1RJXB

Human plasminogen catalytic domain, k698m mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
247
structure length
243
Chain Sequence
b'SFDCGKPQVEPKKCPGAVVGGCVAYPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGEFGAGLLMEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plasminogen
publication title Characterization of Lys-698 to met substitution in human plasminogen catalytic domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 243
sequence length 247
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rjxB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rjxB01
3UOPA 1SFQB 2BHGA 2J94A 3NKKA 2VIWA 1DXWA 2QN5T 3LPRA 1Y59T 2BDAA 1IQHA 1EB2A 3GDVA 1WTGH 2VIDA 1ZOMA 2RCEA 2WV4A 1AY6H 1BTHH 2STBE 3RXOA 2PUQH 1SGEE 1K1MA 4TWYA 1MQ5A 3SW2B 1MD7A 1QY6A 1VCWA 2HNTE 3LU9B 1LVYA 1GMHG 1V2KT 3VFEA 4X6OA 1C1TA 2A5AA 1MZDA 2J4IA 2WPMS 1LHDH 2FOHA 1AQ7A 4GAWA 3D49H 4ZXXH 1C5OH 2A4GA 1MU6B 4MQAA 1A61H 2ZDAH 5JB8S 4Y6DA 2SNWA 4BXWA 1YYY1 4A5TS 4H4FA 3AVZA 2SGDE 3H7OA 1K21H 2A2XH 1PPFE 1O3PB 3UNQA 5FPSA 1QJ1B 1P11E 1C5NH 1HYLA 2ZEBA 3UR9A 1YKTA 3RXJA 1EUFA 1P2IA 4NIVA 1OWJA 2A7HA 1NU9A 2BX3A 2R3YA 2ZCKP 4X6NA 2XWAA 3KL6A 1WYKA 1H8DH 3CS0A 1JRTA 3ZVBA 5BPEA 1N6YA 3ZYEA 1SOZA 1WQVH 1BMLA 3GY8A 1KDQA 2VINA 1PQ8A 2FI3E 3B9FH 3IG6B 1BBRK 4OS6A 5AF9H 2YOLA 1MZAA 2G51A 2OD3B 1WSSH 4UFDH 1B5GH 3PMHB 3MNCA 1UCYK 2QY0B 2VVCA 4DVAU 1MKXK 1Y3VA 1GJAB 3BG4B 3QZQA 4Q7YA 2FTLE 1RS0A 4U30A 3TJNA 2AFQB 3LGIA 4I8GA 3RUOA 1AWHB 3P8GA 1NO9H 2H5CA 3ZZAA 1ZGIA 2PSXA 3BSQA 3QN7A 4GSOA 1BJUA 5DG6A 2YNBA 1OWIA 5FX6A 1O3JA 1ZMLA 3RLYH 1FONA 2VIPA 3LC5A 3LGTA 1DUAA 1LCYA 4KELA 2TBSA 1GI7B 2ALVA 1Q2WA 1UHBA 4ZMAH 1P9UA 4CRGA 2FEQH 1UHBB 1LVOA 1ETSH 1Z1IA 2DUCA 1S0QA 1D6RA 1YPKH 2WPIS 2F9BH 3A7XA 1NU7B 2OUAA 3MO9A 1ANBA 2UUKB 3VB5A 1GJ7B 1GJBB 1F5RA 8GCHF 3RM0H 1UO6A 1C1UH 3GY7A 1TNLA 2Y5GA 4FUCA 1P3CA 4DW2U 5LPEA 2ZU4A 1ZGVA 1GJDB 4HGCA 2Z9JA 1HLTH 3ZZCA 3UWJH 1P9SA 1A0LA 2GDDA 5LPFA 2AERH 2CMYA 1SOTA 2NWNA 3UWIA 1P03A 3PROA 3UIRA 4Q2KA 2P95A 2V0BA 1BTWA 3L33A 4K1TA 2ZP0H 1OWHA 3PMJA 1DPOA 1C4Y2 4KTUA 2WINI 3TPIZ 1P2NA 3M5LA 1DWCH 4NA7A 3CS7A 1FY8E 1O39A 1AE5A 3Q3YA 3RXPA 1PPCE 2ZPSA 3F68H 1J16A 3W95A 1MCVA 4CREA 1O2QA 5DO4H 2GMTB 4OGYA 4A7IB 5JB9S 3SQEE 1P2OA 3VXEH 2ZKSA 4DIHH 3SNAA 4DT7B 1QBNA 2TGPZ 2F9NA 2P93A 3EA9A 4FVDA 1C2KA 3AAVA 3PLKA 2BM2A 4CRDA 1TRNA 4AG2A 3PO1B 1QR3E 2A31A 1K1IA 1CHGA 1P06A 1HUTH 1FIZA 3S9BA 1O2NA 1EXFA 1SI5H 2GMTC 3FFGA 1TONA 3O8CA 1LHEH 1NFWA 3TNSA 1M9UA 1DICA 1C5QA 3UQVA 1A4WH 1C1QA 1ARBA 1BT7A 2A32A 1XUKA 3SJOA 3SJKA 1DITH 4JZFH 2RA0A 4LK4A 3MH6A 1UTPA 2BZAA 1O5CB 1SGFG 2ZPRA 1ORFA 4K2YA 1RD3B 3KHVA 4E06H 5EW1H 1OKXA 1SQAA 2TRMA 2BLWA 4O9VA 1GI1A 3U9AH 2ZTZA 4BXSA 3NK8A 1DLEA 1FXYA 1C1VH 1Q3XA 4XE4A 1QNJA 1XUJA 1XXFA 1K1OA 3TK9A 3ESTA 3NWUA 3TITA 3SI4H 1HCGA 4I33A 2WYGA 4I8LA 1BITA 1T8OA 5HXFA 3BEIB 1Y8TA 3A84A 1KXEA 3MTYA 4AX9H 3HATH 5H4IB 2ZU2A 4YESB 5EXNA 2HGTH 1QGFA 4R0IA 1BQYA 3MH5A 1C5RA 3ZZBA 1C5PA 3RXQA 1IQLA 2BD2A 3ATKA 2XCFA 1CO7E 5E8EH 1DVAH 3Q3KA 3ZV8A 4XBCA 3LT3A 2C8WB 1O2GH 3QTVH 1QL7A 1GHAG 4BAKB 5C1UA 3AW0A 4LZ1H 2H9TH 4FUJA 1NZQH 2BLVA 4ABJA 3S0NA 1WU1A 2ZFTA 2B7DH 2W5EA 5EU8A 2VWOA 4TPYA 1EATA 4NA9H 2VWLA 1G3DA 1O2TA 3AAUA 1W13U 1KXDA 4UONA 1CE5A 1EPTA 2ZGXH 3AASA 4FUEA 1GHVH 3SV9A 1EPTB 1C2EA 1GBCA 1FJSA 4X1SU 3M3TA 1NFXA 1RIWB 3VPKA 1FPCH 2Z9IA 2VIOA 4GHQA 4Y79A 1P2KA 2FESH 2R0KA 3K6YA 1G2LA 2OBQA 3FZZA 3MI4A 1SGTA 3GICB 1UTOA 3DT0H 3T29A 4DCDA 1T7CA 6GCHG 1O3OA 1W14U 5FPYA 2Z9KA 1IQGA 4JYTA 1EX3A 2A7JA 3MO3A 4FU7A 4K5ZA 3F9HA 2AIPA 1HGTH 4THNH 4TY7A 5ETXA 3GCHC 1C9TA 3OTJE 1AMHA 4IGDA 1C1NA 1NC6A 1KLJH 2BTCE 4XOJA 2R2WU 2BD8A 1UMAH 3MU5A 3UREA 3SGBE 4WXIA 2QCYA 1D4PB 1FN6A 2FLRH 3VB6A 4NCYA 1NFUA 1TOCB 4WMEA 2WUBA 3ZZ4A 1MCTA 4ABDA 4H42U 1VZQH 3M37A 1YLCA 2GCTC 1J15A 2CF8H 4DURA 1JXPA 5T6GA 5C1YA 1LHGH 3SOSA 3UNSA 1W12U 1IHTH 2SFAA 