1FY3A

[g175q]hbp, a mutant of human heparin binding protein (cap37)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
225
structure length
219
Chain Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDQGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords HEPARIN-BINDING PROTEIN
publication title Two mutants of human heparin binding protein (CAP37): toward the understanding of the nature of lipid A/LPS and BPTI binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 219
sequence length 225
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy3A02
1ZJKA 2ZEBA 1SGNE 1V2QT 4IW4E 1A0HB 2XXLA 3LKWA 1D6RA 3ENSB 1BTZA 2VH6A 3RC5A 2Z7FE 4Y71A 3TJUA 1V2ST 3ZZ4A 3BIUH 2UWPA 1C9PA 4LXBH 1QJ6B 3LJOA 3M5MA 4O03A 3AW1A 4NA7A 1NFUA 5EOKA 3B23B 3TNTA 4WXIA 1ZRKA 1DY9A 4I8LA 3KNXA 1C5OH 3GY4A 1BMLA 3E0NB 3URDA 1HDTH 2ZDMA 3PB1E 2G8TA 1YCPH 3SHAH 3AW0A 1TABE 4Q7ZA 4UFFH 5CHAC 1E35B 1GJ7B 1V2LT 1BITA 3VB4A 1L1NA 3V13A 1GI1A 4CREA 1RGQA 1UTOA 2VIVA 4Y79A 3O8RA 1B7XB 2VNTA 3MTYA 3FAOA 4JZFH 1MKWH 1QY6A 2F9VA 1SGRE 1FY1A 1V2VT 4JYUH 1UCYK 2FX6A 3SJIA 3MWIU 1J9CH 3HATH 3TGJE 1GCDA 2AH4X 2IJOB 2ZECA 1Y3YA 4D7FA 2ULLA 1IQGA 1MCVA 5EXLA 4ZKOU 1O39A 4AFQA 1FPHH 1PPFE 1A0JA 2B9LA 1RTLA 4XOJA 4NFEA 5EU8A 5HYOA 1TX7A 1AO5A 4YM9A 1VJAU 3QK1A 2JH5D 1L2EA 4ABHA 4FUJA 2AERH 2ZCKP 1FY4A 1TWXB 1P2JA 2AIQA 1LTOA 1O3FA 2FESH 4B2AA 1K1NA 4YOIA 3W94A 3RXKA 2OC1A 1C2EA 2BX4A 1XX9A 3SUDA 2B0FA 1AI8H 1OPHB 5L30H 1C5UA 3GCHC 1UK4A 4CRDA 1CT2E 4NZLA 4HZHA 4AB9A 1AVXA 1D3QB 1VITF 1EZQA 3GY5A 3RXOA 1OS8A 1GJ4H 1PJPA 1EATA 4Y8ZA 3TVJB 4IBLH 1O2WA 1W10U 2VWOA 1O3CA 3DA9B 3NXPA 3QDZB 2ZHQH 1NZQH 2ZC9H 3RXJA 3RLYH 1X7AC 1Y3VA 1C5QA 4JZEH 3PTBA 2GD4B 1TFXA 4WMFA 1O38A 4ISIH 2XWAA 1TA6A 1DWBH 1CHOG 3BG4B 1TMTH 4DOQA 4UEHH 2WPLS 3PO1B 1EPTC 5I46H 1TIOA 4Y0YE 3KQEA 3ITIA 5L2ZH 1F0TA 2ZDLA 4A92A 1GBFA 3LOXA 3T2NA 4FU7A 1IOEA 2Z3CA 1SHYA 2C8XB 3UWIA 1BA8B 1QCPA 2IPHA 1ELAA 1H8IH 1FNIA 1BJUA 3T26A 1K2I1 1L4ZA 1OWIA 2Z3DA 3KL6A 1GBKA 2VINA 2R0KA 3U8OH 1FAXA 1BMNH 3CENA 5E8EH 2GMTC 3HGPA 1SGTA 5DP8A 4DJZB 1IAUA 4WJG2 1O2NA 1K9OE 2F9OA 2PKSB 4DGJA 2ZA5A 3K65B 4JYTA 1SGEE 1GBAA 1A7SA 4J1YA 4MVNA 1HAVB 2BD7A 3EGKH 2FX4A 2VIQA 3RXQA 3IITA 1ZSLA 2BOHB 4F4OC 2C8YB 5BRRE 1NU7B 2NU3E 1TQ0B 3T5FH 3MU4A 2PGBB 2OINA 4SGAE 4U32A 1EAUA 2ZZUH 2HNTF 3V3MA 1UVPA 4BAMB 3O8CA 1GVZA 4JK6A 1PQ8A 1VGCB 2OXSA 1O2ZA 2EI7A 3CS7A 2SGAA 3RDZA 1TGTA 2GT8A 2PUXB 1O5AB 1SHHB 4MPUA 2QV1A 1UTNA 2P3UB 3ZZCA 1LCYA 4MDSA 5PTPA 3P6ZB 2A5IA 4AYVB 1AE8H 1BCUH 2GV6A 1AUTC 1FMGA 5TCAA 1NESE 1DOJA 1K1OA 2ZU4A 5E2OA 2FODA 4AOQA 1GHVH 1C2DA 4GAWA 1UTQA 1QJ7B 3H7OA 1V3XA 3A88A 2ZU5A 4B1TA 5EW2H 1GBTA 1XKAC 2BDHA 4TWWA 1HIAB 1V2MT 1PYTD 5DGJA 3RXGA 1G3CA 4ZMAH 2VVVA 1K1PA 2BY7X 3FZZA 2A4GA 4ZHMU 1G32B 1ACBE 1WTHD 1GJDB 1V2NT 1KY9A 1O33A 2FWWA 3A80A 3I77A 3KQCA 1ZMJA 1HJAB 2A7CA 1QQ4A 1C4V2 2J92A 4H42U 1AVGH 1IQFA 3ZZ5A 1AB9B 2AGIX 7LPRA 1TRYA 3ZVEA 3ZZDA 4CBOA 1PFXC 2A45B 3GY7A 2TGTA 3M5LA 9LPRA 2JH6D 1IQLA 2SNWA 3ZZ6A 2M5TA 1KYNA 4AGJA 4B2BA 1A0LA 1GMDG 1EJNA 2ZU3A 1ZTLA 3QTOH 3M5NA 5DPAA 1P2KA 3RXPA 4Z0KA 2OUAA 3EDXB 3U9AH 1GVKB 2VJ1A 2ZO3H 1YYY1 1G9IE 4RSPA 2ZU2A 1PPEE 4MPWA 1OOKB 3GISB 2O8MA 3E6PH 5T3HA 2D2DA 2OP9A 1ABIH 1CGJE 1C1UH 1FZZA 1MTNB 3BTGE 1LQEA 2HPPH 2VWMA 4ZKNU 1K1LA 4NA8A 4X1RU 1ID5H 4KTSA 3RXMA 4NG9H 1EOLA 1C1SA 4FU9A 2ZG0H 1OP0A 5DJ7A 4NIYA 1CT4E 3S7KB 1TMUH 1WCZA 3DFLA 4MNVA 1SPJA 3RU4E 3S0NA 3RP2A 1Q3XA 1EJAA 1YGCH 3ZVAA 2Y5FA 2HPQH 2OD3B 3A8BA 4IS5A 1TRMA 2VWLA 4JMYA 5GDSH 2ZGHA 3PMHB 1G2MA 2B5TB 2GZ9A 2GCTC 1TE0A 1MBQA 3H5CB 3Q77A 3SGQE 3SNAA 3FZDA 1ANBA 2QA9E 1P57B 5FAHA 5JB9S 5F8XA 1S6FA 2ANYA 1FI8A 1C2LA 3EYDA 3ZZAA 4CBNA 1AZ8A 1P09A 4Q7XA 1O3GA 5G4BA 4K69A 2FZZA 1PQAA 1G37A 2BLQA 4YESB 2Y81A 5GWZA 1TAWA 1QIXB 2SGPE 3UNSA 1V2UT 3P8FA 1C2MA 1BQYA 2ZIQH 2TPIZ 4GUXA 1MQ5A 2QIQA 5CMXH 1ANCA 2CHAC 3SUGA 2JKHA 7KMEH 4FVDA 5DP6A 2Z9KA 2WV4A 1SMFE 2RG3A 4GHQA 1MH0A 5GPIB 3NK8A 1OYQA 2XC5A 3TJOA 1GJ8B 3SV6A 1KLIH 4AFSA 1A5GH 9ESTA 1OWDA 4FUEA 4Q2KA 4JZDH 3U8TH 1XVOA 3SQHE 1HAYB 4X8VH 3O8BA 4UDWH 1THPB 2F9UA 1AKSA 2Z94A 3AAUA 4OS7A 2ZFFH 1SG8B 2PSYA 1TGBA 7GCHG 1F7ZA 2OQ5A 2BZAA 1SC8U 1PQ7A 5JYIA 1TYNA 1G36A 2AS9A 1W7GH 3A8DA 3SU3A 3ATWA 1BTPA 1CGIE 4TPYA 4Z6AH 8KME2 6GCHG 2P95A 1YPHC 1S85A 4OS1A 1LMWB 4ISHH 1AZZA 4O97A 1O2OA 4NGAH 2ZF0H 1BIOA 1FLEE 1G30B 1GBDA 1KSNA 5B6OA 2H2ZA 4FUCA 4CRCA 4U30A 1UHBA 3GY8A 3ATKA 2C8ZB 2P8OB 3HK3B 3EA8A 3TH4H 4CRBA 4MG3A 3SW2B 1AHTH 6CHAB 2VWNA 1BRBE 3RU4D 1E38B 4OGXA 4FUHA 1T31A 2ANWA 1KTTB 1TNIA 5LPEA 3NUMA 1GBEA 4WVPE 3PYHA 4UFEH 4VGCC 1M9UA 2H6MA 3SJKA 1UTMA 1YKTA 4DIHH 1ZHRA 3U1IB 3T62A 3SV2H 1GHAF 2UUJB 1O32A 2ODPA 3VXFH 4ASHA 2BD3A 1SLWB 3ZVGA 4GVUA 1S0RA 1HV7A 1Y59T 5ESBA 1A2CH 4Q80A 3SU6A 2CJIA 1SB1H 1ETRH 3O8DA 4BAKB 4I8JA 1AIXH 2STBE 3TGIE 3E90B 1MTUA 2ZQ1A 5C1UA 1YPGH 3SU5A 4THNH 1O3JA 2Q6FA 1KDQA 4UFGH 2R2MB 1YC0A 3VB7A 3LH3A 1F5RA 5A0AE 3URCA 1RS0A 2BLVA 1DS2E 1IQMA 3SGBE 4O3TA 1LPKB 2EC9H 3CP7A 4E06H 3M7QA 2WPIS 2CXVA 4Y0ZE 2V3OH 1P8VC 3ZYEA 3HKJB 2QYIA 3EQ0H 