1FY3A

[g175q]hbp, a mutant of human heparin binding protein (cap37)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
225
structure length
219
Chain Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDQGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPARIN-BINDING PROTEIN
publication title Two mutants of human heparin binding protein (CAP37): toward the understanding of the nature of lipid A/LPS and BPTI binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 56
structure length 219
sequence length 225
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy3A02
4ZXXH 2A7JA 2BX3A 1G9IE 3MU4A 1BTWA 3MH6A 1ANDA 5FX6A 4H4FA 3PMJA 1V2RT 3MU8A 2PV9B 4JYVH 3T28A 3A7XA 1ZPBA 2GDDA 3TH4H 1LHGH 2VGCB 3SV7A 2BDAA 2A4OA 1O36A 2WPIS 4BAMB 1HAVB 4IN1A 1XUKA 3SU2A 3MO9A 1PJPA 1SLXB 3FAOA 3SU0A 4X8UH 1ZJKA 5E8EH 3RXGA 1Z8JB 3B23B 1EXFA 4INHA 1TAWA 3E0NB 4UDWH 2ZGXH 1S5SA 2JKHA 3GY7A 1TMBH 4AB9A 4NSVA 2GZ8A 1YGCH 1DANH 3MFJA 3MOCA 5SGAE 1XUGA 3S7KB 1EP6A 1FMGA 1RFNA 1BTUA 1V2MT 2Q6FA 5C5OA 2SGPE 1C1VH 2VIOA 3RXSA 1DT2A 2DUCA 5DPAA 2Y7ZA 5A0BA 2AMPA 1V6DA 2BLOA 2O8WA 2VU8E 3Q76A 3O8CA 1BJUA 5FPSA 5FHTA 4LZ1H 1IOEA 2A2QH 2J94A 2BMGB 2STBE 1GBFA 3VB6A 4X2XA 3VPKA 4QT8C 5FBEA 2G4UA 4INKA 2HLCA 1D3DB 2Z3CA 1LQDB 1TIOA 2OP9A 1AQ7A 1GMCF 5EPNA 1TOCB 4X6MA 4LXBH 1HUTH 1FI8A 2PSXA 3M5OA 2QGRA 1UMAH 2G52A 1FIZA 3ATLA 4FUBA 2F83A 1AFEH 1SI5H 5T6DA 1FN8A 3QX5H 3TPIZ 1S0RA 2PLXA 4AFUA 1OYTH 1Z7KA 3PO1C 1P09A 1IAUA 2YNBA 2FS8A 3DD2H 1KTTB 6GCHG 3LOXA 3E16B 1GJDB 1O5CB 2AMQA 3A80A 1SOZA 2G55A 1ZSKA 3ZZCA 3A7ZA 1GVLA 3RMLH 2KAIB 1Z71A 3F68H 1UJ1A 3RXMA 5E0GA 3V7TA 2BD2A 2YNAA 4ZKOU 2FOGA 2F9NA 2A4GA 2UWOA 2F9VA 2AGIX 4BTIB 1BBRE 3A87A 1MBQA 3BTFE 2P3FH 2FYRA 4GLYA 3A7WA 1G36A 2ILNA 3JZ2B 3LJOA 1VJAU 1GI4A 4AN7A 2BX4A 2OCVB 5GPIB 3A86A 2ZHQH 3UREA 3TVJB 4FUHA 1O2PA 1MKWK 1P9UA 3SO3A 3KGPA 1EJNA 1GI6A 1D6WA 5A8ZA 1UVOA 3K6YA 2H2ZA 2RG3A 1ANBA 4ISHH 1Q31A 5ESBA 4A5TS 1O3NA 2WV4A 5C20A 1ZSLA 1VCQA 3IWMA 4K1EA 3EE0B 2CXVA 2ODPA 3ZZ7A 1HAGE 1ZRBA 1SFIA 4O9VA 1Z1JA 3MNXA 3A81A 4A7IB 2BOHB 1MU8B 3FZDA 2GCTC 1GG6B 4JZFH 4CRBA 1W13U 1SPJA 2ZDAH 2VWOA 4E7NA 4CH8B 1O3DA 4Y11E 3UFAA 1OWKA 2H5CA 1NO9H 2NU3E 3LC3A 3QGNB 2BY7X 4D9QA 1P2MA 2W3KA 3VXEH 1CBWC 1EOJA 1L1NA 4OGYA 1P3CA 3KQCA 1BRAA 2QXHA 4NCYA 4Z6AH 5GJ4B 4ZHAA 3RMNH 5E2PA 4JCNA 1TE0A 4XSKU 1ID5H 3VGCC 3QWCH 1CA0C 2G5VA 3GCHC 1TMUH 2J34A 1P3EA 1SGDE 5E0JA 4D7GA 4THNH 1LPZB 1DWEH 5AFYH 1LHCH 4GCHF 1LKAA 5A8YA 1ELDE 1O35A 2GVFA 1UTJA 3OY6U 3PMHB 1UK4A 1ZHRA 3E90B 5GCHG 1RTKA 1MTUA 4WY3A 3S69A 2R9PA 3P8GA 4F49A 2FX6A 1C5QA 1ESAA 2ZTZA 1MKXK 3T26A 4OS1A 3P70B 2G8TA 1W7XH 4YTAA 1K2I1 4AGJA 1OP2A 1GMCG 2VH0A 3DFJA 2BD5A 3HGPA 4FXGH 2B0FA 1A3BH 4ISIH 4VGCC 1OP8A 2BLVA 1MBMA 3LGIA 1S84A 2BD7A 2GKVE 4Q7YA 1O5FH 5DGJA 1NM6A 1GBMA 1CGHA 1XMNB 2QN5T 1YC0A 1HJAB 3SV8A 1XKBC 1O3EA 1MKXH 4NIVA 4KP0A 1ACBE 2BVSH 3U9AH 2BXUH 3RXFA 1P8VC 5EXLA 5E0HA 1T32A 4NA7A 2P8OB 4AGKA 1MH0A 4CREA 1TA2A 4INLA 3ATWA 2GTBA 4JMYA 4K60A 1D3QB 1CQQA 2GMTB 1GMHF 1WV7H 2K1QA 2H9EH 1H9LB 1TABE 2Z9IA 4I8GA 1ELGA 3U98H 1A1RA 2ZDVH 2HNTC 2WPLS 1CT2E 1HJ8A 1O3HA 1SHYA 1DWDH 3O8RA 1HRTH 3EA9A 4E06H 5A0CA 1BTPA 1NFYA 2BLQA 5T6GA 3ZVGA 2Q1JA 3GDVA 1C5MD 4ESTE 1UTPA 1NC6A 2EI8A 4I8KA 3PMBB 1MAXA 3FZZA 1Y3YA 2ZTYA 2OC8A 2BZ6H 2FWWA 1PPBH 1F0SA 3MU0A 1GDNA 4ABGA 1JIRA 1K1OA 2C90B 1Z8RA 4MVNA 1TNGA 1VCWA 4NWLA 3FP8E 2JH5D 3SW2B 1ZTKA 4JZIA 2CV3A 4YT6H 3M7UA 1CT4E 2FO9A 2EA3A 4FUGA 1FY8E 1KLJH 2B5TB 3SJIA 1CE5A 1O5AB 1T4VH 1TALA 3UUZA 4IGDA 1M9UA 1LPKB 2TGDA 4CRFA 1TB6H 1FY3A 2J38A 1SGNE 2AIPA 1P05A 1RXPA 2TGAA 1ZOMA 1TRMA 3SGAE 1EATA 2ANWA 2BD4A 2AERH 4NZLA 1TWXB 1BBRK 1LVMA 2XBXA 1L1GA 1UVUH 2OQ5A 4FUJA 3AW1A 1S6FA 5LH8A 1Z8GA 1DXWA 1K9OE 3T29A 4B76A 2UUFB 1GBKA 1EJMA 1F5RA 1JOUB 4X1RU 2PUQH 3PMAB 1SSXA 1FPHH 1P2QA 2Y7XA 3N7OA 3RXEA 1T8LA 3KL6A 4DIHH 3ZVDA 1BMAA 1V2WT 1TX7A 1TONA 1GVKB 1VR1H 1HXEH 2BZAA 4UFFH 3KCGH 1HYLA 4RN6A 1BBRH 4GCHG 1WBGB 2Y81A 1G3CA 2QA9E 5IYTA 1GHBF 1QL7A 3SV2H 1Y5AT 3LC5A 1TX6A 1O2MA 4MPXA 1B0FA 1YPHE 1NT1A 4Q2KA 1OWIA 2QXIA 3GY8A 3SJ9A 2ZCLP 3RXIA 4TYDA 2XC5A 1OXGA 1ZZZA 3BTQE 1NS3A 1H9IE 2HNTF 5EU8A 2FI4E 2OD3B 4MPWA 3SUEA 2Z94A 2J2UA 1B5GH 2EEKA 4X6OA 3BG4B 4Y8XA 8KME2 2C3SA 1GI5A 1HDTH 4ZKSU 4YM9A 1FIWA 5AF9H 2TGTA 4XBCA 1PQAA 1ZTJA 2VVUA 2ZHEH 3ZVAA 3VFEA 4FU9A 1BJVA 1TMTH 4Y8ZA 4XFQA 4Q7ZA 5I25A 1EPTA 1ETSH 3LH1A 2H1UA 3EA8A 1SL3A 2IN2A 1YPJH 1C2GA 1GMHG 1MD7A 2FLBH 3A7TA 2ZFSA 3ATIA 1GBLA 1C9PA 2XBYA 2Y6TA 3SU1A 1C2MA 1X7AC 4YESB 4F4OC 1BUIA 2QV1A 2V3OH 1DUAA 2VWNA 4DW2U 4I31A 4X1SU 2AH4X 1VZQH 2ZHWH 4U2WA 3UNRA 1HAIH 1TGSZ 1VITH 1AD8H 4CR9A 3MTYA 1IQGA 2VVCA 2A7HA 2BD9A 2ZHDA 3OX7U 1JWTA 1LHEH 2ZO3H 5A0AE 3GY2A 4A1XA 3QO6A 1QR3E 1QBOA 3QUMP 4RKOB 1C1MA 1EZUC 4ABBA 1GDQA 2UWPA 1O3JA 4AYVB 3KQBA 1D9IA 3I29A 4OS5A 1NY22 3LGYA 3MH5A 1QJ1B 1AUJA 4DY7B 1C9TA 5DG6A 2FTMA 2VB0A 2B9LA 3HPTB 2ZFPH 1QA0A 2ZKSA 1Z6JH 4B75A 2CF8H 2VIPA 2B7DH 5LGOA 2V0BA 1DLKB 7GCHF 1O2GH 1PQ5A 1UTKA 3DHKH 3QTOH 4AFZA 1XX9A 2HVXA 4WMFA 4DIIH 1UHBA 1BZXE 1QHRB 