1RJXB

Human plasminogen catalytic domain, k698m mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
247
structure length
243
Chain Sequence
SFDCGKPQVEPKKCPGAVVGGCVAYPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGEFGAGLLMEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Plasminogen
publication title Characterization of Lys-698 to met substitution in human plasminogen catalytic domain
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 243
sequence length 247
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rjxB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rjxB01
3L3TA 1T8LA 1T4VH 1AIXH 1A61H 1C5YB 1D4PB 1O3BA 2NU2E 2VVUA 4TWYA 4JZ1A 2FOBA 2A45B 1ZHPA 1GBAA 3SOSA 3SV7A 2Z7FE 4OGXA 1EQ9A 5E8EH 1ESBA 1DSUA 1GDNA 1P2OA 2A7CA 3RXTA 1SGYE 5EODA 1C9TA 1SC8U 1O5GH 1IHSH 1QL8A 2R2MB 3ODDA 2QF0A 1O3KA 2ZQ1A 1BRCE 1GGDB 4A1XA 1S85A 2W7SA 1ANDA 3SNCA 1SSXA 2UWLA 2HGTH 7KMEH 2Q6FA 4HGCA 1Y3WA 4TY7A 1OWKA 4K69A 2Z9GA 1ETRH 1PPGE 4UD9H 1S6FA 1OWHA 1PQ5A 1S83A 1F0RA 4OGYA 4UFEH 3TPIZ 1LQDB 1SLXB 3WY8A 1BTHH 3Q3KA 1ANCA 4THNH 1IQMA 1EAWA 4DW2U 2P3TB 1J15A 1SR5C 1NU9A 2JH5D 1AVWA 3TLOA 3GY7A 2W26A 3RXUA 9LPRA 3QO6A 2Z3CA 1JWTA 3SU6A 4AG2A 2HNTE 3M7QA 1EZQA 1C1PA 3EA7A 5CE1A 4F49A 5ESTE 1E36B 3I77A 4OS4A 1GJ6A 1G37A 2GZ8A 3P70B 1SGTA 4AZ2B 3RXKA 4FUFA 2ANYA 1VITH 1FDPA 3IG6B 4Y8XA 5HGGA 2B9LA 2D26C 3T2NA 3M5LA 2QGRA 3D62A 1THSH 2ZDVH 5LGOA 1HNEE 3MU5A 2HLCA 5DG6A 1MD7A 4TPIZ 3KHVA 4KTSA 1LCYA 2WPHS 1UTKA 4X1PU 1K2I1 1K1JA 4QT8C 2QXIA 1SMFE 1C5WB 2F9PA 2XXLA 2ZGHA 1GI2A 3LKWA 2A2QH 1E34B 3E16B 1W8BH 3GY3A 4NIXA 2BDYA 1M9UA 1DANH 1P3CA 4A1TA 2ZZUH 2GTBA 1O3PB 4IN1A 1OP0A 1A3EH 1SLUB 1TA2A 4ABIA 3GYLB 4RKJB 3B23B 4AFZA 2SFAA 3DA9B 2UUJB 5JB9S 5EW1H 1PFXC 3U8TH 1TOCB 1GBTA 1GDQA 2ZU4A 2TIOA 4ZMAH 2B5TB 1QJ7B 4MNWA 2BQWB 1XUHA 1FIWA 1GVZA 1OKXA 1NN6A 2BY5X 1CT4E 1GJCB 1ZTJA 4ZXXH 5CMXH 5GXPA 1FPHH 1TRMA 1YPJH 2YOLA 2ILNA 3LGTA 1W12U 1MTUA 1UTNA 1CA0C 1RIWB 3ZZ9A 1AB9B 1TX6A 1SL3A 1GMCG 3LC3A 1WU1A 3RMLH 1UHBB 4WH8A 3VXFH 5ABWA 4AFUA 3PMAB 1INCA 2PSYA 3A83A 1GHYH 1YGCH 3H7OA 3LJOA 1V2LT 4GVUA 3ZZ7A 1CGHA 3ZVDA 3BTGE 1NY22 2BD5A 2QY0B 1TQ7B 4CH8B 5DP3A 1EPTC 1EZSC 2J92A 1A0JA 2QAAA 4NGAH 3O8BA 2XNIA 4MDSA 1CBWC 3LU9B 1QBNA 3Q76A 4Q80A 2WPKS 4IMZA 1C5ZB 2FYQA 2OQ5A 2BDAA 3SGAE 3BG4B 3A7VA 1O2WA 2JKHA 2F9VA 3LGUA 4B71A 2QV1A 2R3YA 3SV2H 1PPCE 2VWMA 2BDHA 1TNKA 1HAVB 1CHOF 1LQEA 4YLQH 1ABJH 1NROH 3BEUA 4D9RA 3H7TA 1LVMA 9ESTA 1Y5AT 4I8KA 3PMBB 1QGFA 1QY6A 3GCOA 4WXIA 3V13A 1C5VA 1FY8E 5JPMH 1DWEH 1P02A 1ZTLA 1XXFA 1EXFA 3L6PA 3GCNA 4CRAA 3SJOA 1ZSLA 3RMOH 5DP4A 3ZZCA 3GICB 2Z9JA 3DT0H 3TJUA 3M3VA 3KF2A 1H1BA 2BOKA 1C5UA 3HPTB 4NIWA 3VGCB 1ZHMA 2PHBA 3QTVH 2BLOA 4HTCH 1O39A 4K2YA 3UWIA 1Y59T 3D23A 2RG3A 2QN5T 1YP9A 3RMMH 1GI4A 2WPLS 1KLTA 1BBRE 1ZJDA 1MKWK 3KNXA 3SU5A 4PROA 1O2JA 1KLIH 2ZQ2A 3M61U 2P3UB 3FAOA 2XBXA 1JOUB 4ZROA 3R3GB 2SNWA 3SN8A 5T3HA 4GSOA 5GIBA 4CBOA 3PYHA 1YCPM 2AIPA 1X7AC 4GAWA 2BD2A 4K5ZA 4B76A 1D3PB 4ZKRU 3V0XA 1FAKH 3UWJH 1O2HA 1YPMH 1QIXB 4Y7AA 1QJ1B 2A5IA 4AFQA 4B2AA 5HM2A 2AGGX 3UFAA 1UMAH 4H6SB 2HNTF 2GGVB 1OWEA 1MU8B 1P09A 2F83A 5GDSH 5GWZA 3RMNH 1XUGA 3CP7A 1GDUA 1XUJA 2H9HA 3RXAA 1DS2E 4JYUH 1ELGA 1EAUA 4ABEA 5IDKA 1HUTH 1CO7E 4GHQA 1GI5A 4ISLA 4CRFA 1DPOA 3HK6B 1OP8A 1KIGH 1IHTH 1N6YA 1ZSKA 4B1TA 1C1RA 2VGCC 3NK8A 4HI3A 1P9UA 1F7ZA 4YOJA 3SO3A 2H5DA 2ZF0H 1AY6H 2P59A 3MNBA 1XUIA 3M36A 2BTCE 3FP8E 1A5HA 2BX3A 2XBYA 1ZGVA 3AW0A 3MH4A 5T6FA 4ISIH 2F3CE 4ABDA 3ODFA 1G3DA 2BD3A 2P8OB 2VIPA 4WJG2 1UTLM 3A89A 1O2VA 2ZIQH 3LT3A 2CV3A 2ZDKA 3BTQE 3NPSA 1BUIA 1LHFH 2FOEA 1FNIA 1DVAH 1O35A 2NU1E 1P11E 1TQ0B 1OWIA 4DIIH 1J14A 2P93A 4FU8A 2FIRH 1OYQA 1O30A 2SGEE 3P17H 1Y3XA 1BJVA 3GY8A 1N1LA 1V2MT 5SGAE 2Q1JA 2O8UA 4NZQA 1C2IA 3A81A 5CHAC 2QC2A 4JK5A 4X1QU 1PQ7A 1G36A 1S84A 2IJOB 4X8UH 3V3MA 1AQ7A 1GL0E 4JMYA 1MBQA 1QB1A 1P8VC 1PQAA 1IAUA 3IWMA 1UJ1A 1AUTC 3TNSA 4AB9A 4MNYA 1MAYA 1E38B 4A6LA 3BF6H 4YTAA 3SU0A 3F6UH 4CRBA 2EI7A 1W7XH 3M5NA 4Y6DA 5EPNA 4I8JA 1CSOE 1SOTA 3ZYEA 5F8ZA 2TPIZ 1QFKH 1GJDB 1SQAA 2THFB 1IQFA 2OUAA 2EI6A 3DFLA 5DP8A 3TJOA 2W5EA 1C5QA 1A5IA 2A4RA 2JH0D 3SV9A 3JZ2B 4I7YH 4MLFB 1Z6EA 1AGJA 1RTKA 1EKBB 5A8YA 4CRDA 2VNTA 1C2EA 3RXGA 1V2JT 1C5RA 2AGIX 1PYTD 1IQLA 1BB0B 2PUQH 4UONA 2BD4A 3NKKA 1FMGA 1LKBA 1KXAA 2AYWA 4I8GA 1TPSA 4K1EA 3SORA 2ZU5A 4B2CA 1UVOA 3E3TA 4X1RU 2XWBI 2FXRA 1MTNB 4WVPE 2QA9E 1UCYH 3QUMP 1XVMA 1HAIH 2AH4X 4Q2KA 5FHTA 4DY7B 3ATKA 1G3EA 3MH5A 4ZAEA 3QTOH 4GHTA 1FI8A 2R0KA 3E6PH 1V2KT 1IQEA 1P04A 3MO9A 1PPHE 1V2OT 1TPAE 2AFQB 3ZZBA 2IOTA 1KTTB 2UUYA 2G55A 1C1TA 2C8WB 3SUEA 1WQSA 4FUGA 1NS3A 4AYYB 3RDZA 2GP9B 3KN2A 1KXCA 1GHZA 2Y7XA 2Z6BD 1CVWH 2CF9H 1V2WT 2H5CA 4WF8A 3UNQA 2FODA 3RXFA 2G5NA 1L1GA 2GT7A 4AGJA 1O5BB 8LPRA 3PROA 4Y76A 1HJ9A 2V3HH 1F2SE 3RP2A 4IGDA 4TWWA 1HJ8A 3M3TA 1FY4A 5HM9A 1QTFA 1C1OA 2BDCA 3O8RA 2BVXH 4BTTB 3RU4E 3S9AA 2A7HA 1HAOH 1E37B 2ZTYA 4VGCC 4ISNA 4BOHA 1TA6A 2ANKH 3T5FH 3QZQA 1TFXA 1ELFA 1ETSH 1V2TT 1C5OH 6CHAC 1C5LH 1YPGH 2GKVE 5GJ4B 3SBKA 3AW1A 2JH6D 2OXSA 2CMYA 3BTFE 