4AG1A

Human chymase - fynomer complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 53
structure length 221
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag1A02
2AMPA 4I8KA 6GCHF 3LKWA 2O8UA 3V13A 1DDJA 1AWHB 3ZVDA 2IPHA 1F5RA 1SOTA 3MH5A 3OYPA 2P93A 2XRCA 5JYIA 1N8OC 1PPFE 3ZV9A 2QAAA 2ZGCA 1FAKH 1TIOA 4X2WA 4RN6A 4X8TH 5TJXA 1F7ZA 2QY0B 1SL3A 3S9AA 1ELGA 2FOEA 5GCHF 3GY3A 1C1PA 1HAVA 1HJ9A 2P59A 1XM1A 3SGQE 8ESTE 1EP5A 3VB7A 2FS8A 5A09A 1T7CA 1GBLA 1RD3B 2FM2A 3GYMA 1PFXC 4FUFA 1H8IH 5DPAA 2NWNA 1YM0A 2Z9IA 2BY6X 1UTNA 3MU5A 3ZZ9A 2QXHA 4YOIA 1SQTA 3ATMA 2W3KA 3L33A 1QR3E 1O5EH 2Z7FE 3RXKA 1NU7B 2BY7X 4FU7A 6GCHG 1MBQA 1EAIA 2SGEE 1NFYA 2AMQA 3ZZ6A 1QBVH 1GHBG 2C90B 2ZPQA 1IQNA 3PMHB 2ZDNA 2WV5A 1EAWA 3DA9B 4Y0ZE 1LHGH 1LKAA 3A7TA 5A2MH 3TPIZ 4WH6A 1BBRH 4NZQA 4YM9A 1AVGH 2GVFA 3M35A 5GCHG 1O37A 1TGSZ 3BG4C 4I33A 9LPRA 1QL7A 1V6DA 2IJOB 1SLXB 1THSH 4AYYB 2DE9A 4AGKA 1ZGIA 3TITA 5AF9H 5IYTA 5C1XA 5I46H 1AY6H 4BNRA 2BM2A 1K22H 2GZ9A 1TPPA 1H9IE 1ABIH 3TK5A 1Q31A 3F68H 1T8LA 2HPQH 4X6PA 5A8ZA 1ZPZA 2XCNA 4D9RA 1O2LA 3LOXA 1F0UA 4U30A 1GBKA 4DIIH 1MZDA 5HYOA 1S6FA 1HAIH 2V3OH 2WYGA 4UFFH 4B2AA 4A92A 1L4DA 1AO5A 1HAOH 3CS7A 3L6PA 5CE1A 4KGAA 3RC5A 1G2LA 1BTZA 1YKTA 1OKXA 2G8TA 1EAXA 5EOKA 2OQUA 4MPWA 5FAHA 3QZRA 2ANKH 1EPTB 3RM2H 1D6RA 3I78A 3FP7E 3EGKH 1K1LA 1O3PB 2BD8A 5L2YH 4LZ1H 4YT6H 4R8TB 2D1JA 1Z71A 4HTCH 1C5SA 4MNYA 2HPPH 4HZHA 2BX4A 2FX4A 4UFGH 1TFXA 3ZVGA 5GXPA 3AAVA 2J95A 2PLXA 3M37A 1W14U 1Y3VA 4JK5A 3F1SB 1V3XA 1MH0A 3MO9A 1J14A 4ZKSU 3HKJB 5AFYH 2PGBB 1GCDA 5F8TA 3GISB 3A7WA 2BDCA 2F9NA 3FANA 1S82A 1ETRH 3A81A 4ISNA 2FO9A 1LTOA 2XBVA 2BVSH 2VU8E 4LK4A 2XTTB 3KL6A 4WJG2 1OS8A 1ZOMA 1DITH 3VXFH 1NROH 2HGTH 3ZVCA 3KQCA 4K1EA 3RMMH 1NM6A 1MQ6A 1LPGB 1HYLA 4ZROA 2FOFA 3D62A 3F9FA 2CXVA 5JBTA 1DXWA 3BSQA 1O31A 1B5GH 1EB1H 2ODQA 3RXSA 1NO9H 4XBBA 1C5RA 1HIAA 1TA2A 4FVBA 5EQQA 1NZQH 1ZTLA 4DURA 4CRGA 1B7XB 1DM4B 4ZHAA 2VIWA 1P09A 2CF8H 3UPEA 3RP2A 1XMNB 2FOGA 2ZCHP 3U69H 2O9QA 2H9HA 1QTFA 3MH6A 1EPTC 2SGFE 2O8MA 1GI3A 1PYTC 4JYTA 1XVMA 3RXJA 3NK8A 3STIA 1GHVH 1TB6H 3T2NA 1RTFB 1N6XA 1O3JA 3LGTA 1W3CA 9ESTA 2AGGX 1XUKA 1C1NA 2Z94A 1TABE 2EI8A 1BITA 4GUXA 4Q80A 2BLVA 5F6MA 3N7OA 1XX9A 2D8WA 3SI4H 1GVLA 1DANH 1GBDA 2ALPA 4J2YB 3TJNA 1FI8A 2WPMS 3LIWA 4IMZA 4AN7A 3VB4A 1W12U 5BRRE 1KLIH 3Q76A 5TCCA 4B76A 1AGJA 2CF9H 1EASA 2JH6D 2J94A 2VWOA 3KN2A 2VWLA 1C5UA 3UFAA 1MU6B 5EQRA 2PW8H 1G3CA 1BZXE 1SBWA 2B5TB 2QIQA 1KLJH 2O8LA 1TBRH 2HOBA 1DS2E 2OC8A 3SU0A 1RTLA 4NZLA 1PPHE 1D3QB 4D9QA 1E34B 1S5SA 1O36A 1RGQA 1GDUA 1O2RA 2ZCKP 1O3MA 1H9HE 1E37B 1SC8U 4K8YA 2STAE 2Y5HA 2BD3A 4K8BA 4DGJA 3ZVFA 1A3EH 2A4RA 4B2CA 3A83A 3V7TA 1SOZA 1IQHA 3P6ZB 1F5KU 4H6SB 5A0AE 1GHAF 2XCFA 1FPCH 4IC5A 2ZI2H 2WPHS 3LH3A 1C1QA 4FUCA 1MMJN 2FOMB 2ULLA 1A1RA 2A2QH 1O2QA 1OWIA 1JOUB 2GCHF 1MD7A 1ZSLA 3C1KA 3SUDA 5FPTA 1W8BH 1GBHA 1QNJA 5E0GA 2FXRA 2ZU4A 3BV9B 3SV2H 2ZF0H 2FMJA 2ZU3A 1C5LH 2VB0A 1E36B 2BX3A 3TLOA 1CHGA 5C1UA 1AE8H 8GCHF 4D76A 2J92A 3PV4A 2BXUH 2O8TA 1HDTH 1FY5A 1GBAA 1DY9A 3E16B 4DY7B 3BIVH 2FDAA 1C5NH 2W5EA 1T8NA 1IQLA 2FI4E 1MU8B 4FUEA 4OS5A 3MH7A 2R3UA 3MH4A 4JK6A 3QDZB 2A1DB 1BHXF 4X1NU 1HXEH 2OTVA 3RXQA 1GHWH 1GHAG 1O3CA 1OYTH 4H4FA 1YC0A 1O3NA 4ABJA 3AVZA 3SO3A 2ZDMA 1ELVA 5TCAA 3ODDA 1D3TB 2GCHG 2ZP0H 4O9VA 1CGHA 1KSNA 4U2WA 1ANCA 1O2IA 1O5BB 1Y5UT 4QT8C 4IS5A 1C2MA 1BRUP 3STJA 1MQ5A 4FU9A 1QB6A 3GY5A 1GJ6A 8GCHG 4BTIB 4Y11E 2VIQA 1G3EA 4X8UH 1C5VA 1UK4A 2P3UB 2ILNA 1DFPA 1BDAA 1SGFA 4I32A 4TWYA 2C8ZB 1EQ9A 3MNXA 3WY8A 4IMQA 1SMFE 1D3PB 4JZEH 4X2VA 1F0SA 2GV6A 3VB3A 1ETTH 1FLEE 4KELA 1SGTA 1BCUH 3ZYDA 2FYRA 1Z8JB 3I29A 1AUTC 3RM0H 1AFQC 1VJAU 1NRRH 1C2GA 2OXSA 2BY9X 1THPB 1ZPBA 1C2FA 1OWHA 3S7KB 3ZZ8A 3BEFB 1ZHMA 1NRPH 1HAPH 3BF6H 2XBWA 4NIVA 1G32B 4M7GA 1PPZA 3ENSB 3GY2A 4XBCA 1G3DA 1PPEE 3K65B 3LJJA 5EQSA 1GI6A 3GDSA 3P70B 1DWEH 4Q2KA 5DP9A 2ZHDA 5DP5A 2OLGA 3RC6A 1SGPE 4MVNA 4YOJA 4OGXA 1XVOA 2P3FH 4MG3A 3BTWE 3QTVH 1C1TA 4GHQA 1HAYB 3KEEA 1SFQB 1BJUA 4ESTE 1EOLA 5FCKA 2CGAA 4FUGA 4PROA 4X6OA 5E0JA 3A8BA 3UQVA 1PYTD 1O2GH 1ARBA 1FY1A 4ISIH 4X0WU 1TNKA 5AFZH 1NFWA 1TQ7B 1GHXH 1VR1H 1PQ5A 3O8DA 3PWCA 1EJNA 1BHXB 1TX8A 1ZZZA 4DG4A 4XSKU 4AFUA 4X8VH 1JXPA 1FDPA 3SNEA 3KIDU 1V2UT 1QQ4A 2A5KA 1BBRE 3T29A 3PYHA 1CT2E 2A0QB 2FZZA 1TAWA 1RXPA 2Q6DA 2ZO3H 2WPKS 3F9GA 3A8CA 2CMYA 2WINI 2ZG0H 1GBCA 3H7TA 3A7XA 2H9TH 2J34A 3DT0H 1ZSJA 4MPUA 4Q7YA 1FJSA 3M5LA 1ANEA 4MTBA 1YBWA 4DW2U 1MZAA 4ABHA 2FI3E 4A1VA 1A46H 1CU1A 1GI7B 2G4UA 2Y7ZA 4K5ZA 2GMTB 3QN7A 3GICB 1ZYOA 1OPHB 1O38A 1MAXA 2FX6A 3A89A 1K1JA 3FFGA 1EZXC 3SNDA 1NESE 6CHAB 4WH8A 1SVPA 2VVUA 1O5CB 3UOPA 4OS1A 5C20A 4NCYA 2A4QA 1GJ4H 2F9VA 2ZFTA 3DHKH 4HI3A 2AIQA 3A8DA 2ZIQH 1UO6A 5FPYA 1W2KH 1ZSKA 2Z9KA 4B2BA 1BIOA 3TJVA 2Z3EA 4NA8A 2VIPA 1SI5H 7KMEH 1KTSB 3A80A 2CHAB 2YNBA 1C4V2 1O2MA 4A1TA 1O2OA 2B0FA 4FUDA 2ZFQH 3RUOA 1EKBB 1ABJH 3HK3B 5DP8A 1UTQA 1W13U 1CT0E 5JDUB 2AMDA 4X8SH 3SV8A 2F9UA 1LMWB 4WMFA 2NU0E 3GYLB 2BDHA 3SN8A 3DD2H 1K1OA 