1A7SA

Atomic resolution structure of hbp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
225
structure length
221
Chain Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPARIN BINDING PROTEIN
publication title Atomic resolution structure of human HBP/CAP37/azurocidin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease homolog
total genus 53
structure length 221
sequence length 225
ec nomenclature
pdb deposition date 1998-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a7sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a7sA02
1A3BH 3DD2H 2HNTE 4FUFA 3RXIA 3VFEA 1BMAA 3RUOA 2K1QA 4I8KA 1MZAA 1A5HA 3CENA 1K1JA 3STJA 3BEUA 3I78A 1CT0E 3B9FH 1GGDC 1PFXC 1PPEE 3SV9A 3VPKA 1GCTC 1SFIA 1O3IA 3SU2A 3A85A 1WOFA 4BTUB 2ZDKA 2WUCA 3RXAA 1AD8H 2RA0A 1V2UT 1DLEA 1G32B 4U01A 1VJAU 4NIWA 2C3SA 2PW8H 1IHSH 4ZXYH 4X2YA 2BDGA 1O3OA 4DURA 3ATIA 4MG3A 1OYQA 4ZHMU 5AVDA 5L6NH 1K1LA 2FOEA 2FOFA 1H9HE 2GX4A 1C2KA 3A81A 1TMBH 3SU5A 2XC4A 3ZZDA 3ESTA 3QGJA 3ZZ9A 2J4IA 1J16A 2FYQA 1FNIA 1MKXH 1AMHA 5JDUB 3SQHE 1NTPA 1O3CA 1C5NH 1ELEE 1SI5H 1SOTA 2ZG0H 4CBNA 1EPTB 1S0RA 2RCEA 3LC5A 1LVYA 2FXRA 4YTAA 4XBBA 2QV1A 2W5EA 1G3CA 2BDAA 3NPSA 1C5TA 1PQ8A 1DY9A 3ITIA 3EAJA 1O2IA 1C1TA 4NSYA 5L2YH 1O5AB 4FUGA 5JBCS 4TY6A 2AYWA 3P70B 3MNBA 1Y3XA 1ZTLA 1Z1JA 2QXHA 1NO9H 2FI3E 2A4GA 1AY6H 4KP0A 1JRSA 1GBMA 1HAHH 2ZHDA 3S9BA 5F03A 1B7XB 1Z6EA 1EB2A 1TALA 1UMAH 1FQ3A 4Y0ZE 1H4WA 2EEKA 2OCVB 4DG4A 1CGHA 5C20A 4WY3A 4AG1A 4K60A 3BTQE 1NU9A 1FMGA 3UREA 2V0BA 5I25A 4NFFA 1FPCH 5DO4H 1CGJE 1CHGA 2WPLS 2WYGA 1TONA 3S7KB 4GUXA 1L4ZA 1K22H 5A0BA 1T4UH 1ZPBA 1SGYE 3T26A 4CRDA 2A4OA 1RGQA 1ESAA 1SQAA 3RC4A 1RIWB 1HAOH 2A7CA 3GYMA 2ZGCA 3OX7U 1HFDA 3RXQA 3BTFE 1SC8U 1FV9A 3GY8A 2P16A 2V35A 4Y11E 1MTWA 4K8YA 1AI8H 3F9GA 1FY5A 1HJ8A 1YM0A 1YCPH 3LKWA 3OY6U 3A8AA 1Y3VA 2ZZUH 3U8OH 1GJDB 1C2GA 3FP7E 2XC0A 1AE8H 1VITF 4A1VA 1E36B 1KTSB 3RXMA 1EZQA 1Y5UT 5EU8A 2PWXA 4I32A 5GWZA 1NROH 1TPSA 2Y7ZA 4MVNA 1EAUA 1N8OB 1UCYH 2FOAA 4NSVA 1C4V2 2A1DB 3LOXA 1GHVH 3PTNA 1NRNH 1GWAA 2Z9LA 1O2ZA 4NA9H 4MPXA 4E06H 2D26C 3SJ8A 2Z94A 3ZYDA 4BAKB 1OSSA 4JK5A 3P92A 1MKWH 4MTBA 2OC0A 3PMAB 4B76A 3S0NA 1JIMA 3QTVH 1NFUA 3DFLA 3D65E 3VXFH 5JPMH 1C1RA 1XVMA 3RXCA 1RFNA 1TNIA 2WV5A 3P95A 1O3GA 4YT7H 5A0CA 1NRPH 3VB3A 1TE0A 1DVAH 2JETC 1BJVA 3D23A 2C8YB 2NU0E 2W26A 4Q7YA 1JRTA 3ZZ6A 1A3EH 1TBRH 3K2UA 3HGPA 1BBRK 1LVMA 1Q31A 1UTPA 5K7RA 2Y5GA 3HKJB 4I8JA 4U2WA 4LZ1H 4K8BA 5A2MH 5CHAB 4B2BA 2B0FA 2Q6DA 3RXBA 1O37A 4M7GA 1O2QA 4K1EA 4X6NA 1MZDA 4AYVB 4B2AA 1QQUA 4CREA 3STIA 1ZMLA 2BX4A 2OINA 2QF0A 3DT0H 5CMXH 2BY5X 1XUFA 2BD2A 3L3TA 2ZHFH 4WXVA 1CBWC 1U6QA 1GMDG 4FUBA 2H9HA 4RKOB 1OXGA 2UWPA 2A7HA 3HKIB 1DWCH 3SJOA 2ZTXA 3BG8A 3U1IB 1G30B 3QWCH 4AOQA 1O3HA 3A7VA 2ZDMA 7LPRA 4OS2A 2ZCHP 1LKBA 2P8OC 1W10U 3LGYA 1ESTA 1DT2A 2XC5A 2FWWA 4A1TA 1KIGH 2GV6A 4O03A 1RTKA 1Z7KA 2GP9B 2ZTYA 4FUHA 1BTWA 1BTXA 3UPEA 2ZFFH 3BIVH 4Q80A 4NZQA 1QRWA 3TJOA 4AFZA 3IG6B 1PPCE 4CH2B 3SOSA 5HGGA 6CHAC 5GCHG 3SU1A 1IQIA 1QB6A 5HXFA 3M5MA 6GCHF 3W95A 2EI6A 2ZU5A 1BHXB 1YPMH 4UONA 1B5GH 3Q00A 4HI3A 1THRH 1YLCA 1HUTH 1C5LH 1K9OE 1ZSKA 1V2RT 2ODPA 1ZPCA 4CR5A 1N6YA 3PM3A 1TNHA 1QB1A 2VIOA 2VWMA 2O8LA 1XUIA 1SOZA 4IC5A 3SV7A 3VGCC 4VGCC 2ZPQA 4GVUA 1C1SA 1FY4A 1CU1A 1MTSA 1ZJKA 4MPWA 2A0QB 1WQVH 3VEQB 3MNCA 1TYNA 2OLGA 1QCPA 2F9NA 2THFB 3LPRA 1EAXA 4YZUA 2G51A 3AW1A 4B74A 1FY1A 3S9CA 1D3DB 4FUCA 1GDQA 1W11U 1O3PB 5L2ZH 1EZXC 2ZI2H 3UWIA 1GHWH 3JZ2B 4ZROA 1G3DA 1S6FA 1S84A 3GY3A 1GGDB 1BBRE 1A0LA 2VIPA 1O2LA 1BMNH 3TH3H 4PROA 7GCHG 1XUJA 4AFSA 2ZDVH 1GCTB 4LK4A 1GBHA 3HPTB 3VB7A 1ANEA 4CHAC 1DY8A 1H9LB 2PTNA 4Y10E 3M37A 2O8MA 2Z3EA 2GTBA 2ANKH 1FY3A 3B8JA 2AIQA 3SNDA 5A09A 2J94A 5FHTA 5TCCA 1DS2E 3SJIA 1O38A 2H5CA 4F4OC 1V2KT 1AFEH 1IQJA 3R0FA 1OP2A 2QXJA 4WJG2 4ABEA 1VZQH 1TRNA 1TMUH 2EI7A 1EQ9A 3U69H 2CHAC 4NWKA 2CV3A 3ZZ5A 4E7RG 1AVWA 3KNXA 1A5GH 2G8TA 2PTCE 2ZFPH 3PLBA 3GY4A 2BOKA 2FOGA 2BVXH 2VINA 2CXVA 3LJJA 1KYNA 2BVSH 4R8TB 3PTBA 1EKBB 2BQ7B 3H5CB 1MKXK 1S82A 1O33A 1O34A 3A80A 4J2YB 3SQEE 1QRZA 1C1VH 4SGBE 4BAMB 1O2SA 2FLBH 3SI4H 2B8OH 1GJCB 4B2CA 1O5FH 2IOTA 4IMQA 1TRYA 4IBLH 3RMNH 3V7TA 3UQOA 3EDXB 1ELBA 1O5EH 3HK3B 1YLDA 2SGAA 1UHBA 2A5IA 1O2XA 2IPHA 2QXGA 1C5WB 5GDSH 3EA7A 3UNSA 3E16B 3E1XB 2ZO3H 5E2OA 5EW2H 1ZTKA 1GDNA 1O5BB 2OQ5A 1G2MA 1EAIA 1RIWC 3SU0A 2P95A 2BQWB 3PMBB 6ESTA 2ZGBH 1C2LA 1SGCA 1GHAG 1C1OA 7KMEH 2VVCA 3E3TA 1P3EA 1MAYA 2BD7A 1PPBH 2ZDNA 4BANB 1TGTA 3SUFA 1KLIH 1BIOA 3MU4A 4J1YA 1DFPA 1ZMNA 1NFWA 1O3LA 2VU8E 5EQQA 5GCHF 2WYJA 1O5DH 4K1TA 1GBCA 1YCPK 5FX6A 2AIPA 2OC7A 2XCNA 3HK6B 1EJNA 3QUMP 3SUEA 4THNH 3SZNA 1P9SA 4Z0KA 5HM9A 1UTQA 1CT4E 1T4VH 1ANDA 5EG4A 2IN2A 2ODYB 2TGPZ 2ZC9H 2FM2A 1O2GH 4HZHA 4IGDA 1GI7B 1Z8JB 1XKAC 3NXPA 3PYHA 4H42U 1ORFA 1FXYA 3IWMA 1O2RA 1OWIA 1QURH 2Y80A 3LGIA 3RXEA 1O39A 2I6QA 1NRQH 1ZRBA 1GBIA 5J4QA 3ATMA 2QF3A 2JH5D 3HATH 1K1MA 3CP7A 1M9UA 2FZZA 1SGFA 5BPEA 1GI5A 3DA9B 5L30H 3UUZA 2BDCA 2XWBI 1MKWK 4YESB 2JETB 4JCNA 4CRCA 4AZ2B 2UUYA 1UTKA 3LGTA 2ZECA 3RXSA 2HOBA 1SHYA 