2J2UA 1BRUP 1G3BA 4ISHH 2XWAA 1GJAB 5F8TA 3BEFB 2GCTB 4A5TS 3STJA 2FDAA 3AVZA 1P2MA 3PWCA 5T6DA 4NFEA 1TB6H 2QYIA 1PPZA 2SGDE 4Y11E 2Z9IA 2D1JA 2GMTC 1KDQB 1GBJA 1K1LA 4X1SU 1TOMH 1N8OC 3EQ0H 3M7TA 4WMFA 1DXWA 1TX7A 5DPAA 3GY6A 2STAE 3QLPH 4OS6A 3P8OA 3RXOA 1C2LA 1Q2WA 1UK3A 2BMGB 2P16A 4Y7BA 1P01A 3A8CA 3TU7H 3SGQE 1SLWB 3A87A 3DFJA 1IQJA 1UTMA 2ZDAH 2G52A 4J1YA 1HJAB 1YLCA 1ZSJA 3A82A 1GJ8B 1ID5H 2ZFQH 3MNCA 1NFWA 2FS9A 2ZDMA 1B5GH 1SGNE 1TLDA 2WUCA 5DJ7A 3SV6A 1A0LA 2SNVA 4K3JA 1WBGB 3Q77A 2QIQA 1GG6B 1D3DB 2ZO3H 4ABJA 3F9EA 2GD4B 1Y5UT 1QJ6B 1FZZA 1O2ZA 3E0PB 3LONA 2C8ZB 3D49H 1A4WH 1MZDA 4O97A 4Q7XA 5FCRA 4KP0A 3T28A 5FX6A 2AS9A 1DICA 3M5MA 3MO3A 1O3EA 1MCVA 1MTVA 2BM2A 1ZGIA 4YT6H 2BYAX 3PWBA 3RXMA 5L6NH 2OBQA 3PMHB 1P2NA 1BTZA 2R9PA 4NA8A 3T27A 4LXBH 3EAJA 1MTSA 1TGCA 4IC6A 2PTCE 4AOQA 2XCNA 2ODPA 2ZPQA 3O8CA 3TK5A 1EAXA 5FBIA 3HATH 5DP5A 4ZKNU 4ZH8A 1QR3E 1ZR0A 2ALVA 2PKSB 1Q3XA 4X2WA 2LPRA 3SGBE 2VIQA 5L2ZH 3ZV8A 1DSTA 3U98H 1V2NT 3Q3YA 2CHAC 2ZU2A 3A80A 1G32B 3GDSA 4D8NA 4U2WA 1L2EA 1C2KA 1ELTA 2BXUH 3EGKH 4UFDH 1TRYA 1UK2A 1HAHH 2ZNKH 1O2PA 2FO9A 2ZFRH 3AASA 2ODQA 4B73A 3BTDE 2ZCKP 1VJ9U 1FONA 1YCPK 4FU7A 5G4BA 1TBQH 1C5TA 2G81E 4ISOA 2ANWA 1UTQA 1GBLA 4YLUA 1F0TA 3U1IB 1UTPA 3VXEH 2ZP0H 3ZZAA 1HAXB 3LGWA 2BVSH 1ZMJA 1MKXK 3BN9A 3RXQA 1FPCH 4LK4A 1ESTA 1G2MA 1W2KH 2QXHA 4FU9A 1EP6A 1AU8A 3QN7A 1VZQH 3SU3A 3GY5A 2O8LA 4BAKB 2IPHA 5JYIA 1P9SA 2BB4A 3RLYH 2ZA5A 1E0FD 1GHXH 2ALPA 1W11U 1SQOA 3B9FH 2J38A 1LTOA 3TNTA 3P8NA 1TPOA 1DDJA 1XXDA 1AFEH 1Y5BT 1Z6JH 3P6ZB 4ZKOU 1GBCA 3UOPA 3RXJA 5C67A 3BTKE 3TK9A 3BIUH 5C1UA 2V3OH 2GX4A 2ZHEH 3SJKA 3M35A 1MTWA 1A1RA 1LVBA 1BDAA 4ZUHA 1KYNA 2FOFA 2WYJA 2VWLA 4Q7YA 4YO9A 1QQ4A 1ZZZA 2BD9A 1O5CB 5EXLA 2OC1A 4NFFA 3OTJE 3GISB 4WY3A 1CQQA 5E2OA 1NU7B 2BZAA 3QGNB 1LHDH 2OINA 2ZFTA 1TNGA 4ABHA 1T32A 2VINA 4H42U 4UEHH 2CJIA 2J34A 2FMJA 1TGTA 3SZNA 1GJ4H 1OYTH 4ASHA 2K1QA 4KTUA 4Z0KA 1TPPA 2PKAB 4JK6A 2BOHB 5EXNA 2F9NA 5TJXA 1W3CA 5DK1A 1EX3A 2ZHQH 3RXSA 1VCWA 4UDWH 3MO6A 1TNHA 4KTCA 2FOAA 1VCPA 2NU3E 4MPVA 1U6QA 2P95A 3ZVGA 1G30B 1BTPA 3LGVA 4TY6A 3EYDA 1GMDF 5EQRA 2BY7X 2ZTZA 1GJ9B 3U9AH 2O9QA 2GV7A 4JZIA 1C5NH 8ESTE 1YPHC 3E0NB 1AO5A 1AMHA 1V2RT 5K7RA 3E91A 2C3SA 2TBSA 1GWAA 1MD8A 4I8LA 3GDVA 2A7JA 3G01A 1AVGH 3SJIA 1DM4B 5F03A 1GI6A 4O3UA 2FTMA 4I32A 2J4IA 3KQEA 1P57B 2XCFA 2VVCA 1BCUH 3KQCA 3SHCH 3UOUA 2KAIB 4CR9A 2YNBA 5A0AE 4DJZB 3RM0H 1MAXA 5AFZH 1ETTH 1JIMA 2Y80A 4JCNA 1OPHB 1ZYOA 1O3CA 1MQ6A 2ZCHP 4A7IB 4ABFA 3KCGH 5FAHA 1UHBA 3B8JA 4ESTE 1GHAF 3RXBA 1D3QB 1AFQC 5FPTA 4K1TA 2G4UA 1AWFH 3K6ZA 1S0RA 2VH6A 4MNVA 1GBIA 1O3AA 1K1PA 3FP6E 1GCTC 1FAXA 2F9UA 2WPMS 1TE0A 3A8BA 1OS8A 2G4TA 3BV9B 3ZZ8A 1LHCH 2C4FH 1O5EH 1DLKB 1WQVH 1O32A 5C1YA 4LOYH 4A92A 2FX6A 2WV5A 1UVTH 3M7UA 4K8YA 2OQUA 4NG9H 4X8TH 2B7DH 1O33A 4IBLH 2ZC9H 1KSNA 5EQSA 1FUJA 1GI3A 3UY9A 2FLBH 1SI5H 2OC0A 2PTNA 1W13U 2VWNA 5HXFA 2AEIH 2D2DA 1HAVA 1QL9A 2F9BH 3I78A 1NRSH 1CA0B 2XBWA 3DUXH 3A7WA 1JRTA 4K1SA 3RUOA 1ZLRA 1IQGA 2F9OA 3ZZ6A 3PTNA 1GI0A 1P3EA 2EA3A 1C1VH 1FV9A 1LO6A 3MOCA 2WUBA 3ZZ5A 1QRXA 3QGJA 3EE0B 1TBRH 1S5SA 1C5SA 4MPUA 1V2QT 3MU1A 1GBFA 1EPTB 2BHGA 3ZZDA 1O3NA 3ZVAA 1CT0E 2A4QA 4KELA 4BTUB 2HWLB 3MH6A 3UR9A 1CBWB 1BJUA 2FOHA 1O2RA 1J9CH 4CBNA 1W0YH 1IQKA 1O3FA 3NCLA 3A85A 1D6RA 1NC6A 2HNTC 4OS5A 3TJVA 4E05H 4Z6AH 1DT2A 2BY6X 1G2LA 3K6YA 1SG8B 4ABBA 2ZGBH 1TMBH 3BEIB 3OX7U 1SGIB 2C8YB 1EP5A 1EUFA 2A1DB 3P8FA 1LPKB 1TGNA 2VIOA 4ABGA 3L33A 1W0ZU 2PV9B 1ANBA 1AKSA 1TMUH 2NWNA 2HALA 1VCQA 1OOKB 3HKJB 2ZWLH 1SB1H 1ZRKA 3V7TA 4DVAU 5FCKA 2D8WA 2ZKSA 4MPXA 1Y3VA 1HIAB 4DURA 3LGYA 1UTOA 2AMPA 4WMEA 2UUKB 2XW9A 1TMTH 3A88A 4FVDA 5IYTA 1RGQA 3RXHA 2R2WU 5J4SA 1ZJKA 1T7CA 4UE7H 1Z8RA 4NIVA 3M3SA 5T6GA 1SFQB 2V0BA 3BTWE 1T31A 2EEKA 4NWKA 1XVOA 2ZDNA 4F4OC 1VGCC 4JZDH 3MHWU 1MKWH 2BLVA 3FP7E 1NM6A 1A0HB 3EA8A 1SGCA 3EDXB 3ITIA 2A5AA 1AZZA 4RKOB 3TIUA 3KQDA 1SBWA 1GMDG 1O38A 2QF3A 1C4V2 2HPPH 1LPGB 3P92A 1A5GH 1YBWA 1BA8B 3LOXA 4MNXA 1BRAA 1C1SA 5PTPA 3RC5A 3HKIB 4B75A 3MNXA 2FI5E 3RXPA 1O2TA 1C5MD 1V6DA 1NESE 5EU8A 3HGNA 1ZOMA 1NTPA 1SGQE 2HPQH 1FN8A 5JB8S 2BY8X 4K8BA 1KXEA 1HPGA 4CHAC 1CHGA 3MNSA 2VH0A 1K22H 2AMQA 3SI4H 3RU4D 3SUDA 1Z71A 5F8XA 3RXIA 1W14U 1W7GH 5DO4H 1GHAG 4LZ4B 4JYVH 2VGCB 2B8OH 1TAWA 1TONA 4H6TA 3OYPA 4R8TB 3QWCH 1JMOH 4AFSA 1NT1A 3KIDU 2G00A 1C2DA 3SUFA 1YF4A 3U69H 1ANEA 2H6MA 2JETC 2V35A 3GCHC 4WH6A 3T26A 1ZHRA 3QK1A 1EZXC 1LVYA 5E0GA 4DCDA 2XRCA 3FANA 1L0ZA 1YLDA 1IQNA 2STBE 1D9IA 2Y7ZA 5DP7A 3LC5A 4I8HA 1O3MA 5FPSA 1H4WA 1DY8A 3ATWA 2WPIS 1BMLA 3N7OA 3STIA 2FI3E 1F5KU 3PO1C 5TCAA 1HAPH 1SHHB 1HAGE 1ESAA 1B0EA 5CHAB 3RM2H 4GCHF 3RXDA 5LPRA 3LH3A 5FX5A 2XC5A 1EATA 1BBRK 1QA7A 1BRBE 2AIQA 2TGTA 4U01A 5L2YH 1UVUH 4O03A 3D65E 2FTLE 1D3TB 2FS8A 4AN7A 3UTUH 2ZPSA 1MUEB 3DHKH 1T8NA 3W94A 1FJSA 3U8OH 1YC0A 3K9XB 3RC4A 3ATIA 1S82A 2OP9A 4AB8A 2OC8A 1AI8H 1NPMA 5E0JA 1QBOA 1ZMLA 5B6OA 5TCCA 2SGFE 4MTBA 4GPGA 4AORA 2FPZA 3ZVCA 2BLQA 1BOQA 3C1KA 2CXVA 5EW2H 1SGFG 4LZ1H 3A7ZA 1SGEE 1HBTH 1MH0A 4BAOB 2Y82A 3KGPA 6GCHG 1GJBB 2TGDA 