1FY3A

[g175q]hbp, a mutant of human heparin binding protein (cap37)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
225
structure length
219
Chain Sequence
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDQGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two mutants of human heparin binding protein (CAP37): toward the understanding of the nature of lipid A/LPS and BPTI binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
molecule keywords HEPARIN-BINDING PROTEIN
total genus 56
structure length 219
sequence length 225
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy3A02
1C1SA 1XVOA 1KXDA 4WMEA 1ETRH 4R8TB 1VJAU 2C3SA 3VB5A 1KXEA 5HMAA 2J2UA 4KKDA 4A1VA 1DS2E 1UTQA 1O2GH 4KELA 4Y8ZA 2XW9A 1A0HB 3RXLA 2O8WA 2P8OB 2F9UA 1THRH 1FAXA 2OBOA 4DIIH 1SOTA 1S0RA 4ZH8A 1BUIA 3F1SB 3H5CB 2G55A 3QO6A 1QTFA 1VR1H 3LGUA 1S85A 1S6FA 2ZU4A 1L2EA 2Q6GA 1HJAB 1MUEB 3I29A 3MNSA 1QB6A 5DP8A 2SNVA 1IQEA 1BRUP 2FYRA 4IGDA 3S69A 2B8OH 1CHGA 3LC3A 2Z94A 1C4Y2 1L0ZA 4NGAH 3A8CA 5CMXH 3EGKH 3SHCH 3M7QA 4WXVA 5CE1A 1FIZA 2ZF0H 5DPAA 4X8UH 1C1WH 1LDTT 3FAOA 1QHRB 3GY8A 1O2LA 2P93A 3NWUA 1BRBE 2VU8E 1F5LA 1V2WT 4AB8A 1TRMA 1IQGA 1ZPZA 3QWCH 4ZHMU 1NPMA 4ISHH 5ESBA 3QK1A 5I25A 4I8HA 3PMHB 5EOKA 5EXNA 4CRBA 2PKAB 3VB3A 2G52A 5K7RA 3SJ8A 1LPKB 4AYVB 2Y5GA 1CBWB 3LH1A 1GCTB 1K1MA 1P03A 2BVSH 2PGQB 1UVTH 5EXMA 3M7UA 4XBDA 3ZVCA 1Y5BT 4GHQA 1SBWA 1TA2A 1WOFA 1DPOA 1EJAA 1GI0A 5EG4A 1O2OA 2J92A 4YO9A 5GPIB 1H9HE 3D23A 3SI4H 2ZFTA 2Y80A 4NWLA 2B7DH 2P3UB 3P6ZB 2CN0H 2HALA 3QZQA 1GBCA 3U8RH 4JYUH 1SGFA 5HYOA 1AFEH 1KXAA 1TGTA 1QCPA 1OWKA 1AVXA 1GGDB 1YPEH 3ZZ6A 4LZ1H 1SLUB 4VGCC 1A5HA 1CVWH 4NWKA 3A82A 3D65E 4X6PA 3TNSA 3V12A 2ZEBA 3UNRA 1HPGA 3IG6B 3RXSA 1MAXA 1MBQA 4NA7A 3SGBE 2C8YB 1VITG 4GVUA 1XXFA 4MPUA 1GJDB 2WPIS 1TBZH 3RXEA 3RC4A 1W3CA 3KQCA 4BXSA 3ELAH 1L4DA 3RXOA 1KTSB 3RXJA 1P06A 1MTVA 3QZRA 1SGYE 2O8UA 4IS5A 1GBMA 2ZZUH 3EQ0H 1HAYB 5L2ZH 4K8BA 1QL7A 3STIA 4K2YA 4OS2A 3U69H 3V0XA 1C2DA 1YBWA 1IOEA 4HFPB 4AN7A 2ZHFH 1S82A 1D4PB 2PLXA 2ILNA 1W14U 1C5OH 2EI7A 2VGCB 8ESTE 1ELBA 1SGIB 1T8OA 1ID5H 2GCHG 5E8EH 1TPPA 1M9UA 4RKJB 2CJIA 1TNHA 3EA7A 1MQ6A 1C1PA 3TH2H 4OS1A 1EX3A 1MD7A 4NIWA 1KTTB 1MTNB 1O36A 5FBIA 2HPPH 3BIUH 1AVWA 3OU0A 5T6GA 3RMNH 4WJG2 5JBCS 1F0SA 1F92A 2GZ9A 2WINI 3UFAA 3GY4A 1SGNE 1KLJH 3MNBA 7KMEH 2OXSA 1TBQH 1O2WA 2BM2A 2VVVA 2ZQ2A 3GY3A 3RXCA 4ABIA 3C27B 3I78A 4AFSA 5F03A 1P12E 2FYQA 1PPZA 1TX6A 1XUHA 1A61H 2BDCA 4BTTB 2FXRA 3ATIA 2PSXA 2BDIA 4Y7BA 2J95A 2RG3A 3UWJH 3MHWU 1O2RA 2ZTZA 4XDEA 2C90B 4X6NA 2ZFFH 2BDAA 1F5RA 4X1QU 4JCNA 2FTMA 3TH3H 1TAWA 1GI6A 4AGJA 5B6OA 1PPGE 2ZDNA 1Y3UA 2SGEE 4YLUA 4AG2A 4TYDA 4B71A 3TJUA 2PGBB 3CP7A 5TJXA 3GY5A 2I6QA 1YPKH 2GT8A 1C2EA 4OGXA 3M37A 1XUJA 1RJXB 1C2FA 1IQJA 1HIAB 2O8TA 1GMDF 3BSQA 3SQEE 1ZRBA 1FY5A 4ZUHA 1T4UH 3NPSA 4NCYA 3A88A 1DSUA 3VGCC 4TPYA 4X2YA 1UVUH 3PYHA 1ELGA 1P01A 1EPTB 2OTVA 4ZKOU 3A89A 1RRKA 3VB6A 3SNEA 5JB9S 1D3TB 1UK3A 1GI3A 3NCLA 3U1JB 3KNXA 1EQ9A 3O8DA 4THNH 1TLDA 1GBAA 1ACBE 1ZGVA 4BAOB 1ABJH 3DUXH 4I33A 4BANB 1PPBH 4RKOB 1F5KU 1AKSB 4BAKB 1C4U2 2W3KA 5FX5A 3QGJA 5DP7A 1NRPH 1EZSC 3LIWA 4O9VA 3SORA 1IQIA 3PMBB 3URDA 3P8FA 1H9LB 1Z8JB 4Y8XA 2FODA 1GWAA 1INCA 1YCPM 2FI3E 1P57B 1U6QA 2B0FA 1O3NA 1PQ8A 2XCNA 3GISB 3T25A 4BAHB 1ESBA 4X1SU 1EZQA 4CRCA 2RCEA 1Z6EA 1DE7H 1NU9A 1MTWA 5IYTA 3BTWE 1V2TT 1DOJA 2QCYA 1D3DB 3VB4A 3M5OA 3UTUH 1O3CA 2OUAA 5A0CA 1FV9A 3RMLH 1P2IA 4D7GA 1FPHH 1A3EH 5E2OA 3LJOA 3ZZ3A 1TNIA 3LGTA 1O2VA 3KGPA 3NZIA 1YPJH 1PPEE 3PROA 3MWIU 5A0AE 1C2LA 1J16A 2BLQA 4MQAA 1QBNA 2WV5A 3UNSA 3GCTF 4B76A 1ZOMA 1CT4E 1DWEH 1FQ3A 2BQWB 1D6WA 1CHOF 4X1PU 4TY6A 4TWWA 1CHOG 1GL1A 3RLYH 3K9XB 1ZHMA 3L3TA 3M3TA 1WSSH 3Q77A 2XXLA 1C2HA 3UQVA 5GWZA 1C5LH 1GJ6A 1N8OC 5J4QA 1KLIH 4FUHA 1OPHB 3D49H 3MH6A 3KL6A 1AUJA 5E0JA 1ESAA 2BY5X 1SQOA 1G2LA 1EASA 4Q7XA 1E35B 1HAXB 2AMPA 2BB4A 2CGAA 1RGQA 5EPNA 1QNJA 4ABEA 4O3UA 2K1QA 4KGAA 1O2MA 2ZFRH 1MQ5A 4NSYA 3ATLA 2M5TA 2BQ7B 1GHWH 1FY4A 2CHAC 1FN6A 1EAUA 1ELFA 1BT7A 5DP3A 1NFUA 1GJ9B 1TMBH 1G2MA 2PKSC 3GDVA 1N8OB 2IOTA 1O3HA 4AGKA 1HJ9A 2ZECA 3RXQA 4Q7ZA 1BTHH 1UTJA 2GT7A 2ZCLP 2G4TA 5TCCA 1C1QA 3RP2A 1DICA 1FI8A 1YPLH 3E0NB 3EYDA 3UQOA 3D62A 2ZFQH 1XX9A 3U1IB 5FCRA 1W7XH 3OX7U 1N6XA 2SGQE 3GDSA 2A5IA 3Q76A 1O3DA 3H7OA 2WUCA 2EI6A 3U8TH 1TMUH 1EATA 1W12U 1G9IE 3TGIE 1BDAA 4KTUA 2BHGA 1MZDA 1GBTA 2CF9H 1AY6H 1ZTKA 4IMZA 1C1NA 3RMOH 4KTSA 4J1YA 1KIGH 4OS7A 4I32A 4IMQA 2J9NA 2UWLA 3GY6A 1LTOA 4B2BA 2OBQA 2R9PA 5C5NA 2VNTA 4NZQA 1GDUA 4NFFA 3HGPA 3BIVH 2JETC 1TPSA 3OTJE 3UIRA 2XRCA 6ESTA 8GCHF 3GCTG 3L33A 5C3NA 1NFWA 4K1EA 5FAHA 1YGCH 1GI8B 4Q7YA 1V2LT 4YOJA 2VINA 2UUJB 1A46H 1TA6A 1A0JA 3ZV9A 1BQYA 1NS3A 1O2SA 2GDEH 1C5WB 1MTNC 2PWXA 1WQVH 2BDGA 1BITA 5GDSH 4ASHA 2VWNA 2VIPA 1O2UA 2FI4E 1C5SA 1EP6A 3P8GA 4AZ2B 4HZHA 2QXIA 1FXYA 1NESE 1PFXC 4U2WA 2J38A 2R0LA 3PO1B 1Z8RA 3SU1A 3TJNA 1ZPCA 5A0BA 5C1UA 3NXPA 1HIAA 1LO6A 4WH6A 2IN2A 3PMAB 3TK6A 1L1NA 1SB1H 2H5CA 2CV3A 2SGDE 3LU9B 1J14A 1BMLA 3B8JA 1IQHA 4D8NA 1AIXH 3HKJB 1NRSH 4K69A 5HGGA 