1AWHB 3MO6A 1O3DA 1YBWA 1OWDA 4NIYA 1WUNH 5C5NA 2D1JA 1Y3WA 5HM2A 2BLOA 4X2WA 1A0JA 2CGAA 1SGPE 4ABHA 3BTME 1O2PA 1MCVA 1MD7A 3KQEA 2GCHG 9ESTA 1G2LA 1GI2A 5AFYH 4JYVH 2Y7XA 1TAWA 1HAZB 3H7OA 5CHAC 4WH8A 3OTJE 5J4SA 3SO3A 2PGBB 1JWTA 1Q2WA 1PPFE 3KQCA 2ULLA 2AMDA 4FU9A 1QRXA 3SW2B 1O3EA 1CBWB 2TPIZ 1C5XB 1P0SH 1GJ9B 1TPPA 4OS5A 3TJVA 1AHTH 1T7CA 2B9LA 3LJOA 2V6NA 4QT8C 2BHGA 4Q7ZA 1T31A 1HXFH 1TX6A 1E37B 5LGOA 2F83A 2BXTH 1O2UA 1NS3A 2BD9A 3URCA 2Z3CA 1AE5A 2P8OB 4XSKU 1EXFA 4WMFA 4UFGH 1Z8RA 3LC3A 4X1RU 3RC5A 4OS6A 2OP9A 1SQOA 1EB1H 4BAHB 1A1RA 2QGRA 4CBOA 3HGNA 1K28D 1TX8A 8KME2 3RXVA 6CHAB 3MU5A 2H1UA 3SN8A 1K1NA 5EQRA 2FP7B 3VB5A 1AGJA 3U9AH 1TA2A 3ATKA 1FAKH 4TY7A 1HXEH 1PQ7A 1C1WH 4B1TA 2AMPA 1DXWA 1CVWH 1PPZA 2H9TH 3A83A 1P05A 3A88A 1BJUA 5LH8A 3BIUH 1HAPH 1PYTC 5F6MA 1UHBB 1GL1A 3IITA 2Y5FA 1ANCA 2BY8X 2J95A 2FESH 4BTTB 3TLOA 1MBQA 2WPKS 3VGCB 4VGCB 1K1IA 2BD5A 3ZZ8A 1G9IE 3SNBA 3RC6A 1UTMA 1NRSH 2STBE 4I8GA 3MO3A 1ANBA 2A4RA 3MYWA 3A89A 1J8AA 3O8CA 1HV7A 2M5TA 3JZ1B 4O9VA 2KAIA 2JH6D 1ZR0A 3SORA 1OWJA 2XBVA 3LDXH 2BTCE 1SPJA 1O2JA 4ZKRU 2XRCA 3ZVCA 3AAVA 1QJ6B 1BMMH 2ZTZA 2AMQA 2BXUH 1HIAA 1INCA 1P2OA 2ZGHA 4CH8B 5A8XA 3GICB 4CHAB 4KKDA 1V2PT 1OYTH 1P9UA 1THPB 2VGCC 3MH4A 1L0ZA 2GV7A 2QAAA 1GHBF 1OKXA 2NU4E 4XFQA 3BTKE 1H8IH 4YM9A 3ZVGA 4X1NU 1TPOA 2TGTA 2C93B 3PLKA 1SLVB 1ZSLA 4RSPA 3SNEA 3PWCA 1GMCF 3SUGA 1P2JA 4O3TA 3ODDA 4Q2KA 2CHAB 2BLVA 2LPRA 1ESBA 4INKA 2GD4B 3C1KA 4A7IB 4K3JA 3A82A 7ESTE 4TPIZ 1LHGH 1SR5C 4MLFB 1C9PA 5I46H 2A2XH 2C90B 1FDPA 2R3YA 1MD8A 1DANH 4U30A 2ZU4A 1TB6H 3KF2A 4MNWA 1YP9A 1E38B 4MPUA 4IS5A 2YNAA 3A87A 3SUDA 3MFJA 2GZ9A 2FLRH 3PLPA 1NRRH 2YOLA 4NZLA 1Y8TA 3S7HB 3E6PH 2BDIA 4ISHH 1O2OA 1O2KA 1GI9B 1S81A 1SGTA 2SNWA 2ODQA 5DP7A 1XUKA 4ABFA 2OBQA 1YCPM 2P94A 1ELTA 1Y5BT 1QNJA 1D3TB 1D6RA 3NKKA 4DW2U 2FI4E 2Z6BD 4NFEA 5AFZH 1UO6A 3E0PB 1BTHH 3K9XB 1ID5H 2H9EH 2XNIA 1RJXB 2Z9IA 1T8OA 2FX4A 4ZKSU 4XDEA 1YPHE 1OS8A 1EJMA 3EYDA 4I8HA 1NPMA 5DK1A 2F9OA 2Q6FA 2Z7FE 1GMHG 3GCTF 3GISB 4X0WU 1CHOF 4YLQH 4UFFH 3P6ZB 1JXPA 3S9AA 1DWEH 4X8VH 3UFAA 3KQDA 2PKSC 2ZDAH 1EAWA 4NG9H 3ZZ7A 1BB0B 3RDZA 1GI6A 2HNTC 1EASA 4MNYA 4GHTA 2HWLB 2J34A 5F8XA 3ZV8A 1KDQA 1QY6A 1F0SA 5AHGH 1P06A 5FCRA 2H2ZA 1DWBH 2HNTF 1YYY1 1A7SA 1G37A 3KL6A 4HGCA 1HYLA 1DXPA 1XX9A 2Y6TA 5EPNA 1V2LT 2SGEE 3RU4E 5IDKA 4ISNA 3LONA 1RRKA 1W3CA 1BOQA 1GBBA 1DX5M 5C2ZA 1EUFA 2KAIB 2CN0H 1O2MA 1VCQA 5E0HA 4Y7AA 4WMDA 4NWLA 2CMYA 1DLKB 3SGAE 2ZPSA 4TYDA 1FAXA 3RXKA 1C5QA 2WPMS 4X8UH 1VITH 4D7GA 3U1JB 1P03A 3ZZBA 4AFUA 1TOMH 1HIAB 1V2MT 4TPYA 5DP9A 1GPZA 3ZVDA 2D2DA 1ABIH 5DPAA 1T8LA 3W94A 3GOVB 1SHHB 1BRUP 3K6ZA 1HAGE 3C27B 1PQAA 1V2WT 1IQNA 2DUCA 2ZNKH 1GVKB 2FDAA 4Y6DA 2PLXA 5C1XA 2WV4A 3P17H 4XBDA 1A4WH 2VJ1A 2BVRH 2BOHB 1FZZA 1VR1H 1C5SA 1HJAB 1DUAA 2C8WB 2Q6GA 1UVSH 1HAXB 2G4TA 4CRGA 3SV6A 4ABJA 4LOYH 1UTNA 1O3FA 4KTSA 3RXFA 2HLCA 3U8TH 2BMGB 1OWKA 2ZP0H 1HLTH 2Z9GA 3OYPA 1HRTH 1GJAB 2RG3A 2VIVA 2FIRH 1YPHC 2QXIA 3VXEH 2SGDE 8GCHG 1DSUA 4NGAH 1TIOA 1BITA 4X6PA 1BCUH 4A5TS 1Z71A 1QBNA 4WVPE 3RLYH 2HPQH 3L33A 1CQQA 1DPOA 1YKTA 1K2I1 1QA0A 3TGIE 4K5ZA 2FPZA 1K21H 4X8SH 3VB6A 6LPRA 4FVBA 1C4U2 1XMNB 3NZIA 3R3GB 2EI8A 3SV8A 1J15A 1SGRE 1Z6JH 2FX6A 1YGCH 5DP4A 2ZGXH 4FU8A 2G5NA 1MBMA 1MQ5A 1IQLA 2H5DA 4BXSA 2GMTC 1OP0A 1P8VC 3GDUA 4XE4A 4INLA 1GI4A 3RXLA 1QBOA 1P2MA 3MH5A 3M3SA 2ZQ2A 4GAWA 1ELAA 5EXMA 1NN6A 3KEEA 3ELAH 2GCTC 4JZEH 2QA9E 3T62A 4GPGA 2QN5T 1L4DA 1KDQB 2ASUB 1TFXA 2VGCB 3EA8A 1FJSA 4JZ1A 2R9PA 1BUIA 3F9HA 1MH0A 2A2QH 4FUIA 3RLWH 2P59A 3GYLB 5FPTA 1AU8A 4D7FA 5ETXA 4RKJB 2Y81A 1QR3E 3BSQA 1DOJA 3RMMH 1TGBA 3RXDA 2XBYA 1O0DH 1V2QT 1HJ9A 4WF8A 3ZVFA 1MTVA 2FTMA 2A32A 1ARBA 1ZTJA 1LO6A 4DCDA 1PPHE 3TH4H 2FMJA 1A46H 1QL8A 4MQAA 3A8CA 4U32A 5A0AE 1RS0A 1ETTH 3FAOA 5ABWA 1AVGH 5T6GA 3QGNB 1P2NA 1SGDE 1B0EA 3QK1A 2Z3DA 1F5LA 3DHKH 4ISIH 1GCDA 2BX3A 1CE5A 4K69A 1D3PB 1OP8A 1XVOA 3V3MA 1V2JT 2Y5HA 2F9PA 4H4FA 1TWXB 3FANA 4I31A 1VCPA 1P2IA 3UWJH 4FVDA 2ANMH 3BG4B 3ODFA 1WAYB 1ZGIA 1TLDA 3GDSA 1K1PA 3S69A 2R2WU 2FOCA 1OPHB 2PV9B 3QTOH 1Y3YA 1GMDF 2XTTB 1CO7E 2ZHWH 5DGJA 5FBIA 1GG6B 4FXGH 4D9RA 3MTYA 4AGJA 1C5OH 5C1YA 4YO9A 1ELDE 1GJ6A 4Y7BA 1JBUH 3TK6A 2NU2E 1A61H 2FI5E 4O3UA 2C4FH 1O5GH 1GJBB 5DJ7A 2SGQE 2PKSB 2TGAA 2VH6A 1GJ5H 1BTZA 2UWLA 8LPRA 1C1NA 3TNTA 1C1PA 1LHEH 2D8WA 2ALPA 3DUXH 1C5VA 1XKBC 4XBCA 1UK2A 3KIDU 2BZAA 1ELGA 3O8DA 2BB4A 4JYTA 3TPIZ 1GI1A 2J92A 3TVJB 1J17T 3MO9A 4AGKA 5JBTA 2VVUA 2J9NA 1BTYA 3G01A 5FPSA 4B75A 3U8RH 4OS7A 1EZSC 3M5LA 1QL9A 1ZGVA 3TIUA 1ZSJA 3Q3KA 5TJXA 1UCYK 1P2KA 4GSOA 1HAYB 3SNCA 3ENSB 3M61U 3T28A 2EA3A 1GL0E 2DE9A 1BTUA 3SU3A 1PYTD 1UVPA 2BD8A 1AFQC 4Y8ZA 1BDAA 1MTUA 1C5MD 2V3HH 1NFYA 2ILNA 4Y8XA 1ZHMA 3RM2H 4AORA 4A6LA 1S5SA 1LTOA 1GJ8B 1KXBA 3SHCH 1LPZB 1LMWB 3ATWA 2PUXB 5F8ZA 4FUEA 4MNVA 7GCHF 4RN6A 2VIWA 1FIZA 3TGJE 2ZF0H 1MTNC 5CE1A 2YNBA 4X1PU 4NIVA 3A86A 5G4BA 4OS4A 1IQEA 1C5YB 1F5RA 1C2JA 1DDJA 1BBRH 2ESTE 3H7TA 2B5TB 3TU7H 1GBAA 1BRBE 1Y5AT 3PMJA 2ZGJA 3FP8E 1O32A 5HYOA 1EP6A 1GVZA 4CRAA 4BOHA 1BRAA 2UWOA 