4U30A 3RXCA 1OSSA 4FUBA 4Y79A 2EI8A 5J4QA 3VB7A 2Y5FA 2Z3DA 4INKA 2CN0H 3MWIU 3T29A 1V2PT 4X6MA 1L1NA 1PQ8A 4X8SH 1GGDC 5AHGH 1DWBH 1TGSZ 1O3JA 4DGJA 1DFPA 2H1UA 1O2UA 1WTGH 4DOQA 1LDTT 1V2UT 2GZ9A 3QX5H 4GUXA 3K2UA 3A8DA 4JZFH 3S9BA 1BMAA 3VB3A 4YT7H 1AD8H 1QCPA 2YNAA 2GZ7A 1GBEA 2PLXA 8KME2 2FWWA 6LPRA 1KXFA 1VITF 2ZHWH 4Y8YA 1P2QA 3F9HA 2GCHG 2HOBA 3GOVB 3SQEE 1WTHD 1GI1A 1TRNA 3F9FA 5GCHF 3Q3XA 1HB0B 3SJ8A 5BRRE 4I31A 3MU8A 4WMDA 3MMGA 4INLA 4YESB 5EG4A 2AERH 3A7XA 5DP6A 1QNJA 5K0HA 1ELVA 1GHWH 1VJAU 3LGIA 3QDZB 1KLJH 4R0IA 1O34A 3F68H 4NA9H 3PLKA 2F91A 7GCHG 2Q6GA 3TITA 3SQHE 1BBRH 2SGAA 4D7FA 1KDQA 5DP9A 2ODYB 2BDGA 1XMNB 2UWPA 1NRNH 1T4UH 2P94A 4FUJA 1QHRB 1LHGH 1AN1E 4DG4A 2ZI2H 1C1UH 4D76A 5JBBS 2B0FA 4VGCB 1P03A 4Y10E 3SU4A 1XM1A 3ZZ4A 1BHXB 1HRTH 2CF8H 2ASUB 1MMJN 1SHYA 3GY4A 1QA0A 3OU0A 1HAYB 4Y8ZA 4ZHMU 1EJAA 6CHAB 1O2NA 1CT2E 1AWHB 1WCZA 1DUAA 4D9QA 1SGDE 1FQ3A 1TGBA 4BXWA 1K1IA 5F6MA 4XBDA 4KGAA 3VEQB 1HFDA 1AE5A 5AF9H 1KTSB 3MTYA 3TH4H 3VB5A 2ZTXA 5EXMA 1S6HA 2ZPRA 3MH7A 2GMTB 2FM2A 3A8AA 2IN2A 1K21H 2Z3EA 6ESTA 1TYNA 1DWDH 4NSVA 1N8OB 4JYTA 4MPWA 1CU1A 2VIDA 2FYRA 2ZFPH 3ENSB 3UNSA 1O2KA 1Y3YA 3K65B 2BD8A 1KXBA 3FFGA 2BX4A 1Z7KA 2WV4A 3TK6A 2AMDA 1RIWC 2SGPE 1AB9C 1S0QA 3QZRA 1IOEA 2WPJS 1QQUA 1NRPH 3H5CB 3F9GA 1HLTH 1YPLH 2BQ6B 2P3FH 1EAIA 2Y5GA 3A7YA 1GI8B 3PLBA 3KQBA 1GVLA 5H4IB 4U32A 1H9LB 1OP2A 4GCHG 2ZU3A 4IN2A 1UK4A 1GHVH 4IMQA 3UUZA 4CREA 2ZHDA 2C93B 1AUJA 3TJNA 1O2OA 4XDEA 5E0HA 1O2GH 1SPJA 1Z1IA 2HVXA 1AZ8A 4MG3A 3ZV9A 4X6NA 4NA7A 3BG4C 4Y0ZE 3TGKE 1BT7A 1DOJA 1G3CA 1RFNA 4H4FA 1H8DH 1BTUA 5DKMA 3BG8A 1AHTH 3SW2B 2A4OA 1HXFH 3E1XB 1C1MA 3LH1A 4AX9H 1GHBG 1UCYE 2UUFB 3PLPA 4NIYA 1C5XB 1C5PA 1SLVB 3GY2A 7LPRA 4WXVA 5A0CA 1BMMH 4YM9A 1KY9A 1C1NA 3PMJA 1L4DA 3TGJE 1GMHF 1CGIE 4ABAA 3RLWH 2C8XB 4E7RG 2SGQE 1C2GA 2FX4A 1CGJE 2A4GA 4SGBE 2DE9A 2GDEH 2XC0A 2PSXA 3T25A 2RA3A 4O3TA 1BTWA 2CHAB 4K60A 2OCVB 4HFPB 1Z1JA 1PYTC 1QBVH 5A8XA 4FUDA 3URDA 1NO9H 1TBZH 1TNLA 3VGCC 3UQVA 1C2JA 1PPFE 3VPKA 4Q7ZA 1PPBH 2O8MA 5E2PA 4YOIA 2DE8A 1WV7H 3UQOA 1ELCA 5JBAS 3M5OA 1MU6B 3U1JB 1TNJA 4X2VA 1YCPH 4KKDA 2BXTH 3ATLA 4X8VH 1K9OE 4X2YA 1BZXE 1C9PA 2O8WA 1JIRA 1VITG 1HXEH 5A09A 1RTFB 1DX5M 1K1NA 1P05A 1XUKA 1MKXH 1P2KA 2RA0A 5GCHG 1DE7H 1C4Y2 1RS0A 2FP7B 1BITA 2RCEA 1ARCA 4X6OA 1GBBA 1ARBA 1YYY1 5JDUB 4DIHH 1Z8JB 2PKAA 1T8OA 1B7XB 1ZPBA 2J94A 2ZG0H 1QRZA 3M37A 1T8MA 2LNCA 2CGAA 2UWOA 1GPZA 4FVBA 1DUEA 1YKTA 4XFQA 2VVVA 3S7HB 1P2IA 3RU4T 1H9IE 2GV6A 5EQQA 4JZEH 2PGQB 1P12E 1UVSH 4RSPA 4DT7B 1Q31A 5LH8A 4BXSA 2VU8E 4OS7A 1Y8TA 3ZZ3A 4RN6A 4TPYA 5C20A 3GCTF 2KAIA 4J2YB 1P0SH 4IC5A 2QXGA 2ZU1A 3ATMA 1H8IH 2H9EH 1GBDA 3BIVH 1SVPA 2P8OC 1O2XA 2BDIA 1GCDA 1V2ST 2XC4A 5LPEA 1XX9A 2ZECA 3CS7A 1KXDA 5EOKA 3AAUA 2PW8H 1A2CH 3MI4A 4TYDA 5FPYA 5C3NA 4YOGA 3KL6A 2NU0E 1AVXA 1MCTA 1QB9A 1UVPA 5FBEA 3LDXH 1O0DH 2R3UA 2ULLA 1MZAA 2BQ7B 3SU1A 1C4U2 1ELDE 1O5AB 4CR5A 3RXVA 1TNIA 1AKSB 1O3OA 3IITA 1O3DA 8GCHF 1RRKA 3LPRA 1K28D 3OY5U 2R0LA 1BTXA 1F92A 5A0BA 1EB1H 1SFIA 1V3XA 5FXLA 2WYGA 4NZLA 1O2YA 3PM3A 3SI3H 1XUFA 1Y3UA 3W95A 7ESTE 2NU4E 4UFFH 3A7TA 2VIVA 1FIZA 1WSSH 3TGIE 4OS2A 2PUXB 2A2XH 1F5LA 6GCHF 3BSQA 4Y71A 1O2LA 1AFQB 5C5OA 2ZEBA 2BY9X 3RXLA 5HYOA 1O3HA 2GT8A 2J95A 2TRMA 3V12A 1RXPA 3U8RH 1V2VT 1GCTB 4X1NU 1LMWB 1ELEE 4BANB 2ESTE 2VB0A 4SGAE 1S81A 2Y5HA 1GMHG 1EPTA 3F1SB 4XBCA 2I6SA 1VR1H 2OTVA 3A86A 3KEEA 1W10U 1SOZA 5ETXA 4MVNA 3OY6U 3S7KB 2PR3A 1SQTA 2TGAA 2XYAA 4FUCA 1XKBC 5DGJA 4X0WU 1HDTH 4NSYA 4XSKU 2G8TA 1TIOA 1UCYK 2VWOA 2Q6DA 1O5FH 1NFYA 2W3IA 2ZCLP 4A1VA 1MTNC 1OWJA 1BIOA 2J9NA 5EPYA 3A84A 1MBMA 3VFEA 3PTBA 5C5NA 3T62A 2GCHF 4CH2B 3NUMA 2Z9LA 1MQ5A 4NWLA 1QL7A 5BPEA 5HMAA 1J17T 5A2MH 4BAHB 2PFEA 1PJPA 3HK3B 2Y81A 3SUGA 1ZPCA 4FUIA 2PWXA 1JBUH 2W7UA 1O2IA 1J16A 3UIRA 1ORFA 2ZFFH 5C1XA 1WAYB 4ZKSU 7GCHF 3CS0A 3MU0A 2ZGCA 1HIAA 1HV7A 3TVJB 4YZUA 1O36A 3PV4A 1DXPA 1RD3B 1QB6A 3PB1E 3URCA 1BQYA 1CA8B 2FLRH 1A46H 1ABIH 3SNDA 1HYLA 2ANMH 1B0FA 1LPZB 1O3IA 2M5TA 4O9VA 3S9CA 2FOGA 3FZZA 4ZHAA 3VB4A 1F0SA 1H9HE 1QURH 2VJ1A 1DLEA 3UREA 3BTEE 2FESH 1OXGA 2VIWA 3TH2H 3BTME 4E7NA 1CE5A 1UTJA 3ZYDA 4E06H 3DD2H 3CENA 3P8GA 5I25A 1RJXB 1C2MA 4NCYA 2XTTB 1Z8IB 1EOJA 3ZVFA 2GVFA 3E8LA 4UFGH 1CHOG 2Y6TA 3UNRA 2ZDLA 4BTIB 1GBKA 1UO6A 3O8DA 1LVOA 3SHAH 3ELAH 1O2QA 2XBVA 1O2MA 3ESTA 3LIWA 4XOJA 4AYVB 3S69A 1BTYA 1ZRBA 2C90B 3S0NA 2GCTC 1O31A 3SV8A 1A3BH 3MU4A 3R0FA 1O3LA 1P06A 3GCTG 4BAMB 1TX8A 1OWDA 1GVKB 2FI4E 1C1QA 1GBHA 1SGRE 5A8ZA 4IS5A 5C2ZA 4IW4E 1IQIA 2ZHFH 1SGFA 3UPEA 4XE4A 1WOFA 1L1JA 1P10A 4FXGH 5L30H 1GJ7B 1VGCB 3RC6A 1GBMA 3GDUA 1NRRH 3BTHE 5AVDA 1FY1A 3JZ1B 2H9TH 2RDLA 2FOCA 2V6NA 4BNRA 3SNEA 1HJAC 2BD7A 1ZMNA 2OC7A 4BAQB 4Y0YE 1F0UA 1L4ZA 4B2BA 2O8TA 1A7SA 3RXRA 1WYKA 1EASA 1GL1A 3FVFB 8GCHG 1C2FA 1O5DH 2GDDA 4AGKA 2BZ6H 1HAZB 1GG6C 2AGEX 2HRVA 1J8AA 3HGPA 1GJ5H 4GLYA 1O37A 2A5KA 2G5VA 1GHBF 3MFJA 1QRWA 1GI7B 2TGPZ 2WINI 3GYMA 1BHXF 3BTTE 4CHAB 4CRGA 3EA9A 1JRSA 1NZQH 1LKAA 1OX1A 3P95A 5GPIB 2G51A 1YM0A 2BLWA 5ESBA 4INHA 1FY3A 1C1WH 2FZZA 5JBCS 5JBTA 1K1OA 