4ABHA 1B5GH 7ESTE 1O2PA 1C5UA 2IPHA 4WY3A 1IQFA 3ZZAA 1A2CH 1RFNA 4O97A 3BTFE 4FU8A 2WPJS 3A83A 2BY8X 3KN2A 2QGRA 2ZFSA 5HM2A 3O8RA 1EZXC 3T2NA 1YP9A 3SUGA 3RXBA 1OWEA 2AYWA 2FOFA 2BOHB 4UFGH 1O5AB 1T8NA 3LPRA 1HCGA 4UFEH 3P92A 1MCVA 5DP5A 2ZPQA 5GCHG 3T26A 1LVYA 1ZYOA 1FN8A 1O35A 1Y3WA 2H9EH 3DT0H 3RXIA 3FVFB 1AUTC 1TWXB 1NRQH 3AW1A 2TIOA 4X8TH 1O2XA 3PLKA 1C5XB 1OWIA 6LPRA 1SPJA 1WUNH 4SGBE 4FUJA 1HGTH 2BDBA 1DVAH 2Y82A 1BJVA 1Y3XA 3GY2A 3AW0A 5K0HA 4O3TA 4FXGH 4XFQA 3SV2H 1GMHG 3GOVB 4INKA 1DUAA 1GG6C 1EPTA 4M7GA 2VIDA 1NU7B 1CT2E 4WWYA 4X8VH 5A8YA 2AFQB 1J17T 5CHAB 1G3BA 3SU3A 3SUFA 4IBLH 5HXFA 1EB2A 3MU1A 3R0FA 4YM9A 4GAWA 1BIOA 3V3MA 4F4OC 3W95A 4YT6H 3FP7E 2HRVA 2FWWA 1DLKB 2ZGXH 3SUDA 3PLPA 3SJKA 3RXFA 1SLXB 1RTLA 1O3PB 1Y3YA 2XCFA 3RC6A 3GCOA 4BTUB 5C1XA 3LJJA 2ZO3H 7LPRA 1O2IA 5C1YA 1GL0E 2ZKSA 3RMMH 1Z71A 3ZVFA 2BVXH 2R2MB 2FX4A 2WV4A 1AI8H 4AOQA 1HAVB 1TRNA 4E06H 1MCTA 1JIRA 1K1LA 2GCTC 2W5EA 1GJ5H 1QR3E 3ZVGA 2AGIX 1ELEE 5LPEA 3QDZB 2QA9E 3HK6B 4DVAU 1D3QB 4UE7H 3SW2B 2FTLE 2ZHQH 3M7TA 4FU9A 1XUIA 1NM6A 1ETTH 4MPVA 4FUEA 2WYJA 1BB0B 2XC0A 1GMCF 3RC5A 1MKXK 2EEKA 1IQMA 1C2IA 4YOIA 9LPRA 2FZZA 3MU8A 4FU7A 3PMJA 5AFZH 2IJOB 4MVNA 2ZDKA 3F9FA 1HAVA 3L6PA 3PTBA 2TGAA 4Y76A 1UK2A 1UCYK 4IN2A 4FUDA 4TPIZ 3CS7A 3TH4H 3BEFB 3SU5A 2WPMS 4FUIA 1G30B 3DHKH 5CHAC 3A8BA 1AFQC 4A1TA 1Y5AT 2G8TA 5T6DA 1LCYA 1O30A 3G01A 1LVBA 3EA9A 3SU0A 1GVZA 1DANH 1SQTA 1GBKA 4MPWA 3EDXB 3SGQE 2V35A 1ELCA 3T28A 4OS5A 3S0NA 4FUFA 2ZWLH 1AMHA 3LKWA 1XMNB 4X2WA 3SO3A 3UNQA 3SI3H 2Y7XA 1ZTJA 3BTEE 4O03A 2Z3EA 1AFQB 1S84A 1O2YA 1PPHE 1UTPA 5DGJA 1NRRH 4X0WU 1O3EA 3A87A 4ZROA 4DW2U 2DE8A 1VZQH 4Y71A 1EP5A 1PQ5A 2P3TB 4OS6A 1AGJA 2TGPZ 4Y6DA 2Q1JA 1Q3XA 1YC0A 3OYPA 1OYTH 4FUBA 1T31A 1DXWA 2F9VA 1BTUA 2OD3B 3U8OH 4ABDA 3T62A 5A09A 4A92A 5H4IB 5DO4H 1V2OT 1O2ZA 3RU4D 2GVFA 1EJMA 1NY22 2ZIQH 1AO5A 1GHVH 1D6RA 1JRTA 5T3HA 3GDUA 1K2I1 2FO9A 3BG4C 4WVPE 1BBRE 1D9IA 1KSNA 1CA8B 1SMFE 5PTPA 5JPMH 1O3AA 4PROA 1BTPA 1W2KH 1SHYA 2I6SA 1GDQA 1AE8H 2Q6FA 3LOXA 5FPSA 4ZXXH 1ZPBA 2Z9IA 1IHSH 1O5GH 1LQEA 1O39A 2SGPE 3PLBA 3SJOA 1TPOA 1GBHA 1OSSA 4UD9H 1GI5A 5TCAA 1O3KA 1PYTC 3OSYA 9ESTA 3A81A 1ZJDA 5BRRE 3TGJE 2BD9A 2H9TH 2H9HA 1EB1H 2BTCE 2VIVA 2SNWA 2XC4A 3E16B 1ZSLA 1OOKB 3MO6A 2A7CA 1BTXA 2Y5FA 3RUOA 2VIQA 1Z8GA 4UEHH 3HPTB 1TNKA 1KXBA 2PTCE 4I8JA 1V2UT 3CS0A 1O5CB 4BXWA 4B2AA 1S83A 2A7JA 1JMOH 1TGSZ 3IITA 1EJNA 4X6MA 4JK5A 4OGYA 1P9SA 1TX8A 2ZDVH 1C2MA 1ZSJA 2P94A 5J4SA 1YCPH 2Y81A 3M5NA 4ISNA 1KDQB 1V2RT 2VIWA 4Y11E 3DFJA 1QJ1B 1GVLA 2ZCKP 4NFEA 3LC5A 3P8NA 3UY9A 3TNTA 4MLFB 1VJ9U 2HLCA 1F0TA 1ANDA 1S6HA 4K1TA 4YESB 2WPHS 1P2NA 1TIOA 1DY9A 3BTQE 7GCHF 5EODA 3UR9A 1ANBA 2BX4A 1P3EA 4YZUA 1SGFG 1PPFE 3UREA 1MZAA 5A8XA 1WQSA 3BF6H 3ZZCA 3ESTA 4D9QA 4GUXA 3RXGA 3SNBA 2GDDA 1IQNA 2PKSB 1TQ0B 1MD8A 4MG3A 2A4OA 1FAKH 1GJ4H 1SC8U 2FM2A 2SGAA 2OCVB 2VVUA 2FOHA 3A80A 4K8YA 4X2XA 1QA7A 4AYYB 1HV7A 1P2KA 4ABBA 5DG6A 2C93B 2ALVA 1IQKA 2F91A 3AVZA 1GHBG 2C8WB 3SNDA 1BHXB 1GI1A 2FI5E 4CRAA 2ALPA 4D7FA 2ODPA 3M3SA 4B2CA 1QA0A 4DJZB 2QF0A 1F0UA 2ODYB 2QC2A 1SG8B 1ARCA 5FPTA 2PTNA 1DWDH 2TBSA 1TFXA 5AVDA 3ZVAA 3F68H 1LHEH 1K21H 2VGCC 1P9UA 1WAYB 3F6UH 3HGNA 3QLPH 3U98H 5DKMA 3ZVBA 1OP8A 2Y5HA 1A4WH 1EAIA 3I77A 1GMHF 1V3XA 1O3LA 5F8TA 2H1UA 1NZQH 2BD3A 4AFZA 2XC5A 1O5DH 2D2DA 2BD8A 1QFKH 2ZU5A 1BMAA 4XSKU 4TWYA 1MU8B 3HKIB 3QN7A 5LGOA 1V2JT 2P59A 1GBDA 1PJPA 2ZPSA 2ZFPH 2TGDA 5JBAS 3KIDU 4KP0A 2FS8A 2Z3CA 2YOLA 5AF9H 2ZHWH 2GZ8A 2V3HH 4ABJA 1LPGB 3LT3A 2XBWA 2AEIH 3QX5H 3SQHE 3SV6A 1LMWB 1NN6A 3P95A 4AFQA 3MI4A 3SV9A 1L4ZA 2R3YA 2NU3E 4NA9H 3VXFH 1K1PA 2CXVA 4H4FA 1OWDA 1K22H 1HXFH 2PKAA 2ANMH 2QF3A 1YKTA 2ZPRA 1GGDC 2GV6A 4DGJA 1DT2A 1TX7A 4XBCA 1FIWA 1QY6A 1P05A 1O5FH 1HBTH 1C5MD 2FS9A 3STJA 3ZZDA 4D9RA 3KF2A 1CBWC 5F6MA 1C5RA 3A7XA 3A7TA 1SL3A 1BOQA 1T4VH 1GMCG 3SJ9A 2BLOA 1ORFA 2OQUA 1ZMJA 3VEQB 2BY7X 4UFFH 4GCHG 2ZQ1A 3TPIZ 2YNAA 3GCNA 4I31A 2XBYA 3E1XB 4HI3A 2G5NA 2F9PA 4DG4A 3AAUA 1ABIH 2GX4A 3PV4A 5EW2H 2ZGJA 1SOZA 2OLGA 5EQSA 3A8DA 5I46H 1C1RA 4E05H 3B9FH 2AERH 1GHAG 3S7KB 1XUFA 1FJSA 3P17H 2A4RA 1OKXA 1SGRE 3S9AA 2ZGCA 1P8VC 1XUGA 3O8CA 1EPTC 1TE0A 4JZ1A 4NIXA 1K28D 1GMDG 4CRGA 8GCHG 1F0RA 1SR5C 2AH4X 1J15A 1KDQA 3RXVA 1G3CA 3R3GB 1AHTH 3LGWA 4K60A 1FMGA 4CRDA 1QQUA 2BD5A 4BAMB 1WTHD 2A2XH 3RXDA 3S9BA 2NU2E 1CT0E 3N7OA 1B0FA 1C1MA 2GMTC 1UK4A 4K5ZA 3GCHB 1WV7H 6GCHG 1NFYA 1HAPH 2Z9KA 1AU8A 1NRNH 1NROH 2F83A 4DCDA 2BVRH 1O33A 2VWLA 5EXLA 4ZMAH 3F9HA 3SU6A 2BDHA 3MNCA 2CHAB 2XYAA 1GBIA 5C2ZA 1G3EA 1NO9H 3H7TA 3UUZA 1HFDA 5F8ZA 1NTPA 1UHBB 3RXHA 1OYQA 1Q2WA 4BAQB 4LK4A 3FZZA 2WPKS 1Z1JA 1ZTLA 3T29A 4D76A 1GCDA 4IW4E 1S81A 2F9NA 1E38B 5JDUB 4UONA 1C9TA 4MNYA 2P3FH 1Z6JH 4MNXA 3PWCA 1LHFH 4MNVA 1AZ8A 1B0EA 2DE9A 3BN9A 2Z6BD 3PB1E 5EGMA 3IWMA 5E2PA 3TK9A 3ATMA 1THPB 1YM0A 1A3BH 3SV7A 5C67A 1TPAE 3RXMA 1EAWA 4NIYA 1QIXB 5EU8A 4CRFA 4JZIA 2KAIB 1H4WA 4GHTA 1J8AA 4VGCB 1K1IA 1V2VT 2JETB 1P0SH 5HM9A 3ZV8A 1BBRK 1TGCA 1CO7E 2PUQH 2QXGA 3SU4A 1DUEA 1HB0B 1TYNA 5C20A 1ELAA 3MO9A 4CBNA 1MU6B 4X6OA 