1P05A 1GWAA 4CRDA 4X6NA 1BRBE 1C5OH 1ZTKA 3FAOA 3M3TA 2PSYA 2BDGA 3FVFB 4Y0YE 1C2DA 2C8XB 3AW0A 4JYVH 3SHAH 1A5HA 1C4Y2 4MDSA 3LGIA 3ESTA 2H1UA 3V12A 1GI0A 1J16A 2HALA 1X7AC 1HIAB 1JRTA 5LPRA 2XC4A 1KXEA 1J8AA 3A88A 3NXPA 1FQ3A 1T8MA 4JCNA 4E05H 1AIXH 1XXDA 1CGJE 2C8WB 4BTTB 1TNHA 1XUJA 2GMTC 3E3TA 1V2MT 1VZQH 2J2UA 1CBWB 1LQEA 4NSYA 2FI5E 1J15A 1D6WA 1A5IA 1QBOA 4DOQA 2VVCA 2BLQA 5ETXA 2V3HH 3OU0A 1YPJH 3M3VA 3Q00A 3UY9A 4CRAA 3UNRA 3UUZA 4K69A 1PPCE 2A2XH 2JKHA 1GMDF 1GVZA 1U6QA 1C5ZB 1UHBA 3ZZ3A 5E2PA 3ZVEA 1JIMA 2A31A 1ANBA 4XDEA 2SNVA 5LPEA 1O3AA 3E91A 5SGAE 1TONA 1BRCE 4NA7A 4CRFA 1BJVA 1GBTA 1FPHH 2GD4B 1IHSH 4I8JA 4I31A 4VGCB 2UWLA 1UCYK 2XW9A 2JH5D 3HPTB 4IN1A 1TGBA 3HK6B 1CQQA 3RXIA 1XUHA 3TJUA 3PO1C 4YT7H 2CHAC 3SNCA 1WCZA 3A85A 1GI1A 4WXVA 1P04A 3PWBA 3T25A 2A5AA 2P8OB 2XWBI 4Z6AH 3GDUA 2BD4A 2NU2E 1VCPA 1ELDE 2G5VA 2A45B 2IN2A 5CMXH 1UVTH 2M5TA 5GDSH 2Z9LA 3UIRA 1SPJA 3PLBA 2A7HA 2Z6BD 5JBCS 1PQAA 1V2NT 4TWWA 2HVXA 1G36A 3MOCA 1GMDG 1TGCA 4UFDH 2W7UA 1YLDA 4D8NA 1O3DA 1DWBH 3PTNA 4MPVA 3D23A 3GCTF 2BVXH 4Y7AA 3GCHC 2VVVA 1HXFH 1AUJA 1A61H 5CHAB 1ELFA 1K2I1 2BHGA 3VB5A 4YESB 1WTGH 1UTPA 3UR6A 2TGDA 2AFQB 4F49A 5IDKA 1FMGA 3ATLA 4I8GA 1TYNA 1Z6JH 3SUFA 4DVAU 1W10U 1Z1IA 2HNTF 3B23B 1O3IA 1SGFG 2ZGHA 5A0CA 5K7RA 1XUGA 4NIYA 3U1IB 3F9EA 1DY8A 2PKAA 4D7FA 2BDBA 1KLTA 4OGYA 1YPLH 3GCTG 4VGCC 1SGCA 1H4WA 4ABEA 1A0JA 1GJDB 1S6HA 2BY8X 2R9PA 5J4QA 1UTLM 1EZQA 3D65E 2UUJB 1UCYE 4UEHH 4FUIA 1KDQA 2GGVB 3ZZAA 2P8OC 4Y6DA 3K9XB 4B73A 1A3BH 2BOHB 2F9PA 3ZZDA 2B7DH 5EXMA 3U1JB 3PLKA 3TIUA 4D7GA 1ANDA 2RDLA 4ISLA 3MNBA 1CT4E 1O2VA 3UREA 1DUEA 1JIRA 1GJ5H 2FOAA 1WQSA 1O2WA 3H7OA 5ESBA 3PLPA 2ZC9H 1IHTH 3AW1A 3GCNA 1YCPM 3LC5A 1FY4A 1SR5C 2Y5FA 1AN1E 1ELAA 3UR9A 4TY6A 5L30H 1FONA 1S85A 1NY22 1O2JA 2QXGA 1BT7A 1D9IA 1IOEA 1G2MA 3BTME 3O8BA 1CA8B 1QB1A 3Q77A 5T6DA 1DE7H 1EATA 1MKXK 1LO6A 3U8TH 1K1IA 3QK1A 1NTPA 4H42U 1NU9A 3NKKA 1ZTJA 2BQ6B 4CHAB 4A6LA 1O2XA 2A32A 3U98H 1SHYA 1IQMA 4O03A 1L1NA 1DSUA 2GT7A 5GIBA 1UMAH 2ZU2A 3DUXH 3MMGA 4LXBH 2OBQA 1HGTH 3RLWH 4SGBE 8KME2 3V3MA 1GL1A 1K28D 1O2HA 4BAMB 1LVYA 2ZQ2A 2GX4A 1O3GA 1WTHD 4JZFH 1TRNA 1NC6A 1BTUA 2PTCE 1C2LA 1KXCA 3RXPA 4BTUB 2FOHA 1TNIA 3E0PB 1OWKA 3TU7H 1V2PT 1QQUA 5JPMH 3P8FA 2Y7XA 4A5TS 5T6GA 1FY3A 2PFEA 4ISHH 4GAWA 1TMTH 3VEQB 1T32A 2V6NA 1OWEA 3W95A 2Y6TA 4BOHA 5AHGH 5ABWA 1HB0B 2WPIS 4K60A 1SG8B 1C5PA 1YPGH 4RKOB 1P2OA 3GY4A 1AHTH 2WUCA 1FY8E 2BB4A 3SU2A 2G51A 5GPIB 1ZJDA 1GCTB 1O2ZA 3JZ1B 3A8AA 1KY9A 1WU1A 3TGJE 3TK6A 4MPXA 1ELBA 2ZHFH 3SU5A 1JWTA 2IOTA 3EA8A 4YZUA 1GMCF 5DP4A 2OBOA 1ZR0A 4YLUA 3MNSA 1OP8A 4TYDA 1ZRBA 3ODFA 1O5DH 4GPGA 3BTQE 2ZGJA 2TIOA 5PTPA 3Q3XA 1ZRKA 4GCHF 3Q3KA 1EX3A 3L3TA 1FIZA 3EDXB 2VIDA 4NFEA 1BA8B 3ZZBA 4NA9H 1VGCB 2FPZA 5DG6A 1C1SA 4ASHA 1BTXA 3GCOA 1ESBA 1AMHA 3P95A 3QUMP 3HKIB 2QA9E 4CRCA 1QRWA 4BAQB 3EA9A 1THRH 1K1NA 5EPNA 1A2CH 1DLEA 1Z1JA 5DK1A 2D26C 1YPKH 2FTLE 3HGNA 1GJCB 1GMCG 3A84A 2UUKB 4CR5A 1O2TA 3S0NA 2C4FH 5DP7A 5HM2A 1MCTA 4TPIZ 1CE5A 2VWMA 1UCYH 5C5OA 1SLUB 1O5GH 4AX9H 3O8RA 2QXIA 4GCHG 1IQGA 2XXLA 1C2HA 2Q6FA 2BTCE 3UOUA 2YOLA 2G5NA 5E8EH 3TNSA 1GBMA 1AQ7A 1GCTC 1OOKB 1GPZA 1L1GA 1GDNA 4TPYA 1NFXA 2TPIZ 3RDZA 1MBMA 1V2TT 3PTBA 1ZGVA 1DXPA 2SGAA 2ZPRA 4ZHLU 1HAGE 4NFFA 1T8OA 3RC4A 2OUAA 1MTSA 2Z9GA 4YO9A 1WUNH 1EXFA 1TNJA 5FBIA 1O2YA 1B0FA 1GBIA 2WYJA 1EZUC 2H6MA 1OP0A 4WWYA 5DKMA 2PTNA 1FN8A 1P2JA 4BXWA 3GY6A 2ZDAH 4Y71A 1S0RA 3P92A 3M61U 3RXCA 1FN6A 3LU9B 2UWOA 4YTAA 3ELAH 5FBEA 4IN2A 1MKWK 1GJBB 2ZTXA 2ZFRH 2RG3A 3O8CA 1O0DH 1DSTA 1G30B 1P2QA 1UHBB 2BY5X 5DO4H 2NU3E 4JMYA 1E0FD 1QJ6B 2BMGB 2BVRH 1SGNE 2F9BH 3P8OA 4JZIA 1AE5A 2OC1A 4UONA 1MTNB 2TRMA 3FP6E 1VITF 1HAVB 5J4SA 2EEKA 3EYDA 3HGPA 1UVOA 1YPHE 2ESTE 5EU8A 1TOCB 4IC6A 4J1YA 5A8XA 1RJXB 2QV1A 1O5FH 3MHWU 4NGAH 2P94A 1O3EA 2EA3A 3SQHE 2QF0A 1W7XH 1CGIE 2PR3A 1O3OA 3P8GA 2VH0A 2C3SA 1IAUA 2PSXA 4Y8XA 1GBJA 2XNIA 2C93B 1HRTH 4TY7A 3URDA 2ZECA 3DFLA 4X2YA 3VGCB 3SGBE 4BANB 3SORA 3BTKE 5E2OA 2XWAA 3RXAA 1C2EA 4JZDH 4MQAA 2FWWA 4AORA 2P95A 1SGEE 3KF2A 4NSVA 1ZJKA 3QGJA 2H5CA 1TRMA 1N6YA 4ZKNU 5E0HA 1AVWA 2VJ1A 4ZXXH 1TMUH 1VITG 2ZGBH 2ZGXH 4ABAA 8LPRA 2BDYA 2GKVE 2OP9A 1TE0A 2NU1E 4WF8A 2ODYB 2OCVB 1TPOA 3M5MA 3MTYA 3SJIA 1DPOA 1VITH 2FP7B 1IQEA 2JETB 2BLWA 2WPLS 3K2UA 1DLKB 1PJPA 2O8WA 3MU1A 4X1PU 3SV7A 1XUIA 2FIRH 2HWLB 3A87A 1MKXH 1EOJA 1DX5M 3LDXH 1AZ8A 3CENA 4ABGA 2ZDVH 4Z0KA 2BOKA 4XFQA 4DCDA 4CREA 1ZLRA 1TLDA 1TGNA 1TRYA 1O3FA 2SGQE 2AIPA 1WV7H 2GZ8A 2PKAB 4E06H 3QGNB 2Y82A 3BTFE 3PMAB 1MTNC 3PROA 5HMAA 4FXGH 4ZXYH 3RU4T 1O2NA 5DP3A 2DUCA 1SHHB 1Z8IB 7GCHF 3S7HB 3ZVAA 3U8OH 2P3TB 5I25A 1KDQB 3SQEE 4I8LA 1EJAA 1XXFA 1JRSA 1QJ7B 2PGQB 1C1RA 2PUQH 1NRSH 2BZ6H 4B75A 2PHBA 2G52A 5HM9A 1BTWA 1Y8TA 4XOJA 2J4IA 1GJAB 1P12E 4O97A 2VWNA 2BYAX 1VCWA 3BTDE 2QN5T 4ABFA 3S9BA 2A7JA 2ZFFH 3KQBA 4GVUA 1YCPK 3KNXA 4INHA 3SV6A 1SB1H 3VGCC 4B74A 4MNVA 1HNEE 4ZKOU 1UJ1A 1HAXB 1OWDA 3GOVB 1GI4A 5AVDA 1BMAA 1LCYA 3MU0A 1L0ZA 1LVOA 1PPGE 2ZA5A 1WYKA 