5LPFA 1EB2A 1F5RA 1THPB 1O2SA 4X6PA 1EJNA 1IQHA 1EOLA 3RXEA 4M7GA 2PGBB 2QCYA 1Z8GA 2PKSC 1FLEE 2A0QB 1BMNH 3ZVEA 1EJMA 4ZHLU 3NZIA 2JETB 3I29A 1FXYA 2W3KA 3GCHB 5AFYH 4FUEA 3AAVA 2Z9KA 1NFXA 3SNBA 1EZUC 2DUCA 1ELAA 1HGTH 1YPHE 1ACBE 1JXPA 1DWCH 1PPEE 3TH3H 4D7GA 3FZDA 4B74A 3NWUA 1GMCF 1N6XA 4FUHA 3ZVBA 2A32A 4I33A 2H2ZA 1D6WA 4X2XA 4XBBA 4ZXYH 2FEQH 1TABE 1G9IE 1YPEH 3PO1B 3SU2A 5I46H 1DY9A 1TALA 2ZFSA 3UR6A 1O3GA 1FN6A 3VB6A 1RTLA 3OSYA 1NFUA 3C27B 1SGPE 2I6QA 1GI9B 1YPKH 1ELBA 1DITH 1TWXB 4CRCA 3LJJA 1AE8H 3SJ9A 4MQAA 1NRQH 1HCGA 3MYWA 3Q00A 2ZGXH 2BDBA 4OS1A 2OD3B 1C2HA 4WWYA 2ZGJA 1WUNH 1XKAC 2OLGA 3NXPA 1FY5A 2A31A 2Z94A 1THRH 2EC9H 3E90B 4HZHA 2OBOA 1ZPZA 1LHEH 2FOMB 1ZTKA 2BVRH 2QXJA 3SNAA 4AG1A 1E35B 5EGMA 1K1MA 1P2JA
chains in the Genus database with same CATH superfamily
3L3TA 1T8LA 1T4VH 1AIXH 1A61H 1C5YB 1D4PB 1O3BA 2NU2E 2VVUA 4TWYA 4JZ1A 2FOBA 2A45B 1ZHPA 1GBAA 3SOSA 3SV7A 2Z7FE 4OGXA 1EQ9A 5E8EH 1ESBA 1DSUA 1GDNA 1P2OA 2A7CA 3RXTA 1SGYE 5EODA 1C9TA 1SC8U 1O5GH 1IHSH 3KQ5A 1QL8A 2R2MB 3ODDA 2QF0A 1O3KA 2ZQ1A 1BRCE 1GGDB 4A1XA 1S85A 2W7SA 1ANDA 3SNCA 1SSXA 2UWLA 2HGTH 7KMEH 2Q6FA 4HGCA 1Y3WA 4TY7A 1OWKA 4K69A 2Z9GA 1ETRH 1PPGE 4UD9H 1S6FA 1OWHA 1PQ5A 1S83A 1F0RA 4OGYA 4UFEH 3TPIZ 1LQDB 1E79D 1H8HD 1SLXB 3WY8A 1BTHH 2JJ1D 1ANCA 3Q3KA 1IQMA 1EAWA 4THNH 3SYJA 2P3TB 4DW2U 1J15A 1SR5C 1NU9A 2JH5D 1AVWA 2GJGA 3TLOA 3GY7A 2W26A 3RXUA 9LPRA 3QO6A 2Z3CA 1JWTA 3SU6A 4AG2A 2HNTE 3M7QA 1EZQA 1C1PA 3EA7A 5CE1A 4F49A 5ESTE 1E36B 3I77A 4OS4A 1GJ6A 1G37A 2GZ8A 1WDIA 3P70B 1SGTA 4AZ2B 3RXKA 4FUFA 2ANYA 1VITH 1FDPA 3IG6B 4Y8XA 5HGGA 2B9LA 2D26C 3T2NA 3M5LA 2QGRA 3D62A 1THSH 2ZDVH 5LGOA 1HNEE 3MU5A 2HLCA 5DG6A 1MD7A 4TPIZ 3KHVA 4KTSA 1LCYA 2WPHS 1UTKA 4X1PU 1K2I1 1K1JA 4QT8C 2QXIA 1SMFE 1C5WB 2F9PA 2XXLA 2ZGHA 1GI2A 3LKWA 2A2QH 1E34B 3E16B 1W8BH 3GY3A 4NIXA 2BDYA 3DSGA 1M9UA 1DANH 1P3CA 4A1TA 2ZZUH 2GTBA 1O3PB 2WPDD 4IN1A 1OP0A 1A3EH 1SLUB 1TA2A 3NRLA 4ABIA 3N7DA 3GYLB 4RKJB 3B23B 4AFZA 2SFAA 3DA9B 2UUJB 5JB9S 5EW1H 1PFXC 3U8TH 1TOCB 1GBTA 1GDQA 2ZU4A 2TIOA 4ZMAH 2B5TB 1QJ7B 4MNWA 2BQWB 1XUHA 1FIWA 1GVZA 1OKXA 1NN6A 2BY5X 1CT4E 1GJCB 1ZTJA 4ZXXH 5CMXH 5GXPA 1FPHH 1TRMA 1YPJH 2YOLA 2ILNA 3LGTA 1W12U 1MTUA 1UTNA 1CA0C 1RIWB 3ZZ9A 1AB9B 1TX6A 1SL3A 1GMCG 3LC3A 1WU1A 3RMLH 1UHBB 2XNDD 4WH8A 3VXFH 5ABWA 4AFUA 3PMAB 1INCA 2PSYA 3A83A 1GHYH 1YGCH 3H7OA 3LJOA 1V2LT 4GVUA 3ZZ7A 1CGHA 3ZVDA 3BTGE 1NY22 2BD5A 2QY0B 1TQ7B 4CH8B 5DP3A 1EPTC 1EZSC 2J92A 1A0JA 2QAAA 4NGAH 3O8BA 2XNIA 4MDSA 1CBWC 3LU9B 1QBNA 3Q76A 4Q80A 2WPKS 4IMZA 3F0PA 1C5ZB 2FYQA 2OQ5A 2BDAA 3SGAE 3BG4B 3A7VA 1O2WA 2JKHA 2F9VA 3LGUA 4B71A 2QV1A 2R3YA 3SV2H 1PPCE 2VWMA 2BDHA 1TNKA 1HAVB 1CHOF 1LQEA 4YLQH 1ABJH 1NROH 3BEUA 4D9RA 3H7TA 1LVMA 9ESTA 1Y5AT 4I8KA 3PMBB 1QGFA 1QY6A 3GCOA 4WXIA 3V13A 1C5VA 1FY8E 5JPMH 1DWEH 1P02A 1ZTLA 1XXFA 1EXFA 1YWUA 3L6PA 3GCNA 4CRAA 3SJOA 1ZSLA 3RMOH 5DP4A 3ZZCA 3GICB 2Z9JA 3DT0H 3TJUA 3M3VA 3KF2A 1H1BA 2BOKA 1C5UA 3HPTB 4NIWA 3VGCB 1ZHMA 2PHBA 3QTVH 2BLOA 4HTCH 3N99A 1O39A 4K2YA 3UWIA 1Y59T 3D23A 2RG3A 2QN5T 1YP9A 3RMMH 1GI4A 2WPLS 1KLTA 1BBRE 1ZJDA 3KYGA 1MKWK 3KNXA 3SU5A 4PROA 1O2JA 1KLIH 2ZQ2A 3M61U 2P3UB 3FAOA 2XBXA 1JOUB 1E1RD 4ZROA 3R3GB 2SNWA 3SN8A 5T3HA 4GSOA 5GIBA 4CBOA 3PYHA 1YCPM 2AIPA 3FO8D 1X7AC 4GAWA 2BD2A 4K5ZA 4B76A 1D3PB 4ZKRU 3V0XA 1FAKH 3UWJH 1O2HA 1YPMH 1QIXB 2V3MA 4Y7AA 1QJ1B 2A5IA 4AFQA 4B2AA 5HM2A 2AGGX 3UFAA 1UMAH 4H6SB 2HNTF 2GGVB 1OWEA 1MU8B 1P09A 2F83A 5GDSH 5GWZA 3RMNH 1XUGA 3CP7A 1GDUA 1XUJA 2H9HA 3RXAA 1DS2E 4JYUH 1ELGA 1EAUA 4ABEA 5IDKA 1HUTH 1CO7E 2K8IA 4GHQA 1GI5A 4ISLA 4CRFA 1DPOA 5KEDA 3HK6B 1OP8A 1KIGH 1IHTH 1N6YA 1ZSKA 4B1TA 1C1RA 2VGCC 3NK8A 4HI3A 4Q4LA 1P9UA 1F7ZA 4XD7D 4YOJA 3SO3A 2H5DA 2ZF0H 1AY6H 2P59A 3MNBA 1XUIA 3M36A 2BTCE 3FP8E 2BX3A 1A5HA 1W0JD 2XBYA 1ZGVA 3AW0A 3MH4A 5T6FA 4ISIH 2F3CE 2F4LA 4ABDA 3ODFA 1G3DA 2BD3A 2P8OB 2VIPA 4WJG2 1UTLM 3A89A 1O2VA 2ZIQH 3LT3A 2CV3A 2ZDKA 3BTQE 3NPSA 1BUIA 3F0OA 1LHFH 5B6LA 2FOEA 3MQKC 4OM9A 1FNIA 1DVAH 1O35A 2NU1E 1P11E 1TQ0B 1OWIA 4DIIH 1J14A 2P93A 4FU8A 2FIRH 1OYQA 1O30A 2SGEE 3P17H 1Y3XA 1BJVA 3GY8A 1N1LA 1V2MT 5SGAE 2Q1JA 4TSFD 2O8UA 4NZQA 1C2IA 3A81A 5CHAC 2QC2A 4JK5A 4X1QU 1PQ7A 1G36A 1S84A 2IJOB 1BMFD 4X8UH 3V3MA 1AQ7A 1GL0E 4JMYA 1MBQA 1QB1A 1P8VC 1PQAA 3AK5A 1IAUA 3IWMA 1UJ1A 1AUTC 3TNSA 4AB9A 4MNYA 1MAYA 1E38B 4A6LA 3BF6H 4YTAA 3SU0A 3F6UH 4CRBA 2EI7A 3OFND 1W7XH 3M5NA 4Y6DA 5EPNA 4I8JA 1CSOE 1SOTA 3ZYEA 5F8ZA 2TPIZ 1QFKH 1GJDB 4ACBA 3OEHD 1SQAA 2THFB 1IQFA 2OUAA 2EI6A 3DFLA 5DP8A 3TJOA 2W5EA 3H09A 1C5QA 1A5IA 2A4RA 2JH0D 3SV9A 3JZ2B 4I7YH 4MLFB 1Z6EA 1AGJA 1RTKA 1EKBB 5A8YA 4CRDA 5HKKD 2VNTA 3PRDA 4TT3D 1C2EA 3RXGA 1V2JT 1C5RA 2AGIX 1PYTD 1IQLA 1BB0B 2PUQH 4UONA 2BD4A 3NKKA 1FMGA 1LKBA 1KXAA 2AYWA 4I8GA 1TPSA 4K1EA 5F53A 3SORA 1YLNA 2ZU5A 5CHBA 4B2CA 1UVOA 3E3TA 3UB0A 4X1RU 4M9FA 2XWBI 2FXRA 1MTNB 4WVPE 2QA9E 3SZEA 1UCYH 3QUMP 1XVMA 1HAIH 2AH4X 4Q2KA 5FHTA 4DY7B 3ATKA 1G3EA 3MH5A 4ZAEA 3QTOH 4GHTA 1FI8A 2R0KA 3E6PH 1V2KT 1IQEA 1P04A 3MO9A 1PPHE 1V2OT 1TPAE 2QE7D 2AFQB 3ZZBA 