1A7SA

Atomic resolution structure of hbp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
225
structure length
221
Chain Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease homolog
molecule keywords HEPARIN BINDING PROTEIN
publication title Atomic resolution structure of human HBP/CAP37/azurocidin.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 221
sequence length 225
ec nomenclature
pdb deposition date 1998-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a7sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a7sA02
4LXBH 3GDUA 1NFUA 3KQEA 3S9BA 4A5TS 1TGNA 2RG3A 1O2ZA 3C27B 3RXHA 4WXVA 4UFFH 1A7SA 1EX3A 1Y59T 1EOJA 1MAYA 8ESTE 1BTWA 3SI3H 3MHWU 3MU4A 3BTKE 1FY4A 1ABJH 1QL8A 1CGJE 2F9UA 3BG4C 2ZO3H 1UO6A 2NU4E 3MOCA 1Z8IB 1WTHD 1DVAH 1P2OA 1B5GH 1L1JA 1D6RA 1OXGA 2BLQA 2GTBA 2Z9LA 1BB0B 1WCZA 5AFYH 4IC6A 4I8KA 2GD4B 1SOTA 2VIWA 1UHBB 3MWIU 3ZZ8A 2GZ7A 1K22H 1XUHA 5JPMH 1GI3A 1E34B 5C1YA 3RXPA 4CRDA 3TGKE 4A1TA 4X6MA 8GCHG 3A7TA 1GI5A 3RXAA 4B71A 2ZFRH 2F9VA 4HZHA 3T2NA 1U6QA 3AASA 1YF4A 3GCTF 3RLWH 3EYDA 2J38A 2VU8E 1T8OA 2G4UA 4Z6AH 4OS7A 1P06A 2BDCA 5JB8S 1SLWB 1BCUH 3MO6A 5GCHF 4WF8A 1CGHA 3FP8E 1HLTH 1RFNA 3VB6A 3MU8A 4ZKNU 1Y5UT 3P92A 1TA2A 5FXLA 4X2YA 4KGAA 5EGMA 1NY22 5EOKA 3E6PH 1QL9A 3M3SA 1DT2A 4K5ZA 4CRGA 2FTLE 5C2ZA 3RXUA 1C1OA 1SFQB 1FAKH 1LHFH 1GWAA 2WUCA 2H5CA 1O2TA 1FPCH 1HCGA 3EDXB 1B7XB 3P8NA 2J34A 2ANMH 1C1QA 3OU0A 3A89A 3GY2A 1DUEA 3SU6A 2ZA5A 1K1LA 1MQ5A 3D65E 3SZNA 1BOQA 1HAIH 1GHAG 2PHBA 3OY5U 1EPTC 1F2SE 1EAWA 1BIOA 1TX7A 4MVNA 1GVLA 1OWIA 3EA7A 3OY6U 1SR5C 3DD2H 2NWNA 2G4TA 1HUTH 2XRCA 1DM4B 1V2MT 1D3QB 2TRMA 4O9VA 1ZHRA 2BVXH 1BTHH 2FDAA 1SLXB 4WVPE 4NFFA 4DG4A 3NZIA 2BY8X 3PV4A 4AZ2B 1BRCE 1C5NH 1C5PA 2FODA 1RS0A 5C5OA 4WMEA 3RMMH 5K0HA 4FUBA 4NSYA 3R0FA 3AAUA 1FY3A 2F91A 1PYTC 4XOJA 3GY3A 2GCHF 1LVMA 4E05H 3SU5A 1C5LH 1TPPA 5T6FA 1TBZH 3O8DA 1G3EA 1GBEA 2BM2A 2QIQA 2A1DB 4YOGA 1O2SA 3W94A 4ABGA 3FZZA 1VJAU 5A2MH 5EPNA 1EXFA 4OS1A 2ZFSA 1QNJA 2AMPA 4AFZA 2CHAB 3UNRA 1K1OA 1D3TB 3FVFB 4MNWA 4U01A 3ZZ9A 1OYTH 1A0LA 4JZ1A 1FJSA 3G01A 1Z8RA 3RMNH 1ZPCA 1MTSA 3GCNA 1BJUA 4OS5A 3FANA 1MTUA 3BTFE 2DUCA 4X6OA 3RXJA 1UVUH 1MZDA 5L30H 3U9AH 1BRAA 2PSYA 1YCPK 4X6PA 1SG8B 3M7UA 4IS5A 4UE7H 3SQEE 2HVXA 2IOTA 1K9OE 6GCHG 1NRPH 1P02A 2P8OB 4JMYA 1QRXA 3ATIA 3RXBA 5FCKA 1F0RA 3JZ1B 1MMJN 4AORA 4ABAA 5SGAE 4GSOA 2GCTB 1QRZA 1Q3XA 3P8OA 5DK1A 4UEHH 1RGQA 5CHAC 3URCA 1UVOA 2ZCLP 1O3PB 3AW0A 3K2UA 5DP3A 1MD7A 2O8TA 1G2MA 4LZ4B 1O3IA 4AB8A 1TBRH 2OLGA 1O30A 1ZJDA 2FOEA 4RKJB 2I6SA 4GCHF 1C5SA 4MPXA 1F5RA 1MD8A 3A88A 3VXEH 1TNLA 2RA0A 2A4OA 1YPHE 2F9BH 1O3LA 1LQDB 4MPVA 1FUJA 1P11E 2Q6FA 3C1KA 3UUZA 1PPHE 2FOMB 5EQQA 1KSNA 5PTPA 1KDQB 5JBBS 1QB9A 2ODYB 4INLA 2OQUA 1KLIH 4X1RU 1GGDB 1C5XB 4BAHB 1L0ZA 1CBWC 2NU3E 1AN1E 3ATMA 4NSVA 3A84A 4UFEH 2QGRA 4ISHH 1C5OH 2LPRA 4K8YA 1TNIA 3TITA 3Q3YA 3RXGA 1GL1A 2BD9A 1WUNH 2TIOA 4X1NU 5ABWA 2AGEX 2ZKSA 3DFJA 1QR3E 1TPAE 1TOCB 3F9HA 1NRRH 2BB4A 1EB1H 3E91A 1O3AA 1THSH 4D9QA 2VVCA 1C5QA 1OOKB 3M7QA 1IHTH 1G37A 2I6QA 3SNDA 4K69A 3HKIB 1ZGVA 5L2ZH 2ZEBA 1MKXH 2STAE 1AE5A 1V2OT 4VGCB 1DWCH 1UTNA 3BF6H 5JYIA 2AS9A 1UCYK 1ZSKA 3CS0A 1ETSH 1ZHMA 3SV6A 1GCTB 2R2WU 1V2KT 1SHYA 1VCWA 2JH5D 3PO1B 1C1NA 1LTOA 1Y3UA 1ARBA 2H9EH 5HM9A 1BMNH 1V2NT 4FUIA 1F5LA 2C4FH 3ODDA 3A7YA 2CJIA 2QCYA 4DVAU 3U8OH 3KQDA 5A09A 5EW1H 1M9UA 3MH4A 3H5CB 1WAYB 3M3VA 1O3KA 2EI6A 1ZGIA 5IYTA 3GY6A 1BBRH 1YC0A 2H9TH 1J14A 1BHXF 3O8BA 1H1BA 1HFDA 2BVRH 3M35A 2HGTH 1ZTJA 2BDGA 3SJ8A 4IMQA 1C5WB 1E38B 2C93B 3B8JA 1UCYE 3MH5A 1W13U 5DP8A 3TJVA 1O2OA 2V6NA 3PTBA 1O3JA 1VR1H 4O97A 1GBHA 1N8OB 1ELTA 3L33A 4OS4A 4Y7AA 2PFEA 5A8ZA 4CRAA 1Z71A 2P95A 1QA7A 1NFYA 1TNHA 4MTBA 2AYWA 2FYQA 3SO3A 1TLDA 2ZGCA 1K1MA 2GV7A 1DWDH 1HNEE 1SVPA 2A31A 3O8CA 2GT8A 1X7AC 3DFLA 3FZDA 3MMGA 1XUKA 1VCQA 3I77A 3UOPA 2CXVA 1DX5M 2WYJA 4Y6DA 4TPIZ 1OP2A 4JCNA 2GT7A 1YP9A 3FFGA 2SNWA 3M7TA 3ZZCA 2P3FH 3LU9B 2A5KA 2FLBH 3RC5A 2ZTZA 2P16A 2XC0A 2PGBB 5A0BA 1WTGH 1TMTH 4WJG2 1MZAA 1NU7B 2QV1A 2FEQH 1T31A 1C9PA 1QRWA 1V2QT 3D62A 2BX4A 1Y8TA 2BOKA 3RC6A 1A1RA 1E36B 2BLVA 1EAUA 2XBWA 1KXDA 3PMAB 2FYRA 3AVZA 3ATKA 3HK3B 1A0HB 1XKAC 4J2YB 1Q2WA 6CHAC 1Y3WA 1F0SA 1ELEE 1SGFG 2Z9JA 3ATLA 5AFZH 1ZOMA 2KAIA 4ZXYH 4CHAC 2P94A 3FAOA 1GJDB 1GHYH 2OC0A 3WY8A 3HPTB 4TY6A 2Y5FA 3T28A 3NKKA 1DOJA 1W0YH 2Q1JA 1O5FH 3S7KB 1ELVA 4CR5A 3MH7A 5LGOA 1GDNA 1MKWK 4THNH 1O2PA 2A45B 1O2LA 5BRRE 1VGCB 1P09A 3SI4H 2WV4A 8KME2 4NA8A 1NFWA 1TNJA 2A7JA 2FWWA 2PTNA 2EC9H 1GJ7B 2VH6A 2G55A 2FOGA 3S7HB 2YNAA 3E16B 4Y7BA 1V2WT 3SV7A 1P3EA 2TGDA 1THRH 4WXIA 2IN2A 1SGRE 4ZMAH 1W12U 1CO7E 1W11U 1Z7KA 1C5UA 3VGCC 2ZG0H 3TLOA 1GBMA 4ZUHA 3TH4H 2H1UA 2PTCE 1O38A 4I8GA 3PYHA 1GMDG 3EGKH 3KIDU 3A7XA 4AFQA 1JWTA 3TNTA 2BHGA 4YLQH 1L4ZA 2OP9A 1UK3A 3T26A 1ELAA 2QXJA 1ZYOA 5C67A 2ZGHA 3M5LA 3BTWE 3RXSA 1QFKH 1ZMNA 3LT3A 5ETXA 2Z3CA 3UPEA 3V7TA 1O2RA 4AFUA 4AFSA 1V2VT 2AIPA 3SU2A 2Q6GA 3P6ZB 2WPMS 5EQRA 2UUJB 1TOMH 1GHZA 1IQJA 4NWLA 1C1RA 1AB9C 1K28D 1O36A 2ZDMA 3HGNA 1F7ZA 1BBRE 4X0WU 