4CR9A 1Z7KA 2SGQE 1BA8B 2HVXA 2I6QA 1O5FH 4RKOB 1C5ZB 3ZVEA 1O2SA 1UTQA 3RXEA 3ZZ5A 1S84A 1FY1A 2FX4A 1TPSA 2OP9A 4WMFA 1GGDC 1SQTA 4CBOA 2AGIX 1HAHH 1WBGB 5FBIA 1ELVA 3QLPH 3OSYA 5AFZH 4PROA 1V2QT 3A8CA 1MU8B 1LHCH 3KQDA 2NU1E 1SLVB 2HNTC 1TX8A 2Z9GA 4HFPB 3RC5A 4CHAB 1AVGH 4XSKU 1QA7A 1BRAA 5AFYH 2AYWA 5EXMA 1QURH 4JK6A 2Z7FE 2BX4A 1TX6A 3U8RH 1CT0E 1SG8B 1OX1A 2VGCC 5E0HA 4X2WA 2PHBA 1SFIA 4Y8XA 1HXFH 4OS7A 4IW4E 2V3OH 5DP7A 5L6NH 4Z0KA 2Y82A 4JMYA 1E35B 1IQIA 1C5LH 1QQ4A 1F0TA 2A0QB 1GHXH 2A7CA 1DDJA 2IN2A 5DP6A 4ZXYH 4UFFH 3RXRA 1LDTT 4MDSA 4DGJA 3SNCA 4ABEA 1ZTKA 1Z6EA 1F0UA 2ANKH 1ELAA 2PGBB 3MU1A 1V2PT 3ZZDA 2A45B 3A83A 1CA0B 1UK2A 2JH6D 3A8BA 1YPLH 2D8WA 4ABAA 4ZKSU 1QB9A 2BDGA 1O35A 2RA3A 3MWIU 3GCTF 1SQOA 2P59A 3R0FA 2RG3A 4H6TA 1A1RA 4X8TH 1O3KA 4D7FA 4A6LA 1S85A 1AB9B 2FX6A 1XM1A 1QB1A 1GMDG 1QRZA 1D9IA 5DPAA 5HGGA 8KME2 1BHXF 3KQEA 2JETB 1MQ6A 2GZ7A 4IC6A 3DFLA 3T28A 1HBTH 1GVLA 1SGPE 2BMGB 4GCHG 1VJ9U 4Y0ZE 5T6DA 1HIAA 1OS8A 3ZVGA 3MU8A 4Q7XA 1SGIB 3KGPA 1TGTA 3ATWA 4KKDA 1AU8A 4D76A 2XNIA 1W7GH 1AUJA 1ELEE 1RTKA 2ZFSA 3E6PH 1AFQB 2JETC 1SHHB 2BLQA 4F4OC 1FI8A 1DFPA 3KNXA 3TJOA 1E34B 1C4V2 1SC8U 1OOKB 3U98H 5E0GA 2F9VA 1HAVB 3P95A 3AW1A 3GY3A 3LIWA 4CRCA 1T8LA 2VH0A 2XYAA 1C5MD 3FP8E 1FY4A 3PMAB 1O2XA 1BRBE 1YPEH 2V35A 1P12E 2UUFB 2G4UA 4XDEA 4DJZB 4K8BA 1GI2A 2ZWLH 2BD5A 3QZRA 1EASA 5GWZA 3KEEA 1AWFH 2C90B 2OLGA 4AB8A 5ABWA 1TMTH 2ZGJA 4UE7H 1DWDH 7KMEH 3STJA 1LQDB 4J1YA 3SORA 2PFEA 1RTFB 3NPSA 1AKSA 2FTMA 5A0AE 1WOFA 3HK3B 2DE9A 1OP8A 1SGDE 2B8OH 4AOQA 1PQ5A 2SGPE 3QUMP 3OYPA 5F6MA 3RDZA 3SV8A 1SGQE 2RDLA 1O34A 3A7ZA 1DWEH 2FS9A 1QTFA 4YT7H 4NSYA 4AG1A 2FOCA 2FI4E 1ETRH 5HM9A 1HAGE 2KAIB 2D1JA 3RMLH 1VJAU 4O3TA 2FOBA 1LVMA 1A5IA 3SN8A 4Y8YA 3M61U 4DG4A 3D65E 1YPHC 5TCCA 5SGAE 5L2YH 1UTLM 1ZMNA 3BV9B 1U6QA 2ZQ2A 2CV3A 5EG4A 2Z9LA 4BAQB 1TNGA 1S81A 1P05A 2BD4A 1BCUH 4RSPA 4ASHA 4JYVH 1EZUC 1GVKB 1ZZZA 1J14A 4NIWA 3QGJA 2IJOB 1G3BA 1MH0A 1NRRH 2P16A 2Y5HA 2V3HH 2Z3EA 3GY4A 4Q7ZA 3FP6E 3M5MA 5C3NA 4Y10E 2PKAB 3GY6A 1BTUA 4JCNA 1HNEE 2WPLS 1BTPA 2SGAA 1AZ8A 5JBTA 1HB0B 3P8OA 1SL3A 2Y6TA 1TPAE 1Z8GA 4TPIZ 1Z6JH 3HGNA 4K1EA 1T31A 2D26C 1GCTC 1C2JA 5C5NA 2GGVB 2BQ7B 1D3TB 3UR6A 1WV7H 1TX7A 1GDQA 2GVFA 3S9AA 1ANEA 1GCDA 1EOLA 3T5FH 1C5VA 3A80A 1Y3WA 1DOJA 2O8TA 3MH4A 3UTUH 1FIWA 2SNVA 2OCVB 5CE1A 2FIRH 4BOHA 2I6SA 1CT2E 1Y3YA 3SU2A 2J9NA 1BTXA 5GCHF 3SU1A 1E36B 4CH8B 1HJAC 1S6HA 3GY5A 1OWDA 1GHBF 3LGYA 4O3UA 4WH8A 3TK6A 1YC0A 3URCA 1O3BA 1HAPH 5K7RA 3BEFB 1KXAA 1XKAC 3RXGA 2OBOA 3PB1E 3K2UA 1MAYA 1C1OA 3RU4T 2A4RA 5IYTA 4ABIA 2ZO3H 1HXEH 3K9XB 2TIOA 2BVXH 1FAKH 3I29A 2P3UB 3SJ8A 2UUJB 1PPBH 1PQAA 1DANH 2NU4E 2O8MA 1MTSA 3PYHA 5GXPA 1A7SA 3M36A 2B0FA 4WY3A 2ZGCA 5FCKA 1F92A 1PQ7A 2AMPA 3U69H 2ZHQH 4AFUA 3UY9A 4YLQH 4A1XA 5F8ZA 2UUYA 1GMCF 5LGOA 3BTQE 1SHYA 2VNTA 1P01A 2GKVE 1K22H 2ANMH 1EQ9A 1MD8A 2PR3A 1SPJA 4UFEH 1BMAA 2ULLA 5I46H 4ABFA 4QT8C 1NN6A 4X8UH 4B74A 2BQWB 2OXSA 4GPGA 2ZNKH 5J4QA 5GPIB 1ZPZA 4JZIA 3TH2H 1JOUB 1UVPA 2WPKS 1PJPA 2PSYA 3M7QA 1GI9B 1L1NA 1O2LA 2A1DB 1QB6A 1PPGE 2GCHF 2W26A 5FHTA 1T4UH 2O8WA 1FAXA 1PPEE 1V2LT 1AN1E 1TNKA 4U01A 1C9PA 1KIGH 1D6WA 3LKWA 3URDA 4IS5A 1O30A 4DY7B 1KXCA 4Y0YE 1V2MT 2W3IA 3ODDA 1F5LA 4ZKNU 1EAWA 3SGAE 2A4QA 4RKJB 3BTFE 2GP9B 3RXBA 1VGCC 1CHOF 3E91A 1Y5UT 2UWLA 3RXHA 3SUFA 4SGBE 1ZPCA 4AYVB 7LPRA 4UEHH 5DGJA 3E1XB 1ZPBA 1SR5C 3KF2A 1Z8IB 3PM3A 1YPHE 1O3NA 1UJ1A 1MBQA 5C5OA 5LH8A 1HJ8A 2ASUB 4K60A 3SI3H 3RM2H 2BOHB 1BRUP 1EP5A 1KXFA 1GL0E 1UK4A 1W2KH 4ISIH 1CGIE 1JIMA 2O8UA 2ZFPH 3ZVFA 1HFDA 3M3SA 1GBEA 4TWWA 1O32A 1AD8H 3I78A 1BRCE 3GISB 1LVBA 4CR5A 1RXPA 4GVUA 2XBYA 3V0XA 1VCPA 1E38B 5J4SA 2HPPH 3F1SB 4UD9H 2EI6A 1C5SA 4A1VA 2Q6DA 1NPMA 2ZHWH 2SGEE 3ATMA 2ZDVH 3QGNB 3GDUA 2ZC9H 3L3TA 1BDAA 1PYTC 1T32A 1H1BA 3TJVA 5L2ZH 3TK5A 2H5DA 4I8JA 4ZHAA 4KP0A 1C5WB 1P09A 1TGCA 3SO3A 6LPRA 4K8YA 1XXDA 4XBBA 2VB0A 