2IOTA 1KTTB 2UUYA 2G55A 3GS9A 1C1TA 2C8WB 3KYFA 3SUEA 1WQSA 4FUGA 1NS3A 4AYYB 3RDZA 2GP9B 3KN2A 1KXCA 1GHZA 2Y7XA 2Z6BD 1CVWH 2CF9H 1V2WT 2H5CA 4WF8A 2L74A 3UNQA 2FODA 3RXFA 2G5NA 1L1GA 2GT7A 4AGJA 1O5BB 8LPRA 3PROA 4Y76A 1HJ9A 2V3HH 1F2SE 3RP2A 4IGDA 4TWWA 1HJ8A 3M3TA 1FY4A 4AC9A 5HM9A 1QTFA 1C1OA 2BDCA 2WHXA 3O8RA 2BVXH 4BTTB 3RU4E 3S9AA 2A7HA 1HAOH 1E37B 2ZTYA 4VGCC 4ISNA 4BOHA 1TA6A 2JDID 2ANKH 3T5FH 3QZQA 4XRNA 1TFXA 1ELFA 2KCOA 1ETSH 3VG8A 1V2TT 1C5OH 6CHAC 1C5LH 1YPGH 2GKVE 5GJ4B 3SBKA 1FX0B 3AW1A 2JH6D 2CK3D 2OXSA 2CMYA 3BTFE 2J2UA 1BRUP 1G3BA 4ISHH 5EJLA 2XWAA 1YY3A 1GJAB 5F8TA 3BEFB 2GCTB 4A5TS 3STJA 2FDAA 3AVZA 1P2MA 3PWCA 5T6DA 4NFEA 4ZCNA 1TB6H 2QYIA 1PPZA 2SGDE 4Y11E 2Z9IA 2D1JA 2GMTC 1KDQB 1GBJA 1K1LA 4X1SU 1TOMH 1COWD 1N8OC 3EQ0H 3M7TA 4WMFA 1TX7A 1DXWA 5DPAA 3GY6A 2STAE 3QLPH 4OS6A 3P8OA 3RXOA 1C2LA 4F55A 1Q2WA 1UK3A 2BMGB 2P16A 4Y7BA 1P01A 3A8CA 3TU7H 3SGQE 1SLWB 3A87A 3DFJA 1IQJA 1UTMA 2ZDAH 2G52A 2KCPA 4J1YA 1HJAB 5KECA 1YLCA 5IK2D 1ZSJA 3A82A 4Q63A 1GJ8B 1W0KD 4P02A 1ID5H 2ZFQH 1NBME 3MNCA 1NFWA 2FS9A 1OHHD 2ZDMA 1B5GH 1SGNE 1TLDA 2KR7A 2WUCA 5DJ7A 3SV6A 1A0LA 2SNVA 4K3JA 1WBGB 3Q77A 2QIQA 1GG6B 3F2GA 1D3DB 2ZO3H 4ABJA 3F9EA 2GD4B 1Y5UT 1QJ6B 3PV5A 3DCLA 1FZZA 1O2ZA 3E0PB 3LONA 2C8ZB 3D49H 1A4WH 1MZDA 4O97A 4Q7XA 5FCRA 4KP0A 3T28A 5FX6A 2AS9A 4F48B 1DICA 3M5MA 3MO3A 1O3EA 1MCVA 1MTVA 2BM2A 1ZGIA 4YT6H 2BYAX 3PWBA 3RXMA 5L6NH 2OBQA 3PMHB 1P2NA 1BTZA 2R9PA 4NA8A 3T27A 4LXBH 3EAJA 1MTSA 1TGCA 4IC6A 2PTCE 4AOQA 2XCNA 2ODPA 2ZPQA 3O8CA 3TK5A 1EAXA 5FBIA 3HATH 5DP5A 4ZKNU 4ZH8A 1QR3E 1ZR0A 2ALVA 2PKSB 1Q3XA 4X2WA 2LPRA 3SGBE 2VIQA 5L2ZH 3ZV8A 4FOUC 1DSTA 3U98H 1V2NT 3Q3YA 1H8ED 2CHAC 2ZU2A 3A80A 1G32B 3GDSA 4D8NA 4U2WA 1L2EA 1C2KA 1ELTA 2BXUH 3EGKH 4UFDH 1TRYA 1UK2A 1HAHH 2ZNKH 1O2PA 2FO9A 2ZFRH 3AASA 2ODQA 4B73A 3BTDE 2ZCKP 1VJ9U 1FONA 1YCPK 4FU7A 5G4BA 1TBQH 1C5TA 2G81E 4ISOA 2ANWA 1UTQA 1GBLA 4YLUA 1F0TA 3U1IB 1UTPA 3VXEH 2ZP0H 3ZZAA 1HAXB 3LGWA 2BVSH 1ZMJA 1MKXK 3BN9A 3RXQA 1FPCH 4LK4A 1ESTA 1G2MA 1W2KH 2QXHA 4FU9A 1EP6A 5C0UA 1AU8A 3QN7A 1VZQH 3SU3A 3GY5A 2O8LA 4BAKB 2IPHA 5JYIA 1P9SA 2BB4A 3RLYH 2ZA5A 1E0FD 1GHXH 2ALPA 1W11U 1SQOA 3B9FH 2J38A 3FN8A 1LTOA 3TNTA 3P8NA 1TPOA 1DDJA 1XXDA 3U28C 2KCAA 1AFEH 1Y5BT 1Z6JH 3P6ZB 4ZKOU 1GBCA 3UOPA 3RXJA 5C67A 3BTKE 3TK9A 3BIUH 5C1UA 2V3OH 2GX4A 2ZHEH 3SJKA 3M35A 1MTWA 1A1RA 1LVBA 1BDAA 4ZUHA 3EE7A 1KYNA 2FOFA 2WYJA 2VWLA 4Q7YA 4YO9A 1QQ4A 1ZZZA 2BD9A 1O5CB 5EXLA 2OC1A 4NFFA 3OTJE 3GISB 4WY3A 1CQQA 5E2OA 1NU7B 2BZAA 3QGNB 1LHDH 2OINA 2ZFTA 1TNGA 4ABHA 1T32A 2VINA 4H42U 4UEHH 2CJIA 2J34A 2FMJA 1TGTA 3SZNA 1GJ4H 1OYTH 4ASHA 2K1QA 4KTUA 4Z0KA 1TPPA 2PKAB 4JK6A 2BOHB 5EXNA 2F9NA 5TJXA 1W3CA 5DK1A 1EX3A 2ZHQH 3RXSA 1VCWA 4UDWH 3MO6A 1TNHA 4KTCA 2FOAA 5KGOA 1VCPA 2NU3E 4MPVA 1U6QA 2P95A 3ZVGA 1G30B 1BTPA 3LGVA 4TY6A 3EYDA 1GMDF 5EQRA 2BY7X 2ZTZA 1GJ9B 3U9AH 2O9QA 2GV7A 4JZIA 1C5NH 8ESTE 1YPHC 3E0NB 1AO5A 1AMHA 1V2RT 5K7RA 3E91A 2C3SA 2TBSA 1GWAA 1MD8A 4I8LA 3GDVA 2A7JA 3G01A 1AVGH 3SJIA 1DM4B 5F03A 1GI6A 4O3UA 2FTMA 4I32A 2J4IA 3KQEA 1P57B 2XCFA 2VVCA 1BCUH 3KQCA 3SHCH 3UOUA 2KAIB 4CR9A 2YNBA 5A0AE 4DJZB 3RM0H 1MAXA 5AFZH 1ETTH 1JIMA 2Y80A 4JCNA 1OPHB 3N7EA 1ZYOA 1O3CA 1MQ6A 2ZCHP 1KMHB 1E1QD 4A7IB 4ABFA 3KCGH 5FAHA 1UHBA 3B8JA 4ESTE 1GHAF 3RXBA 3OEED 3WW7A 1D3QB 1AFQC 5FPTA 4K1TA 2G4UA 1AWFH 3K6ZA 1S0RA 2VH6A 4MNVA 1GBIA 1O3AA 1K1PA 3FP6E 1GCTC 1FAXA 2F9UA 2WPMS 2M2AA 3OE7D 1TE0A 3A8BA 1OS8A 2G4TA 3BV9B 3ZZ8A 2F43B 1LHCH 2C4FH 1O5EH 1DLKB 1WQVH 1O32A 5C1YA 4LOYH 4A92A 2FX6A 2WV5A 1UVTH 3M7UA 4K8YA 2OQUA 4NG9H 4X8TH 2B7DH 1O33A 4IBLH 2ZC9H 1KSNA 5EQSA 1FUJA 1GI3A 3UY9A 2FLBH 1SI5H 2OC0A 2PTNA 1W13U 2VWNA 5HXFA 2AEIH 2D2DA 1HAVA 1QL9A 2F9BH 3I78A 1NRSH 1CA0B 2XBWA 3DUXH 3A7WA 1JRTA 4K1SA 3RUOA 1ZLRA 1IQGA 2F9OA 3ZZ6A 3PTNA 1GI0A 1P3EA 2EA3A 1C1VH 1FV9A 1LO6A 3MOCA 2WUBA 3ZZ5A 1QRXA 3QGJA 3EE0B 1TBRH 1S5SA 1C5SA 4MPUA 1V2QT 2YMSC 5EJZA 3MU1A 1GBFA 1EPTB 2BHGA 3ZZDA 1O3NA 3ZVAA 1CT0E 2A4QA 4KELA 4BTUB 2HWLB 3MH6A 3UR9A 2KCYA 1CBWB 1BJUA 2FOHA 1O2RA 1J9CH 4CBNA 2AHME 1W0YH 1IQKA 1O3FA 3NCLA 3A85A 1D6RA 1NC6A 2VBCA 2HNTC 4OS5A 3TJVA 4E05H 4Z6AH 1DT2A 2BY6X 1G2LA 3K6YA 1SG8B 4ABBA 2ZGBH 1TMBH 3BEIB 2OK5A 3OX7U 1SGIB 2C8YB 1EP5A 1EUFA 2A1DB 3P8FA 1LPKB 1TGNA 2VIOA 4ABGA 3L33A 1W0ZU 2PV9B 1ANBA 1AKSA 1TMUH 2NWNA 2HALA 1VCQA 1OOKB 2LP6A 3HKJB 2KX4A 2ZWLH 1SB1H 1ZRKA 3V7TA 4DVAU 1SQRA 5FCKA 4RT1A 2D8WA 2ZKSA 1EFRD 4MPXA 1Y3VA 1HIAB 4DURA 3LGYA 1UTOA 2AMPA 4WMEA 2UUKB 2XW9A 1TMTH 3A88A 4FVDA 5IYTA 1RGQA 3RXHA 2R2WU 5J4SA 1ZJKA 5T1VA 1T7CA 4UE7H 1Z8RA 4NIVA 5CDFE 3M3SA 5T6GA 1SFQB 2V0BA 3BTWE 1T31A 2EEKA 4NWKA 1XVOA 2ZDNA 4F4OC 2HVYB 1VGCC 4JZDH 3MHWU 1MKWH 2BLVA 3FP7E 1NM6A 1A0HB 3EA8A 1SGCA 3EDXB 3ITIA 2A5AA 1AZZA 4RKOB 3TIUA 3KQDA 1SBWA 2WV9A 1GMDG 4ACAA 1O38A 2QF3A 1C4V2 2HPPH 1MABB 5C94A 1LPGB 3P92A 1A5GH 2QF4A 1YBWA 1BA8B 3LOXA 4MNXA 1BRAA 1C1SA 5PTPA 3RC5A 3HKIB 4B75A 3MNXA 2FI5E 3RXPA 1O2TA 1C5MD 1V6DA 5C0TA 2J98B 1NESE 5EU8A 3HGNA 1ZOMA 1NTPA 4B6EA 1SGQE 1UW7A 2HPQH 1FN8A 5JB8S 2BY8X 4K8BA 1KXEA 