1LCYA 1NU9A 1TX8A 3MNCA 5LH8A 3SHCH 1UHBA 3EA8A 2WPJS 1ORFA 3P17H 3LGTA 1O34A 2ANKH 2PKAB 2ZDVH 3UQOA 3QGJA 2WPKS 1QURH 1V2PT 1EAIA 4X8TH 3VXFH 1KLTA 1LHGH 1Z1IA 5J4SA 1CVWH 3TH3H 2PKSC 1C4V2 1UJ1A 2QF0A 2GZ8A 2A0QB 4Y0ZE 5F8TA 4AN7A 4NIXA 9LPRA 5DKMA 1NRQH 4LOYH 1K1JA 1EZXC 1PPEE 1P9SA 3UFAA 1P8VC 4UDWH 4DIIH 3M3TA 4H6SB 2ASUB 6ESTA 1SQAA 4DT7B 4BAKB 1Q31A 1TIOA 2GDDA 2OC1A 4BAQB 5I25A 1BZXE 3QZQA 3ZZBA 5GJ4B 1ZHPA 1O2YA 2A4QA 2THFB 3URDA 3SJKA 1RD3B 2ZGBH 4A92A 1SGCA 2F3CE 3PMBB 7GCHG 1HAXB 1JRSA 3P8GA 1GMHF 4Q2KA 1KXAA 3K6YA 2DE8A 3TJUA 3F9GA 1Z1JA 1K1IA 1QQUA 1UTKA 4JYUH 4E7NA 4FUFA 5FX5A 2J4IA 1TA6A 5C1XA 3PMHB 3S9AA 1O0DH 2J95A 1PQAA 1O37A 1TMUH 2EA3A 1GCTC 5AHGH 5I46H 5HM2A 3RC4A 1CT0E 7LPRA 2A4RA 3D23A 2BQ7B 1GJBB 2ZHDA 5F03A 5DO4H 3A7VA 1P9UA 3UIRA 1EAXA 3ATWA 3SU3A 1P2KA 4RN6A 1CA0B 1H4WA 2XYAA 1P57B 1AI8H 2FOBA 1HAZB 3ZVCA 1P2IA 3FP7E 3QDZB 4X1SU 1O3FA 1YCPH 2O9QA 1O3DA 3PROA 3MU1A 1ZPBA 2GMTC 2ZU4A 2XW9A 2ZZUH 1E0FD 4NZLA 2FX4A 1GJCB 2A2XH 2H5DA 2BZAA 4NIVA 1GDQA 3VB3A 2HOBA 1YPLH 2Y7XA 1OP0A 1SOZA 1AU8A 2BY9X 1GJ5H 1TPOA 1CHGA 1G30B 2GP9B 4ISNA 4RKOB 1TQ0B 3QZRA 3UR9A 1BJVA 1GJAB 4Y79A 1BITA 2ZNKH 5J4QA 2WPIS 1MCTA 3NCLA 3EA9A 1PPZA 3K6ZA 2PGQB 5GPIB 1LVBA 2BD3A 4ZKRU 1TNGA 2PSXA 1AZZA 3RXMA 1TB6H 1O2VA 2WUBA 2CF8H 3T62A 1FIWA 1S5SA 1O5BB 2ZPSA 2ZPRA 4GPGA 1AHTH 2ESTE 2XBXA 1PQ8A 4B2BA 3ZVEA 1G32B 1BRUP 1J16A 1KTSB 1AY6H 4JZDH 2HALA 1CHOF 4ASHA 1TAWA 1NM6A 1FLEE 1ELCA 2R2MB 1N1LA 4GHTA 1TYNA 4CRFA 1BMLA 1O2NA 1D4PB 2G8TA 3TU7H 1HXEH 1FMGA 2WYGA 1NT1A 3M5OA 2ZCKP 1T8NA 1HYLA 4FUGA 3B23B 1FNIA 2D1JA 2HNTC 1SMFE 3MFJA 3I78A 1BTZA 1O5EH 1C1UH 1ANCA 5JB9S 1VITF 2Z3EA 4SGAE 3NUMA 1GBDA 2WV5A 2Z94A 3SGAE 3JZ2B 2VWNA 3PWCA 2WPHS 1IQNA 2B8OH 2W3IA 3PLBA 4MNYA 4TPYA 4XSKU 4ABDA 1EQ9A 2OTVA 4BTIB 1UCYH 1UK2A 5IDKA 1AFQC 1ELFA 2F9PA 1HAYB 1FQ3A 1JRTA 3KCGH 1SPJA 1A5GH 1W7GH 1NO9H 3KEEA 1JXPA 3PM3A 1RRKA 4JK6A 5DP6A 3VB4A 1WOFA 1D3DB 5CMXH 1LVOA 2VNTA 2O8LA 2BLWA 2BY5X 4Z0KA 1E35B 1XVMA 1SLVB 3SU4A 4YTAA 2C8YB 2OINA 1IHSH 2AEIH 1O31A 2OXSA 1EP6A 2VB0A 5E0JA 3GCTG 2B7DH 3SN8A 3RXQA 5F6MA 1T32A 1GG6C 1KDQA 1L2EA 1XKBC 1KYNA 1UTJA 2GKVE 1RIWC 3RXLA 2FOCA 5H4IB 1P01A 4TYDA 5GCHG 1HAHH 2HNTE 1HGTH 4J1YA 5HGGA 1C5ZB 1Z8JB 2BY7X 3GDVA 1LMWB 5TCAA 1TGCA 2RDLA 1GDUA 4X1QU 3QK1A 3UY9A 1O3MA 2BXUH 1Y5AT 1G3BA 4MNVA 3BTME 1C2JA 3SQHE 1SGIB 1SI5H 1DFPA 3BIVH 1V2LT 1TX6A 1HIAB 1DWEH 2SGEE 2BTCE 3SGQE 1HXFH 1MTNB 1CT2E 1LPKB 2NU1E 1KLJH 1C2IA 1HBTH 1C1SA 1QL7A 1S0QA 2JETC 4PROA 1P3CA 3GCHB 3RXCA 2SGPE 3RXEA 4A7IB 1H9IE 1S84A 4ZKSU 1UMAH 4DOQA 2O8UA 2VWLA 4FVBA 1F5KU 3RU4D 1C4U2 1HJAB 1O35A 1ZSLA 3F6UH 3PMJA 1QJ1B 1WYKA 4NZQA 8LPRA 1MTWA 5T6GA 2Q6DA 4TY7A 1P03A 1RXPA 4BOHA 1DLKB 2VIVA 2V3OH 1O3HA 3A82A 1T8LA 3SJ9A 4YT7H 3ZZ7A 1AIXH 1LHEH 1AVXA 5EXLA 3ZZAA 4BNRA 2SFAA 3IITA 1C1PA 4Q7YA 1P0SH 1WBGB 4CH2B 4X8VH 5C3NA 2Z6BD 1UVTH 3BV9B 1HAOH 2VGCC 4A1VA 1KY9A 2BZ6H 3Q3XA 2PUQH 2K1QA 2NU2E 4KP0A 4IMZA 4I8JA 1QHRB 1IQFA 4NIWA 2GCHG 4WMFA 4O03A 1O2QA 1P2QA 3ESTA 1NRSH 1MKWH 1QQ4A 4JZFH 2TBSA 1LDTT 4U2WA 3KQCA 3AAVA 1G3CA 3R3GB 1TONA 2A7CA 1XUGA 4MG3A 2OBQA 2ZTXA 4WMDA 5F8XA 1BTYA 1ESAA 1KXEA 4HI3A 3LONA 1OWJA 3LGYA 1D3PB 1MUEB 3SUDA 1TRYA 4DGJA 1C5VA 3RXDA 4A1XA 4X2VA 3V12A 3AW1A 2A5AA 1T4UH 3LH3A 1ABIH 1C2EA 2FX6A 1GMCF 3BG4B 4ISLA 4X8SH 4CR9A 3PB1E 4ZHLU 3KN2A 4FVDA 4NFEA 1O3BA 4DIHH 2STBE 4B73A 2GGVB 1LO6A 5L2YH 1GHBF 1EUFA 1GCDA 1NROH 3M36A 1P10A 2JKHA 3NWUA 2O8WA 4X2WA 1F0TA 1WQVH 7KMEH 3SUEA 2VJ1A 1E37B 2ZHEH 4I8LA 2FOFA 1O2KA 3L3TA 1O2JA 3F68H 1GBKA 3QWCH 2R3YA 1TRNA 5T3HA 5DG6A 3ZZ5A 4R8TB 3QLPH 1W0ZU 3GY4A 3TJNA 1TRMA 1O5AB 4TWWA 1SBWA 2ZHFH 2ZDNA 3RXIA 1V6DA 1V2TT 1IQEA 3TNSA 3SORA 1YKTA 4KKDA 1SL3A 1PJPA 4HTCH 1OWHA 4D8NA 3UWJH 4GUXA 1OYQA 1MTVA 1P05A 1EZUC 1LKAA 2AGIX 4Q7ZA 1W8BH 3A87A 1BDAA 1AUTC 1TNKA 2YOLA 3A8BA 2XXLA 4GCHG 4A6LA 1K1PA 1GJ4H 1HJ8A 2CMYA 1DY8A 2AH4X 1QIXB 1V2ST 3PTNA 2ANWA 3DA9B 3U1IB 2J94A 2P3UB 2FP7B 4H42U 2PWXA 3BEUA 1GI4A 4X8UH 2R9PA 2BDYA 1C2KA 1GBAA 1YBWA 4O3UA 4MPWA 4K60A 1C4Y2 3SJIA 3U98H 5FBIA 2Z3DA 4XE4A 2PW8H 1QTFA 1A2CH 3A86A 2QXHA 3GYLB 4MNXA 4U30A 1ZMJA 1EPTB 3E1XB 3BEIB 1CU1A 4H6TA 2Y81A 1DWBH 1YPGH 1T7CA 1Z6EA 2XBVA 3SGBE 2ALVA 2HLCA 3QO6A 2BDBA 1PPGE 3T27A 2BOHB 3W95A 3QX5H 2Y7ZA 5A8XA 3EAJA 4KTUA 2UWOA 1AE8H 4I32A 2CV3A 2ZDLA 5C20A 3D49H 1TABE 1AWFH 2J92A 4I8HA 1Z8GA 3LOXA 3P8FA 3LPRA 5E0GA 2BDIA 1EATA 3TIUA 2ODQA 1PPFE 1RTLA 1C2DA 2VINA 2FOAA 1IAUA 1OX1A 2M5TA 1ETTH 1IQGA 2GX4A 3UTUH 3OTJE 1C2MA 1NZQH 1XUFA 2QXIA 1IQIA 2AGGX 3I29A 3RXOA 4CRCA 2OC7A 4AG2A 3QTOH 2HPPH 5E2PA 3RDZA 1UVSH 4NG9H 1OSSA 4DCDA 2PKAA 3LIWA 1D9IA 5E8EH 1DUAA 1XX9A 5C5NA 1O2HA 2C3SA 2CHAC 5EODA 2ZFTA 1GBJA 2WPLS 1C5RA 2FTMA 3KQBA 4ABHA 2FESH 2VIQA 3RU4E 5LPFA 4XFQA 2ZGJA 3PLPA 4K1EA 3RXFA 3SNAA 1FIZA 1GVKB 3EE0B 1TBQH 5EPYA 1YPEH 4CH8B 2FO9A 4D7FA 3E0PB 2XNIA 1C9TA 1W7XH 4M7GA 3MU5A 3MO9A 4NA9H 2XC5A 1L1GA 1ANDA 1WQSA 4D76A 1W3CA 4BAMB 4TWYA 4ZKOU 8GCHF 5EXNA 1TGSZ 3U8RH 1BA8B 3GY8A 3KNXA 4JYTA 1A3BH 3UR6A 4Q80A 2P8OC 1TALA 1KXFA 4B2AA 