1HJAC 1W13U 4YOIA 1P57B 1PQ5A 3EGKH 4ABDA 3RMOH 1KXCA 3MH7A 4MNXA 4ZXXH 2Y82A 2FTLE 3CS7A 3E91A 1YPEH 1AB9C 2FEQH 4Y0YE 3M3TA 3MI4A 2WUBA 3F9EA 2OBOA 1HDTH 1L1NA 3GCOA 4E7NA 1UVTH 3KN2A 3NK8A 3SGQE 1MU6B 2PR3A 4OGXA 2ZU3A 1DSTA 4E05H 1CT2E 2O8TA 5GIBA 3O8RA 1J9CH 3K65B 4CRFA 1TBQH 2PUQH 4X8TH 1P10A 2XWAA 3M36A 5LPRA 1T8NA 1GBLA 3AVZA 3UOPA 4FU7A 2HRVA 1AZ8A 1TGSZ 3M3VA 2UUFB 2GT8A 2FO9A 4Q7XA 4X6OA 2GVFA 1G3EA 5GPIB 2BLQA 3BTHE 1XUGA 1OOKB 2VWOA 4IMZA 2G55A 1UCYE 2ZU1A 1TBZH 1C4Y2 2FODA 1C5PA 1O2WA 2SGPE 1VITG 2ZU2A 4I8LA 5JB8S 3LGWA 1D4PB 1ETSH 2IJOB 2AERH 5FCKA 3A7ZA 1SGEE 4YOJA 3SV2H 1MQ6A 1AIXH 4JYUH 2GMTB 1BT7A 1QFKH 3UQVA 1WTGH 4SGAE 1GHAF 1L1GA 5E0GA 4DJZB 1ZZZA 2HGTH 2PKAB 5DG6A 2FYRA 1HB0B 2ZEBA 3Q77A 3A7WA 3NCLA 3V12A 3PROA 2GCTB 4B71A 2H6MA 3I77A 3MNSA 1AQ7A 2AH4X 1B0FA 1LKAA 2O9QA 1ZHRA 2PSXA 1ZYOA 3PB1E 1VJ9U 1EOJA 1GHYH 1RTLA 3I29A 2WPIS 3T25A 1XXFA 1EZUC 5C1UA 2UUJB 1KXEA 3TJNA 1KXFA 1YPKH 1D3QB 5F8TA 1GJ4H 2ZHQH 2BDBA 1TRMA 4D76A 1LHDH 1SBWA 3EE0B 4IC6A 1NESE 4X1SU 3PWBA 5JYIA 1IQKA 2ZA5A 5DP5A 1QJ7B 1CSOE 2F9VA 1O3KA 2CJIA 1O3MA 1V2VT 1O3BA 3V0XA 1GBTA 1KTTB 2A31A 1PPGE 4IW4E 3FVFB 1GBFA 3RXRA 2OD3B 1O2VA 1W8BH 1AUJA 2O8WA 2ZFTA 2FOHA 2AGIX 3NWUA 4ZKOU 1TNJA 4YLUA 3F68H 3KQBA 1LHCH 4JZFH 1F0TA 1HCGA 1THSH 2OC8A 1AKSA 3TK5A 4LZ4B 4JZDH 2GCHF 2ZFQH 3MHWU 2SFAA 5TCAA 1E0FD 3TJUA 4ABBA 3BG4C 1TABE 3SHAH 3T29A 4LXBH 5EW1H 2ANYA 3GCNA 3L6PA 4GHQA 3O8BA 2CF8H 3F6UH 4DIIH 3RM0H 3GY6A 4WMEA 1O36A 4BXWA 2BD3A 1EJAA 1WTHD 1JIRA 2VWNA 2ZIQH 5T6FA 1LCYA 3QZQA 2SGFE 1EP5A 1SB1H 1W7GH 2TIOA 3E90B 1GG6C 4BNRA 1T32A 1QL7A 6GCHG 1IQMA 4ZUHA 4B73A 1V2OT 1YPJH 2F91A 2W7UA 4AYYB 3EA9A 1O3JA 4ABAA 2ALVA 1A5IA 3BTEE 2AFQB 4X2VA 4ZMAH 1C2MA 3SU4A 2Z9JA 1FONA 1MMJN 1Z1IA 5GJ4B 4ASHA 4WWYA 5EPYA 1ZOMA 3LGUA 2OTVA 1OX1A 1KLJH 2BY6X 4IN2A 5FXLA 1W14U 3RU4T 3ZZCA 2XBXA 2PFEA 2R0KA 2FS8A 4UEHH 3BTGE 1DICA 1DM4B 2OXSA 4KGAA 1NC6A 1GBDA 4YT6H 3SNAA 1FLEE 2F9UA 4HTCH 1O2YA 4NA7A 1ZJDA 2RDLA 1AVXA 1Z8IB 3BV9B 5JBAS 2BLWA 1O2HA 4I33A 1NT1A 1UTOA 4AB8A 2QY0B 1YF4A 1TOCB 1C5UA 5T3HA 3SJ9A 4DY7B 2BY9X 2NU1E 3LH3A 1P11E 1O3NA 1GDUA 1SGQE 3MH6A 1PJPA 1ZPZA 1IHTH 3AASA 1DUEA 1YPLH 5DP8A 1P02A 1SG8B 1AFQB 1WV7H 3VB4A 1P09A 2PGQB 2VNTA 5C5OA 1J14A 2GT7A 4BTIB 2V3OH 5EXLA 1O31A 1H8DH 2G5VA 1TA6A 2A5AA 2GDEH 4DOQA 2VIDA 3RMLH 4DGJA 3SJKA 1VGCC 4KELA 2ZPRA 4OGYA 3BTTE 1AWFH 1F7ZA 1MAXA 1MTNB 1C2FA 1QGFA 5EODA 3ZVEA 2A5KA 1BA8B 2TRMA 4UE7H 3FZDA 1RTFB 3EQ0H 4ZKNU 1GI0A 3GY2A 1SL3A 3RU4D 2R2MB 1O2NA 1QHRB 1UK4A 2G4UA 2HALA 2J38A 1Z8GA 1SGFG 4O97A 2ZDLA 3F9FA 1WYKA 5H4IB 1EX3A 1DITH 3M7UA 3E8LA 1HAVA 1D9IA 1CA0C 3M5NA 3TK9A 1P3CA 5DP6A 1UTJA 2WINI 3A7YA 1ELCA 3KCGH 1LVBA 2R3UA 3PMHB 4ZAEA 1AB9B 2ZCLP 1AZZA 1SFQB 4WH6A 1IQHA 1NU7B 3PO1C 1GBEA 1K1OA 5FAHA 4JMYA 1S0QA 4BAOB 1S85A 3F1SB 3TITA 1LHFH 2GZ8A 3SI3H 2O8UA 4CRBA 1WSSH 4D9QA 1F92A 2BM2A 1C9TA 3P8NA 4X1QU 1XM1A 1H1BA 8ESTE 2VH0A 1AKSB 1H9IE 1OWEA 1TNGA 3T2NA 1V3XA 1S83A 1Q3XA 4Y71A 1O2TA 4AN7A 1O5CB 1P01A 1FIWA 1SLWB 2FOMB 1SQTA 1YPGH 1SVPA 3RP2A 1UJ1A 2F3CE 2ANWA 3UOUA 1P2QA 2P93A 3TGKE 3SGBE 1FI8A 1ELFA 4AFQA 1IAUA 5HMAA 2BDYA 1VCWA 4FUJA 1UK3A 5ESBA 1KY9A 2QCYA 4ISLA 1A0HB 1WBGB 1Y3UA 1GMHF 2XCFA 4Y76A 4X6MA 1TGNA 3QDZB 3UNRA 2ZKSA 1C2HA 1GHXH 1EOLA 3QO6A 4KTUA 5EQSA 3GCHC 4ZH8A 1KXAA 4JZIA 1GBJA 1NZQH 1QQ4A 1SLXB 2NWNA 1SGNE 3NUMA 3Q3YA 1GHZA 1TNKA 3ZVAA 1TPAE 1SLUB 2LNCA 2G52A 3OY5U 1S6HA 3P8FA 1KLTA 4UDWH 3P8GA 4DVAU 2G00A 4ZHLU 4TWWA 3SU6A 3Q3XA 4HFPB 1FPHH 1IOEA 2BD4A 1HGTH 1N6XA 3E0NB 1GJ7B 4ABIA 1QA7A 1P04A 5A8ZA 2C8ZB 1C1QA 1XUHA 1EATA 4TWYA 2I6SA 3ZZ3A 3UIRA 3M35A 1BRCE 3RXHA 4KTCA 3U98H 2UUKB 4INHA 2XBWA 1GI8B 1W7XH 2RA3A 4UD9H 2C8XB 5A8YA 4WXIA 3UTUH 2BYAX 3BEFB 2VIQA 4Y8YA 1C2IA 5PTPA 4D8NA 2P3TB 3BN9A 3QX5H 1LPGB 3MWIU 1JOUB 1HNEE 5GXPA 4YOGA 1YC0A 5LPFA 1HAIH 2R0LA 1ABJH 3OU0A 3BF6H 4DT7B 3WY8A 5ESTE 3LGVA 1RD3B 1SGIB 1EPTC 2J2UA 1F5KU 2ZQ1A 5JBBS 1O35A 5C67A 1TGCA 1IQGA 4Z6AH 3M7QA 3RXPA 2HPPH 3K6YA 2XXLA 4AG2A 2VB0A 1SMFE 3D62A 5DP3A 2GZ7A 1TMTH 4GLYA 1HAVB 3RXTA 2PSYA 3FP6E 2XYAA 4H6SB 3MNXA 1GBKA 1V2ST 1DE7H 1QJ1B 3MU1A 3BEIB 1HPGA 1W2KH 3LIWA 4FUDA 1P12E 3T27A 3BTWE 3OSYA 4AB9A 4MPVA 4Y79A 5E8EH 1WQSA 4UFDH 2ZCKP 5E2PA 5EXNA 1IQFA 1UVOA 1V2TT 3SBKA 1XXDA 2ZHEH 1ELVA 2QIQA 2ZWLH 2FOBA 4A1XA 2DE8A 1G3BA 3A7TA 4UFEH 1JMOH 1W0ZU 2PKAA 2SNVA 1GVLA 1TX7A 2BZ6H 5AF9H 8GCHF 1ETRH 2AS9A 1O30A 1T8MA 2WPJS 2G81E 1V6DA 3UR6A 2OC1A 5JB9S 1ZRKA 1ZLRA 4I7YH 2OUAA 1E34B 4GCHG 3RXJA 2W3IA 4NA8A 2QYIA 5E0JA 4ISOA 4DIHH 3RXUA 1BZXE 5C3NA 1WU1A 3LT3A 2GDDA 1L2EA 5EGMA 3Q76A 2QC2A 5BRRE 2GKVE 1F0UA 2JH0D 1C2EA 2WPHS 3GY7A 3A84A 3FZZA 1MCTA 2AGGX 3ZV9A 3A8BA 4AX9H 5LPEA 3T5FH 2FS9A 1NY22 1CGIE 1QBVH 3RXOA 1FUJA 1GHBG 1O3AA 1ZHPA 1N8OC 1QTFA 2XW9A 2BQ6B 2OQUA 3TH2H 1GMCG 1TQ0B 4R0IA 1BQYA 2EC9H 1UVUH 4NCYA 1AO5A 1BTPA 1MU8B 1TNLA 1SSXA 1VGCB 1ZMJA 4OS1A 1QIXB 1A2CH 1C1MA 1RXPA 3FFGA 1LVOA 2STAE 1ARCA 1EPTA 5DKMA 1OWHA 4CR9A 3PV4A 3CS0A 3KGPA 1LPKB 9LPRA 1V2NT 2VWLA 1FN6A 2NU3E 3ATLA 2GGVB 2HVXA 2ZFRH 5IYTA 1CA0B 