2ZWLH 3SOSA 3QO6A 3ZV8A 1HAXB 5HXFA 1J17T 1MTSA 1WSSH 4IGDA 5SGAE 4ABGA 1J16A 4WH6A 1VR1H 3DHKH 4Y6DA 3TLOA 1GHBF 1HJ8A 1W14U 3BEIB 1AKSB 1ZJDA 1SFIA 1TB6H 1F92A 1FQ3A 1DX5M 2VGCC 4GSOA 4GCHG 4ZROA 3TK9A 1P2NA 1GI4A 1HLTH 4FU8A 2C90B 1P3CA 1RRKA 1P2MA 2A2QH 2WPMS 4I8GA 5DKMA 4B76A 2OBOA 3RM2H 1L1JA 2GGVB 5EQSA 3K6YA 2VVCA 2XWBI 1CBWB 1XVMA 2ODQA 1O3EA 3MMGA 1GWAA 1GJ6A 1WBGB 2GZ8A 2H9HA 1P2QA 1EAIA 3S69A 1C2KA 4I33A 1GJCB 1AWHB 1CA8B 1BT7A 2F9NA 1DDJA 1DVAH 1UTLM 3RXBA 4DY7B 3RC6A 1EPTA 1FONA 1H1BA 3RXIA 4D7GA 3OU0A 2FOBA 1KXAA 2Q1JA 1YPJH 4B71A 3LDXH 4DCDA 5ETXA 1LVBA 3SV8A 4AFUA 3GCTG 2CGAA 4Y8YA 1LVYA 1UHBB 3FP6E 1E36B 1W11U 1RD3B 5GXPA 1NRPH 1TGNA 1QRWA 2AMQA 3KHVA 5C1XA 3A87A 1O2QA 3P92A 4IMQA 1UVSH 1QA0A 1ZSJA 2V35A 5LGOA 3A7VA 5CHAB 1O3HA 3VGCC 1MQ6A 1DSTA 1SGPE 1ABJH 3MU0A 1SQTA 4OGYA 1MU8B 4WWYA 6ESTA 1A3EH 1O2VA 1OP8A 2XNIA 1YPEH 3BTFE 4K1SA 5IDKA 2FI3E 3F9GA 1TPAE 2HNTE 3QGJA 2ZPSA 2NU1E 1SLUB 1O36A 1SQOA 3KIDU 4AFZA 2LNCA 7ESTE 1L0ZA 3QX5H 3MU1A 3SNBA 1B0FA 1H4WA 5T6GA 2G5NA 2G4UA 1ELBA 1TNKA 1Y5AT 3VB3A 3SORA 4AYYB 3D65E 2A32A 4LOYH 4ZHAA 4DW2U 1MAYA 2W7SA 1EB2A 3A85A 2SGDE 4MPXA 3W95A 1T8OA 5FBEA 1ELVA 3TK5A 3F68H 1KDQB 5E0HA 3ZVBA 2Z6BD 1C5MD 3A8CA 2ANMH 1DWDH 5F8TA 2ZKSA 1HAVA 3A7WA 1YPHE 1GI5A 2Y80A 3D62A 3UWJH 2Y6TA 2GP9B 4FUFA 2A4OA 2FP7B 2ZDAH 3GCHB 4UFDH 1GI9B 3L33A 1TMBH 1XUFA 3D49H 1TOCB 3MO3A 1E37B 3NZIA 1Y5BT 2BY9X 5FXLA 3U69H 2DE8A 2HOBA 1HRTH 3VPKA 1SBWA 1C1RA 2SGFE 3H7TA 3BV9B 1QTFA 1DWCH 4HFPB 2XRCA 1NFXA 1O3IA 3BSQA 3QN7A 1O2RA 1GG6B 3E8LA 1YPKH 4H6TA 5FPSA 5GJ4B 3M7TA 1HIAA 3MU5A 1CA0C 1EPTB 1EKBB 2LPRA 5DO4H 1U6QA 1LHEH 1GBBA 1S81A 1ANEA 1EZSC 1EZXC 2BD5A 1G3DA 1SL3A 1C5PA 2BQWB 4WMDA 1SOZA 1GMHG 3SO3A 4ZKRU 5A8YA 1DLKB 3KEEA 1ZOMA 1F0SA 1P3EA 2BLOA 2ESTE 4YLUA 2OBQA 3AASA 1RXPA 1VITG 3M7UA 1DUEA 2BQ6B 1NRNH 1V6DA 1PPCE 2VIWA 2GMTB 2QAAA 1BBRH 1PQ5A 3CS0A 3LT3A 4HI3A 4O3UA 2H9TH 3PM3A 5JBCS 3K2UA 1O2YA 2BX3A 1CQQA 1OKXA 1HB0B 1O34A 3BTME 3IG6B 5LH8A 4AZ2B 8GCHF 1WQSA 1GBLA 1LPGB 2GX4A 4I7YH 1FN6A 2D1JA 3A89A 2B7DH 3L3TA 5GIBA 2JETC 2BDBA 4K1EA 2CMYA 2BHGA 2PFEA 2BVXH 3PWBA 3Q76A 5EGMA 3RXUA 3E16B 3M61U 3UUZA 2R2WU 2QF3A 3MHWU 4ISLA 1C1VH 1TBQH 1KXFA 2CF9H 2Y5GA 2QCYA 2C93B 3A7ZA 2XBYA 1MU6B 3BEFB 1BRAA 1YCPK 3SHCH 3UY9A 1BHXB 1HUTH 1CGHA 2ZPRA 1NT1A 3AAVA 1DT2A 1F0RA 3KN2A 2OC7A 3SNCA 2O8WA 4X1QU 2FLRH 1IQHA 3RXEA 3A8AA 1MTWA 1TBRH 1MKWK 1NN6A 3BTEE 4K5ZA 3SUEA 3NWUA 1MUEB 1LHFH 1WV7H 2Z9JA 3BG4C 5FPTA 4DIIH 1GBIA 1W12U 1IQNA 2R0LA 3MNCA 2A5KA 4X2YA 1PPHE 2O8UA 2QF0A 1Z8GA 2PV9B 3SNEA 3E3TA 2GTBA 3QUMP 2BDYA 1FN8A 3TPIZ 4D9QA 2GT7A 3TU7H 2HWLB 1KTSB 1S6HA 2Z9IA 2KAIB 4FUGA 1C1MA 4TY6A 1O2JA 1T7CA 1YPLH 1WQVH 1MAXA 4U01A 2QXIA 3PROA 3RU4T 2ZFSA 2BDAA 3GYMA 4X1PU 4X6MA 4UE7H 4X1SU 4DG4A 2FOMB 2GVFA 1BTWA 1RIWB 3QTVH 1XUGA 2H5CA 2GCHF 3PLPA 1GGDC 2PKSC 3NPSA 1P10A 1E34B 2G5VA 2SFAA 4KP0A 3HK6B 1TRNA 1MBMA 3SUFA 5IYTA 1F2SE 4OS6A 1BZXE 1VCPA 3I29A 4KELA 1L4DA 2I6QA 3P95A 1O2GH 2FI4E 3S9CA 2YNAA 4OS5A 3RXAA 1QRZA 4CRFA 2VH0A 4K8BA 3UQVA 5FPYA 4ABBA 5E0JA 4MTBA 3UOPA 3Q3KA 5C67A 1MMJN 3MI4A 1QB1A 4AG2A 1ZMNA 4K2YA 1UK2A 3QLPH 2QXHA 5HM9A 1BBRK 3ZVDA 2HGTH 1W0YH 1N6XA 3GICB 1K1MA 1SGYE 3LJJA 4XE4A 4LZ1H 2BD4A 1T8LA 2J94A 3VEQB 3LGIA 3NCLA 2FM2A 3LH1A 2F9BH 2PUQH 1Q31A 1EP5A 1P05A 1MKXH 4BAOB 1GDUA 2GCTB 4DURA 2SNVA 2HRVA 2ZTXA 3ZZ8A 3V12A 5LPFA 3DD2H 4KGAA 1MCTA 4AORA 1BTUA 1TLDA 2XTTB 1D6WA 3BTTE 4XFQA 1A5IA 4GPGA 3RXTA 3BTDE 3RMNH 2P59A 1JRSA 2G52A 2UUYA 1D4PB 1ESBA 5FX5A 1O3OA 2TGPZ 1H9HE 1OX1A 2CHAB 5JBBS 3OSYA 1ZGVA 1GL0E 1E0FD 3KQBA 5TCCA 5F6MA 2ZCHP 1P0SH 2C8WB 1DUAA 4LK4A 4RKOB 2NU2E 1TPOA 3HPTB 4ZKSU 2ZP0H 4MNYA 4TWYA 4YT7H 5JPMH 1NRQH 1K1IA 1C5SA 2H1UA 1AE5A 1FIWA 2FDAA 1ELCA 2QC2A 3F1SB 2FOCA 3EA9A 1TA2A 1C2FA 2SGEE 1K21H 1FY8E 4O9VA 2AYWA 2GKVE 1TX8A 1UCYE 3QGNB 1N8OC 1T8MA 1MTNC 3EAJA 1DWEH 1XM1A 4ABFA 3SV7A 4XDEA 2NU0E 1GBMA 4TY7A 2P3FH 2FEQH 1KXDA 3MH4A 2W3IA 1XMNB 1DICA 5DP9A 3K9XB 1EAWA 1PPZA 2HNTC 1HNEE 4XSKU 4NCYA 3Q00A 2ZFTA 1GI0A 2I6SA 5J4QA 4FUIA 1P12E 1UVUH 1LHCH 3HKIB 5AVDA 1GHYH 2G4TA 5C5OA 2EA3A 2BLWA 1C4U2 5DP4A 2G55A 2FS8A 1NROH 1P03A 4RKJB 1TNLA 4X6OA 4YO9A 3S7HB 3SGAE 4CH8B 1XUHA 4XBBA 1TX6A 1O2MA 4YOJA 2P94A 1SVPA 5A0BA 1MD7A 1GHWH 4MNXA 4D9RA 3RXFA 3SBKA 5HMAA 4BNRA 2BTCE 2C4FH 2ZPQA 8ESTE 4BXWA 3OY6U 2GDDA 5A09A 4Y7BA 3BN9A 1L1GA 2ZHDA 3UQOA 3V7TA 1C2HA 3MO9A 4ABEA 4TPIZ 1N1LA 1F0UA 4VGCB 5AFYH 2D8WA 1UTJA 3TITA 4AX9H 2F91A 2BM2A 1MKXK 1TNJA 2CN0H 4JCNA 1SLXB 1TGSZ 3UOUA 5AF9H 3R3GB 2W5EA 1AN1E 2BVSH 1O3KA 1EQ9A 4JYVH 1NC6A 1GJBB 2BY5X 4NSYA 1AGJA 4X0WU 5DP5A 2RDLA 5EG4A 3GYLB 4CHAC 4INHA 5DP3A 1YCPM 5C1YA 2FTMA 3A7TA 4A1TA 1HAOH 1BRUP 1CU1A 2EI6A 3SI4H 1DY8A 5H4IB 1W8BH 3BG8A 1DE7H 2EEKA 1ZTKA 2ZGCA 2ZFRH 1H8DH 4Y10E 2WPJS 4Y11E 1D3DB 5C5NA 3P8GA 4A1XA 1CT0E 4BOHA 3BTWE 5LPRA 1GMCF 1F5KU 1O2IA 3E1XB 1NFWA 3SV9A 4CR9A 1GI2A 1ANDA 2DE9A 4XBDA 5DG6A 3HGNA 2A4QA 2WINI 3PMAB 5T6FA 1G2LA 1VCQA 2VGCB 1C1TA 1NM6A 5EODA 1GCTC 1WOFA 1YPMH 3UNQA 2Z3EA 4Y8XA 1D3PB 1O2XA 2FXRA 2PTCE 4XBCA 