1H8DH 4IGDA 4WWYA 3RUOA 4AYYB 4DJZB 4DURA 1MTNC 2XCNA 3SBKA 1IOEA 3ODFA 2GCTC 3M61U 2G52A 4ZH8A 5CHAB 1G36A 2TGAA 3GDSA 2VVUA 3PWBA 1A5HA 2C8WB 3STJA 2Z9IA 3Q77A 5E2OA 2SNVA 4BTTB 2ULLA 1QJ7B 2GV6A 2OQ5A 3CP7A 2F9OA 3P95A 4ISIH 1W2KH 1P12E 1AKSB 1GJ6A 1S6HA 2G00A 2FPZA 1S82A 2ZQ2A 5B6OA 3A85A 1QA0A 5EU8A 1HAGE 2AIQA 3UWIA 2ODPA 1KTTB 1A4WH 1SGYE 1QCPA 1EJAA 2BDHA 1RTKA 2A2QH 4IN1A 3M37A 1GGDC 2CGAA 3ZYEA 2OUAA 2A5IA 3A8DA 3V0XA 2OD3B 3LGVA 1GHAF 2AFQB 3ZYDA 1DSUA 3SHAH 1H9HE 3LGUA 1XXDA 3MYWA 4K8BA 1A3EH 4B1TA 1ELDE 2AERH 4Y0YE 3A8AA 1KIGH 3SV9A 9ESTA 1NESE 1QB6A 1C1TA 2WINI 3RP2A 4GAWA 1LPZB 1LKBA 2Y6TA 1S85A 3OX7U 1FY1A 1EZSC 3RM2H 2ZCHP 3MU0A 2C8ZB 3LJOA 3Q00A 4VGCC 2W5EA 1J8AA 2FZZA 2PLXA 1L1NA 3GCOA 4KTCA 3BEFB 4KELA 4IW4E 3PO1C 2UWLA 3F9EA 3F9FA 3ZZ3A 2VVVA 3BG8A 1DE7H 4RSPA 5BPEA 3SUFA 1DXWA 5DP4A 1V2RT 3UNSA 2NU0E 2ZC9H 4IN2A 1GI7B 1UTLM 1UTPA 1IQLA 1GI0A 1DSTA 1ETRH 1AQ7A 5ESTE 2A4GA 3SNBA 3TK6A 1C2LA 4OS2A 1BTUA 4GVUA 5FPTA 2Z7FE 1DITH 3NPSA 1BQYA 2QC2A 5FX6A 3IWMA 2H6MA 4CBOA 2ZP0H 2SGFE 1MH0A 1SGEE 4INKA 7ESTE 1GI1A 1SGQE 4ISOA 3HATH 1CGIE 1VCPA 1YLCA 4JZIA 3LH1A 2Y82A 4JYVH 1SGPE 4ZAEA 1MBMA 2QA9E 2PV9B 1FN8A 3ZZ4A 5JDUB 1N8OC 1AMHA 1ZRKA 5FPYA 3DT0H 1KXBA 5C1UA 4CREA 1NRNH 1O3EA 4FUJA 5F8ZA 2B5TB 1UVPA 1EASA 1VJ9U 2CN0H 3S9CA 1V2JT 2FIRH 1FAXA 5K7RA 1PPBH 3H7TA 2QYIA 1GI8B 1AFEH 3BTGE 4SGBE 2BX3A 2TGPZ 4Y11E 6GCHF 2QAAA 1ID5H 5AF9H 1ZTLA 2R0LA 3RMLH 5A0AE 1T8MA 4NWKA 1K2I1 1O3GA 1UTMA 2G51A 1N6YA 3Q76A 2VH0A 1CA8B 4MLFB 2Z9GA 3TK9A 3UREA 4DW2U 2VIOA 1SSXA 2ZHWH 5LPEA 2ZDAH 1ZMLA 1H8IH 1QB1A 2FS8A 1YPJH 3O8RA 1AGJA 3SV2H 5A0CA 3U69H 3P70B 1A46H 1QY6A 6LPRA 1OKXA 1IQKA 1O2IA 2V3HH 4XBDA 4ZHAA 1LPGB 1SGTA 1HIAA 1FZZA 2ZPQA 1A61H 2ZI2H 1PFXC 3HK6B 4Y8ZA 1LHDH 1ESTA 6CHAB 4F49A 1HAVA 1DANH 2ALPA 1GMHG 3M5MA 1DICA 1O39A 2BVSH 2QY0B 2BY6X 3F1SB 1SQOA 3OYPA 3PLKA 4CHAB 1TFXA 3SJOA 3ZVAA 1GPZA 3MNSA 1BT7A 2SGDE 4K2YA 1ZR0A 3SNEA 2XWAA 3H7OA 1PPCE 5DP7A 2FOHA 2Y5HA 1NS3A 1TWXB 4BANB 2ZF0H 4XBBA 2FS9A 1DDJA 2C90B 1L4DA 2JH0D 4XDEA 1S83A 1VGCC 3A80A 1XUIA 1NPMA 5GWZA 2QF3A 3RMOH 3QN7A 5DP5A 1MAXA 1G9IE 4X6NA 2R0KA 2A7HA 2BMGB 1HAPH 4BXSA 5GDSH 3VB5A 5ESBA 4K1TA 2IPHA 4ABBA 1AZ8A 1G2LA 1C1VH 2QN5T 3S0NA 3KHVA 1EP5A 5DGJA 4Y10E 5EXMA 1V2UT 2BD7A 1TGTA 3E90B 3SV8A 1MU6B 1TQ7B 1DXPA 3VGCB 5G4BA 4O3TA 4YESB 5AVDA 4B75A 3HKJB 3MO3A 1QJ6B 4K1SA 2ZDKA 1YPHC 4FU8A 4FUEA 1EB2A 1YCPM 4E7RG 2H2ZA 3GY5A 2P59A 2GZ9A 3LDXH 1RTFB 1CT4E 1BTXA 4FUDA 2BQ6B 3ZZDA 4FUHA 1LQEA 1HAVB 1XUJA 3CENA 1XM1A 1DLEA 3B9FH 1WV7H 1OWEA 1S6FA 2BYAX 1C5TA 4U32A 2ZFPH 2QXGA 3LGIA 4Y71A 4Y8YA 2BD2A 1GVZA 2V0BA 1AB9B 1CHOG 2ANYA 5JBTA 1NFXA 4X1PU 3TVJB 2Z9KA 1ELGA 1ELBA 3QUMP 1O2WA 1P04A 4NA7A 1K1NA 2F9NA 3K9XB 2J9NA 2Y80A 2XTTB 3L6PA 1ZRBA 1F0UA 3EQ0H 3RXVA 1UTQA 2IJOB 1KXCA 2ZFFH 3NXPA 3UNQA 2VWMA 1B0FA 1J15A 1O3CA 3TJOA 1FXYA 1OWDA 1J17T 1J9CH 1SFIA 4WH6A 1VITG 1LVYA 4XBCA 1EKBB 5FPSA 2PKSB 4OS6A 2FI4E 3E8LA 2HNTF 2UUYA 2VIDA 4BAOB 1DS2E 1Z6JH 1ARCA 3GY7A 1ACBE 4NCYA 1YGCH 3ZV9A 4OGXA 2D8WA 1O2XA 2G5NA 3A7ZA 1MCVA 4UFGH 4B74A 2EEKA 1ANBA 3BTEE 1ANEA 1XXFA 4Q7XA 3SOSA 2FI3E 1GHXH 3SUGA 2W3KA 2FI5E 2HPQH 3BTDE 1CSOE 4F4OC 1EOLA 1ESBA 2SGQE 3U1JB 3U8TH 4B2CA 1C1MA 1TPSA 1ZJKA 4WY3A 1AWHB 3QGNB 3BSQA 2B9LA 3DUXH 3VEQB 2BXTH 1QBVH 3DHKH 2P3TB 1GL0E 2BQWB 2HRVA 3LGWA 1SC8U 1HPGA 1YPMH 1G3DA 1EPTA 3HGPA 3SNCA 5HYOA 3MNXA 1C2FA 3SW2B 4MDSA 1S0RA 4AGKA 4UONA 5L6NH 3KF2A 3A7WA 2FLRH 1NTPA 4D9RA 2CF9H 1V3XA 2RA3A 3GYMA 4AG1A 4BXWA 1GJ9B 2ZIQH 1BTPA 1GBTA 1GHWH 2LNCA 3BTHE 1OPHB 1CA0C 1OWKA 1C2HA 2W26A 1QGFA 4ESTE 1A0JA 2AMQA 2G81E 3RM0H 2GMTB 3ENSB 1O33A 2F83A 1AO5A 2JH6D 4GHQA 4IC5A 1YLDA 1QBNA 1PQ5A 3A8CA 2ZU5A 3MNBA 1Y3XA 2OCVB 5HMAA 1MQ6A 1Y5BT 2UWPA 2FMJA 1TE0A 1GMDF 1AVGH 2SGAA 4ZHMU 5T6DA 1GJ8B 4ABIA 2ZU3A 1B0EA 4FU9A 4FUCA 1UK4A 1RJXB 3FP6E 3TH2H 1INCA 1O2UA 4H4FA 1N6XA 3ELAH 5EG4A 1S81A 4YOJA 5JBCS 2D26C 1A5IA 2ZU1A 4ABJA 2PR3A 5FAHA 1SGFA 1PQ7A 2C8XB 3E3TA 1WSSH 1AUJA 1BUIA 1C5MD 2ILNA 4JK5A 1SLUB 1GHVH 3KL6A 2EI8A 1O3NA 2B0FA 3LC5A 3NK8A 4MQAA 2HWLB 5FCRA 1HJ9A 1SB1H 2W7UA 3GOVB 1JOUB 3Q3KA 2D2DA 1BMMH 1YM0A 1ZZZA 1BMAA 4KTSA 3BN9A 1O5DH 1SGNE 3UQVA 3LC3A 3K65B 3BTTE 1ZSJA 2XBYA 3T5FH 2ZECA 4NIYA 1P2JA 1MU8B 1HRTH 1ZTKA 1OP8A 1O32A 3ITIA 1FI8A 2ZTYA 2BLOA 2GVFA 1LHCH 2BD5A 4QT8C 4FXGH 1GBCA 2ZU2A 3GICB 1T4VH 5DPAA 1MBQA 2TPIZ 4AX9H 2EI7A 3T25A 1D6WA 2BDAA 1K21H 5A8YA 3V3MA 4CRBA 1SGDE 1FY5A 4I33A 4YO9A 1O3OA 2ZFQH 1GMCG 2ZHQH 1FY8E 2FXRA 2ZWLH 1O2GH 2AMDA 3BTQE 5GXPA 4WH8A 1AFQB 4E06H 2UUKB 1XMNB 3LKWA 3SU1A 5DJ7A 2OBOA 1GHBG 1GI9B 1VITH 5FHTA 3VB7A 4Y76A 4YM9A 3QTVH 1AKSA 1JMOH 4FU7A 2V35A 4HFPB 3ZVDA 1JIRA 1MKXK 1GBBA 1OS8A 1CQQA 3RU4T 3ZVBA 2UUFB 2ZQ1A 1SHHB 2DE9A 4JZEH 1YYY1 4YOIA 3MTYA 7GCHF 1GG6B 4K3JA 1C5YB 1THPB 4YZUA 1RIWB 3TK5A 5TJXA 2G5VA 1P2MA 3A83A 1W14U 1C1WH 1UTOA 1JIMA 1HB0B 5JBAS 4B76A 5CE1A 1HDTH 4YLUA 4IBLH 1SQTA 2J2UA 1TMBH 2TGTA 2XCFA 4DY7B 1GI2A 4LK4A 3S69A 5TCCA 2XWBI 3A81A 3N7OA 2P93A 2GDEH 1BBRK 1EJMA 2OC8A 3KGPA 4HGCA 4BTUB 3OSYA 3RXKA 3IG6B 