2AGIX 1N8OB 1UVPA 4UE7H 1WSSH 2AH4X 1GL0E 3BTTE 5JB9S 7GCHG 3BTEE 2JH0D 4FU8A 4IGDA 4E7RG 4KTSA 1HCGA 1QBNA 2JETC 2Z9JA 2QCYA 3EQ0H 2PWXA 1G37A 4ZMAH 1GHZA 1DWDH 2HNTE 4E7NA 1C1OA 3LONA 4ABDA 1GBBA 2F91A 3LGWA 1Z7KA 1A5GH 3V0XA 3M7TA 3MWIU 1T31A 2KAIA 3EA7A 4AFSA 2VIVA 4SGAE 3RMOH 1TOMH 1BB0B 1EJMA 4ABIA 1O3HA 1C5YB 2G81E 2BD9A 3A7YA 3BEUA 3PMBB 1KXDA 7LPRA 3MO3A 3RXVA 4LZ4B 2AGEX 4ZAEA 1ELCA 4AYVB 3PB1E 1Y3YA 3FP8E 5F8XA 5C67A 5HGGA 1HLTH 3E0NB 4X6MA 3BG4B 2STBE 3I77A 4Q7ZA 1HAHH 3NPSA 1KYNA 4JYUH 6CHAC 2SGDE 1L1JA 4AG2A 2YNAA 3RXOA 1V2ST 1GG6B 2FLRH 3B8JA 4K2YA 5BPEA 4A1XA 1XKAC 1NFUA 1LVMA 5DGJA 3RLYH 3LGYA 2EC9H 1O34A 1QURH 1QFKH 1GHBF 3G01A 1QHRB 3RXTA 4B1TA 1H1BA 2R2MB 3TK9A 1LVBA 1O2SA 1QA0A 2GT8A 1W7GH 1V2QT 2C8YB 1MTVA 2ZTYA 3MNCA 3ZZCA 4GHTA 1OX1A 1J9CH 5DP6A 3SI3H 1C4U2 1WBGB 4KKDA 4XBDA 3SV9A 2RCEA 3QZQA 3QTOH 1BMLA 1TGTA 1LPKB 4UD9H 5C3NA 3SUGA 3MO6A 1OYQA 3W94A 3VPKA 4KTUA 1P10A 3AAUA 5HXFA 2BDAA 1P57B 3T26A 1JBUH 1C5WB 1VCQA 2G55A 5EW1H 2A4GA 2Y81A 1XKBC 4THNH 2HLCA 1ZMJA 2TGAA 5LH8A 4MNXA 3P8NA 1UK2A 4Y8ZA 3E8LA 3SW2B 2FLBH 4WY3A 1DT2A 1MKWH 4ZUHA 1EZSC 4Y10E 1RFNA 1P01A 1LHEH 3FZZA 1OP2A 2BQWB 1GI9B 2AS9A 1B0EA 3RXMA 1CBWC 1LDTT 2DE8A 3URCA 3RXGA 3T27A 1W0ZU 3VFEA 2ODPA 2VINA 1QGFA 2QYIA 1GG6C 1AKSA 1TBQH 1P3EA 3TH3H 3F6UH 3B9FH 3F9HA 1Q2WA 2OD3B 4YLQH 1H9LB 2WUBA 3TJOA 4DT7B 1S81A 1O32A 1W11U 2UUYA 1LHFH 1ZHRA 1MAYA 2PKSB 1YYY1 2VNTA 1SGYE 1FAXA 1HFDA 1HV7A 1WOFA 2TBSA 3ZV8A 1TNGA 3M5OA 2I6QA 1WAYB 5GWZA 3ATIA 4Y76A 1MUEB 4Y8YA 2UUFB 1TX7A 3ZZ5A 5FPSA 2ZU5A 1C2JA 4YOGA 2V0BA 1AZZA 5DJ7A 2Y80A 3ATKA 3RXRA 1ESAA 2QGRA 1Y3UA 2ZKSA 2LNCA 2G4TA 1UTKA 2ZPSA 1BTYA 1F0RA 1LPZB 2EI6A 3M5NA 4CRBA 2OQ5A 5EODA 1P2KA 2FOBA 2GTBA 1YPHC 1C9PA 1A0HB 1FNIA 5EXNA 1BMMH 3BN9A 4O3TA 2XBXA 2H2ZA 1OSSA 4R0IA 3TGKE 1RIWB 5A0BA 2I6SA 1TQ0B 5F03A 1DUAA 2F83A 3EAJA 3IG6B 1O39A 1L4ZA 5CHAC 1TALA 5LGOA 1CVWH 3M3SA 3NCLA 3E90B 2FESH 1D4PB 2W7SA 5L2ZH 1OWJA 1HAZB 4AZ2B 1S84A 5K0HA 3TH4H 1H8DH 2ZHEH 1KIGH 1QIXB 3BTHE 3GDVA 4BAHB 1O3KA 1FZZA 4IBLH 4NIXA 3TH2H 1ARCA 4X1SU 2W26A 5H4IB 4Y7BA 1C5XB 1IQKA 4CH2B 1GGDB 2SNWA 1WQVH 4GSOA 3LPRA 1SFIA 3ZVBA 2PUXB 1F2SE 3UTUH 3BG8A 2VIOA 2Z3CA 4WMEA 4ABBA 2PKSC 1AWFH 2VH6A 1RTKA 3M7QA 1CO7E 2CV3A 1L2EA 2ZZUH 3SJ9A 1YCPH 1ZMLA 5FCRA 1P02A 1P9SA 5B6OA 2TGPZ 2UWPA 2B9LA 1V2OT 3KHVA 3MFJA 1J17T 1QL9A 4HFPB 2ALVA 4WXIA 4DIHH 4X2XA 2FS9A 3M36A 2ASUB 1GI5A 1TNLA 2ZU1A 4BAKB 3LJOA 1F0TA 1BUIA 4FVDA 3DFJA 2B8OH 1IQIA 1G3BA 7ESTE 4U32A 2CJIA 1MCVA 3SGAE 3TNTA 2BD2A 3BIUH 2RA3A 5FHTA 2SFAA 1RIWC 2THFB 4KTCA 3KQEA 1P8VC 1PPBH 2Q1JA 1A7SA 3PM3A 1UVUH 1C1MA 1XUFA 2WPJS 1SGDE 5C1YA 3ZZ4A 4CHAC 1T4UH 5F8ZA 1LHCH 2BD5A 4AFQA 1UVSH 3VB6A 5C5NA 1C5TA 1HBTH 4INKA 1KXAA 4X1QU 4AB8A 5T6FA 3OY6U 2FODA 1V2VT 3GY7A 3NWUA 1S0QA 5EXLA 1C5QA 2VGCB 3K6YA 1GGDC 4NWLA 1O2PA 4FUHA 1ORFA 2R3YA 1E38B 1G9IE 1E35B 2R0LA 5FX5A 1P0SH 1SGQE 1K1PA 2A4OA 1SSXA 5EPYA 1INCA 1YLCA 2HNTC 1FUJA 1HJ8A 2CN0H 1V2KT 2J9NA 2RA0A 1P2MA 1SLWB 2PV9B 4OS2A 4RKJB 2HRVA 2QF3A 3KQDA 3ZZ7A 3A7VA 4OS6A 4ZH8A 3SJKA 4AOQA 3K6ZA 1CHOF 2ZFPH 2R0KA 2ZWLH 2P16A 5EG4A 3LGVA 1QL8A 3SJOA 1YPEH 2XC5A 1Z8RA 3RMNH 3P17H 1W0YH 3U8RH 4OS7A 1AFQB 1V2RT 1A4WH 4UFEH 1NS3A 1UK3A 1IQJA 2ZNKH 3PMJA 1O33A 4F4OC 1K9OE 4FUJA 2F3CE 5LPFA 4RSPA 1YPMH 3H5CB 1AU8A 2BZAA 2FTMA 3SU4A 5G4BA 1T4VH 2KAIB 3LC3A 3LT3A 4CR9A 3MU8A 4AB9A 1GJ7B 1BRAA 1P06A 3VXEH 1ESTA 3RXFA 3S69A 3T5FH 3RXHA 5JBBS 1CHOG 1GJ8B 1BMNH 1EPTA 1GBFA 4MNWA 1SQOA 2ANMH 1LKBA 3MI4A 1DOJA 1P3CA 2XC0A 1GI2A 1UTJA 2ZHWH 1VGCC 1S83A 2J38A 5FX6A 4HGCA 3RU4D 2VGCC 3SOSA 1QCPA 1ZMNA 1MD8A 3TGIE 2OINA 1TPSA 3LH1A 3JZ2B 4I8HA 1C2IA 1BBRK 1GVKB 3M7UA 3E6PH 4Q7XA 1VJ9U 1P03A 1P2IA 4B71A 2AYWA 3UNSA 1O2KA 5FXLA 1NT1A 3CS0A 1DWCH 2GV7A 4H6TA 2GDEH 3SU3A 3U9AH 2OC7A 3UNQA 1F92A 1GMHF 1HUTH 1LQDB 2V35A 2LPRA 1KTTB 1OXGA 3OTJE 1A0LA 3EE0B 4K1SA 1O30A 3GY8A 4JZ1A 3RU4E 1HJAB 1GDQA 3OY5U 5GJ4B 1P2NA 3SU1A 3MU4A 4LOYH 4FUBA 1SGRE 3UQOA 2ZFSA 2GZ7A 1CSOE 1AVXA 1NN6A 3C27B 3Q3YA 3KGPA 2Q6GA 1NPMA 4K3JA 1V2LT 1K1MA 2BD7A 1P11E 1QRXA 3BEIB 1TMBH 1ELEE 3S9CA 1MTUA 2ZEBA 1Y3XA 1FV9A 2EI7A 2A7CA 2A5IA 4XE4A 1CA0B 1P9UA 2XBYA 1TBZH 2ZDLA 1F5LA 2D2DA 2ZHQH 1BQYA 5JB8S 1V2JT 1BOQA 2WV4A 4INLA 3A82A 2QXJA 2BQ7B 1UTMA 1V2WT 2Z3DA 1GMHG 4BXSA 4AFZA 1C9TA 2BLOA 1DICA 3RMLH 1MTWA 1C1UH 1GHYH 5EGMA 1TWXB 4KP0A 4AGJA 1O5AB 3RXLA 1YGCH 2FYQA 3SNBA 3T28A 1O35A 3RXUA 1D3DB 1N1LA 3E1XB 2BXTH 1YF4A 4IW4E 1AFEH 1C1VH 2GDDA 2TGTA 3NZIA 3OX7U 2OC0A 1AKSB 3IITA 3SHCH 2F9OA 1LHDH 3RXDA 1QA7A 1RS0A 1GBEA 4ZHMU 3SNAA 2ZDKA 6ESTA 1C1WH 2NU4E 1O2UA 3UWIA 2ZTZA 1ZPCA 1Y5BT 1ID5H 3QX5H 3T62A 1RRKA 4UDWH 1KXBA 5EW2H 4CBNA 1M9UA 3QO6A 4A7IB 3BTGE 5JBAS 4WMDA 3QWCH 1PQ7A 3ITIA 1UTOA 2H9EH 1AB9B 3SU6A 3RXBA 1BTPA 2G00A 3KCGH 1Q3XA 2GCTB 1HJAC 4AG1A 4O3UA 1GJ9B 1QB9A 1Y3WA 3HATH 2BDIA 1K21H 1QJ1B 5ESTE 1QRZA 5T3HA 4K1TA 4I7YH 1SGIB 2GP9B 2SGPE 1Y5AT 1Y59T 1TA6A 2ZQ1A 1AD8H 4CH8B 1TPAE 1Z6EA 1CA0C 3A86A 3ATWA 4NG9H 1C2KA 4NIWA 1SLVB 1IQFA 2FEQH 2Y5GA 3SZNA 1GI8B 1HPGA 3OSYA 4MLFB 3SBKA 3A7ZA 2R2WU 1FXYA 2W3IA 2FOCA 3MYWA 3PO1B 4CBOA 1EAUA 1TX6A 1EUFA 5L6NH 3IWMA 4WVPE 3UWJH 4OS4A 4GLYA 1BTHH 1Z8GA 5C2ZA 1AI8H 4DJZB 1JMOH 2XYAA 5A8YA 4ZKRU 1C5MD 1O3LA 3RXEA 2ANYA 1EP6A 4NWKA 2ANWA 3R3GB 4ISOA 1QY6A 2H5DA 3TVJB 1PQ8A 1SQAA 6LPRA 2K1QA 1ETSH 1DVAH 3FZDA 3LGUA 3AASA 1EB2A 3ZYEA 1O3BA 2AEIH 3NUMA 3GCHB 3D49H 1AB9C 1NRNH 3SJ8A 3SUEA 3R0FA 4X1RU 4Y79A 1FIWA 2ZCLP 2QC2A 3CP7A 1ZHPA 1ELTA 2GCTC 4U01A 3QLPH 2AERH 1YP9A 1KXFA 1ACBE 4BAOB 1NRQH