1AMHA 1V2WT 1ZSKA 1WU1A 4F49A 5EQQA 1VJ9U 2H5DA 2PTNA 4FUBA 6CHAC 3BIVH 3GCOA 3F9HA 1KXCA 1C5RA 1ZMLA 2RA0A 2WPHS 1SGIB 5EXNA 4X2WA 1DXWA 4MLFB 3EE0B 4ABJA 1QL7A 3ODFA 1AFEH 2ZI2H 3GCNA 3GDSA 6LPRA 4DT7B 5JDUB 4X1NU 1W2KH 3UR9A 4Y7AA 5GCHF 4YTAA 2BB4A 5C20A 1T4VH 3JZ1B 1O2LA 1EUFA 2H9EH 2WPKS 1GDNA 1O2KA 4YOGA 4HTCH 4UD9H 1UK3A 1GI7B 4M7GA 1C5TA 1GHBG 1O3LA 1W0ZU 1HAHH 5I25A 1FPCH 1TNHA 2A1DB 2STAE 1HBTH 2TGAA 5HGGA 5JBAS 3SU2A 2ZGJA 3TH3H 2OLGA 3LU9B 3RMLH 2GV7A 4K60A 1ELFA 2J4IA 3P70B 2PLXA 2ZU1A 4ZUHA 3MH6A 4BTUB 2FLBH 1DXPA 1O3PB 1P9UA 4H6SB 5FX6A 3GCTF 2ZDKA 4K3JA 4KKDA 3LC5A 1P9SA 2R3UA 1QNJA 2F83A 2ZHFH 1CSOE 1O5EH 1OP2A 1GHZA 2XW9A 3UIRA 5EW1H 1QL9A 4WF8A 1A46H 3UREA 4ZH8A 1HYLA 1HAGE 5K0HA 2Y5HA 1TONA 2ANKH 4YT6H 5ESTE 4Y76A 1CBWC 1SGCA 3M3SA 2TGDA 3PMJA 1S82A 3SI3H 1ORFA 1YLDA 3A7YA 3TGKE 1NRSH 1K28D 5F8ZA 2G81E 3SJ9A 2FPZA 1SI5H 1C2GA 3M5OA 3L6PA 2A7JA 1Z7KA 5A0CA 1Q2WA 1AFQC 2TBSA 1GJ5H 1QBVH 3A7XA 1C1WH 2FOGA 1HAZB 8LPRA 1QRXA 1EAXA 3AVZA 1HPGA 3STJA 3ESTA 1MZDA 1S84A 2BXTH 4R0IA 3PWCA 2Z9GA 2F3CE 1XUJA 1O3DA 1P2IA 3MNSA 5TJXA 5EXMA 1BHXF 3C1KA 2FYRA 1GL1A 5FCRA 1CA0B 1Z1IA 1C2IA 4LZ4B 3P17H 5EPNA 1K1JA 3UPEA 3RXLA 3GY6A 2RA3A 1AU8A 1EX3A 1SGFA 2KAIA 4OS4A 4B2CA 4JZ1A 1VITH 3SNDA 3B9FH 3E0PB 1TNGA 1AUJA 2BY8X 5JB8S 3LGTA 3ZZ3A 1C1QA 1Z8JB 3RC4A 3LGVA 1EZUC 2VVUA 2PW8H 3UNRA 3BTKE 2O8LA 2YOLA 4BTTB 1SGFG 2AIPA 1HFDA 2P16A 4B75A 1YLCA 3OY5U 1O35A 1ZPCA 1QR3E 1HAPH 1O5CB 3U98H 2O9QA 2FOAA 1HJ9A 1CHGA 4JZIA 4NIXA 1D3TB 1FUJA 4IN2A 1SSXA 1GBHA 1O31A 4OS2A 1BTHH 2G51A 2QY0B 1W13U 2BQ7B 2ZFQH 1IQJA 4FVBA 1DSUA 2JETB 3LGUA 1W7XH 3Q3XA 1GMHF 4WY3A 5A8XA 5F03A 1DLEA 1JWTA 3V0XA 5C3NA 2G00A 3GOVB 2PKAA 1A4WH 4BTIB 3WY8A 1QFKH 2BMGB 3SU4A 1HCGA 1LQDB 1O2SA 1OWHA 2R3YA 3RXVA 1LKBA 1CO7E 1CHOF 1ZPBA 1LKAA 2UUKB 2Y7ZA 3ATMA 3VXEH 2B8OH 1VCWA 1ARBA 2BD9A 1ESTA 4GHTA 3M3TA 1P02A 5EPYA 3OX7U 1A1RA 2Q6GA 5A2MH 3PLKA 1A5HA 1GG6C 1BTYA 2ZCLP 3UFAA 4CRGA 2DUCA 1V2OT 2ZTZA 2IOTA 3ZV9A 4NIWA 1UMAH 3LC3A 3P8OA 3RMOH 2TIOA 1O5FH 4ZXYH 2FOFA 4X6PA 1J8AA 8GCHG 1KXBA 1WUNH 1C5LH 3MOCA 1C5NH 3RXSA 1TPSA 4KTUA 1D9IA 1NTPA 1UTKA 2OCVB 3GY2A 5J4SA 1C5WB 1HGTH 1ZR0A 1Z71A 2CV3A 1EASA 2V3HH 1UO6A 3DFJA 1YM0A 4PROA 4J2YB 1FDPA 3S9AA 4QT8C 2FOHA 1O5BB 1Y3WA 4ZAEA 1GGDB 4HGCA 1HAIH 3T25A 1YP9A 1FAKH 3G01A 1O5GH 1JBUH 3PO1C 4BXSA 3FANA 1O2UA 4MQAA 1NS3A 2BDCA 2A4RA 3LONA 1O3NA 1ARCA 3TH2H 3P8NA 1TGCA 3RXDA 1J14A 3A81A 4CRAA 5AHGH 2WYJA 3FVFB 4AN7A 1ESAA 2W3KA 2Q6DA 4WMEA 2P93A 1T4UH 2ALVA 3RMMH 1W3CA 4E7NA 2ZQ2A 3DT0H 1SGDE 1GJ9B 2BOKA 3KF2A 2FI5E 3M37A 5ABWA 4H4FA 1ZPZA 5L2YH 1EB1H 1QL8A 3VB5A 2PWXA 2K1QA 3LGYA 3PLBA 1SGQE 1Y3XA 4YLQH 4NFFA 3BTQE 1OWJA 4ZHLU 3MNBA 1LHGH 3F9FA 2SGQE 1N6YA 4MPVA 2XBWA 2GCHG 2HVXA 2C3SA 3FP7E 1ZHPA 3TJNA 1XKBC 2OQUA 2A5AA 4NZQA 1KLTA 1JIMA 1O2PA 1QBOA 2PKAB 1YBWA 2BXUH 1UJ1A 4UONA 3A84A 1MTVA 4D76A 1IHTH 2A2XH 1B5GH 3A86A 1DANH 1VGCC 2XCFA 1EJMA 1QGFA 1GDQA 3ZZBA 1GPZA 2GZ7A 2FIRH 2RCEA 1KLJH 3BF6H 2AFQB 3PV4A 4ISNA 4ABDA 3U1JB 1GMDF 1P11E 3QZRA 1ELDE 1ELTA 2AMDA 5EQRA 1GI6A 2AEIH 3Q3YA 3RUOA 4B74A 4NWLA 4E05H 1RIWC 4WH8A 1NPMA 4SGBE 1QB9A 2ODYB 1F5LA 3MO6A 3QWCH 1Z6EA 1TQ7B 4E7RG 4A7IB 1IQKA 1S83A 2FO9A 2ZGXH 4I31A 2HALA 2ZDVH 1FY3A 1RJXB 4BAQB 4IC5A 3RXRA 5E0GA 3MH5A 5JBTA 1JRTA 1ZRBA 2ZGBH 1JMOH 3T28A 1BOQA 1V2TT 2CF8H 2TRMA 1C1PA 1Z1JA 1S5SA 3JZ2B 1K22H 1HJAC 4I8HA 1ZTJA 4AGKA 1LDTT 5T6DA 1AB9C 3SU1A 4I8KA 1QURH 1CVWH 1N8OB 1SR5C 1C1NA 2ASUB 2WYGA 5A8ZA 1O0DH 1GBCA 4D8NA 1YF4A 2VU8E 3M3VA 4WXVA 3U8RH 1P04A 3GDUA 2JH0D 1ELEE 3GDVA 3D23A 1S0QA 2PGQB 3BTHE 2BYAX 2A7HA 3R0FA 1DPOA 4ESTE 3MH7A 1AY6H 1BUIA 1ZLRA 1XUKA 2Z9LA 1PPBH 4CH2B 2R9PA 1JIRA 2QN5T 1G3EA 4IC6A 1O3BA 5CE1A 2QXJA 1GVLA 2FTLE 1CE5A 1LPZB 1SLVB 1BJVA 1UTPA 2O8TA 1GJAB 1C2JA 3FFGA 4NWKA 1FY5A 1THSH 1ZZZA 5L6NH 1ZYOA 1FIZA 2AGGX 3STIA 1V2KT 4A1VA 4ABAA 1A61H 1ETTH 4I32A 4TYDA 5FCKA 2FMJA 1BB0B 1LVMA 1INCA 1ETSH 1Y3UA 1AVWA 3K6ZA 1P01A 4RN6A 3SU0A 2UUFB 2V0BA 1IQEA 1B0EA 1XXDA 2HLCA 1RTKA 3T27A 1EXFA 1C9TA 3EA7A 3RXCA 1BRCE 3TNSA 1QA7A 2F9PA 3MU8A 1BTXA 7GCHF 1ZHMA 3S9BA 2A0QB 1OSSA 1C5ZB 1LHDH 2QGRA 2XC0A 2PSXA 2XYAA 3F6UH 1EOJA 4CHAB 3TIUA 2XCNA 2BDGA 1HXEH 4FXGH 1WAYB 5E2PA 1WYKA 2WUCA 1FXYA 3M35A 1MD8A 2PHBA 1JXPA 4U2WA 2EI8A 6GCHF 1MZAA 1QQUA 1NY22 3VB6A 4FUDA 4BANB 3SZNA 1T8NA 1DM4B 4ABIA 5BPEA 2WUBA 1C1OA 3ZZ7A 1O37A 1AQ7A 2J2UA 3BEUA 2BD2A 1AWFH 1THRH 2OC8A 2ZHEH 3ELAH 3A82A 4R8TB 3KGPA 1JOUB 1QBNA 4X2VA 3SN8A 1G3BA 2BVRH 2FOEA 3TK6A 1O2HA 1Y8TA 1GCTB 1O2TA 3MFJA 4IN1A 2W26A 1DFPA 3RLWH 4A5TS 1Z8RA 2XBXA 3LPRA 3NKKA 4X8TH 1OWEA 3ZZ9A 1GI8B 4ISOA 4MNWA 4AB8A 2IN2A 1GI3A 1HXFH 1ZGIA 4GLYA 1VZQH 1O3MA 2VIOA 3ZVFA 4Q7YA 4A6LA 3RM0H 1XUIA 2UWOA 2ZHWH 3SQEE 5K7RA 1OWKA 2NU4E 1EP6A 2AGEX 5HM2A 3PTNA 4X8UH 5FBIA 3GY3A 1LVOA 1C5VA 1GHAG 1NU9A 2OTVA 3IWMA 4YZUA 1QB6A 1C5XB 2BD8A 1ELGA 1BMMH 3ODDA 1IQIA 1PYTC 2Y82A 5FHTA 3QZQA 1NRRH 4ZXXH 1FJSA 1GMCG 2NWNA 1V2RT 1BMAA 2W7UA 3OYPA 1KXEA 2P8OC 4NA9H 2VIDA 4DVAU 1O5DH 2ZTYA 1Z8IB 1V2JT 3LIWA 1V2PT 3N7OA 1TALA 4KTCA 1H9LB 3I78A 