1O5CB 1BHXB 3TGIE 5DP9A 2W7SA 3RLYH 1W10U 1FDPA 2XC4A 1EJNA 4D7GA 1FN6A 2H9HA 5HXFA 3SU0A 4OGYA 1WU1A 5E0HA 1AD8H 2BD4A 1JBUH 1DY9A 2VIPA 1F92A 1FONA 1GBLA 2KAIB 4CBNA 1TGBA 2JETB 1BRBE 1YPKH 4NGAH 4AGJA 4LZ1H 3GCHC 3M5NA 1Y3VA 5GIBA 3ZVFA 4X2XA 1ZLRA 4MPUA 1O2MA 5EQSA 4ZXXH 4R0IA 2A32A 3V13A 1HJAC 4UFDH 3GISB 3UOUA 4INHA 2ZGXH 1O5GH 2FM2A 3CS7A 3ZZ6A 2YNBA 1NC6A 3VPKA 4ABFA 1GI6A 3ZVGA 1CE5A 3VFEA 5EW2H 1HV7A 1IQHA 1FPHH 4I31A 1AVWA 1P2NA 4AB9A 4I7YH 5FBEA 4AYVB 1DPOA 3LJJA 4ZROA 1IQMA 1VZQH 3MI4A 3BIUH 3STIA 1GBFA 2Y5GA 3RXRA 1Y3YA 2BD8A 1CBWB 1ZPZA 1H9LB 3RXTA 3ZV8A 1XVOA 2PUXB 2VWOA 4Y8XA 1NN6A 1FV9A 1EZQA 3TPIZ 2VGCB 3MH6A 4ABEA 1GBIA 1PYTD 4AOQA 5LPRA 4YT6H 2R3UA 1QBOA 3E0NB 2O8MA 4UD9H 2RCEA 1C2GA 3T29A 4GLYA 3TGJE
chains in the Genus database with same CATH superfamily
4LXBH 1VKYA 3GDUA 1E1RD 1NFUA 3KQEA 3S9BA 4A5TS 2KM0A 1TGNA 4P02A 2RG3A 1O2ZA 3C27B 3RXHA 4WXVA 4UFFH 1A7SA 1EX3A 1Y59T 1EOJA 1MAYA 8ESTE 1BTWA 3SI3H 3MHWU 3MU4A 1S6LA 3BTKE 4XD7D 1FY4A 1ABJH 1QL8A 3NRLA 1CGJE 2F9UA 3BG4C 2ZO3H 1UO6A 2NU4E 3MOCA 1Z8IB 1WTHD 1DVAH 1P2OA 1B5GH 1L1JA 1D6RA 1OXGA 2BLQA 2GTBA 2Z9LA 1BB0B 1WDIA 1WCZA 2K8IA 5AFYH 4IC6A 4I8KA 5EJ1A 2GD4B 1SOTA 2VIWA 1UHBB 3MWIU 3ZZ8A 2GZ7A 1K22H 1XUHA 5JPMH 1GI3A 1E34B 5C1YA 3RXPA 4CRDA 3TGKE 4A1TA 4X6MA 8GCHG 3A7TA 1GI5A 3RXAA 4B71A 2ZFRH 2F9VA 4HZHA 3T2NA 1U6QA 3AASA 1YF4A 3GCTF 2LELA 3EYDA 3RLWH 1YLNA 2J38A 2VU8E 1T8OA 2G4UA 4Z6AH 4OS7A 1P06A 2BDCA 5JB8S 1SLWB 1BCUH 3MO6A 5GCHF 4WF8A 1CGHA 3FP8E 1HLTH 1RFNA 5HKKD 3VB6A 3MU8A 4ZKNU 1Y5UT 3P92A 1TA2A 5FXLA 4X2YA 4KGAA 5EGMA 1NY22 5EOKA 3E6PH 1QL9A 3M3SA 1DT2A 4K5ZA 4CRGA 2FTLE 5C2ZA 3RXUA 1C1OA 1SFQB 1FAKH 1LHFH 1GWAA 3DSPA 2WUCA 2H5CA 1O2TA 1FPCH 1HCGA 3EDXB 1B7XB 3P8NA 2J34A 2ANMH 2OK5A 1C1QA 3OU0A 3A89A 3GY2A 1DUEA 3SU6A 2ZA5A 1K1LA 1MQ5A 3D65E 3SZNA 1BOQA 1HAIH 1GHAG 2PHBA 3OY5U 1EPTC 1F2SE 1EAWA 1BIOA 1TX7A 4MVNA 1GVLA 1OWIA 3EA7A 3OY6U 1SR5C 3DD2H 2NWNA 2G4TA 1HUTH 2XRCA 1DM4B 1V2MT 1D3QB 2TRMA 4O9VA 1ZHRA 2BVXH 1BTHH 2FDAA 2KCYA 1SLXB 4WVPE 4NFFA 4DG4A 3NZIA 2BY8X 3PV4A 5GNDA 1W0JD 4AZ2B 1BRCE 1C5NH 1C5PA 2FODA 1RS0A 5C5OA 1MABB 3EE7A 4WMEA 3RMMH 5K0HA 4FUBA 4NSYA 3R0FA 3AAUA 1FY3A 2F91A 5T1VA 1PYTC 4XOJA 3GY3A 2GCHF 1LVMA 4E05H 3SU5A 1C5LH 1TPPA 5T6FA 1TBZH 3O8DA 1G3EA 1GBEA 2BM2A 2QIQA 2A1DB 4YOGA 1WXRA 1O2SA 3W94A 4ABGA 3FZZA 2WZQA 1VJAU 5A2MH 5EPNA 1EXFA 4OS1A 2ZFSA 1QNJA 2AMPA 4AFZA 2CHAB 3UNRA 3UB0A 1K1OA 1D3TB 3FVFB 4MNWA 4U01A 3ZZ9A 1OYTH 1A0LA 2WPDD 4JZ1A 1FJSA 3G01A 1Z8RA 3RMNH 1ZPCA 1MTSA 3GCNA 1BJUA 4OS5A 3FANA 1MTUA 3BTFE 2KZ4A 3F2GA 3F3BA 2DUCA 4X6OA 3RXJA 1FX0B 1MZDA 1UVUH 3U9AH 5L30H 1BRAA 2PSYA 1YCPK 4X6PA 1SG8B 3M7UA 4IS5A 4UE7H 3SQEE 2HVXA 2IOTA 1K9OE 6GCHG 1NRPH 1P02A 2GJGA 2P8OB 4JMYA 1QRXA 3ATIA 3RXBA 5FCKA 1F0RA 3JZ1B 1MMJN 4AORA 4ABAA 5SGAE 4GSOA 2GCTB 1QRZA 1Q3XA 3P8OA 5DK1A 4UEHH 1RGQA 5CHAC 3URCA 1UVOA 2ZCLP 1O3PB 3AW0A 3K2UA 5DP3A 1MD7A 2O8TA 1G2MA 4LZ4B 1O3IA 4AB8A 1TBRH 2OLGA 1O30A 1ZJDA 2FOEA 4RKJB 2I6SA 4GCHF 1C5SA 4MPXA 1F5RA 1MD8A 2QF5A 3A88A 3VXEH 1TNLA 2RA0A 2A4OA 1YPHE 2F9BH 1O3LA 1LQDB 4MPVA 1FUJA 1P11E 2Q6FA 3C1KA 3UUZA 1PPHE 2FOMB 5EQQA 1KSNA 5PTPA 1KDQB 5JBBS 1QB9A 2ODYB 4INLA 2OQUA 1KLIH 4X1RU 1GGDB 1C5XB 4BAHB 1L0ZA 1CBWC 2NU3E 1AN1E 3ATMA 4NSVA 3A84A 4UFEH 2QGRA 4ISHH 1C5OH 2LPRA 4K8YA 1TNIA 3TITA 3Q3YA 3RXGA 1GL1A 2BD9A 1WUNH 2TIOA 4X1NU 4Z1MD 5ABWA 2AGEX 2ZKSA 3DFJA 1QR3E 1TPAE 1TOCB 2M2AA 3F9HA 1NRRH 2LP6A 2BB4A 1EB1H 3E91A 1O3AA 1THSH 4D9QA 2VVCA 1C5QA 1OOKB 3M7QA 1IHTH 1G37A 2I6QA 3SNDA 4K69A 3HKIB 1ZGVA 5L2ZH 2ZEBA 1MKXH 2KR7A 2STAE 1AE5A 1V2OT 4VGCB 1DWCH 1UTNA 3BF6H 5JYIA 2AS9A 2CK3D 1UCYK 1ZSKA 3CS0A 1ETSH 1ZHMA 3SV6A 2KCOA 1GCTB 2R2WU 1V2KT 1SHYA 1VCWA 2JH5D 3PO1B 1C1NA 1LTOA 1Y3UA 2IJD1 1ARBA 2H9EH 5HM9A 1BMNH 1V2NT 4FUIA 1F5LA 2C4FH 5DN6D 3ODDA 3A7YA 2CJIA 2QCYA 4DVAU 3U8OH 3KQDA 5A09A 5EW1H 1M9UA 3MH4A 3H5CB 1WAYB 3M3VA 1O3KA 2PP6A 2EI6A 1ZGIA 5IYTA 3GY6A 1BBRH 1YC0A 2H9TH 1J14A 1BHXF 3O8BA 1H1BA 1HFDA 2BVRH 3M35A 2HGTH 1ZTJA 2BDGA 3SJ8A 3VG8A 4IMQA 1C5WB 3F0PA 1E38B 2C93B 3B8JA 1UCYE 5IK2D 3MH5A 1W13U 5DP8A 3TJVA 1O2OA 4TSFD 2V6NA 3PTBA 1O3JA 1VR1H 4O97A 1GBHA 1N8OB 1ELTA 3L33A 4OS4A 4Y7AA 2PFEA 5A8ZA 5EJLA 4CRAA 1Z71A 2P95A 1QA7A 1NFYA 1TNHA 4MTBA 2AYWA 2FYQA 3SO3A 1TLDA 5DSFA 2ZGCA 1K1MA 2KCAA 2GV7A 1DWDH 1HNEE 1SVPA 2A31A 3O8CA 2GT8A 5HIZA 1X7AC 3DFLA 3FZDA 3MMGA 1XUKA 1VCQA 3I77A 3UOPA 2CXVA 1DX5M 2WYJA 4Y6DA 4TPIZ 5F53A 1OP2A 4JCNA 2GT7A 1YP9A 3FFGA 4XRNA 2SNWA 3M7TA 3ZZCA 2P3FH 3LU9B 2A5KA 2FLBH 3RC5A 2ZTZA 2P16A 3N7DA 2XC0A 2PGBB 5A0BA 1WTGH 1TMTH 4WJG2 1MZAA 1NU7B 2QV1A 2FEQH 1T31A 1C9PA 1QRWA 3PRBA 1V2QT 2KX4A 3D62A 2BX4A 1Y8TA 2BOKA 3RC6A 1A1RA 1E36B 2BLVA 1EAUA 2XBWA 1KXDA 3PMAB 2FYRA 5CDFE 3AVZA 3ATKA 3HK3B 4FOUC 1A0HB 1XKAC 4J2YB 1Q2WA 6CHAC 1Y3WA 1F0SA 1ELEE 1SGFG 2Z9JA 3ATLA 5AFZH 1ZOMA 2KAIA 4ZXYH 4CHAC 2P94A 4M9FA 3FAOA 1GJDB 1GHYH 2OC0A 3WY8A 3HPTB 4TY6A 2Y5FA 3T28A 3NKKA 1DOJA 1W0YH 2Q1JA 1O5FH 3S7KB 1ELVA 4CR5A 3MH7A 5LGOA 1GDNA 1MKWK 4THNH 1O2PA 4ZCNA 2A45B 1O2LA 5BRRE 