4R0IA 5GJ4B 4DT7B 4QT8C 3KQBA 1ANEA 4JK6A 1FZZA 1AZZA 1IHTH 3EE0B 1TOMH 3RDZA 3DD2H 1MTUA 1FY3A 1GPZA 1JRSA 3QGNB 3KQEA 1EOJA 1KLTA 1ZZZA 1O32A 4CHAB 1DX5M 1HAOH 1GHZA 1CA0B 1QURH 1SI5H 1C5TA 1DDJA 1N6YA 1Z1IA 2CMYA 3BTHE 1UTOA 2Z3DA 1VITH 1G3DA 4DY7B 1QJ6B 1AWHB 4Y10E 2FOCA 3TJOA 1AQ7A 2ZA5A 4K3JA 3E91A 5JYIA 1G37A 1XM1A 2GV7A 2NU1E 1UTKA 2ZCHP 1Z7KA 2A32A 1PQ7A 3RU4T 1W11U 4Q2KA 1FDPA 3RXPA 2GTBA 1UVPA 1TALA 3MU4A 1WU1A 1GI7B 2ZU2A 3MH4A 1CU1A 1HAHH 1W13U 4ABAA 1AB9C 2FOGA 2R3UA 2ZHEH 1ETSH 4X1NU 4CBOA 2AIPA 1C2GA 1TNLA 4IN1A 2ANYA 1UO6A 1A5IA 5EQQA 1SHHB 1O3IA 1LPZB 1XUKA 2ANWA 2O8MA 1BA8B 2BD2A 1QRXA 2G4UA 3LONA 3RXAA 1DFPA 1OWHA 2WYGA 3M3VA 3QUMP 3BTME 1GI2A 1K9OE 4A5TS 1QGFA 4X1RU 3GICB 2FMJA 1C1OA 5FBEA 2Y7ZA 3RXRA 5EW1H 2G81E 4J2YB 3M36A 4MDSA 2H2ZA 4B74A 1OP2A 2FEQH 1GJAB 4B73A 1GI4A 2BZ6H 1S5SA 3FP6E 1P02A 3LGYA 1FPCH 5ABWA 4ISLA 1H8IH 2D8WA 4UFDH 3RM2H 1SFIA 3SU2A 1TABE 3SV8A 2XNIA 1B7XB 1UTLM 2BDYA 2AIQA 2JH0D 1V2ST 1ANCA 4XBBA 1WBGB 1ESTA 2GKVE 1Z8IB 5A2MH 3TITA 4INLA 3MU5A 2HOBA 1UMAH 1HJ8A 2BD7A 4Y0ZE 2Q6DA 4BNRA 3UOUA 1GDNA 1SGCA 2W3IA 2W26A 2FIRH 4AG1A 3B23B 4IC6A 4K1SA 1W0YH 1G36A 2UUKB 3VXEH 1RD3B 1XKBC 2V6NA 2G00A 2PUXB 1KXCA 1QBOA 3NK8A 2DUCA 2GMTB 2VWMA 1TNGA 3GY7A 1WCZA 4ZHAA 2THFB 1HAZB 3PWBA 2A4QA 1O2JA 4SGAE 2A5KA 2F9OA 2NWNA 3AAVA 2J4IA 3W94A 1SQAA 1XKAC 5DP4A 3VB7A 1S0QA 2UUFB 2R0KA 1DY8A 4CR9A 1C5ZB 1ZHRA 5T6FA 3HK3B 1RS0A 2Y6TA 1ZHPA 4U30A 1AVGH 5DP6A 1P04A 3TLOA 2FDAA 1W7GH 3SNCA 1C5QA 2V0BA 2QXHA 3BTDE 5LPRA 3LDXH 2D26C 1O3GA 1O2NA 5BPEA 1TRYA 4AFUA 3NKKA 4I8GA 1DSTA 2ZU1A 1FLEE 1EUFA 1V2QT 2LPRA 2TGTA 1HDTH 1P2JA 1C9PA 5G4BA 2LNCA 5FX6A 3UPEA 2A1DB 1CGIE 1TBRH 1SGPE 2HGTH 1EXFA 2ZC9H 1OS8A 1QRZA 1E34B 1UVSH 2C4FH 2NU4E 1G32B 1QRWA 1HAGE 1TONA 2BMGB 4CHAC 1O2HA 1LHDH 3TJVA 1AD8H 1V2MT 1EAXA 6CHAB 3DA9B 4GCHF 2AS9A 4B1TA 1UCYH 2AGEX 1BMMH 1GHXH 1RTFB 2VH6A 3ITIA 3BTKE 3P8OA 2PR3A 2P16A 1TMTH 1V2NT 4Q80A 2GGVB 4ISIH 2ZHDA 3C1KA 2A31A 3A84A 4WMDA 1FY1A 3K6YA 5F8XA 1SGEE 1VCWA 1QB1A 1C1UH 2A5AA 1O3OA 1CSOE 1YF4A 1A0LA 2GCTB 1VITF 1EZUC 2H5DA 2UWPA 1MAYA 2XTTB 1P3CA 4GPGA 4DURA 1DWCH 3S9CA 1K1JA 1ZLRA 2ZGHA 2AGGX 2P95A 3ZZ7A 4DIHH 6GCHF 5ETXA 1C1VH 1K1OA 5A8ZA 1TQ7B 1ELDE 1TGBA 3ODFA 2HPQH 2XWBI 1KY9A 2STBE 2FOMB 3SBKA 3E90B 1KXFA 3BEUA 3MTYA 5FPYA 1BBRH 1GG6B 2QXJA 4U01A 4IC5A 1TNJA 2JKHA 4XOJA 3CENA 4H6TA 1A5GH 1DITH 2VIOA 3JZ2B 1CQQA 3BTGE 1O3BA 3Q00A 1GHYH 4JZFH 4AX9H 1YPHC 3LGVA 4A6LA 4H42U 3KQDA 2JH6D 3GCHC 1UTNA 1YYY1 4AORA 1E0FD 1O31A 1EOLA 3BG4B 1YPGH 2B5TB 4Y8YA 1ZJKA 3DFLA 1OX1A 1W10U 3T27A 3TU7H 3ZZ5A 1ELTA 5DJ7A 2OC8A 1BCUH 2ZI2H 1W8BH 2QIQA 4LOYH 1RIWC 3QTVH 1SFQB 5EQRA 1RIWB 4I8LA 1VCPA 2RA0A 1MKXH 4ZKSU 4YT7H 4YLQH 2AMDA 1XVMA 2OQ5A 1GJCB 1UVOA 5FCKA 3FANA 5IDKA 2KAIA 1T7CA 1GJ7B 1Y8TA 4ESTE 1JIMA 4TY7A 1OWJA 2Z9LA 1O3FA 1A1RA 2A4GA 5GCHF 2HWLB 3MOCA 1LHCH 2C8XB 1IQLA 1QQ4A 3K2UA 1VGCC 5C5OA 4CREA 4YOGA 3VPKA 2J94A 2R2WU 4LZ4B 2BXUH 1BHXF 4GSOA 1AE5A 3A7VA 3UOPA 2BYAX 4ZKRU 1C5VA 2BLVA 4E7NA 6CHAC 3F9EA 3TK5A 1JWTA 4Y79A 2O8LA 4MPXA 2FLRH 4WXIA 1P2MA 1HXEH 1LQDB 1BRCE 1RXPA 2PW8H 3MYWA 1RTKA 3KEEA 1MKWH 3LH3A 2PFEA 3RXUA 3UR6A 3O8BA 2BY6X 4CR5A 1TOCB 1H8DH 5JB8S 1LVOA 1O2KA 4KTCA 5L6NH 3SZNA 1P09A 3BG8A 1WTGH 2TRMA 2C8ZB 1QB9A 3KCGH 2NU0E 1DLEA 2ANKH 1O37A 1HYLA 2EA3A 3ATKA 3M35A 3ZYDA 3MU0A 4WF8A 2WPLS 2ODQA 4A7IB 4I8KA 3TVJB 3ODDA 2HVXA 8LPRA 1EKBB 1LKAA 3A86A 2PV9B 5FXLA 1BMNH 3K65B 4X2VA 2ZP0H 3Q3KA 4Y0YE 2JH5D 4BOHA 3HATH 4I7YH 3QTOH 2V3OH 3MH5A 4WH8A 2G5VA 1GJBB 1THSH 3U9AH 2HNTF 4NZLA 2OC7A 3Q3YA 1FNIA 1ZMNA 3FZDA 4MNWA 1MTSA 4ZKNU 1L1GA 2STAE 1P2QA 3BTTE 1UCYE 2ZNKH 1O2QA 3ZVEA 1V2KT 3ZZ8A 1T8LA 2ZDLA 2BD4A 2VWOA 3A7ZA 1Q31A 2ZTYA 3ZYEA 2WUBA 2UWOA 2QY0B 1ARBA 1JXPA 4Z6AH 1GHBF 3RXKA 1GVKB 1ZMLA 4B75A 1H9IE 1GHAF 4Z0KA 1T8MA 2OC1A 1PYTD 1BTYA 4YTAA 1XXDA 1Y5UT 2EI8A 3WY8A 2GD4B 2PHBA 1AWFH 4CH2B 1ZR0A 1CGHA 4ZAEA 5AFYH 2RDLA 1GBBA 1GCTC 4F49A 2BX3A 4Y7AA 2A7HA 5FHTA 1T32A 4FVDA 4X8SH 5LPFA 2ULLA 3M5MA 5AHGH 4HTCH 3SUEA 2QAAA 2QYIA 1SLVB 2HNTC 1HAIH 2FLBH 2OINA 3ENSB 1YPMH 2FP7B 3SHAH 3SNAA 2BY9X 3MMGA 8KME2 1FUJA 1TB6H 2A2QH 1VCQA 3UWIA 1BTZA 1UHBA 1QL8A 1YCPK 3RM0H 1H1BA 2FOBA 4U32A 1D3PB 1TGNA 2XBVA 1FY8E 5L2YH 3ZZBA 3SN8A 3A7WA 1O38A 4INHA 1V2PT 1C5NH 1P2OA 2P8OC 1LKBA 3LGIA 3MO3A 2ZTXA 2HNTE 2Z9GA 2TPIZ 5E0HA 4DOQA 1SVPA 5SGAE 2SGFE 2F3CE 2VB0A 2VH0A 4JYVH 1C2KA 1SGQE 4WMFA 1QL9A 5DP9A 1CGJE 3E6PH 1BRAA 1JBUH 1SGDE 3ZVDA 2XBXA 1GBFA 1O3MA 1C5PA 1E37B 4E7RG 2FPZA 1O3JA 2GCHF 1HJAC 4ISOA 3GYLB 4HGCA 4BTIB 2OP9A 1X7AC 3SGAE 1F7ZA 1ELVA 3BV9B 1O2TA 1SLWB 5DK1A 4XE4A 1GBEA 2QN5T 1P10A 1O5EH 3NUMA 2ZDMA 1HRTH 4NIVA 2G51A 5EPYA 4A1XA 1NFXA 2ZDAH 4FUCA 1YPHE 1ZSKA 3AASA 4ZHLU 1O34A 2D1JA 1PQAA 1AB9B 1DXPA 4JZDH 3SOSA 1DWBH 1O5BB 2BQ6B 4RSPA 2J34A 1AN1E 1GBLA 1F2SE 1UTMA 3FFGA 5L30H 1C1TA 1LVMA 4ZXYH 3BEIB 1NT1A 2BLWA 3PO1C 2B9LA 1FONA 1BZXE 2SFAA 1GBJA 1CE5A 1QJ7B 3JZ1B 3PTNA 3ZZ9A 1N1LA 1Y3VA 3E3TA 2RA3A 3PM3A 5LH8A 1MKWK 4LXBH 1J9CH 1JOUB 3GYMA 4NG9H 3K6ZA 3E8LA 5JBBS 2BOKA 3OY6U 4NA8A 1BTWA 