1AUTC 3MOCA 3ZZ4A 3AAUA 4MDSA 3BTDE 3GDVA 2JKHA 2A7JA 2BY7X 4F49A 1DWDH 2TGDA 3LH1A 3A8DA 3M7TA 3PO1B 4X2XA 5FPYA 1QB9A 2PHBA 3KHVA 4BAQB 4K1SA 3LU9B 1F2SE 1CA8B 3TNSA 2BDHA 3M5OA 4JK6A 5K0HA 2A4QA 1BMLA 2W3KA 5EOKA 3UR9A 3QLPH 1KXDA 1GI3A 3DFJA 1UTLM 3QZRA 2CF9H 3A7XA 4H6TA 5FX5A 1W0YH 4K2YA 1G36A 1E35B 3GCTG 5SGAE 1CHOG 4A92A 4XOJA 3D49H 1W12U 1LQEA 1L1JA 4ZHAA 1X7AC 2ZFSA 1F0RA 4ABGA 3MU0A 1C5RA 1KSNA 5B6OA 2A45B 1AN1E 3UY9A 3GY5A 4ESTE 1N1LA 2P3FH 4NIXA 2Z9KA 2TBSA 3AW0A 1C2DA 1TQ7B 2AEIH 2AGEX 3QN7A 1FY8E 1D6WA 3V13A 1LDTT 1Y59T 2F9BH 3ZZAA 2W7SA 3RXGA 1NM6A 3ZYEA 1FN8A 2Q1JA 3P8OA 3ZVBA 3URDA 1BHXF 1C5ZB 1ACBE 2VVVA 1HBTH 2B7DH 2P3UB 3GCHB 4IN1A 1NFXA 3UNQA 3N7OA 1MUEB 1LQDB 1C1UH 3MMGA 3MU8A 5FBEA 5T6DA 3B23B 1WCZA 4GCHF
chains in the Genus database with same CATH superfamily
1A3BH 3DD2H 2HNTE 4FUFA 3RXIA 3VFEA 1BMAA 3RUOA 2K1QA 4I8KA 4Q63A 1MZAA 1A5HA 3CENA 1K1JA 3STJA 3BEUA 3N7EA 3I78A 1CT0E 3B9FH 1GGDC 1PFXC 1PPEE 3SV9A 3VPKA 4FOUC 1GCTC 4TT3D 1SFIA 1O3IA 3SU2A 3A85A 1WOFA 4BTUB 2ZDKA 2WUCA 3RXAA 1AD8H 2RA0A 1V2UT 1DLEA 1G32B 4U01A 1VJAU 4NIWA 2C3SA 2PW8H 1IHSH 4ZXYH 4X2YA 2BDGA 2KX4A 1O3OA 4DURA 3ATIA 4MG3A 1OYQA 4ZHMU 5AVDA 5L6NH 1K1LA 2FOEA 2FOFA 1H9HE 2GX4A 1C2KA 3A81A 2V7QD 1TMBH 3SU5A 2XC4A 3ZZDA 3ESTA 3QGJA 3ZZ9A 2J4IA 1J16A 2FYQA 2J98B 1FNIA 1MKXH 1AMHA 5JDUB 3SQHE 1NTPA 1O3CA 1C5NH 1ELEE 1SI5H 1SOTA 2ZG0H 4CBNA 1EPTB 1S0RA 2RCEA 3LC5A 1LVYA 2FXRA 4YTAA 4XBBA 2QV1A 2W5EA 1G3CA 2BDAA 3NPSA 1C5TA 3DSOA 1PQ8A 1DY9A 3ITIA 3EAJA 1O2IA 1C1TA 4NSYA 5L2YH 1O5AB 4FUGA 5JBCS 4TY6A 2AYWA 3P70B 3MNBA 1Y3XA 1ZTLA 1Z1JA 2QXHA 1NO9H 2FI3E 2A4GA 1AY6H 4KP0A 1JRSA 1GBMA 1HAHH 2ZHDA 3S9BA 5F03A 1B7XB 1Z6EA 1EB2A 1TALA 2JJ2D 1UMAH 1FQ3A 4Y0ZE 1H4WA 2EEKA 2OCVB 4DG4A 1CGHA 5C20A 4WY3A 1H8ED 4AG1A 4K60A 3BTQE 1NU9A 1FMGA 3UREA 2V0BA 5I25A 4NFFA 1FPCH 3GS9A 5DO4H 1CGJE 1CHGA 2WPLS 2WYGA 1TONA 3S7KB 4GUXA 1L4ZA 1K22H 5A0BA 1T4UH 1ZPBA 1SGYE 3T26A 4CRDA 2A4OA 1RGQA 1ESAA 1SQAA 3RC4A 1RIWB 1HAOH 2A7CA 3GYMA 2ZGCA 3OX7U 1HFDA 3RXQA 3BTFE 1SC8U 1FV9A 3GY8A 2P16A 2V35A 4Y11E 1MTWA 4K8YA 1AI8H 3F9GA 1FY5A 1HJ8A 1YM0A 1YCPH 3LKWA 2WSSD 3OY6U 3A8AA 1Y3VA 2ZZUH 3U8OH 2KCOA 1GJDB 1C2GA 3FP7E 2XC0A 1AE8H 2XOKD 1VITF 4A1VA 1E36B 1KTSB 3RXMA 1FX0B 1EZQA 1Y5UT 5EU8A 2PWXA 4I32A 5GWZA 1NROH 1TPSA 2Y7ZA 4MVNA 1EAUA 1N8OB 1UCYH 2FOAA 4NSVA 1C4V2 5CDFE 2A1DB 3LOXA 1GHVH 2KFWA 3PTNA 4ACBA 3OTPA 1NRNH 1GWAA 2Z9LA 5GNDA 1O2ZA 4NA9H 4MPXA 4E06H 2D26C 3SJ8A 2Z94A 3ZYDA 4BAKB 1OSSA 4JK5A 3P92A 1MKWH 4MTBA 2OC0A 3PMAB 4B76A 3S0NA 1JIMA 3QTVH 1NFUA 3DFLA 2VBCA 3D65E 3SZEA 3VXFH 5JPMH 1C1RA 1XVMA 3RXCA 1RFNA 1TNIA 2WV5A 2YMSD 3P95A 1O3GA 4YT7H 5A0CA 1NRPH 3VB3A 1TE0A 1DVAH 2JETC 1BJVA 3D23A 2C8YB 2NU0E 2W26A 4Q7YA 1JRTA 3ZZ6A 1A3EH 1TBRH 3K2UA 3HGPA 1BBRK 1LVMA 1Q31A 1UTPA 5K7RA 2Y5GA 3HKJB 2PP6A 4I8JA 4U2WA 4LZ1H 4K8BA 5A2MH 5CHAB 4B2BA 2B0FA 2Q6DA 3RXBA 1O37A 5EJ1A 4M7GA 1O2QA 4K1EA 4X6NA 1MZDA 4AYVB 4B2AA 1QQUA 4CREA 3STIA 1ZMLA 2BX4A 2OINA 2QF0A 3DT0H 5CMXH 2BY5X 1XUFA 2BD2A 3L3TA 2ZHFH 4WXVA 1CBWC 1U6QA 1GMDG 4FUBA 2H9HA 4RKOB 1OXGA 2UWPA 2A7HA 3HKIB 1DWCH 3SJOA 2ZTXA 3BG8A 3U1IB 4ACAA 1G30B 3QWCH 5C0TA 4AOQA 1O3HA 3A7VA 2ZDMA 7LPRA 4OS2A 2ZCHP 1LKBA 2P8OC 1W10U 3LGYA 1ESTA 1DT2A 2XC5A 2FWWA 4A1TA 1KIGH 2GV6A 4O03A 1RTKA 1Z7KA 2GP9B 2ZTYA 4FUHA 1BTWA 1BTXA 3UPEA 2ZFFH 3BIVH 4Q80A 4NZQA 1QRWA 3TJOA 4AFZA 3IG6B 1PPCE 4CH2B 3SOSA 5HGGA 6CHAC 2HVYB 5GCHG 2RDEA 3SU1A 1IQIA 4XRNA 1QB6A 5HXFA 3M5MA 2JJ1D 6GCHF 3W95A 1NBME 2EI6A 2ZU5A 1BHXB 1YPMH 4UONA 1B5GH 3Q00A 4HI3A 1THRH 1YLCA 1HUTH 1C5LH 1K9OE 1ZSKA 1V2RT 2ODPA 1ZPCA 4CR5A 1N6YA 3PM3A 1TNHA 1QB1A 2VIOA 2VWMA 2O8LA 1XUIA 1SOZA 4IC5A 3SV7A 3VGCC 4VGCC 2ZPQA 4GVUA 1C1SA 1FY4A 1CU1A 1MTSA 1ZJKA 4MPWA 2A0QB 1WQVH 3VEQB 3MNCA 1TYNA 1QCPA 2OLGA 2F9NA 2THFB 3LPRA 1EAXA 4YZUA 2G51A 3AW1A 4B74A 1FY1A 3S9CA 1D3DB 4FUCA 4RI0A 5KGOA 1GDQA 1W11U 1O3PB 5L2ZH 1EZXC 2ZI2H 3UWIA 1GHWH 3JZ2B 1YWUA 4ZROA 1G3DA 1S6FA 1S84A 3GY3A 1GGDB 1BBRE 1A0LA 2VIPA 1WDIA 1O2LA 1BMNH 3TH3H 4PROA 7GCHG 1XUJA 2WPDD 5HIYA 4AFSA 2ZDVH 1GCTB 4LK4A 1GBHA 3HPTB 3VB7A 1ANEA 4CHAC 1DY8A 1H9LB 2PTNA 4Y10E 3M37A 2O8MA 2Z3EA 2GTBA 2ANKH 1FY3A 3B8JA 2AIQA 3SNDA 5A09A 2J94A 5FHTA 5TCCA 1DS2E 3SJIA 1O38A 2H5CA 4F4OC 1V2KT 1AFEH 1IQJA 3R0FA 1OP2A 2QXJA 5FL7D 4WJG2 4ABEA 1VZQH 1TRNA 1TMUH 2EI7A 4F55A 1EQ9A 3U69H 2CHAC 4NWKA 3OEED 2CV3A 3ZZ5A 4E7RG 1AVWA 3KNXA 1A5GH 2G8TA 2PTCE 2ZFPH 3PLBA 3GY4A 2BOKA 2FOGA 4ZCNA 2BVXH 2VINA 2CXVA 3LJJA 1KYNA 2BVSH 4R8TB 3PTBA 1EKBB 2BQ7B 3H5CB 1MKXK 1S82A 1O33A 1O34A 3A80A 4J2YB 3SQEE 1QRZA 1C1VH 4SGBE 4BAMB 4P02A 1O2SA 2FLBH 4P00A 3SI4H 2B8OH 1GJCB 4B2CA 1O5FH 2IOTA 4IMQA 5DSFA 1TRYA 4IBLH 3RMNH 3V7TA 3UQOA 3EDXB 2WV9A 1ELBA 1O5EH 3HK3B 1YLDA 2SGAA 1UHBA 2A5IA 1O2XA 2IPHA 2QXGA 2AHME 1C5WB 5GDSH 3EA7A 3UNSA 3E16B 3E1XB 2ZO3H 5E2OA 5EW2H 1ZTKA 1GDNA 1O5BB 2OQ5A 1G2MA 1EAIA 1RIWC 5IK2D 3SU0A 2P95A 2BQWB 3PMBB 6ESTA 2ZGBH 1C2LA 1SGCA 1GHAG 1C1OA 7KMEH 2VVCA 3E3TA 1P3EA 1MAYA 2BD7A 1PPBH 2ZDNA 4BANB 1TGTA 5C17A 3SUFA 1KLIH 1BIOA 3MU4A 