chains in the Genus database with same CATH superfamily
2AMPA 4I8KA 6GCHF 3FO8D 3LKWA 2O8UA 3V13A 1DDJA 2JJ1D 1AWHB 3ZVDA 2IPHA 1F5RA 1SOTA 3MH5A 3OYPA 2P93A 2XRCA 5JYIA 1N8OC 1PPFE 2JDID 3ZV9A 2QAAA 2RFKC 2ZGCA 1FAKH 1TIOA 4X2WA 4RN6A 4X8TH 5TJXA 1F7ZA 2QY0B 1SL3A 3S9AA 1ELGA 2FOEA 5GCHF 3GY3A 1C1PA 1HAVA 1HJ9A 2M2AA 2P59A 1XM1A 3SGQE 8ESTE 1EP5A 3VB7A 2FS8A 5A09A 1T7CA 1GBLA 1RD3B 2FM2A 3GYMA 1PFXC 4FUFA 1S6LA 1H8IH 5DPAA 2NWNA 1YM0A 2Z9IA 2BY6X 1UTNA 3MU5A 3ZZ9A 2QXHA 4YOIA 1SQTA 3ATMA 2W3KA 3L33A 1QR3E 1O5EH 2Z7FE 3RXKA 1NU7B 2BY7X 4FU7A 6GCHG 1MBQA 1EAIA 2SGEE 1NFYA 2AMQA 3ZZ6A 1QBVH 1GHBG 2C90B 2KCAA 2ZPQA 1IQNA 3PMHB 2ZDNA 2WV5A 1UW7A 1EAWA 3DA9B 4Y0ZE 1LHGH 1LKAA 3A7TA 5A2MH 3TPIZ 4WH6A 1BBRH 4NZQA 4YM9A 1AVGH 2GVFA 3M35A 5GCHG 1O37A 1TGSZ 3BG4C 4I33A 9LPRA 1QL7A 1V6DA 2IJOB 1SLXB 3H09A 1THSH 4AYYB 2DE9A 4AGKA 1ZGIA 3TITA 5AF9H 5IYTA 5C1XA 5I46H 1AY6H 4BNRA 2BM2A 1K22H 2GZ9A 1TPPA 1H9IE 1ABIH 3TK5A 1Q31A 3F68H 1T8LA 2HPQH 4X6PA 5A8ZA 1ZPZA 2XCNA 4D9RA 1O2LA 3LOXA 1F0UA 4U30A 1GBKA 4DIIH 1MZDA 5HYOA 1S6FA 1HAIH 2V3OH 2WYGA 4UFFH 4B2AA 4A92A 1L4DA 1AO5A 1HAOH 3CS7A 3L6PA 5CE1A 4KGAA 3RC5A 1G2LA 1BTZA 1YKTA 1OKXA 2G8TA 1EAXA 5EOKA 2OQUA 4MPWA 5FAHA 3QZRA 2ANKH 1EPTB 3RM2H 1D6RA 3I78A 3FP7E 3GS9A 3EGKH 1K1LA 1O3PB 2BD8A 5CDFE 5L2YH 4LZ1H 4YT6H 4R8TB 2D1JA 1Z71A 4HTCH 1C5SA 4MNYA 2HPPH 4HZHA 2BX4A 2FX4A 4UFGH 1TFXA 3ZVGA 5GXPA 3AAVA 2J95A 2PLXA 3M37A 1W14U 1Y3VA 3W1EA 4JK5A 3F1SB 1V3XA 1MH0A 3MO9A 1J14A 4ZKSU 3HKJB 5AFYH 4YXWD 2PGBB 1GCDA 5F8TA 3GISB 3A7WA 2BDCA 2F9NA 3FANA 1S82A 1ETRH 3A81A 4ISNA 2FO9A 1LTOA 2XBVA 2BVSH 2J98B 2VU8E 4LK4A 2XTTB 3KL6A 4WJG2 1OS8A 1ZOMA 1DITH 3VXFH 1NROH 2HGTH 3ZVCA 3KQCA 4K1EA 3RMMH 1NM6A 1MQ6A 1YLNA 1LPGB 1HYLA 4ZROA 2FOFA 3D62A 3F9FA 2CXVA 3KQ5A 5JBTA 1DXWA 3BSQA 1O31A 1B5GH 1EB1H 2ODQA 3RXSA 1NO9H 4XBBA 1C5RA 1HIAA 1TA2A 4FVBA 5EQQA 1NZQH 1ZTLA 4DURA 4CRGA 1B7XB 1DM4B 4ZHAA 2VIWA 1P09A 2CF8H 3UPEA 3RP2A 1XMNB 2FOGA 2ZCHP 3U69H 2O9QA 2H9HA 1QTFA 3MH6A 1EPTC 2SGFE 2O8MA 1GI3A 1PYTC 4JYTA 1XVMA 3RXJA 3NK8A 3STIA 1GHVH 1TB6H 3T2NA 1RTFB 1N6XA 1O3JA 4F48B 3LGTA 1W3CA 9ESTA 2AGGX 1XUKA 1C1NA 2Z94A 1TABE 2EI8A 1BITA 4GUXA 4Q80A 2BLVA 5F6MA 3N7OA 1XX9A 2D8WA 3SI4H 1GVLA 1DANH 1BMFD 1GBDA 2ALPA 4J2YB 3TJNA 1FI8A 2WPMS 3LIWA 4IMZA 4AN7A 3VB4A 1W12U 5BRRE 3PRBA 1KLIH 4ACAA 3Q76A 5TCCA 4B76A 1AGJA 2CF9H 1EASA 2JH6D 2J94A 2VWOA 3KN2A 2VWLA 1C5UA 3UFAA 1MU6B 5EQRA 2PW8H 1G3CA 1BZXE 1SBWA 2B5TB 2QIQA 4P00A 1KLJH 2O8LA 1TBRH 2HOBA 1DS2E 2OC8A 3SU0A 1RTLA 4NZLA 1PPHE 1D3QB 4D9QA 3N7EA 1E34B 1S5SA 1O36A 1RGQA 1GDUA 1O2RA 2ZCKP 1O3MA 1H9HE 1E37B 1SC8U 4K8YA 2STAE 2Y5HA 2BD3A 4K8BA 4DGJA 3ZVFA 1A3EH 2A4RA 4B2CA 5HKKD 3A83A 3V7TA 5HIYA 1SOZA 1IQHA 3P6ZB 1F5KU 4H6SB 5A0AE 1GHAF 2XCFA 1FPCH 4IC5A 2ZI2H 2WPHS 3LH3A 1C1QA 4FUCA 1MMJN 2FOMB 2ULLA 1A1RA 2A2QH 1O2QA 1OWIA 1JOUB 2GCHF 2V3MA 1MD7A 1ZSLA 3C1KA 4F55A 3SUDA 5FPTA 1W8BH 1GBHA 1QNJA 5E0GA 2FXRA 2ZU4A 3BV9B 3SV2H 2ZF0H 2FMJA 2ZU3A 1C5LH 2VB0A 1E36B 2BX3A 3TLOA 1CHGA 5C1UA 1AE8H 8GCHF 4D76A 2J92A 3PV4A 2BXUH 2O8TA 1HDTH 1FY5A 1GBAA 1DY9A 3E16B 4DY7B 3BIVH 2FDAA 1C5NH 2W5EA 1T8NA 1IQLA 2FI4E 1MU8B 4FUEA 4OS5A 3MH7A 2R3UA 3MH4A 4JK6A 3QDZB 2A1DB 1BHXF 4X1NU 5DN6D 1HXEH 2OTVA 3RXQA 2QE7D 1GHWH 1GHAG 1O3CA 1OYTH 4H4FA 1YC0A 1O3NA 4ABJA 3AVZA 3SO3A 2ZDMA 1ELVA 5TCAA 3ODDA 1D3TB 2GCHG 2ZP0H 4O9VA 1CGHA 1KSNA 4U2WA 3F2FA 1ANCA 1O2IA 1O5BB 1Y5UT 4QT8C 4IS5A 1C2MA 1BRUP 3STJA 3F0OA 1MQ5A 4FU9A 1QB6A 3GY5A 1GJ6A 8GCHG 2IPQX 4BTIB 4Y11E 2VIQA 1G3EA 4X8UH 1C5VA 1UK4A 2P3UB 2ILNA 1DFPA 1BDAA 1SGFA 4I32A 4TWYA 2C8ZB 1EQ9A 3MNXA 3WY8A 4IMQA 1SMFE 1D3PB 4JZEH 4X2VA 1F0SA 2GV6A 3VB3A 1ETTH 1FLEE 4KELA 1SGTA 1BCUH 3ZYDA 2FYRA 1Z8JB 3I29A 1AUTC 3RM0H 1AFQC 1VJAU 1YY3A 1NRRH 1C2GA 2OXSA 2BY9X 1THPB 1ZPBA 1C2FA 1OWHA 3S7KB 3ZZ8A 3BEFB 1ZHMA 1NRPH 1HAPH 3BF6H 2XBWA 4NIVA 1G32B 4M7GA 1PPZA 3ENSB 3GY2A 4XBCA 1G3DA 1PPEE 3K65B 3LJJA 5EQSA 1GI6A 3GDSA 3P70B 1DWEH 4Q2KA 5DP9A 2ZHDA 5DP5A 2OLGA 3RC6A 1SGPE 4MVNA 4YOJA 4OGXA 1XVOA 2P3FH 3WW7A 4MG3A 3BTWE 3QTVH 1C1TA 4GHQA 1HAYB 3KEEA 1SFQB 1BJUA 4ESTE 1EOLA 5FCKA 2CGAA 4FUGA 4PROA 4X6OA 5E0JA 3A8BA 3UQVA 1PYTD 1O2GH 1ARBA 1FY1A 4ISIH 4X0WU 1TNKA 1W0KD 4B6FA 5AFZH 1NFWA 1TQ7B 1GHXH 1VR1H 3AK5A 1PQ5A 3O8DA 3PWCA 1EJNA 1BHXB 1TX8A 1ZZZA 4DG4A 4XSKU 4AFUA 4X8VH 1JXPA 1FDPA 3SNEA 3KIDU 1V2UT 1QQ4A 2A5KA 1BBRE 2QF5A 3T29A 3PYHA 1CT2E 2A0QB 2FZZA 1TAWA 1RXPA 2Q6DA 2ZO3H 5HIZA 2WPKS 3F9GA 3A8CA 2CMYA 2WINI 2ZG0H 