1HPGA 4CHAC 1CHGA 3MNSA 2VH0A 1K22H 2AMQA 3SI4H 3F2HA 3RU4D 3SUDA 1Z71A 5F8XA 3RXIA 5FL7D 1W14U 1W7GH 5DO4H 1GHAG 2HLDD 4LZ4B 4JYVH 2VGCB 2B8OH 1TAWA 1TONA 4H6TA 3OYPA 4R8TB 2XOKD 3QWCH 3UAIC 1JMOH 4AFSA 2JIZD 1K0HA 1NT1A 3KIDU 2G00A 1C2DA 3SUFA 1YF4A 3U69H 1ANEA 2H6MA 2JETC 2V35A 3GCHC 4WH6A 3T26A 1ZHRA 3QK1A 1EZXC 1LVYA 5E0GA 4ASUD 4DCDA 2XRCA 3FANA 1L0ZA 1YLDA 1IQNA 2STBE 1D9IA 2Y7ZA 5DP7A 2IPQX 3LC5A 4I8HA 1O3MA 5FPSA 1H4WA 1DY8A 4FETA 3ATWA 2WPIS 1BMLA 3N7OA 3STIA 2FI3E 1F5KU 3PO1C 5TCAA 1HAPH 1SHHB 1HAGE 1ESAA 1B0EA 5CHAB 3RM2H 4GCHF 3RXDA 5LPRA 3LH3A 5FX5A 2XC5A 1EATA 1BBRK 1QA7A 4HG6A 1BRBE 2AIQA 2TGTA 4U01A 5L2YH 1NBMD 1UVUH 4O03A 3D65E 2FTLE 1D3TB 2FS8A 4AN7A 3UTUH 2ZPSA 1MUEB 3DHKH 1T8NA 3W94A 1FJSA 3U8OH 1YC0A 3K9XB 3RC4A 3ATIA 1S82A 2OP9A 4AB8A 2OC8A 1AI8H 1NPMA 5E0JA 1QBOA 1ZMLA 5B6OA 5TCCA 2SGFE 4MTBA 2KZ4A 4GPGA 4AORA 2FPZA 3ZVCA 2BLQA 1BOQA 3C1KA 2CXVA 5EW2H 1SGFG 4LZ1H 3A7ZA 1SGEE 1HBTH 1MH0A 4BAOB 2Y82A 3KGPA 6GCHG 1GJBB 2TGDA 4U30A 3RXCA 1OSSA 4FUBA 4Y79A 2EI8A 5J4QA 3VB7A 2Y5FA 2Z3DA 4INKA 2CN0H 2IJD1 3MWIU 3T29A 1V2PT 4X6MA 1L1NA 4RI0A 1PQ8A 4YXWD 4X8SH 1GGDC 5AHGH 1DWBH 1TGSZ 1O3JA 4DGJA 1DFPA 2H1UA 1O2UA 1WTGH 4DOQA 1LDTT 1V2UT 2GZ9A 3QX5H 4GUXA 3K2UA 3A8DA 4JZFH 3S9BA 1BMAA 3VB3A 4YT7H 1AD8H 1QCPA 5GNDA 2YNAA 2GZ7A 1GBEA 2J5UA 2PLXA 8KME2 2FWWA 6LPRA 1KXFA 1VITF 2ZHWH 4Y8YA 1P2QA 3F9HA 2GCHG 2HOBA 3GOVB 3SQEE 1WTHD 1GI1A 1TRNA 3F9FA 5GCHF 3Q3XA 1HB0B 3SJ8A 5BRRE 4I31A 3MU8A 4WMDA 3MMGA 4INLA 4YESB 5EG4A 2AERH 3A7XA 5DP6A 1QNJA 5K0HA 1ELVA 1GHWH 1VJAU 3LGIA 3QDZB 1KLJH 3DSOA 4R0IA 1O34A 3F68H 4NA9H 3PLKA 2F91A 7GCHG 2Q6GA 3TITA 3SQHE 1BBRH 2SGAA 4D7FA 1KDQA 5DP9A 1WXRA 2ODYB 2BDGA 1XMNB 2W6JD 2UWPA 1NRNH 1T4UH 2P94A 4FUJA 2QF5A 1QHRB 5DN6D 1LHGH 1AN1E 4DG4A 2ZI2H 1C1UH 4D76A 5JBBS 2B0FA 2J97A 4VGCB 1P03A 4Y10E 3SU4A 1XM1A 3ZZ4A 1BHXB 1HRTH 3DSPA 2CF8H 2ASUB 1MMJN 1SHYA 3GY4A 1QA0A 2WZQA 3OU0A 1HAYB 4Y8ZA 4ZHMU 1EJAA 6CHAB 1O2NA 1CT2E 1AWHB 1WCZA 1DUAA 4D9QA 1SGDE 1FQ3A 1TGBA 4BXWA 1K1IA 2L6OA 5F6MA 4XBDA 4KGAA 3VEQB 1HFDA 1AE5A 5AF9H 1KTSB 3MTYA 3TH4H 1S6LA 3VB5A 2ZTXA 5EXMA 1S6HA 2ZPRA 3MH7A 2GMTB 2FM2A 3A8AA 2IN2A 1K21H 2Z3EA 6ESTA 1TYNA 1DWDH 4NSVA 1N8OB 4JYTA 4MPWA 1CU1A 2VIDA 2FYRA 2ZFPH 3ENSB 3UNSA 1O2KA 1Y3YA 3F2FA 3K65B 2BD8A 1KXBA 3FFGA 2BX4A 1Z7KA 2WV4A 3OAAD 3TK6A 2AMDA 2RDEA 1RIWC 2SGPE 1AB9C 1S0QA 3QZRA 1IOEA 2WPJS 1QQUA 1NRPH 3H5CB 3F9GA 1HLTH 1YPLH 2BQ6B 2RFKC 2P3FH 1EAIA 2Y5GA 3A7YA 1GI8B 3PLBA 3KQBA 1GVLA 5H4IB 4U32A 1H9LB 1OP2A 4GCHG 2ZU3A 4IN2A 1UK4A 1GHVH 4IMQA 3UUZA 4CREA 2ZHDA 2C93B 1AUJA 3TJNA 1O2OA 4XDEA 5E0HA 1O2GH 1SPJA 1Z1IA 2HVXA 1AZ8A 2EY4C 4MG3A 5HIZA 3WWBA 3ZV9A 3PRBA 4X6NA 4NA7A 3BG4C 4Y0ZE 3TGKE 4P00A 1BT7A 1DOJA 1G3CA 1RFNA 4DT4A 4H4FA 1H8DH 1BTUA 5DKMA 3BG8A 5HIYA 1AHTH 3SW2B 2A4OA 1HXFH 3E1XB 1C1MA 3LH1A 4AX9H 1GHBG 1UCYE 2UUFB 3PLPA 4NIYA 1C5XB 1C5PA 1SLVB 3GY2A 7LPRA 4WXVA 5A0CA 1BMMH 4YM9A 1KY9A 1C1NA 3PMJA 1L4DA 3TGJE 1GMHF 1CGIE 4ABAA 3RLWH 4RT0A 2C8XB 4E7RG 2SGQE 1C2GA 2FX4A 1CGJE 4Z1MD 2A4GA 4SGBE 2DE9A 2GDEH 2XC0A 2PSXA 3T25A 2RA3A 4O3TA 1BTWA 2CHAB 4K60A 2OCVB 4HFPB 1Z1JA 1PYTC 1QBVH 5A8XA 4FUDA 3URDA 1NO9H 1TBZH 1TNLA 3VGCC 3UQVA 1C2JA 1PPFE 3VPKA 4Q7ZA 1PPBH 2O8MA 5E2PA 4YOIA 2DE8A 1WV7H 3UQOA 1ELCA 5JBAS 3M5OA 1MU6B 3U1JB 1TNJA 4X2VA 1YCPH 1QZ8A 4KKDA 2BXTH 3ATLA 4X8VH 1K9OE 4X2YA 1BZXE 1C9PA 2O8WA 1JIRA 1VITG 2PP6A 1HXEH 5A09A 1RTFB 1DX5M 1K1NA 1P05A 1XUKA 1MKXH 1P2KA 2RA0A 5GCHG 1DE7H 1C4Y2 1RS0A 5EIYA 2FP7B 1BITA 2RCEA 1ARCA 4X6OA 1GBBA 1ARBA 1YYY1 5JDUB 4DIHH 1Z8JB 2PKAA 1T8OA 1B7XB 1ZPBA 2J94A 2ZG0H 1QRZA 3M37A 1T8MA 2LNCA 2CGAA 2UWOA 1GPZA 4FVBA 1DUEA 1YKTA 4XFQA 3F3BA 2VVVA 3S7HB 1P2IA 3RU4T 1H9IE 2GV6A 5EQQA 4JZEH 2PGQB 1P12E 1UVSH 4RSPA 4DT7B 1Q31A 5LH8A 4BXSA 2VU8E 4OS7A 1Y8TA 3ZZ3A 4RN6A 4TPYA 2JJ2D 5C20A 3GCTF 2KAIA 4J2YB 1P0SH 4IC5A 2QXGA 2ZU1A 3ATMA 1H8IH 2H9EH 1GBDA 3BIVH 1SVPA 2P8OC 3WWFA 1O2XA 2LELA 2BDIA 1GCDA 1V2ST 2XC4A 5LPEA 1XX9A 2ZECA 3CS7A 1KXDA 5EOKA 3AAUA 2PW8H 1A2CH 3MI4A 4TYDA 5FPYA 5C3NA 4YOGA 3KL6A 2NU0E 1AVXA 1MCTA 1QB9A 1UVPA 5FBEA 3LDXH 1O0DH 2R3UA 2ULLA 1MZAA 2BQ7B 3SU1A 1C4U2 1ELDE 1O5AB 4CR5A 3RXVA 5C17A 1TNIA 1AKSB 1O3OA 3IITA 1O3DA 8GCHF 1RRKA 3LPRA 1K28D 3OY5U 2R0LA 1BTXA 1F92A 2W6ID 5A0BA 1EB1H 1SFIA 1V3XA 5FXLA 2WYGA 4NZLA 1O2YA 3PM3A 3SI3H 1XUFA 1Y3UA 3W95A 7ESTE 2NU4E 4UFFH 3A7TA 2VIVA 1FIZA 1WSSH 3TGIE 2K0QA 4OS2A 2PUXB 2A2XH 1F5LA 6GCHF 3BSQA 4Y71A 1O2LA 1AFQB 5C5OA 2ZEBA 2BY9X 3RXLA 5HYOA 1O3HA 2GT8A 2J95A 2TRMA 3V12A 1RXPA 3U8RH 1V2VT 1GCTB 4X1NU 1LMWB 1ELEE 4BANB 2ESTE 2VB0A 4SGAE 1S81A 2Y5HA 1GMHG 1EPTA 3F1SB 4XBCA 2I6SA 1VR1H 2OTVA 3A86A 3KEEA 1W10U 1SOZA 5ETXA 4MVNA 3OY6U 3S7KB 2PR3A 1SQTA 2TGAA 2XYAA 4FUCA 1XKBC 5DGJA 4X0WU 1HDTH 4NSYA 4XSKU 2G8TA 2V7QD 1TIOA 1UCYK 2VWOA 2Q6DA 1O5FH 1NFYA 2W3IA 2ZCLP 4A1VA 1MTNC 1OWJA 1BIOA 2J9NA 5EPYA 3A84A 1MBMA 3VFEA 3PTBA 5C5NA 3T62A 2GCHF 4CH2B 3NUMA 2Z9LA 1MQ5A 4NWLA 1QL7A 5BPEA 5HMAA 1J17T 3FOAA 5A2MH 4BAHB 2PFEA 1PJPA 3HK3B 2Y81A 5DSFA 3SUGA 1ZPCA 4FUIA 1VKYA 2PWXA 2EQNA 1JBUH 2W7UA 1O2IA 