1LO6A 4NSVA 2J9NA 4CR5A 2V6NA 3KQDA 3DUXH 3KCGH 2YNBA 3PMBB 3SJ8A 1H9IE 1UVTH 2THFB 4AG1A 1XXFA 2GDEH 1TPPA 1UCYH 3B8JA 1T32A 2XBVA 2J95A 4GCHF 1SOTA 4X6NA 1TBZH 1SFQB 1RTFB 4K8YA 2J34A 2Y7XA 1A3BH 3FP8E 2ALPA 1UVOA 1WTGH 2ILNA 2BZ6H 3UTUH 3E91A 1C5YB 1OXGA 5GCHG 2PR3A 5AFZH 3C27B 4NIVA 3ZYDA 2WV5A 3MYWA 1PPGE 3ZVCA 1DITH 3ATIA 3VGCB 3A83A 1IHSH 3UR6A 4IMZA 4INKA 3VFEA 4X2XA 1GBJA 3OTJE 1GHXH 1P2OA 3SJOA 1SQAA 3ATLA 2XC4A 2BY6X 5DK1A 3LGWA 3TJVA 2ZFPH 2ZNKH 4BAHB 1BBRE 4INLA 4K1TA 2UWLA 2VB0A 1AD8H 4X8SH 1KIGH 5C2ZA 1J15A 2AMPA 3RXHA 2ZDNA 1TOMH 2VIPA 2FYQA 1QJ1B 1C4Y2 3M36A 1Y5UT 2BDIA 2FS9A 3F9EA 1AFQB 2QXGA 3MNXA 5DP7A 1NO9H 1O30A 2J38A 2OC0A 4JK5A 1P06A 1O3AA 1FV9A 1OYTH 1QHRB 1NFYA 2A31A 2P3TB 1BDAA 4B73A 2D26C 1RFNA 3T29A 1Z6JH
chains in the Genus database with same CATH superfamily
1ZJKA 2ZEBA 1SGNE 2LP6A 1V2QT 4IW4E 1A0HB 1S6LA 2XXLA 3LKWA 1D6RA 3ENSB 1BTZA 2VH6A 3RC5A 2Z7FE 4Y71A 3TJUA 1V2ST 3ZZ4A 3BIUH 2UWPA 1C9PA 4LXBH 1QJ6B 3LJOA 3M5MA 4O03A 3AW1A 4NA7A 1NFUA 5EOKA 3B23B 3TNTA 4WXIA 1ZRKA 1DY9A 4I8LA 3KNXA 1C5OH 1FX0B 3GY4A 1BMLA 2J97A 3E0NB 3URDA 1HDTH 2ZDMA 2KCYA 3PB1E 3KYFA 2G8TA 1YCPH 3SHAH 3AW0A 1TABE 4Q7ZA 4UFFH 4XD7D 1E35B 1GJ7B 1V2LT 5CHAC 1BITA 3VB4A 4F48B 1L1NA 3V13A 1GI1A 4CREA 1RGQA 1UTOA 2VIVA 4Y79A 3O8RA 1B7XB 2VNTA 3MTYA 3FAOA 4JZFH 1MKWH 1QY6A 2F9VA 1SGRE 1FY1A 1V2VT 4JYUH 1UCYK 2FX6A 3SJIA 3MWIU 1J9CH 3HATH 3TGJE 1GCDA 2AH4X 2IJOB 2ZECA 1Y3YA 4D7FA 2ULLA 1IQGA 1MCVA 5EXLA 4ZKOU 1O39A 4AFQA 1FPHH 1PPFE 1A0JA 2B9LA 1RTLA 4XOJA 4NFEA 5EU8A 5HYOA 1TX7A 1AO5A 4FOUC 4YM9A 1VJAU 3QK1A 3OAAD 2JH5D 1L2EA 4ABHA 2OK5A 4FUJA 2AERH 2ZCKP 1FY4A 1TWXB 1P2JA 2AIQA 1LTOA 1O3FA 2FESH 4B2AA 1K1NA 4YOIA 3W94A 3RXKA 3PV2A 2OC1A 1C2EA 2BX4A 1XX9A 3SUDA 2B0FA 1AI8H 1OPHB 5L30H 1C5UA 3GCHC 1UK4A 4CRDA 1CT2E 4NZLA 4HZHA 4AB9A 1AVXA 1D3QB 1VITF 1EZQA 3GY5A 3RXOA 1OS8A 1GJ4H 1PJPA 1EATA 4Y8ZA 3TVJB 4IBLH 1O2WA 1W10U 3OFND 2VWOA 1O3CA 3DA9B 3NXPA 3QDZB 2ZHQH 1NZQH 2ZC9H 3RXJA 3RLYH 1X7AC 1Y3VA 1C5QA 4JZEH 3PTBA 2GD4B 1TFXA 4WMFA 1O38A 4ISIH 2XWAA 2L6OA 1TA6A 1DWBH 1CHOG 3BG4B 1TMTH 4DOQA 4UEHH 2WPLS 3F0OA 3PO1B 1EPTC 5I46H 1TIOA 4Y0YE 3KQEA 3ITIA 5L2ZH 1F0TA 2ZDLA 4A92A 1GBFA 3LOXA 3T2NA 4FU7A 1IOEA 2Z3CA 1SHYA 2C8XB 3UWIA 1BA8B 1QCPA 2IPHA 1ELAA 1H8IH 1FNIA 1BJUA 3T26A 1K2I1 1L4ZA 1OWIA 2Z3DA 3KL6A 1GBKA 2VINA 2R0KA 3U8OH 1FAXA 1BMNH 3CENA 5E8EH 2GMTC 3HGPA 1SGTA 5DP8A 4DJZB 1IAUA 4WJG2 1O2NA 1K9OE 2F9OA 2PKSB 4DGJA 2ZA5A 3K65B 4JYTA 1SGEE 1GBAA 3WWFA 5HKKD 1A7SA 4J1YA 4MVNA 1HAVB 2BD7A 3EGKH 2FX4A 2VIQA 3RXQA 3IITA 1ZSLA 2BOHB 1W0JD 4F4OC 2C8YB 5BRRE 1NU7B 2NU3E 1TQ0B 3T5FH 3MU4A 2PGBB 2OINA 4SGAE 4U32A 1EAUA 2ZZUH 2HNTF 3V3MA 1UVPA 4BAMB 3O8CA 1GVZA 4JK6A 1PQ8A 1VGCB 2OXSA 1O2ZA 2IPQX 2EI7A 3CS7A 2SGAA 3RDZA 1TGTA 2GT8A 2PUXB 1O5AB 1SHHB 4MPUA 2QV1A 1UTNA 2P3UB 3ZZCA 1LCYA 2K8IA 4MDSA 3P6ZB 5PTPA 2A5IA 3KQ5A 4AYVB 1AE8H 1BCUH 2GV6A 1AUTC 1FMGA 5TCAA 1NESE 1DOJA 1K1OA 2ZU4A 3DSPA 5E2OA 2FODA 4AOQA 1GHVH 1C2DA 4GAWA 1UTQA 1QJ7B 3H7OA 1V3XA 3A88A 2ZU5A 1YLNA 4B1TA 5EW2H 1GBTA 1XKAC 2BDHA 4TWWA 1HIAB 1V2MT 1PYTD 3GS9A 5DGJA 3RXGA 1G3CA 1EFRD 4ZMAH 2VVVA 1K1PA 2BY7X 3FZZA 2A4GA 4ZHMU 1G32B 1ACBE 1WTHD 1GJDB 1V2NT 1KY9A 1O33A 2FWWA 3A80A 3I77A 3KQCA 1ZMJA 1HJAB 2A7CA 1QQ4A 1C4V2 2J92A 4H42U 1AVGH 1IQFA 3ZZ5A 1AB9B 2AGIX 7LPRA 1TRYA 3ZVEA 3ZZDA 4CBOA 1PFXC 2JDID 2A45B 3GY7A 2TGTA 3M5LA 9LPRA 2JH6D 1IQLA 2SNWA 3ZZ6A 2M5TA 1KYNA 4AGJA 4B2BA 1A0LA 1GMDG 1EJNA 2ZU3A 1ZTLA 3QTOH 3M5NA 5DPAA 1P2KA 3RXPA 4TSFD 4Z0KA 2OUAA 3EDXB 3U9AH 1GVKB 3F3BA 2VJ1A 2ZO3H 1YYY1 1G9IE 4RSPA 2ZU2A 1PPEE 4MPWA 1OOKB 4B6FA 3GISB 2O8MA 3E6PH 5T3HA 2D2DA 2OP9A 4F55A 1ABIH 1CGJE 1C1UH 1FZZA 1MTNB 5KECA 3BTGE 1LQEA 2HPPH 2VWMA 2YMSD 3OEED 4ZKNU 1K1LA 4NA8A 4X1RU 1ID5H 4KTSA 3RXMA 4NG9H 1EOLA 1C1SA 4FU9A 2ZG0H 1OP0A 5DJ7A 1SQRA 4NIYA 1CT4E 3S7KB 1TMUH 1WCZA 3DFLA 4MNVA 1SPJA 3RU4E 3S0NA 3RP2A 1Q3XA 1EJAA 1YGCH 3ZVAA 2Y5FA 2HPQH 2OD3B 3A8BA 4IS5A 1TRMA 2VWLA 4JMYA 5GDSH 2ZGHA 3PMHB 1G2MA 2B5TB 2GZ9A 2GCTC 1TE0A 1MBQA 3H5CB 3Q77A 3SGQE 3SNAA 3FZDA 3WW7A 1ANBA 2QA9E 1P57B 5FAHA 5JB9S 5F8XA 1S6FA 2ANYA 1FI8A 1C2LA 3EYDA 3ZZAA 4CBNA 5KEDA 1AZ8A 1P09A 2KZ4A 4Q7XA 1O3GA 5G4BA 4K69A 2FZZA 1PQAA 1G37A 2BLQA 4YESB 2Y81A 5GWZA 1TAWA 1QIXB 2SGPE 5C94A 3UNSA 1V2UT 3P8FA 3F2FA 1C2MA 1BQYA 2ZIQH 2TPIZ 4GUXA 1MQ5A 2QIQA 5CMXH 1ANCA 2CHAC 3SUGA 2QF5A 2JKHA 7KMEH 4FVDA 5DP6A 2Z9KA 2WV4A 1SMFE 2RG3A 4GHQA 1MH0A 2AHME 5GPIB 3NK8A 1OYQA 2XC5A 3TJOA 1GJ8B 3SV6A 1KLIH 4AFSA 1A5GH 9ESTA 1OWDA 4FUEA 4Q2KA 4JZDH 3U8TH 1XVOA 3SQHE 1HAYB 4X8VH 3O8BA 4UDWH 1THPB 2F9UA 1AKSA 2Z94A 3AAUA 4OS7A 2ZFFH 1SG8B 2PSYA 1TGBA 7GCHG 1F7ZA 2OQ5A 2BZAA 1SC8U 1PQ7A 5JYIA 1TYNA 1G36A 2AS9A 2KCPA 1W7GH 1YY3A 3A8DA 3SU3A 3ATWA 1BTPA 1CGIE 4TPYA 2WSSD 4Z6AH 8KME2 6GCHG 1YPHC 1S85A 2P95A 4OS1A 1LMWB 4ISHH 1AZZA 4O97A 1O2OA 4NGAH 2J5UA 2ZF0H 1BIOA 1FLEE 1G30B 1GBDA 1KSNA 5B6OA 2H2ZA 4FUCA 4CRCA 3PV5A 4U30A 1UHBA 3GY8A 5B6LA 3ATKA 2C8ZB 2P8OB 1K0HA 3HK3B 3EA8A 3TH4H 4CRBA 1WXRA 4MG3A 3SW2B 1AHTH 6CHAB 2VWNA 1BRBE 3DCLA 