4H6SB 4ABGA 4AB9A 2Z7FE 1WYKA 4JZEH 1L1JA 1HLTH 1ZGIA 2UUYA 1OXGA 1KYNA 2CF8H 4OS4A 1C2JA 1SGTA 4ABFA 2GZ7A 3MH7A 1BJUA 2FOAA 3KHVA 3EAJA 3A8AA 2YNBA 3VFEA 3S7HB 4JMYA 3EA8A 2QV1A 1UJ1A 1NC6A 2W7UA 2VJ1A 3URCA 1OP0A 1C4V2 3MFJA 3FP8E 3T5FH 1DM4B 1PPCE 1AKSA 2O9QA 2ZG0H 3RU4E 3SJIA 1IAUA 3RXTA 1K1NA 4FUGA 1YLCA 1MBMA 3F9GA 5ESTE 5GIBA 3ZZ4A 4NSVA 1MH0A 2VVCA 4JYTA 7GCHG 1ZRKA 2FESH 3VGCB 1P11E 4FVBA 4UDWH 4CH8B 5JBTA 2EC9H 2AMQA 1YLDA 2GP9B 1E36B 2ESTE 3Q3XA 1GI9B 2BZAA 4GLYA 3OY5U 1V6DA 3TIUA 1QBVH 1C5YB 2ZU3A 2W7SA 3TGKE 1HUTH 2Z9JA 3ATWA 1O0DH 3M5LA 1HNEE 3E0PB 4MTBA 1MMJN 2OC0A 2H6MA 1LHGH 3V13A 1GJ8B 1SSXA 1CA0C 1VGCB 3A85A 3A7YA 2A45B 1Y59T 2A0QB 3MNXA 2ZGBH 3P70B 2BXTH 2PSYA 2FOEA 5E0GA 1A7SA 2XWAA 1W0ZU 2ASUB 5GXPA 2FX6A 4RN6A 3RLWH 3V7TA 2F9BH 3M61U
chains in the Genus database with same CATH superfamily
1C1SA 1XVOA 1KXDA 4WMEA 1ETRH 4R8TB 1VJAU 2C3SA 3VB5A 1KXEA 2CK3D 5HMAA 1VKYA 2J2UA 4KKDA 4RT0A 4A1VA 1DS2E 1UTQA 1O2GH 4KELA 4Y8ZA 2XW9A 1A0HB 3RXLA 2O8WA 2P8OB 2F9UA 1THRH 1FAXA 2OBOA 3F3BA 1SOTA 1S0RA 4ZH8A 4DIIH 1BUIA 3F1SB 3H5CB 2G55A 1FX0B 3QO6A 1QTFA 1VR1H 3LGUA 1S85A 3F2FA 1S6FA 2ZU4A 1L2EA 2Q6GA 1HJAB 1MUEB 3I29A 3MNSA 2HLDD 1QB6A 5DP8A 2SNVA 1IQEA 1BRUP 1YY3A 2FYRA 4IGDA 3S69A 2B8OH 1CHGA 3VG8A 3LC3A 2Z94A 1C4Y2 1L0ZA 4NGAH 3A8CA 5CMXH 3EGKH 3SHCH 4TT3D 3M7QA 4WXVA 5CE1A 1FIZA 2ZF0H 5DPAA 4X8UH 1C1WH 1LDTT 3FAOA 1QHRB 3GY8A 1O2LA 2P93A 3NWUA 1BRBE 2VU8E 1F5LA 1V2WT 4AB8A 1TRMA 1IQGA 1ZPZA 3QWCH 4ZHMU 5CDFE 3OE7D 1NPMA 4ISHH 5ESBA 3QK1A 5I25A 4I8HA 3PMHB 5EOKA 5EXNA 4CRBA 2PKAB 3VB3A 2G52A 5K7RA 3SJ8A 1LPKB 4AYVB 2Y5GA 1CBWB 3LH1A 1GCTB 1K1MA 1P03A 2BVSH 2PGQB 1UVTH 5EXMA 3M7UA 4XBDA 3ZVCA 5KECA 1Y5BT 4GHQA 1SBWA 1TA2A 1WOFA 1DPOA 1EJAA 1GI0A 5EG4A 1O2OA 2J92A 4YO9A 5GPIB 1H9HE 3D23A 3SI4H 2ZFTA 2Y80A 4NWLA 2B7DH 2P3UB 3P6ZB 2CN0H 2HALA 3QZQA 1GBCA 3U8RH 2IPQX 4JYUH 2KCPA 1SGFA 5HYOA 1AFEH 4FETA 1H8HD 1KXAA 1TGTA 1QCPA 1OWKA 1AVXA 1GGDB 1YPEH 2J98B 3ZZ6A 4LZ1H 1SLUB 4VGCC 5C94A 1A5HA 1CVWH 4NWKA 3A82A 3D65E 4X6PA 3TNSA 1E1RD 3V12A 2ZEBA 3UNRA 1HPGA 3IG6B 3RXSA 1MAXA 1WXRA 1MBQA 3EE7A 4NA7A 3SGBE 2C8YB 1VITG 1NBMD 4GVUA 1XXFA 3F2HA 4MPUA 4XD7D 1GJDB 2WPIS 1TBZH 3RXEA 3RC4A 1W3CA 3KQCA 4BXSA 3ELAH 1L4DA 3RXOA 1KTSB 3RXJA 1P06A 1MTVA 3QZRA 1SGYE 2O8UA 4IS5A 1GBMA 2ZZUH 3EQ0H 2KX4A 1HAYB 5L2ZH 4K8BA 1QL7A 3STIA 4K2YA 4OS2A 3U69H 3V0XA 1C2DA 2KR7A 1YBWA 1IOEA 4HFPB 4AN7A 2ZHFH 1S82A 1D4PB 2PLXA 2ILNA 1W14U 1C5OH 2EI7A 2VGCB 8ESTE 1ELBA 1SGIB 1T8OA 2PP6A 1ID5H 2GCHG 5E8EH 1TPPA 1M9UA 4RKJB 2CJIA 1TNHA 3EA7A 1MQ6A 1C1PA 3TH2H 3KQ5A 4OS1A 1EX3A 1MD7A 4NIWA 1KTTB 1MTNB 1O36A 5FBIA 2HPPH 3BIUH 1AVWA 3OU0A 5T6GA 3RMNH 4WJG2 5JBCS 1F0SA 1F92A 2GZ9A 2WINI 3UFAA 3GY4A 1SGNE 1KLJH 3MNBA 7KMEH 2OXSA 1QZ8A 1TBQH 1O2WA 2BM2A 2VVVA 2ZQ2A 3GY3A 3RXCA 2KCOA 4ABIA 3C27B 3I78A 4AFSA 5F03A 2YMSD 1P12E 2FYQA 1PPZA 1TX6A 1XUHA 1A61H 2BDCA 4BTTB 2FXRA 3ATIA 2PSXA 2BDIA 4Y7BA 2J95A 2RG3A 3UWJH 3MHWU 1O2RA 2ZTZA 4XDEA 2V3MA 3OEHD 2XNDD 2C90B 4X6NA 2ZFFH 2BDAA 1F5RA 4X1QU 4JCNA 2FTMA 5B6LA 3TH3H 1TAWA 1GI6A 4AGJA 5B6OA 2YMSC 1PPGE 2ZDNA 1Y3UA 2SGEE 4YLUA 4AG2A 4TYDA 4B71A 3TJUA 2PGBB 3CP7A 5TJXA 3GY5A 2I6QA 1YPKH 2GT8A 1C2EA 4OGXA 3M37A 1XUJA 1RJXB 1C2FA 1IQJA 1HIAB 2O8TA 1GMDF 3BSQA 3SQEE 1ZRBA 1FY5A 4ZUHA 1T4UH 3NPSA 4NCYA 3A88A 1DSUA 3VGCC 4TPYA 4X2YA 1UVUH 3PYHA 1ELGA 1P01A 1EPTB 2OTVA 4ZKOU 3A89A 1RRKA 3VB6A 3SNEA 5JB9S 1D3TB 1UK3A 1GI3A 3NCLA 3U1JB 3KNXA 1EQ9A 3O8DA 4THNH 1TLDA 1GBAA 1ACBE 1ZGVA 4BAOB 1ABJH 3DUXH 4I33A 4BANB 1PPBH 4RKOB 1F5KU 1AKSB 4BAKB 1C4U2 2W3KA 5FX5A 3QGJA 5DP7A 1NRPH 1EZSC 3LIWA 4O9VA 3SORA 1IQIA 3PMBB 3URDA 3P8FA 1H9LB 1Z8JB 4Y8XA 2FODA 1GWAA 1INCA 1YCPM 5HKKD 2FI3E 1P57B 1U6QA 2B0FA 1O3NA 1PQ8A 2IJD1 5HIYA 2XCNA 3GISB 3T25A 4BAHB 1ESBA 4X1SU 1EZQA 4CRCA 2RCEA 4P00A 1Z6EA 1DE7H 1NU9A 1MTWA 5IYTA 3BTWE 1V2TT 1DOJA 2QCYA 1D3DB 3VB4A 3M5OA 3UTUH 1O3CA 2OUAA 5A0CA 1FV9A 2YMSB 3RMLH 1P2IA 4D7GA 1FPHH 1A3EH 5E2OA 3LJOA 3ZZ3A 1TNIA 3LGTA 1O2VA 3KGPA 3NZIA 1YPJH 1PPEE 3PROA 3MWIU 5A0AE 1C2LA 1J16A 2BLQA 4MQAA 1QBNA 2WV5A 4HG6A 3UNSA 3GCTF 4B76A 1ZOMA 1CT4E 1DWEH 1FQ3A 2BQWB 1D6WA 1CHOF 4X1PU 4TY6A 4TWWA 1CHOG 1GL1A 3RLYH 3K9XB 1ZHMA 3L3TA 3M3TA 1WSSH 3Q77A 2XXLA 1C2HA 3UQVA 5GWZA 1C5LH 1GJ6A 1N8OC 5J4QA 1KLIH 4FUHA 1OPHB 3D49H 3MH6A 3KL6A 1AUJA 5E0JA 1ESAA 2BY5X 1SQOA 1G2LA 1EASA 4Q7XA 1E35B 1HAXB 1MABB 2AMPA 2BB4A 2CGAA 1RGQA 5EPNA 1QNJA 4ABEA 4O3UA 2K1QA 4KGAA 1O2MA 2ZFRH 1MQ5A 4NSYA 3ATLA 2M5TA 2BQ7B 1GHWH 3WWBA 1FY4A 2CHAC 1FN6A 1EAUA 1ELFA 1BT7A 5DP3A 1NFUA 1GJ9B 1TMBH 1G2MA 2PKSC 3GDVA 1N8OB 2IOTA 5KEDA 1O3HA 4AGKA 1HJ9A 2ZECA 3RXQA 4Q7ZA 1BTHH 1UTJA 2GT7A 5EJ1A 2ZCLP 2G4TA 2K8IA 4F48B 5TCCA 4ZCNA 1C1QA 3RP2A 1DICA 1FI8A 1YPLH 3E0NB 3EYDA 3UQOA 3D62A 2ZFQH 1XX9A 3U1IB 5FCRA 1W7XH 3OX7U 1N6XA 2SGQE 3GDSA 2A5IA 3Q76A 1O3DA 3H7OA 2WUCA 2EI6A 3U8TH 1TMUH 1EATA 1W12U 1G9IE 3TGIE 1BDAA 4KTUA 2BHGA 1MZDA 1GBTA 1SQRA 2CF9H 1AY6H 1ZTKA 4IMZA 1C1NA 3RMOH 4KTSA 4J1YA 1KIGH 4OS7A 4I32A 4IMQA 2J9NA 2UWLA 3GY6A 1LTOA 4B2BA 2OBQA 2R9PA 