1GBCA 3H7TA 3A7XA 2H9TH 2J34A 3DT0H 1ZSJA 4MPUA 4Q7YA 1FJSA 3M5LA 1ANEA 3N99A 1YBWA 4MTBA 4DW2U 1MZAA 4ABHA 2FI3E 4A1VA 1A46H 1CU1A 1GI7B 2G4UA 5KGOA 2Y7ZA 3WWBA 4K5ZA 2GMTB 3QN7A 3GICB 1ZYOA 2F43B 1OPHB 1O38A 1MAXA 2FX6A 3A89A 1K1JA 3FFGA 1EZXC 3SNDA 1NESE 6CHAB 4WH8A 1SVPA 2L74A 2VVUA 1O5CB 3UOPA 4OS1A 5C20A 4ACBA 4NCYA 2A4QA 1GJ4H 2F9VA 2ZFTA 3DHKH 4HI3A 2AIQA 3A8DA 2ZIQH 1UO6A 5FPYA 1W2KH 1ZSKA 2Z9KA 4FOUC 4B2BA 1BIOA 3TJVA 2Z3EA 4NA8A 2VIPA 1COWD 1SI5H 7KMEH 1KTSB 3A80A 2CHAB 2YNBA 1C4V2 1O2MA 2EQNA 4A1TA 1O2OA 4Z1MD 2B0FA 4FUDA 2ZFQH 3RUOA 1EKBB 1ABJH 3HK3B 5DP8A 1UTQA 1W13U 1CT0E 5JDUB 2AMDA 4X8SH 3F3BA 3SV8A 2F9UA 1LMWB 4WMFA 2NU0E 3FOAA 3GYLB 2BDHA 3SN8A 3DD2H 1K1OA 5C94A 1P05A 1GWAA 4CRDA 4X6NA 2CK3D 1BRBE 1C5OH 1ZTKA 3FAOA 3M3TA 2PSYA 2BDGA 3FVFB 4Y0YE 1C2DA 2C8XB 5EJLA 3AW0A 4JYVH 3N7DA 3SHAH 1A5HA 1C4Y2 4MDSA 3LGIA 3ESTA 2H1UA 3V12A 3F2HA 1GI0A 1J16A 2HALA 1X7AC 1HIAB 1JRTA 5LPRA 2XC4A 1KXEA 1J8AA 3A88A 3NXPA 1FQ3A 1T8MA 4JCNA 4E05H 1AIXH 1XXDA 1CGJE 2C8WB 5IK2D 4BTTB 1TNHA 1XUJA 2GMTC 3SYJA 3E3TA 1V2MT 1VZQH 2J2UA 1CBWB 1LQEA 4NSYA 2FI5E 1J15A 1D6WA 1A5IA 1QBOA 4DOQA 2VVCA 2BLQA 5ETXA 2V3HH 3OU0A 1YPJH 3M3VA 3Q00A 3UY9A 4CRAA 3UNRA 3UUZA 4K69A 1PPCE 2A2XH 2JKHA 1GMDF 3SZEA 1GVZA 1U6QA 1C5ZB 1UHBA 3ZZ3A 5E2PA 3ZVEA 1JIMA 2A31A 1ANBA 4XDEA 2SNVA 5LPEA 1O3AA 3E91A 5SGAE 4ZCNA 1TONA 1BRCE 4NA7A 4CRFA 1BJVA 1GBTA 1FPHH 2GD4B 1IHSH 4I8JA 4I31A 4VGCB 2UWLA 1UCYK 2XW9A 2JH5D 3HPTB 4IN1A 1TGBA 3HK6B 1CQQA 3RXIA 1XUHA 3TJUA 5EJ1A 2JIZD 3PO1C 4YT7H 2CHAC 3SNCA 1WCZA 3A85A 5EIYA 1GI1A 4WXVA 1P04A 3PWBA 3T25A 2A5AA 2P8OB 2XWBI 4Z6AH 3GDUA 2BD4A 2NU2E 1VCPA 1ELDE 2G5VA 2A45B 2IN2A 5CMXH 1UVTH 2M5TA 5GDSH 2Z9LA 3UIRA 1SPJA 3PLBA 2A7HA 2Z6BD 4ASUD 5JBCS 1PQAA 1V2NT 4TWWA 2HVXA 1G36A 3MOCA 1GMDG 1TGCA 4UFDH 2W7UA 1YLDA 4D8NA 1O3DA 1DWBH 3PTNA 4MPVA 3D23A 3GCTF 2BVXH 4Y7AA 3GCHC 2VVVA 1HXFH 1AUJA 2V7QD 1A61H 5CHAB 1ELFA 1K2I1 2BHGA 3VB5A 4YESB 1WTGH 1UTPA 3UR6A 2TGDA 2AFQB 4F49A 5IDKA 1FMGA 3ATLA 4I8GA 2YMSD 1TYNA 1Z6JH 3SUFA 2WPDD 4DVAU 1W10U 4TT3D 1Z1IA 1E1QD 2HNTF 5FL7D 3B23B 1O3IA 1SGFG 2ZGHA 5A0CA 5K7RA 1XUGA 4NIYA 3U1IB 3F9EA 1DY8A 2PKAA 4D7FA 2BDBA 1KLTA 4OGYA 1YPLH 3GCTG 4VGCC 1SGCA 1H4WA 4ABEA 2KM0A 1A0JA 1GJDB 1S6HA 2BY8X 2R9PA 5J4QA 1UTLM 1EZQA 3D65E 2UUJB 1UCYE 4UEHH 4FUIA 1KDQA 2GGVB 3ZZAA 2P8OC 4Y6DA 3K9XB 4B73A 1A3BH 2BOHB 2F9PA 3ZZDA 2B7DH 5EXMA 3U1JB 3PLKA 3TIUA 4D7GA 1ANDA 2RDLA 4ISLA 4RI0A 3MNBA 1CT4E 1O2VA 3CNRA 1DUEA 1JIRA 1GJ5H 2FOAA 3UREA 1WQSA 1O2WA 3H7OA 5ESBA 3PLPA 2ZC9H 1IHTH 3AW1A 3GCNA 1YCPM 3LC5A 1FY4A 1SR5C 2Y5FA 1AN1E 3OE7D 1ELAA 3UR9A 4TY6A 5L30H 1FONA 1S85A 1NY22 1O2JA 2QXGA 1BT7A 1D9IA 1IOEA 1G2MA 3BTME 3O8BA 1CA8B 3WWFA 1QB1A 3Q77A 5T6DA 1DE7H 1EATA 1MKXK 1LO6A 3U8TH 1K1IA 3QK1A 1NTPA 4H42U 1NU9A 3NKKA 1ZTJA 2BQ6B 4CHAB 4A6LA 1O2XA 2A32A 3U98H 1SHYA 1IQMA 4O03A 1L1NA 1DSUA 2GT7A 5GIBA 1UMAH 2ZU2A 3DUXH 3MMGA 4LXBH 2OBQA 1HGTH 3RLWH 4SGBE 8KME2 3V3MA 1GL1A 1K28D 1O2HA 2GJGA 4BAMB 1LVYA 2ZQ2A 2GX4A 1E1RD 1O3GA 1WTHD 4JZFH 1TRNA 1NC6A 1BTUA 2PTCE 1C2LA 1KXCA 3RXPA 4BTUB 2FOHA 1TNIA 3E0PB 1OWKA 3TU7H 1V2PT 1QQUA 5JPMH 3P8FA 2Y7XA 4A5TS 5T6GA 1FY3A 2PFEA 4ISHH 4GAWA 1TMTH 2KFWA 3VEQB 1T32A 2V6NA 1OWEA 3W95A 2Y6TA 4BOHA 5AHGH 5ABWA 1HB0B 2WPIS 2WV9A 4K60A 1SG8B 2OK5A 1C5PA 1YPGH 4RKOB 1P2OA 3GY4A 1AHTH 2WUCA 1FY8E 2BB4A 3SU2A 2G51A 5GPIB 1ZJDA 1GCTB 1O2ZA 5EJZA 3JZ1B 2LP6A 3A8AA 1KY9A 1WU1A 3TGJE 3TK6A 2KCYA 1SKYE 4MPXA 1ELBA 2ZHFH 3SU5A 1JWTA 2IOTA 3EA8A 4YZUA 1GMCF 5DP4A 2OBOA 1ZR0A 4YLUA 3MQKC 3MNSA 1OP8A 4TYDA 1ZRBA 3ODFA 1O5DH 4GPGA 3BTQE 2ZGJA 2TIOA 5PTPA 3Q3XA 1ZRKA 4GCHF 3Q3KA 1EX3A 3L3TA 1FIZA 3EDXB 2VIDA 4NFEA 1BA8B 3ZZBA 4NA9H 1VGCB 3DCLA 2FPZA 5DG6A 1C1SA 4ASHA 1BTXA 3GCOA 1ESBA 1AMHA 3P95A 3QUMP 3HKIB 2QA9E 4CRCA 1QRWA 4BAQB 3EA9A 1THRH 1K1NA 5EPNA 1A2CH 1DLEA 1Z1JA 5DK1A 2D26C 1YPKH 2FTLE 3HGNA 1GJCB 1GMCG 3A84A 2UUKB 4CR5A 1O2TA 2XNDD 3S0NA 2C4FH 5DP7A 5HM2A 1MCTA 4TPIZ 1CE5A 2VWMA 1UCYH 5C5OA 1SLUB 1O5GH 4AX9H 2JJ2D 3O8RA 2QXIA 4GCHG 5B6LA 1IQGA 2XXLA 1C2HA 2Q6FA 2BTCE 3UOUA 2YOLA 2G5NA 5E8EH 3TNSA 1GBMA 1AQ7A 4RT1A 1GCTC 1OOKB 1GPZA 1L1GA 1GDNA 1VKYA 4TPYA 1NFXA 2TPIZ 3RDZA 1MBMA 1V2TT 3DSPA 3PTBA 1ZGVA 2WSSD 1DXPA 2SGAA 2ZPRA 4ZHLU 1HAGE 4NFFA 1T8OA 3RC4A 2OUAA 5DSFA 1MTSA 2Z9GA 4YO9A 1WUNH 1EXFA 1TNJA 5FBIA 1O2YA 1B0FA 1GBIA 2WYJA 1EZUC 2H6MA 1OP0A 4WWYA 5DKMA 2PTNA 1FN8A 1P2JA 4BXWA 3GY6A 2ZDAH 4Y71A 3EE7A 1S0RA 3P92A 3M61U 3RXCA 1FN6A 3LU9B 2UWOA 4YTAA 3ELAH 5FBEA 4IN2A 2YMSB 1MKWK 1GJBB 2ZTXA 2ZFRH 2RG3A 3O8CA 1O0DH 1DSTA 1G30B 1P2QA 4TSFD 1UHBB 2BY5X 5DO4H 2NU3E 4JMYA 1E0FD 1QJ6B 2BMGB 2BVRH 1SGNE 2F9BH 3P8OA 4JZIA 1AE5A 2OC1A 4UONA 2KX4A 1MTNB 2TRMA 3FP6E 1VITF 1HAVB 5J4SA 2EEKA 3EYDA 3HGPA 1UVOA 1YPHE 2ESTE 5EU8A 1TOCB 4IC6A 4J1YA 5A8XA 1RJXB 2QV1A 1O5FH 3MHWU 4NGAH 2P94A 1O3EA 2EA3A 3SQHE 2QF0A 2LELA 1W7XH 1CGIE 2PR3A 1O3OA 3P8GA 2VH0A 2C3SA 1IAUA 2PSXA 4Y8XA 1GBJA 2XNIA 2C93B 1MABB 1HRTH 4TY7A 3URDA 2ZECA 3DFLA 4X2YA 3VGCB 3OTPA 3SGBE 