1VGCB 1P09A 3SI4H 2WV4A 8KME2 4NA8A 1NFWA 1TNJA 2KFWA 2A7JA 2FWWA 2PTNA 2EC9H 1GJ7B 2VH6A 2G55A 2FOGA 3S7HB 4B6EA 2YNAA 3E16B 4Y7BA 1V2WT 2XNDD 3SV7A 1P3EA 2F4LA 2TGDA 2WHXA 1THRH 4WXIA 2IN2A 1SGRE 4ZMAH 1W12U 1CO7E 1W11U 1Z7KA 1C5UA 3VGCC 2ZG0H 3TLOA 1GBMA 2F43B 4ZUHA 3TH4H 2H1UA 2PTCE 1O38A 4I8GA 3PYHA 1GMDG 3EGKH 3KIDU 4ACBA 3A7XA 4AFQA 1JWTA 3TNTA 2BHGA 4YLQH 1L4ZA 2OP9A 1UK3A 3T26A 1ELAA 5C17A 2QXJA 1ZYOA 5C67A 2ZGHA 3M5LA 2KCPA 3BTWE 3RXSA 1QFKH 1ZMNA 3LT3A 5ETXA 2Z3CA 3UPEA 3V7TA 1O2RA 4AFUA 4AFSA 1V2VT 2AIPA 3SU2A 1K0HA 2Q6GA 3P6ZB 2WPMS 5EQRA 2UUJB 1TOMH 1GHZA 1IQJA 4NWLA 1C1RA 1AB9C 1K28D 1O36A 2ZDMA 3HGNA 1F7ZA 1BBRE 4X0WU 1LCYA 1NU9A 1TX8A 3MNCA 5LH8A 3SHCH 1UHBA 3EA8A 2WPJS 5EJZA 1ORFA 2IPQX 3P17H 3LGTA 1W0KD 1O34A 5KECA 2ANKH 2PKAB 2ZDVH 3UQOA 3QGJA 2WPKS 1QURH 1V2PT 1EAIA 4X8TH 3VXFH 4Q63A 1KLTA 3OFND 1LHGH 1Z1IA 5J4SA 1CVWH 3TH3H 1C4V2 2PKSC 1UJ1A 2QF0A 2GZ8A 2A0QB 4Y0ZE 5F8TA 4AN7A 4NIXA 9LPRA 5DKMA 1NRQH 4LOYH 1K1JA 1EZXC 1PPEE 1P9SA 3UFAA 1P8VC 4UDWH 4DIIH 3M3TA 4H6SB 2ASUB 6ESTA 1SQAA 4DT7B 4BAKB 1Q31A 1TIOA 2GDDA 2OC1A 4BAQB 2JJ1D 1BZXE 2JDID 5I25A 3QZQA 3ZZBA 5GJ4B 1ZHPA 1O2YA 2A4QA 2THFB 3URDA 3SJKA 1RD3B 2ZGBH 4A92A 1SGCA 2F3CE 3PMBB 7GCHG 1HAXB 1JRSA 3P8GA 1GMHF 4Q2KA 1KXAA 3K6YA 2DE8A 3TJUA 3F9GA 1Z1JA 1K1IA 1QQUA 1UTKA 4JYUH 4E7NA 4FUFA 5FX5A 2J4IA 1TA6A 5C1XA 3PMHB 3S9AA 1O0DH 2J95A 2WSSD 1PQAA 1O37A 1TMUH 2EA3A 1GCTC 5AHGH 5I46H 5HM2A 3RC4A 1CT0E 7LPRA 2A4RA 3D23A 2BQ7B 1GJBB 2ZHDA 5F03A 5DO4H 3A7VA 1P9UA 3UIRA 1EAXA 3ATWA 3SU3A 1P2KA 4RN6A 1CA0B 1H4WA 2XYAA 1P57B 1AI8H 2FOBA 1HAZB 3ZVCA 1P2IA 3FP7E 3QDZB 4X1SU 1O3FA 1YCPH 2O9QA 1O3DA 3PROA 3MU1A 1QZ8A 1ZPBA 2GMTC 2ZU4A 2XW9A 2ZZUH 1E0FD 4NZLA 2FX4A 1GJCB 2A2XH 2H5DA 2BZAA 4NIVA 1GDQA 3VB3A 2HOBA 1YPLH 2Y7XA 1OP0A 1SOZA 1AU8A 3GS9A 2BY9X 1GJ5H 1TPOA 1CHGA 3KQ5A 1G30B 2GP9B 4ISNA 4RKOB 1TQ0B 2EY4C 2K0QA 3QZRA 3UR9A 1BJVA 1GJAB 3N99A 4B6FA 4Y79A 1BITA 2ZNKH 5J4QA 2WPIS 1MCTA 3NCLA 3EA9A 1PPZA 4RT0A 3K6ZA 2PGQB 5GPIB 1LVBA 2BD3A 4ZKRU 1TNGA 2PSXA 1AZZA 3RXMA 1TB6H 1O2VA 2WUBA 2CF8H 3T62A 1FIWA 3F2FA 1S5SA 1O5BB 2ZPSA 2ZPRA 4GPGA 1AHTH 2ESTE 2XBXA 1PQ8A 2RDEA 4B2BA 3ZVEA 1G32B 1BRUP 1J16A 1KTSB 1AY6H 4JZDH 2HALA 2HVYB 1CHOF 4ASHA 1TAWA 1NM6A 1FLEE 1ELCA 2R2MB 1N1LA 4GHTA 1TYNA 2W6JD 4CRFA 1BMLA 1O2NA 1D4PB 2G8TA 3TU7H 1HXEH 1FMGA 2WYGA 1NT1A 3M5OA 2ZCKP 1T8NA 1HYLA 4FUGA 3B23B 5C0TA 1FNIA 2D1JA 2HNTC 1SMFE 3MFJA 3I78A 1BTZA 1O5EH 1C1UH 1ANCA 5JB9S 1VITF 2Z3EA 4SGAE 3NUMA 1GBDA 2WV5A 2W6ID 2Z94A 3SGAE 3JZ2B 2VWNA 3PWCA 2WPHS 1IQNA 2B8OH 2W3IA 3PLBA 4MNYA 4TPYA 4XSKU 4ABDA 1EQ9A 2OTVA 4BTIB 1UCYH 1UK2A 5IDKA 1AFQC 1ELFA 2F9PA 1HAYB 1FQ3A 1JRTA 3KCGH 1SPJA 1A5GH 1W7GH 1NO9H 3KEEA 1JXPA 3PM3A 1RRKA 4JK6A 5DP6A 3VB4A 1WOFA 1D3DB 5CMXH 1LVOA 2VNTA 2O8LA 2BLWA 2BY5X 4Z0KA 1E35B 1XVMA 1SLVB 3SU4A 4YTAA 2C8YB 2OINA 1IHSH 2AEIH 1O31A 2OXSA 1EP6A 2VB0A 5E0JA 3GCTG 2B7DH 3SN8A 3RXQA 5F6MA 1T32A 3OAAD 1GG6C 1KDQA 1L2EA 1XKBC 3FOAA 1KYNA 1UTJA 2GKVE 1RIWC 3RXLA 2FOCA 5H4IB 1P01A 4TYDA 5GCHG 1HAHH 4Q4LA 2HNTE 1HGTH 4J1YA 5HGGA 1C5ZB 1Z8JB 2BY7X 3GDVA 1LMWB 5TCAA 1TGCA 2RDLA 1GDUA 4X1QU 3QK1A 3UAIC 3UY9A 1O3MA 2BXUH 1Y5AT 1G3BA 4MNVA 1NBMD 3BTME 1C2JA 3SQHE 1SGIB 1SI5H 1DFPA 3BIVH 1V2LT 1TX6A 1HIAB 1DWEH 2SGEE 2BTCE 3SGQE 1HXFH 1MTNB 1CT2E 1LPKB 2NU1E 1KLJH 1C2IA 1HBTH 1C1SA 1QL7A 1S0QA 2JETC 4PROA 1P3CA 3GCHB 3RXCA 2SGPE 3RXEA 4A7IB 1H9IE 1S84A 4ZKSU 1UMAH 4DOQA 2O8UA 2VWLA 1E1QD 4FVBA 1F5KU 3RU4D 1C4U2 1HJAB 1O35A 1ZSLA 3F6UH 5HIYA 3PMJA 2JIZD 1QJ1B 1WYKA 4NZQA 8LPRA 1MTWA 5T6GA 2Q6DA 4TY7A 1P03A 1RXPA 4BOHA 1DLKB 2VIVA 2V3OH 1O3HA 3A82A 1T8LA 3SJ9A 4YT7H 3ZZ7A 1AIXH 1LHEH 1AVXA 5EXLA 3ZZAA 4BNRA 2SFAA 3IITA 1C1PA 4Q7YA 1P0SH 1WBGB 4CH2B 4X8VH 5C3NA 2Z6BD 3PV5A 1UVTH 3BV9B 1HAOH 2VGCC 4A1VA 1KY9A 2BZ6H 3Q3XA 2PUQH 2K1QA 2NU2E 4KP0A 4IMZA 4I8JA 1QHRB 1IQFA 4NIWA 2GCHG 4WMFA 4O03A 1O2QA 1P2QA 3ESTA 1NRSH 1MKWH 1QQ4A 4JZFH 2TBSA 1LDTT 4U2WA 4F55A 3KQCA 3AAVA 1G3CA 3R3GB 1TONA 2A7CA 1XUGA 4MG3A 2OBQA 2ZTXA 4WMDA 5F8XA 1BTYA 1ESAA 1KXEA 4HI3A 3LONA 1OWJA 3LGYA 1D3PB 1MUEB 3SUDA 1TRYA 4DGJA 1C5VA 3RXDA 4A1XA 4X2VA 3V12A 3AW1A 2A5AA 1T4UH 3LH3A 1ABIH 1C2EA 2FX6A 1GMCF 3BG4B 4ISLA 2V3MA 4X8SH 4CR9A 3PB1E 4ZHLU 3KN2A 4FVDA 4NFEA 1O3BA 4DIHH 2STBE 4B73A 2GGVB 1LO6A 5L2YH 1GHBF 1EUFA 1GCDA 1NROH 3M36A 1P10A 2JKHA 3NWUA 2O8WA 4X2WA 1F0TA 1WQVH 2QE7D 7KMEH 3SUEA 2VJ1A 1E37B 2ZHEH 4I8LA 2FOFA 1O2KA 3L3TA 1O2JA 3F68H 1GBKA 3QWCH 2R3YA 1TRNA 5T3HA 3U28C 5DG6A 3ZZ5A 4R8TB 3QLPH 1W0ZU 3GY4A 3TJNA 1TRMA 1O5AB 4TWWA 1SBWA 2ZHFH 2ZDNA 3RXIA 1V6DA 1V2TT 1IQEA 3TNSA 3SORA 1YKTA 4KKDA 1SL3A 1PJPA 4HTCH 1OWHA 4D8NA 3UWJH 4GUXA 1OYQA 1MTVA 1P05A 1EZUC 1LKAA 2AGIX 4Q7ZA 1W8BH 3A87A 1BDAA 1AUTC 1TNKA 2YOLA 3A8BA 2XXLA 4GCHG 4A6LA 1K1PA 1GJ4H 1HJ8A 2CMYA 1DY8A 2AH4X 1QIXB 1V2ST 3PTNA 2ANWA 3DA9B 3U1IB 2J94A 1SQRA 2P3UB 2FP7B 4H42U 2PWXA 3BEUA 1GI4A 4X8UH 2R9PA 2BDYA 1C2KA 1GBAA 1YBWA 4O3UA 3OEHD 4K60A 4MPWA 1C4Y2 3SJIA 3U98H 5FBIA 2Z3DA 4XE4A 2PW8H 1QTFA 1A2CH 3A86A 2QXHA 3GYLB 4MNXA 2WV9A 4U30A 1ZMJA 