5C5NA 2VNTA 4NZQA 1GDUA 4NFFA 3HGPA 3BIVH 2JETC 1TPSA 3OTJE 3UIRA 2XRCA 6ESTA 8GCHF 3GCTG 3L33A 5C3NA 1NFWA 4K1EA 5FAHA 1YGCH 1GI8B 4Q7YA 5EJLA 3OFND 1V2LT 4YOJA 3FKSD 2VINA 2UUJB 1A46H 1TA6A 1A0JA 3ZV9A 1BQYA 1NS3A 1O2SA 2GDEH 1C5WB 1MTNC 2PWXA 1WQVH 2BDGA 1BITA 5GDSH 4ASHA 2VWNA 2VIPA 1O2UA 2FI4E 1C5SA 1EP6A 3P8GA 4AZ2B 4HZHA 2QXIA 2KFWA 1FXYA 1NESE 1PFXC 4U2WA 2J38A 2R0LA 3PO1B 1Z8RA 3SU1A 3TJNA 1ZPCA 5A0BA 5C1UA 1YWUA 3NXPA 1HIAA 1LO6A 4WH6A 2IN2A 3PMAB 3TK6A 1L1NA 1SB1H 2H5CA 2CV3A 2SGDE 3LU9B 1J14A 1BMLA 3B8JA 1IQHA 4D8NA 1AIXH 3HKJB 1NRSH 4K69A 5HGGA 4ABHA 1B5GH 7ESTE 1O2PA 1C5UA 4Z1MD 1S6LA 2IPHA 4WY3A 1IQFA 3ZZAA 4YXWD 1A2CH 1E79D 1RFNA 4O97A 3BTFE 4FU8A 4RI0A 2WPJS 3A83A 2BY8X 3KN2A 2QGRA 2ZFSA 5DSFA 5HM2A 3O8RA 1EZXC 3T2NA 1YP9A 3SUGA 3RXBA 1OWEA 2AYWA 2FOFA 2BOHB 4UFGH 1O5AB 1T8NA 3LPRA 1HCGA 4UFEH 3P92A 1MCVA 4TSFD 5DP5A 2ZPQA 5GCHG 3T26A 1LVYA 1ZYOA 1FN8A 1O35A 1Y3WA 2H9EH 3DT0H 3RXIA 3FVFB 1AUTC 1TWXB 1NRQH 3AW1A 2TIOA 4X8TH 1O2XA 3PLKA 1C5XB 1OWIA 6LPRA 1SPJA 1WUNH 4SGBE 4FUJA 1HGTH 2BDBA 1DVAH 2Y82A 1BJVA 1Y3XA 3GY2A 3AW0A 5K0HA 4O3TA 4FXGH 2WV9A 4XFQA 3SV2H 1GMHG 3GOVB 4INKA 1DUAA 1GG6C 1EPTA 4M7GA 2VIDA 1NU7B 1CT2E 4WWYA 4X8VH 5A8YA 5GNDA 2AFQB 1J17T 5CHAB 1G3BA 3SU3A 3SUFA 4IBLH 5HXFA 1EB2A 3MU1A 3R0FA 4YM9A 4ACAA 4GAWA 1BIOA 3V3MA 4F4OC 3W95A 4YT6H 3FP7E 2HRVA 2FWWA 1DLKB 2ZGXH 3SUDA 3PLPA 3SJKA 3RXFA 3DSPA 1SLXB 1RTLA 1O3PB 1Y3YA 2XCFA 3RC6A 3GCOA 4BTUB 5C1XA 3LJJA 2LP6A 2ZO3H 7LPRA 1O2IA 5C1YA 1GL0E 2ZKSA 3RMMH 1Z71A 3ZVFA 2BVXH 2R2MB 2FX4A 2WV4A 1AI8H 4AOQA 1HAVB 1TRNA 4E06H 1MCTA 1JIRA 1K1LA 2GCTC 2W5EA 1GJ5H 1QR3E 3ZVGA 2AGIX 1ELEE 5LPEA 3QDZB 2QA9E 3HK6B 4DVAU 1D3QB 4UE7H 3SW2B 2FTLE 2ZHQH 3M7TA 5EIYA 4FU9A 1XUIA 1NM6A 1ETTH 3OEED 4FUEA 4MPVA 2WYJA 1BB0B 2XC0A 1GMCF 3RC5A 1MKXK 2EEKA 1IQMA 1C2IA 4YOIA 9LPRA 2FZZA 3MU8A 5CHBA 4FU7A 3PMJA 5AFZH 2IJOB 4MVNA 2ZDKA 3F9FA 1HAVA 3L6PA 3PTBA 2TGAA 4Y76A 1UK2A 1UCYK 4IN2A 4FUDA 4TPIZ 3CS7A 3TH4H 3BEFB 3CNRA 3SU5A 2WPMS 4FUIA 1G30B 3DHKH 5CHAC 3A8BA 1AFQC 4A1TA 1Y5AT 2G8TA 5T6DA 1LCYA 1O30A 3G01A 1LVBA 3EA9A 3SU0A 1GVZA 1DANH 1SQTA 1GBKA 4MPWA 3EDXB 3SGQE 2V35A 1ELCA 3T28A 4OS5A 3S0NA 4FUFA 2ZWLH 1AMHA 3LKWA 1XMNB 4X2WA 3SO3A 3UNQA 3SI3H 1SKYE 1ZTJA 2Y7XA 3BTEE 4O03A 2Z3EA 1AFQB 1S84A 1O2YA 1PPHE 1UTPA 5DGJA 1NRRH 4X0WU 1O3EA 3A87A 4ZROA 4DW2U 2DE8A 1VZQH 4Y71A 1EP5A 1PQ5A 2P3TB 4OS6A 1AGJA 3KYGA 2TGPZ 4Y6DA 2Q1JA 1Q3XA 1YC0A 3OYPA 1OYTH 4FUBA 1T31A 1DXWA 2F9VA 1BTUA 2OD3B 3U8OH 4ABDA 3T62A 5A09A 4A92A 5H4IB 5DO4H 1V2OT 1O2ZA 3RU4D 2GVFA 1EJMA 1NY22 2ZIQH 1AO5A 1GHVH 1D6RA 1JRTA 5T3HA 3GDUA 1K2I1 2FO9A 3BG4C 4WVPE 3W1EA 1BBRE 1D9IA 1KSNA 1CA8B 1SMFE 5PTPA 5JPMH 1O3AA 4PROA 5IK2D 1BTPA 1W2KH 4XRNA 1SHYA 2I6SA 1GDQA 1AE8H 2Q6FA 3LOXA 5FPSA 4ZXXH 1ZPBA 2EY4C 2Z9IA 2F4LA 1IHSH 1O5GH 1LQEA 1O39A 2SGPE 3PLBA 3SJOA 1TPOA 1GBHA 1OSSA 4UD9H 1GI5A 5TCAA 1O3KA 1PYTC 3OSYA 9ESTA 3A81A 1ZJDA 5BRRE 3TGJE 2BD9A 5HIZA 2H9TH 2H9HA 1EB1H 2BTCE 2VIVA 2SNWA 2XC4A 3E16B 1ZSLA 1OOKB 3MO6A 2A7CA 1BTXA 2Y5FA 3RUOA 2VIQA 1Z8GA 4UEHH 3HPTB 1TNKA 1KXBA 2PTCE 4I8JA 1V2UT 3CS0A 1O5CB 4BXWA 4B2AA 1S83A 2A7JA 3UAIC 1JMOH 1TGSZ 3IITA 1EJNA 4X6MA 4JK5A 4OGYA 1P9SA 1TX8A 2ZDVH 1C2MA 1ZSJA 2P94A 5J4SA 1YCPH 2EQNA 2Y81A 3M5NA 4ISNA 1KDQB 1V2RT 2VIWA 4Y11E 3DFJA 1QJ1B 1GVLA 2ZCKP 4NFEA 3LC5A 3P8NA 3UY9A 3TNTA 4MLFB 1VJ9U 2HLCA 1F0TA 1ANDA 1S6HA 4K1TA 4YESB 2WPHS 1P2NA 1TIOA 1DY9A 3BTQE 7GCHF 5EODA 3UR9A 1ANBA 2BX4A 1P3EA 4YZUA 4P02A 1SGFG 1PPFE 3UREA 1MZAA 5A8XA 1WQSA 3BF6H 3ZZCA 3ESTA 4D9QA 4GUXA 3RXGA 3SNBA 2GDDA 1IQNA 2PKSB 1TQ0B 1MD8A 4MG3A 2A4OA 1FAKH 1GJ4H 1SC8U 3OAAD 2XOKD 2FM2A 2SGAA 2OCVB 2VVUA 2FOHA 3A80A 4K8YA 3N99A 1QA7A 4X2XA 4AYYB 1HV7A 1P2KA 4ABBA 5DG6A 2C93B 2ALVA 2J5UA 1IQKA 2F91A 3AVZA 1GHBG 2C8WB 3SNDA 1BHXB 1GI1A 2FI5E 4CRAA 2ALPA 4D7FA 2ODPA 3M3SA 4B2CA 1QA0A 1WDIA 4DJZB 2QF0A 1F0UA 2ODYB 2QC2A 1SG8B 1ARCA 5FPTA 3PV5A 2PTNA 1DWDH 2TBSA 1TFXA 5AVDA 3SYJA 1COWD 3ZVAA 2RDEA 3F68H 1LHEH 1K21H 2VGCC 3DSGA 1P9UA 1WAYB 3F6UH 3HGNA 3QLPH 3U98H 5DKMA 3ZVBA 1OP8A 2Y5HA 1A4WH 1EAIA 3I77A 1GMHF 1V3XA 1O3LA 5F8TA 2H1UA 1NZQH 2BD3A 4AFZA 2XC5A 1O5DH 2D2DA 2K0QA 2BD8A 1QFKH 2ZU5A 1BMAA 4XSKU 4TWYA 1MU8B 3HKIB 3QN7A 3KYFA 5LGOA 1V2JT 2P59A 1GBDA 1PJPA 2ZPSA 2ZFPH 2TGDA 5JBAS 3KIDU 4KP0A 1H8ED 2FS8A 2Z3CA 2YOLA 5AF9H 2ZHWH 2OK5A 2GZ8A 2V3HH 4ABJA 2QF4A 1LPGB 3LT3A 2XBWA 2AEIH 3QX5H 3SQHE 3SV6A 1LMWB 1NN6A 4RT1A 3P95A 4AFQA 3MI4A 3SV9A 1L4ZA 2R3YA 2NU3E 4NA9H 3VXFH 1K1PA 2CXVA 4H4FA 1OWDA 1K22H 1HXFH 2RFKC 2PKAA 2ANMH 2QF3A 1YKTA 2ZPRA 1GGDC 2GV6A 4DGJA 1DT2A 1TX7A 4XBCA 1FIWA 1QY6A 1P05A 1O5FH 1HBTH 1C5MD 2FS9A 3STJA 3ZZDA 4D9RA 3KF2A 1CBWC 5F6MA 1C5RA 3A7XA 3A7TA 1SL3A 1BOQA 3GS9A 1T4VH 1GMCG 3SJ9A 2BLOA 1ORFA 2OQUA 1ZMJA 3VEQB 2BY7X 4UFFH 4GCHG 2ZQ1A 3TPIZ 2YNAA 3F0OA 1W0JD 2QF5A 3GCNA 1OHHD 4I31A 2XBYA 3E1XB 4HI3A 2G5NA 2F9PA 4DG4A 3AAUA 1ABIH 2GX4A 3PV4A 5EW2H 2ZGJA 1SOZA 2OLGA 5EQSA 3A8DA 5I46H 1C1RA 4E05H 3B9FH 2AERH 1GHAG 3S7KB 1XUFA 1FJSA 5C0UA 3P17H 2A4RA 1OKXA 1SGRE 3S9AA 2ZGCA 1P8VC 1XUGA 3O8CA 1EPTC 