4J1YA 1DFPA 1ZMNA 1NFWA 1O3LA 2VU8E 5EQQA 5GCHF 2WYJA 1O5DH 2KCPA 1GBCA 4K1TA 1YCPK 5FX6A 2AIPA 2OC7A 4F48B 2XCNA 3HK6B 1EJNA 3QUMP 3SUEA 4THNH 3SZNA 1P9SA 4Z0KA 5HM9A 1UTQA 1CT4E 1T4VH 1ANDA 5EG4A 2IN2A 2ODYB 2TGPZ 2KM0A 2FM2A 2ZC9H 1O2GH 4HZHA 4IGDA 2QF5A 1GI7B 1Z8JB 1XKAC 3NXPA 3PV5A 3PYHA 5EJZA 4H42U 1ORFA 1FXYA 3IWMA 1O2RA 1OWIA 1QURH 2Y80A 3LGIA 3RXEA 1O39A 2I6QA 3KQ5A 1NRQH 1ZRBA 1GBIA 5J4QA 3ATMA 2QF3A 2JH5D 3HATH 1K1MA 3CP7A 2J98A 1M9UA 2FZZA 1SGFA 5BPEA 1GI5A 3DA9B 5C94A 5L30H 3UUZA 2BDCA 3PV2A 2XWBI 1MKWK 4YESB 2JETB 4JCNA 4CRCA 4AZ2B 2UUYA 1UTKA 3LGTA 2ZECA 3RXSA 2HOBA 1SHYA 1AWHB 3MO6A 1O3DA 1YBWA 1OWDA 4NIYA 1WUNH 5C5NA 2D1JA 1Y3WA 5HM2A 2BLOA 4X2WA 1A0JA 2CGAA 1SGPE 4ABHA 3BTME 1O2PA 1MCVA 1MD7A 3KQEA 2GCHG 9ESTA 1G2LA 1GI2A 5AFYH 4JYVH 2Y7XA 1TAWA 1HAZB 3H7OA 5CHAC 4WH8A 3OTJE 5J4SA 3SO3A 2PGBB 1JWTA 1Q2WA 1PPFE 3KQCA 2ULLA 2AMDA 4FU9A 1QRXA 3SW2B 1O3EA 1CBWB 2TPIZ 1C5XB 1P0SH 1GJ9B 1TPPA 4OS5A 3TJVA 1AHTH 1T7CA 2B9LA 3LJOA 2V6NA 4QT8C 2BHGA 4Q7ZA 1T31A 1HXFH 1TX6A 1E37B 5LGOA 2F83A 2IJD1 2BXTH 1O2UA 1NS3A 2BD9A 3URCA 2Z3CA 1AE5A 2P8OB 4XSKU 1EXFA 4WMFA 4UFGH 1Z8RA 3LC3A 4X1RU 3RC5A 4OS6A 2OP9A 1SQOA 1EB1H 4BAHB 1A1RA 2QGRA 4CBOA 3HGNA 1K28D 1TX8A 8KME2 3RXVA 6CHAB 3MU5A 2H1UA 3SN8A 1K1NA 5EQRA 2FP7B 3VB5A 1AGJA 3U9AH 1TA2A 3ATKA 1FAKH 4TY7A 1HXEH 1PQ7A 1C1WH 4B1TA 2AMPA 1DXWA 1CVWH 1PPZA 2H9TH 3A83A 1P05A 3A88A 1BJUA 5LH8A 3BIUH 1HAPH 1PYTC 5F6MA 5HKKD 1UHBB 1GL1A 3IITA 2Y5FA 1ANCA 2BY8X 2J95A 2FESH 4BTTB 3TLOA 1MBQA 2WPKS 3VGCB 2K0QA 4VGCB 1K1IA 2BD5A 3ZZ8A 1G9IE 3SNBA 3FKSD 3RC6A 1UTMA 1NRSH 2STBE 4I8GA 2CK3D 3MO3A 1ANBA 2A4RA 3MYWA 3A89A 1J8AA 3O8CA 1HV7A 2M5TA 3JZ1B 4O9VA 2KAIA 2JH6D 1ZR0A 3SORA 1OWJA 2XBVA 3LDXH 2BTCE 1SPJA 1O2JA 4ZKRU 2XRCA 3ZVCA 3AAVA 1QJ6B 1BMMH 2ZTZA 2AMQA 2BXUH 1HIAA 1INCA 1P2OA 2ZGHA 4CH8B 5A8XA 3GICB 4CHAB 4KKDA 1V2PT 1OYTH 1P9UA 4XD7D 1THPB 2VGCC 3MH4A 1L0ZA 4AC9A 3FO8D 2GV7A 2QAAA 1GHBF 1OKXA 2NU4E 4XFQA 3BTKE 1H8IH 4YM9A 3ZVGA 4X1NU 1TPOA 2TGTA 2C93B 3PLKA 1SLVB 1ZSLA 4RSPA 3SNEA 3PWCA 1GMCF 3SUGA 1P2JA 4O3TA 3ODDA 4Q2KA 2CHAB 2BLVA 2LPRA 1ESBA 4INKA 2GD4B 3C1KA 4A7IB 4K3JA 3A82A 7ESTE 4TPIZ 4ASUD 3AK5A 1LHGH 1SR5C 4MLFB 1C9PA 5I46H 2A2XH 2C90B 1FDPA 2WHXA 2R3YA 1MD8A 1DANH 4U30A 2ZU4A 1TB6H 3KF2A 4MNWA 1YP9A 1E38B 4MPUA 4IS5A 2YNAA 3A87A 3SUDA 3MFJA 2GZ9A 2FLRH 3PLPA 1NRRH 2YOLA 4NZLA 1Y8TA 3S7HB 5KECA 3E6PH 2BDIA 4ISHH 1O2OA 1O2KA 1GI9B 1S81A 1SGTA 2SNWA 2ODQA 5DP7A 1XUKA 4ABFA 2OBQA 1YCPM 2P94A 1ELTA 3WWBA 1Y5BT 2GJGA 1QNJA 1D3TB 1D6RA 3NKKA 4DW2U 2FI4E 2Z6BD 4NFEA 5AFZH 1UO6A 3E0PB 1BTHH 3K9XB 1ID5H 2H9EH 2XNIA 1RJXB 2Z9IA 1T8OA 2FX4A 4ZKSU 4XDEA 1YPHE 1OS8A 1EJMA 3EYDA 4I8HA 1NPMA 5DK1A 2F9OA 2Q6FA 2Z7FE 1GMHG 3WW7A 3GCTF 3GISB 4X0WU 1CHOF 4YLQH 4UFFH 3P6ZB 1JXPA 3S9AA 1DWEH 3PRDA 4X8VH 3UFAA 1KMHB 3KQDA 2PKSC 2ZDAH 1EAWA 4NG9H 3ZZ7A 1BB0B 3N7DA 3RDZA 2XNDD 1GI6A 2HNTC 1EASA 4MNYA 4GHTA 2HWLB 2J34A 5F8XA 3ZV8A 1KDQA 1QY6A 1F0SA 2F43B 5AHGH 1P06A 5FCRA 2H2ZA 1DWBH 2HNTF 1YYY1 1A7SA 1G37A 3KL6A 4HGCA 1HYLA 1DXPA 1XX9A 2Y6TA 5EPNA 1V2LT 2SGEE 3RU4E 5IDKA 4YXWD 4ISNA 3LONA 1RRKA 1W3CA 1BOQA 1GBBA 1DX5M 5C2ZA 1EUFA 2KAIB 2CN0H 1O2MA 1VCQA 5E0HA 4Y7AA 1E1RD 4WMDA 4NWLA 2CMYA 1DLKB 3SGAE 2ZPSA 4TYDA 1FAXA 3RXKA 1C5QA 2WPMS 4X8UH 1VITH 4D7GA 3U1JB 1P03A 3ZZBA 4AFUA 1TOMH 1HIAB 1V2MT 1VKYA 4TPYA 5DP9A 1GPZA 2K8IA 3ZVDA 2D2DA 1ABIH 1QZ8A 5DPAA 1T8LA 3W94A 5HIZA 3GOVB 1SHHB 1BRUP 3K6ZA 1HAGE 2V3MA 3C27B 1PQAA 1V2WT 1IQNA 2DUCA 2ZNKH 1GVKB 2FDAA 4Y6DA 2PLXA 5C1XA 2WV4A 3P17H 4XBDA 1A4WH 2VJ1A 2BVRH 2BOHB 1FZZA 1VR1H 1C5SA 1HJAB 1DUAA 2C8WB 2Q6GA 1UVSH 1HAXB 2G4TA 4CRGA 3SV6A 4ABJA 4LOYH 1UTNA 2WZQA 5EIYA 1O3FA 4KTSA 3RXFA 2HLCA 3U8TH 2BMGB 1OWKA 2ZP0H 1HLTH 2Z9GA 3OYPA 1HRTH 1GJAB 2RG3A 2VIVA 2FIRH 1YPHC 2QXIA 3VXEH 1K0HA 2SGDE 8GCHG 1DSUA 1UW7A 4NGAH 1TIOA 1BITA 4X6PA 1BCUH 4A5TS 1Z71A 1QBNA 4WVPE 3RLYH 2HPQH 3L33A 1CQQA 1DPOA 1YKTA 1K2I1 1QA0A 3TGIE 4M9FA 4K5ZA 2FPZA 1K21H 4X8SH 3VB6A 6LPRA 4FVBA 1C4U2 1YLNA 1XMNB 3NZIA 5CHBA 3R3GB 2EI8A 3SV8A 1J15A 1SGRE 1Z6JH 2FX6A 1YGCH 5DP4A 2ZGXH 4FU8A 2G5NA 1MBMA 1MQ5A 1IQLA 4FETA 2H5DA 4BXSA 2GMTC 3SYJA 1OP0A 1P8VC 3GDUA 4XE4A 4INLA 1GI4A 3RXLA 1QBOA 1P2MA 3MH5A 3M3SA 2ZQ2A 4GAWA 1ELAA 2W6ID 5EXMA 1NN6A 3KEEA 3ELAH 1NBMD 2GCTC 4JZEH 3VG8A 2QA9E 3T62A 1EFRD 4GPGA 2QN5T 1L4DA 1KDQB 2ASUB 1TFXA 2VGCB 3EA8A 1FJSA 4JZ1A 2R9PA 1BUIA 3F9HA 1MH0A 2A2QH 4FUIA 3RLWH 2P59A 3GYLB 5FPTA 1AU8A 4D7FA 5ETXA 4RKJB 2Y81A 1QR3E 3DCLA 3BSQA 1DOJA 3RMMH 3UB0A 1TGBA 3RXDA 2XBYA 1O0DH 1V2QT 1HJ9A 4WF8A 3ZVFA 3OAAD 1MTVA 2FTMA 2A32A 1ARBA 1ZTJA 1LO6A 4DCDA 1PPHE 5EJLA 3TH4H 2FMJA 1A46H 1QL8A 2EQNA 4MQAA 3A8CA 4U32A 5A0AE 1RS0A 1ETTH 3FAOA 5ABWA 1AVGH 5T6GA 3QGNB 1P2NA 1SGDE 3N99A 1B0EA 3QK1A 2Z3DA 1F5LA 3DHKH 4ISIH 1GCDA 2BX3A 1CE5A 4K69A 1D3PB 3F2FA 1OP8A 1XVOA 2W6JD 3V3MA 1V2JT 2Y5HA 2F9PA 4H4FA 1TWXB 3FANA 4I31A 1VCPA 1P2IA 3UWJH 4FVDA 2ANMH 3BG4B 3ODFA 1WAYB 1ZGIA 4OM9A 1TLDA 3GDSA 1K1PA 3S69A 2R2WU 2FOCA 1OPHB 3ZIAD 2PV9B 3QTOH 1Y3YA 1GMDF 2XTTB 1CO7E 2ZHWH 5DGJA 5FBIA 