1EPTB 3E1XB 3BEIB 1CU1A 4H6TA 2Y81A 1DWBH 1YPGH 1T7CA 1Z6EA 2XBVA 3SGBE 2ALVA 2HLCA 3QO6A 2BDBA 1PPGE 3T27A 2BOHB 3W95A 3QX5H 2Y7ZA 5A8XA 3EAJA 4KTUA 2UWOA 1AE8H 4I32A 2CV3A 2ZDLA 5C20A 3D49H 1TABE 1AWFH 2J92A 4I8HA 1Z8GA 3LOXA 3P8FA 3LPRA 5E0GA 2BDIA 1EATA 3TIUA 2ODQA 1PPFE 1RTLA 1C2DA 2VINA 2FOAA 1IAUA 1OX1A 2M5TA 1ETTH 1IQGA 2GX4A 3UTUH 3FO8D 3OTJE 1C2MA 1NZQH 1XUFA 2QXIA 1IQIA 1NBME 2AGGX 3I29A 3RXOA 4CRCA 2OC7A 4AG2A 2YMSB 3QTOH 2HPPH 5E2PA 3RDZA 1UVSH 4OM9A 4NG9H 1OSSA 4DCDA 2PKAA 3LIWA 1D9IA 5E8EH 1DUAA 1XX9A 5C5NA 1O2HA 2C3SA 2CHAC 5EODA 2ZFTA 1GBJA 2WPLS 1C5RA 2JJ2D 2FTMA 3KQBA 4ABHA 2FESH 2VIQA 3RU4E 5LPFA 4XFQA 2ZGJA 3PLPA 4K1EA 3RXFA 3SNAA 1FIZA 1GVKB 3EE0B 1TBQH 5EPYA 1YPEH 4CH8B 2FO9A 4D7FA 3E0PB 2XNIA 1C9TA 1W7XH 4M7GA 3MU5A 1COWD 3MO9A 4NA9H 2XC5A 1L1GA 1ANDA 1WQSA 4D76A 1W3CA 2RFKC 4BAMB 4TWYA 4ZKOU 8GCHF 5EXNA 1TGSZ 3U8RH 1BA8B 3GY8A 3KNXA 4JYTA 1A3BH 3UR6A 4Q80A 2P8OC 1TALA 3OTPA 1KXFA 4B2AA 1H8DH 4IGDA 4WWYA 3RUOA 4AYYB 4DJZB 4DURA 1MTNC 2XCNA 3SBKA 1IOEA 3ODFA 2GCTC 3M61U 2G52A 2AHME 4ZH8A 5CHAB 1G36A 2TGAA 3GDSA 2VVUA 2J98B 1A5HA 3PWBA 2C8WB 3STJA 2Z9IA 3Q77A 5E2OA 2SNVA 4BTTB 2ULLA 1QJ7B 2GV6A 2OQ5A 3CP7A 2F9OA 3P95A 4ISIH 1W2KH 1P12E 5KEDA 1AKSB 1GJ6A 1S6HA 3OEED 2G00A 2FPZA 1S82A 2ZQ2A 5B6OA 3A85A 1QA0A 5EU8A 1HAGE 2AIQA 3UWIA 2ODPA 1KTTB 1A4WH 1SGYE 1QCPA 1EJAA 2BDHA 1RTKA 2A2QH 4IN1A 3M37A 1GGDC 2CGAA 3ZYEA 2OUAA 1SKYE 2A5IA 3A8DA 3V0XA 2OD3B 3LGVA 1GHAF 2AFQB 3ZYDA 1DSUA 3SZEA 3SHAH 1H9HE 3LGUA 1XXDA 3MYWA 4K8BA 1A3EH 4B1TA 1ELDE 2AERH 4Y0YE 3A8AA 1KIGH 3SV9A 9ESTA 1NESE 1QB6A 1C1TA 2WINI 3RP2A 4GAWA 1LPZB 1LKBA 2Y6TA 1S85A 3OX7U 2EQNA 1FY1A 1EZSC 3RM2H 2ZCHP 1YY3A 3MU0A 2C8ZB 3LJOA 3Q00A 4VGCC 2W5EA 1J8AA 2FZZA 4ACAA 2PLXA 1L1NA 3GCOA 4KTCA 3BEFB 4KELA 4IW4E 3PO1C 2UWLA 3F9EA 3F9FA 3ZZ3A 2VVVA 3BG8A 1DE7H 4RSPA 5BPEA 3SUFA 1DXWA 5DP4A 1V2RT 3UNSA 2NU0E 2ZC9H 4IN2A 1GI7B 1UTLM 1UTPA 1IQLA 1GI0A 1DSTA 1ETRH 1AQ7A 5ESTE 2A4GA 3SNBA 2QF4A 3TK6A 1C2LA 4OS2A 1BTUA 4AC9A 4GVUA 5FPTA 2Z7FE 1DITH 3NPSA 1BQYA 2QC2A 2J97A 5FX6A 3IWMA 2H6MA 4CBOA 2ZP0H 2SGFE 1MH0A 1SGEE 4INKA 7ESTE 1GI1A 1SGQE 4ISOA 3HATH 4HG6A 1CGIE 1VCPA 1YLCA 4JZIA 3LH1A 2Y82A 4JYVH 1SGPE 4ZAEA 4RI0A 1MBMA 2QA9E 2PV9B 1FN8A 3ZZ4A 5JDUB 1N8OC 1AMHA 1ZRKA 2V7QD 3PV2A 5FPYA 3DT0H 1KXBA 5C1UA 4CREA 1NRNH 1O3EA 4FUJA 3DSGA 5F8ZA 2B5TB 1UVPA 1EASA 1VJ9U 2CN0H 3S9CA 1V2JT 2FIRH 1FAXA 5K7RA 1PPBH 3H7TA 2QYIA 1GI8B 1AFEH 3BTGE 4SGBE 5FL7D 2BX3A 2TGPZ 4Y11E 6GCHF 2QAAA 1ID5H 5AF9H 1ZTLA 2R0LA 3RMLH 5A0AE 1T8MA 4NWKA 1K2I1 1O3GA 1UTMA 2G51A 1N6YA 3Q76A 2VH0A 1CA8B 4MLFB 2Z9GA 3TK9A 3UREA 4DW2U 2VIOA 1SSXA 2ZHWH 5LPEA 2ZDAH 1ZMLA 1H8IH 1QB1A 2FS8A 1YPJH 3O8RA 1AGJA 3SV2H 5A0CA 3U69H 3P70B 1A46H 1QY6A 6LPRA 1OKXA 1IQKA 1O2IA 2V3HH 4XBDA 4ZHAA 1LPGB 1SGTA 1HIAA 1FZZA 2ZPQA 1A61H 2ZI2H 1PFXC 3HK6B 4Y8ZA 1LHDH 1ESTA 6CHAB 4F49A 1HAVA 1DANH 2ALPA 1GMHG 3M5MA 1DICA 1O39A 2VBCA 2BVSH 2QY0B 2BY6X 3F1SB 1SQOA 3OYPA 3PLKA 4CHAB 1TFXA 3SJOA 3ZVAA 1GPZA 3MNSA 1BT7A 2SGDE 4K2YA 3F2HA 1ZR0A 3SNEA 2XWAA 3H7OA 1PPCE 5DP7A 2FOHA 2Y5HA 1NS3A 1TWXB 4BANB 2ZF0H 4XBBA 2FS9A 1DDJA 2C90B 1L4DA 2JH0D 4XDEA 1S83A 1VGCC 3A80A 1XUIA 1NPMA 5GWZA 2QF3A 3RMOH 3QN7A 5DP5A 1MAXA 1G9IE 4X6NA 2R0KA 2A7HA 2BMGB 1HAPH 4BXSA 5GDSH 3VB5A 5ESBA 4K1TA 2IPHA 2YMSC 4ABBA 1AZ8A 1G2LA 1C1VH 2QN5T 3S0NA 3KHVA 1EP5A 5DGJA 4Y10E 5EXMA 1V2UT 2BD7A 1TGTA 3E90B 3SV8A 1MU6B 1TQ7B 1DXPA 3VGCB 5G4BA 4O3TA 4YESB 5AVDA 4B75A 3HKJB 3MO3A 1QJ6B 4K1SA 2ZDKA 3WWBA 1OHHD 1YPHC 4FU8A 4FUEA 1EB2A 1YCPM 4E7RG 2H2ZA 3GY5A 2P59A 2GZ9A 3LDXH 1RTFB 1CT4E 1BTXA 4FUDA 2BQ6B 3ZZDA 4FUHA 1LQEA 1HAVB 1XUJA 3CENA 1XM1A 1DLEA 3B9FH 1WV7H 1OWEA 1S6FA 2BYAX 1C5TA 4U32A 2ZFPH 2QXGA 3LGIA 4Y71A 4Y8YA 2BD2A 1GVZA 2V0BA 1AB9B 1CHOG 2ANYA 5JBTA 1NFXA 4X1PU 2HLDD 3TVJB 2Z9KA 1ELGA 1ELBA 3QUMP 1O2WA 1P04A 4NA7A 4DT4A 1K1NA 2F9NA 3K9XB 2J9NA 2Y80A 2XTTB 3L6PA 3PRDA 5C94A 3MQKC 1ZRBA 1F0UA 3EQ0H 3RXVA 1UTQA 2IJOB 1KXCA 2ZFFH 1BMFD 3NXPA 3UNQA 2VWMA 1B0FA 1J15A 1O3CA 3TJOA 1FXYA 1OWDA 1J17T 1J9CH 1SFIA 4WH6A 1VITG 1LVYA 4XBCA 1EKBB 5FPSA 2PKSB 4OS6A 2FI4E 3E8LA 2HNTF 2UUYA 2VIDA 5C0UA 4BAOB 1DS2E 1Z6JH 1ARCA 3GY7A 1ACBE 4NCYA 1YGCH 3ZV9A 4OGXA 2D8WA 1O2XA 2G5NA 3A7ZA 1MCVA 4UFGH 3DSOA 4B74A 2EEKA 1ANBA 3BTEE 1ANEA 1XXFA 4Q7XA 3SOSA 2FI3E 1GHXH 3WWFA 3SUGA 2W3KA 2J5UA 2FI5E 2HPQH 3BTDE 1CSOE 4F4OC 1EOLA 1ESBA 2SGQE 3U1JB 3U8TH 5B6LA 4B2CA 1C1MA 1TPSA 1E79D 1ZJKA 4WY3A 1AWHB 3QGNB 3BSQA 2B9LA 3DUXH 3VEQB 2BXTH 1QBVH 3DHKH 2P3TB 1YWUA 1GL0E 2BQWB 2HRVA 3LGWA 4FETA 1SC8U 1HPGA 1YPMH 1G3DA 1EPTA 3HGPA 5CHBA 3SNCA 5HYOA 3MNXA 1C2FA 3SW2B 4MDSA 1S0RA 4AGKA 4UONA 5L6NH 3KF2A 3A7WA 2FLRH 1NTPA 4D9RA 3SYJA 2CF9H 1V3XA 2RA3A 3GYMA 4AG1A 4BXWA 1GJ9B 2ZIQH 1BTPA 1GBTA 1GHWH 2LNCA 3BTHE 1OPHB 1CA0C 1OWKA 1C2HA 2W26A 1QGFA 4ESTE 1A0JA 2AMQA 5EIYA 2G81E 3F0OA 3RM0H 5KGOA 2GMTB 3ENSB 1O33A 2F83A 1AO5A 2JH6D 4GHQA 4IC5A 1YLDA 1QBNA 1PQ5A 3A8CA 2ZU5A 3MNBA 1Y3XA 2OCVB 5HMAA 1MQ6A 4RT1A 1Y5BT 2UWPA 2FMJA 1TE0A 1GMDF 3H09A 1AVGH 2SGAA 4ZHMU 5T6DA 1GJ8B 4ABIA 2ZU3A 