1TE0A 4JZ1A 3AK5A 4NIXA 1K28D 1GMDG 4CRGA 8GCHG 1F0RA 1SR5C 2AH4X 2HVYB 1J15A 1KDQA 3RXVA 1G3CA 3R3GB 1AHTH 3LGWA 2GJGA 1FMGA 4K60A 4CRDA 1QQUA 2BD5A 4BAMB 1WTHD 2A2XH 3RXDA 3S9BA 2NU2E 1CT0E 3N7OA 3WW7A 1B0FA 1C1MA 2GMTC 1UK4A 4K5ZA 3GCHB 1WV7H 6GCHG 1NFYA 1HAPH 2Z9KA 1AU8A 1NRNH 1NROH 2F83A 5KGOA 4DCDA 2BVRH 1O33A 2VWLA 5EXLA 4ZMAH 3F9HA 3SU6A 2BDHA 3MNCA 2CHAB 2XYAA 1GBIA 5C2ZA 1G3EA 1NO9H 3H7TA 3UUZA 1HFDA 5F8ZA 1NTPA 1UHBB 3RXHA 1OYQA 1Q2WA 4BAQB 2L6OA 4LK4A 3FZZA 2WPKS 1Z1JA 1ZTLA 3T29A 4D76A 1GCDA 4IW4E 2KCYA 1S81A 2F9NA 1E38B 5JDUB 4UONA 1C9TA 4MNYA 2P3FH 1Z6JH 4MNXA 3PWCA 1LHFH 4MNVA 1AZ8A 1B0EA 2DE9A 3N7EA 3BN9A 2Z6BD 3PB1E 5EGMA 3IWMA 5E2PA 3TK9A 3ATMA 1THPB 1YM0A 1A3BH 3SV7A 5C67A 1TPAE 3RXMA 1EAWA 4NIYA 1QIXB 5EU8A 4CRFA 4JZIA 4OM9A 2KAIB 1H4WA 4GHTA 1J8AA 4VGCB 1K1IA 1V2VT 2JETB 1P0SH 5HM9A 4F55A 3ZV8A 1BBRK 1TGCA 1CO7E 2PUQH 2QXGA 2L74A 3SU4A 1DUEA 1HB0B 1TYNA 5C20A 1ELAA 3MO9A 4CBNA 1MU6B 4X6OA 4R0IA 5GJ4B 4DT7B 4QT8C 3KQBA 3F0PA 1ANEA 4JK6A 1FZZA 1AZZA 1IHTH 3EE0B 1TOMH 3RDZA 3DD2H 1MTUA 1FY3A 1GPZA 4ACBA 1JRSA 3QGNB 3KQEA 1EOJA 1KLTA 1ZZZA 1O32A 4CHAB 1DX5M 1HAOH 1GHZA 1CA0B 1QURH 3FO8D 1SI5H 1C5TA 1DDJA 1N6YA 1Z1IA 2CMYA 3BTHE 1UTOA 2Z3DA 1VITH 1G3DA 4DY7B 1QJ6B 1AWHB 4Y10E 2FOCA 3TJOA 1AQ7A 2ZA5A 4K3JA 3E91A 5JYIA 1G37A 1XM1A 2GV7A 2M2AA 2NU1E 1UTKA 2WHXA 2ZCHP 1Z7KA 2A32A 1PQ7A 3RU4T 1W11U 4Q2KA 1FDPA 3RXPA 2GTBA 1UVPA 1TALA 3MU4A 1WU1A 1GI7B 2ZU2A 3MH4A 2WPDD 1CU1A 1HAHH 1W13U 4ABAA 1AB9C 2FOGA 2R3UA 2ZHEH 1ETSH 4X1NU 4CBOA 2AIPA 1C2GA 2JDID 1TNLA 4IN1A 2ANYA 1UO6A 2KM0A 1A5IA 1SHHB 3PV2A 5EQQA 1O3IA 1LPZB 1XUKA 2ANWA 2O8MA 1BA8B 2BD2A 1QRXA 2G4UA 3LONA 3RXAA 1DFPA 1OWHA 2WYGA 3M3VA 3QUMP 3BTME 1GI2A 1K9OE 4A5TS 1QGFA 4X1RU 1NBME 3GICB 2FMJA 1C1OA 5FBEA 2Y7ZA 2AHME 3RXRA 5EW1H 2G81E 4J2YB 3M36A 4MDSA 2H2ZA 4B74A 4Q4LA 1OP2A 2FEQH 1GJAB 4B73A 1GI4A 2JIZD 2BZ6H 1S5SA 3FP6E 1P02A 3LGYA 1FPCH 5ABWA 4ISLA 1H8IH 2D8WA 4UFDH 3RM2H 1SFIA 3SU2A 1TABE 3SV8A 2XNIA 1B7XB 1UTLM 2BDYA 2AIQA 2JH0D 1V2ST 1ANCA 4XBBA 1WBGB 1ESTA 2GKVE 1Z8IB 5A2MH 3TITA 4INLA 3MU5A 2HOBA 1UMAH 1HJ8A 2BD7A 4Y0ZE 2Q6DA 4BNRA 3UOUA 1GDNA 1SGCA 2W3IA 2W26A 2FIRH 4AG1A 3B23B 4IC6A 4K1SA 1W0YH 1G36A 2UUKB 3VXEH 1RD3B 1XKBC 2V6NA 2G00A 2PUXB 1KXCA 2WSSD 1QBOA 3NK8A 2DUCA 2GMTB 2VWMA 1TNGA 3GY7A 1WCZA 4ZHAA 1EFRD 2THFB 1HAZB 3PWBA 2A4QA 4B6FA 1O2JA 4SGAE 2A5KA 2F9OA 2NWNA 3AAVA 2J4IA 3W94A 1SQAA 1XKAC 5DP4A 3VB7A 1S0QA 2UUFB 2R0KA 1DY8A 4CR9A 1C5ZB 1ZHRA 5T6FA 2KCAA 3HK3B 1RS0A 2Y6TA 1ZHPA 4U30A 4AC9A 1AVGH 5DN6D 5DP6A 1P04A 3TLOA 2FDAA 1W7GH 3SNCA 1C5QA 2V0BA 2QXHA 3BTDE 5LPRA 3LDXH 2D26C 1O3GA 1O2NA 5BPEA 1TRYA 4AFUA 3NKKA 4I8GA 1DSTA 3N7DA 2ZU1A 1FLEE 1EUFA 1V2QT 2LPRA 2TGTA 3MQKC 1HDTH 1P2JA 1C9PA 5G4BA 2LNCA 5FX6A 3UPEA 2A1DB 1CGIE 1TBRH 1SGPE 2HGTH 1EXFA 2ZC9H 1OS8A 1QRZA 1E34B 1UVSH 2C4FH 2NU4E 1G32B 1QRWA 1HAGE 1TONA 2BMGB 4CHAC 1O2HA 1LHDH 3TJVA 1AD8H 1V2MT 1EAXA 6CHAB 3DA9B 4GCHF 2AS9A 3NRLA 4B1TA 1UCYH 2AGEX 1BMMH 1GHXH 1RTFB 2VH6A 3ITIA 3BTKE 3P8OA 2PR3A 2P16A 1TMTH 1V2NT 4Q80A 2GGVB 4ASUD 4ISIH 2ZHDA 3C1KA 2A31A 3A84A 4WMDA 1FY1A 3K6YA 5F8XA 1SGEE 1VCWA 1QB1A 1C1UH 2A5AA 2LELA 1O3OA 1CSOE 1YF4A 1A0LA 2GCTB 1VITF 1EZUC 2H5DA 2UWPA 1MAYA 2XTTB 1P3CA 4GPGA 4DURA 1DWCH 3S9CA 1K1JA 1ZLRA 2ZGHA 2AGGX 2P95A 3ZZ7A 4DIHH 6GCHF 5ETXA 1C1VH 1K1OA 5A8ZA 5C0TA 1TQ7B 1ELDE 1TGBA 3ODFA 2HPQH 2XWBI 1KY9A 2W6JD 2STBE 2FOMB 3SBKA 3E90B 3U28C 1KXFA 3BEUA 3MTYA 5C17A 5FPYA 1BBRH 1GG6B 2QXJA 4U01A 4IC5A 2WZQA 1TNJA 2JKHA 4XOJA 3CENA 4H6TA 1A5GH 1DITH 2VIOA 3JZ2B 1CQQA 3BTGE 1O3BA 3Q00A 1GHYH 4JZFH 4AX9H 1YPHC 3LGVA 4A6LA 4H42U 3KQDA 2JH6D 3GCHC 1UTNA 1YYY1 4AORA 1E0FD 1O31A 1EOLA 3BG4B 1YPGH 2B5TB 4Y8YA 1ZJKA 3DFLA 1OX1A 1W10U 3T27A 3TU7H 3ZZ5A 1ELTA 5DJ7A 2OC8A 1BCUH 2ZI2H 1W8BH 2QIQA 4LOYH 1RIWC 3QTVH 1SFQB 5EQRA 1RIWB 4I8LA 4B6EA 1VCPA 1YLNA 2RA0A 1MKXH 4ZKSU 4YT7H 4YLQH 2AMDA 1XVMA 2OQ5A 1GJCB 1UVOA 5FCKA 3FANA 5IDKA 2KAIA 1T7CA 1GJ7B 1Y8TA 4ESTE 1JIMA 4TY7A 1OWJA 2Z9LA 1O3FA 1A1RA 2A4GA 5GCHF 2HWLB 3MOCA 1LHCH 2C8XB 1IQLA 1QQ4A 3K2UA 1VGCC 1UW7A 2W6ID 5C5OA 2JJ1D 4CREA 4YOGA 3VPKA 3UB0A 2J94A 2R2WU 3FN8A 4LZ4B 2BXUH 1BHXF 3PRBA 1AE5A 4GSOA 3A7VA 3UOPA 2BYAX 5FL7D 4ZKRU 1C5VA 2BLVA 4E7NA 6CHAC 3F9EA 3TK5A 1JWTA 4Y79A 2O8LA 4MPXA 2FLRH 4WXIA 1P2MA 1HXEH 1LQDB 1BRCE 1RXPA 2PW8H 3MYWA 1BMFD 1RTKA 3KEEA 1MKWH 3LH3A 2PFEA 3RXUA 3UR6A 3O8BA 2BY6X 4CR5A 4FOUC 1TOCB 1H8DH 2QE7D 5JB8S 1LVOA 1O2KA 4KTCA 5L6NH 3SZNA 1P09A 3BG8A 1WTGH 2TRMA 2C8ZB 1QB9A 3KCGH 2NU0E 1DLEA 2ANKH 1O37A 1HYLA 2EA3A 3ATKA 3M35A 3ZYDA 3MU0A 4WF8A 3SZEA 2WPLS 2ODQA 4A7IB 4I8KA 3TVJB 3ODDA 2HVXA 8LPRA 1EKBB 1LKAA 3A86A 2PV9B 5FXLA 1BMNH 3K65B 4X2VA 2ZP0H 3Q3KA 4Y0YE 2JH5D 4BOHA 3HATH 4I7YH 3QTOH 2V3OH 3MH5A 4WH8A 2G5VA 1GJBB 1THSH 3U9AH 2HNTF 4NZLA 2OC7A 3Q3YA 1FNIA 1ZMNA 3FZDA 4MNWA 1MTSA 4ZKNU 1L1GA 2STAE 1P2QA 3BTTE 1UCYE 2ZNKH 1O2QA 3ZVEA 1V2KT 3ZZ8A 1T8LA 2ZDLA 2BD4A 2VWOA 3A7ZA 1Q31A 2ZTYA 3ZYEA 2WUBA 2UWOA 2QY0B 1ARBA 1JXPA 4Z6AH 1GHBF 3RXKA 1GVKB 1ZMLA 4B75A 1H9IE 1GHAF 4Z0KA 1T8MA 3FOAA 2OC1A 