4AFZA 4MG3A 5DJ7A 3UQOA 1C1SA 4A1TA 3RMOH 2FOFA 4CRBA 1JWTA 3VB7A 5DP3A 1Z1JA 3RC4A 3F9GA 1F0SA 2BY9X 4JYUH 3RC6A 3P8FA 3EA8A 1XX9A 4Y7BA 1HDTH 1MTUA 3TIUA 3P6ZB 2AS9A 1N6XA 4B75A 3PWCA 1JRSA 1QJ7B 1NROH 1LPGB 4WF8A 2ZZUH 5CHAB 3PTNA 5A0BA 1GBBA 1CBWC 1CT4E 1QQUA 1QBOA 3MNXA 2A2QH 5PTPA 3RXKA 2QYIA 3V7TA 2ZGBH 1GJ4H 2FOEA 3LGVA 1SGNE 3V12A 7ESTE 2G4TA 4B2BA 3GCOA 1C2DA 3E0PB 5CHAC 4K69A 4Q80A 1EAIA 3U1JB 1OYTH 2WUCA 1Z8RA 3RXMA 1QRWA 3PLPA 2BDBA 1GG6B 4FVBA 2Y81A 3GYMA 2F91A 1WUNH 3GOVB 1SGYE 1TBZH 3D62A 2ALPA 1SGRE 2G5NA 4FU9A 2CJIA 2Y5FA 3R3GB 4FUBA 4U32A 4ZHMU 4AN7A 2OC7A 5GIBA 3A85A 4I32A 1L0ZA 5E0JA 1VITH 2ZFQH 4AFQA 1GG6C 3A7WA 1H9IE 2A5KA 2PLXA 1MKWH 2AGEX 4B73A 2Y80A 3RXAA 3PTBA 4LZ4B 1CU1A 1BTYA 3BTKE 3GCHB 5JDUB 3T26A 3ATIA 3UNRA 2BY8X 1G2MA 1K1PA 3BEUA 4FUDA 1EJNA 1G37A 7GCHF 5K0HA 1LMWB 3DD2H 2BY6X 2G5VA 2FZZA 1THPB 1SGCA 2ZCLP 1TOMH 5B6OA 2BDCA 1JMOH 2ANWA 2VVVA 4O97A 3L6PA 1D3QB 1VCQA 1C4U2 5AHGH 2TGDA 1AFEH 1L1GA 5DKMA 4IMQA 4D9QA 1GI4A 1MTNC 4YOJA 3PMBB 2GCTB 1TIOA 2C8YB 4JZ1A 1TA6A 1GMHF 2DE8A 2B9LA 1O36A 1W0YH 3VB3A 2P3FH 3RXCA 3NUMA 5A8ZA 1FQ3A 2ZI2H 4U2WA 2FODA 2BXUH 1DS2E 3FVFB 3T27A 1TGSZ 2BDYA 1OXGA 1ZR0A 1GGDB 1CQQA 2VWMA 3D23A 2XC5A 1UVUH 2H1UA 1QIXB 8GCHG 2EEKA 2GT8A 2PW8H 2F3CE 1ZSJA 2SGFE 4X8SH 4YOIA 5BRRE 1FLEE 5HMAA 3Q77A 2FS8A 4BTUB 1KXBA 3ITIA 1HJ9A 1NRPH 3SU4A 2VGCB 1H4WA 3RXIA 3RU4D 1BIOA 3O8RA 5FXLA 2AH4X 4BNRA 1HRTH 4RN6A 4X2VA 6ESTA 2XWBI 1FY5A 1OYQA 1DY8A 1PYTD 1ZRKA 2WPHS 1O2KA 3RMMH 3RXUA 1QCPA 3Q3XA 1W0ZU 1O2WA 1K1LA 5L30H 3LC3A 1YF4A 3BTHE 1GI5A 3BTTE 3HKJB 3LH3A 2BYAX 1Q31A 5T3HA 3M7UA 2C8ZB 3KN2A 1FDPA 3ZZ7A 1Z71A 2GZ9A 3ZV9A 1BZXE 3MOCA 3MHWU 4LOYH 4A92A 2ZDKA 1ZJDA 2VIVA 3RXDA 4ISNA 2GV6A 1GHWH 2PWXA 1ZTJA 1L4ZA 1WQSA 5A2MH 2R9PA 1C2MA 2Y7XA 4HTCH 1UTKA 4ZH8A 1BTZA 1XUHA 3SV6A 5FX5A 1MUEB 3RXFA 1FV9A 1GI8B 1DX5M 1E37B 1GL1A 2WV5A 2P94A 1ZHRA 2HWLB 1A3EH 5EPYA 2PKSB 4E7RG 3QTOH 3T62A 1O3GA 1ZSLA 2Q1JA 3LONA 5DP5A 1SGFA 3MMGA 3BIUH 2HNTF 1ELFA 1B0FA 1J9CH 2ODQA 2UWPA 3ZZ6A 2PTCE 3BTGE 3ZVAA 1EAUA 1L2EA 2CHAB 1AI8H 2FPZA 3SU5A 2AMDA 1K9OE 3MO6A 3ZVCA 3S9CA 1DSUA 1W7XH 1NRNH 1EB1H 1N1LA 1GBDA 1ZSKA 2PKSC 1QL9A 1IQFA 2EI7A 3S7KB 1V2VT 1TYNA 1TQ0B 2FLBH 1P0SH 3OY5U 1TRMA 2ZU3A 1HAVA 1GBLA 3T25A 3P70B 1OP0A 1P04A 4INKA 2CHAC 1SLWB 1UTNA 1O33A 2ZGHA 2HRVA 1V2JT 1DE7H 1UVOA 1V2WT 1OP2A 1UVSH 1W3CA 3SNDA 4X6MA 1JIRA 4TYDA 2F83A 2QA9E 5TCAA 4AGJA 4B2CA 1TLDA 1N8OB 3M7TA 1E0FD 3S69A 3A7YA 4H6SB 1O3CA 1O2PA 1ID5H 2TGAA 1AUTC 3SUEA 1KSNA 2QXIA 3MFJA 1ANDA 3U1IB 5ESBA 2QXHA 5EGMA 1VR1H 1FUJA 1AGJA 1O37A 2LPRA 1TMBH 4DOQA 1FZZA 2ZF0H 1IQKA 1ELCA 1N8OC 3TH3H 3K65B 1B7XB 1ELBA 2BDHA 1OWKA 4Y7AA 4X2XA 1G32B 4SGAE 2H2ZA 3HPTB 2IPHA 6CHAC 5FCRA 2OC0A 3EAJA 2AIQA 4ISHH 1O3AA 4VGCC 1TAWA 3E3TA 2O8LA 2QGRA 1C2IA 3EYDA 5HYOA 1A0HB 2R2MB 1D3DB 1HV7A 2ZCHP 2KAIA 1CGHA 2QXGA 3F9EA 2IOTA 2PUXB 3PWBA 3TNTA 2J95A 4OS4A 1K1NA 3P92A 3RXVA 2H9EH 5A09A 3EDXB 5C2ZA 3E90B 4Y11E 2JH0D 1ZTLA 1GHYH 3V13A 3F9FA 1VITF 2FOAA 1O2MA 3H7TA 2XRCA 1K1JA 1O2JA 1XUGA 3OX7U 2EC9H 5E2PA 1RTLA 1F5KU 1EZXC 4CRAA 4ZAEA 3MNSA 1C1WH 1TB6H 4MVNA 2C4FH 4WMDA 1GCTB 2PKAA 1GBJA 1UVTH 3LGWA 1DSTA 3SGQE 4K3JA 1O3LA 1ELTA 2H9HA 1G9IE 4MLFB 8LPRA 2BDIA 4CH2B 4GHTA 1YGCH 3GY2A 1TA2A 3FP7E 3O8DA 1SLUB 1LKBA 1A2CH 4BAHB 9ESTA 1C2HA 1OWEA 2F9UA 1TFXA 1ESTA 2J34A 2NU3E 3IWMA 4D7GA 1HJAB 2YNAA 1HPGA 4FXGH 3P17H 4B1TA 1CA8B 4ISLA 5EQRA 1YPJH 3ZZ3A 3K6ZA 1P02A 5A8XA 2FM2A 1GHAF 1GBTA 1O3IA 2BY5X 3DA9B 3SHCH 1J17T 1BUIA 2V6NA 5GDSH 4D9RA 3FZDA 2BY7X 3LJOA 1EZSC 1GPZA 1O3HA 1BBRH 3LDXH 1L1JA 1O3EA 1JBUH 5DP8A 1NT1A 2AEIH 4Z6AH 2TPIZ 1H8IH 4GUXA 3TU7H 2C93B 4BAMB 1O5EH 1UCYH 1V2OT 2J38A 2VIQA 4AFSA 4FUIA 1C5XB 3PLBA 1LPKB 4IN2A 4ABHA 1O2RA 1MKXH 1ZLRA 1GI3A 3H5CB 3E16B 1KDQB 2JH5D 2K1QA 4HZHA 1J8AA 1DM4B 2ZIQH 3GCNA 4UFGH 4NIYA 1BJVA 1LO6A 2VU8E 4WH6A 5EOKA 1O3DA 3TJUA 1O5GH 1GJCB 3MNBA 3MU4A 