1B0EA 4FU9A 4FUCA 1H8HD 1UK4A 1RJXB 3FP6E 3TH2H 1INCA 1O2UA 4H4FA 1N6XA 3ELAH 5EG4A 1S81A 4YOJA 5JBCS 2D26C 1A5IA 2ZU1A 4ABJA 2PR3A 5FAHA 1SGFA 1PQ7A 2C8XB 3E3TA 1WSSH 1AUJA 1BUIA 1C5MD 2ILNA 4JK5A 1SLUB 2XOKD 1GHVH 1UW7A 3KL6A 1EFRD 2EI8A 1O3NA 2B0FA 3LC5A 3NK8A 4MQAA 2HWLB 5FCRA 1HJ9A 1SB1H 2W7UA 3GOVB 1JOUB 3Q3KA 2D2DA 1BMMH 1YM0A 4I86A 1ZZZA 1BMAA 4KTSA 3BN9A 1O5DH 1SGNE 3UQVA 3LC3A 3K65B 3BTTE 1ZSJA 2XBYA 3T5FH 2ZECA 4NIYA 3W1EA 1P2JA 1MU8B 1KMHB 1HRTH 1ZTKA 1OP8A 1O32A 3ITIA 1FI8A 2ZTYA 2BLOA 3WW7A 2GVFA 3AK5A 1LHCH 2BD5A 4QT8C 4FXGH 1GBCA 2ZU2A 3GICB 1T4VH 2L74A 5DPAA 1MBQA 2TPIZ 4AX9H 2EI7A 3T25A 1D6WA 2BDAA 1K21H 5A8YA 3V3MA 4CRBA 3DCLA 1SGDE 1FY5A 4I33A 4YO9A 1O3OA 2ZFQH 1GMCG 2ZHQH 1FY8E 2FXRA 3FN8A 2ZWLH 1O2GH 2AMDA 3BTQE 5GXPA 4WH8A 1AFQB 4E06H 2UUKB 1XMNB 3LKWA 3SU1A 2J98A 5DJ7A 2OBOA 1GHBG 1GI9B 1VITH 5FHTA 3VB7A 4Y76A 4YM9A 3QTVH 1AKSA 1JMOH 4FU7A 2V35A 4HFPB 3ZVDA 1JIRA 1MKXK 1GBBA 1OS8A 1CQQA 3RU4T 3ZVBA 2UUFB 2ZQ1A 1SHHB 4F48B 2DE9A 4JZEH 1YYY1 4YOIA 1H8ED 3MTYA 7GCHF 1GG6B 4K3JA 1C5YB 1THPB 4YZUA 1RIWB 3TK5A 5TJXA 2G5VA 1P2MA 3A83A 1W14U 1C1WH 1UTOA 1JIMA 1HB0B 5JBAS 4B76A 5CE1A 1HDTH 4YLUA 4IBLH 4TT3D 1SQTA 2J2UA 1TMBH 2TGTA 2XCFA 4DY7B 1GI2A 4LK4A 3S69A 5TCCA 2XWBI 3A81A 3N7OA 2P93A 2GDEH 1BBRK 1EJMA 2OC8A 3KGPA 4HGCA 4BTUB 3OSYA 3RXKA 3IG6B 1O5CB 1BHXB 3TGIE 5DP9A 2W7SA 3CNRA 3RLYH 1W10U 3N7EA 1FDPA 2XC4A 1EJNA 4D7GA 1FN6A 2H9HA 5HXFA 2L6OA 3SU0A 4OGYA 1WU1A 5E0HA 1AD8H 2BD4A 1JBUH 1DY9A 2VIPA 1F92A 1FONA 1GBLA 2KAIB 4CBNA 1TGBA 2JETB 1BRBE 1YPKH 4NGAH 4AGJA 4LZ1H 3GCHC 3M5NA 1Y3VA 5GIBA 3ZVFA 4X2XA 1ZLRA 4MPUA 1O2MA 5EQSA 4ZXXH 4R0IA 3ZIAD 2A32A 3V13A 1HJAC 4UFDH 3GISB 3UOUA 4INHA 2ZGXH 1O5GH 2FM2A 3CS7A 3ZZ6A 2YNBA 1NC6A 3VPKA 4ABFA 1GI6A 3KYFA 1CE5A 3ZVGA 3VFEA 5EW2H 3FKSD 1HV7A 1IQHA 1FPHH 4I31A 1AVWA 1P2NA 4P00A 4AB9A 4ASUD 4I7YH 5FBEA 4AYVB 1DPOA 3LJJA 4ZROA 1IQMA 1VZQH 3MI4A 3BIUH 3STIA 1GBFA 2Y5GA 3RXRA 3KYGA 1Y3YA 2BD8A 1CBWB 1ZPZA 1H9LB 3RXTA 3ZV8A 1XVOA 2PUXB 2VWOA 4Y8XA 1NN6A 4YXWD 1FV9A 1EZQA 3OE7D 3TPIZ 2VGCB 3MH6A 4ABEA 1GBIA 1PYTD 4AOQA 5LPRA 4YT6H 2R3UA 1QBOA 3E0NB 2O8MA 4UD9H 2RCEA 1C2GA 3T29A 4GLYA 2YMSD 3TGJE
chains in the Genus database with same CATH topology
4LXBH 3GDUA 1NFUA 3KQEA 3S9BA 4A5TS 1TGNA 2RG3A 1O2ZA 3C27B 3RXHA 4WXVA 4UFFH 1A7SA 1EX3A 1Y59T 1EOJA 1MAYA 8ESTE 1BTWA 3SI3H 3MHWU 3MU4A 3BTKE 1FY4A 1ABJH 1QL8A 1CGJE 2F9UA 3BG4C 2ZO3H 1UO6A 2NU4E 3MOCA 1Z8IB 1WTHD 1DVAH 1P2OA 1B5GH 1L1JA 1D6RA 1OXGA 2BLQA 2GTBA 2Z9LA 1BB0B 1WCZA 5AFYH 4IC6A 4I8KA 2GD4B 1SOTA 2VIWA 1UHBB 3MWIU 3ZZ8A 2GZ7A 1K22H 1XUHA 5JPMH 1GI3A 1E34B 5C1YA 3RXPA 4CRDA 3TGKE 4A1TA 4X6MA 8GCHG 3A7TA 1GI5A 3RXAA 4B71A 2ZFRH 2F9VA 4HZHA 3T2NA 1U6QA 3AASA 1YF4A 3GCTF 3RLWH 3EYDA 2J38A 2VU8E 1T8OA 2G4UA 4Z6AH 4OS7A 1P06A 2BDCA 5JB8S 1SLWB 1BCUH 3MO6A 5GCHF 4WF8A 1CGHA 3FP8E 1HLTH 1RFNA 3VB6A 3MU8A 4ZKNU 1Y5UT 3P92A 1TA2A 5FXLA 4X2YA 4KGAA 5EGMA 1NY22 5EOKA 3E6PH 1QL9A 3M3SA 1DT2A 4K5ZA 4CRGA 2FTLE 5C2ZA 3RXUA 1C1OA 1SFQB 1FAKH 1LHFH 1GWAA 2WUCA 2H5CA 1O2TA 1FPCH 1HCGA 3EDXB 1B7XB 3P8NA 2J34A 2ANMH 1C1QA 3OU0A 3A89A 3GY2A 1DUEA 3SU6A 2ZA5A 1K1LA 1MQ5A 3D65E 3SZNA 1BOQA 1HAIH 1GHAG 2PHBA 3OY5U 1EPTC 1F2SE 1EAWA 1BIOA 1TX7A 4MVNA 1GVLA 1OWIA 3EA7A 3OY6U 1SR5C 3DD2H 2NWNA 2G4TA 1HUTH 2XRCA 1DM4B 1V2MT 1D3QB 2TRMA 4O9VA 1ZHRA 2BVXH 1BTHH 2FDAA 1SLXB 4WVPE 4NFFA 4DG4A 3NZIA 2BY8X 3PV4A 4AZ2B 1BRCE 1C5NH 1C5PA 2FODA 1RS0A 5C5OA 4WMEA 3RMMH 5K0HA 4FUBA 4NSYA 3R0FA 3AAUA 1FY3A 2F91A 1PYTC 4XOJA 3GY3A 2GCHF 1LVMA 4E05H 3SU5A 1C5LH 1TPPA 5T6FA 1TBZH 3O8DA 1G3EA 1GBEA 2BM2A 2QIQA 2A1DB 4YOGA 1O2SA 3W94A 4ABGA 3FZZA 1VJAU 5A2MH 5EPNA 1EXFA 4OS1A 2ZFSA 1QNJA 2AMPA 4AFZA 2CHAB 3UNRA 1K1OA 1D3TB 3FVFB 4MNWA 4U01A 3ZZ9A 1OYTH 1A0LA 4JZ1A 1FJSA 3G01A 1Z8RA 3RMNH 1ZPCA 1MTSA 3GCNA 1BJUA 4OS5A 3FANA 1MTUA 3BTFE 2DUCA 4X6OA 3RXJA 1UVUH 1MZDA 5L30H 3U9AH 1BRAA 2PSYA 1YCPK 4X6PA 1SG8B 3M7UA 4IS5A 4UE7H 3SQEE 2HVXA 2IOTA 1K9OE 6GCHG 1NRPH 1P02A 2P8OB 4JMYA 1QRXA 3ATIA 3RXBA 5FCKA 1F0RA 3JZ1B 1MMJN 4AORA 4ABAA 5SGAE 4GSOA 2GCTB 1QRZA 1Q3XA 3P8OA 5DK1A 4UEHH 1RGQA 5CHAC 3URCA 1UVOA 2ZCLP 1O3PB 3AW0A 3K2UA 5DP3A 1MD7A 2O8TA 1G2MA 4LZ4B 1O3IA 4AB8A 1TBRH 2OLGA 1O30A 1ZJDA 2FOEA 4RKJB 2I6SA 4GCHF 1C5SA 4MPXA 1F5RA 1MD8A 3A88A 3VXEH 1TNLA 2RA0A 2A4OA 1YPHE 2F9BH 1O3LA 1LQDB 4MPVA 1FUJA 1P11E 2Q6FA 3C1KA 3UUZA 1PPHE 2FOMB 5EQQA 1KSNA 5PTPA 1KDQB 5JBBS 1QB9A 2ODYB 4INLA 2OQUA 1KLIH 4X1RU 1GGDB 1C5XB 4BAHB 1L0ZA 1CBWC 2NU3E 1AN1E 3ATMA 4NSVA 3A84A 4UFEH 2QGRA 4ISHH 1C5OH 2LPRA 4K8YA 1TNIA 3TITA 3Q3YA 3RXGA 1GL1A 2BD9A 1WUNH 2TIOA 4X1NU 5ABWA 2AGEX 2ZKSA 3DFJA 1QR3E 1TPAE 1TOCB 3F9HA 1NRRH 2BB4A 1EB1H 3E91A 1O3AA 1THSH 4D9QA 2VVCA 1C5QA 1OOKB 3M7QA 1IHTH 1G37A 2I6QA 3SNDA 4K69A 3HKIB 1ZGVA 5L2ZH 2ZEBA 1MKXH 2STAE 1AE5A 1V2OT 4VGCB 1DWCH 1UTNA 3BF6H 5JYIA 2AS9A 1UCYK 1ZSKA 3CS0A 1ETSH 1ZHMA 3SV6A 1GCTB 2R2WU 1V2KT 1SHYA 1VCWA 2JH5D 3PO1B 1C1NA 1LTOA 1Y3UA 1ARBA 2H9EH 5HM9A 1BMNH 1V2NT 4FUIA 1F5LA 2C4FH 3ODDA 3A7YA 2CJIA 2QCYA 4DVAU 3U8OH 3KQDA 5A09A 5EW1H 