1PYTD 1BTYA 4YTAA 1XXDA 1Y5UT 2EI8A 3WY8A 2GD4B 2PHBA 1AWFH 4CH2B 1ZR0A 1CGHA 4ZAEA 5AFYH 2RDLA 1GBBA 1GCTC 4F49A 2BX3A 4Y7AA 2A7HA 1K0HA 5FHTA 1T32A 3OTPA 4FVDA 4X8SH 5LPFA 2ULLA 3M5MA 5AHGH 4HTCH 3SUEA 2QAAA 2QYIA 1SLVB 2HNTC 1HAIH 2FLBH 2OINA 3ENSB 1YPMH 2FP7B 3SHAH 3SNAA 2BY9X 3MMGA 8KME2 1FUJA 1TB6H 2A2QH 1VCQA 3UWIA 1BTZA 1UHBA 1QL8A 1YCPK 3RM0H 1H1BA 2FOBA 4U32A 1D3PB 1TGNA 1FY8E 1KMHB 2XBVA 3ZZBA 5L2YH 3SN8A 3A7WA 1O38A 1W0KD 4Q63A 4INHA 1V2PT 5T1VA 1C5NH 1P2OA 1E1QD 2P8OC 1LKBA 3LGIA 3MO3A 2ZTXA 2HNTE 2Z9GA 2TPIZ 5E0HA 4DOQA 1SVPA 5SGAE 2SGFE 2F3CE 2VB0A 2VH0A 4JYVH 1C2KA 1SGQE 4WMFA 1QL9A 5DP9A 1CGJE 5F53A 3E6PH 2KZ4A 1BRAA 3ZIAD 1JBUH 1SGDE 3ZVDA 2XBXA 1GBFA 1O3MA 1C5PA 2V7QD 1E37B 4E7RG 2FPZA 2VBCA 1O3JA 2GCHF 1HJAC 4ISOA 3GYLB 4HGCA 3F2GA 2OP9A 1X7AC 3H09A 3SGAE 1F7ZA 4BTIB 1ELVA 3BV9B 1O2TA 1SLWB 5DK1A 2J97A 4XE4A 1GBEA 2QN5T 1P10A 1O5EH 3NUMA 2ZDMA 1HRTH 4NIVA 2G51A 5EPYA 4A1XA 1NFXA 2ZDAH 4FUCA 3WWFA 1YPHE 1ZSKA 3AASA 4ZHLU 1O34A 2D1JA 1PQAA 1AB9B 1DXPA 4JZDH 3SOSA 1DWBH 1O5BB 2BQ6B 4RSPA 2J34A 1AN1E 1GBLA 1F2SE 1UTMA 3FFGA 5L30H 1C1TA 1LVMA 4ZXYH 3BEIB 1NT1A 2BLWA 3PO1C 2B9LA 1FONA 1BZXE 2SFAA 1GBJA 1CE5A 1QJ7B 3JZ1B 3PTNA 3ZZ9A 1N1LA 1Y3VA 2F43B 2RA3A 3E3TA 3PM3A 5LH8A 1MKWK 4LXBH 1J9CH 1JOUB 3GYMA 4NG9H 3K6ZA 3E8LA 5JBBS 2BOKA 3OY6U 4NA8A 1BTWA 4H6SB 4ABGA 4AB9A 2Z7FE 1WYKA 4JZEH 1L1JA 1HLTH 1ZGIA 3PRDA 2UUYA 1OXGA 1KYNA 2CF8H 4OS4A 1C2JA 1SGTA 4ABFA 2GZ7A 3MH7A 1BJUA 2FOAA 3KHVA 3EAJA 3A8AA 2YNBA 3VFEA 3S7HB 4JMYA 3EA8A 2QV1A 1UJ1A 1NC6A 2W7UA 2VJ1A 3URCA 3DCLA 4DT4A 1OP0A 1C4V2 3MFJA 2J98A 3FP8E 3T5FH 1DM4B 4I86A 1PPCE 5EJZA 1AKSA 2O9QA 2ZG0H 3RU4E 3SJIA 1IAUA 3RXTA 1K1NA 4FUGA 1YLCA 1MBMA 3F9GA 5ESTE 5GIBA 3ZZ4A 4M9FA 4NSVA 1MH0A 2VVCA 4JYTA 7GCHG 1ZRKA 2FESH 3VGCB 1P11E 4FVBA 4UDWH 4CH8B 5JBTA 2EC9H 2AMQA 1YLDA 2GP9B 1E36B 2ESTE 2JJ2D 3Q3XA 1GI9B 2BZAA 4GLYA 3OY5U 1V6DA 3DSOA 3TIUA 1QBVH 1C5YB 2ZU3A 2W7SA 3TGKE 1HUTH 2Z9JA 3ATWA 1O0DH 3M5LA 1HNEE 3E0PB 4MTBA 1MMJN 2OC0A 2H6MA 1LHGH 3V13A 1GJ8B 1SSXA 1CA0C 1VGCB 3A85A 3A7YA 2A45B 1Y59T 2A0QB 3MNXA 2ZGBH 3P70B 2BXTH 2PSYA 2FOEA 5E0GA 1A7SA 2XWAA 1W0ZU 2ASUB 5GXPA 2FX6A 4RN6A 3RLWH 3V7TA 2F9BH 3M61U
chains in the Genus database with same CATH topology
1C1SA 1XVOA 1KXDA 4WMEA 1ETRH 4R8TB 1VJAU 2C3SA 3VB5A 1KXEA 5HMAA 2J2UA 4KKDA 4A1VA 1DS2E 1UTQA 1O2GH 4KELA 4Y8ZA 2XW9A 1A0HB 3RXLA 2O8WA 2P8OB 2F9UA 1THRH 1FAXA 2OBOA 4DIIH 1SOTA 1S0RA 4ZH8A 1BUIA 3F1SB 3H5CB 2G55A 3QO6A 1QTFA 1VR1H 3LGUA 1S85A 1S6FA 2ZU4A 1L2EA 2Q6GA 1HJAB 1MUEB 3I29A 3MNSA 1QB6A 5DP8A 2SNVA 1IQEA 1BRUP 2FYRA 4IGDA 3S69A 2B8OH 1CHGA 3LC3A 2Z94A 1C4Y2 1L0ZA 4NGAH 3A8CA 5CMXH 3EGKH 3SHCH 3M7QA 4WXVA 5CE1A 1FIZA 2ZF0H 5DPAA 4X8UH 1C1WH 1LDTT 3FAOA 1QHRB 3GY8A 1O2LA 2P93A 3NWUA 1BRBE 2VU8E 1F5LA 1V2WT 4AB8A 1TRMA 1IQGA 1ZPZA 3QWCH 4ZHMU 1NPMA 4ISHH 5ESBA 3QK1A 5I25A 4I8HA 3PMHB 5EOKA 5EXNA 4CRBA 2PKAB 3VB3A 2G52A 5K7RA 3SJ8A 1LPKB 4AYVB 2Y5GA 1CBWB 3LH1A 1GCTB 1K1MA 1P03A 2BVSH 2PGQB 1UVTH 5EXMA 3M7UA 4XBDA 3ZVCA 1Y5BT 4GHQA 1SBWA 1TA2A 1WOFA 1DPOA 1EJAA 1GI0A 5EG4A 1O2OA 2J92A 4YO9A 5GPIB 1H9HE 3D23A 3SI4H 2ZFTA 2Y80A 4NWLA 2B7DH 2P3UB 3P6ZB 2CN0H 2HALA 3QZQA 1GBCA 3U8RH 4JYUH 1SGFA 5HYOA 1AFEH 1KXAA 1TGTA 1QCPA 1OWKA 1AVXA 1GGDB 1YPEH 3ZZ6A 4LZ1H 1SLUB 4VGCC 1A5HA 1CVWH 4NWKA 3A82A 3D65E 4X6PA 3TNSA 3V12A 2ZEBA 3UNRA 1HPGA 3IG6B 3RXSA 1MAXA 1MBQA 4NA7A 3SGBE 2C8YB 1VITG 4GVUA 1XXFA 4MPUA 1GJDB 2WPIS 1TBZH 3RXEA 3RC4A 1W3CA 3KQCA 4BXSA 3ELAH 1L4DA 3RXOA 1KTSB 3RXJA 1P06A 1MTVA 3QZRA 1SGYE 2O8UA 4IS5A 1GBMA 2ZZUH 3EQ0H 1HAYB 5L2ZH 4K8BA 1QL7A 3STIA 4K2YA 4OS2A 3U69H 3V0XA 1C2DA 1YBWA 1IOEA 4HFPB 4AN7A 2ZHFH 1S82A 1D4PB 2PLXA 2ILNA 1W14U 1C5OH 2EI7A 2VGCB 8ESTE 1ELBA 1SGIB 1T8OA 1ID5H 2GCHG 5E8EH 1TPPA 1M9UA 4RKJB 2CJIA 1TNHA 3EA7A 1MQ6A 1C1PA 3TH2H 4OS1A 1EX3A 1MD7A 4NIWA 1KTTB 1MTNB 1O36A 5FBIA 2HPPH 3BIUH 1AVWA 3OU0A 5T6GA 3RMNH 4WJG2 5JBCS 1F0SA 1F92A 2GZ9A 2WINI 3UFAA 3GY4A 1SGNE 1KLJH 3MNBA 7KMEH 2OXSA 1TBQH 1O2WA 2BM2A 2VVVA 2ZQ2A 3GY3A 3RXCA 4ABIA 3C27B 3I78A 4AFSA 5F03A 1P12E 2FYQA 1PPZA 1TX6A 1XUHA 1A61H 2BDCA 4BTTB 2FXRA 3ATIA 2PSXA 2BDIA 4Y7BA 2J95A 2RG3A 3UWJH 3MHWU 1O2RA 2ZTZA 4XDEA 2C90B 4X6NA 2ZFFH 2BDAA 1F5RA 4X1QU 4JCNA 2FTMA 3TH3H 1TAWA 1GI6A 4AGJA 5B6OA 1PPGE 2ZDNA 1Y3UA 2SGEE 4YLUA 4AG2A 4TYDA 4B71A 3TJUA 2PGBB 3CP7A 5TJXA 3GY5A 2I6QA 1YPKH 2GT8A 1C2EA 4OGXA 3M37A 1XUJA 1RJXB 1C2FA 1IQJA 1HIAB 2O8TA 1GMDF 3BSQA 3SQEE 1ZRBA 1FY5A 4ZUHA 1T4UH 3NPSA 4NCYA 3A88A 1DSUA 3VGCC 4TPYA 4X2YA 1UVUH 3PYHA 1ELGA 1P01A 1EPTB 2OTVA 4ZKOU 3A89A 1RRKA 3VB6A 3SNEA 5JB9S 1D3TB 1UK3A 1GI3A 3NCLA 3U1JB 3KNXA 1EQ9A 3O8DA 4THNH 1TLDA 1GBAA 1ACBE 1ZGVA 4BAOB 1ABJH 3DUXH 4I33A 4BANB 1PPBH 4RKOB 1F5KU 1AKSB 4BAKB 1C4U2 2W3KA 5FX5A 3QGJA 5DP7A 1NRPH 1EZSC 3LIWA 4O9VA 3SORA 1IQIA 3PMBB 3URDA 3P8FA 1H9LB 1Z8JB 4Y8XA 2FODA 1GWAA 1INCA 1YCPM 2FI3E 1P57B 1U6QA 2B0FA 1O3NA 1PQ8A 2XCNA 3GISB 3T25A 4BAHB 1ESBA 4X1SU 1EZQA 4CRCA 2RCEA 1Z6EA 1DE7H 1NU9A 1MTWA 5IYTA 3BTWE 1V2TT 1DOJA 2QCYA 1D3DB 3VB4A 3M5OA 3UTUH 1O3CA 2OUAA 