3RU4D 1E38B 4OGXA 4FUHA 1T31A 4RT0A 2ANWA 1KTTB 1TNIA 5LPEA 3NUMA 1GBEA 4WVPE 3PYHA 4UFEH 4VGCC 1M9UA 2H6MA 3SJKA 1UTMA 1YKTA 4DIHH 1ZHRA 3U1IB 3T62A 3SV2H 1GHAF 2UUJB 1O32A 2ODPA 3VXFH 4ASHA 2BD3A 1SLWB 3ZVGA 4GVUA 1S0RA 1HV7A 1Y59T 5ESBA 1A2CH 4Q80A 3CNRA 3SU6A 2CJIA 1SB1H 1ETRH 3O8DA 4BAKB 4I8JA 1AIXH 2STBE 3TGIE 3E90B 1MTUA 2ZQ1A 5C1UA 1YPGH 3SU5A 4THNH 1O3JA 2Q6FA 1KDQA 4UFGH 2R2MB 1YC0A 3VB7A 3LH3A 1F5RA 5A0AE 3URCA 4ACAA 1RS0A 2BLVA 1DS2E 1E79D 1IQMA 3SGBE 4O3TA 1LPKB 2EC9H 4I86A 3CP7A 4E06H 3M7QA 4YXWD 2WPIS 2CXVA 4Y0ZE 2V3OH 1P8VC 3ZYEA 3HKJB 2QYIA 3EQ0H 2ZWLH 3SOSA 3QO6A 3ZV8A 1HAXB 5HXFA 1J17T 1MTSA 1WSSH 4IGDA 5SGAE 4ABGA 1J16A 4WH6A 1VR1H 3DHKH 4Y6DA 3TLOA 1GHBF 1HJ8A 1W14U 3BEIB 1AKSB 1ZJDA 1SFIA 1TB6H 1F92A 1FQ3A 1DX5M 2VGCC 4GSOA 4GCHG 4ZROA 3TK9A 1P2NA 1GI4A 1HLTH 4FU8A 2C90B 1P3CA 1RRKA 2JJ2D 1P2MA 2A2QH 2WPMS 4I8GA 5DKMA 4B76A 2OBOA 3RM2H 1L1JA 2GGVB 5EQSA 3K6YA 2VVCA 2XWBI 1CBWB 1XVMA 2ODQA 1O3EA 3MMGA 1GWAA 1GJ6A 1WBGB 2GZ8A 2H9HA 2VBCA 1P2QA 1EAIA 3EE7A 3S69A 1C2KA 4I33A 1NBME 1GJCB 1AWHB 1CA8B 3ZIAD 1BT7A 2F9NA 1DDJA 4ASUD 1DVAH 1UTLM 3RXBA 4DY7B 3RC6A 1EPTA 1FONA 1H1BA 3RXIA 4D7GA 3OU0A 2FOBA 1KXAA 2Q1JA 1YPJH 4B71A 3LDXH 4DCDA 5ETXA 1LVBA 2KCOA 3SV8A 4AFUA 3GCTG 2CGAA 4Y8YA 1LVYA 1UHBB 3FP6E 1E36B 1W11U 1RD3B 5GXPA 1NRPH 1TGNA 1QRWA 2AMQA 3KHVA 5C1XA 3A87A 1O2QA 3P92A 4IMQA 1UVSH 1QA0A 3DSGA 1ZSJA 2V35A 5LGOA 3A7VA 5CHAB 1O3HA 3VGCC 1MQ6A 1DSTA 1SGPE 1ABJH 3MU0A 1SQTA 4OGYA 1MU8B 4WWYA 6ESTA 1A3EH 1O2VA 1OP8A 2XNIA 1YPEH 3BTFE 4K1SA 5IDKA 2FI3E 3F9GA 1TPAE 2HNTE 3QGJA 2ZPSA 2NU1E 1SLUB 1O36A 1SQOA 3KIDU 4AFZA 2LNCA 7ESTE 1L0ZA 3QX5H 2RDEA 3MU1A 3SNBA 1B0FA 1H4WA 5T6GA 2G5NA 2G4UA 1ELBA 1TNKA 1Y5AT 3VB3A 1BMFD 3SORA 3D65E 4AYYB 2A32A 4LOYH 4ZHAA 4DW2U 1MAYA 2W7SA 1EB2A 3A85A 2SGDE 4MPXA 3W95A 1T8OA 5FBEA 1ELVA 3TK5A 3F68H 1KDQB 5E0HA 3ZVBA 1H8HD 2Z6BD 1C5MD 2KCAA 3A8CA 2ANMH 1DWDH 5F8TA 2ZKSA 1HAVA 3A7WA 1YPHE 1GI5A 2Y80A 3D62A 3UWJH 2Y6TA 2GP9B 4FUFA 2A4OA 2FP7B 2ZDAH 3GCHB 4UFDH 1GI9B 3L33A 1TMBH 1XUFA 3D49H 1TOCB 3MO3A 1E37B 2XNDD 1Y5BT 2BY9X 3NZIA 5FXLA 3U69H 2DE8A 2HOBA 1HRTH 3VPKA 3FOAA 1SBWA 1C1RA 2SGFE 3H7TA 3BV9B 1QTFA 1DWCH 4HFPB 2XRCA 1NFXA 1O3IA 3BSQA 3QN7A 1O2RA 1GG6B 2KFWA 1NBMD 3E8LA 1YPKH 4H6TA 5FPSA 5GJ4B 3M7TA 1HIAA 3MU5A 1CA0C 1EPTB 1EKBB 2LPRA 5DO4H 1U6QA 1LHEH 1GBBA 1S81A 1ANEA 1EZSC 1EZXC 2BD5A 1G3DA 1SL3A 5EJZA 1C5PA 2BQWB 4WMDA 1SOZA 1GMHG 3SO3A 4ZKRU 5A8YA 1DLKB 3KEEA 1ZOMA 1F0SA 1P3EA 2BLOA 2ESTE 4YLUA 2OBQA 3AASA 1RXPA 1VITG 3M7UA 1DUEA 2BQ6B 1NRNH 1V6DA 1PPCE 2VIWA 2GMTB 2QAAA 1BBRH 1PQ5A 3CS0A 3LT3A 4HI3A 4O3UA 2H9TH 3PM3A 5JBCS 3K2UA 1O2YA 4XRNA 2BX3A 1CQQA 5EJ1A 1OKXA 1HB0B 1O34A 3BTME 3IG6B 5LH8A 4AZ2B 8GCHF 1WQSA 1GBLA 1LPGB 2GX4A 4I7YH 1FN6A 2D1JA 3A89A 2B7DH 3L3TA 5GIBA 2JETC 2BDBA 4K1EA 2CMYA 2BHGA 2PFEA 3MQKC 2BVXH 3PWBA 3Q76A 5EGMA 3RXUA 3E16B 2W6ID 3M61U 3UUZA 2R2WU 2QF3A 3MHWU 4ISLA 1C1VH 1TBQH 1KXFA 2CF9H 2Y5GA 2QCYA 2C93B 3A7ZA 2XBYA 1MU6B 3BEFB 1BRAA 1YCPK 3SHCH 3UY9A 1BHXB 1HUTH 1CGHA 2ZPRA 1NT1A 3AAVA 1DT2A 1F0RA 3KN2A 2OC7A 3SNCA 4AC9A 4OM9A 2KX4A 2O8WA 4X1QU 2FLRH 1IQHA 3RXEA 3A8AA 1MTWA 1TBRH 1MKWK 1NN6A 3BTEE 4K5ZA 3SUEA 3NWUA 1MUEB 1LHFH 1WV7H 2Z9JA 3BG4C 5FPTA 4DIIH 1GBIA 1W12U 1IQNA 2R0LA 3MNCA 2A5KA 4X2YA 1PPHE 2O8UA 2QF0A 1Z8GA 2PV9B 3SNEA 3E3TA 2GTBA 3QUMP 2BDYA 1FN8A 3TPIZ 4D9QA 2GT7A 3TU7H 2HWLB 1KTSB 1S6HA 2Z9IA 2KAIB 4FUGA 1C1MA 4TY6A 1O2JA 1T7CA 1YPLH 1WQVH 1MAXA 4U01A 2QXIA 3PROA 3RU4T 2ZFSA 2BDAA 3GYMA 4X1PU 4X6MA 4UE7H 4X1SU 4DG4A 5DSFA 2FOMB 2GVFA 1BTWA 1RIWB 3QTVH 1XUGA 2H5CA 2GCHF 3PLPA 1GGDC 2PKSC 3NPSA 1P10A 1E34B 2G5VA 2SFAA 4KP0A 3HK6B 1TRNA 1MBMA 3SUFA 5IYTA 1F2SE 4OS6A 1BZXE 1VCPA 3I29A 4KELA 1L4DA 2I6QA 3P95A 1O2GH 2FI4E 3S9CA 2YNAA 4OS5A 3RXAA 1QRZA 4CRFA 2VH0A 4K8BA 3UQVA 5FPYA 4ABBA 5E0JA 4MTBA 3UOPA 3Q3KA 5C67A 1MMJN 3MI4A 1QB1A 4AG2A 1ZMNA 4K2YA 1UK2A 3QLPH 2QXHA 5HM9A 1BBRK 3ZVDA 2HGTH 1W0YH 2L74A 2QE7D 1N6XA 3GICB 1K1MA 1SGYE 3LJJA 4XE4A 4LZ1H 2BD4A 1T8LA 2J94A 2QF4A 3VEQB 2WHXA 3LGIA 3NCLA 2FM2A 3LH1A 2F9BH 2PUQH 1Q31A 1EP5A 1P05A 1MKXH 4BAOB 1GDUA 2GCTB 4DURA 2SNVA 2HRVA 2ZTXA 3ZZ8A 3V12A 5LPFA 3DD2H 4KGAA 1MCTA 4AORA 1BTUA 1TLDA 2XTTB 1D6WA 5C0TA 3BTTE 4XFQA 1A5IA 4GPGA 3RXTA 3BTDE 3RMNH 2P59A 1JRSA 2G52A 2UUYA 1D4PB 1ESBA 5FX5A 1O3OA 2TGPZ 1H9HE 1OX1A 2CHAB 5JBBS 3OSYA 1ZGVA 1GL0E 4Q63A 1E0FD 3KQBA 5TCCA 5F6MA 2ZCHP 1P0SH 2C8WB 1DUAA 4LK4A 4RKOB 2NU2E 1TPOA 3HPTB 4ZKSU 2ZP0H 4MNYA 4TWYA 4YT7H 5JPMH 1NRQH 1K1IA 1C5SA 2H1UA 1AE5A 1FIWA 2FDAA 1ELCA 2QC2A 3F1SB 2FOCA 3EA9A 3OTPA 1MABB 1TA2A 1C2FA 2SGEE 1K21H 1FY8E 4O9VA 5T1VA 2AYWA 2GKVE 1TX8A 1UCYE 3QGNB 1N8OC 1T8MA 3F0PA 1MTNC 3EAJA 1DWEH 1XM1A 4ABFA 3SV7A 4XDEA 2NU0E 1GBMA 4TY7A 2P3FH 2FEQH 1KXDA 3MH4A 2W3IA 1XMNB 1DICA 5DP9A 3K9XB 1EAWA 5HIYA 1PPZA 2HNTC 1HNEE 4XSKU 4NCYA 3Q00A 2ZFTA 1GI0A 2I6SA 5J4QA 4FUIA 1P12E 1UVUH 1LHCH 3HKIB 5AVDA 1GHYH 2G4TA 3SYJA 5C5OA 2EA3A 2BLWA 1C4U2 5DP4A 2G55A 2FS8A 1NROH 1P03A 4RKJB 1TNLA 4X6OA 4YO9A 3S7HB 3SGAE 4CH8B 1XUHA 4XBBA 1TX6A 1O2MA 4YOJA 