6GCHF 2VJ1A 1IQEA 1SB1H 1AZZA 5JPMH 1DLKB 1D3PB 2PGQB 3TGIE 1A5HA 1MTVA 3RXTA 3SHAH 4XBDA 2OINA 2XBWA 4J2YB 1C2FA 1O5AB 1Y3XA 3A88A 4E7NA 2ODPA 1ELDE 1T8MA 3HGPA 4NIXA 4KTSA 2FOGA 1PPZA 1O31A 1DWBH 4JK5A 2ZDMA 3GCTG 3SUDA 5EPNA 4K1SA 3BG4C 5JYIA 1O5BB 1S0RA 1QBVH 2ZPQA 3VEQB 1THRH 4ZKRU 1NRQH 2ZFRH 1OSSA 1VGCB 4X0WU 2UWOA 3FAOA 1OPHB 2FXRA 1PPHE 4NFEA 1DT2A 1CVWH 4JZDH 3TVJB 1P2JA 1T4VH 5T6FA 1ZYOA 2BQ6B 1TMUH 2GTBA 1GBMA 3UUZA 1S6FA 3HKIB 2G81E 1LHFH 1S5SA 1C1MA 2THFB 2ZHEH 2QIQA 3Q76A 5EW2H 4NA8A 2XXLA 1GJ6A 3TGJE 1EOJA 2ZA5A 3V3MA 4IMZA 3ELAH 4IN1A 1O5DH 2CF9H 1GI0A 3FANA 1G36A 1HAYB 2ODYB 1H9HE 4OS1A 1UTJA 3BTEE 2ILNA 3TLOA 2M5TA 4R8TB 5CMXH 1Y5AT 1SLXB 1A46H 1F0RA 3A8DA 2HPQH 4ABGA 3NXPA 1Z8JB 1MAXA 2FI5E 3A7VA 3RLWH 3C27B 1TGNA 3EE0B 3LGUA 2AGGX 4X8VH 4B2AA 4M7GA 3STIA 1O2OA 2QAAA 2OQUA 5G4BA 4WWYA 4MPVA 3B23B 1TABE 1YCPH 2BD3A 3ZZ8A 2BLOA 3A89A 3ODFA 3UFAA 1LKAA 3BTME 2CGAA 4CBNA 3S7HB 3U8OH 1QFKH 1FMGA 3IITA 1GVZA 3KIDU 2GX4A 2P8OB 1S83A 3Q00A 4JZEH 1C1RA 4Y76A 5F8XA 4D8NA 5DP9A 1NM6A 1XMNB 5GJ4B 4GLYA 2ZDLA 1MMJN 2HLCA 3UPEA 2ZHFH 1YCPM 2Z94A 5I25A 2VVUA 2Z3CA 4NWKA 1YCPK 2OC8A 3SU6A 1BOQA 1O2VA 1TGBA 2F9OA 5LPRA 1O2HA 1TWXB 3LJJA 2VWNA 3JZ2B 2H6MA 2P8OC 1V2ST 2G52A 1ZJKA 4MTBA 4DIIH 1S82A 4AORA 1GMDF 1W10U 2XTTB 1K28D 2GD4B 3PO1C 4NZLA 1C5TA 1GBKA 2HALA 1V2NT 1O2UA 1VITG 1CBWB 1NS3A 3DFJA 2FYQA 2B5TB 1GHZA 4I8KA 4GCHF 2WPJS 2EA3A 8ESTE 3E0NB 1TRYA 2FMJA 3A86A 4X2YA 1YBWA 3QK1A 2W3KA 3NZIA 1MBMA 1IHSH 1T8NA 1X7AC 5A0CA 1AO5A 1KTSB 1HAXB 1DY9A 4CRFA 1C5YB 4NFFA 4FUHA 4FUFA 1WTHD 1INCA 2QC2A 3CP7A 3JZ1B 3SBKA 1Y5BT 3DUXH 2BZ6H 2XC0A 3CENA 3M5NA 2CN0H 1TNHA 2QF3A 2ZU5A 1O3FA 1XVOA 9LPRA 4NZQA 1C2LA 1KLTA 4Y71A 1GJ9B 1FY3A 4AGKA 2FP7B 5EQQA 3SV2H 3M3VA 1QHRB 4Y8ZA 2GDEH 1BB0B 4XFQA 1GDUA 5F03A 5GCHG 3QO6A 3A82A 3BIVH 5IDKA 1SMFE 1H9LB 2FYRA 3SV7A 1GHBG 1UTMA 3T2NA 2GV7A 1ACBE 1KTTB 2BVRH 3BTDE 4MNYA 1ABIH 2FDAA 4NSVA 2W7UA 2ZG0H 1DUEA 3A7TA 3SNBA 4KGAA 5E2OA 1V6DA 4MPWA 3B8JA 1MTWA 1SBWA 5JBBS 4ZUHA 2Q6GA 1EJAA 4INHA 2W7SA 1G3EA 1MTNB 1O0DH 2HOBA 1EJMA 3ZZ9A 2AMQA 2LNCA 1W11U 1RJXB 5JBAS 2ZHDA 5AVDA 1SSXA 1TBQH 1MKWK 4MNVA 1EPTC 1C2GA 1GI6A 1O2YA 2G55A 5DK1A 4AB9A 1AVXA 3MU0A 5EODA 1RIWC 2OTVA 3BF6H 1ZHPA 5EXLA 1P3EA 3TGKE 2ZTXA 1RRKA 4F49A 4BAOB 1BMMH 2R3UA 1F7ZA 1GMCG 3U8TH 1AE8H 2Z6BD 2A5IA 3RP2A 3QWCH 1XUIA 2BOKA 1WAYB 1KY9A 1FNIA 3OU0A 4KTCA 3ATLA 4X1NU 4UDWH 3QDZB 1YPGH 2CXVA 4MNXA 4HI3A 1G30B 2O9QA 3W94A 5FAHA 2ZECA 3GYLB 3MYWA 3LH1A 3P8NA 1LTOA 1NTPA 1TNJA 1IQNA 1CSOE 4TY6A 3LOXA 5ESTE 5TJXA 4I8HA 1P10A 4YM9A 1GJ8B 1IOEA 4BTTB 4X6PA 2GCHG 2QXJA 2ZTYA 2QF0A 3RU4E 1LQEA 1QRXA 1L4DA 3E8LA 3NCLA 4NG9H 1O3MA 3KCGH 2GT7A 1ANCA 2ZQ1A 1O2ZA 4YLUA 3F6UH 1BHXB 4X1RU 3RXLA 1GBAA 1CHOG 1AVWA 2R0LA 3UOUA 5F8TA 1GBFA 1ZRBA 1WCZA 1TPPA 3EGKH 4BANB 1NY22 4WJG2 1EP6A 5A8YA 4IBLH 3WY8A 1V3XA 3MH7A 1YLDA 2G00A 1XVMA 4OS5A 4MPUA 1TNIA 3GDSA 1ESBA 2PV9B 2XC4A 2TGTA 2BD7A 4FUGA 3SJIA 1UK3A 2FOMB 1O2IA 1EAXA 1YM0A 2D2DA 3KQBA 4I7YH 1SVPA 1P2QA 1ZHMA 3VB4A 2A4OA 2NU2E 1V2RT 4X1PU 3A8AA 2ESTE 1DXPA 2OC1A 1TE0A 1GBHA 2XCNA 1EZQA 3A87A 4YTAA 4ABBA 4CHAC 1BBRE 2NU0E 2BD9A 3SQHE 3I77A 3C1KA 1HAZB 2P3TB 1GJ5H 1K2I1 3SU3A 1C5UA 1QA0A 1ETTH 2EI8A 2XBVA 1UCYE 1THSH 3EQ0H 1QL8A 2J92A 4YO9A 2BB4A 2GZ8A 1PFXC 4YOGA 5FPTA 1HAIH 1W8BH 1ABJH 2FO9A 1Y3UA 4O03A 2OQ5A 1GBIA 1QJ6B 1AHTH 4OS2A 4LXBH 3A81A 1NFYA 1AIXH 2J2UA 3PV4A 4MNWA 1BMNH 3ZYDA 3VGCB 2FWWA 1TALA 2VH6A 1O38A 2XBXA 3OY6U 4X1QU 4MPXA 3VXFH 1RGQA 2ANYA 1C1PA 1CA0C 1P8VC 5JBCS 3RXSA 2BXTH 3G01A 1IAUA 4YZUA 3SU0A 5FBEA 4NGAH 4AYYB 1ESAA 2XW9A 4ZKOU 4IC5A 3VGCC 1HAOH 1F2SE 1AB9C 2G8TA 3M5OA 4ESTE 2ZDNA 2ZU1A 2BVSH 2F9PA 4ISOA 3SJ9A 1HIAB 2Q6FA 5C67A 4I31A 1TPOA 3SUGA 1KYNA 1G3CA 1NRSH 1RFNA 1ARCA 4E05H 3M35A 1ZMJA 4YT6H 1GDNA 1TQ7B 6CHAB 1A3BH 3EA7A 3BN9A 4ZHLU 3BG8A 5HM2A 4VGCB 1FN8A 3ZVDA 3SZNA 2JKHA 1TBRH 2Z3DA 3QX5H 3SNEA 1NESE 1AFQC 1B0EA 4B76A 3DHKH 4B71A 1LPZB 4WXVA 3O8BA 3N7OA 2WYJA 4BTIB 4NWLA 2ZFFH 1IQJA 4INLA 1V2TT 1XUFA 1AKSB 1YP9A 3BTWE 1CGJE 1EKBB 1FPHH 1KLIH 5EQSA 3HK6B 1XKBC 1A5GH 2C3SA 3ENSB 1IQMA 2QV1A 5C20A 3KQCA 3TH4H 2Y7ZA 4OGXA 4ZROA 1GWAA 3RMNH 1P2MA 1ELGA 1YPMH 2STAE 1A0JA 2C8XB 4AZ2B 4FU8A 5DP4A 4WVPE 5C1XA 2PTNA 1V2UT 7GCHG 1P57B