2F9UA 4JZ1A 3SGQE 1N8OC 1O3OA 4CBNA 2RA3A 2AFQB 1C5YB 1UVPA 1OYQA 3GYLB 5HMAA 1EAXA 4K8BA 1TNIA 1O2JA 5A09A 3KNXA 1NROH 1MQ5A 5CMXH 1C4Y2 2SNVA 5T6FA 4B1TA 4TY7A 1HAXB 8GCHG 2C93B 4UE7H 4NG9H 2FODA 3E0PB 1O2ZA 1BDAA 3IG6B 1GBIA 3F9FA 3SGBE 2CMYA 1FLEE 3M7QA 2BDIA 4K8YA 5JBAS 3BTEE 2WYJA 2PSYA 2ZQ2A 1ELEE 1BT7A 4ISLA 5DP8A 1TBZH 1CVWH 5FPYA 1V2ST 1ZR0A 4IW4E 3ZZ5A 1O3AA 2R0KA 4H6SB 1ZJDA 1EKBB 2W5EA 1XKAC 2EI6A 2ZCKP 1EPTB 3WY8A 1GBJA 3CS7A 4GVUA 2R2MB 1ZSJA 4DG4A 4MLFB 2ANYA 1A3EH 2QCYA 1RD3B 5JBCS 3ZZ8A 2VIDA 4KKDA 1V2KT 2D1JA 1AVWA 1HAPH 2OTVA 4AFQA 4I8HA 2ZDMA 2WUCA 3GYMA 1A5HA 2Z7FE 2TBSA 1GI1A 3G01A 5JDUB 4KGAA 3MNBA 4O97A 1V2VT 2WPHS 1BHXF 4DT7B 1LVBA 3E6PH 3KHVA 5EXNA 3VB4A 4O3UA 1PYTD 4ABEA 3NK8A 1GBHA 1W12U 1PPHE 6CHAC 1NTPA 2PKAA 1CT0E 2BXTH 2F3CE 5DK1A 1WQVH 1AMHA 2AIQA 1E0FD 3CP7A 3ITIA 2GCTB 1O3GA 1ETRH 2VIWA 1HIAA 2ZP0H 3E3TA 1NRPH 1ELTA 1YPEH 1XVOA 2Y82A 1NRQH 3PYHA 1EUFA 1FXYA 5HYOA 3ZVFA 5L2ZH 4LZ4B 1O37A 1OWJA 3TU7H 1P2NA 3SI3H 3CENA 3RLWH 1C5WB 2FOMB 4TPIZ 2GT7A 1XUIA 3M36A 4Y0ZE 2Q6GA 1TOMH 4SGAE 1F0RA 1DPOA 1UHBB 3GDUA 3KEEA 3M5NA 1PQ7A 2PKSC 3DUXH 2CHAB 1C4U2 4K5ZA 2ZGCA 1ELFA 1H9HE 1LCYA 2AMDA 3LONA 1MUEB 1O34A 1C2KA 2R2WU 2C8YB 1E35B 1KXCA 3PWBA 1V2TT 1AZZA 2FI3E 4DJZB 4GHTA 7GCHG 1FN6A 2XCNA 3OU0A 2M5TA 4LK4A 2GGVB 1OPHB 1AWFH 4ZKNU 1JIMA 1GL0E 3NCLA 1NU7B 3SJ8A 1EAWA 1S6HA 3SV6A 2ZPSA 5ETXA 3ZV9A 3QGJA 4ZAEA 3M35A 1O3BA 4BAHB 3PLPA 3A7YA 1J17T 2TGPZ 1BRUP 3PLKA 4YZUA 2HPQH 4NGAH 2P94A 2C8ZB 4AORA 1LPGB 1FJSA 3P95A 3ENSB 4ZROA 3B8JA 1QQUA 1CGJE 2FYQA 4X1PU 2VWMA 3F9HA 1WYKA 1QTFA 3RU4T 1SLWB 1ELVA 2A1DB 1FV9A 1GBEA 4GPGA 5TCCA 3U1IB 1P2IA 3LH3A 4NA8A 1C5ZB 2PW8H 3E91A 3H7TA 1JRSA 4D76A 9ESTA 4B74A 3NXPA 1C2FA 1SLVB 4BOHA 5DP9A 2VNTA 2A45B 6ESTA 3RXHA 1FAXA 2ALPA 3RXPA 4AFSA 1D4PB 1AGJA 1QURH 1LQEA 5FXLA 3M61U 1QL9A 3HK6B 2ZGBH 1O5BB 1NZQH 1XUFA 1YCPK 3BF6H 2J9NA 4YT7H 5EPYA 4R0IA 2H5DA 1LTOA 4ZUHA 2ZU5A 1V2QT 1P12E 4CBOA 4I33A 3M7TA 2D26C 4BXWA 4Y8YA 1G3EA 1K1PA 1QRWA 1QB9A 2H9TH 3P6ZB 3TJUA 3ZZ9A 6LPRA 1MKWH 1KLTA 1F0UA 3I78A 3R0FA 2J95A 1AZ8A 2QYIA 1O5EH 2ZG0H 1Y3WA 2PKAB 3ZZ4A 1YLCA 4A1TA 2QXJA 3LDXH 1YCPH 2RCEA 2BQ7B 4CRGA 2WPKS 4FVDA 1FNIA 1TA6A 1QRZA 1IQEA 3PTBA 1CA8B 1HIAB 2ZQ1A 1OWDA 1KTSB 1TRYA 1UCYK 2GV7A 1SGIB 1C2JA 1QA7A 2LNCA 5DP7A 4DURA 1K1LA 5JBTA 4TWWA 2Z3EA 2Z9GA 2P93A 4JK5A 1TGTA 2I6SA 5DJ7A 4YO9A 3TITA 1ESBA 3IITA 2FPZA 3F1SB 3SNDA 1B7XB 3UNSA 4XBBA 1F0TA 3RXDA 1NU9A 3PM3A 1Y5UT 4H6TA 5EOKA 1O2XA 3AASA 4B2BA 1ZGVA 4OS7A 1HAZB 3BIUH 3L33A 4JZDH 1A0JA 3C1KA 4XDEA 3MNCA 1A0LA 1ZYOA 3ZVBA 1QCPA 1Z6EA 2BLWA 2FP7B 2ANKH 2D8WA 4I7YH 1HAHH 1TPPA 3RU4D 3BTGE 3ELAH 3OYPA 3BTDE 4B73A 3UIRA 2PGQB 2ZGJA 4CRCA 2GCHF 1KSNA 5LPFA 3FP7E 1G3DA 1YKTA 4Y7AA 1OKXA 3ZYEA 5DO4H 2F9PA 3OY5U 3SU5A 1XXDA 1S85A 1IQHA 1JXPA 4WVPE 1GMDF 3KIDU 4IBLH 4B2AA 5EQQA 1TFXA 1Y59T 1PQ8A 4HI3A 1NFWA 2ODYB 2ZEBA 4AX9H 4JZEH 1H1BA 2OBQA 3HK3B 1AU8A 1O2LA 3K65B 2HNTE 2F91A 1EP5A 1WTGH 2PFEA 1G3BA 3DFLA 1O2OA 1LO6A 1KXAA 1Q2WA 3GDSA 4HGCA 4X8SH 1CHOF 1K22H 1O3FA 3TK5A 2FEQH 3AAVA 1H8IH 2NU1E 1XM1A 3T25A 4XBDA 3TGJE 2Y5FA 1QB1A 2ZTXA 1LHDH 4CH2B 2VIVA 3LJJA 1P9SA 4B71A 1DY8A 2NWNA 3RXAA 1C1WH 1PYTC 1KYNA 3MO3A 5A2MH 3RDZA 1V2LT 1FY5A 1P06A 3T62A 5C2ZA 1GBAA 1E38B 3BEIB 2PUXB 3GY4A 3UY9A 5FBIA 1A7SA 2JETB 1GJAB 3P17H 1F5KU 5F6MA 1RRKA 3SBKA 1OWEA 1JRTA 3BV9B 4XOJA 1QJ6B 3P8NA 4I32A 7ESTE 4SGBE 5JPMH 2O8LA 3GCTF 3TNTA 1JMOH 1TBQH 1VGCB 3BG8A 3GCOA 1UO6A 1DY9A 5HM9A 1F7ZA 1O5GH 1QIXB 3A84A 3RXQA 3JZ1B 1GG6C 1P2KA 3NZIA 2Z3DA 1V2NT 3RC6A 3SNAA 5HXFA 4TPYA 2XC0A 1AVXA 4ZH8A 1Y3XA 5FAHA 1ARBA 1TQ7B 3TJVA 1A5GH 5JB9S 3LGVA 4CHAB 3A82A 3ZZAA 1GBBA 1KXEA 3PLBA 2C4FH 1GJCB 4FUDA 3GY5A 1EB2A 1MZDA 3SI4H 1WSSH 2BDHA 1O39A 1AFQB 2ZFQH 1K21H 3TIUA 1QY6A 3FVFB 2STAE 4OS6A 1GJ8B 5G4BA 1G30B 3LGWA 1F5LA 1DM4B 1RGQA 5L6NH 5CE1A 2FXRA 1D6RA 1O33A 1SG8B 2WINI 2GDEH 1T8MA 2BYAX 1NFUA 1TPAE 4ABIA 1GHVH 1G37A 1YBWA 1O38A 4OGXA 1N6YA 1TNKA 2G51A 5DP4A 1BB0B 2W7UA 1MCVA 5ESTE 2WYGA 2ODQA 1K1IA 1O2YA 1AUTC 1TGCA 1GBDA 2BDYA 1IQKA 2Z6BD 1L4DA 1C5TA 1O2KA 1THPB 4E05H 2ZA5A 2F9OA 2P3TB 4FUIA 2QY0B 1MTVA 4WXVA 2SFAA 1BMMH 2GCHG 3PTNA 3KF2A 2PTCE 2PGBB 3F9EA 2XWAA 1GGDB 1C1QA 1GMDG 2AGGX 2GV6A 1GI7B 1HJAC 4DVAU 3OTJE 3Q3KA 3U69H 4BANB 4WWYA 4M7GA 3A8AA 3Q3XA 5CHAB 4UONA 4K3JA 5FCKA 2P8OC 1MMJN 3UWJH 1CHGA 3STJA 1IQFA 1BIOA 3HATH 2F9BH 2GMTC 1DITH 1HNEE 1YP9A 4BTUB 4XE4A 2YOLA 3GY3A 3L6PA 4FUFA 3LU9B 2CGAA 3RP2A 2ZNKH 1QBNA 1LHFH 1CHOG 1GCTB 3P8FA 2SNWA 4WH8A 3SNBA 3ZYDA 3D23A 4NFEA 1AB9C 2HOBA 3RXLA 2BQWB 4KTSA 1YM0A 4AYYB 1DUEA 1NRSH 1GHZA 1VCPA 1K1JA 1C2EA 4KTUA 4WMDA 1ELAA 2ZU3A 3QK1A 1UTNA 1BQYA 1A0HB 3D62A 1W3CA 1K28D 1TNHA 2ZPRA 2GZ7A 3M5MA 3RC4A 3SJKA 3A8DA 2IPHA 1Y8TA 3K6ZA 3K2UA 3LIWA 3RXBA 1UTQA 1O2QA 1TPOA 1V2UT 2SGDE 3GCTG 4BAKB 3RC5A 3A8BA 3RMMH 2SGFE 1GCDA 1O31A 1PFXC 1O32A 3F6UH 3TH3H 1GBCA 1O2HA 2Z9LA 2BTCE 5F03A 4BAOB 2ZDNA 1UTLM 3MH7A 2O9QA 3U8TH 2G4TA 4ZMAH 3LPRA 1C1UH 1C4V2 3O8DA 3A88A 1IQIA 1W14U 1O3PB 2BQ6B 1C5UA 1H8DH 1FZZA 2G5NA 1HJ9A 2FZZA 1TX8A 