3SORA 4BANB 3BTKE 3KYGA 5E2OA 2XWAA 2KCPA 3RXAA 1C2EA 4JZDH 4MQAA 2FWWA 4AORA 2P95A 1SGEE 3KF2A 4NSVA 1ZJKA 3QGJA 2H5CA 2K8IA 1TRMA 1N6YA 4ZKNU 5E0HA 1AVWA 2VJ1A 4ZXXH 1TMUH 1VITG 2ZGBH 2ZGXH 4ABAA 8LPRA 2BDYA 2GKVE 2OP9A 1TE0A 2NU1E 4WF8A 2ODYB 2OCVB 1TPOA 3M5MA 3MTYA 3SJIA 1DPOA 1VITH 2FP7B 1IQEA 2JETB 2BLWA 2WPLS 3K2UA 1DLKB 1PJPA 2O8WA 3MU1A 4X1PU 3SV7A 1XUIA 2FIRH 2HWLB 3A87A 1MKXH 1EOJA 1DX5M 3LDXH 1AZ8A 3CENA 4ABGA 2ZDVH 2HVYB 2YMSC 4Z0KA 2BOKA 4XFQA 4DCDA 4CREA 1WDIA 1ZLRA 1TLDA 1TGNA 1TRYA 1O3FA 2SGQE 2AIPA 1WV7H 2GZ8A 2PKAB 4E06H 3QGNB 2Y82A 3BTFE 3PMAB 1MTNC 3PROA 5HMAA 4FXGH 4ZXYH 3RU4T 1O2NA 5DP3A 2DUCA 1SHHB 1Z8IB 7GCHF 3S7HB 3ZVAA 3U8OH 5CHBA 2P3TB 5I25A 1KDQB 3SQEE 4I8LA 1EJAA 1XXFA 1JRSA 1QJ7B 2PGQB 1C1RA 2PUQH 1NRSH 2BZ6H 4B75A 2PHBA 2G52A 5HM9A 1BTWA 1Y8TA 4XOJA 2J4IA 1GJAB 1P12E 4O97A 2VWNA 2BYAX 1VCWA 3BTDE 2QN5T 4ABFA 3S9BA 2A7JA 2ZFFH 3KQBA 4GVUA 1YCPK 3KNXA 4INHA 3SV6A 1SB1H 3VGCC 4B74A 4MNVA 1HNEE 4ZKOU 1UJ1A 1HAXB 1OWDA 3GOVB 1GI4A 5AVDA 1BMAA 1LCYA 3MU0A 1L0ZA 3FKSD 1LVOA 1PPGE 2ZA5A 1WYKA 2AGIX 1N8OB 1UVPA 4UE7H 1WSSH 2AH4X 1GL0E 3BTTE 5JB9S 7GCHG 3BTEE 2JH0D 4FU8A 4IGDA 4E7RG 4KTSA 1HCGA 1QBNA 2JETC 2Z9JA 2QCYA 3EQ0H 2PWXA 1G37A 4ZMAH 1GHZA 1DWDH 2HNTE 4E7NA 1C1OA 3LONA 4ABDA 1GBBA 2F91A 3LGWA 1Z7KA 1A5GH 3V0XA 3M7TA 3MWIU 2EY4C 1T31A 2KAIA 3EA7A 4AFSA 1WXRA 2VIVA 4SGAE 3RMOH 1TOMH 1BB0B 1EJMA 4ABIA 1O3HA 1C5YB 2G81E 2BD9A 3A7YA 3BEUA 4DT4A 3PMBB 1KXDA 7LPRA 3MO3A 3RXVA 4LZ4B 2AGEX 4ZAEA 1ELCA 4AYVB 3PB1E 1Y3YA 3FP8E 5F8XA 5C67A 5HGGA 1HLTH 3E0NB 4X6MA 3BG4B 2STBE 3I77A 4Q7ZA 1HAHH 3NPSA 1KYNA 4JYUH 6CHAC 2SGDE 1L1JA 4RT0A 2YNAA 4AG2A 3RXOA 1V2ST 1GG6B 2FLRH 3B8JA 4K2YA 5BPEA 4A1XA 1XKAC 1NFUA 5KEDA 1LVMA 5DGJA 1NBMD 3RLYH 3LGYA 2EC9H 4FETA 1O34A 1QURH 1QFKH 1GHBF 3G01A 1QHRB 3RXTA 4B1TA 1H1BA 3OEHD 2R2MB 3TK9A 1LVBA 1O2SA 2F4LA 1QA0A 2GT8A 1W7GH 1V2QT 2C8YB 1MTVA 2ZTYA 3MNCA 3ZZCA 4GHTA 1OX1A 4HG6A 1J9CH 5DP6A 3SI3H 1C4U2 1WBGB 4KKDA 2IJD1 4XBDA 3SV9A 2RCEA 3QZQA 3QTOH 1BMLA 1TGTA 1LPKB 4UD9H 5C3NA 3SUGA 3MO6A 1OYQA 3W94A 3VPKA 4KTUA 1P10A 3AAUA 5HXFA 2BDAA 1P57B 3T26A 1JBUH 4XRNA 1C5WB 1NBME 1VCQA 2G55A 5EW1H 2A4GA 2Y81A 1XKBC 4THNH 2HLCA 1ZMJA 2TGAA 5LH8A 4MNXA 3P8NA 1UK2A 4Y8ZA 3E8LA 3SW2B 2FLBH 4WY3A 1DT2A 1MKWH 4ZUHA 1EZSC 4Y10E 1YWUA 1RFNA 1P01A 1LHEH 3FZZA 1OP2A 2BQWB 1GI9B 2AS9A 1B0EA 3RXMA 3DSGA 1CBWC 1LDTT 2DE8A 3URCA 3RXGA 3T27A 1W0ZU 3VFEA 1H8HD 3U28C 2ODPA 2J5UA 2VINA 1QGFA 2QYIA 1GG6C 1AKSA 1TBQH 1P3EA 3TH3H 3F6UH 3B9FH 3F9HA 1Q2WA 2OD3B 4YLQH 1H9LB 2WUBA 3TJOA 4DT7B 1S81A 1O32A 1W11U 2UUYA 1LHFH 1ZHRA 1MAYA 2PKSB 1YYY1 2VNTA 2RDEA 1SGYE 1FAXA 1HFDA 1HV7A 1WOFA 2TBSA 3ZV8A 1TNGA 3M5OA 2I6QA 1WAYB 5GWZA 3ATIA 4Y76A 1MUEB 4Y8YA 2UUFB 1TX7A 3ZZ5A 5FPSA 2ZU5A 1C2JA 4YOGA 2V0BA 1AZZA 5DJ7A 2Y80A 3ATKA 3RXRA 1ESAA 2QGRA 1Y3UA 2ZKSA 3UB0A 2LNCA 2G4TA 1UTKA 2ZPSA 1BTYA 1F0RA 3F0PA 1LPZB 2EI6A 3M5NA 4CRBA 2OQ5A 5EODA 1P2KA 2FOBA 2GTBA 1YPHC 1C9PA 1A0HB 2QF4A 1FNIA 5EXNA 3DSOA 1BMMH 3BN9A 4O3TA 2XBXA 2H2ZA 1OSSA 4R0IA 3TGKE 1RIWB 5A0BA 2I6SA 1TQ0B 5F03A 1DUAA 2F83A 3EAJA 3IG6B 3OEED 1O39A 1L4ZA 5CHAC 1TALA 5LGOA 1CVWH 3M3SA 3NCLA 3E90B 2FESH 1D4PB 2W7SA 5L2ZH 1OWJA 1HAZB 4AZ2B 1S84A 5K0HA 3TH4H 1H8DH 2ZHEH 1KIGH 1QIXB 2WHXA 3BTHE 3GDVA 2K0QA 4BAHB 1O3KA 2W6JD 1FZZA 2KZ4A 4IBLH 4NIXA 3TH2H 1ARCA 4X1SU 2W26A 5H4IB 4M9FA 4Y7BA 1C5XB 1IQKA 4CH2B 1GGDB 2SNWA 2J97A 1W0JD 1WQVH 4GSOA 3LPRA 4B6EA 1SFIA 3ZVBA 1K0HA 2PUXB 5C0TA 1F2SE 3UTUH 3BG8A 2VIOA 2Z3CA 4WMEA 4ABBA 3F2GA 2PKSC 1AWFH 2VH6A 1RTKA 3M7QA 2HLDD 1CO7E 2CV3A 1L2EA 2ZZUH 3SJ9A 1YCPH 1ZMLA 5FCRA 1P02A 1P9SA 5B6OA 2TGPZ 2UWPA 2B9LA 1V2OT 3KHVA 3MFJA 1J17T 1QL9A 4HFPB 2ALVA 4WXIA 4DIHH 4X2XA 2FS9A 3M36A 2ASUB 1GI5A 1TNLA 2ZU1A 4BAKB 3LJOA 1F0TA 1BUIA 4FVDA 3DFJA 2B8OH 1IQIA 1G3BA 7ESTE 2KR7A 4U32A 2CJIA 1MCVA 3SGAE 3TNTA 2BD2A 3BIUH 2RA3A 3ZIAD 5FHTA 5GNDA 2SFAA 1RIWC 2THFB 4KTCA 3KQEA 1P8VC 3VG8A 1PPBH 3PV2A 2Q1JA 1A7SA 3PM3A 1UVUH 1C1MA 1XUFA 2WPJS 1SGDE 5C1YA 1QZ8A 3ZZ4A 4I86A 1T4UH 5F8ZA 1LHCH 2BD5A 4AFQA 1UVSH 4CHAC 3VB6A 5C5NA 1C5TA 1HBTH 4OM9A 4INKA 1KXAA 4X1QU 4AB8A 5T6FA 3OY6U 2FODA 1V2VT 3GY7A 3NWUA 1S0QA 5EXLA 1C5QA 2VGCB 3K6YA 1GGDC 4NWLA 1O2PA 4FUHA 1ORFA 2R3YA 4P02A 3NRLA 1E38B 1G9IE 1E35B 2R0LA 5FX5A 1P0SH 1SGQE 1K1PA 2A4OA 1SSXA 5EPYA 1INCA 1YLCA 2HNTC 1FUJA 1HJ8A 2CN0H 1V2KT 2J9NA 2RA0A 1P2MA 1SLWB 2PV9B 4OS2A 3FN8A 4RKJB 2HRVA 2QF3A 3KQDA 3ZZ7A 3A7VA 4OS6A 4ZH8A 3SJKA 4AOQA 3K6ZA 1CHOF 2ZFPH 1EFRD 2L6OA 2R0KA 2ZWLH 2P16A 5EG4A 3LGVA 1QL8A 3SJOA 1YPEH 2XC5A 1Z8RA 3RMNH 3P17H 1W0YH 3U8RH 4OS7A 1AFQB 4Q63A 1V2RT 1A4WH 4UFEH 1NS3A 1UK3A 1IQJA 2ZNKH 3PMJA 1O33A 4F4OC 1K9OE 4FUJA 2F3CE 5LPFA 4RSPA 1YPMH 3H5CB 1AU8A 2BZAA 2FTMA 3SU4A 5G4BA 1T4VH 2KAIB 3LC3A 3LT3A 4CR9A 3MU8A 4AB9A 1GJ7B 1BRAA 1P06A 3VXEH 1ESTA 3RXFA 3S69A 3T5FH 3RXHA 5JBBS 1CHOG 1GJ8B 1BMNH 1EPTA 1GBFA 4MNWA 2KCOA 1SQOA 2ANMH 1LKBA 2W6ID 3MI4A 1DOJA 1P3CA 2XC0A 1GI2A 1UTJA 2ZHWH 1VGCC 1S83A 2J38A 5FX6A 4HGCA 3RU4D 2VGCC 3SOSA 