chains in the Genus database with same CATH superfamily
3UOPA 1SFQB 2BHGA 2J94A 3NKKA 2VIWA 1DXWA 2QN5T 3LPRA 1Y59T 2BDAA 1IQHA 1EB2A 3GDVA 1WTGH 2VIDA 3FKSD 1ZOMA 2RCEA 2WV4A 1AY6H 1BTHH 2STBE 3RXOA 2PUQH 1SGEE 1K1MA 4TWYA 1MQ5A 3SW2B 1MD7A 1QY6A 1VCWA 2HNTE 3LU9B 1LVYA 1GMHG 1V2KT 3VFEA 3OAAD 4X6OA 1C1TA 2A5AA 1MZDA 2J4IA 2WPMS 1LHDH 3KQ5A 2FOHA 1AQ7A 4GAWA 3D49H 4ZXXH 1C5OH 2A4GA 2J98B 1MU6B 4MQAA 3W1EA 1A61H 2ZDAH 5JB8S 4Y6DA 2SNWA 4BXWA 1YYY1 4A5TS 4H4FA 3AVZA 2SGDE 3H7OA 1K21H 2A2XH 1PPFE 3OE7D 1O3PB 3UNQA 5FPSA 1QJ1B 1P11E 1C5NH 1HYLA 2ZEBA 3UR9A 1YKTA 3RXJA 1EUFA 1P2IA 4NIVA 1OWJA 5EJLA 2A7HA 1NU9A 2BX3A 2R3YA 2ZCKP 4X6NA 2XWAA 3KL6A 1WYKA 1H8DH 3CS0A 1JRTA 3ZVBA 5HIYA 5BPEA 2JDID 1N6YA 3ZYEA 1SOZA 1WQVH 1BMLA 3GY8A 1KDQA 2VINA 1PQ8A 2FI3E 3B9FH 3IG6B 1BBRK 4OS6A 5AF9H 2YOLA 1MZAA 2G51A 2OD3B 1WSSH 4UFDH 1B5GH 3PMHB 3MNCA 1UCYK 2QY0B 2VVCA 4DVAU 1MKXK 1Y3VA 1GJAB 3BG4B 3QZQA 4Q7YA 2FTLE 3PV2A 1RS0A 4U30A 3TJNA 2AFQB 3LGIA 2XNDD 4I8GA 3RUOA 1AWHB 3P8GA 1NO9H 2H5CA 3ZZAA 1ZGIA 2PSXA 3BSQA 3QN7A 4GSOA 2YMSD 1BJUA 4FETA 5DG6A 2YNBA 1OWIA 5FX6A 1O3JA 1ZMLA 3RLYH 1FONA 2VIPA 3LC5A 5EJ1A 1W0JD 3LGTA 1DUAA 1LCYA 4KELA 2TBSA 1GI7B 2ALVA 1Q2WA 1UHBA 4ZMAH 1P9UA 4CRGA 2FEQH 1UHBB 2L74A 1LVOA 1ETSH 1Z1IA 2DUCA 1S0QA 1D6RA 1YPKH 2WPIS 2F9BH 3A7XA 1NU7B 2OUAA 3MO9A 1ANBA 2UUKB 3VB5A 1GJ7B 1GJBB 1F5RA 8GCHF 3RM0H 3OEHD 1UO6A 1C1UH 3GY7A 1TNLA 2Y5GA 4FUCA 1P3CA 4DW2U 5LPEA 2ZU4A 1ZGVA 1GJDB 4HGCA 2Z9JA 1HLTH 3ZZCA 3UWJH 1P9SA 1A0LA 2GDDA 5LPFA 2AERH 2CMYA 1SOTA 2NWNA 5FL7D 3UWIA 1P03A 3F2HA 3PROA 3UIRA 4Q2KA 2P95A 2V0BA 5C0TA 1BTWA 3L33A 4K1TA 2ZP0H 1OWHA 3PMJA 1DPOA 1C4Y2 4KTUA 2WINI 3TPIZ 1P2NA 3M5LA 1DWCH 4NA7A 3CS7A 1FY8E 1O39A 1AE5A 3Q3YA 3RXPA 1PPCE 2ZPSA 3F68H 1J16A 3W95A 1MCVA 4CREA 1O2QA 5DO4H 2GMTB 4OGYA 4A7IB 5JB9S 3SQEE 1P2OA 3VXEH 2ZKSA 4DIHH 3FOAA 3SNAA 4DT7B 1QBNA 2TGPZ 2F9NA 2P93A 3EA9A 4FVDA 1C2KA 3AAVA 3PLKA 2BM2A 4CRDA 1TRNA 4AG2A 3PO1B 1QR3E 2A31A 1K1IA 1CHGA 1P06A 1HUTH 1FIZA 3S9BA 1O2NA 1EXFA 1SI5H 4YXWD 2GMTC 3FFGA 1TONA 3O8CA 1LHEH 1NFWA 3TNSA 1M9UA 1DICA 1C5QA 3UQVA 1A4WH 1C1QA 1ARBA 1BT7A 2A32A 3OEED 1XUKA 3SJOA 3SJKA 1DITH 2LP6A 4JZFH 2RA0A 4LK4A 3MH6A 5KGOA 1UTPA 2BZAA 1O5CB 1SGFG 2ZPRA 1ORFA 4K2YA 1RD3B 3KHVA 4E06H 5EW1H 1NBMD 1OKXA 1SQAA 2TRMA 2BLWA 4O9VA 1GI1A 3U9AH 2ZTZA 4BXSA 3NK8A 1DLEA 1FXYA 1C1VH 1Q3XA 4XE4A 1QNJA 1XUJA 1XXFA 1K1OA 3TK9A 3ESTA 3NWUA 3TITA 3SI4H 1HCGA 4I33A 2WYGA 4I8LA 4TSFD 1BITA 1T8OA 5HXFA 3BEIB 1Y8TA 3A84A 1KXEA 3MTYA 4AX9H 3HATH 5H4IB 2ZU2A 4YESB 5EXNA 2HGTH 1QGFA 4R0IA 1BQYA 3MH5A 1C5RA 3ZZBA 1C5PA 3RXQA 1IQLA 2KCPA 2BD2A 3ATKA 2XCFA 1CO7E 5E8EH 1DVAH 3Q3KA 3ZV8A 2XOKD 2JIZD 4XBCA 3LT3A 2K8IA 2C8WB 1O2GH 3QTVH 1QL7A 1GHAG 4BAKB 5C1UA 3AW0A 2OK5A 4LZ1H 2H9TH 4FUJA 1NZQH 2BLVA 4ABJA 3S0NA 1WU1A 2ZFTA 2B7DH 2W5EA 1YWUA 5EU8A 1FX0B 2VWOA 4TPYA 1EATA 4NA9H 2VWLA 1G3DA 1O2TA 3AAUA 1W13U 1KXDA 4UONA 1CE5A 2CK3D 1EPTA 2ZGXH 3AASA 4FUEA 1GHVH 3SV9A 1EPTB 1C2EA 1GBCA 1W0KD 1FJSA 4X1SU 3M3TA 1NFXA 1RIWB 3VPKA 1FPCH 2Z9IA 3F0PA 2VIOA 4GHQA 4Y79A 1YY3A 1P2KA 2FESH 2R0KA 3K6YA 1G2LA 2OBQA 1E79D 3FZZA 1SGTA 3MI4A 3GICB 1UTOA 3DT0H 3T29A 4DCDA 2IJD1 1T7CA 6GCHG 1O3OA 1W14U 5FPYA 2Z9KA 1IQGA 4JYTA 1EX3A 2A7JA 3MO3A 4FU7A 4K5ZA 3F9HA 2AIPA 2V3MA 1HGTH 4THNH 4TY7A 5ETXA 3GCHC 1C9TA 3OTJE 1AMHA 4IGDA 1C1NA 1NC6A 1KLJH 3PV5A 2BTCE 4XOJA 2R2WU 2BD8A 1UMAH 3MU5A 3UREA 3SGBE 4WXIA 2QCYA 1D4PB 1FN6A 2FLRH 3VB6A 4NCYA 1NFUA 1TOCB 4WMEA 2WUBA 3ZZ4A 1MCTA 4ABDA 4H42U 1VZQH 3M37A 1YLCA 2GCTC 1J15A 2CF8H 4DURA 1JXPA 