1ZTLA 4UEHH 5HGGA 3MI4A 1DOJA 1GJ4H 3PWCA 4MPVA 4TY6A 4IC5A 2UWLA 1ZMNA 1GJ5H 1ZHMA 2XW9A 4Y0YE 1QNJA 1S82A 1W2KH 1QB6A 1QGFA 3V0XA 3S9BA 3S9CA 1DSTA 1KXDA 3LT3A 1ETTH 1HXFH 3A7VA 2ZFRH 2TRMA 2D2DA 5C3NA 3MO6A 1WOFA 2QC2A 4OS2A 1C1PA 5H4IB 4Y10E 1W7GH 2EC9H 1FUJA 4AG1A 3QZQA 1DFPA 3SUFA 2XRCA 1P2OA 1GHYH 3LGTA 4H42U 4OS4A 3RM0H 5PTPA 2ZCHP 1RIWC 1E37B 1T8NA 2ZC9H 1UVSH 4UD9H 2BHGA 1YPMH 2W7SA 1UVTH 3BN9A 1GHBG 1UTOA 4X1QU 1UCYE 3PO1B 5FX5A 1C5PA 1WUNH 1L0ZA 3SQEE 4X2VA 4Y71A 3U1JB 5EW1H 5C1XA 1AHTH 2BY5X 1HFDA 1MQ6A 2GZ9A 3URDA 1GI3A 2DE9A 5EQRA 1AI8H 4MPUA 3PV4A 1LMWB 1GHWH 1GI2A 2ZPQA 1O0DH 1SOTA 2A5KA 2ZFTA 4GUXA 3ZZ6A 3RXVA 3V3MA 1AE8H 1HBTH 1G2MA 3GY6A 3ZVEA 3F9GA 1QQ4A 4ABFA 4A92A 3DT0H 1Y3VA 1QL8A 3MYWA 4Q80A 3SHAH 1P04A 2BY6X 1SR5C 5F8XA 1AY6H 3Q77A 5AVDA 1SBWA 2RA0A 1EB1H 1OX1A 2FS9A 5JYIA 1DICA 3GOVB 2FM2A 1MTNC 1W11U 2FOCA 3BTTE 5FCRA 2C8XB 2CF9H 4MQAA 1AN1E 3PB1E 5BPEA 3BTKE 5DKMA 5B6OA 3VB5A 5K7RA 1ORFA 3SU6A 4NZQA 2AYWA 1TNLA 2ZIQH 2OBOA 3SUGA 1YPLH 2ZFFH 2XTTB 4A6LA 1WQSA 1O2IA 1P01A 2FOAA 5EW2H 2G81E 2BD8A 2SGEE 4K2YA 1FPCH 1FONA 2BDBA 2XNIA 1P03A 4CRAA 2GX4A 1SFQB 2QF0A 1C1TA 4NWKA 1IHSH 1KXBA 1HLTH 1ANEA 3ZV8A 1YYY1 2Y5HA 4NFFA 1ANCA 1CBWB 1YF4A 4Y76A 2TIOA 1GJ9B 2SGAA 3RXKA 4Q7XA 2AGEX 4I8LA 2A5AA 1FY1A 1C5RA 3VGCB 2JH6D 3UWIA 2ZF0H 2FI5E 1CA0B 1L2EA 4AG2A 1JBUH 3GCHB 2B8OH 3NUMA 1OP0A 4IN2A 2ZU4A 2BY9X 1A61H 5GCHF 1PPCE 3BEUA 2CJIA 1AO5A 1DWCH 1EOLA 3RMOH 5DP3A 3M3VA 4NSYA 5C1YA 1HV7A 3MU5A 4KTCA 1V2OT 5LPRA 4JYUH 1IHTH 1MCTA 1HPGA 4MNYA 1Y3UA 1CU1A 3FFGA 5FPTA 2G00A 1ZLRA 5EODA 4IMQA 3SU4A 1LVOA 1GHAF 2WUBA 1VJ9U 1PPFE 4R8TB 2OC1A 3A83A 3UQOA 1XUHA 2VWLA 4IS5A 4VGCB 1P0SH 4ZHMU 1DVAH 3ZZ3A 4HTCH 4IMZA 1DLEA 3MWIU 1TGNA 2XYAA 3EYDA 4GHQA 4DGJA 1BTZA 4DOQA 1BTHH 2RDLA 3E1XB 2FMJA 4FU8A 4ABAA 3QLPH 4U01A 1C5VA 1ESTA 1C2LA 1EPTC 2A7CA 2XXLA 3DA9B 1NFXA 3NWUA 4ISOA 1KXFA 1GI9B 1CO7E 4WF8A 1O3MA 5IDKA 3OSYA 1C2HA 1TQ0B 2AEIH 3BEFB 5L2YH 1ABJH 1T4UH 3S9AA 2C8WB 2VGCC 1A5IA 3E8LA 2OINA 1DXPA 1N1LA 1DE7H 4MDSA 2UUYA 3MU1A 1DX5M 2VINA 3SQHE 2Y80A 1A4WH 1O2NA 3TK6A 3Q3YA 1V2JT 4RKJB 5TCAA 1P57B 1UTMA 4K69A 2HWLB 2ZHFH 4X0WU 2IOTA 4O03A 1W0ZU 1SC8U 2OUAA 1Q3XA 3ATMA 4UFEH 3RXOA 1ABIH 1RS0A 3SHCH 2IJOB 3VEQB 3LGUA 3P92A 1SGCA 2ESTE 5E2OA 5C1UA 5JBBS 5HM2A 3UOUA 2BY8X 1SGRE 4WXIA 4YLQH 1EAIA 1DSUA 4D7FA 4AB8A 1IQMA 1Y5BT 3V12A 2QXGA 8ESTE 2PWXA 2LPRA 1BOQA 4CRDA 1OSSA 1E34B 1GDUA 2Y5GA 5J4SA 4Y79A 2A5IA 1C1RA 5EGMA 3UOPA 1WCZA 1UCYH 3L3TA 3MMGA 3TNSA 2XBWA 7LPRA 1O3LA 3EAJA 2Z9KA 1EASA 2R3YA 5DP6A 9LPRA 4YOJA 3AVZA 2CHAC 2BVXH 3M3TA 2FX4A 5JB8S 1BRBE 2THFB 1AVGH 1OOKB 5EQSA 3SNEA 1MD8A 4MTBA 3TK9A 4FVBA 3AW0A 3SV9A 2ZWLH 3O8BA 2HALA 1HAOH 2JH0D 1C5LH 2FOFA 3B9FH 4X8TH 1O2VA 1D3TB 5F8ZA 3EGKH 2ALVA 3RXTA 4Y6DA 2WPMS 3QZRA 4K1SA 1ARCA 4FUCA 2P59A 1GI0A 3EA7A 2PHBA 1NESE 2GD4B 4GSOA 1L1JA 3A85A 2A0QB 3GISB 3TJNA 1BTXA 3ATKA 1GHAG 3ESTA 1SQTA 2OC0A 2Z9JA 4ASHA 2J4IA 1P2JA 3S7HB 1BCUH 1O2UA 1TBRH 5J4QA 1Z8IB 1AKSA 1C1SA 1QRXA 8LPRA 1YLDA 2EI7A 1EJAA 2XBVA 1O30A 1MTWA 1KY9A 1MAYA 2PR3A 4NIWA 1KIGH 1GJ7B 1LKBA 1NPMA 1GJBB 1T7CA 1ELCA 1AE5A 1J8AA 4MG3A 3W94A 1ZHPA 2ZGHA 2Q6DA 3ZZDA 1SGFG 2PTNA 1FAKH 1IQNA 3HKIB 1O2WA 1AB9B 1KLIH 3VB3A 2QF3A 1U6QA 4ZXYH 3D49H 1OWHA 3EQ0H 4MNWA 1D3PB 4U32A 4ZKRU 4A1VA 2NU0E 3UTUH 3UQVA 2BB4A 1GBTA 3T27A 3RXCA 7KMEH 4X2YA 1W0YH 1LDTT 1HGTH 3SUDA 3PROA 5GXPA 5TJXA 2VJ1A 1IQJA 1RTLA 2O8UA 3HGNA 1S81A 1SGQE 2P95A 4MNXA 4BXSA 1G32B 2A32A 3S0NA 1SGFA 2R0LA 2WPJS 3KQDA 2BDGA 4I8JA 4AZ2B 1H4WA 1QBVH 1ZPCA 3U8OH 1WTHD 2ZI2H 5EG4A 3SOSA 5ABWA 1PPZA 2V3HH 3QTVH 1BITA 1BHXB 4X8VH 1KDQA 1TGBA 1W8BH 4DCDA 4BTTB 1P10A 5C5NA 4NIXA 2OC7A 1B0EA 1P11E 1VITF 2BVRH 1PPGE 2XCFA 3W95A 1AIXH 1SGTA 3P8OA 4WMEA 4ABHA 3H5CB 2J92A 4YOIA 1N6XA 1AWHB 3BTHE 1BMNH 4J1YA 1THSH 4D8NA 1C2DA 2W26A 1L4ZA 1YPKH 3TH2H 2V35A 2O8MA 4O3TA 1HCGA 1WAYB 3ODFA 2NU2E 1MU6B 1CSOE 1FY4A 4TWYA 3TJOA 1T8OA 3KN2A 2ZDLA 4WH6A 1N8OB 4NIYA 1SQAA 4FU7A 1SB1H 1HAYB 4X6PA 8GCHF 4YOGA 4B2CA 3URCA 2HGTH 2WV5A 1ZRKA 2P16A 4YLUA 1RTFB 3KQEA 1O3IA 3A8CA 3A89A 3SN8A 1IQLA 1C1NA 1EZSC 1INCA 1DDJA 2FOHA 2A4QA 1XVMA 2UUKB 1RIWB 5DP5A 3ZVCA 3TLOA 4CR5A 2BD3A 1EAUA 1W10U 4BNRA 1ELBA 1SGYE 1GHXH 3GICB 1WU1A 1MZAA 1O2SA 1TRNA 4FUEA 4ZHLU 1V2PT 4AOQA 2AS9A 2FESH 2R3UA 4NA9H 1ZMJA 1CGIE 2HPPH 1AKSB 1O3KA 2FLRH 4Y7BA 1J16A 1YPHC 2BDCA 5I46H 5LPEA 1XUJA 3STIA 3RM2H 3BIVH 4X1NU 5AHGH 3RXRA 3MHWU 2VIQA 1QJ7B 1FDPA 1GWAA 3MNSA 1NN6A 5A8XA 4U30A 2VH6A 1LVYA 3LKWA 2JETC 2OLGA 2H9HA 1BRCE 3V13A 1GI8B 1MTSA 3UR6A 3I77A 4UFDH 3VB7A 1O5DH 1K1NA 1EZXC 1GJ6A 5C67A 1C1OA 3BSQA 3R3GB 1VGCC 1SHHB 4HZHA 1C5NH 1TYNA 3TGKE 1J15A 2ZZUH 3RU4E 4ABJA 4LOYH 5GDSH 2A31A 1YCPM 3K9XB 2BM2A 1G2LA 3RXUA 1DS2E 1OS8A 1Z1IA 5K0HA 4GAWA 3D65E 2QIQA 1HAVA 1MTNB 2FDAA 3C27B 4IC6A 2I6QA 1EX3A 2GP9B 2FIRH 4UFGH 3M37A 1A46H 3ZZBA 1PPEE 3BTME 3ODDA 6CHAB 5GWZA 1SVPA 2CN0H 1ZPZA 4J2YB 2P3UB 4JK6A 5AFZH 3RXJA 4E7RG 1P02A 1UK3A 1KDQB 1TPSA 3CS0A 2A4RA 3SU3A 4X6NA 3TGIE 3FANA 1SGEE 4PROA 2ZECA 3T2NA 4CHAC 1SLUB 2FOEA 