1QCPA 1ZMNA 1MD8A 3TGIE 2AHME 2OINA 1TPSA 3LH1A 3JZ2B 4I8HA 1C2IA 1BBRK 1GVKB 3M7UA 3E6PH 4Q7XA 1VJ9U 1P03A 1P2IA 4B71A 2AYWA 1OHHD 3UNSA 1O2KA 5FXLA 3PV5A 1NT1A 3CS0A 3UAIC 1DWCH 2GV7A 4H6TA 2GDEH 3SU3A 5T1VA 3U9AH 2OC7A 3UNQA 1F92A 1GMHF 1HUTH 1LQDB 2V35A 2LPRA 1KTTB 1OXGA 3OTJE 1A0LA 3EE0B 4K1SA 1O30A 3GY8A 2J98A 4JZ1A 3RU4E 1HJAB 1GDQA 3OY5U 5GJ4B 1P2NA 3SU1A 3MU4A 4LOYH 4FUBA 1SGRE 3UQOA 2ZFSA 2GZ7A 1CSOE 1AVXA 2XOKD 1NN6A 3C27B 3Q3YA 3KGPA 2Q6GA 1NPMA 4K3JA 1V2LT 1K1MA 2BD7A 1P11E 1QRXA 3BEIB 1TMBH 1ELEE 3S9CA 1MTUA 2ZEBA 1Y3XA 1FV9A 2EI7A 5KECA 2A7CA 2A5IA 4XE4A 1CA0B 1P9UA 2XBYA 1TBZH 2ZDLA 1F5LA 2D2DA 2ZHQH 1BQYA 5JB8S 1E79D 1V2JT 1BOQA 2WV4A 4INLA 3A82A 2QXJA 4Q4LA 2BQ7B 1UTMA 1SQRA 1V2WT 2Z3DA 1GMHG 4BXSA 4AFZA 1C9TA 2BLOA 1DICA 3RMLH 1MTWA 1C1UH 1GHYH 5EGMA 1TWXB 4KP0A 4AGJA 1O5AB 3RXLA 1YGCH 2FYQA 3SNBA 3T28A 1O35A 3RXUA 1D3DB 1N1LA 3E1XB 2BXTH 1YF4A 4IW4E 1AFEH 1C1VH 2GDDA 2TGTA 3NZIA 3OX7U 2OC0A 1AKSB 3IITA 3SHCH 2F9OA 1LHDH 3RXDA 1QA7A 1RS0A 1GBEA 2WZQA 4ZHMU 3SNAA 2ZDKA 6ESTA 1C1WH 2NU4E 1O2UA 3UWIA 2PP6A 2ZTZA 1ZPCA 1Y5BT 1ID5H 3QX5H 3T62A 1RRKA 4UDWH 1KXBA 5EW2H 4CBNA 1M9UA 3QO6A 4A7IB 3BTGE 5JBAS 4WMDA 3QWCH 1PQ7A 3ITIA 1UTOA 2H9EH 1AB9B 3SU6A 3RXBA 1BTPA 2G00A 3KCGH 1Q3XA 2GCTB 1HJAC 4AG1A 3PRDA 4O3UA 1GJ9B 1QB9A 1Y3WA 3HATH 2BDIA 1K21H 1QJ1B 4XD7D 5ESTE 1QRZA 5T3HA 4K1TA 4AC9A 1SGIB 4I7YH 5C17A 2GP9B 2SGPE 1Y5AT 1Y59T 1TA6A 2ZQ1A 1AD8H 4CH8B 1TPAE 3KYFA 1Z6EA 1CA0C 3A86A 5C0UA 1KMHB 3ATWA 4NG9H 1C2KA 4NIWA 1SLVB 1IQFA 2FEQH 2Y5GA 3SZNA 1GI8B 1HPGA 3OSYA 4MLFB 3SBKA 3A7ZA 2R2WU 1FXYA 2W3IA 2FOCA 3MYWA 3PO1B 4CBOA 1FX0B 1EAUA 1TX6A 1EUFA 5L6NH 3IWMA 4WVPE 3UWJH 4OS4A 4GLYA 1BTHH 1Z8GA 5C2ZA 1AI8H 4DJZB 1JMOH 2XYAA 5A8YA 4ZKRU 1C5MD 1O3LA 3RXEA 2ANYA 1EP6A 4NWKA 2ANWA 3R3GB 4ISOA 1QY6A 2H5DA 3TVJB 1PQ8A 1SQAA 3OAAD 6LPRA 2K1QA 1ETSH 1DVAH 5F53A 3FZDA 1H8ED 3AASA 1EB2A 3LGUA 3ZYEA 1O3BA 2AEIH 3NUMA 3GCHB 3D49H 1AB9C 2VBCA 1NRNH 3SJ8A 3SUEA 3R0FA 4X1RU 4Y79A 1FIWA 2ZCLP 2QC2A 3CP7A 1ZHPA 1ELTA 2GCTC 4U01A 3QLPH 3OFND 2AERH 1YP9A 1KXFA 1ACBE 4BAOB 1NRQH
chains in the Genus database with same CATH topology
2AMPA 4I8KA 6GCHF 3LKWA 2O8UA 3V13A 1DDJA 1AWHB 3ZVDA 2IPHA 1F5RA 1SOTA 3MH5A 3OYPA 2P93A 2XRCA 5JYIA 1N8OC 1PPFE 3ZV9A 2QAAA 2ZGCA 1FAKH 1TIOA 4X2WA 4RN6A 4X8TH 5TJXA 1F7ZA 2QY0B 1SL3A 3S9AA 1ELGA 2FOEA 5GCHF 3GY3A 1C1PA 1HAVA 1HJ9A 2P59A 1XM1A 3SGQE 8ESTE 1EP5A 3VB7A 2FS8A 5A09A 1T7CA 1GBLA 1RD3B 2FM2A 3GYMA 1PFXC 4FUFA 1H8IH 5DPAA 2NWNA 1YM0A 2Z9IA 2BY6X 1UTNA 3MU5A 3ZZ9A 2QXHA 4YOIA 1SQTA 3ATMA 2W3KA 3L33A 1QR3E 1O5EH 2Z7FE 3RXKA 1NU7B 2BY7X 4FU7A 6GCHG 1MBQA 1EAIA 2SGEE 1NFYA 2AMQA 3ZZ6A 1QBVH 1GHBG 2C90B 2ZPQA 1IQNA 3PMHB 2ZDNA 2WV5A 1EAWA 3DA9B 4Y0ZE 1LHGH 1LKAA 3A7TA 5A2MH 3TPIZ 4WH6A 1BBRH 4NZQA 4YM9A 1AVGH 2GVFA 3M35A 5GCHG 1O37A 1TGSZ 3BG4C 4I33A 9LPRA 1QL7A 1V6DA 2IJOB 1SLXB 1THSH 4AYYB 2DE9A 4AGKA 1ZGIA 3TITA 5AF9H 5IYTA 5C1XA 5I46H 1AY6H 4BNRA 2BM2A 1K22H 2GZ9A 1TPPA 1H9IE 1ABIH 3TK5A 1Q31A 3F68H 1T8LA 2HPQH 4X6PA 5A8ZA 1ZPZA 2XCNA 4D9RA 1O2LA 3LOXA 1F0UA 4U30A 1GBKA 4DIIH 1MZDA 5HYOA 1S6FA 1HAIH 2V3OH 2WYGA 4UFFH 4B2AA 4A92A 1L4DA 1AO5A 1HAOH 3CS7A 3L6PA 5CE1A 4KGAA 3RC5A 1G2LA 1BTZA 1YKTA 1OKXA 2G8TA 1EAXA 5EOKA 2OQUA 4MPWA 5FAHA 3QZRA 2ANKH 1EPTB 3RM2H 1D6RA 3I78A 3FP7E 3EGKH 1K1LA 1O3PB 2BD8A 5L2YH 4LZ1H 4YT6H 4R8TB 2D1JA 1Z71A 4HTCH 1C5SA 4MNYA 2HPPH 4HZHA 2BX4A 2FX4A 4UFGH 1TFXA 3ZVGA 5GXPA 3AAVA 2J95A 2PLXA 3M37A 1W14U 1Y3VA 4JK5A 3F1SB 1V3XA 1MH0A 3MO9A 1J14A 4ZKSU 3HKJB 5AFYH 2PGBB 1GCDA 5F8TA 3GISB 3A7WA 2BDCA 2F9NA 3FANA 1S82A 1ETRH 3A81A 4ISNA 2FO9A 1LTOA 2XBVA 2BVSH 2VU8E 4LK4A 2XTTB 3KL6A 4WJG2 1OS8A 1ZOMA 1DITH 3VXFH 1NROH 2HGTH 3ZVCA 3KQCA 4K1EA 3RMMH 1NM6A 1MQ6A 1LPGB 1HYLA 4ZROA 2FOFA 3D62A 3F9FA 2CXVA 5JBTA 1DXWA 3BSQA 1O31A 1B5GH 1EB1H 2ODQA 3RXSA 1NO9H 4XBBA 1C5RA 1HIAA 1TA2A 4FVBA 5EQQA 1NZQH 1ZTLA 4DURA 4CRGA 1B7XB 1DM4B 4ZHAA 2VIWA 1P09A 2CF8H 3UPEA 3RP2A 1XMNB 2FOGA 2ZCHP 3U69H 2O9QA 2H9HA 1QTFA 3MH6A 1EPTC 2SGFE 2O8MA 1GI3A 1PYTC 4JYTA 1XVMA 3RXJA 3NK8A 3STIA 1GHVH 1TB6H 3T2NA 1RTFB 1N6XA 1O3JA 3LGTA 1W3CA 9ESTA 2AGGX 1XUKA 1C1NA 2Z94A 1TABE 2EI8A 1BITA 4GUXA 4Q80A 2BLVA 5F6MA 3N7OA 1XX9A 2D8WA 3SI4H 1GVLA 1DANH 1GBDA 2ALPA 4J2YB 3TJNA 1FI8A 2WPMS 3LIWA 4IMZA 4AN7A 3VB4A 1W12U 5BRRE 1KLIH 3Q76A 5TCCA 4B76A 1AGJA 2CF9H 1EASA 2JH6D 2J94A 2VWOA 3KN2A 2VWLA 1C5UA 3UFAA 1MU6B 5EQRA 2PW8H 1G3CA 1BZXE 1SBWA 2B5TB 2QIQA 1KLJH 2O8LA 1TBRH 2HOBA 1DS2E 2OC8A 3SU0A 1RTLA 4NZLA 1PPHE 1D3QB 4D9QA 1E34B 1S5SA 1O36A 1RGQA 1GDUA 1O2RA 2ZCKP 1O3MA 1H9HE 1E37B 1SC8U 4K8YA 2STAE 2Y5HA 2BD3A 4K8BA 4DGJA 3ZVFA 1A3EH 2A4RA 4B2CA 3A83A 3V7TA 1SOZA 1IQHA 3P6ZB 1F5KU 4H6SB 5A0AE 1GHAF 2XCFA 1FPCH 4IC5A 2ZI2H 2WPHS 3LH3A 1C1QA 4FUCA 1MMJN 2FOMB 2ULLA 1A1RA 2A2QH 1O2QA 1OWIA 1JOUB 2GCHF 1MD7A 1ZSLA 3C1KA 3SUDA 5FPTA 1W8BH 1GBHA 1QNJA 5E0GA 2FXRA 2ZU4A 3BV9B 3SV2H 2ZF0H 2FMJA 2ZU3A 1C5LH 2VB0A 1E36B 2BX3A 3TLOA 1CHGA 5C1UA 1AE8H 8GCHF 4D76A 2J92A 3PV4A 2BXUH 