5T6GA 5C1YA 1LHGH 3SOSA 3UNSA 1W12U 1IHTH 2SFAA 4CR9A 1Z7KA 2SGQE 1BA8B 2HVXA 2I6QA 1O5FH 4RKOB 1C5ZB 3ZVEA 1O2SA 1UTQA 3RXEA 3ZZ5A 1S84A 1FY1A 2FX4A 1TPSA 2OP9A 4OM9A 4WMFA 5HIZA 1GGDC 1SQTA 4CBOA 2AGIX 1HAHH 1WBGB 5FBIA 1ELVA 3QLPH 3OSYA 5AFZH 4PROA 1V2QT 3A8CA 1MU8B 1LHCH 3KQDA 2NU1E 1SLVB 2HNTC 1TX8A 2Z9GA 4HFPB 3RC5A 4CHAB 1AVGH 4XSKU 1QA7A 1BRAA 5AFYH 2AYWA 5EXMA 1QURH 4JK6A 2Z7FE 4Q63A 2BX4A 1TX6A 3U8RH 1CT0E 1SG8B 1OX1A 2VGCC 5E0HA 4X2WA 2PHBA 1SFIA 4Y8XA 1HXFH 4OS7A 4IW4E 2V3OH 5DP7A 5L6NH 4Z0KA 2Y82A 4JMYA 1E35B 1IQIA 1C5LH 4ACAA 1QQ4A 2AHME 1F0TA 2A0QB 1GHXH 2A7CA 1DDJA 2IN2A 5DP6A 4ZXYH 4UFFH 1WXRA 4F48B 3RXRA 1LDTT 4MDSA 4DGJA 3SNCA 4ABEA 1ZTKA 1Z6EA 1F0UA 2ANKH 1ELAA 2PGBB 3MU1A 1V2PT 3ZZDA 2A45B 3A83A 1CA0B 1UK2A 1YLNA 2JH6D 3A8BA 1YPLH 2D8WA 4ABAA 4ZKSU 1QB9A 2BDGA 1O35A 2RA3A 3F3BA 3MWIU 3GCTF 1SQOA 2P59A 3R0FA 2RG3A 2W6ID 4H6TA 1A1RA 4X8TH 1O3KA 4D7FA 4A6LA 1S85A 1AB9B 2FX6A 1XM1A 1QB1A 1GMDG 1QRZA 1D9IA 5DPAA 5HGGA 8KME2 1BHXF 3KQEA 2JETB 1MQ6A 2GZ7A 4IC6A 3DFLA 3T28A 1HBTH 1GVLA 1SGPE 2BMGB 4GCHG 5KEDA 1VJ9U 4Y0ZE 5T6DA 1HIAA 1OS8A 3ZVGA 3MU8A 4Q7XA 1SGIB 3KGPA 1TGTA 3ATWA 4KKDA 1AU8A 4D76A 2XNIA 1W7GH 1AUJA 1ELEE 1RTKA 2ZFSA 3E6PH 1AFQB 2JETC 1SHHB 2BLQA 4F4OC 1FI8A 1DFPA 3KNXA 3TJOA 1E34B 1C4V2 1SC8U 1OOKB 3U98H 5E0GA 2EY4C 2F9VA 1HAVB 3P95A 3AW1A 3GY3A 3LIWA 4CRCA 1T8LA 2VH0A 2XYAA 1C5MD 3FP8E 1FY4A 3PMAB 1O2XA 1BRBE 1YPEH 2V35A 1P12E 2UUFB 2G4UA 4XDEA 4DJZB 4K8BA 1GI2A 2ZWLH 2BD5A 3QZRA 1EASA 5GWZA 3KEEA 1AWFH 2C90B 2OLGA 4AB8A 5ABWA 1TMTH 2ZGJA 4UE7H 1DWDH 7KMEH 3STJA 1LQDB 4J1YA 3SORA 2PFEA 1RTFB 3NPSA 1AKSA 2FTMA 5A0AE 1WOFA 3HK3B 2DE9A 1OP8A 1SGDE 2B8OH 4AOQA 1PQ5A 2SGPE 3QUMP 3OYPA 5F6MA 3RDZA 3SV8A 1SGQE 2RDLA 1O34A 3A7ZA 1DWEH 2FS9A 1QTFA 4YT7H 4NSYA 4AG1A 3F0OA 2FOCA 2FI4E 1ETRH 5HM9A 1HAGE 2KAIB 2D1JA 3RMLH 1VJAU 4O3TA 2FOBA 1LVMA 1A5IA 3SN8A 5C17A 4Y8YA 3M61U 4DG4A 3D65E 1YPHC 5TCCA 5SGAE 5L2YH 1UTLM 1ZMNA 3BV9B 1U6QA 2ZQ2A 2CV3A 5EG4A 2Z9LA 1VKYA 4BAQB 1TNGA 1S81A 1P05A 5T1VA 2BD4A 1BCUH 4RSPA 4ASHA 3N7EA 4JYVH 1EZUC 1GVKB 1ZZZA 1J14A 4NIWA 3QGJA 2IJOB 1G3BA 1MH0A 1NRRH 2P16A 2Y5HA 2V3HH 2Z3EA 3GY4A 4Q7ZA 3FP6E 3M5MA 5C3NA 4Y10E 2PKAB 3GY6A 1BTUA 2J98A 4JCNA 1HNEE 2WPLS 1BTPA 2SGAA 1AZ8A 5IK2D 5JBTA 1HB0B 3P8OA 1SL3A 2Y6TA 1TPAE 1Z8GA 4TPIZ 1Z6JH 3HGNA 4K1EA 1T31A 2D26C 1GCTC 1C2JA 5C5NA 2GGVB 2BQ7B 1D3TB 3UR6A 1WV7H 1TX7A 1GDQA 2GVFA 3S9AA 1ANEA 1GCDA 4RI0A 1EOLA 3T5FH 1C5VA 3A80A 1Y3WA 1QZ8A 4M9FA 1DOJA 2O8TA 3MH4A 3UTUH 1FIWA 2SNVA 2OCVB 5CE1A 2FIRH 4BOHA 2I6SA 1CT2E 1Y3YA 3SU2A 2J9NA 1BTXA 5GCHF 3SU1A 1E36B 4CH8B 1HJAC 1S6HA 3GY5A 1OWDA 1GHBF 3LGYA 4O3UA 4WH8A 3TK6A 1YC0A 3URCA 1O3BA 1HAPH 5K7RA 3BEFB 1KXAA 1XKAC 2KZ4A 3RXGA 2OBOA 3PB1E 3K2UA 1MAYA 1C1OA 3RU4T 2A4RA 5IYTA 4ABIA 2ZO3H 1HXEH 3K9XB 2TIOA 2BVXH 1FAKH 3I29A 2P3UB 3SJ8A 2UUJB 1PPBH 5B6LA 1PQAA 1DANH 2NU4E 2O8MA 1MTSA 3PYHA 5GXPA 1A7SA 3M36A 2B0FA 4WY3A 2ZGCA 5FCKA 1F92A 1PQ7A 2AMPA 3U69H 2ZHQH 4AFUA 3UY9A 4YLQH 4A1XA 5F8ZA 2UUYA 1GMCF 5LGOA 3BTQE 1SHYA 2VNTA 1P01A 2GKVE 1K22H 2ANMH 1EQ9A 1MD8A 2PR3A 1SPJA 4UFEH 1BMAA 2ULLA 3F2FA 5I46H 4ABFA 4QT8C 1NN6A 4X8UH 4B74A 2BQWB 2OXSA 4GPGA 2ZNKH 5J4QA 5GPIB 1ZPZA 4JZIA 3TH2H 1JOUB 1UVPA 2WPKS 1PJPA 2PSYA 3M7QA 1GI9B 1L1NA 1O2LA 2A1DB 4AC9A 1QB6A 2WV9A 1PPGE 2GCHF 2W26A 5FHTA 1T4UH 1FAXA 1PPEE 1V2LT 2O8WA 1AN1E 1TNKA 4U01A 1C9PA 1KIGH 1D6WA 3LKWA 3URDA 4IS5A 1O30A 4DY7B 1KXCA 4Y0YE 1V2MT 2W3IA 3ODDA 1F5LA 4ZKNU 1EAWA 3SGAE 2A4QA 2J5UA 4F55A 4RKJB 3BTFE 2GP9B 3F2GA 1KMHB 3RXBA 1VGCC 1CHOF 3E91A 1Y5UT 2UWLA 3RXHA 3SUFA 4SGBE 1ZPCA 4AYVB 7LPRA 4UEHH 5DGJA 4B6FA 3E1XB 1ZPBA 1SR5C 3KF2A 1Z8IB 3PM3A 1YPHE 1O3NA 1UJ1A 1MBQA 5C5OA 5LH8A 1HJ8A 2ASUB 4K60A 3SI3H 3RM2H 2HVYB 2BOHB 1BRUP 1EP5A 1KXFA 3GS9A 1GL0E 1UK4A 1W2KH 4ISIH 1CGIE 1JIMA 2O8UA 2ZFPH 3ZVFA 1HFDA 3M3SA 1GBEA 4TWWA 1O32A 1AD8H 3I78A 1BRCE 3GISB 1LVBA 4CR5A 1RXPA 4GVUA 