2P94A 4TT3D 1SVPA 5A0BA 1MD7A 3NRLA 1GHWH 4MNXA 4D9RA 3RXFA 3SBKA 5HMAA 4BNRA 2BTCE 2C4FH 2ZPQA 8ESTE 4BXWA 3OY6U 2GDDA 1H8ED 5A09A 4Y7BA 3BN9A 1L1GA 2ZHDA 3UQOA 3V7TA 1C2HA 3MO9A 4ABEA 4TPIZ 1N1LA 4RT1A 1F0UA 2WPDD 4VGCB 5AFYH 2D8WA 1UTJA 3TITA 4AX9H 2F91A 2BM2A 3UB0A 1MKXK 1TNJA 2CN0H 4JCNA 1SLXB 1TGSZ 3UOUA 5AF9H 3R3GB 2W5EA 1AN1E 2BVSH 1O3KA 1EQ9A 4JYVH 1NC6A 1GJBB 2BY5X 4NSYA 1AGJA 4X0WU 5DP5A 2RDLA 5EG4A 3GYLB 4CHAC 5EIYA 3N7EA 4INHA 5DP3A 1YCPM 5C1YA 2FTMA 3A7TA 4A1TA 1HAOH 2M2AA 1BRUP 1CU1A 5KGOA 2EI6A 3SI4H 1DY8A 5H4IB 1W8BH 4DT4A 3BG8A 1DE7H 2EEKA 1ZTKA 2ZGCA 2ZFRH 2XOKD 1H8DH 4Y10E 2WPJS 4Y11E 1D3DB 5C5NA 3P8GA 4A1XA 1CT0E 4BOHA 3BTWE 5LPRA 2KM0A 1GMCF 1F5KU 1O2IA 3E1XB 1NFWA 3SV9A 4CR9A 1GI2A 1ANDA 2DE9A 4XBDA 5DG6A 3HGNA 2A4QA 2WINI 3PMAB 5T6FA 1G2LA 1VCQA 2VGCB 1C1TA 1NM6A 3OEHD 5EODA 1GCTC 1WOFA 1YPMH 3UNQA 2Z3EA 4Y8XA 1D3PB 1O2XA 2FXRA 2PTCE 4XBCA 1AMHA 1V2WT 1ZSKA 3DSOA 2YMSB 1WU1A 4F49A 5EQQA 1VJ9U 2H5DA 2PTNA 4FUBA 6CHAC 2JJ1D 3BIVH 3GCOA 3F9HA 1KXCA 1C5RA 1ZMLA 2RA0A 2WPHS 1SGIB 5EXNA 4X2WA 1DXWA 4MLFB 3EE0B 4ABJA 1QL7A 3N7DA 3ODFA 1AFEH 2ZI2H 3GCNA 3GDSA 6LPRA 4DT7B 5JDUB 4X1NU 1W2KH 3UR9A 4Y7AA 5GCHF 4YTAA 2IJD1 2BB4A 5C20A 1T4VH 3JZ1B 1O2LA 1EUFA 2H9EH 5DN6D 2WPKS 1GDNA 3W1EA 1O2KA 4YOGA 4HTCH 4UD9H 1UK3A 1GI7B 4M7GA 1C5TA 1GHBG 1O3LA 1W0ZU 1HAHH 5I25A 1FPCH 1TNHA 2A1DB 2STAE 1HBTH 2TGAA 5HGGA 5JBAS 1OHHD 3SU2A 2ZGJA 3TH3H 2OLGA 3LU9B 3RMLH 3WWBA 3UAIC 2GV7A 4K60A 1ELFA 2J4IA 3P70B 2PLXA 2ZU1A 4ZUHA 3MH6A 4BTUB 2FLBH 1DXPA 1O3PB 1P9UA 4H6SB 5FX6A 3GCTF 4FETA 2ZDKA 4K3JA 4KKDA 3LC5A 1E1RD 4Q4LA 1P9SA 2R3UA 1QNJA 2F83A 2ZHFH 1CSOE 1O5EH 1OP2A 1GHZA 2XW9A 3UIRA 5EW1H 1QL9A 4WF8A 1A46H 3UREA 2V3MA 4ZH8A 4ZCNA 1HYLA 1HAGE 5K0HA 2Y5HA 1TONA 2ANKH 4YT6H 5ESTE 4Y76A 1CBWC 1SGCA 3M3SA 2TGDA 3PMJA 1S82A 3SI3H 1ORFA 1YLDA 3A7YA 3TGKE 1NRSH 2HLDD 2W6JD 1K28D 5F8ZA 2G81E 3SJ9A 2FPZA 1SI5H 1C2GA 3M5OA 3L6PA 2A7JA 5HIZA 1Z7KA 2J98B 5A0CA 1Q2WA 1AFQC 2TBSA 3FO8D 1GJ5H 1QBVH 3A7XA 1C1WH 4Z1MD 2FOGA 1HAZB 8LPRA 1UW7A 1QRXA 1EAXA 3AVZA 1HPGA 3STJA 3ESTA 1MZDA 1S84A 2BXTH 3PRDA 3PWCA 4R0IA 2Z9GA 2F3CE 1XUJA 1O3DA 1P2IA 3MNSA 5TJXA 5EXMA 1BHXF 3C1KA 2FYRA 1GL1A 5FCRA 1CA0B 1Z1IA 1C2IA 4LZ4B 3P17H 5EPNA 1K1JA 3UPEA 3RXLA 3GY6A 2RA3A 1AU8A 1EX3A 1SGFA 2KAIA 4OS4A 4B2CA 4JZ1A 1VITH 3F2GA 3SNDA 3B9FH 3E0PB 1TNGA 1AUJA 2BY8X 5JB8S 3LGTA 3ZZ3A 1C1QA 1Z8JB 3RC4A 3VG8A 3LGVA 1EZUC 2VVUA 2PW8H 3UNRA 3BTKE 2O8LA 2YOLA 4BTTB 1SGFG 2AIPA 1HFDA 2P16A 4B75A 1YLCA 3OY5U 1O35A 1ZPCA 1QR3E 1HAPH 1O5CB 3U98H 3H09A 2O9QA 2FOAA 1HJ9A 1CHGA 4JZIA 4NIXA 1D3TB 1FUJA 4IN2A 1SSXA 1GBHA 1O31A 4OS2A 1BTHH 2G51A 2QY0B 1W13U 2BQ7B 2ZFQH 1IQJA 4FVBA 1DSUA 2JETB 3LGUA 1W7XH 3Q3XA 1GMHF 4WY3A 5A8XA 5F03A 1DLEA 1JWTA 3V0XA 5C3NA 2G00A 3GOVB 2PKAA 1A4WH 3AK5A 4BTIB 2EY4C 3WY8A 1QFKH 2BMGB 3SU4A 1HCGA 1LQDB 1O2SA 1OWHA 2R3YA 3RXVA 1LKBA 1CO7E 1CHOF 1ZPBA 1LKAA 2UUKB 2Y7ZA 3ATMA 3VXEH 2B8OH 5IK2D 1VCWA 1ARBA 2BD9A 1ESTA 4GHTA 3M3TA 1P02A 5EPYA 3OX7U 1A1RA 2Q6GA 5A2MH 3PLKA 1A5HA 1GG6C 1BTYA 2ZCLP 3UFAA 4CRGA 2DUCA 1V2OT 2ZTZA 2IOTA 3ZV9A 4NIWA 1UMAH 3LC3A 3P8OA 4P02A 3RMOH 2TIOA 1O5FH 4ZXYH 2FOFA 4X6PA 1J8AA 8GCHG 1KXBA 1WUNH 1C5LH 3MOCA 1C5NH 3RXSA 1TPSA 4KTUA 1D9IA 1NTPA 1UTKA 2OCVB 3GY2A 5J4SA 1C5WB 1HGTH 1ZR0A 1Z71A 2CV3A 2WZQA 1EASA 2V3HH 1UO6A 3DFJA 1YM0A 4PROA 2V7QD 4J2YB 1FDPA 3S9AA 4QT8C 2FOHA 1O5BB 1Y3WA 4ZAEA 1GGDB 4HGCA 1HAIH 3T25A 1YP9A 1FAKH 2EQNA 4B6EA 3G01A 1O5GH 1JBUH 3PO1C 4BXSA 3FANA 1O2UA 4MQAA 1NS3A 2BDCA 2A4RA 3LONA 1O3NA 1ARCA 3TH2H 3P8NA 1TGCA 3RXDA 2HVYB 1J14A 2JIZD 4M9FA 3A81A 4CRAA 5AHGH 2WYJA 3FVFB 4AN7A 1ESAA 2W3KA 2Q6DA 4WMEA 2P93A 1T4UH 2ALVA 5CHBA 3RMMH 1W3CA 4E7NA 2ZQ2A 3DT0H 1SGDE 1GJ9B 2BOKA 3KF2A 2FI5E 3M37A 5ABWA 4H4FA 1ZPZA 5L2YH 1EB1H 1QL8A 3VB5A 2PWXA 2K1QA 3LGYA 3PLBA 1SGQE 1Y3XA 4YLQH 4NFFA 3BTQE 1OWJA 4ZHLU 3MNBA 1LHGH 3F9FA 2SGQE 1N6YA 4MPVA 2XBWA 2GCHG 2HVXA 2C3SA 3FP7E 1ZHPA 3TJNA 1XKBC 2OQUA 2A5AA 4NZQA 1KLTA 1JIMA 1O2PA 1QBOA 2PKAB 1YBWA 2BXUH 1UJ1A 4UONA 3A84A 1MTVA 3OE7D 4D76A 1IHTH 2A2XH 1B5GH 5CDFE 3A86A 1DANH 1VGCC 2XCFA 1EJMA 1QGFA 1GDQA 3ZZBA 1GPZA 2GZ7A 2FIRH 2RCEA 1KLJH 3BF6H 2AFQB 3PV4A 4ISNA 4ABDA 3U1JB 1GMDF 1P11E 3QZRA 1ELDE 1ELTA 2AMDA 5EQRA 1GI6A 2AEIH 3Q3YA 3RUOA 4B74A 4NWLA 4E05H 1RIWC 2F4LA 2GJGA 4WH8A 1NPMA 4SGBE 1QB9A 2ODYB 1F5LA 5FL7D 5C17A 3MO6A 3QWCH 1COWD 1Z6EA 1TQ7B 4E7RG 4A7IB 2PP6A 1IQKA 1S83A 2FO9A 2ZGXH 4I31A 2HALA 2ZDVH 1FY3A 1RJXB 4BAQB 4IC5A 3RXRA 5E0GA 3MH5A 5JBTA 1JRTA 1ZRBA 2ZGBH 1JMOH 3T28A 1BOQA 1V2TT 2K0QA 2CF8H 2TRMA 1C1PA 1Z1JA 1S5SA 3JZ2B 1K22H 3KYGA 1HJAC 4I8HA 1ZTJA 4AGKA 1LDTT 5T6DA 1AB9C 3SU1A 4I8KA 1QURH 1CVWH 1N8OB 1SR5C 1C1NA 2ASUB 2WYGA 5A8ZA 1O0DH 1GBCA 4D8NA 1YF4A 2VU8E 3M3VA 4WXVA 3U8RH 1P04A 3GDUA 2JH0D 1ELEE 3GDVA 3D23A 1S0QA 2PGQB 3BTHE 2BYAX 2RFKC 2A7HA 3R0FA 1DPOA 4ESTE 3MH7A 1AY6H 1BUIA 1ZLRA 1XUKA 2Z9LA 1PPBH 4CH2B 2R9PA 1JIRA 2QN5T 1G3EA 4IC6A 1O3BA 5CE1A 2QXJA 1GVLA 2FTLE 1CE5A 1LPZB 1SLVB 1BJVA 1UTPA 2O8TA 1GJAB 1C2JA 3FFGA 4NWKA 1FY5A 1THSH 1ZZZA 5L6NH 1ZYOA 