1O3CA 1E36B 2XWBI 1S83A 1C5XB 2VVVA 1UK2A 4Z0KA 3UR9A 2V6NA 3NKKA 3HKJB 1A2CH 1AFQC 2TPIZ 3H7OA 1J9CH 2QAAA 4MNVA 5GIBA 1GVZA 3Q00A 2XC4A 1TNJA 2GT8A 4D9RA 2ASUB 2BOKA 4RSPA 2ULLA 1TLDA 3EDXB 3UNQA 2W3IA 1XXFA 1VITG 1S0QA 1EQ9A 4HFPB 3M3SA 3UPEA 2ZU1A 4BAQB 2PKSB 3QDZB 1O2TA 2ZDKA 4WJG2 1K1MA 2OXSA 3MH4A 1BA8B 3GCNA 4KELA 4X2WA 4ABDA 1ZGIA 2SGQE 6GCHF 2FOBA 1J14A 1V3XA 1QFKH 1RJXB 2UUJB 1SQOA 3AAUA 3M5LA 4ISNA 1GGDC 2FTLE 3FP6E 3QN7A 1NRRH 1GPZA 1SGPE 1F92A 4K1TA 4JYTA 5L30H 2A2XH 2ZU2A 3SJOA 1HB0B 1ZMLA 2O8TA 1FQ3A 2DE8A 1SMFE 2ANMH 5BRRE 3BG4C 1BMLA 5CHAC 2HRVA 3BTWE 3NPSA 5F8TA 1GL1A 1T31A 1C5SA 2KAIA 1EZQA 5EXMA 3U8RH 3RUOA 3RLYH 3SZNA 1O2RA 1THRH 3SNCA 3VXFH 2OQUA 3T5FH 1YPGH 5T3HA 1DWBH 1NRNH 1C5OH 1GCTC 1BTYA 3SORA 1F2SE 2NU4E 2H6MA 1C2IA
chains in the Genus database with same CATH superfamily
4RT0A 4ZXXH 2A7JA 2BX3A 1G9IE 3MU4A 1BTWA 3MH6A 1ANDA 5FX6A 4H4FA 3PMJA 1V2RT 3MU8A 2PV9B 4JYVH 3T28A 5DN6D 3A7XA 1ZPBA 2GDDA 3TH4H 2J5UA 1LHGH 2VGCB 3SV7A 2BDAA 2A4OA 1O36A 2WPIS 4BAMB 1HAVB 4IN1A 1XUKA 3SU2A 3MO9A 4Q63A 1PJPA 1SLXB 3FAOA 3SU0A 4X8UH 1ZJKA 5E8EH 3RXGA 1Z8JB 3B23B 1EXFA 4INHA 1TAWA 3E0NB 4UDWH 2ZGXH 1S5SA 2JKHA 3GY7A 1TMBH 4AB9A 4NSVA 2KCYA 2GZ8A 1YGCH 1DANH 3MFJA 3MOCA 5SGAE 2V7QD 1XUGA 3S7KB 1EP6A 1FMGA 1RFNA 5KECA 1BTUA 1V2MT 2Q6FA 5C5OA 2SGPE 1C1VH 2VIOA 3RXSA 1DT2A 2DUCA 5DPAA 2Y7ZA 5A0BA 2AMPA 1V6DA 2BLOA 2O8WA 1W0JD 2VU8E 3Q76A 3O8CA 1BJUA 5FPSA 5FHTA 4LZ1H 1IOEA 2A2QH 2J94A 2BMGB 2STBE 4XD7D 1GBFA 3VB6A 4X2XA 3VPKA 4QT8C 5FBEA 2G4UA 4INKA 2HLCA 1D3DB 2Z3CA 1LQDB 1TIOA 2KX4A 2OP9A 1AQ7A 1GMCF 5EPNA 1TOCB 4X6MA 4LXBH 1HUTH 1FI8A 2PSXA 3M5OA 2QGRA 1UMAH 2G52A 1FIZA 3ATLA 4FUBA 2F83A 1AFEH 1SI5H 5T6DA 1FN8A 3QX5H 3TPIZ 1S0RA 2PLXA 4AFUA 1OYTH 1Z7KA 3PO1C 1P09A 1IAUA 2YNBA 2FS8A 3DD2H 1KTTB 6GCHG 3LOXA 3E16B 1GJDB 1O5CB 2AMQA 3A80A 1SOZA 2G55A 1ZSKA 3ZZCA 3A7ZA 1GVLA 3RMLH 2KAIB 1Z71A 3F68H 1UJ1A 1YWUA 3RXMA 2JIZD 5E0GA 3V7TA 2BD2A 3OE7D 2YNAA 4ZKOU 2FOGA 2F9NA 2A4GA 5FL7D 2UWOA 2F9VA 2AGIX 4BTIB 1UW7A 1BBRE 3A87A 1MBQA 3BTFE 2P3FH 2FYRA 4GLYA 3A7WA 1G36A 2ILNA 3JZ2B 3LJOA 1VJAU 1GI4A 4AN7A 2BX4A 2OCVB 5GPIB 3A86A 2ZHQH 5KEDA 3UREA 3TVJB 4FUHA 1O2PA 1MKWK 1P9UA 3SO3A 3KGPA 1EJNA 1GI6A 1D6WA 5A8ZA 1UVOA 3K6YA 2H2ZA 2RG3A 1ANBA 2YMSB 2XOKD 4ISHH 1Q31A 5ESBA 4A5TS 5C94A 1O3NA 2WV4A 5HIYA 5C20A 1ZSLA 1VCQA 3IWMA 4K1EA 3EE0B 2CXVA 2ODPA 3ZZ7A 1HAGE 1ZRBA 1SFIA 4O9VA 1Z1JA 3MNXA 3A81A 4A7IB 2BOHB 3SZEA 1MU8B 2KZ4A 3FZDA 2GCTC 1GG6B 4JZFH 4CRBA 1W13U 1SPJA 2ZDAH 2VWOA 4E7NA 4CH8B 1O3DA 4Y11E 3UFAA 1OWKA 2H5CA 1NO9H 2NU3E 3LC3A 3QGNB 2BY7X 4D9QA 1P2MA 2W3KA 2KM0A 3VXEH 1CBWC 1EOJA 1L1NA 4OGYA 1P3CA 3KQCA 1BRAA 2QXHA 4NCYA 4Z6AH 5GJ4B 4ZHAA 3RMNH 3GS9A 4JCNA 5E2PA 1TE0A 4XSKU 1ID5H 3VGCC 3QWCH 1CA0C 2G5VA 3GCHC 1TMUH 2J34A 1P3EA 1SGDE 5E0JA 4D7GA 4THNH 1LPZB 1DWEH 5AFYH 1LHCH 4GCHF 1LKAA 5A8YA 1ELDE 1O35A 2GVFA 1UTJA 3OY6U 3PMHB 1UK4A 1ZHRA 3E90B 5GCHG 1RTKA 1MTUA 4WY3A 3S69A 2R9PA 3P8GA 4F49A 2FX6A 1C5QA 1ESAA 2ZTZA 1MKXK 3T26A 4OS1A 3P70B 2G8TA 1W7XH 4YTAA 1K2I1 4AGJA 1OP2A 3PRBA 1GMCG 2VH0A 3DFJA 2BD5A 3HGPA 4FXGH 2B0FA 1A3BH 4ISIH 4VGCC 1OP8A 2BLVA 1MBMA 3LGIA 1S84A 2BD7A 2GKVE 4Q7YA 1O5FH 5DGJA 1NM6A 1GBMA 1CGHA 1XMNB 2QN5T 1YC0A 1HJAB 3SV8A 1XKBC 1O3EA 1MKXH 4NIVA 4KP0A 1ACBE 2BVSH 3U9AH 2BXUH 2QE7D 3RXFA 1P8VC 5EXLA 5E0HA 1T32A 4NA7A 2P8OB 1SQRA 4AGKA 1MH0A 4CREA 1TA2A 4INLA 3OTPA 3ATWA 2GTBA 4JMYA 4K60A 1D3QB 1CQQA 2GMTB 1GMHF 1WV7H 2K1QA 2H9EH 1H9LB 1TABE 2Z9IA 4I8GA 1ELGA 3U98H 1A1RA 2ZDVH 2HNTC 2WPLS 1CT2E 1HJ8A 1O3HA 1SHYA 1DWDH 3O8RA 1HRTH 3EA9A 4E06H 5A0CA 1BTPA 1NFYA 2BLQA 5T6GA 3ZVGA 2Q1JA 3GDVA 1C5MD 4ESTE 1UTPA 1NC6A 2EI8A 4I8KA 3PMBB 1MAXA 3FZZA 1Y3YA 2ZTYA 2OC8A 3OFND 2BZ6H 2FWWA 1PPBH 1F0SA 3MU0A 1GDNA 4ABGA 2LELA 1JIRA 1K1OA 2C90B 1Z8RA 4MVNA 1TNGA 1VCWA 4NWLA 3FP8E 3N7DA 2JH5D 3SW2B 3AK5A 1ZTKA 4JZIA 2CV3A 4YT6H 3M7UA 1CT4E 2FO9A 2EA3A 2HVYB 4FUGA 1FY8E 1KLJH 2B5TB 3SJIA 1CE5A 1O5AB 1T4VH 1TALA 3UUZA 2GJGA 4IGDA 1KMHB 2RDEA 1M9UA 1LPKB 2TGDA 4CRFA 1TB6H 1FY3A 2J38A 1SGNE 2AIPA 1P05A 1RXPA 2TGAA 1ZOMA 1TRMA 3SGAE 1EATA 2ANWA 2BD4A 2AERH 4NZLA 3UB0A 1TWXB 1BBRK 1LVMA 2XBXA 1L1GA 1UVUH 2OQ5A 4FUJA 3AW1A 1S6FA 5LH8A 1Z8GA 1DXWA 1K9OE 3T29A 4B76A 2UUFB 1GBKA 1EJMA 1F5RA 1JOUB 4X1RU 2PUQH 3PMAB 1SSXA 1FPHH 1P2QA 2Y7XA 3N7OA 3RXEA 1T8LA 3KL6A 4DIHH 3ZVDA 1BMAA 1V2WT 1TX7A 1TONA 1GVKB 1VR1H 1HXEH 2BZAA 4UFFH 3KCGH 1HYLA 4RN6A 1BBRH 4GCHG 1WBGB 2Y81A 1G3CA 2QA9E 5IYTA 1GHBF 1QL7A 3SV2H 1Y5AT 3LC5A 1TX6A 1O2MA 4MPXA 1B0FA 1YPHE 1NT1A 4Q2KA 1OWIA 2QXIA 3GY8A 3SJ9A 2ZCLP 3RXIA 4TYDA 2XC5A 1OXGA 1ZZZA 3BTQE 1NS3A 1H9IE 2HNTF 5EU8A 2FI4E 4FOUC 2OD3B 4MPWA 3SUEA 2Z94A 2J2UA 1MABB 1B5GH 2EEKA 4X6OA 3BG4B 4Y8XA 2K0QA 8KME2 2C3SA 1GI5A 1HDTH 4ZKSU 4YM9A 1FIWA 5AF9H 2TGTA 4XBCA 1PQAA 1ZTJA 2VVUA 2ZHEH 3ZVAA 3VFEA 4FU9A 1BJVA 1TMTH 4Y8ZA 4XFQA 4Q7ZA 4P02A 5I25A 1EPTA 1ETSH 3LH1A 2H1UA 3EA8A 1SL3A 2IN2A 1YPJH 1C2GA 1GMHG 1MD7A 2FLBH 3A7TA 2ZFSA 3ATIA 1GBLA 1C9PA 2XBYA 2Y6TA 3SU1A 1C2MA 1X7AC 4YESB 4F4OC 1BUIA 2QV1A 2V3OH 1DUAA 