2XBYA 3V0XA 1VCPA 1E38B 5J4SA 2HPPH 3F1SB 4UD9H 2EI6A 1C5SA 4A1VA 2Q6DA 1NPMA 2ZHWH 2SGEE 3ATMA 2ZDVH 3QGNB 3GDUA 2ZC9H 3L3TA 1BDAA 3SYJA 1PYTC 1T32A 1H1BA 3TJVA 5L2ZH 3TK5A 2H5DA 4I8JA 4ZHAA 4B6EA 4KP0A 1C5WB 1P09A 3KYGA 1TGCA 3SO3A 6LPRA 4K8YA 1XXDA 4XBBA 2VB0A 4AFZA 4MG3A 5DJ7A 3UQOA 1C1SA 4A1TA 3RMOH 2FOFA 4CRBA 1JWTA 3VB7A 5DP3A 1Z1JA 3RC4A 3F9GA 1F0SA 2BY9X 4JYUH 3RC6A 3P8FA 3EA8A 1XX9A 4Y7BA 1HDTH 1MTUA 3TIUA 3P6ZB 2AS9A 1N6XA 4B75A 2VBCA 3PWCA 3H09A 1JRSA 3ZIAD 1QJ7B 1NROH 1LPGB 4HG6A 4WF8A 2ZZUH 5CHAB 3PTNA 5A0BA 1GBBA 1CBWC 1CT4E 1QQUA 2RFKC 1QBOA 3MNXA 2A2QH 5PTPA 3RXKA 2QYIA 3V7TA 2ZGBH 1GJ4H 2FOEA 3LGVA 1SGNE 3V12A 7ESTE 2G4TA 4B2BA 3GCOA 1C2DA 3E0PB 5CHAC 4K69A 4Q80A 1EAIA 3U1JB 1OYTH 2WUCA 1Z8RA 3RXMA 1QRWA 3PLPA 2BDBA 1GG6B 4FVBA 2Y81A 3GYMA 1EFRD 2F91A 1WUNH 3GOVB 1SGYE 1TBZH 3D62A 2ALPA 1SGRE 2G5NA 4FU9A 2CJIA 2Y5FA 3R3GB 4FUBA 4U32A 4ZHMU 4AN7A 2OC7A 5GIBA 3A85A 4I32A 2KCYA 1L0ZA 1BMFD 5E0JA 3DSGA 1VITH 2ZFQH 4AFQA 1GG6C 3A7WA 1H9IE 2A5KA 2PLXA 1MKWH 2AGEX 4B73A 2Y80A 3RXAA 3PTBA 4LZ4B 1CU1A 1BTYA 3BTKE 3GCHB 5JDUB 3T26A 3ATIA 3UNRA 2BY8X 1G2MA 1K1PA 3BEUA 4FUDA 1EJNA 1G37A 7GCHF 5K0HA 1LMWB 3DD2H 2BY6X 2G5VA 2FZZA 1THPB 1SGCA 2ZCLP 1TOMH 5B6OA 2BDCA 1JMOH 2ANWA 2VVVA 4O97A 3L6PA 1D3QB 1VCQA 1C4U2 5AHGH 2TGDA 1AFEH 1L1GA 5DKMA 4IMQA 4D9QA 1GI4A 1MTNC 4YOJA 3PMBB 2GCTB 1H8ED 1TIOA 2C8YB 4JZ1A 1TA6A 1GMHF 2DE8A 2B9LA 1O36A 1W0YH 3VB3A 2P3FH 3RXCA 3VG8A 3NUMA 5A8ZA 1FQ3A 2ZI2H 4U2WA 2FODA 2BXUH 1DS2E 3FVFB 3T27A 1TGSZ 4XD7D 2KX4A 2BDYA 1OXGA 1ZR0A 1GGDB 1CQQA 3DCLA 2VWMA 3D23A 2K0QA 2PP6A 2XC5A 1UVUH 2H1UA 1QIXB 8GCHG 2EEKA 2GT8A 2PW8H 2F3CE 1ZSJA 2SGFE 4X8SH 4YOIA 5BRRE 1FLEE 5HMAA 3Q77A 2FS8A 4BTUB 1KXBA 3ITIA 1HJ9A 1NRPH 3SU4A 2VGCB 1H4WA 3RXIA 3RU4D 1BIOA 3O8RA 3AK5A 5FXLA 2F43B 2AH4X 4BNRA 1HRTH 4RN6A 4X2VA 6ESTA 2XWBI 1FY5A 1OYQA 1DY8A 1PYTD 1ZRKA 2WPHS 1O2KA 3RMMH 3RXUA 1QCPA 3Q3XA 1W0ZU 1O2WA 2W6JD 1K1LA 2J97A 5L30H 3LC3A 1YF4A 3BTHE 1GI5A 3BTTE 3HKJB 3LH3A 2BYAX 1Q31A 5T3HA 3M7UA 3WWBA 2C8ZB 3KN2A 1FDPA 3ZZ7A 1Z71A 2GZ9A 3ZV9A 3FO8D 1BZXE 3MOCA 3MHWU 4LOYH 1E1QD 4A92A 2ZDKA 1ZJDA 2V7QD 2VIVA 3RXDA 4ISNA 2GV6A 1GHWH 2PWXA 1ZTJA 1L4ZA 1WQSA 5A2MH 2R9PA 1C2MA 2Y7XA 4HTCH 1UTKA 4ZH8A 1BTZA 1XUHA 2KCOA 3SV6A 5FX5A 1MUEB 3RXFA 1FV9A 1GI8B 1DX5M 1E37B 1GL1A 2WV5A 2P94A 1ZHRA 2HWLB 1A3EH 2YMSB 4FOUC 1COWD 5EPYA 2JJ1D 2PKSB 4E7RG 3QTOH 3T62A 1O3GA 1ZSLA 2Q1JA 3LONA 5DP5A 1SGFA 3MMGA 3BIUH 2HNTF 1ELFA 1B0FA 1J9CH 2ODQA 2UWPA 3ZZ6A 2PTCE 3BTGE 3ZVAA 1EAUA 1L2EA 2CHAB 1AI8H 2FPZA 3SU5A 2AMDA 1K9OE 3MO6A 3ZVCA 3S9CA 2YMSC 1DSUA 1W7XH 1NRNH 1EB1H 1N1LA 1GBDA 1ZSKA 2PKSC 1QL9A 1IQFA 2EI7A 3S7KB 4Q4LA 1V2VT 1TYNA 1TQ0B 2FLBH 1P0SH 3OY5U 1TRMA 1WDIA 1HAVA 2ZU3A 3WW7A 1GBLA 3T25A 3P70B 1OP0A 1P04A 4INKA 2CHAC 1SLWB 1UTNA 1O33A 2ZGHA 2HRVA 1V2JT 1DE7H 1UVOA 1V2WT 1OP2A 1UVSH 1W3CA 3SNDA 4X6MA 1JIRA 4TYDA 2F83A 2QA9E 5TCAA 4AGJA 4B2CA 1TLDA 1N8OB 3M7TA 1E0FD 3S69A 3A7YA 4H6SB 1O3CA 1O2PA 1ID5H 2TGAA 1AUTC 2WPDD 5DSFA 3SUEA 1KSNA 2HLDD 2QXIA 5C94A 3FN8A 3MFJA 1ANDA 3U1IB 5ESBA 2QXHA 5EGMA 1VR1H 1FUJA 2JJ2D 1AGJA 1O37A 2LPRA 1TMBH 4DOQA 1FZZA 2ZF0H 1IQKA 1ELCA 1N8OC 3TH3H 3K65B 1B7XB 1ELBA 2BDHA 1OWKA 4Y7AA 4X2XA 1G32B 4SGAE 2H2ZA 3HPTB 2KFWA 2IPHA 5EIYA 6CHAC 5FCRA 2OC0A 3EAJA 2AIQA 4ISHH 1O3AA 4VGCC 1TAWA 3E3TA 2O8LA 5EJZA 2QGRA 1C2IA 3EYDA 5HYOA 1A0HB 2R2MB 1D3DB 1HV7A 2ZCHP 2KAIA 1CGHA 2QXGA 3F9EA 2IOTA 2PUXB 3PWBA 3TNTA 2J95A 4XRNA 3MQKC 4OS4A 1K1NA 3P92A 3RXVA 2H9EH 5A09A 3EDXB 1S6LA 5C2ZA 3E90B 4Y11E 2JH0D 1ZTLA 1GHYH 3V13A 3F9FA 1VITF 2FOAA 1O2MA 3H7TA 5KECA 2XRCA 4I86A 1K1JA 1O2JA 1XUGA 2WHXA 2EC9H 3OX7U 5E2PA 1RTLA 1F5KU 1EZXC 4CRAA 4ZAEA 2WZQA 1C1WH 3MNSA 1TB6H 4MVNA 3PRBA 2C4FH 4WMDA 1GCTB 2PKAA 1GBJA 1UVTH 3LGWA 1DSTA 2L6OA 4K3JA 3SGQE 1O3LA 3NRLA 1ELTA 2H9HA 1G9IE 4MLFB 8LPRA 2BDIA 4CH2B 4GHTA 1YGCH 3GY2A 1TA2A 3FP7E 3O8DA 1SLUB 1LKBA 1A2CH 4BAHB 