5A0CA 1FV9A 3RMLH 1P2IA 4D7GA 1FPHH 1A3EH 5E2OA 3LJOA 3ZZ3A 1TNIA 3LGTA 1O2VA 3KGPA 3NZIA 1YPJH 1PPEE 3PROA 3MWIU 5A0AE 1C2LA 1J16A 2BLQA 4MQAA 1QBNA 2WV5A 3UNSA 3GCTF 4B76A 1ZOMA 1CT4E 1DWEH 1FQ3A 2BQWB 1D6WA 1CHOF 4X1PU 4TY6A 4TWWA 1CHOG 1GL1A 3RLYH 3K9XB 1ZHMA 3L3TA 3M3TA 1WSSH 3Q77A 2XXLA 1C2HA 3UQVA 5GWZA 1C5LH 1GJ6A 1N8OC 5J4QA 1KLIH 4FUHA 1OPHB 3D49H 3MH6A 3KL6A 1AUJA 5E0JA 1ESAA 2BY5X 1SQOA 1G2LA 1EASA 4Q7XA 1E35B 1HAXB 2AMPA 2BB4A 2CGAA 1RGQA 5EPNA 1QNJA 4ABEA 4O3UA 2K1QA 4KGAA 1O2MA 2ZFRH 1MQ5A 4NSYA 3ATLA 2M5TA 2BQ7B 1GHWH 1FY4A 2CHAC 1FN6A 1EAUA 1ELFA 1BT7A 5DP3A 1NFUA 1GJ9B 1TMBH 1G2MA 2PKSC 3GDVA 1N8OB 2IOTA 1O3HA 4AGKA 1HJ9A 2ZECA 3RXQA 4Q7ZA 1BTHH 1UTJA 2GT7A 2ZCLP 2G4TA 5TCCA 1C1QA 3RP2A 1DICA 1FI8A 1YPLH 3E0NB 3EYDA 3UQOA 3D62A 2ZFQH 1XX9A 3U1IB 5FCRA 1W7XH 3OX7U 1N6XA 2SGQE 3GDSA 2A5IA 3Q76A 1O3DA 3H7OA 2WUCA 2EI6A 3U8TH 1TMUH 1EATA 1W12U 1G9IE 3TGIE 1BDAA 4KTUA 2BHGA 1MZDA 1GBTA 2CF9H 1AY6H 1ZTKA 4IMZA 1C1NA 3RMOH 4KTSA 4J1YA 1KIGH 4OS7A 4I32A 4IMQA 2J9NA 2UWLA 3GY6A 1LTOA 4B2BA 2OBQA 2R9PA 5C5NA 2VNTA 4NZQA 1GDUA 4NFFA 3HGPA 3BIVH 2JETC 1TPSA 3OTJE 3UIRA 2XRCA 6ESTA 8GCHF 3GCTG 3L33A 5C3NA 1NFWA 4K1EA 5FAHA 1YGCH 1GI8B 4Q7YA 1V2LT 4YOJA 2VINA 2UUJB 1A46H 1TA6A 1A0JA 3ZV9A 1BQYA 1NS3A 1O2SA 2GDEH 1C5WB 1MTNC 2PWXA 1WQVH 2BDGA 1BITA 5GDSH 4ASHA 2VWNA 2VIPA 1O2UA 2FI4E 1C5SA 1EP6A 3P8GA 4AZ2B 4HZHA 2QXIA 1FXYA 1NESE 1PFXC 4U2WA 2J38A 2R0LA 3PO1B 1Z8RA 3SU1A 3TJNA 1ZPCA 5A0BA 5C1UA 3NXPA 1HIAA 1LO6A 4WH6A 2IN2A 3PMAB 3TK6A 1L1NA 1SB1H 2H5CA 2CV3A 2SGDE 3LU9B 1J14A 1BMLA 3B8JA 1IQHA 4D8NA 1AIXH 3HKJB 1NRSH 4K69A 5HGGA 4ABHA 1B5GH 7ESTE 1O2PA 1C5UA 2IPHA 4WY3A 1IQFA 3ZZAA 1A2CH 1RFNA 4O97A 3BTFE 4FU8A 2WPJS 3A83A 2BY8X 3KN2A 2QGRA 2ZFSA 5HM2A 3O8RA 1EZXC 3T2NA 1YP9A 3SUGA 3RXBA 1OWEA 2AYWA 2FOFA 2BOHB 4UFGH 1O5AB 1T8NA 3LPRA 1HCGA 4UFEH 3P92A 1MCVA 5DP5A 2ZPQA 5GCHG 3T26A 1LVYA 1ZYOA 1FN8A 1O35A 1Y3WA 2H9EH 3DT0H 3RXIA 3FVFB 1AUTC 1TWXB 1NRQH 3AW1A 2TIOA 4X8TH 1O2XA 3PLKA 1C5XB 1OWIA 6LPRA 1SPJA 1WUNH 4SGBE 4FUJA 1HGTH 2BDBA 1DVAH 2Y82A 1BJVA 1Y3XA 3GY2A 3AW0A 5K0HA 4O3TA 4FXGH 4XFQA 3SV2H 1GMHG 3GOVB 4INKA 1DUAA 1GG6C 1EPTA 4M7GA 2VIDA 1NU7B 1CT2E 4WWYA 4X8VH 5A8YA 2AFQB 1J17T 5CHAB 1G3BA 3SU3A 3SUFA 4IBLH 5HXFA 1EB2A 3MU1A 3R0FA 4YM9A 4GAWA 1BIOA 3V3MA 4F4OC 3W95A 4YT6H 3FP7E 2HRVA 2FWWA 1DLKB 2ZGXH 3SUDA 3PLPA 3SJKA 3RXFA 1SLXB 1RTLA 1O3PB 1Y3YA 2XCFA 3RC6A 3GCOA 4BTUB 5C1XA 3LJJA 2ZO3H 7LPRA 1O2IA 5C1YA 1GL0E 2ZKSA 3RMMH 1Z71A 3ZVFA 2BVXH 2R2MB 2FX4A 2WV4A 1AI8H 4AOQA 1HAVB 1TRNA 4E06H 1MCTA 1JIRA 1K1LA 2GCTC 2W5EA 1GJ5H 1QR3E 3ZVGA 2AGIX 1ELEE 5LPEA 3QDZB 2QA9E 3HK6B 4DVAU 1D3QB 4UE7H 3SW2B 2FTLE 2ZHQH 3M7TA 4FU9A 1XUIA 1NM6A 1ETTH 4MPVA 4FUEA 2WYJA 1BB0B 2XC0A 1GMCF 3RC5A 1MKXK 2EEKA 1IQMA 1C2IA 4YOIA 9LPRA 2FZZA 3MU8A 4FU7A 3PMJA 5AFZH 2IJOB 4MVNA 2ZDKA 3F9FA 1HAVA 3L6PA 3PTBA 2TGAA 4Y76A 1UK2A 1UCYK 4IN2A 4FUDA 4TPIZ 3CS7A 3TH4H 3BEFB 3SU5A 2WPMS 4FUIA 1G30B 3DHKH 5CHAC 3A8BA 1AFQC 4A1TA 1Y5AT 2G8TA 5T6DA 1LCYA 1O30A 3G01A 1LVBA 3EA9A 3SU0A 1GVZA 1DANH 1SQTA 1GBKA 4MPWA 3EDXB 3SGQE 2V35A 1ELCA 3T28A 4OS5A 3S0NA 4FUFA 2ZWLH 1AMHA 3LKWA 1XMNB 4X2WA 3SO3A 3UNQA 3SI3H 2Y7XA 1ZTJA 3BTEE 4O03A 2Z3EA 1AFQB 1S84A 1O2YA 1PPHE 1UTPA 5DGJA 1NRRH 4X0WU 1O3EA 3A87A 4ZROA 4DW2U 2DE8A 1VZQH 4Y71A 1EP5A 1PQ5A 2P3TB 4OS6A 1AGJA 2TGPZ 4Y6DA 2Q1JA 1Q3XA 1YC0A 3OYPA 1OYTH 4FUBA 1T31A 1DXWA 2F9VA 1BTUA 2OD3B 3U8OH 4ABDA 3T62A 5A09A 4A92A 5H4IB 5DO4H 1V2OT 1O2ZA 3RU4D 2GVFA 1EJMA 1NY22 2ZIQH 1AO5A 1GHVH 1D6RA 1JRTA 5T3HA 3GDUA 1K2I1 2FO9A 3BG4C 4WVPE 1BBRE 1D9IA 1KSNA 1CA8B 1SMFE 5PTPA 5JPMH 1O3AA 4PROA 1BTPA 1W2KH 1SHYA 2I6SA 1GDQA 1AE8H 2Q6FA 3LOXA 5FPSA 4ZXXH 1ZPBA 2Z9IA 1IHSH 1O5GH 1LQEA 1O39A 2SGPE 3PLBA 3SJOA 1TPOA 1GBHA 1OSSA 4UD9H 1GI5A 5TCAA 1O3KA 1PYTC 3OSYA 9ESTA 3A81A 1ZJDA 5BRRE 3TGJE 2BD9A 2H9TH 2H9HA 1EB1H 2BTCE 2VIVA 2SNWA 2XC4A 3E16B 1ZSLA 1OOKB 3MO6A 2A7CA 1BTXA 2Y5FA 3RUOA 2VIQA 1Z8GA 4UEHH 3HPTB 1TNKA 1KXBA 2PTCE 4I8JA 1V2UT 3CS0A 1O5CB 4BXWA 4B2AA 1S83A 2A7JA 1JMOH 1TGSZ 3IITA 1EJNA 4X6MA 4JK5A 4OGYA 1P9SA 1TX8A 2ZDVH 1C2MA 1ZSJA 2P94A 5J4SA 1YCPH 2Y81A 3M5NA 4ISNA 1KDQB 1V2RT 2VIWA 4Y11E 3DFJA 1QJ1B 1GVLA 2ZCKP 4NFEA 3LC5A 3P8NA 3UY9A 3TNTA 4MLFB 1VJ9U 2HLCA 1F0TA 1ANDA 1S6HA 4K1TA 4YESB 2WPHS 1P2NA 1TIOA 1DY9A 3BTQE 7GCHF 5EODA 3UR9A 1ANBA 2BX4A 1P3EA 4YZUA 1SGFG 1PPFE 3UREA 1MZAA 5A8XA 1WQSA 3BF6H 3ZZCA 3ESTA 4D9QA 4GUXA 3RXGA 3SNBA 2GDDA 1IQNA 2PKSB 1TQ0B 1MD8A 4MG3A 2A4OA 1FAKH 1GJ4H 1SC8U 2FM2A 2SGAA 2OCVB 2VVUA 2FOHA 3A80A 4K8YA 4X2XA 1QA7A 4AYYB 1HV7A 1P2KA 4ABBA 5DG6A 2C93B 2ALVA 1IQKA 2F91A 3AVZA 1GHBG 2C8WB 3SNDA 1BHXB 1GI1A 2FI5E 4CRAA 2ALPA 4D7FA 2ODPA 3M3SA 4B2CA 1QA0A 4DJZB 2QF0A 1F0UA 2ODYB 2QC2A 1SG8B 1ARCA 5FPTA 2PTNA 1DWDH 2TBSA 1TFXA 5AVDA 3ZVAA 3F68H 1LHEH 1K21H 2VGCC 1P9UA 1WAYB 3F6UH 3HGNA 3QLPH 3U98H 5DKMA 3ZVBA 1OP8A 2Y5HA 1A4WH 1EAIA 3I77A 1GMHF 1V3XA 1O3LA 5F8TA 2H1UA 1NZQH 2BD3A 4AFZA 2XC5A 1O5DH 2D2DA 2BD8A 1QFKH 2ZU5A 1BMAA 4XSKU 4TWYA 1MU8B 3HKIB 3QN7A 5LGOA 1V2JT 2P59A 1GBDA 1PJPA 2ZPSA