2VWNA 4DW2U 4I31A 4X1SU 2AH4X 1BMFD 1VZQH 2ZHWH 4U2WA 3UNRA 1HAIH 1TGSZ 1VITH 1AD8H 4CR9A 3MTYA 1IQGA 2VVCA 2A7HA 2BD9A 2ZHDA 3OX7U 1JWTA 1LHEH 2ZO3H 5A0AE 3GY2A 4A1XA 3QO6A 1QR3E 1QBOA 3QUMP 4RKOB 1C1MA 1EZUC 4ABBA 1GDQA 2UWPA 1O3JA 4AYVB 3KQBA 1D9IA 3I29A 4OS5A 1NY22 3LGYA 3MH5A 1QJ1B 1AUJA 4DY7B 1C9TA 4B6FA 5DG6A 2FTMA 2VB0A 2B9LA 3HPTB 2ZFPH 1QA0A 2ZKSA 1Z6JH 4B75A 2CF8H 2VIPA 2B7DH 5LGOA 2V0BA 1DLKB 7GCHF 1O2GH 1PQ5A 1UTKA 3DHKH 3QTOH 4AFZA 1XX9A 2HVXA 4WMFA 4DIIH 1UHBA 1BZXE 1QHRB 2F9UA 4JZ1A 3SGQE 1N8OC 1O3OA 4CBNA 2RA3A 2AFQB 5C17A 1C5YB 1UVPA 1OYQA 3GYLB 5HMAA 1EAXA 5EJLA 4K8BA 1TNIA 1O2JA 5A09A 3KNXA 1NROH 1MQ5A 5CMXH 1C4Y2 2SNVA 5T6FA 4B1TA 4TY7A 4RT1A 1HAXB 8GCHG 2C93B 4UE7H 4NG9H 2FODA 3E0PB 1O2ZA 1BDAA 3IG6B 1GBIA 3F9FA 2LP6A 3SGBE 2HLDD 2CMYA 1FLEE 3M7QA 2BDIA 4K8YA 5JBAS 3BTEE 2WYJA 2PSYA 2ZQ2A 1ELEE 1BT7A 4ISLA 5DP8A 1TBZH 1CVWH 5FPYA 1V2ST 1E1QD 1ZR0A 4IW4E 3ZZ5A 1O3AA 2R0KA 4H6SB 1ZJDA 1EKBB 2W5EA 1XKAC 2EI6A 2ZCKP 1EPTB 3WY8A 1GBJA 3CS7A 4GVUA 2R2MB 2M2AA 3KYFA 1ZSJA 4DG4A 4MLFB 2ANYA 1A3EH 2QCYA 1RD3B 5JBCS 3ZZ8A 3FKSD 2VIDA 1K0HA 4KKDA 1V2KT 2D1JA 1AVWA 4ACAA 1HAPH 2OTVA 4AFQA 3FO8D 2ZDMA 2WUCA 4I8HA 3GYMA 1A5HA 2Z7FE 2TBSA 1GI1A 3G01A 5JDUB 4KGAA 3MNBA 4O97A 1V2VT 2WPHS 1BHXF 4DT7B 1LVBA 3E6PH 3KHVA 5EXNA 3VB4A 4O3UA 1WXRA 1PYTD 2AHME 4ABEA 3NK8A 1GBHA 1W12U 1PPHE 3WW7A 6CHAC 1NTPA 2PKAA 1CT0E 2BXTH 2F3CE 5DK1A 1WQVH 1AMHA 2AIQA 1E0FD 3CP7A 3ITIA 2GCTB 2YMSD 1O3GA 1ETRH 2VIWA 1HIAA 2ZP0H 3E3TA 1NRPH 1ELTA 1YPEH 1XVOA 2Y82A 1NRQH 3PYHA 1EUFA 1FXYA 5HYOA 3ZVFA 5L2ZH 4LZ4B 1O37A 1OWJA 3TU7H 1P2NA 3SI3H 3CENA 3RLWH 1C5WB 2FOMB 4TPIZ 2GT7A 1XUIA 3M36A 4Y0ZE 2Q6GA 1TOMH 4SGAE 1F0RA 1DPOA 1UHBB 3GDUA 3KEEA 3M5NA 1PQ7A 2PKSC 3DUXH 2CHAB 1C4U2 4K5ZA 2ZGCA 1ELFA 1H9HE 1LCYA 2AMDA 3LONA 1MUEB 1O34A 1C2KA 2R2WU 2C8YB 1E35B 1KXCA 3PWBA 1V2TT 1AZZA 2FI3E 4DJZB 4GHTA 7GCHG 1FN6A 2XCNA 3OU0A 2M5TA 4LK4A 2GGVB 1OPHB 1AWFH 4ZKNU 1JIMA 1GL0E 3NCLA 1NU7B 3SJ8A 3ZIAD 1EAWA 1S6HA 3SV6A 2ZPSA 5ETXA 4DT4A 3ZV9A 3QGJA 4ZAEA 3WWFA 3M35A 1O3BA 4BAHB 3PLPA 3A7YA 1J17T 2TGPZ 1BRUP 3PLKA 4YZUA 2HPQH 4NGAH 2P94A 2C8ZB 4AORA 1LPGB 1FJSA 3P95A 3ENSB 5F53A 4ZROA 3B8JA 1QQUA 1CGJE 2FYQA 4X1PU 2VWMA 3F9HA 1WYKA 1QTFA 3RU4T 1SLWB 1ELVA 2A1DB 1FV9A 1GBEA 4GPGA 5TCCA 3U1IB 1P2IA 3LH3A 4NA8A 1C5ZB 2PW8H 3E91A 3H7TA 1JRSA 4D76A 9ESTA 4B74A 3PV5A 3NXPA 2WV9A 1C2FA 1SLVB 4BOHA 5DP9A 2VNTA 2A45B 6ESTA 3RXHA 1FAXA 2ALPA 3RXPA 4AFSA 1D4PB 1AGJA 1QURH 1LQEA 5FXLA 3U28C 3M61U 1QL9A 3HK6B 2ZGBH 1O5BB 1NZQH 1XUFA 1YCPK 3BF6H 2J9NA 4YT7H 5EPYA 4R0IA 2H5DA 1LTOA 4ZUHA 2ZU5A 1V2QT 1P12E 4CBOA 4I33A 3M7TA 2D26C 4BXWA 4Y8YA 1G3EA 1K1PA 1QRWA 1QB9A 2H9TH 3P6ZB 3TJUA 3ZZ9A 6LPRA 1MKWH 1KLTA 1F0UA 3I78A 3R0FA 2J95A 1AZ8A 2QYIA 1O5EH 2ZG0H 1Y3WA 2PKAB 3ZZ4A 1YLCA 4A1TA 2QXJA 3LDXH 1YCPH 2RCEA 2BQ7B 4CRGA 2WPKS 4FVDA 3KQ5A 1FNIA 1TA6A 1QRZA 1IQEA 3PTBA 1CA8B 1HIAB 2ZQ1A 1OWDA 1KTSB 1TRYA 1UCYK 2GV7A 1SGIB 1C2JA 1QA7A 2LNCA 5DP7A 4DURA 1K1LA 5JBTA 4TWWA 2Z3EA 2Z9GA 2P93A 4JK5A 1TGTA 2I6SA 5DJ7A 4YO9A 3TITA 1ESBA 3IITA 2FPZA 3F1SB 3SNDA 1B7XB 3UNSA 4XBBA 1F0TA 3RXDA 1NU9A 3PM3A 1Y5UT 4H6TA 5EOKA 1O2XA 3AASA 4B2BA 1ZGVA 4OS7A 1HAZB 3BIUH 3L33A 4JZDH 1A0JA 3C1KA 4XDEA 3MNCA 1A0LA 1ZYOA 3ZVBA 1QCPA 1Z6EA 2PP6A 2BLWA 2FP7B 2ANKH 2D8WA 4I7YH 1HAHH 1TPPA 3RU4D 3BTGE 3ELAH 3OYPA 3BTDE 4B73A 3UIRA 3F2GA 2PGQB 2ZGJA 2IPQX 4CRCA 2GCHF 1KSNA 5LPFA 3FP7E 1G3DA 2JDID 1YKTA 4Y7AA 1OKXA 3ZYEA 2EY4C 5DO4H 2F9PA 3OY5U 3SU5A 1XXDA 1S85A 1IQHA 4OM9A 1JXPA 4WVPE 1GMDF 3KIDU 4IBLH 4B2AA 5EQQA 1TFXA 1Y59T 1PQ8A 4HI3A 1NFWA 2ODYB 2ZEBA 4AX9H 4JZEH 1H1BA 2OBQA 3HK3B 1AU8A 1O2LA 2J98A 3K65B 2HNTE 2F91A 1EP5A 1WTGH 2PFEA 1G3BA 3DFLA 1O2OA 1LO6A 1KXAA 1Q2WA 3DSGA 3GDSA 4HGCA 1CHOF 1K22H 4X8SH 1O3FA 3TK5A 2FEQH 3AAVA 1H8IH 2NU1E 1XM1A 3T25A 4XBDA 3TGJE 2Y5FA 1QB1A 2ZTXA 1LHDH 4CH2B 2VIVA 3LJJA 1P9SA 2KFWA 4B71A 1DY8A 2NWNA 3VG8A 3RXAA 1C1WH 1PYTC 1KYNA 3MO3A 5A2MH 3RDZA 1V2LT 1FY5A 1P06A 3T62A 5C2ZA 1GBAA 1E38B 3BEIB 2PUXB 3GY4A 3UY9A 5FBIA 1A7SA 4B6EA 2JETB 1GJAB 3P17H 1F5KU 2OK5A 1RRKA 5F6MA 2YMSC 3SBKA 1OWEA 3DCLA 1JRTA 3BV9B 4XOJA 1QJ6B 3P8NA 4I32A 7ESTE 4SGBE 5EJZA 5JPMH 2O8LA 3GCTF 3TNTA 1JMOH 1TBQH 2WZQA 1VGCB 3BG8A 3GCOA 1UO6A 1DY9A 5HM9A 1F7ZA 1O5GH 1QIXB 3A84A 3RXQA 3JZ1B 1GG6C 2KCOA 1P2KA 3NZIA 1E79D 2Z3DA 1V2NT 3RC6A 3SNAA 5HXFA 4TPYA 2XC0A 1AVXA 4ZH8A 1Y3XA 5FAHA 3N7EA 1ARBA 1TQ7B 2QF4A 3TJVA 1A5GH 2L6OA 5JB9S 3LGVA 4CHAB 3A82A 3ZZAA 1GBBA 1KXEA 3PLBA 2C4FH 1GJCB 4FUDA 3GY5A 1EB2A 1MZDA 5CDFE 3SI4H 1WSSH 2BDHA 1O39A 1AFQB 2ZFQH 1K21H 3TIUA 1QY6A 3FVFB 2STAE 4OS6A 1GJ8B 5G4BA 1G30B 3LGWA 1F5LA 1DM4B 1RGQA 5L6NH 5CE1A 2FXRA 1D6RA 1O33A 1SG8B 2WINI 2GDEH 1T8MA 2BYAX 3CNRA 1NFUA 1TPAE 4ABIA 1GHVH 1G37A 1YBWA 1O38A 4OGXA 1N6YA 1TNKA 2G51A 5DP4A 1BB0B 2W7UA 1MCVA 5ESTE 2WYGA 2ODQA 1K1IA 1O2YA 1AUTC 1TGCA 1GBDA 2BDYA 1IQKA 2Z6BD 1L4DA 1C5TA 1O2KA 1THPB 4E05H 2ZA5A 2F9OA 2P3TB 4FUIA 2QY0B 1MTVA 4WXVA 2SFAA 1BMMH 2GCHG 3PTNA 3KF2A 2PTCE 2PGBB 1H8HD 3F9EA 2J98B 2XWAA 1GGDB 1OHHD 1C1QA 1GMDG 2AGGX 2GV6A 