1M9UA 3MH4A 3H5CB 1WAYB 3M3VA 1O3KA 2EI6A 1ZGIA 5IYTA 3GY6A 1BBRH 1YC0A 2H9TH 1J14A 1BHXF 3O8BA 1H1BA 1HFDA 2BVRH 3M35A 2HGTH 1ZTJA 2BDGA 3SJ8A 4IMQA 1C5WB 1E38B 2C93B 3B8JA 1UCYE 3MH5A 1W13U 5DP8A 3TJVA 1O2OA 2V6NA 3PTBA 1O3JA 1VR1H 4O97A 1GBHA 1N8OB 1ELTA 3L33A 4OS4A 4Y7AA 2PFEA 5A8ZA 4CRAA 1Z71A 2P95A 1QA7A 1NFYA 1TNHA 4MTBA 2AYWA 2FYQA 3SO3A 1TLDA 2ZGCA 1K1MA 2GV7A 1DWDH 1HNEE 1SVPA 2A31A 3O8CA 2GT8A 1X7AC 3DFLA 3FZDA 3MMGA 1XUKA 1VCQA 3I77A 3UOPA 2CXVA 1DX5M 2WYJA 4Y6DA 4TPIZ 1OP2A 4JCNA 2GT7A 1YP9A 3FFGA 2SNWA 3M7TA 3ZZCA 2P3FH 3LU9B 2A5KA 2FLBH 3RC5A 2ZTZA 2P16A 2XC0A 2PGBB 5A0BA 1WTGH 1TMTH 4WJG2 1MZAA 1NU7B 2QV1A 2FEQH 1T31A 1C9PA 1QRWA 1V2QT 3D62A 2BX4A 1Y8TA 2BOKA 3RC6A 1A1RA 1E36B 2BLVA 1EAUA 2XBWA 1KXDA 3PMAB 2FYRA 3AVZA 3ATKA 3HK3B 1A0HB 1XKAC 4J2YB 1Q2WA 6CHAC 1Y3WA 1F0SA 1ELEE 1SGFG 2Z9JA 3ATLA 5AFZH 1ZOMA 2KAIA 4ZXYH 4CHAC 2P94A 3FAOA 1GJDB 1GHYH 2OC0A 3WY8A 3HPTB 4TY6A 2Y5FA 3T28A 3NKKA 1DOJA 1W0YH 2Q1JA 1O5FH 3S7KB 1ELVA 4CR5A 3MH7A 5LGOA 1GDNA 1MKWK 4THNH 1O2PA 2A45B 1O2LA 5BRRE 1VGCB 1P09A 3SI4H 2WV4A 8KME2 4NA8A 1NFWA 1TNJA 2A7JA 2FWWA 2PTNA 2EC9H 1GJ7B 2VH6A 2G55A 2FOGA 3S7HB 2YNAA 3E16B 4Y7BA 1V2WT 3SV7A 1P3EA 2TGDA 1THRH 4WXIA 2IN2A 1SGRE 4ZMAH 1W12U 1CO7E 1W11U 1Z7KA 1C5UA 3VGCC 2ZG0H 3TLOA 1GBMA 4ZUHA 3TH4H 2H1UA 2PTCE 1O38A 4I8GA 3PYHA 1GMDG 3EGKH 3KIDU 3A7XA 4AFQA 1JWTA 3TNTA 2BHGA 4YLQH 1L4ZA 2OP9A 1UK3A 3T26A 1ELAA 2QXJA 1ZYOA 5C67A 2ZGHA 3M5LA 3BTWE 3RXSA 1QFKH 1ZMNA 3LT3A 5ETXA 2Z3CA 3UPEA 3V7TA 1O2RA 4AFUA 4AFSA 1V2VT 2AIPA 3SU2A 2Q6GA 3P6ZB 2WPMS 5EQRA 2UUJB 1TOMH 1GHZA 1IQJA 4NWLA 1C1RA 1AB9C 1K28D 1O36A 2ZDMA 3HGNA 1F7ZA 1BBRE 4X0WU 1LCYA 1NU9A 1TX8A 3MNCA 5LH8A 3SHCH 1UHBA 3EA8A 2WPJS 1ORFA 3P17H 3LGTA 1O34A 2ANKH 2PKAB 2ZDVH 3UQOA 3QGJA 2WPKS 1QURH 1V2PT 1EAIA 4X8TH 3VXFH 1KLTA 1LHGH 1Z1IA 5J4SA 1CVWH 3TH3H 2PKSC 1C4V2 1UJ1A 2QF0A 2GZ8A 2A0QB 4Y0ZE 5F8TA 4AN7A 4NIXA 9LPRA 5DKMA 1NRQH 4LOYH 1K1JA 1EZXC 1PPEE 1P9SA 3UFAA 1P8VC 4UDWH 4DIIH 3M3TA 4H6SB 2ASUB 6ESTA 1SQAA 4DT7B 4BAKB 1Q31A 1TIOA 2GDDA 2OC1A 4BAQB 5I25A 1BZXE 3QZQA 3ZZBA 5GJ4B 1ZHPA 1O2YA 2A4QA 2THFB 3URDA 3SJKA 1RD3B 2ZGBH 4A92A 1SGCA 2F3CE 3PMBB 7GCHG 1HAXB 1JRSA 3P8GA 1GMHF 4Q2KA 1KXAA 3K6YA 2DE8A 3TJUA 3F9GA 1Z1JA 1K1IA 1QQUA 1UTKA 4JYUH 4E7NA 4FUFA 5FX5A 2J4IA 1TA6A 5C1XA 3PMHB 3S9AA 1O0DH 2J95A 1PQAA 1O37A 1TMUH 2EA3A 1GCTC 5AHGH 5I46H 5HM2A 3RC4A 1CT0E 7LPRA 2A4RA 3D23A 2BQ7B 1GJBB 2ZHDA 5F03A 5DO4H 3A7VA 1P9UA 3UIRA 1EAXA 3ATWA 3SU3A 1P2KA 4RN6A 1CA0B 1H4WA 2XYAA 1P57B 1AI8H 2FOBA 1HAZB 3ZVCA 1P2IA 3FP7E 3QDZB 4X1SU 1O3FA 1YCPH 2O9QA 1O3DA 3PROA 3MU1A 1ZPBA 2GMTC 2ZU4A 2XW9A 2ZZUH 1E0FD 4NZLA 2FX4A 1GJCB 2A2XH 2H5DA 2BZAA 4NIVA 1GDQA 3VB3A 2HOBA 1YPLH 2Y7XA 1OP0A 1SOZA 1AU8A 2BY9X 1GJ5H 1TPOA 1CHGA 1G30B 2GP9B 4ISNA 4RKOB 1TQ0B 3QZRA 3UR9A 1BJVA 1GJAB 4Y79A 1BITA 2ZNKH 5J4QA 2WPIS 1MCTA 3NCLA 3EA9A 1PPZA 3K6ZA 2PGQB 5GPIB 1LVBA 2BD3A 4ZKRU 1TNGA 2PSXA 1AZZA 3RXMA 1TB6H 1O2VA 2WUBA 2CF8H 3T62A 1FIWA 1S5SA 1O5BB 2ZPSA 2ZPRA 4GPGA 1AHTH 2ESTE 2XBXA 1PQ8A 4B2BA 3ZVEA 1G32B 1BRUP 1J16A 1KTSB 1AY6H 4JZDH 2HALA 1CHOF 4ASHA 1TAWA 1NM6A 1FLEE 1ELCA 2R2MB 1N1LA 4GHTA 1TYNA 4CRFA 1BMLA 1O2NA 1D4PB 2G8TA 3TU7H 1HXEH 1FMGA 2WYGA 1NT1A 3M5OA 2ZCKP 1T8NA 1HYLA 4FUGA 3B23B 1FNIA 2D1JA 2HNTC 1SMFE 3MFJA 3I78A 1BTZA 1O5EH 1C1UH 1ANCA 5JB9S 1VITF 2Z3EA 4SGAE 3NUMA 1GBDA 2WV5A 2Z94A 3SGAE 3JZ2B 2VWNA 3PWCA 2WPHS 1IQNA 2B8OH 2W3IA 3PLBA 4MNYA 4TPYA 4XSKU 4ABDA 1EQ9A 2OTVA 4BTIB 1UCYH 1UK2A 5IDKA 1AFQC 1ELFA 2F9PA 1HAYB 1FQ3A 1JRTA 3KCGH 1SPJA 1A5GH 1W7GH 1NO9H 3KEEA 1JXPA 3PM3A 1RRKA 4JK6A 5DP6A 3VB4A 1WOFA 1D3DB 5CMXH 1LVOA 2VNTA 2O8LA 2BLWA 2BY5X 4Z0KA 1E35B 1XVMA 1SLVB 3SU4A 4YTAA 2C8YB 2OINA 1IHSH 2AEIH 1O31A 2OXSA 1EP6A 2VB0A 5E0JA 3GCTG 2B7DH 3SN8A 3RXQA 5F6MA 1T32A 1GG6C 1KDQA 1L2EA 1XKBC 1KYNA 1UTJA 2GKVE 1RIWC 3RXLA 2FOCA 5H4IB 1P01A 4TYDA 5GCHG 1HAHH 2HNTE 1HGTH 4J1YA 5HGGA 1C5ZB 1Z8JB 2BY7X 3GDVA 1LMWB 5TCAA 1TGCA 2RDLA 1GDUA 4X1QU 3QK1A 3UY9A 1O3MA 2BXUH 1Y5AT 1G3BA 4MNVA 3BTME 1C2JA 3SQHE 1SGIB 1SI5H 1DFPA 3BIVH 1V2LT 1TX6A 1HIAB 1DWEH 2SGEE 2BTCE 3SGQE 1HXFH 1MTNB 1CT2E 1LPKB 2NU1E 1KLJH 1C2IA 1HBTH 1C1SA 1QL7A 1S0QA 2JETC 4PROA 1P3CA 3GCHB 3RXCA 2SGPE 3RXEA 4A7IB 1H9IE 1S84A 4ZKSU 1UMAH 4DOQA 2O8UA 2VWLA 4FVBA 1F5KU 3RU4D 1C4U2 1HJAB 1O35A 1ZSLA 3F6UH 3PMJA 1QJ1B 1WYKA 4NZQA 8LPRA 1MTWA 5T6GA 2Q6DA 4TY7A 1P03A 1RXPA 4BOHA 1DLKB 2VIVA 2V3OH 1O3HA 3A82A 1T8LA 3SJ9A 4YT7H 3ZZ7A 1AIXH 1LHEH 1AVXA 5EXLA 3ZZAA 4BNRA 2SFAA 3IITA 1C1PA 4Q7YA 1P0SH 1WBGB 4CH2B 4X8VH 5C3NA 2Z6BD 1UVTH 3BV9B 1HAOH 2VGCC 4A1VA 1KY9A 2BZ6H 3Q3XA 2PUQH 2K1QA 2NU2E 4KP0A 4IMZA 4I8JA 1QHRB 1IQFA 4NIWA 2GCHG 4WMFA 4O03A 1O2QA 1P2QA 3ESTA 1NRSH 1MKWH 1QQ4A 4JZFH 2TBSA 1LDTT 4U2WA 3KQCA 3AAVA 1G3CA 3R3GB 1TONA 2A7CA 1XUGA 4MG3A 2OBQA 2ZTXA 4WMDA 5F8XA 1BTYA 1ESAA 1KXEA 4HI3A 3LONA 1OWJA 3LGYA 1D3PB 1MUEB 3SUDA 1TRYA 4DGJA 1C5VA 3RXDA 4A1XA 4X2VA 3V12A 3AW1A 2A5AA 1T4UH 3LH3A 1ABIH 1C2EA 2FX6A 1GMCF 3BG4B 4ISLA 4X8SH 4CR9A 3PB1E 4ZHLU 3KN2A 4FVDA 4NFEA 1O3BA 4DIHH 2STBE