1GG6B 4FXGH 4D9RA 3MTYA 4AGJA 1C5OH 5C1YA 1E1QD 4YO9A 1ELDE 1GJ6A 4Y7BA 1JBUH 3TK6A 2NU2E 1A61H 1OHHD 2FI5E 4O3UA 2C4FH 1O5GH 1GJBB 5DJ7A 2SGQE 2PKSB 2TGAA 2VH6A 1GJ5H 1BTZA 2UWLA 8LPRA 1C1NA 3TNTA 1C1PA 1LHEH 2D8WA 2ALPA 3DUXH 1C5VA 1XKBC 4XBCA 1MABB 1UK2A 3KIDU 2BZAA 1ELGA 3O8DA 2BB4A 4JYTA 3TPIZ 1GI1A 2J92A 3TVJB 1J17T 3MO9A 4AGKA 5JBTA 2VVUA 2J9NA 1BTYA 3G01A 5FPSA 4B75A 3U8RH 4OS7A 1EZSC 3M5LA 1QL9A 1ZGVA 3TIUA 1ZSJA 3Q3KA 5TJXA 1UCYK 1P2KA 4GSOA 1HAYB 3SNCA 3ENSB 3M61U 3T28A 2EA3A 1GL0E 2DE9A 1BTUA 3SU3A 1PYTD 1UVPA 2BD8A 1AFQC 4Y8ZA 1BDAA 1MTUA 1C5MD 2V3HH 1NFYA 2ILNA 4Y8XA 1ZHMA 1S6LA 4TSFD 3RM2H 4AORA 4A6LA 1S5SA 1LTOA 1GJ8B 1KXBA 3SHCH 1LPZB 1LMWB 3ATWA 2PUXB 5F8ZA 4FUEA 4MNVA 7GCHF 4RN6A 2VIWA 1FIZA 3TGJE 2ZF0H 1MTNC 5CE1A 2YNBA 4X1PU 4NIVA 3A86A 5G4BA 4OS4A 1IQEA 1C5YB 3W1EA 1F5RA 1C2JA 1DDJA 1BBRH 2ESTE 3H7TA 2B5TB 3TU7H 1GBAA 4I86A 1BRBE 1Y5AT 4HG6A 5T1VA 3PMJA 2ZGJA 3FP8E 1O32A 5HYOA 1EP6A 1GVZA 4CRAA 5C0UA 4BOHA 1BRAA 2UWOA 1HJAC 1W13U 4YOIA 1P57B 1PQ5A 3EGKH 4ABDA 3RMOH 1KXCA 3MH7A 4MNXA 4ZXXH 2Y82A 2FTLE 3CS7A 3E91A 1YPEH 1AB9C 2FEQH 4Y0YE 1H8HD 3M3TA 3MI4A 2WUBA 3F9EA 2OBOA 1HDTH 2RFKC 1L1NA 3GCOA 4E7NA 1UVTH 3KN2A 3NK8A 3SGQE 1MU6B 2PR3A 4OGXA 2ZU3A 1DSTA 4E05H 1CT2E 2O8TA 5GIBA 3O8RA 1J9CH 3K65B 4CRFA 3WWFA 1TBQH 2PUQH 4X8TH 1P10A 2IPQX 2XWAA 3M36A 5LPRA 1T8NA 1GBLA 3AVZA 3UOPA 4FU7A 2HRVA 1AZ8A 1TGSZ 3M3VA 2UUFB 2GT8A 2FO9A 4Q7XA 4X6OA 2GVFA 1G3EA 5GPIB 2BLQA 3BTHE 1XUGA 1OOKB 2VWOA 4IMZA 2G55A 1UCYE 2ZU1A 3U28C 1TBZH 5DN6D 1C4Y2 2OK5A 2FODA 1C5PA 1O2WA 2SGPE 1VITG 2ZU2A 4I8LA 5JB8S 3LGWA 1D4PB 1ETSH 2IJOB 2AERH 5FCKA 3A7ZA 1SGEE 4YOJA 3SV2H 1MQ6A 1AIXH 4JYUH 2GMTB 3OEHD 1BT7A 1QFKH 3UQVA 1WTGH 4SGAE 1GHAF 1L1GA 5E0GA 4DJZB 1ZZZA 2HGTH 2PKAB 4Q4LA 5DG6A 2FYRA 1HB0B 2ZEBA 3Q77A 3A7WA 3NCLA 3V12A 3PROA 2GCTB 4B71A 2H6MA 3I77A 3MNSA 1AQ7A 2AH4X 1B0FA 1LKAA 2O9QA 1ZHRA 2PSXA 1ZYOA 3PB1E 1VJ9U 3F0PA 4Z1MD 1EOJA 1GHYH 1RTLA 3I29A 2WPIS 3T25A 1XXFA 1EZUC 5C1UA 2UUJB 1KXEA 3TJNA 1KXFA 1YPKH 3FN8A 1D3QB 5F8TA 1GJ4H 2ZHQH 2BDBA 1TRMA 4D76A 2LELA 1LHDH 1SBWA 3EE0B 3NRLA 4IC6A 1NESE 4X1SU 3PWBA 5JYIA 1IQKA 2ZA5A 5DP5A 1QJ7B 1CSOE 2F9VA 1O3KA 2CJIA 1O3MA 1V2VT 1O3BA 3V0XA 1GBTA 1KTTB 2A31A 1PPGE 4IW4E 3FVFB 1GBFA 3RXRA 2OD3B 1O2VA 1W8BH 1AUJA 2O8WA 2ZFTA 2FOHA 2AGIX 3NWUA 4ZKOU 1TNJA 4YLUA 3F68H 3KQBA 1LHCH 4JZFH 1F0TA 1HCGA 1THSH 2OC8A 1AKSA 3TK5A 4LZ4B 4JZDH 2GCHF 2ZFQH 3MHWU 2SFAA 5TCAA 1E0FD 3TJUA 4ABBA 3BG4C 2KCYA 3OE7D 1COWD 1TABE 3SHAH 3T29A 4LXBH 5EW1H 2ANYA 3GCNA 3L6PA 4GHQA 3O8BA 2CF8H 3F6UH 4DIIH 3RM0H 3GY6A 4WMEA 1O36A 4BXWA 2BD3A 1EJAA 3H09A 1WTHD 1JIRA 2VWNA 2ZIQH 1E79D 5T6FA 1LCYA 3QZQA 2SGFE 1EP5A 1SB1H 1W7GH 2TIOA 2F4LA 3E90B 1GG6C 4BNRA 1T32A 1QL7A 6GCHG 1IQMA 4ZUHA 4B73A 1V2OT 1YPJH 2F91A 2W7UA 4AYYB 3EA9A 1O3JA 4ABAA 2ALVA 1A5IA 3BTEE 2AFQB 4X2VA 4ZMAH 1C2MA 3SU4A 2Z9JA 1FONA 1MMJN 1Z1IA 5GJ4B 4ASHA 4WWYA 5EPYA 1ZOMA 3LGUA 2OTVA 1OX1A 1KLJH 2BY6X 4IN2A 5FXLA 1W14U 3RU4T 3ZZCA 2XBXA 2PFEA 2R0KA 2FS8A 4UEHH 3BTGE 3CNRA 1DICA 1DM4B 2OXSA 4KGAA 1NC6A 1GBDA 4YT6H 3SNAA 1FLEE 2F9UA 4HTCH 1O2YA 4NA7A 5B6LA 1ZJDA 2RDLA 1AVXA 3MQKC 1Z8IB 3BV9B 5JBAS 2BLWA 1O2HA 4I33A 1NT1A 1UTOA 4AB8A 2QY0B 1YF4A 1TOCB 1C5UA 5T3HA 3SJ9A 4DY7B 2BY9X 2NU1E 3LH3A 1P11E 1O3NA 1GDUA 1SGQE 3MH6A 1PJPA 1ZPZA 1IHTH 3AASA 5KEDA 1DUEA 1YPLH 5DP8A 1P02A 1SG8B 1AFQB 1WV7H 3VB4A 1P09A 2PGQB 2VNTA 5C5OA 1J14A 2GT7A 4BTIB 2V3OH 5EXLA 1O31A 1H8DH 2G5VA 1TA6A 2A5AA 2GDEH 4DOQA 2VIDA 3RMLH 4DGJA 3SJKA 1VGCC 4KELA 2ZPRA 4OGYA 3BTTE 1AWFH 1F7ZA 1MAXA 1MTNB 1C2FA 1QGFA 5EODA 3ZVEA 2A5KA 1BA8B 2TRMA 4UE7H 3FZDA 1RTFB 3EQ0H 4ZKNU 1GI0A 3GY2A 1SL3A 3RU4D 2R2MB 1O2NA 1QHRB 1UK4A 2G4UA 2HALA 2J38A 1Z8GA 1SGFG 4O97A 2ZDLA 3F9FA 1WYKA 5H4IB 1EX3A 1DITH 3M7UA 3E8LA 1HAVA 1D9IA 1CA0C 3M5NA 3TK9A 1P3CA 5DP6A 1UTJA 2WINI 3A7YA 1ELCA 3KCGH 1LVBA 2R3UA 3PMHB 4ZAEA 1AB9B 2ZCLP 1AZZA 1SFQB 4WH6A 1IQHA 1NU7B 3PO1C 1GBEA 1K1OA 3EE7A 5FAHA 4JMYA 1S0QA 4BAOB 1S85A 3F1SB 3TITA 1LHFH 2GZ8A 3SI3H 2O8UA 4CRBA 1WSSH 4D9QA 1F92A 2BM2A 3PRBA 2J5UA 1C9TA 3P8NA 4X1QU 1XM1A 1H1BA 8ESTE 2VH0A 4B6FA 1AKSB 1H9IE 1OWEA 1TNGA 3T2NA 1V3XA 1S83A 1Q3XA 4Y71A 1O2TA 4AN7A 1O5CB 1P01A 1FIWA 1SLWB 2FOMB 1SQTA 2HLDD 1YPGH 1SVPA 3RP2A 1UJ1A 2F3CE 2ANWA 3UOUA 1P2QA 2P93A 3TGKE 3F2GA 3SGBE 1SKYE 1FI8A 1ELFA 4AFQA 1IAUA 5HMAA 2BDYA 1VCWA 4FUJA 1UK3A 5ESBA 1KY9A 2QCYA 4ISLA 1A0HB 1WBGB 1Y3UA 5F53A 1GMHF 2XCFA 4Y76A 4X6MA 2YMSC 1TGNA 3QDZB 3UNRA 2ZKSA 1C2HA 3DSGA 1GHXH 1EOLA 3QO6A 4KTUA 5EQSA 3GCHC 4ZH8A 1KXAA 4JZIA 1GBJA 1NZQH 1QQ4A 1SLXB 2NWNA 1SGNE 3NUMA 3Q3YA 1GHZA 1TNKA 3ZVAA 1TPAE 1SLUB 2LNCA 2KCAA 2G52A 3OY5U 1S6HA 3P8FA 1KLTA 4UDWH 3P8GA 4DVAU 2G00A 4ZHLU 1YY3A 4TWWA 3SU6A 3Q3XA 4HFPB 1FPHH 1IOEA 2BD4A 1HGTH 1N6XA 3E0NB 1GJ7B 4ABIA 1QA7A 1P04A 5A8ZA 2C8ZB 1C1QA 1XUHA 1EATA 4TWYA 2I6SA 3ZZ3A 3UIRA 3M35A 1BRCE 2JIZD 3RXHA 2J97A 4KTCA 3U98H 2QF4A 2UUKB 4INHA 2XBWA 1GI8B 1W0KD 1W7XH 2RA3A 4UD9H 2C8XB 5A8YA 1BMFD 4WXIA 3UTUH 2BYAX 2KR7A 2VIQA 3BEFB 4Y8YA 1C2IA 5PTPA 4D8NA 2P3TB 3BN9A 4B6EA 3QX5H 1LPGB 