1GI7B 1HJAC 4DVAU 3OTJE 3Q3KA 3U69H 4BANB 3DSPA 4WWYA 4M7GA 3A8AA 3Q3XA 5CHAB 4UONA 4K3JA 5FCKA 2P8OC 1MMJN 3UWJH 1CHGA 4ASUD 3STJA 1IQFA 1BIOA 3HATH 1VKYA 2F9BH 2GMTC 1E1RD 1DITH 1HNEE 1YP9A 4BTUB 4XE4A 2YOLA 3GY3A 3L6PA 4FUFA 3LU9B 2CGAA 3RP2A 2ZNKH 4TSFD 1H8ED 1LHFH 1CHOG 1GCTB 1QBNA 2SNWA 3P8FA 4WH8A 3SNBA 3ZYDA 3D23A 2KCPA 4I86A 4NFEA 1AB9C 2HOBA 3RXLA 2BQWB 4KTSA 1YM0A 4AYYB 1DUEA 1NRSH 1GHZA 1VCPA 1K1JA 1C2EA 4KTUA 4WMDA 1ELAA 2ZU3A 3QK1A 1UTNA 2K8IA 1BQYA 1A0HB 2W6ID 3D62A 1W3CA 1K28D 1TNHA 2ZPRA 2GZ7A 3M5MA 3RC4A 3SJKA 2WSSD 3A8DA 2IPHA 4F55A 1Y8TA 3K6ZA 3K2UA 3LIWA 3RXBA 1UTQA 1O2QA 1TPOA 1V2UT 2SGDE 3GCTG 4BAKB 3RC5A 5T1VA 3A8BA 3RMMH 2SGFE 1GCDA 1O31A 1PFXC 1O32A 3F6UH 3TH3H 1GBCA 1O2HA 2Z9LA 2BTCE 5F03A 4BAOB 2ZDNA 1UTLM 4AC9A 2L74A 3MH7A 2O9QA 3U8TH 2G4TA 4ZMAH 3LPRA 1C1UH 1C4V2 3O8DA 3A88A 1IQIA 1W14U 1O3PB 2BQ6B 1C5UA 1H8DH 1FZZA 3OEED 2G5NA 1HJ9A 2FZZA 1TX8A 1ZTLA 4UEHH 5HGGA 3MI4A 1DOJA 1GJ4H 3PWCA 4MPVA 4TY6A 4IC5A 2UWLA 1ZMNA 1GJ5H 1ZHMA 2XW9A 4Y0YE 1QNJA 1S82A 1W2KH 1QB6A 1QGFA 3V0XA 3S9BA 3S9CA 1DSTA 1KXDA 3LT3A 1ETTH 1HXFH 3A7VA 2ZFRH 2TRMA 2D2DA 5C3NA 3MO6A 1WOFA 2QC2A 4OS2A 1C1PA 5H4IB 4Y10E 1W7GH 2EC9H 1FUJA 4AG1A 3QZQA 1DFPA 3N99A 3SUFA 2XRCA 1P2OA 1GHYH 3LGTA 4H42U 4OS4A 3RM0H 5PTPA 2ZCHP 1FX0B 3KYGA 1RIWC 1E37B 1T8NA 2ZC9H 2JJ2D 1UVSH 4UD9H 2BHGA 1YPMH 2W7SA 1UVTH 3BN9A 1GHBG 1UTOA 4X1QU 1UCYE 3PO1B 5FX5A 1C5PA 1WUNH 1L0ZA 3SQEE 4X2VA 4Y71A 2VBCA 3U1JB 5EW1H 5C1XA 1AHTH 2BY5X 1HFDA 1MQ6A 2GZ9A 3URDA 5EIYA 1GI3A 2DE9A 5EQRA 1AI8H 4MPUA 3PV4A 1LMWB 1GHWH 1GI2A 2ZPQA 1O0DH 1SOTA 2A5KA 2ZFTA 4GUXA 3ZZ6A 3RXVA 3V3MA 1AE8H 1HBTH 1G2MA 3GY6A 3ZVEA 3F9GA 1QQ4A 4ABFA 4A92A 3DT0H 1Y3VA 1QL8A 3MYWA 5EJ1A 4Q80A 3SHAH 2QF5A 1P04A 2BY6X 1SR5C 5F8XA 1AY6H 3Q77A 5AVDA 1SBWA 2RA0A 1EB1H 1OX1A 2FS9A 5JYIA 1DICA 3GOVB 2FM2A 1MTNC 1W11U 2FOCA 3BTTE 5FCRA 2C8XB 2CF9H 4MQAA 1AN1E 3PB1E 5BPEA 3BTKE 5DKMA 5B6OA 3VB5A 5K7RA 3SYJA 1ORFA 3SU6A 4NZQA 2AYWA 1TNLA 2ZIQH 2OBOA 3SUGA 1YPLH 2ZFFH 2XTTB 4A6LA 1WQSA 1O2IA 1P01A 2FOAA 5EW2H 2G81E 2BD8A 2SGEE 4K2YA 1FPCH 1FONA 2BDBA 2XNIA 4TT3D 1P03A 4CRAA 2GX4A 1SFQB 2QF0A 1C1TA 3FOAA 4NWKA 1IHSH 1KXBA 3PV2A 1HLTH 2EQNA 1ANEA 3ZV8A 1YYY1 2Y5HA 4NFFA 1ANCA 1CBWB 1YF4A 4Y76A 2TIOA 1GJ9B 2SGAA 2WPDD 3RXKA 4Q7XA 2AGEX 5DSFA 4I8LA 5B6LA 2A5AA 1FY1A 1C5RA 3VGCB 2JH6D 3UWIA 2ZF0H 2FI5E 1CA0B 2F4LA 1S6LA 1L2EA 4AG2A 1JBUH 3GCHB 2B8OH 3NUMA 5CHBA 1OP0A 3F0OA 4IN2A 2ZU4A 2BY9X 2CK3D 1A61H 5GCHF 1PPCE 3BEUA 2CJIA 1AO5A 1DWCH 1EOLA 3RMOH 5DP3A 3M3VA 4NSYA 5C1YA 1HV7A 3MU5A 4KTCA 1V2OT 5LPRA 4JYUH 1IHTH 1MCTA 1HPGA 4MNYA 1Y3UA 1CU1A 3FFGA 5FPTA 2G00A 1ZLRA 5EODA 4IMQA 3SU4A 1LVOA 1GHAF 2WUBA 1VJ9U 1PPFE 4R8TB 2OC1A 3A83A 3UQOA 1XUHA 2VWLA 4IS5A 4VGCB 1P0SH 4ZHMU 1DVAH 3ZZ3A 4HTCH 4IMZA 1DLEA 3MWIU 1TGNA 2XYAA 3EYDA 4GHQA 4DGJA 1BTZA 4DOQA 1BTHH 2RDLA 3E1XB 2IJD1 2FMJA 4FU8A 4ABAA 3QLPH 4U01A 1C5VA 1ESTA 1C2LA 1EPTC 2A7CA 2XXLA 3NRLA 3DA9B 1NFXA 3NWUA 4ISOA 1KXFA 4FETA 1GI9B 1CO7E 4WF8A 1O3MA 4HG6A 5IDKA 3OSYA 1C2HA 1TQ0B 2AEIH 3BEFB 5L2YH 1YY3A 1ABJH 1T4UH 3S9AA 2C8WB 2VGCC 1A5IA 4P00A 3F2HA 3E8LA 2OINA 1DXPA 1N1LA 1DE7H 4MDSA 2UUYA 3MU1A 1DX5M 2VINA 3SQHE 2Y80A 1A4WH 1O2NA 3TK6A 3Q3YA 1V2JT 4RKJB 3PRDA 5TCAA 1P57B 1UTMA 4K69A 2HWLB 2ZHFH 4X0WU 2IOTA 4O03A 1W0ZU 1SC8U 2OUAA 1Q3XA 3ATMA 4UFEH 3RXOA 1ABIH 1RS0A 1YLNA 3SHCH 2IJOB 3VEQB 3LGUA 3P92A 1SGCA 2ESTE 5E2OA 5C1UA 5JBBS 5HM2A 3UOUA 2BY8X 1SGRE 4WXIA 4YLQH 1EAIA 1DSUA 4D7FA 4AB8A 1IQMA 5C0TA 1Y5BT 3V12A 2QXGA 8ESTE 2PWXA 2LPRA 1BOQA 4CRDA 1OSSA 1E34B 1GDUA 2Y5GA 3H09A 2V3MA 5J4SA 4Y79A 2A5IA 1C1RA 5EGMA 3UOPA 1WCZA 1UCYH 3L3TA 3MMGA 3TNSA 2XBWA 7LPRA 3DSOA 1O3LA 3EAJA 2Z9KA 1EASA 2R3YA 5DP6A 9LPRA 4YOJA 3AVZA 2W6JD 2CHAC 2BVXH 3M3TA 2FX4A 1SKYE 5JB8S 1BRBE 2THFB 4RI0A 1AVGH 1OOKB 5EQSA 3SNEA 1MD8A 4MTBA 5IK2D 3TK9A 4FVBA 3AW0A 3SV9A 2ZWLH 3O8BA 4XRNA 5HKKD 2HALA 1HAOH 2JH0D 1C5LH 2FOFA 3B9FH 4X8TH 1O2VA 1D3TB 5F8ZA 3EGKH 2ALVA 3RXTA 4Y6DA 2WPMS 3QZRA 4K1SA 1ARCA 4FUCA 2P59A 1GI0A 3EA7A 2PHBA 1NESE 2GD4B 4GSOA 1L1JA 3A85A 2A0QB 3GISB 3TJNA 3F3BA 1BTXA 3ATKA 1GHAG 3ESTA 1SQTA 2OC0A 2Z9JA 4ASHA 2J4IA 1P2JA 3S7HB 1BCUH 1O2UA 1TBRH 4F48B 5J4QA 1Z8IB 1AKSA 1C1SA 1QRXA 8LPRA 1YLDA 1NBMD 2EI7A 1EJAA 2XBVA 1O30A 1MTWA 1KY9A 1MAYA 2PR3A 4NIWA 1KIGH 1GJ7B 1LKBA 1NPMA 1GJBB 1T7CA 1ELCA 4ACBA 1AE5A 1J8AA 4MG3A 3W94A 1ZHPA 2ZGHA 2Q6DA 3ZZDA 1SGFG 2PTNA 1FAKH 1IQNA 3WWBA 3HKIB 1O2WA 1AB9B 1KLIH 3VB3A 2QF3A 1U6QA 4ZXYH 3D49H 1OWHA 3EQ0H 2RFKC 4MNWA 1D3PB 4U32A 4ZKRU 4A1VA 2NU0E 3UTUH 3UQVA 2BB4A 1GBTA 3T27A 3RXCA 7KMEH 4X2YA 1W0YH 1LDTT 1EFRD 1HGTH 3SUDA 3PROA 5GXPA 5TJXA 2VJ1A 1IQJA 1RTLA 2O8UA 3HGNA 1S81A 1SGQE 2P95A 4MNXA 4BXSA 1G32B 2A32A 3S0NA 1SGFA 2R0LA 2WPJS 3KQDA 2BDGA 4I8JA 4AZ2B 1H4WA 1QBVH 1ZPCA 3U8OH 1WTHD 2ZI2H 5EG4A 3SOSA 5ABWA 1PPZA 2V3HH 3QTVH 1BITA 1BHXB 4X8VH 1KDQA 1TGBA 1W8BH 4DCDA 4BTTB 1P10A 5C5NA 4NIXA 2OC7A 1B0EA 1P11E 1VITF 2BVRH 1PPGE 2XCFA 3F2FA 3W95A 1AIXH 5KGOA 1SGTA 3P8OA 4WMEA 4ABHA 3H5CB 2J92A 4YOIA 1N6XA 1AWHB 3BTHE 1BMNH 4J1YA 3OAAD 1THSH 