1J16A 3UIRA 1ORFA 2ZFFH 5C1XA 1WAYB 4ZKSU 7GCHF 2YMSB 3CS0A 3MU0A 2ZGCA 1HIAA 1HV7A 3TVJB 4YZUA 1O36A 3PV4A 1DXPA 1RD3B 1QB6A 3PB1E 3URCA 1BQYA 1CA8B 2FLRH 1A46H 1ABIH 3SNDA 1HYLA 2ANMH 1B0FA 1LPZB 1O3IA 2M5TA 4O9VA 3S9CA 2FOGA 3FZZA 4ZHAA 3VB4A 1F0SA 1H9HE 1QURH 2VJ1A 1DLEA 3UREA 3BTEE 2FESH 1OXGA 2VIWA 3TH2H 3BTME 4E7NA 1CE5A 1UTJA 3ZYDA 4E06H 3DD2H 3CENA 3P8GA 5I25A 1RJXB 1C2MA 4NCYA 2XTTB 1Z8IB 4I86A 1EOJA 3ZVFA 2GVFA 3E8LA 4UFGH 1CHOG 2Y6TA 3UNRA 2ZDLA 4BTIB 1GBKA 1UO6A 3O8DA 1LVOA 3SHAH 3ELAH 1O2QA 2XBVA 1O2MA 3ESTA 3LIWA 4XOJA 4AYVB 3S69A 1BTYA 1ZRBA 2C90B 3S0NA 2GCTC 1O31A 3SV8A 1A3BH 3MU4A 3R0FA 2J98A 1O3LA 1P06A 3GCTG 4BAMB 1TX8A 1OWDA 1GVKB 2FI4E 1C1QA 1GBHA 1SGRE 5A8ZA 4IS5A 5C2ZA 4IW4E 1IQIA 2ZHFH 1SGFA 3UPEA 4XE4A 1WOFA 1L1JA 1P10A 4FXGH 5L30H 1GJ7B 1VGCB 3CNRA 3RC6A 1GBMA 3GDUA 1NRRH 3BTHE 5AVDA 1FY1A 3JZ1B 2H9TH 2RDLA 2FOCA 2KM0A 2V6NA 4BNRA 3SNEA 1HJAC 2BD7A 1ZMNA 3PV2A 2OC7A 4BAQB 4Y0YE 1F0UA 1L4ZA 5EJ1A 4B2BA 2O8TA 1A7SA 3RXRA 1WYKA 1EASA 1GL1A 3FVFB 8GCHG 1C2FA 1O5DH 2GDDA 4AGKA 2BZ6H 1HAZB 1GG6C 2AGEX 2HRVA 1J8AA 3HGPA 1GJ5H 4GLYA 1O37A 2A5KA 2G5VA 1GHBF 3MFJA 1QRWA 1GI7B 2TGPZ 2WINI 3GYMA 1BHXF 2KFWA 1SKYE 3BTTE 4CHAB 4CRGA 3ZIAD 3EA9A 1JRSA 1NZQH 1LKAA 1OX1A 3P95A 5GPIB 2G51A 1YM0A 2BLWA 5ESBA 4INHA 1FY3A 1C1WH 2FZZA 5JBCS 5JBTA 1K1OA 5LPFA 1EB2A 1F5RA 1THPB 1O2SA 4X6PA 1EJNA 1IQHA 1EOLA 3RXEA 4M7GA 2PGBB 2QCYA 1Z8GA 2PKSC 1FLEE 2A0QB 4B6FA 1BMNH 3ZVEA 1EJMA 4ZHLU 3NZIA 2JETB 3I29A 1FXYA 2W3KA 3GCHB 5AFYH 4FUEA 3AAVA 2Z9KA 1NFXA 2WSSD 3SNBA 1EZUC 2DUCA 1ELAA 1HGTH 1YPHE 1ACBE 1JXPA 1DWCH 1PPEE 3FKSD 3TH3H 4D7GA 3FZDA 4B74A 3NWUA 1GMCF 1N6XA 3OTPA 4FUHA 3ZVBA 3W1EA 2A32A 4I33A 2H2ZA 1D6WA 4X2XA 4XBBA 4ZXYH 2FEQH 1TABE 1G9IE 1YPEH 3PO1B 3SU2A 5I46H 1DY9A 1TALA 2ZFSA 2YMSD 3UR6A 1O3GA 1FN6A 3VB6A 1RTLA 3OSYA 1NFUA 3C27B 1SGPE 2I6QA 1GI9B 1YPKH 1ELBA 1DITH 1TWXB 4CRCA 3LJJA 1AE8H 3SJ9A 4MQAA 1NRQH 1HCGA 3MYWA 3Q00A 2ZGXH 2BDBA 4OS1A 2OD3B 1C2HA 4WWYA 2ZGJA 1WUNH 1XKAC 2OLGA 3NXPA 1FY5A 2A31A 2Z94A 1THRH 2EC9H 3E90B 4HZHA 2OBOA 1ZPZA 1LHEH 2FOMB 1ZTKA 2BVRH 2QXJA 3SNAA 4AG1A 1E35B 5EGMA 1K1MA 1P2JA
chains in the Genus database with same CATH topology
3L3TA 1T8LA 1T4VH 1AIXH 1A61H 1C5YB 1D4PB 1O3BA 2NU2E 2VVUA 4TWYA 4JZ1A 2FOBA 2A45B 1ZHPA 1GBAA 3SOSA 3SV7A 2Z7FE 4OGXA 1EQ9A 5E8EH 1ESBA 1DSUA 1GDNA 1P2OA 2A7CA 3RXTA 1SGYE 5EODA 1C9TA 1SC8U 1O5GH 1IHSH 1QL8A 2R2MB 3ODDA 2QF0A 1O3KA 2ZQ1A 1BRCE 1GGDB 4A1XA 1S85A 2W7SA 1ANDA 3SNCA 1SSXA 2UWLA 2HGTH 7KMEH 2Q6FA 4HGCA 1Y3WA 4TY7A 1OWKA 4K69A 2Z9GA 1ETRH 1PPGE 4UD9H 1S6FA 1OWHA 1PQ5A 1S83A 1F0RA 4OGYA 4UFEH 3TPIZ 1LQDB 1SLXB 3WY8A 1BTHH 3Q3KA 1ANCA 4THNH 1IQMA 1EAWA 4DW2U 2P3TB 1J15A 1SR5C 1NU9A 2JH5D 1AVWA 3TLOA 3GY7A 2W26A 3RXUA 9LPRA 3QO6A 2Z3CA 1JWTA 3SU6A 4AG2A 2HNTE 3M7QA 1EZQA 1C1PA 3EA7A 5CE1A 4F49A 5ESTE 1E36B 3I77A 4OS4A 1GJ6A 1G37A 2GZ8A 3P70B 1SGTA 4AZ2B 3RXKA 4FUFA 2ANYA 1VITH 1FDPA 3IG6B 4Y8XA 5HGGA 2B9LA 2D26C 3T2NA 3M5LA 2QGRA 3D62A 1THSH 2ZDVH 5LGOA 1HNEE 3MU5A 2HLCA 5DG6A 1MD7A 4TPIZ 3KHVA 4KTSA 1LCYA 2WPHS 1UTKA 4X1PU 1K2I1 1K1JA 4QT8C 2QXIA 1SMFE 1C5WB 2F9PA 2XXLA 2ZGHA 1GI2A 3LKWA 2A2QH 1E34B 3E16B 1W8BH 3GY3A 4NIXA 2BDYA 1M9UA 1DANH 1P3CA 4A1TA 2ZZUH 2GTBA 1O3PB 4IN1A 1OP0A 1A3EH 1SLUB 1TA2A 4ABIA 3GYLB 4RKJB 3B23B 4AFZA 2SFAA 3DA9B 2UUJB 5JB9S 5EW1H 1PFXC 3U8TH 1TOCB 1GBTA 1GDQA 2ZU4A 2TIOA 4ZMAH 2B5TB 1QJ7B 4MNWA 2BQWB 1XUHA 1FIWA 1GVZA 1OKXA 1NN6A 2BY5X 1CT4E 1GJCB 1ZTJA 4ZXXH 5CMXH 5GXPA 1FPHH 1TRMA 1YPJH 2YOLA 2ILNA 3LGTA 1W12U 1MTUA 1UTNA 1CA0C 1RIWB 3ZZ9A 1AB9B 1TX6A 1SL3A 1GMCG 3LC3A 1WU1A 3RMLH 1UHBB 4WH8A 3VXFH 5ABWA 4AFUA 3PMAB 1INCA 2PSYA 3A83A 1GHYH 1YGCH 3H7OA 3LJOA 1V2LT 4GVUA 3ZZ7A 1CGHA 3ZVDA 3BTGE 1NY22 2BD5A 2QY0B 1TQ7B 4CH8B 5DP3A 1EPTC 1EZSC 2J92A 1A0JA 2QAAA 4NGAH 3O8BA 2XNIA 4MDSA 1CBWC 3LU9B 1QBNA 3Q76A 4Q80A 2WPKS 4IMZA 1C5ZB 2FYQA 2OQ5A 2BDAA 3SGAE 3BG4B 3A7VA 1O2WA 2JKHA 2F9VA 3LGUA 4B71A 2QV1A 2R3YA 3SV2H 1PPCE 2VWMA 2BDHA 1TNKA 1HAVB 1CHOF 1LQEA 4YLQH 1ABJH 1NROH 3BEUA 4D9RA 3H7TA 1LVMA 9ESTA 1Y5AT 4I8KA 3PMBB 1QGFA 1QY6A 3GCOA 4WXIA 3V13A 1C5VA 1FY8E 5JPMH 1DWEH 1P02A 1ZTLA 1XXFA 1EXFA 3L6PA 3GCNA 4CRAA 3SJOA 1ZSLA 3RMOH 5DP4A 3ZZCA 3GICB 2Z9JA 3DT0H 3TJUA 3M3VA 3KF2A 1H1BA 2BOKA 1C5UA 3HPTB 4NIWA 3VGCB 1ZHMA 2PHBA 3QTVH 2BLOA 4HTCH 1O39A 4K2YA 3UWIA 1Y59T 3D23A 2RG3A 2QN5T 1YP9A 3RMMH 1GI4A 2WPLS 1KLTA 1BBRE 1ZJDA 1MKWK 3KNXA 3SU5A 4PROA 1O2JA 1KLIH 2ZQ2A 3M61U 2P3UB 3FAOA 2XBXA 1JOUB 4ZROA 3R3GB 2SNWA 3SN8A 5T3HA 4GSOA 5GIBA 4CBOA 3PYHA 1YCPM 2AIPA 1X7AC 4GAWA 2BD2A 4K5ZA 4B76A 1D3PB 4ZKRU 3V0XA 1FAKH 3UWJH 1O2HA 1YPMH 1QIXB 4Y7AA 1QJ1B 2A5IA 4AFQA 4B2AA 5HM2A 2AGGX 3UFAA 1UMAH 4H6SB 2HNTF 2GGVB 1OWEA 1MU8B 1P09A 2F83A 5GDSH 5GWZA 3RMNH 1XUGA 3CP7A 1GDUA 1XUJA 2H9HA 3RXAA 1DS2E 4JYUH 1ELGA 1EAUA 4ABEA 5IDKA 1HUTH 1CO7E 4GHQA 1GI5A 4ISLA 4CRFA 1DPOA 3HK6B 1OP8A 1KIGH 1IHTH 1N6YA 1ZSKA 4B1TA 1C1RA 2VGCC 3NK8A 4HI3A 1P9UA 1F7ZA 4YOJA 3SO3A 2H5DA 2ZF0H 1AY6H 2P59A 3MNBA 1XUIA 3M36A 2BTCE 3FP8E 1A5HA 2BX3A 2XBYA 1ZGVA 3AW0A 3MH4A 5T6FA 