1FIZA 2AGGX 3STIA 1V2KT 4A1VA 4ABAA 1A61H 1ETTH 4I32A 4TYDA 5FCKA 2FMJA 1BB0B 1LVMA 1INCA 1ETSH 1Y3UA 1AVWA 3N99A 3K6ZA 1P01A 4RN6A 3SU0A 2UUFB 2V0BA 4P00A 1IQEA 1B0EA 1XXDA 2HLCA 1RTKA 3T27A 1VKYA 1EXFA 1C9TA 3EA7A 3RXCA 1SKYE 1BRCE 3TNSA 1QA7A 2F9PA 3MU8A 1BTXA 7GCHF 3FN8A 1ZHMA 3S9BA 2A0QB 1OSSA 1C5ZB 1LHDH 2QGRA 2XC0A 2PSXA 2XYAA 3F6UH 1EOJA 4CHAB 3TIUA 2XCNA 2BDGA 1HXEH 3FKSD 4FXGH 1WAYB 5E2PA 1WYKA 2WUCA 1FXYA 3M35A 1MD8A 2CK3D 2PHBA 1JXPA 4U2WA 2EI8A 6GCHF 1MZAA 1QQUA 1NY22 3VB6A 4FUDA 4BANB 3SZNA 1T8NA 1DM4B 4ABIA 5BPEA 2WUBA 1YWUA 1C1OA 4HG6A 3ZZ7A 1O37A 1AQ7A 4RI0A 2J2UA 2WV9A 3BEUA 2BD2A 1W0KD 1AWFH 1THRH 2OC8A 2ZHEH 3ELAH 3A82A 4R8TB 3KGPA 1JOUB 1QBNA 4X2VA 3SN8A 1G3BA 2BVRH 3PRBA 2FOEA 3TK6A 1O2HA 2KR7A 1Y8TA 1GCTB 1O2TA 3MFJA 4IN1A 2W26A 1DFPA 3RLWH 4A5TS 1Z8RA 2XBXA 3LPRA 3NKKA 4X8TH 1OWEA 3ZZ9A 1GI8B 4ISOA 4MNWA 4AB8A 2IN2A 1GI3A 1HXFH 1ZGIA 4GLYA 1VZQH 1O3MA 2VIOA 3ZVFA 4Q7YA 4A6LA 3RM0H 1XUIA 2UWOA 2ZHWH 3U28C 3SQEE 5K7RA 1OWKA 2NU4E 1EP6A 2AGEX 5HM2A 3PTNA 2J98A 4X8UH 5FBIA 3GY3A 1LVOA 1C5VA 1GHAG 1NU9A 2OTVA 3IWMA 4YZUA 1QB6A 1C5XB 2BD8A 1ELGA 1BMMH 3ODDA 1IQIA 1PYTC 2Y82A 5FHTA 3QZQA 1NRRH 4ZXXH 1FJSA 1GMCG 1V2RT 2NWNA 1BMAA 2W7UA 3OYPA 1KXEA 2P8OC 4NA9H 2VIDA 4DVAU 1O5DH 2ZTYA 1Z8IB 1V2JT 3LIWA 1V2PT 3N7OA 1TALA 4KTCA 1H9LB 3I78A 1LO6A 4NSVA 3SZEA 2J9NA 4CR5A 2V6NA 3KQDA 3DUXH 3KCGH 2YNBA 3PMBB 3SJ8A 1H9IE 1UVTH 2THFB 4AG1A 1XXFA 2GDEH 1TPPA 1UCYH 3B8JA 1T32A 2XBVA 2J95A 4GCHF 1SOTA 4X6NA 1TBZH 1SFQB 1RTFB 4K8YA 2J34A 2Y7XA 1A3BH 3FP8E 5F53A 2ALPA 1UVOA 1WTGH 2ILNA 2F43B 2BZ6H 3UTUH 3E91A 5EJLA 1C5YB 1OXGA 5GCHG 1E1QD 2PR3A 5AFZH 3C27B 4NIVA 3ZYDA 2WV5A 3MYWA 1PPGE 3ZVCA 1DITH 4ACBA 3ATIA 3VGCB 1QZ8A 3A83A 1IHSH 3UR6A 4IMZA 4INKA 3VFEA 4X2XA 1GBJA 3OTJE 1GHXH 1P2OA 3SJOA 1SQAA 3ATLA 2XC4A 2BY6X 2YMSC 5DK1A 3LGWA 3TJVA 2ZFPH 2ZNKH 4BAHB 1BBRE 4INLA 4K1TA 2UWLA 2VB0A 1AD8H 4X8SH 1KIGH 5C2ZA 1J15A 2AMPA 1WDIA 3RXHA 2ZDNA 1TOMH 2VIPA 2FYQA 1KMHB 1QJ1B 1C4Y2 3M36A 1Y5UT 2BDIA 2FS9A 3F9EA 1AFQB 2QXGA 3MNXA 5DP7A 1NO9H 1O30A 2J38A 2OC0A 4JK5A 1P06A 2LELA 1O3AA 1FV9A 1OYTH 1QHRB 1NFYA 2A31A 3F2HA 5GNDA 2P3TB 1BDAA 4B73A 5C0UA 2D26C 1RFNA 3T29A 1Z6JH
chains in the Genus database with same CATH topology
1ZJKA 2ZEBA 1SGNE 1V2QT 4IW4E 1A0HB 2XXLA 3LKWA 1D6RA 3ENSB 1BTZA 2VH6A 3RC5A 2Z7FE 4Y71A 3TJUA 1V2ST 3ZZ4A 3BIUH 2UWPA 1C9PA 4LXBH 1QJ6B 3LJOA 3M5MA 4O03A 3AW1A 4NA7A 1NFUA 5EOKA 3B23B 3TNTA 4WXIA 1ZRKA 1DY9A 4I8LA 3KNXA 1C5OH 3GY4A 1BMLA 3E0NB 3URDA 1HDTH 2ZDMA 3PB1E 2G8TA 1YCPH 3SHAH 3AW0A 1TABE 4Q7ZA 4UFFH 5CHAC 1E35B 1GJ7B 1V2LT 1BITA 3VB4A 1L1NA 3V13A 1GI1A 4CREA 1RGQA 1UTOA 2VIVA 4Y79A 3O8RA 1B7XB 2VNTA 3MTYA 3FAOA 4JZFH 1MKWH 1QY6A 2F9VA 1SGRE 1FY1A 1V2VT 4JYUH 1UCYK 2FX6A 3SJIA 3MWIU 1J9CH 3HATH 3TGJE 1GCDA 2AH4X 2IJOB 2ZECA 1Y3YA 4D7FA 2ULLA 1IQGA 1MCVA 5EXLA 4ZKOU 1O39A 4AFQA 1FPHH 1PPFE 1A0JA 2B9LA 1RTLA 4XOJA 4NFEA 5EU8A 5HYOA 1TX7A 1AO5A 4YM9A 1VJAU 3QK1A 2JH5D 1L2EA 4ABHA 4FUJA 2AERH 2ZCKP 1FY4A 1TWXB 1P2JA 2AIQA 1LTOA 1O3FA 2FESH 4B2AA 1K1NA 4YOIA 3W94A 3RXKA 2OC1A 1C2EA 2BX4A 1XX9A 3SUDA 2B0FA 1AI8H 1OPHB 5L30H 1C5UA 3GCHC 1UK4A 4CRDA 1CT2E 4NZLA 4HZHA 4AB9A 1AVXA 1D3QB 1VITF 1EZQA 3GY5A 3RXOA 1OS8A 1GJ4H 1PJPA 1EATA 4Y8ZA 3TVJB 4IBLH 1O2WA 1W10U 2VWOA 1O3CA 3DA9B 3NXPA 3QDZB 2ZHQH 1NZQH 2ZC9H 3RXJA 3RLYH 1X7AC 1Y3VA 1C5QA 4JZEH 3PTBA 2GD4B 1TFXA 4WMFA 1O38A 4ISIH 2XWAA 1TA6A 1DWBH 1CHOG 3BG4B 1TMTH 4DOQA 4UEHH 2WPLS 3PO1B 1EPTC 5I46H 1TIOA 4Y0YE 3KQEA 3ITIA 5L2ZH 1F0TA 2ZDLA 4A92A 1GBFA 3LOXA 3T2NA 4FU7A 1IOEA 2Z3CA 1SHYA 2C8XB 3UWIA 1BA8B 1QCPA 2IPHA 1ELAA 1H8IH 1FNIA 1BJUA 3T26A 1K2I1 1L4ZA 1OWIA 2Z3DA 3KL6A 1GBKA 2VINA 2R0KA 3U8OH 1FAXA 1BMNH 3CENA 5E8EH 2GMTC 3HGPA 1SGTA 5DP8A 4DJZB 1IAUA 4WJG2 1O2NA 1K9OE 2F9OA 2PKSB 4DGJA 2ZA5A 3K65B 4JYTA 1SGEE 1GBAA 1A7SA 4J1YA 4MVNA 1HAVB 2BD7A 3EGKH 2FX4A 2VIQA 3RXQA 3IITA 1ZSLA 2BOHB 4F4OC 2C8YB 5BRRE 1NU7B 2NU3E 1TQ0B 3T5FH 3MU4A 2PGBB 2OINA 4SGAE 4U32A 1EAUA 2ZZUH 2HNTF 3V3MA 1UVPA 4BAMB 3O8CA 1GVZA 4JK6A 1PQ8A 1VGCB 2OXSA 1O2ZA 2EI7A 3CS7A 2SGAA 3RDZA 1TGTA 2GT8A 2PUXB 1O5AB 1SHHB 4MPUA 2QV1A 1UTNA 2P3UB 3ZZCA 1LCYA 4MDSA 5PTPA 3P6ZB 2A5IA 4AYVB 1AE8H 1BCUH 2GV6A 1AUTC 1FMGA 5TCAA 1NESE 1DOJA 1K1OA 2ZU4A 5E2OA 2FODA 4AOQA 1GHVH 1C2DA 4GAWA 1UTQA 1QJ7B 3H7OA 1V3XA 3A88A 2ZU5A 4B1TA 5EW2H 1GBTA 1XKAC 2BDHA 4TWWA 1HIAB 1V2MT 1PYTD 5DGJA 3RXGA 1G3CA 4ZMAH 2VVVA 1K1PA 2BY7X 3FZZA 2A4GA 4ZHMU 1G32B 1ACBE 1WTHD 1GJDB 1V2NT 1KY9A 1O33A 2FWWA 3A80A 3I77A 3KQCA 1ZMJA 1HJAB 2A7CA 1QQ4A 1C4V2 2J92A 4H42U 1AVGH 1IQFA 3ZZ5A 1AB9B 2AGIX 7LPRA 1TRYA 3ZVEA 3ZZDA 4CBOA 1PFXC 2A45B 3GY7A 2TGTA 3M5LA 9LPRA 2JH6D 1IQLA 2SNWA 3ZZ6A 2M5TA 1KYNA 4AGJA 4B2BA 1A0LA 1GMDG 1EJNA 2ZU3A 1ZTLA 3QTOH 3M5NA 5DPAA 1P2KA 3RXPA 4Z0KA 2OUAA 3EDXB 3U9AH 1GVKB 2VJ1A 2ZO3H 1YYY1 1G9IE 4RSPA 2ZU2A 1PPEE 4MPWA 1OOKB 3GISB 2O8MA 3E6PH 5T3HA 2D2DA 2OP9A 1ABIH 1CGJE 1C1UH 1FZZA 1MTNB 3BTGE 1LQEA 2HPPH 2VWMA 4ZKNU 1K1LA 4NA8A 4X1RU 1ID5H 4KTSA 3RXMA 4NG9H 1EOLA 1C1SA 4FU9A 2ZG0H 1OP0A 5DJ7A 4NIYA 1CT4E 3S7KB 