4D8NA 1C2DA 2W26A 1L4ZA 1YPKH 5HIZA 3TH2H 2J97A 2V35A 2O8MA 4O3TA 1HCGA 1WAYB 3ODFA 2NU2E 1MU6B 1CSOE 1FY4A 4TWYA 3TJOA 2WHXA 1T8OA 3KN2A 2ZDLA 4WH6A 1N8OB 1WDIA 4NIYA 1SQAA 4FU7A 1SB1H 1HAYB 4X6PA 8GCHF 4YOGA 4B2CA 3URCA 2HGTH 2WV5A 1ZRKA 2P16A 4YLUA 1RTFB 3KQEA 1O3IA 3A8CA 3A89A 3SN8A 1IQLA 1C1NA 2JJ1D 1EZSC 1INCA 1DDJA 2FOHA 2A4QA 2KR7A 1XVMA 2UUKB 1RIWB 5DP5A 3ZVCA 3TLOA 4CR5A 2BD3A 1EAUA 1W10U 4BNRA 1ELBA 1SGYE 1GHXH 3GICB 1WU1A 1MZAA 1O2SA 1TRNA 4FUEA 4ZHLU 1V2PT 4AOQA 2AS9A 3OEHD 2FESH 2R3UA 4NA9H 2KCAA 1ZMJA 1CGIE 2HPPH 1AKSB 1O3KA 2FLRH 4Y7BA 1J16A 1YPHC 2BDCA 5I46H 5LPEA 3UAIC 1XUJA 3STIA 3RM2H 3EE7A 3BIVH 4X1NU 5AHGH 3RXRA 3MHWU 2VIQA 4Z1MD 1QJ7B 1FDPA 1GWAA 3MNSA 1NN6A 5A8XA 4U30A 2VH6A 1LVYA 3LKWA 2JETC 3F0PA 2OLGA 2H9HA 3MQKC 1BRCE 3V13A 1GI8B 1MTSA 4Q4LA 3UR6A 3I77A 4UFDH 3VB7A 1O5DH 4M9FA 1K1NA 5C0UA 1EZXC 1GJ6A 3FN8A 5C67A 1C1OA 3BSQA 3R3GB 1VGCC 1SHHB 4HZHA 1C5NH 1TYNA 3TGKE 1J15A 2ZZUH 3RU4E 4ABJA 4LOYH 5GDSH 2A31A 1YCPM 3K9XB 2BM2A 1G2LA 3RXUA 1DS2E 1OS8A 1Z1IA 5K0HA 4GAWA 3D65E 2QIQA 1HAVA 1MTNB 2FDAA 3C27B 4IC6A 2I6QA 1EX3A 2GP9B 2FIRH 4UFGH 1COWD 3M37A 1A46H 3ZZBA 1PPEE 3BTME 3ODDA 6CHAB 5GWZA 1SVPA 2CN0H 1ZPZA 4J2YB 2P3UB 4JK6A 5AFZH 3RXJA 4E7RG 1P02A 1UK3A 1KDQB 1TPSA 1W0KD 3CS0A 2A4RA 3SU3A 4X6NA 3TGIE 3FANA 1SGEE 4PROA 2ZECA 3T2NA 4CHAC 1SLUB 2FOEA 1O3CA 4YXWD 1E36B 2XWBI 1S83A 1C5XB 2VVVA 1UK2A 4Z0KA 3UR9A 2V6NA 4ZCNA 3NKKA 3HKJB 1A2CH 1AFQC 2TPIZ 3H7OA 1J9CH 2QAAA 4MNVA 5GIBA 1GVZA 3Q00A 2XC4A 1TNJA 2GT8A 4D9RA 2ASUB 2BOKA 4RSPA 2ULLA 1TLDA 3EDXB 3UNQA 2W3IA 1XXFA 1VITG 1S0QA 1EQ9A 4HFPB 3M3SA 3UPEA 2ZU1A 4BAQB 2PKSB 3QDZB 1O2TA 2ZDKA 1NBME 4WJG2 1K1MA 2OXSA 3MH4A 1BA8B 3GCNA 4KELA 4X2WA 4ABDA 1ZGIA 2SGQE 6GCHF 2FOBA 1J14A 1V3XA 1QFKH 1RJXB 2UUJB 1SQOA 3AAUA 3M5LA 3W1EA 4ISNA 1GGDC 2FTLE 3FP6E 3QN7A 1NRRH 1GPZA 1SGPE 1F92A 2F43B 4K1TA 4JYTA 5L30H 2A2XH 2ZU2A 3SJOA 1HB0B 1ZMLA 2O8TA 1FQ3A 2DE8A 1SMFE 2ANMH 5BRRE 3BG4C 1BMLA 5CHAC 2HRVA 3BTWE 5GNDA 3NPSA 5F8TA 1GL1A 1T31A 1C5SA 2XNDD 2KAIA 1EZQA 5EXMA 3U8RH 3RUOA 3RLYH 3SZNA 1O2RA 1THRH 3SNCA 3VXFH 2OQUA 3T5FH 1YPGH 5T3HA 1DWBH 1NRNH 1C5OH 1GCTC 1BTYA 3SORA 1F2SE 2NU4E 1QZ8A 2H6MA 1C2IA
chains in the Genus database with same CATH topology
4ZXXH 2A7JA 2BX3A 1G9IE 3MU4A 1BTWA 3MH6A 1ANDA 5FX6A 4H4FA 3PMJA 1V2RT 3MU8A 2PV9B 4JYVH 3T28A 3A7XA 1ZPBA 2GDDA 3TH4H 1LHGH 2VGCB 3SV7A 2BDAA 2A4OA 1O36A 2WPIS 4BAMB 1HAVB 4IN1A 1XUKA 3SU2A 3MO9A 1PJPA 1SLXB 3FAOA 3SU0A 4X8UH 1ZJKA 5E8EH 3RXGA 1Z8JB 3B23B 1EXFA 4INHA 1TAWA 3E0NB 4UDWH 2ZGXH 1S5SA 2JKHA 3GY7A 1TMBH 4AB9A 4NSVA 2GZ8A 1YGCH 1DANH 3MFJA 3MOCA 5SGAE 1XUGA 3S7KB 1EP6A 1FMGA 1RFNA 1BTUA 1V2MT 2Q6FA 5C5OA 2SGPE 1C1VH 2VIOA 3RXSA 1DT2A 2DUCA 5DPAA 2Y7ZA 5A0BA 2AMPA 1V6DA 2BLOA 2O8WA 2VU8E 3Q76A 3O8CA 1BJUA 5FPSA 5FHTA 4LZ1H 1IOEA 2A2QH 2J94A 2BMGB 2STBE 1GBFA 3VB6A 4X2XA 3VPKA 4QT8C 5FBEA 2G4UA 4INKA 2HLCA 1D3DB 2Z3CA 1LQDB 1TIOA 2OP9A 1AQ7A 1GMCF 5EPNA 1TOCB 4X6MA 4LXBH 1HUTH 1FI8A 2PSXA 3M5OA 2QGRA 1UMAH 2G52A 1FIZA 3ATLA 4FUBA 2F83A 1AFEH 1SI5H 5T6DA 1FN8A 3QX5H 3TPIZ 1S0RA 2PLXA 4AFUA 1OYTH 1Z7KA 3PO1C 1P09A 1IAUA 2YNBA 2FS8A 3DD2H 1KTTB 6GCHG 3LOXA 3E16B 1GJDB 1O5CB 2AMQA 3A80A 1SOZA 2G55A 1ZSKA 3ZZCA 3A7ZA 1GVLA 3RMLH 2KAIB 1Z71A 3F68H 1UJ1A 3RXMA 5E0GA 3V7TA 2BD2A 2YNAA 4ZKOU 2FOGA 2F9NA 2A4GA 2UWOA 2F9VA 2AGIX 4BTIB 1BBRE 3A87A 1MBQA 3BTFE 2P3FH 2FYRA 4GLYA 3A7WA 1G36A 2ILNA 3JZ2B 3LJOA 1VJAU 1GI4A 4AN7A 2BX4A 2OCVB 5GPIB 3A86A 2ZHQH 3UREA 3TVJB 4FUHA 1O2PA 1MKWK 1P9UA 3SO3A 3KGPA 1EJNA 1GI6A 1D6WA 5A8ZA 1UVOA 3K6YA 2H2ZA 2RG3A 1ANBA 4ISHH 1Q31A 5ESBA 4A5TS 1O3NA 2WV4A 5C20A 1ZSLA 1VCQA 3IWMA 4K1EA 3EE0B 2CXVA 2ODPA 3ZZ7A 1HAGE 1ZRBA 1SFIA 4O9VA 1Z1JA 3MNXA 3A81A 4A7IB 2BOHB 1MU8B 3FZDA 2GCTC 1GG6B 4JZFH 4CRBA 1W13U 1SPJA 2ZDAH 2VWOA 4E7NA 4CH8B 1O3DA 4Y11E 3UFAA 1OWKA 2H5CA 1NO9H 2NU3E 3LC3A 3QGNB 2BY7X 4D9QA 1P2MA 2W3KA 3VXEH 1CBWC 1EOJA 1L1NA 4OGYA 1P3CA 3KQCA 1BRAA 2QXHA 4NCYA 4Z6AH 5GJ4B 4ZHAA 3RMNH 5E2PA 4JCNA 1TE0A 4XSKU 1ID5H 3VGCC 3QWCH 1CA0C 2G5VA 3GCHC 1TMUH 2J34A 1P3EA 1SGDE 5E0JA 4D7GA 4THNH 1LPZB 1DWEH 5AFYH 1LHCH 4GCHF 1LKAA 5A8YA 1ELDE 1O35A 2GVFA 1UTJA 3OY6U 3PMHB 1UK4A 1ZHRA 3E90B 5GCHG 1RTKA 1MTUA 4WY3A 3S69A 2R9PA 3P8GA 4F49A 2FX6A 1C5QA 1ESAA 2ZTZA 1MKXK 3T26A 4OS1A 3P70B 2G8TA 1W7XH 4YTAA 1K2I1 4AGJA 1OP2A 1GMCG 2VH0A 3DFJA 2BD5A 3HGPA 4FXGH 2B0FA 1A3BH 4ISIH 4VGCC 1OP8A 2BLVA 1MBMA 3LGIA 1S84A 2BD7A 2GKVE 4Q7YA 1O5FH 5DGJA 1NM6A 1GBMA 1CGHA 1XMNB 2QN5T 1YC0A 1HJAB 3SV8A 1XKBC 1O3EA 1MKXH 4NIVA 4KP0A 1ACBE 2BVSH 3U9AH 2BXUH 3RXFA 1P8VC 5EXLA 5E0HA 1T32A 4NA7A 2P8OB 4AGKA 1MH0A 4CREA 1TA2A 4INLA 3ATWA 2GTBA 4JMYA 4K60A 1D3QB 1CQQA 2GMTB 1GMHF 1WV7H 2K1QA 2H9EH 1H9LB 1TABE 2Z9IA 4I8GA 1ELGA 3U98H 1A1RA 2ZDVH 2HNTC 2WPLS 1CT2E 1HJ8A 1O3HA 1SHYA 1DWDH 3O8RA 1HRTH 3EA9A 4E06H 5A0CA 1BTPA 1NFYA 2BLQA 5T6GA 3ZVGA 2Q1JA 3GDVA 1C5MD 4ESTE 1UTPA 1NC6A 2EI8A 4I8KA 3PMBB 1MAXA 3FZZA 1Y3YA 2ZTYA 2OC8A 2BZ6H 2FWWA 1PPBH 1F0SA 3MU0A 1GDNA 4ABGA 1JIRA 1K1OA 2C90B 1Z8RA 4MVNA 1TNGA 1VCWA 4NWLA 3FP8E 