4ISIH 2F3CE 4ABDA 3ODFA 1G3DA 2BD3A 2P8OB 2VIPA 4WJG2 1UTLM 3A89A 1O2VA 2ZIQH 3LT3A 2CV3A 2ZDKA 3BTQE 3NPSA 1BUIA 1LHFH 2FOEA 1FNIA 1DVAH 1O35A 2NU1E 1P11E 1TQ0B 1OWIA 4DIIH 1J14A 2P93A 4FU8A 2FIRH 1OYQA 1O30A 2SGEE 3P17H 1Y3XA 1BJVA 3GY8A 1N1LA 1V2MT 5SGAE 2Q1JA 2O8UA 4NZQA 1C2IA 3A81A 5CHAC 2QC2A 4JK5A 4X1QU 1PQ7A 1G36A 1S84A 2IJOB 4X8UH 3V3MA 1AQ7A 1GL0E 4JMYA 1MBQA 1QB1A 1P8VC 1PQAA 1IAUA 3IWMA 1UJ1A 1AUTC 3TNSA 4AB9A 4MNYA 1MAYA 1E38B 4A6LA 3BF6H 4YTAA 3SU0A 3F6UH 4CRBA 2EI7A 1W7XH 3M5NA 4Y6DA 5EPNA 4I8JA 1CSOE 1SOTA 3ZYEA 5F8ZA 2TPIZ 1QFKH 1GJDB 1SQAA 2THFB 1IQFA 2OUAA 2EI6A 3DFLA 5DP8A 3TJOA 2W5EA 1C5QA 1A5IA 2A4RA 2JH0D 3SV9A 3JZ2B 4I7YH 4MLFB 1Z6EA 1AGJA 1RTKA 1EKBB 5A8YA 4CRDA 2VNTA 1C2EA 3RXGA 1V2JT 1C5RA 2AGIX 1PYTD 1IQLA 1BB0B 2PUQH 4UONA 2BD4A 3NKKA 1FMGA 1LKBA 1KXAA 2AYWA 4I8GA 1TPSA 4K1EA 3SORA 2ZU5A 4B2CA 1UVOA 3E3TA 4X1RU 2XWBI 2FXRA 1MTNB 4WVPE 2QA9E 1UCYH 3QUMP 1XVMA 1HAIH 2AH4X 4Q2KA 5FHTA 4DY7B 3ATKA 1G3EA 3MH5A 4ZAEA 3QTOH 4GHTA 1FI8A 2R0KA 3E6PH 1V2KT 1IQEA 1P04A 3MO9A 1PPHE 1V2OT 1TPAE 2AFQB 3ZZBA 2IOTA 1KTTB 2UUYA 2G55A 1C1TA 2C8WB 3SUEA 1WQSA 4FUGA 1NS3A 4AYYB 3RDZA 2GP9B 3KN2A 1KXCA 1GHZA 2Y7XA 2Z6BD 1CVWH 2CF9H 1V2WT 2H5CA 4WF8A 3UNQA 2FODA 3RXFA 2G5NA 1L1GA 2GT7A 4AGJA 1O5BB 8LPRA 3PROA 4Y76A 1HJ9A 2V3HH 1F2SE 3RP2A 4IGDA 4TWWA 1HJ8A 3M3TA 1FY4A 5HM9A 1QTFA 1C1OA 2BDCA 3O8RA 2BVXH 4BTTB 3RU4E 3S9AA 2A7HA 1HAOH 1E37B 2ZTYA 4VGCC 4ISNA 4BOHA 1TA6A 2ANKH 3T5FH 3QZQA 1TFXA 1ELFA 1ETSH 1V2TT 1C5OH 6CHAC 1C5LH 1YPGH 2GKVE 5GJ4B 3SBKA 3AW1A 2JH6D 2OXSA 2CMYA 3BTFE 2J2UA 1BRUP 1G3BA 4ISHH 2XWAA 1GJAB 5F8TA 3BEFB 2GCTB 4A5TS 3STJA 2FDAA 3AVZA 1P2MA 3PWCA 5T6DA 4NFEA 1TB6H 2QYIA 1PPZA 2SGDE 4Y11E 2Z9IA 2D1JA 2GMTC 1KDQB 1GBJA 1K1LA 4X1SU 1TOMH 1N8OC 3EQ0H 3M7TA 4WMFA 1DXWA 1TX7A 5DPAA 3GY6A 2STAE 3QLPH 4OS6A 3P8OA 3RXOA 1C2LA 1Q2WA 1UK3A 2BMGB 2P16A 4Y7BA 1P01A 3A8CA 3TU7H 3SGQE 1SLWB 3A87A 3DFJA 1IQJA 1UTMA 2ZDAH 2G52A 4J1YA 1HJAB 1YLCA 1ZSJA 3A82A 1GJ8B 1ID5H 2ZFQH 3MNCA 1NFWA 2FS9A 2ZDMA 1B5GH 1SGNE 1TLDA 2WUCA 5DJ7A 3SV6A 1A0LA 2SNVA 4K3JA 1WBGB 3Q77A 2QIQA 1GG6B 1D3DB 2ZO3H 4ABJA 3F9EA 2GD4B 1Y5UT 1QJ6B 1FZZA 1O2ZA 3E0PB 3LONA 2C8ZB 3D49H 1A4WH 1MZDA 4O97A 4Q7XA 5FCRA 4KP0A 3T28A 5FX6A 2AS9A 1DICA 3M5MA 3MO3A 1O3EA 1MCVA 1MTVA 2BM2A 1ZGIA 4YT6H 2BYAX 3PWBA 3RXMA 5L6NH 2OBQA 3PMHB 1P2NA 1BTZA 2R9PA 4NA8A 3T27A 4LXBH 3EAJA 1MTSA 1TGCA 4IC6A 2PTCE 4AOQA 2XCNA 2ODPA 2ZPQA 3O8CA 3TK5A 1EAXA 5FBIA 3HATH 5DP5A 4ZKNU 4ZH8A 1QR3E 1ZR0A 2ALVA 2PKSB 1Q3XA 4X2WA 2LPRA 3SGBE 2VIQA 5L2ZH 3ZV8A 1DSTA 3U98H 1V2NT 3Q3YA 2CHAC 2ZU2A 3A80A 1G32B 3GDSA 4D8NA 4U2WA 1L2EA 1C2KA 1ELTA 2BXUH 3EGKH 4UFDH 1TRYA 1UK2A 1HAHH 2ZNKH 1O2PA 2FO9A 2ZFRH 3AASA 2ODQA 4B73A 3BTDE 2ZCKP 1VJ9U 1FONA 1YCPK 4FU7A 5G4BA 1TBQH 1C5TA 2G81E 4ISOA 2ANWA 1UTQA 1GBLA 4YLUA 1F0TA 3U1IB 1UTPA 3VXEH 2ZP0H 3ZZAA 1HAXB 3LGWA 2BVSH 1ZMJA 1MKXK 3BN9A 3RXQA 1FPCH 4LK4A 1ESTA 1G2MA 1W2KH 2QXHA 4FU9A 1EP6A 1AU8A 3QN7A 1VZQH 3SU3A 3GY5A 2O8LA 4BAKB 2IPHA 5JYIA 1P9SA 2BB4A 3RLYH 2ZA5A 1E0FD 1GHXH 2ALPA 1W11U 1SQOA 3B9FH 2J38A 1LTOA 3TNTA 3P8NA 1TPOA 1DDJA 1XXDA 1AFEH 1Y5BT 1Z6JH 3P6ZB 4ZKOU 1GBCA 3UOPA 3RXJA 5C67A 3BTKE 3TK9A 3BIUH 5C1UA 2V3OH 2GX4A 2ZHEH 3SJKA 3M35A 1MTWA 1A1RA 1LVBA 1BDAA 4ZUHA 1KYNA 2FOFA 2WYJA 2VWLA 4Q7YA 4YO9A 1QQ4A 1ZZZA 2BD9A 1O5CB 5EXLA 2OC1A 4NFFA 3OTJE 3GISB 4WY3A 1CQQA 5E2OA 1NU7B 2BZAA 3QGNB 1LHDH 2OINA 2ZFTA 1TNGA 4ABHA 1T32A 2VINA 4H42U 4UEHH 2CJIA 2J34A 2FMJA 1TGTA 3SZNA 1GJ4H 1OYTH 4ASHA 2K1QA 4KTUA 4Z0KA 1TPPA 2PKAB 4JK6A 2BOHB 5EXNA 2F9NA 5TJXA 1W3CA 5DK1A 1EX3A 2ZHQH 3RXSA 1VCWA 4UDWH 3MO6A 1TNHA 4KTCA 2FOAA 1VCPA 2NU3E 4MPVA 1U6QA 2P95A 3ZVGA 1G30B 1BTPA 3LGVA 4TY6A 3EYDA 1GMDF 5EQRA 2BY7X 2ZTZA 1GJ9B 3U9AH 2O9QA 2GV7A 4JZIA 1C5NH 8ESTE 1YPHC 3E0NB 1AO5A 1AMHA 1V2RT 5K7RA 3E91A 2C3SA 2TBSA 1GWAA 1MD8A 4I8LA 3GDVA 2A7JA 3G01A 1AVGH 3SJIA 1DM4B 5F03A 1GI6A 4O3UA 2FTMA 4I32A 2J4IA 3KQEA 1P57B 2XCFA 2VVCA 1BCUH 3KQCA 3SHCH 3UOUA 2KAIB 4CR9A 2YNBA 5A0AE 4DJZB 3RM0H 1MAXA 5AFZH 1ETTH 1JIMA 2Y80A 4JCNA 1OPHB 1ZYOA 1O3CA 1MQ6A 2ZCHP 4A7IB 4ABFA 3KCGH 5FAHA 1UHBA 3B8JA 4ESTE 1GHAF 3RXBA 1D3QB 1AFQC 5FPTA 4K1TA 2G4UA 1AWFH 3K6ZA 1S0RA 2VH6A 4MNVA 1GBIA 1O3AA 1K1PA 3FP6E 1GCTC 1FAXA 2F9UA 2WPMS 1TE0A 3A8BA 1OS8A 2G4TA 3BV9B 3ZZ8A 1LHCH 2C4FH 1O5EH 1DLKB 1WQVH 1O32A 5C1YA 4LOYH 4A92A 2FX6A 2WV5A 1UVTH 3M7UA 4K8YA 2OQUA 4NG9H 4X8TH 2B7DH 1O33A 4IBLH 2ZC9H 1KSNA 5EQSA 1FUJA 1GI3A 3UY9A 2FLBH 1SI5H 2OC0A 2PTNA 1W13U 2VWNA 5HXFA 2AEIH 2D2DA 1HAVA 1QL9A 2F9BH 3I78A 1NRSH 1CA0B 2XBWA 3DUXH 3A7WA 1JRTA 4K1SA 3RUOA 1ZLRA 1IQGA 2F9OA 3ZZ6A 3PTNA 1GI0A 1P3EA 2EA3A 1C1VH 1FV9A 1LO6A 3MOCA 2WUBA 3ZZ5A 1QRXA 3QGJA 3EE0B 1TBRH 1S5SA 1C5SA 4MPUA 1V2QT 3MU1A 1GBFA 1EPTB 2BHGA 3ZZDA 1O3NA 3ZVAA 1CT0E 2A4QA 4KELA 4BTUB 2HWLB 3MH6A 3UR9A 1CBWB 1BJUA 2FOHA 1O2RA 1J9CH 4CBNA 1W0YH 1IQKA 1O3FA 3NCLA 3A85A 1D6RA 1NC6A 2HNTC 4OS5A 3TJVA 4E05H 4Z6AH 1DT2A 2BY6X 1G2LA 3K6YA 1SG8B 4ABBA 2ZGBH 1TMBH 3BEIB 3OX7U 1SGIB 2C8YB 1EP5A 1EUFA 2A1DB 3P8FA 1LPKB 1TGNA 2VIOA 4ABGA 3L33A 1W0ZU 2PV9B