1TMUH 1WCZA 3DFLA 4MNVA 1SPJA 3RU4E 3S0NA 3RP2A 1Q3XA 1EJAA 1YGCH 3ZVAA 2Y5FA 2HPQH 2OD3B 3A8BA 4IS5A 1TRMA 2VWLA 4JMYA 5GDSH 2ZGHA 3PMHB 1G2MA 2B5TB 2GZ9A 2GCTC 1TE0A 1MBQA 3H5CB 3Q77A 3SGQE 3SNAA 3FZDA 1ANBA 2QA9E 1P57B 5FAHA 5JB9S 5F8XA 1S6FA 2ANYA 1FI8A 1C2LA 3EYDA 3ZZAA 4CBNA 1AZ8A 1P09A 4Q7XA 1O3GA 5G4BA 4K69A 2FZZA 1PQAA 1G37A 2BLQA 4YESB 2Y81A 5GWZA 1TAWA 1QIXB 2SGPE 3UNSA 1V2UT 3P8FA 1C2MA 1BQYA 2ZIQH 2TPIZ 4GUXA 1MQ5A 2QIQA 5CMXH 1ANCA 2CHAC 3SUGA 2JKHA 7KMEH 4FVDA 5DP6A 2Z9KA 2WV4A 1SMFE 2RG3A 4GHQA 1MH0A 5GPIB 3NK8A 1OYQA 2XC5A 3TJOA 1GJ8B 3SV6A 1KLIH 4AFSA 1A5GH 9ESTA 1OWDA 4FUEA 4Q2KA 4JZDH 3U8TH 1XVOA 3SQHE 1HAYB 4X8VH 3O8BA 4UDWH 1THPB 2F9UA 1AKSA 2Z94A 3AAUA 4OS7A 2ZFFH 1SG8B 2PSYA 1TGBA 7GCHG 1F7ZA 2OQ5A 2BZAA 1SC8U 1PQ7A 5JYIA 1TYNA 1G36A 2AS9A 1W7GH 3A8DA 3SU3A 3ATWA 1BTPA 1CGIE 4TPYA 4Z6AH 8KME2 6GCHG 2P95A 1YPHC 1S85A 4OS1A 1LMWB 4ISHH 1AZZA 4O97A 1O2OA 4NGAH 2ZF0H 1BIOA 1FLEE 1G30B 1GBDA 1KSNA 5B6OA 2H2ZA 4FUCA 4CRCA 4U30A 1UHBA 3GY8A 3ATKA 2C8ZB 2P8OB 3HK3B 3EA8A 3TH4H 4CRBA 4MG3A 3SW2B 1AHTH 6CHAB 2VWNA 1BRBE 3RU4D 1E38B 4OGXA 4FUHA 1T31A 2ANWA 1KTTB 1TNIA 5LPEA 3NUMA 1GBEA 4WVPE 3PYHA 4UFEH 4VGCC 1M9UA 2H6MA 3SJKA 1UTMA 1YKTA 4DIHH 1ZHRA 3U1IB 3T62A 3SV2H 1GHAF 2UUJB 1O32A 2ODPA 3VXFH 4ASHA 2BD3A 1SLWB 3ZVGA 4GVUA 1S0RA 1HV7A 1Y59T 5ESBA 1A2CH 4Q80A 3SU6A 2CJIA 1SB1H 1ETRH 3O8DA 4BAKB 4I8JA 1AIXH 2STBE 3TGIE 3E90B 1MTUA 2ZQ1A 5C1UA 1YPGH 3SU5A 4THNH 1O3JA 2Q6FA 1KDQA 4UFGH 2R2MB 1YC0A 3VB7A 3LH3A 1F5RA 5A0AE 3URCA 1RS0A 2BLVA 1DS2E 1IQMA 3SGBE 4O3TA 1LPKB 2EC9H 3CP7A 4E06H 3M7QA 2WPIS 2CXVA 4Y0ZE 2V3OH 1P8VC 3ZYEA 3HKJB 2QYIA 3EQ0H 2ZWLH 3SOSA 3QO6A 3ZV8A 1HAXB 5HXFA 1J17T 1MTSA 1WSSH 4IGDA 5SGAE 4ABGA 1J16A 4WH6A 1VR1H 3DHKH 4Y6DA 3TLOA 1GHBF 1HJ8A 1W14U 3BEIB 1AKSB 1ZJDA 1SFIA 1TB6H 1F92A 1FQ3A 1DX5M 2VGCC 4GSOA 4GCHG 4ZROA 3TK9A 1P2NA 1GI4A 1HLTH 4FU8A 2C90B 1P3CA 1RRKA 1P2MA 2A2QH 2WPMS 4I8GA 5DKMA 4B76A 2OBOA 3RM2H 1L1JA 2GGVB 5EQSA 3K6YA 2VVCA 2XWBI 1CBWB 1XVMA 2ODQA 1O3EA 3MMGA 1GWAA 1GJ6A 1WBGB 2GZ8A 2H9HA 1P2QA 1EAIA 3S69A 1C2KA 4I33A 1GJCB 1AWHB 1CA8B 1BT7A 2F9NA 1DDJA 1DVAH 1UTLM 3RXBA 4DY7B 3RC6A 1EPTA 1FONA 1H1BA 3RXIA 4D7GA 3OU0A 2FOBA 1KXAA 2Q1JA 1YPJH 4B71A 3LDXH 4DCDA 5ETXA 1LVBA 3SV8A 4AFUA 3GCTG 2CGAA 4Y8YA 1LVYA 1UHBB 3FP6E 1E36B 1W11U 1RD3B 5GXPA 1NRPH 1TGNA 1QRWA 2AMQA 3KHVA 5C1XA 3A87A 1O2QA 3P92A 4IMQA 1UVSH 1QA0A 1ZSJA 2V35A 5LGOA 3A7VA 5CHAB 1O3HA 3VGCC 1MQ6A 1DSTA 1SGPE 1ABJH 3MU0A 1SQTA 4OGYA 1MU8B 4WWYA 6ESTA 1A3EH 1O2VA 1OP8A 2XNIA 1YPEH 3BTFE 4K1SA 5IDKA 2FI3E 3F9GA 1TPAE 2HNTE 3QGJA 2ZPSA 2NU1E 1SLUB 1O36A 1SQOA 3KIDU 4AFZA 2LNCA 7ESTE 1L0ZA 3QX5H 3MU1A 3SNBA 1B0FA 1H4WA 5T6GA 2G5NA 2G4UA 1ELBA 1TNKA 1Y5AT 3VB3A 3SORA 4AYYB 3D65E 2A32A 4LOYH 4ZHAA 4DW2U 1MAYA 2W7SA 1EB2A 3A85A 2SGDE 4MPXA 3W95A 1T8OA 5FBEA 1ELVA 3TK5A 3F68H 1KDQB 5E0HA 3ZVBA 2Z6BD 1C5MD 3A8CA 2ANMH 1DWDH 5F8TA 2ZKSA 1HAVA 3A7WA 1YPHE 1GI5A 2Y80A 3D62A 3UWJH 2Y6TA 2GP9B 4FUFA 2A4OA 2FP7B 2ZDAH 3GCHB 4UFDH 1GI9B 3L33A 1TMBH 1XUFA 3D49H 1TOCB 3MO3A 1E37B 3NZIA 1Y5BT 2BY9X 5FXLA 3U69H 2DE8A 2HOBA 1HRTH 3VPKA 1SBWA 1C1RA 2SGFE 3H7TA 3BV9B 1QTFA 1DWCH 4HFPB 2XRCA 1NFXA 1O3IA 3BSQA 3QN7A 1O2RA 1GG6B 3E8LA 1YPKH 4H6TA 5FPSA 5GJ4B 3M7TA 1HIAA 3MU5A 1CA0C 1EPTB 1EKBB 2LPRA 5DO4H 1U6QA 1LHEH 1GBBA 1S81A 1ANEA 1EZSC 1EZXC 2BD5A 1G3DA 1SL3A 1C5PA 2BQWB 4WMDA 1SOZA 1GMHG 3SO3A 4ZKRU 5A8YA 1DLKB 3KEEA 1ZOMA 1F0SA 1P3EA 2BLOA 2ESTE 4YLUA 2OBQA 3AASA 1RXPA 1VITG 3M7UA 1DUEA 2BQ6B 1NRNH 1V6DA 1PPCE 2VIWA 2GMTB 2QAAA 1BBRH 1PQ5A 3CS0A 3LT3A 4HI3A 4O3UA 2H9TH 3PM3A 5JBCS 3K2UA 1O2YA 2BX3A 1CQQA 1OKXA 1HB0B 1O34A 3BTME 3IG6B 5LH8A 4AZ2B 8GCHF 1WQSA 1GBLA 1LPGB 2GX4A 4I7YH 1FN6A 2D1JA 3A89A 2B7DH 3L3TA 5GIBA 2JETC 2BDBA 4K1EA 2CMYA 2BHGA 2PFEA 2BVXH 3PWBA 3Q76A 5EGMA 3RXUA 3E16B 3M61U 3UUZA 2R2WU 2QF3A 3MHWU 4ISLA 1C1VH 1TBQH 1KXFA 2CF9H 2Y5GA 2QCYA 2C93B 3A7ZA 2XBYA 1MU6B 3BEFB 1BRAA 1YCPK 3SHCH 3UY9A 1BHXB 1HUTH 1CGHA 2ZPRA 1NT1A 3AAVA 1DT2A 1F0RA 3KN2A 2OC7A 3SNCA 2O8WA 4X1QU 2FLRH 1IQHA 3RXEA 3A8AA 1MTWA 1TBRH 1MKWK 1NN6A 3BTEE 4K5ZA 3SUEA 3NWUA 1MUEB 1LHFH 1WV7H 2Z9JA 3BG4C 5FPTA 4DIIH 1GBIA 1W12U 1IQNA 2R0LA 3MNCA 2A5KA 4X2YA 1PPHE 2O8UA 2QF0A 1Z8GA 2PV9B 3SNEA 3E3TA 2GTBA 3QUMP 2BDYA 1FN8A 3TPIZ 4D9QA 2GT7A 3TU7H 2HWLB 1KTSB 1S6HA 2Z9IA 2KAIB 4FUGA 1C1MA 4TY6A 1O2JA 1T7CA 1YPLH 1WQVH 1MAXA 4U01A 2QXIA 3PROA 3RU4T 2ZFSA 2BDAA 3GYMA 4X1PU 4X6MA 4UE7H 4X1SU 4DG4A 2FOMB 2GVFA 1BTWA 1RIWB 3QTVH 1XUGA 2H5CA 2GCHF 3PLPA 1GGDC 2PKSC 3NPSA 1P10A 1E34B 2G5VA 2SFAA 4KP0A 3HK6B 1TRNA 1MBMA 3SUFA 5IYTA 1F2SE 4OS6A 1BZXE 1VCPA 3I29A 4KELA 1L4DA 2I6QA 3P95A 1O2GH 2FI4E 3S9CA 2YNAA 4OS5A 3RXAA 1QRZA 4CRFA 2VH0A 4K8BA 3UQVA 5FPYA 4ABBA 5E0JA 4MTBA 3UOPA 3Q3KA 5C67A 1MMJN 3MI4A 1QB1A 4AG2A 1ZMNA 4K2YA 1UK2A 3QLPH 2QXHA 5HM9A 1BBRK 3ZVDA 2HGTH 1W0YH 1N6XA 3GICB 1K1MA 1SGYE 3LJJA 4XE4A 4LZ1H 2BD4A 1T8LA 2J94A 3VEQB 3LGIA 3NCLA 2FM2A 3LH1A 2F9BH 2PUQH 1Q31A 1EP5A 1P05A 1MKXH 4BAOB 1GDUA 2GCTB 4DURA 2SNVA 2HRVA 2ZTXA 3ZZ8A 3V12A 5LPFA 3DD2H 4KGAA