2O8TA 1HDTH 1FY5A 1GBAA 1DY9A 3E16B 4DY7B 3BIVH 2FDAA 1C5NH 2W5EA 1T8NA 1IQLA 2FI4E 1MU8B 4FUEA 4OS5A 3MH7A 2R3UA 3MH4A 4JK6A 3QDZB 2A1DB 1BHXF 4X1NU 1HXEH 2OTVA 3RXQA 1GHWH 1GHAG 1O3CA 1OYTH 4H4FA 1YC0A 1O3NA 4ABJA 3AVZA 3SO3A 2ZDMA 1ELVA 5TCAA 3ODDA 1D3TB 2GCHG 2ZP0H 4O9VA 1CGHA 1KSNA 4U2WA 1ANCA 1O2IA 1O5BB 1Y5UT 4QT8C 4IS5A 1C2MA 1BRUP 3STJA 1MQ5A 4FU9A 1QB6A 3GY5A 1GJ6A 8GCHG 4BTIB 4Y11E 2VIQA 1G3EA 4X8UH 1C5VA 1UK4A 2P3UB 2ILNA 1DFPA 1BDAA 1SGFA 4I32A 4TWYA 2C8ZB 1EQ9A 3MNXA 3WY8A 4IMQA 1SMFE 1D3PB 4JZEH 4X2VA 1F0SA 2GV6A 3VB3A 1ETTH 1FLEE 4KELA 1SGTA 1BCUH 3ZYDA 2FYRA 1Z8JB 3I29A 1AUTC 3RM0H 1AFQC 1VJAU 1NRRH 1C2GA 2OXSA 2BY9X 1THPB 1ZPBA 1C2FA 1OWHA 3S7KB 3ZZ8A 3BEFB 1ZHMA 1NRPH 1HAPH 3BF6H 2XBWA 4NIVA 1G32B 4M7GA 1PPZA 3ENSB 3GY2A 4XBCA 1G3DA 1PPEE 3K65B 3LJJA 5EQSA 1GI6A 3GDSA 3P70B 1DWEH 4Q2KA 5DP9A 2ZHDA 5DP5A 2OLGA 3RC6A 1SGPE 4MVNA 4YOJA 4OGXA 1XVOA 2P3FH 4MG3A 3BTWE 3QTVH 1C1TA 4GHQA 1HAYB 3KEEA 1SFQB 1BJUA 4ESTE 1EOLA 5FCKA 2CGAA 4FUGA 4PROA 4X6OA 5E0JA 3A8BA 3UQVA 1PYTD 1O2GH 1ARBA 1FY1A 4ISIH 4X0WU 1TNKA 5AFZH 1NFWA 1TQ7B 1GHXH 1VR1H 1PQ5A 3O8DA 3PWCA 1EJNA 1BHXB 1TX8A 1ZZZA 4DG4A 4XSKU 4AFUA 4X8VH 1JXPA 1FDPA 3SNEA 3KIDU 1V2UT 1QQ4A 2A5KA 1BBRE 3T29A 3PYHA 1CT2E 2A0QB 2FZZA 1TAWA 1RXPA 2Q6DA 2ZO3H 2WPKS 3F9GA 3A8CA 2CMYA 2WINI 2ZG0H 1GBCA 3H7TA 3A7XA 2H9TH 2J34A 3DT0H 1ZSJA 4MPUA 4Q7YA 1FJSA 3M5LA 1ANEA 4MTBA 1YBWA 4DW2U 1MZAA 4ABHA 2FI3E 4A1VA 1A46H 1CU1A 1GI7B 2G4UA 2Y7ZA 4K5ZA 2GMTB 3QN7A 3GICB 1ZYOA 1OPHB 1O38A 1MAXA 2FX6A 3A89A 1K1JA 3FFGA 1EZXC 3SNDA 1NESE 6CHAB 4WH8A 1SVPA 2VVUA 1O5CB 3UOPA 4OS1A 5C20A 4NCYA 2A4QA 1GJ4H 2F9VA 2ZFTA 3DHKH 4HI3A 2AIQA 3A8DA 2ZIQH 1UO6A 5FPYA 1W2KH 1ZSKA 2Z9KA 4B2BA 1BIOA 3TJVA 2Z3EA 4NA8A 2VIPA 1SI5H 7KMEH 1KTSB 3A80A 2CHAB 2YNBA 1C4V2 1O2MA 4A1TA 1O2OA 2B0FA 4FUDA 2ZFQH 3RUOA 1EKBB 1ABJH 3HK3B 5DP8A 1UTQA 1W13U 1CT0E 5JDUB 2AMDA 4X8SH 3SV8A 2F9UA 1LMWB 4WMFA 2NU0E 3GYLB 2BDHA 3SN8A 3DD2H 1K1OA 1P05A 1GWAA 4CRDA 4X6NA 1BRBE 1C5OH 1ZTKA 3FAOA 3M3TA 2PSYA 2BDGA 3FVFB 4Y0YE 1C2DA 2C8XB 3AW0A 4JYVH 3SHAH 1A5HA 1C4Y2 4MDSA 3LGIA 3ESTA 2H1UA 3V12A 1GI0A 1J16A 2HALA 1X7AC 1HIAB 1JRTA 5LPRA 2XC4A 1KXEA 1J8AA 3A88A 3NXPA 1FQ3A 1T8MA 4JCNA 4E05H 1AIXH 1XXDA 1CGJE 2C8WB 4BTTB 1TNHA 1XUJA 2GMTC 3E3TA 1V2MT 1VZQH 2J2UA 1CBWB 1LQEA 4NSYA 2FI5E 1J15A 1D6WA 1A5IA 1QBOA 4DOQA 2VVCA 2BLQA 5ETXA 2V3HH 3OU0A 1YPJH 3M3VA 3Q00A 3UY9A 4CRAA 3UNRA 3UUZA 4K69A 1PPCE 2A2XH 2JKHA 1GMDF 1GVZA 1U6QA 1C5ZB 1UHBA 3ZZ3A 5E2PA 3ZVEA 1JIMA 2A31A 1ANBA 4XDEA 2SNVA 5LPEA 1O3AA 3E91A 5SGAE 1TONA 1BRCE 4NA7A 4CRFA 1BJVA 1GBTA 1FPHH 2GD4B 1IHSH 4I8JA 4I31A 4VGCB 2UWLA 1UCYK 2XW9A 2JH5D 3HPTB 4IN1A 1TGBA 3HK6B 1CQQA 3RXIA 1XUHA 3TJUA 3PO1C 4YT7H 2CHAC 3SNCA 1WCZA 3A85A 1GI1A 4WXVA 1P04A 3PWBA 3T25A 2A5AA 2P8OB 2XWBI 4Z6AH 3GDUA 2BD4A 2NU2E 1VCPA 1ELDE 2G5VA 2A45B 2IN2A 5CMXH 1UVTH 2M5TA 5GDSH 2Z9LA 3UIRA 1SPJA 3PLBA 2A7HA 2Z6BD 5JBCS 1PQAA 1V2NT 4TWWA 2HVXA 1G36A 3MOCA 1GMDG 1TGCA 4UFDH 2W7UA 1YLDA 4D8NA 1O3DA 1DWBH 3PTNA 4MPVA 3D23A 3GCTF 2BVXH 4Y7AA 3GCHC 2VVVA 1HXFH 1AUJA 1A61H 5CHAB 1ELFA 1K2I1 2BHGA 3VB5A 4YESB 1WTGH 1UTPA 3UR6A 2TGDA 2AFQB 4F49A 5IDKA 1FMGA 3ATLA 4I8GA 1TYNA 1Z6JH 3SUFA 4DVAU 1W10U 1Z1IA 2HNTF 3B23B 1O3IA 1SGFG 2ZGHA 5A0CA 5K7RA 1XUGA 4NIYA 3U1IB 3F9EA 1DY8A 2PKAA 4D7FA 2BDBA 1KLTA 4OGYA 1YPLH 3GCTG 4VGCC 1SGCA 1H4WA 4ABEA 1A0JA 1GJDB 1S6HA 2BY8X 2R9PA 5J4QA 1UTLM 1EZQA 3D65E 2UUJB 1UCYE 4UEHH 4FUIA 1KDQA 2GGVB 3ZZAA 2P8OC 4Y6DA 3K9XB 4B73A 1A3BH 2BOHB 2F9PA 3ZZDA 2B7DH 5EXMA 3U1JB 3PLKA 3TIUA 4D7GA 1ANDA 2RDLA 4ISLA 3MNBA 1CT4E 1O2VA 3UREA 1DUEA 1JIRA 1GJ5H 2FOAA 1WQSA 1O2WA 3H7OA 5ESBA 3PLPA 2ZC9H 1IHTH 3AW1A 3GCNA 1YCPM 3LC5A 1FY4A 1SR5C 2Y5FA 1AN1E 1ELAA 3UR9A 4TY6A 5L30H 1FONA 1S85A 1NY22 1O2JA 2QXGA 1BT7A 1D9IA 1IOEA 1G2MA 3BTME 3O8BA 1CA8B 1QB1A 3Q77A 5T6DA 1DE7H 1EATA 1MKXK 1LO6A 3U8TH 1K1IA 3QK1A 1NTPA 4H42U 1NU9A 3NKKA 1ZTJA 2BQ6B 4CHAB 4A6LA 1O2XA 2A32A 3U98H 1SHYA 1IQMA 4O03A 1L1NA 1DSUA 2GT7A 5GIBA 1UMAH 2ZU2A 3DUXH 3MMGA 4LXBH 2OBQA 1HGTH 3RLWH 4SGBE 8KME2 3V3MA 1GL1A 1K28D 1O2HA 4BAMB 1LVYA 2ZQ2A 2GX4A 1O3GA 1WTHD 4JZFH 1TRNA 1NC6A 1BTUA 2PTCE 1C2LA 1KXCA 3RXPA 4BTUB 2FOHA 1TNIA 3E0PB 1OWKA 3TU7H 1V2PT 1QQUA 5JPMH 3P8FA 2Y7XA 4A5TS 5T6GA 1FY3A 2PFEA 4ISHH 4GAWA 1TMTH 3VEQB 1T32A 2V6NA 1OWEA 3W95A 2Y6TA 4BOHA 5AHGH 5ABWA 1HB0B 2WPIS 4K60A 1SG8B 1C5PA 1YPGH 4RKOB 1P2OA 3GY4A 1AHTH 2WUCA 1FY8E 2BB4A 3SU2A 2G51A 5GPIB 1ZJDA 1GCTB 1O2ZA 3JZ1B 3A8AA 1KY9A 1WU1A 3TGJE 3TK6A 4MPXA 1ELBA 2ZHFH 3SU5A 1JWTA 2IOTA 3EA8A 4YZUA 1GMCF 5DP4A 2OBOA 1ZR0A 4YLUA 3MNSA 1OP8A 4TYDA 1ZRBA 3ODFA 1O5DH 4GPGA 3BTQE 2ZGJA 2TIOA 5PTPA 3Q3XA 1ZRKA 4GCHF 3Q3KA 1EX3A 3L3TA 1FIZA 3EDXB 2VIDA 4NFEA 1BA8B 3ZZBA 4NA9H 1VGCB 2FPZA 5DG6A 1C1SA 4ASHA 1BTXA 3GCOA 1ESBA 1AMHA 3P95A 3QUMP 3HKIB 2QA9E 4CRCA 1QRWA 4BAQB 3EA9A 1THRH 1K1NA 5EPNA 1A2CH 1DLEA 1Z1JA 5DK1A 2D26C 1YPKH 2FTLE 3HGNA 1GJCB 1GMCG 3A84A 2UUKB 4CR5A 1O2TA 3S0NA 2C4FH 5DP7A 5HM2A 1MCTA 4TPIZ 1CE5A 2VWMA