2JH5D 3SW2B 1ZTKA 4JZIA 2CV3A 4YT6H 3M7UA 1CT4E 2FO9A 2EA3A 4FUGA 1FY8E 1KLJH 2B5TB 3SJIA 1CE5A 1O5AB 1T4VH 1TALA 3UUZA 4IGDA 1M9UA 1LPKB 2TGDA 4CRFA 1TB6H 1FY3A 2J38A 1SGNE 2AIPA 1P05A 1RXPA 2TGAA 1ZOMA 1TRMA 3SGAE 1EATA 2ANWA 2BD4A 2AERH 4NZLA 1TWXB 1BBRK 1LVMA 2XBXA 1L1GA 1UVUH 2OQ5A 4FUJA 3AW1A 1S6FA 5LH8A 1Z8GA 1DXWA 1K9OE 3T29A 4B76A 2UUFB 1GBKA 1EJMA 1F5RA 1JOUB 4X1RU 2PUQH 3PMAB 1SSXA 1FPHH 1P2QA 2Y7XA 3N7OA 3RXEA 1T8LA 3KL6A 4DIHH 3ZVDA 1BMAA 1V2WT 1TX7A 1TONA 1GVKB 1VR1H 1HXEH 2BZAA 4UFFH 3KCGH 1HYLA 4RN6A 1BBRH 4GCHG 1WBGB 2Y81A 1G3CA 2QA9E 5IYTA 1GHBF 1QL7A 3SV2H 1Y5AT 3LC5A 1TX6A 1O2MA 4MPXA 1B0FA 1YPHE 1NT1A 4Q2KA 1OWIA 2QXIA 3GY8A 3SJ9A 2ZCLP 3RXIA 4TYDA 2XC5A 1OXGA 1ZZZA 3BTQE 1NS3A 1H9IE 2HNTF 5EU8A 2FI4E 2OD3B 4MPWA 3SUEA 2Z94A 2J2UA 1B5GH 2EEKA 4X6OA 3BG4B 4Y8XA 8KME2 2C3SA 1GI5A 1HDTH 4ZKSU 4YM9A 1FIWA 5AF9H 2TGTA 4XBCA 1PQAA 1ZTJA 2VVUA 2ZHEH 3ZVAA 3VFEA 4FU9A 1BJVA 1TMTH 4Y8ZA 4XFQA 4Q7ZA 5I25A 1EPTA 1ETSH 3LH1A 2H1UA 3EA8A 1SL3A 2IN2A 1YPJH 1C2GA 1GMHG 1MD7A 2FLBH 3A7TA 2ZFSA 3ATIA 1GBLA 1C9PA 2XBYA 2Y6TA 3SU1A 1C2MA 1X7AC 4YESB 4F4OC 1BUIA 2QV1A 2V3OH 1DUAA 2VWNA 4DW2U 4I31A 4X1SU 2AH4X 1VZQH 2ZHWH 4U2WA 3UNRA 1HAIH 1TGSZ 1VITH 1AD8H 4CR9A 3MTYA 1IQGA 2VVCA 2A7HA 2BD9A 2ZHDA 3OX7U 1JWTA 1LHEH 2ZO3H 5A0AE 3GY2A 4A1XA 3QO6A 1QR3E 1QBOA 3QUMP 4RKOB 1C1MA 1EZUC 4ABBA 1GDQA 2UWPA 1O3JA 4AYVB 3KQBA 1D9IA 3I29A 4OS5A 1NY22 3LGYA 3MH5A 1QJ1B 1AUJA 4DY7B 1C9TA 5DG6A 2FTMA 2VB0A 2B9LA 3HPTB 2ZFPH 1QA0A 2ZKSA 1Z6JH 4B75A 2CF8H 2VIPA 2B7DH 5LGOA 2V0BA 1DLKB 7GCHF 1O2GH 1PQ5A 1UTKA 3DHKH 3QTOH 4AFZA 1XX9A 2HVXA 4WMFA 4DIIH 1UHBA 1BZXE 1QHRB 2F9UA 4JZ1A 3SGQE 1N8OC 1O3OA 4CBNA 2RA3A 2AFQB 1C5YB 1UVPA 1OYQA 3GYLB 5HMAA 1EAXA 4K8BA 1TNIA 1O2JA 5A09A 3KNXA 1NROH 1MQ5A 5CMXH 1C4Y2 2SNVA 5T6FA 4B1TA 4TY7A 1HAXB 8GCHG 2C93B 4UE7H 4NG9H 2FODA 3E0PB 1O2ZA 1BDAA 3IG6B 1GBIA 3F9FA 3SGBE 2CMYA 1FLEE 3M7QA 2BDIA 4K8YA 5JBAS 3BTEE 2WYJA 2PSYA 2ZQ2A 1ELEE 1BT7A 4ISLA 5DP8A 1TBZH 1CVWH 5FPYA 1V2ST 1ZR0A 4IW4E 3ZZ5A 1O3AA 2R0KA 4H6SB 1ZJDA 1EKBB 2W5EA 1XKAC 2EI6A 2ZCKP 1EPTB 3WY8A 1GBJA 3CS7A 4GVUA 2R2MB 1ZSJA 4DG4A 4MLFB 2ANYA 1A3EH 2QCYA 1RD3B 5JBCS 3ZZ8A 2VIDA 4KKDA 1V2KT 2D1JA 1AVWA 1HAPH 2OTVA 4AFQA 4I8HA 2ZDMA 2WUCA 3GYMA 1A5HA 2Z7FE 2TBSA 1GI1A 3G01A 5JDUB 4KGAA 3MNBA 4O97A 1V2VT 2WPHS 1BHXF 4DT7B 1LVBA 3E6PH 3KHVA 5EXNA 3VB4A 4O3UA 1PYTD 4ABEA 3NK8A 1GBHA 1W12U 1PPHE 6CHAC 1NTPA 2PKAA 1CT0E 2BXTH 2F3CE 5DK1A 1WQVH 1AMHA 2AIQA 1E0FD 3CP7A 3ITIA 2GCTB 1O3GA 1ETRH 2VIWA 1HIAA 2ZP0H 3E3TA 1NRPH 1ELTA 1YPEH 1XVOA 2Y82A 1NRQH 3PYHA 1EUFA 1FXYA 5HYOA 3ZVFA 5L2ZH 4LZ4B 1O37A 1OWJA 3TU7H 1P2NA 3SI3H 3CENA 3RLWH 1C5WB 2FOMB 4TPIZ 2GT7A 1XUIA 3M36A 4Y0ZE 2Q6GA 1TOMH 4SGAE 1F0RA 1DPOA 1UHBB 3GDUA 3KEEA 3M5NA 1PQ7A 2PKSC 3DUXH 2CHAB 1C4U2 4K5ZA 2ZGCA 1ELFA 1H9HE 1LCYA 2AMDA 3LONA 1MUEB 1O34A 1C2KA 2R2WU 2C8YB 1E35B 1KXCA 3PWBA 1V2TT 1AZZA 2FI3E 4DJZB 4GHTA 7GCHG 1FN6A 2XCNA 3OU0A 2M5TA 4LK4A 2GGVB 1OPHB 1AWFH 4ZKNU 1JIMA 1GL0E 3NCLA 1NU7B 3SJ8A 1EAWA 1S6HA 3SV6A 2ZPSA 5ETXA 3ZV9A 3QGJA 4ZAEA 3M35A 1O3BA 4BAHB 3PLPA 3A7YA 1J17T 2TGPZ 1BRUP 3PLKA 4YZUA 2HPQH 4NGAH 2P94A 2C8ZB 4AORA 1LPGB 1FJSA 3P95A 3ENSB 4ZROA 3B8JA 1QQUA 1CGJE 2FYQA 4X1PU 2VWMA 3F9HA 1WYKA 1QTFA 3RU4T 1SLWB 1ELVA 2A1DB 1FV9A 1GBEA 4GPGA 5TCCA 3U1IB 1P2IA 3LH3A 4NA8A 1C5ZB 2PW8H 3E91A 3H7TA 1JRSA 4D76A 9ESTA 4B74A 3NXPA 1C2FA 1SLVB 4BOHA 5DP9A 2VNTA 2A45B 6ESTA 3RXHA 1FAXA 2ALPA 3RXPA 4AFSA 1D4PB 1AGJA 1QURH 1LQEA 5FXLA 3M61U 1QL9A 3HK6B 2ZGBH 1O5BB 1NZQH 1XUFA 1YCPK 3BF6H 2J9NA 4YT7H 5EPYA 4R0IA 2H5DA 1LTOA 4ZUHA 2ZU5A 1V2QT 1P12E 4CBOA 4I33A 3M7TA 2D26C 4BXWA 4Y8YA 1G3EA 1K1PA 1QRWA 1QB9A 2H9TH 3P6ZB 3TJUA 3ZZ9A 6LPRA 1MKWH 1KLTA 1F0UA 3I78A 3R0FA 2J95A 1AZ8A 2QYIA 1O5EH 2ZG0H 1Y3WA 2PKAB 3ZZ4A 1YLCA 4A1TA 2QXJA 3LDXH 1YCPH 2RCEA 2BQ7B 4CRGA 2WPKS 4FVDA 1FNIA 1TA6A 1QRZA 1IQEA 3PTBA 1CA8B 1HIAB 2ZQ1A 1OWDA 1KTSB 1TRYA 1UCYK 2GV7A 1SGIB 1C2JA 1QA7A 2LNCA 5DP7A 4DURA 1K1LA 5JBTA 4TWWA 2Z3EA 2Z9GA 2P93A 4JK5A 1TGTA 2I6SA 5DJ7A 4YO9A 3TITA 1ESBA 3IITA 2FPZA 3F1SB 3SNDA 1B7XB 3UNSA 4XBBA 1F0TA 3RXDA 1NU9A 3PM3A 1Y5UT 4H6TA 5EOKA 1O2XA 3AASA 4B2BA 1ZGVA 4OS7A 1HAZB 3BIUH 3L33A 4JZDH 1A0JA 3C1KA 4XDEA 3MNCA 1A0LA 1ZYOA 3ZVBA 1QCPA 1Z6EA 2BLWA 2FP7B 2ANKH 2D8WA 4I7YH 1HAHH 1TPPA 3RU4D 3BTGE 3ELAH 3OYPA 3BTDE 4B73A 3UIRA 2PGQB 2ZGJA 4CRCA 2GCHF 1KSNA 5LPFA 3FP7E 1G3DA 1YKTA 4Y7AA 1OKXA 3ZYEA 5DO4H 2F9PA 3OY5U 3SU5A 1XXDA 1S85A 1IQHA 1JXPA 4WVPE 1GMDF 3KIDU 4IBLH 4B2AA 5EQQA 1TFXA 1Y59T 1PQ8A 4HI3A 1NFWA 2ODYB 2ZEBA 4AX9H 4JZEH 1H1BA 2OBQA 3HK3B 1AU8A 1O2LA 3K65B 2HNTE 2F91A 1EP5A 1WTGH 2PFEA 1G3BA 3DFLA 1O2OA 1LO6A 1KXAA 1Q2WA 3GDSA 4HGCA 4X8SH 1CHOF 1K22H 1O3FA 3TK5A 2FEQH 3AAVA 1H8IH 2NU1E 1XM1A 3T25A 4XBDA 3TGJE 2Y5FA 1QB1A 2ZTXA 1LHDH 4CH2B 2VIVA 3LJJA 1P9SA 4B71A 1DY8A 2NWNA 3RXAA 1C1WH 1PYTC 1KYNA 3MO3A 5A2MH 3RDZA 1V2LT 1FY5A 1P06A 3T62A 5C2ZA 1GBAA 1E38B 3BEIB 2PUXB 3GY4A 3UY9A 5FBIA 1A7SA 2JETB 1GJAB 3P17H 1F5KU 5F6MA 1RRKA 3SBKA 1OWEA 1JRTA 3BV9B 4XOJA 1QJ6B 3P8NA 4I32A 7ESTE 4SGBE