3MWIU 1JOUB 3F2HA 1HNEE 5GXPA 4YOGA 1YC0A 5LPFA 1HAIH 2R0LA 1ABJH 3OU0A 3BF6H 4DT7B 3WY8A 5ESTE 3LGVA 1RD3B 1SGIB 1EPTC 2J2UA 1F5KU 2ZQ1A 5JBBS 1O35A 5C67A 1TGCA 1IQGA 4Z6AH 3M7QA 3RXPA 2HPPH 3K6YA 2JDID 2XXLA 4AG2A 2VB0A 1SMFE 3D62A 5DP3A 2GZ7A 1TMTH 4RT0A 4GLYA 1HAVB 3RXTA 2PSYA 3FP6E 2XYAA 4H6SB 3MNXA 1GBKA 1V2ST 1DE7H 1QJ1B 3MU1A 3BEIB 1HPGA 1W2KH 3LIWA 4FUDA 1P12E 3T27A 3BTWE 3OSYA 4AB9A 4MPVA 4Y79A 5E8EH 1WQSA 4UFDH 2ZCKP 5E2PA 5EXNA 1IQFA 1UVOA 1V2TT 3SBKA 1XXDA 2ZHEH 1ELVA 1W0JD 2QIQA 2ZWLH 2FOBA 1WXRA 4A1XA 2DE8A 1G3BA 3A7TA 4UFEH 1JMOH 1W0ZU 2PKAA 2SNVA 1GVLA 1TX7A 2BZ6H 5AF9H 3KYGA 8GCHF 1ETRH 2AS9A 1O30A 1T8MA 2WPJS 2G81E 1V6DA 3UR6A 2OC1A 5JB9S 1ZRKA 1ZLRA 4I7YH 2OUAA 1E34B 4GCHG 3RXJA 2W3IA 4NA8A 2QE7D 2QYIA 5E0JA 4ISOA 4DIHH 3RXUA 1BZXE 5C3NA 1WU1A 3LT3A 2GDDA 1L2EA 5EGMA 3Q76A 2QC2A 5BRRE 2GKVE 1F0UA 2JH0D 1C2EA 2WPHS 3GY7A 3A84A 3FZZA 1MCTA 2AGGX 3ZV9A 3A8BA 4AX9H 5LPEA 3T5FH 2FS9A 1NY22 1CGIE 1QBVH 3RXOA 1FUJA 1GHBG 1O3AA 1ZHPA 1N8OC 1QTFA 2XW9A 2BQ6B 2OQUA 3TH2H 1GMCG 1TQ0B 4R0IA 1BQYA 2EC9H 1UVUH 4NCYA 1AO5A 1BTPA 1MU8B 1TNLA 1SSXA 1VGCB 1ZMJA 4OS1A 1QIXB 1A2CH 1C1MA 1RXPA 3FFGA 1LVOA 2STAE 1ARCA 1EPTA 5DKMA 1OWHA 4CR9A 3PV4A 3CS0A 1SQRA 3KGPA 1LPKB 9LPRA 1V2NT 2VWLA 1FN6A 2NU3E 3ATLA 2GGVB 2HVXA 2ZFRH 5IYTA 1CA0B 1AUTC 3MOCA 3ZZ4A 3AAUA 4MDSA 3BTDE 3GDVA 3F3BA 2JKHA 2A7JA 3F0OA 2BY7X 2EY4C 4F49A 1DWDH 2TGDA 3LH1A 3A8DA 3M7TA 3PO1B 4X2XA 5FPYA 1QB9A 2PHBA 2KZ4A 3KHVA 4BAQB 4K1SA 3LU9B 1F2SE 1CA8B 3TNSA 2BDHA 3M5OA 4JK6A 5K0HA 3UAIC 2A4QA 1BMLA 2W3KA 5EOKA 3UR9A 3QLPH 1KXDA 1GI3A 3DFJA 1UTLM 3QZRA 2CF9H 3A7XA 4DT4A 4H6TA 5FX5A 1W0YH 4K2YA 1G36A 1E35B 3GCTG 5SGAE 1CHOG 4A92A 4XOJA 3D49H 1W12U 1LQEA 1L1JA 2L74A 4ZHAA 1X7AC 2ZFSA 1F0RA 4ABGA 3MU0A 1C5RA 1KSNA 5B6OA 2A45B 1AN1E 3UY9A 3GY5A 4ESTE 1N1LA 3FOAA 2M2AA 2P3FH 3DSPA 4NIXA 2Z9KA 3OFND 2TBSA 3AW0A 1C2DA 1TQ7B 2AEIH 2AGEX 3QN7A 1FY8E 1D6WA 3V13A 1LDTT 1Y59T 2F9BH 3ZZAA 2W7SA 2YMSB 3RXGA 1NM6A 3ZYEA 1FN8A 2Q1JA 3P8OA 3ZVBA 3URDA 1BHXF 4RT1A 1C5ZB 1ACBE 2VVVA 1HBTH 2B7DH 2P3UB 3GCHB 3KYFA 4IN1A 1NFXA 3UNQA 3N7OA 1MUEB 1LQDB 1C1UH 2LP6A 3MMGA 3MU8A 5FBEA 5T6DA 3B23B 1WCZA 2L6OA 4GCHF
chains in the Genus database with same CATH topology
1A3BH 3DD2H 2HNTE 4FUFA 3RXIA 3VFEA 1BMAA 3RUOA 2K1QA 4I8KA 1MZAA 1A5HA 3CENA 1K1JA 3STJA 3BEUA 3I78A 1CT0E 3B9FH 1GGDC 1PFXC 1PPEE 3SV9A 3VPKA 1GCTC 1SFIA 1O3IA 3SU2A 3A85A 1WOFA 4BTUB 2ZDKA 2WUCA 3RXAA 1AD8H 2RA0A 1V2UT 1DLEA 1G32B 4U01A 1VJAU 4NIWA 2C3SA 2PW8H 1IHSH 4ZXYH 4X2YA 2BDGA 1O3OA 4DURA 3ATIA 4MG3A 1OYQA 4ZHMU 5AVDA 5L6NH 1K1LA 2FOEA 2FOFA 1H9HE 2GX4A 1C2KA 3A81A 1TMBH 3SU5A 2XC4A 3ZZDA 3ESTA 3QGJA 3ZZ9A 2J4IA 1J16A 2FYQA 1FNIA 1MKXH 1AMHA 5JDUB 3SQHE 1NTPA 1O3CA 1C5NH 1ELEE 1SI5H 1SOTA 2ZG0H 4CBNA 1EPTB 1S0RA 2RCEA 3LC5A 1LVYA 2FXRA 4YTAA 4XBBA 2QV1A 2W5EA 1G3CA 2BDAA 3NPSA 1C5TA 1PQ8A 1DY9A 3ITIA 3EAJA 1O2IA 1C1TA 4NSYA 5L2YH 1O5AB 4FUGA 5JBCS 4TY6A 2AYWA 3P70B 3MNBA 1Y3XA 1ZTLA 1Z1JA 2QXHA 1NO9H 2FI3E 2A4GA 1AY6H 4KP0A 1JRSA 1GBMA 1HAHH 2ZHDA 3S9BA 5F03A 1B7XB 1Z6EA 1EB2A 1TALA 1UMAH 1FQ3A 4Y0ZE 1H4WA 2EEKA 2OCVB 4DG4A 1CGHA 5C20A 4WY3A 4AG1A 4K60A 3BTQE 1NU9A 1FMGA 3UREA 2V0BA 5I25A 4NFFA 1FPCH 5DO4H 1CGJE 1CHGA 2WPLS 2WYGA 1TONA 3S7KB 4GUXA 1L4ZA 1K22H 5A0BA 1T4UH 1ZPBA 1SGYE 3T26A 4CRDA 2A4OA 1RGQA 1ESAA 1SQAA 3RC4A 1RIWB 1HAOH 2A7CA 3GYMA 2ZGCA 3OX7U 1HFDA 3RXQA 3BTFE 1SC8U 1FV9A 3GY8A 2P16A 2V35A 4Y11E 1MTWA 4K8YA 1AI8H 3F9GA 1FY5A 1HJ8A 1YM0A 1YCPH 3LKWA 3OY6U 3A8AA 1Y3VA 2ZZUH 3U8OH 1GJDB 1C2GA 3FP7E 2XC0A 1AE8H 1VITF 4A1VA 1E36B 1KTSB 3RXMA 1EZQA 1Y5UT 5EU8A 2PWXA 4I32A 5GWZA 1NROH 1TPSA 2Y7ZA 4MVNA 1EAUA 1N8OB 1UCYH 2FOAA 4NSVA 1C4V2 2A1DB 3LOXA 1GHVH 3PTNA 1NRNH 1GWAA 2Z9LA 1O2ZA 4NA9H 4MPXA 4E06H 2D26C 3SJ8A 2Z94A 3ZYDA 4BAKB 1OSSA 4JK5A 3P92A 1MKWH 4MTBA 2OC0A 3PMAB 4B76A 3S0NA 1JIMA 3QTVH 1NFUA 3DFLA 3D65E 3VXFH 5JPMH 1C1RA 1XVMA 3RXCA 1RFNA 1TNIA 2WV5A 3P95A 1O3GA 4YT7H 5A0CA 1NRPH 3VB3A 1TE0A 1DVAH 2JETC 1BJVA 3D23A 2C8YB 2NU0E 2W26A 4Q7YA 1JRTA 3ZZ6A 1A3EH 1TBRH 3K2UA 3HGPA 1BBRK 1LVMA 1Q31A 1UTPA 5K7RA 2Y5GA 3HKJB 4I8JA 4U2WA 4LZ1H 4K8BA 5A2MH 5CHAB 4B2BA 2B0FA 2Q6DA 3RXBA 1O37A 4M7GA 1O2QA 4K1EA 4X6NA 1MZDA 4AYVB 4B2AA 1QQUA 4CREA 3STIA 1ZMLA 2BX4A 2OINA 2QF0A 3DT0H 5CMXH 2BY5X 1XUFA 2BD2A 3L3TA 2ZHFH 4WXVA 1CBWC 1U6QA 1GMDG 4FUBA 2H9HA 4RKOB 1OXGA 2UWPA 2A7HA 3HKIB 1DWCH 3SJOA 2ZTXA 3BG8A 3U1IB 1G30B 3QWCH 4AOQA 1O3HA 3A7VA 2ZDMA 7LPRA 4OS2A 2ZCHP 1LKBA 2P8OC 1W10U 3LGYA 1ESTA 1DT2A 2XC5A 2FWWA 4A1TA 1KIGH 2GV6A 4O03A 1RTKA 1Z7KA 2GP9B 2ZTYA 4FUHA 1BTWA 1BTXA 3UPEA 2ZFFH 3BIVH 4Q80A 4NZQA 1QRWA 3TJOA 4AFZA 3IG6B 1PPCE 4CH2B 3SOSA 5HGGA 6CHAC 5GCHG 3SU1A 1IQIA 1QB6A 5HXFA 3M5MA 6GCHF 3W95A 2EI6A 2ZU5A 1BHXB 1YPMH 4UONA 1B5GH 3Q00A 4HI3A 1THRH 1YLCA 1HUTH 1C5LH 1K9OE 1ZSKA 1V2RT 2ODPA 1ZPCA 4CR5A 1N6YA 3PM3A 1TNHA 1QB1A 2VIOA 2VWMA 2O8LA 1XUIA 1SOZA 4IC5A 3SV7A 3VGCC 4VGCC 2ZPQA 4GVUA 1C1SA 1FY4A 1CU1A 1MTSA 1ZJKA 4MPWA 2A0QB 1WQVH 3VEQB 3MNCA 1TYNA 2OLGA 1QCPA 2F9NA 2THFB 3LPRA 1EAXA 4YZUA 2G51A 3AW1A 