH 4BTTB 4Q7XA 2RDLA 2THFB 2WPKS 4GPGA 2PSXA 1V2MT 1S84A 2SFAA 2Z94A 3STIA 2FESH 4TYDA 5L30H 4RKJB 3U1JB 1GHAG 1O3IA 4X1PU 2F9VA 4IN1A 4E7RG 2GCTC 5SGAE 1VZQH 5ESBA 4LZ1H 3EAJA 5JPMH 1OX1A 1OXGA 3C1KA 1MKWK 4JYVH 3RC5A 1O2MA 3SJKA 1AWFH 1A5IA 1LHEH 1NU7B 2IOTA 3SNAA 1C2GA 1EATA 2Y82A 1AUTC 2BD7A 1DITH 4KKDA 1EP5A 2VWMA 2BQWB 1WV7H 1O39A 2ZDAH 2ZNKH 2GZ7A 1XX9A 3MHWU 1SFIA 2SGEE 1P2NA 5LPFA 3PLBA 2STAE 2ZDKA 1L4ZA 3MNSA 2CHAB 1HBTH 1B0EA 1L4DA 4JZIA 3F68H 1C1OA 1YC0A 3BTDE 1A2CH 2GZ9A 2J92A 3C27B 4OS2A 1ELEE 1D3QB 5ETXA 3RXGA 1FY5A 4X8VH 5EPNA 5TJXA 3A7WA 1P8VC 4AB9A 2BVSH 1GHYH 1P9SA 2FX6A 1V2RT 2XW9A 2B5TB 3GCTG 6ESTA 2P59A 4I8LA 4UEHH 2ANKH 8KME2 4GCHG 1ANCA 3ZZ6A 1TMUH 4XBCA 2Z9GA 2PFEA 3TNSA 5FCKA 5BPEA 4MPVA 2ZU3A 1GI6A 5FCRA 1G3DA 3PO1B 1GDNA 3Q77A 4H6SB 3RU4T 2ZFQH 1CQQA 2OBOA 1UTPA 1TIOA 4TY7A 1HAVA 4CRGA 4DGJA 1C5PA 4RSPA 1YPMH 1GGDB 1LTOA 3NCLA 2ZCLP 2V3OH 3OTJE 3RXRA 3SQEE 2JH0D 4ZHMU 5AFYH 3RXHA 1SLXB 4D7GA 3LJJA 5EXLA 4YOGA 1S83A 1LHDH 4X6PA 2FEQH 1A4WH 2B0FA 3JZ1B 3S9CA 1T31A 4CHAB 1WQSA 1RIWC 1ZMNA 2ZGCA 1AVGH 4I8JA 1NN6A 1T4VH 2BTCE 4WXVA 4HI3A 4ABJA 1N6XA 1XUKA 1C5VA 1CSOE 2W3IA 1GBKA 2IN2A 1G3BA 3EA7A 3SW2B 2F9UA 1P57B 1C2LA 5EW2H 1O33A 4I8HA 2OP9A 2WYGA 3A7XA 1YPHE 2ZDLA 1O2TA 4DG4A 1GJCB 3KQDA 3A87A 3I77A 1NRSH 3T25A 1SVPA 2BD2A 5EW1H 3TJOA 3LH1A 3SQHE 1MMJN 4Y10E 2ZKSA 1L1NA 3ATMA 3MYWA 3RU4E 1O5DH 3TITA 4LXBH 1T8OA 1SMFE 3UR6A 3DA9B 3SJ9A 3H7TA 4NG9H 1TPAE 1D3TB 4IN2A 1SOTA 3SJIA 4X8UH 1C5WB 2ZU4A 3RXOA 1ZJKA 4IBLH 4K5ZA 1OKXA 1QA7A 4B2BA 1V6DA 3LC3A 1KXAA 4KTSA 5A8XA 8LPRA 3FZDA 2HALA 4MNWA 4K60A 4Y0ZE 3R0FA 1O3GA 1HIAA 2QA9E 2UWOA 3UQOA 5F6MA 2AH4X 1OWHA 2GD4B 1OWDA 1TA2A 4ZHAA 2H9HA 2Z3EA 1BTWA 3M36A 1BUIA 1G9IE 1ORFA 8ESTE 1UK3A 2ZFPH 4GHQA 4D9QA 2RG3A 2ZGHA 4IC6A 1GJAB 2QXJA 1JIRA 1QL8A 2GGVB 5JBTA 3MO6A 5LGOA 4MG3A 5E0GA 1HUTH 1ELGA 3O8CA 1O3OA 1K1OA 3RXJA 5L6NH 3B23B 3E0PB 1ELBA 1AMHA 1CGIE 2UUFB 2QXHA 1G3EA 4Y7AA 1ZR0A 2P16A 1QBNA 1K1PA 5JB9S 3EGKH 1P11E 2FXRA 4CR9A 2P8OB 3RXVA 1OP2A 4ISHH 1ACBE 2ZZUH 3GYLB 3F9GA 1OWEA 1FDPA 2QXGA 1L1GA 4Q7ZA 4B75A 3P92A 1IQIA 3B9FH 5DP3A 1SQTA 4MLFB 4F4OC 1CVWH 2ODYB 1ZTKA 2BD3A 3U8TH 4FU7A 1A61H 1O5FH 3QN7A 1MAYA 2R0KA 1ZHMA 1H8IH 2A4GA 1FIWA 2HOBA 1XUJA 2SNVA 2BYAX 4IGDA 2FOAA 2BDAA 3KL6A 1GBHA 1UHBA 4FUEA 3TU7H 1O5AB 1ETTH 3W94A 3BTQE 4Q7YA 2GCHF 3KHVA 1V2QT 2BY6X 1TLDA 5DP6A 3LDXH 4X1QU 1INCA 1C4Y2 1QCPA 3T5FH 1DWBH 3U9AH 1SGRE 3BG8A 1BDAA 3GCHB 1P3EA 1LVBA 5E0JA 2C4FH 2HGTH 3TJUA 1HLTH 5FPSA 4A6LA 2D1JA 2LPRA 2OQUA 4I33A 3HATH 3PM3A 1YGCH 1MQ6A 3AASA 3ZVDA 3BIVH 1HYLA 3A8CA 4NZLA 2EEKA 1MTVA 2KAIA 3L3TA 3BG4C 1TNHA 3ATLA 2ZGJA 2BY9X 2B8OH 1QIXB 3K65B 2C3SA 3GDUA 5FPYA 1NM6A 1F0UA 5C1YA 4X1NU 1C5NH 2PW8H 1U6QA 3ZZ5A 1FY1A 1C2MA 1HAZB 1Z6JH 1F92A 2GT8A 1P9UA 1S81A 1GJ7B 1NS3A 2BD8A 1OWKA 2ZU2A 2H5DA 1J16A 2OUAA 3D49H 5DP4A 1EPTA 3VFEA 3PLKA 4FUCA 1RFNA 2WV4A 1AVWA 3SU2A 2BDYA 2ZHQH 1IAUA 2ANYA 2VIVA 1C5QA 1LCYA 1S0QA 1HAIH 2VWNA 3TGJE 1C1NA 2BY8X 2Z7FE 1WCZA 2UWLA 3PTNA 1EKBB 2FIRH 1O2HA 1XM1A 1TBRH 2XBWA 4YOIA 6LPRA 5EQQA 1C5TA 1BMLA 2WPHS 1AGJA 1SB1H 3SGAE 2EI7A 1OYQA 2G55A 4FVBA 1WQVH 4MQAA 2GDDA 5AVDA 2D2DA 2WPLS 2AIPA 4FUGA 3A81A