4B74A 1FY1A 3S9CA 1D3DB 4FUCA 1GDQA 1W11U 1O3PB 5L2ZH 1EZXC 2ZI2H 3UWIA 1GHWH 3JZ2B 4ZROA 1G3DA 1S6FA 1S84A 3GY3A 1GGDB 1BBRE 1A0LA 2VIPA 1O2LA 1BMNH 3TH3H 4PROA 7GCHG 1XUJA 4AFSA 2ZDVH 1GCTB 4LK4A 1GBHA 3HPTB 3VB7A 1ANEA 4CHAC 1DY8A 1H9LB 2PTNA 4Y10E 3M37A 2O8MA 2Z3EA 2GTBA 2ANKH 1FY3A 3B8JA 2AIQA 3SNDA 5A09A 2J94A 5FHTA 5TCCA 1DS2E 3SJIA 1O38A 2H5CA 4F4OC 1V2KT 1AFEH 1IQJA 3R0FA 1OP2A 2QXJA 4WJG2 4ABEA 1VZQH 1TRNA 1TMUH 2EI7A 1EQ9A 3U69H 2CHAC 4NWKA 2CV3A 3ZZ5A 4E7RG 1AVWA 3KNXA 1A5GH 2G8TA 2PTCE 2ZFPH 3PLBA 3GY4A 2BOKA 2FOGA 2BVXH 2VINA 2CXVA 3LJJA 1KYNA 2BVSH 4R8TB 3PTBA 1EKBB 2BQ7B 3H5CB 1MKXK 1S82A 1O33A 1O34A 3A80A 4J2YB 3SQEE 1QRZA 1C1VH 4SGBE 4BAMB 1O2SA 2FLBH 3SI4H 2B8OH 1GJCB 4B2CA 1O5FH 2IOTA 4IMQA 1TRYA 4IBLH 3RMNH 3V7TA 3UQOA 3EDXB 1ELBA 1O5EH 3HK3B 1YLDA 2SGAA 1UHBA 2A5IA 1O2XA 2IPHA 2QXGA 1C5WB 5GDSH 3EA7A 3UNSA 3E16B 3E1XB 2ZO3H 5E2OA 5EW2H 1ZTKA 1GDNA 1O5BB 2OQ5A 1G2MA 1EAIA 1RIWC 3SU0A 2P95A 2BQWB 3PMBB 6ESTA 2ZGBH 1C2LA 1SGCA 1GHAG 1C1OA 7KMEH 2VVCA 3E3TA 1P3EA 1MAYA 2BD7A 1PPBH 2ZDNA 4BANB 1TGTA 3SUFA 1KLIH 1BIOA 3MU4A 4J1YA 1DFPA 1ZMNA 1NFWA 1O3LA 2VU8E 5EQQA 5GCHF 2WYJA 1O5DH 4K1TA 1GBCA 1YCPK 5FX6A 2AIPA 2OC7A 2XCNA 3HK6B 1EJNA 3QUMP 3SUEA 4THNH 3SZNA 1P9SA 4Z0KA 5HM9A 1UTQA 1CT4E 1T4VH 1ANDA 5EG4A 2IN2A 2ODYB 2TGPZ 2ZC9H 2FM2A 1O2GH 4HZHA 4IGDA 1GI7B 1Z8JB 1XKAC 3NXPA 3PYHA 4H42U 1ORFA 1FXYA 3IWMA 1O2RA 1OWIA 1QURH 2Y80A 3LGIA 3RXEA 1O39A 2I6QA 1NRQH 1ZRBA 1GBIA 5J4QA 3ATMA 2QF3A 2JH5D 3HATH 1K1MA 3CP7A 1M9UA 2FZZA 1SGFA 5BPEA 1GI5A 3DA9B 5L30H 3UUZA 2BDCA 2XWBI 1MKWK 4YESB 2JETB 4JCNA 4CRCA 4AZ2B 2UUYA 1UTKA 3LGTA 2ZECA 3RXSA 2HOBA 1SHYA 1AWHB 3MO6A 1O3DA 1YBWA 1OWDA 4NIYA 1WUNH 5C5NA 2D1JA 1Y3WA 5HM2A 2BLOA 4X2WA 1A0JA 2CGAA 1SGPE 4ABHA 3BTME 1O2PA 1MCVA 1MD7A 3KQEA 2GCHG 9ESTA 1G2LA 1GI2A 5AFYH 4JYVH 2Y7XA 1TAWA 1HAZB 3H7OA 5CHAC 4WH8A 3OTJE 5J4SA 3SO3A 2PGBB 1JWTA 1Q2WA 1PPFE 3KQCA 2ULLA 2AMDA 4FU9A 1QRXA 3SW2B 1O3EA 1CBWB 2TPIZ 1C5XB 1P0SH 1GJ9B 1TPPA 4OS5A 3TJVA 1AHTH 1T7CA 2B9LA 3LJOA 2V6NA 4QT8C 2BHGA 4Q7ZA 1T31A 1HXFH 1TX6A 1E37B 5LGOA 2F83A 2BXTH 1O2UA 1NS3A 2BD9A 3URCA 2Z3CA 1AE5A 2P8OB 4XSKU 1EXFA 4WMFA 4UFGH 1Z8RA 3LC3A 4X1RU 3RC5A 4OS6A 2OP9A 1SQOA 1EB1H 4BAHB 1A1RA 2QGRA 4CBOA 3HGNA 1K28D 1TX8A 8KME2 3RXVA 6CHAB 3MU5A 2H1UA 3SN8A 1K1NA 5EQRA 2FP7B 3VB5A 1AGJA 3U9AH 1TA2A 3ATKA 1FAKH 4TY7A 1HXEH 1PQ7A 1C1WH 4B1TA 2AMPA 1DXWA 1CVWH 1PPZA 2H9TH 3A83A 1P05A 3A88A 1BJUA 5LH8A 3BIUH 1HAPH 1PYTC 5F6MA 1UHBB 1GL1A 3IITA 2Y5FA 1ANCA 2BY8X 2J95A 2FESH 4BTTB 3TLOA 1MBQA 2WPKS 3VGCB 4VGCB 1K1IA 2BD5A 3ZZ8A 1G9IE 3SNBA 3RC6A 1UTMA 1NRSH 2STBE 4I8GA 3MO3A 1ANBA 2A4RA 3MYWA 3A89A 1J8AA 3O8CA 1HV7A 2M5TA 3JZ1B 4O9VA 2KAIA 2JH6D 1ZR0A 3SORA 1OWJA 2XBVA 3LDXH 2BTCE 1SPJA 1O2JA 4ZKRU 2XRCA 3ZVCA 3AAVA 1QJ6B 1BMMH 2ZTZA 2AMQA 2BXUH 1HIAA 1INCA 1P2OA 2ZGHA 4CH8B 5A8XA 3GICB 4CHAB 4KKDA 1V2PT 1OYTH 1P9UA 1THPB 2VGCC 3MH4A 1L0ZA 2GV7A 2QAAA 1GHBF 1OKXA 2NU4E 4XFQA 3BTKE 1H8IH 4YM9A 3ZVGA 4X1NU 1TPOA 2TGTA 2C93B 3PLKA 1SLVB 1ZSLA 4RSPA 3SNEA 3PWCA 1GMCF 3SUGA 1P2JA 4O3TA 3ODDA 4Q2KA 2CHAB 2BLVA 2LPRA 1ESBA 4INKA 2GD4B 3C1KA 4A7IB 4K3JA 3A82A 7ESTE 4TPIZ 1LHGH 1SR5C 4MLFB 1C9PA 5I46H 2A2XH 2C90B 1FDPA 2R3YA 1MD8A 1DANH 4U30A 2ZU4A 1TB6H 3KF2A 4MNWA 1YP9A 1E38B 4MPUA 4IS5A 2YNAA 3A87A 3SUDA 3MFJA 2GZ9A 2FLRH 3PLPA 1NRRH 2YOLA 4NZLA 1Y8TA 3S7HB 3E6PH 2BDIA 4ISHH 1O2OA 1O2KA 1GI9B 1S81A 1SGTA 2SNWA 2ODQA 5DP7A 1XUKA 4ABFA 2OBQA 1YCPM 2P94A 1ELTA 1Y5BT 1QNJA 1D3TB 1D6RA 3NKKA 4DW2U 2FI4E 2Z6BD 4NFEA 5AFZH 1UO6A 3E0PB 1BTHH 3K9XB 1ID5H 2H9EH 2XNIA 1RJXB 2Z9IA 1T8OA 2FX4A 4ZKSU 4XDEA 1YPHE 1OS8A 1EJMA 3EYDA 4I8HA 1NPMA 5DK1A 2F9OA 2Q6FA 2Z7FE 1GMHG 3GCTF 3GISB 4X0WU 1CHOF 4YLQH 4UFFH 3P6ZB 1JXPA 3S9AA 1DWEH 4X8VH 3UFAA 3KQDA 2PKSC 2ZDAH 1EAWA 4NG9H 3ZZ7A 1BB0B 3RDZA 1GI6A 2HNTC 1EASA 4MNYA 4GHTA 2HWLB 2J34A 5F8XA 3ZV8A 1KDQA 1QY6A 1F0SA 5AHGH 1P06A 5FCRA 2H2ZA 1DWBH 2HNTF 1YYY1 1A7SA 1G37A 3KL6A 4HGCA 1HYLA 1DXPA 1XX9A 2Y6TA 5EPNA 1V2LT 2SGEE 3RU4E 5IDKA 4ISNA 3LONA 1RRKA 1W3CA 1BOQA 1GBBA 1DX5M 5C2ZA 1EUFA 2KAIB 2CN0H 1O2MA 1VCQA 5E0HA 4Y7AA 4WMDA 4NWLA 2CMYA 1DLKB 3SGAE 2ZPSA 4TYDA 1FAXA 3RXKA 1C5QA 2WPMS 4X8UH 1VITH 4D7GA 3U1JB 1P03A 3ZZBA 4AFUA 1TOMH 1HIAB 1V2MT 4TPYA 5DP9A 1GPZA 3ZVDA 2D2DA 1ABIH 5DPAA 1T8LA 3W94A 3GOVB 1SHHB 1BRUP 3K6ZA 1HAGE 3C27B 1PQAA 1V2WT 1IQNA 2DUCA 2ZNKH 1GVKB 2FDAA 4Y6DA 2PLXA 5C1XA 2WV4A 3P17H 4XBDA 1A4WH 2VJ1A 2BVRH 2BOHB 1FZZA 1VR1H 1C5SA 1HJAB 1DUAA 2C8WB 2Q6GA 1UVSH 1HAXB 2G4TA 4CRGA 3SV6A 4ABJA 4LOYH 1UTNA 1O3FA 4KTSA 3RXFA 2HLCA 3U8TH 2BMGB 1OWKA 2ZP0H 1HLTH 2Z9GA 3OYPA 1HRTH 1GJAB 2RG3A 2VIVA 2FIRH 1YPHC 2QXIA 3VXEH 2SGDE 8GCHG 1DSUA 4NGAH 1TIOA 1BITA 4X6PA 1BCUH 4A5TS 1Z71A 1QBNA 4WVPE 3RLYH 2HPQH 3L33A 1CQQA 1DPOA 1YKTA 1K2I1 1QA0A 3TGIE 4K5ZA 2FPZA 1K21H 4X8SH 3VB6A 6LPRA 4FVBA 1C4U2 1XMNB 3NZIA 3R3GB 2EI8A 3SV8A 1J15A 1SGRE 1Z6JH 2FX6A 1YGCH 5DP4A 2ZGXH 4FU8A 2G5NA 1MBMA 1MQ5A 1IQLA 2H5DA 4BXSA 2GMTC 1OP0A 1P8VC 3GDUA 4XE4A 4INLA 1GI4A 3RXLA 1QBOA 1P2MA 3MH5A 3M3SA 2ZQ2A 4GAWA 1ELAA <