9ESTA 1C2HA 1OWEA 2F9UA 1TFXA 1ESTA 2J34A 2NU3E 3IWMA 3PRDA 4D7GA 1HJAB 2YNAA 1HPGA 4FXGH 3P17H 4B1TA 1CA8B 4ISLA 5EQRA 1YPJH 3ZZ3A 3K6ZA 1P02A 5A8XA 2FM2A 1GHAF 1GBTA 1O3IA 2BY5X 3DA9B 3SHCH 1J17T 1BUIA 2V6NA 5GDSH 4D9RA 3FZDA 2BY7X 3LJOA 1EZSC 1GPZA 1O3HA 1BBRH 3LDXH 1L1JA 1O3EA 5C0UA 1JBUH 5DP8A 1NT1A 2AEIH 4Z6AH 2TPIZ 1H8IH 4GUXA 3TU7H 2C93B 4BAMB 1O5EH 1UCYH 1V2OT 2J38A 2RDEA 2VIQA 4AFSA 4FUIA 1C5XB 3PLBA 1LPKB 4IN2A 4ABHA 1O2RA 3CNRA 1MKXH 1ZLRA 1GI3A 3H5CB 3E16B 1KDQB 2JH5D 2K1QA 3N99A 4HZHA 2F4LA 1J8AA 1DM4B 2ZIQH 3GCNA 4UFGH 4NIYA 1BJVA 1LO6A 2VU8E 4WH6A 5EOKA 1O3DA 3TJUA 1O5GH 1GJCB 3MNBA 3MU4A 2LELA 6GCHF 2VJ1A 1IQEA 1SB1H 1AZZA 5JPMH 1DLKB 1D3PB 2PGQB 3TGIE 1A5HA 1MTVA 3RXTA 3SHAH 3WWFA 4XBDA 2OINA 2XBWA 4J2YB 1C2FA 1O5AB 1Y3XA 3A88A 4E7NA 2ODPA 1ELDE 1T8MA 3HGPA 4NIXA 4KTSA 2FOGA 5CHBA 1PPZA 1O31A 1DWBH 4JK5A 2ZDMA 3GCTG 3SUDA 5EPNA 4K1SA 3BG4C 5JYIA 1O5BB 1S0RA 1QBVH 2ZPQA 3VEQB 1THRH 4ZKRU 1NRQH 2ZFRH 1OSSA 1VGCB 4X0WU 2UWOA 3FAOA 1OPHB 2FXRA 1PPHE 4NFEA 1DT2A 1CVWH 4JZDH 3TVJB 1P2JA 1T4VH 5T6FA 2IPQX 1ZYOA 2BQ6B 1TMUH 2GTBA 1GBMA 3UUZA 1S6FA 3HKIB 4RT1A 2G81E 1LHFH 1S5SA 1C1MA 2THFB 2ZHEH 2QF4A 2QIQA 3Q76A 5EW2H 4NA8A 2XXLA 1GJ6A 3TGJE 1EOJA 2ZA5A 3V3MA 4IMZA 3SZEA 3ELAH 4IN1A 1O5DH 2CF9H 1GI0A 3FANA 1G36A 1HAYB 2ODYB 1H9HE 4OS1A 1UTJA 3BTEE 2ILNA 3TLOA 2M5TA 4R8TB 5CMXH 1Y5AT 1SLXB 1A46H 1F0RA 3A8DA 2HPQH 4ABGA 3NXPA 1Z8JB 1MAXA 2FI5E 3A7VA 3RLWH 3C27B 1TGNA 3EE0B 3LGUA 2AGGX 4X8VH 4B2AA 4M7GA 3STIA 1O2OA 2QAAA 2OQUA 5GNDA 5G4BA 4WWYA 4MPVA 3B23B 1TABE 1YCPH 2BD3A 3ZZ8A 2BLOA 3A89A 3ODFA 3UFAA 1LKAA 3BTME 2CGAA 4CBNA 3S7HB 2M2AA 3U8OH 1QFKH 1FMGA 3IITA 1GVZA 3KIDU 2GX4A 2P8OB 1S83A 3Q00A 4JZEH 1C1RA 4Y76A 5F8XA 4D8NA 5DP9A 1NBME 1NM6A 1XMNB 5GJ4B 3U28C 4GLYA 2ZDLA 1MMJN 2HLCA 3UPEA 2ZHFH 1YCPM 2Z94A 5I25A 2VVUA 2Z3CA 4NWKA 1YCPK 2OC8A 3SU6A 1BOQA 1O2VA 1TGBA 2F9OA 5LPRA 1O2HA 1TWXB 3LJJA 2VWNA 3JZ2B 2H6MA 2P8OC 1V2ST 2G52A 1ZJKA 4MTBA 4DIIH 1S82A 4AORA 1GMDF 1W10U 2XTTB 4ACBA 1K28D 2GD4B 3PO1C 4NZLA 1C5TA 1GBKA 2HALA 1V2NT 1O2UA 1UW7A 1VITG 2WSSD 1CBWB 1NS3A 3DFJA 2FYQA 2B5TB 1GHZA 4I8KA 4GCHF 2WPJS 2EA3A 1H8HD 8ESTE 3E0NB 1TRYA 2FMJA 3A86A 4X2YA 1YBWA 3QK1A 2W3KA 3NZIA 1MBMA 1IHSH 1T8NA 1X7AC 5A0CA 1AO5A 1KTSB 1HAXB 1DY9A 4CRFA 1C5YB 4ASUD 4NFFA 4FUHA 4FUFA 1WTHD 1INCA 2QC2A 3CP7A 3JZ1B 3SBKA 1Y5BT 3DUXH 2BZ6H 2XC0A 3CENA 3M5NA 2CN0H 1TNHA 2QF3A 2ZU5A 1O3FA 1XVOA 3N7DA 4NZQA 9LPRA 1C2LA 1KLTA 4Y71A 1GJ9B 1FY3A 4AGKA 2FP7B 5EQQA 2KCAA 3SV2H 3M3VA 1QHRB 4Y8ZA 2GDEH 1BB0B 4XFQA 1GDUA 5F03A 2GJGA 5GCHG 3QO6A 3A82A 3BIVH 5IDKA 1SMFE 1H9LB 2FYRA 3SV7A 1GHBG 1UTMA 1MABB 3T2NA 2GV7A 1ACBE 1KTTB 2BVRH 3BTDE 4MNYA 1ABIH 2FDAA 1K0HA 4NSVA 2W7UA 2ZG0H 1DUEA 3A7TA 3SNBA 4KGAA 5E2OA 1V6DA 4RT0A 4MPWA 3B8JA 1MTWA 1SBWA 5JBBS 4ZUHA 2Q6GA 1EJAA 4INHA 2W7SA 1G3EA 1MTNB 1O0DH 2HOBA 1EJMA 3ZZ9A 2KM0A 2AMQA 3OFND 2LNCA 1W11U 1RJXB 5JBAS 2ZHDA 5AVDA 1SSXA 4TT3D 1TBQH 5F53A 1MKWK 4MNVA 1EPTC 1C2GA 4P02A 1GI6A 1O2YA 2G55A 5DK1A 4AB9A 1AVXA 3MU0A 5EODA 1RIWC 2OTVA 3BF6H 1ZHPA 2QF5A 1P3EA 5EXLA 2ZTXA 3TGKE 1RRKA 4F49A 4BAOB 1BMMH 2R3UA 1F7ZA 1GMCG 3U8TH 1AE8H 2Z6BD 2A5IA 1SQRA 3RP2A 3QWCH 1XUIA 2BOKA 1WAYB 1KY9A 1FNIA 3OU0A 4KTCA 3ATLA 4X1NU 4UDWH 3QDZB 1YPGH 2CXVA 4MNXA 4HI3A 1G30B 2O9QA 3W94A 5FAHA 2ZECA 3GYLB 3MYWA 3LH1A 3P8NA 1LTOA 1NTPA 1TNJA 1IQNA 1CSOE 4TY6A 3LOXA 5CDFE 5ESTE 5TJXA 4I8HA 1P10A 4YM9A 1GJ8B 1IOEA 4BTTB 4X6PA 2GCHG 2QXJA 2ZTYA 2QF0A 3RU4E 3KYFA 1LQEA 1QRXA 1L4DA 3E8LA 3UB0A 3NCLA 4NG9H 1O3MA 3KCGH 2GT7A 1ANCA 2ZQ1A 1O2ZA 4YLUA 3F6UH 3DSOA 1BHXB 4X1RU 3RXLA 1GBAA 1CHOG 1AVWA 2R0LA 3UOUA 5F8TA 1GBFA 1ZRBA 1WCZA 1TPPA 3EGKH 4BANB 1NY22 4WJG2 1EP6A 5A8YA 4IBLH 3WY8A 1V3XA 3MH7A 1YLDA 2G00A 4Z1MD 1XVMA 4OS5A 4MPUA 1TNIA 3GDSA 5DN6D 1ESBA 2PV9B 2XC4A 2TGTA 2BD7A 4FUGA 3SJIA 1UK3A 2FOMB 1O2IA 1EAXA 1YM0A 2D2DA 3KQBA 4I7YH 3EE7A 1SVPA 1P2QA 1ZHMA 3VB4A 2A4OA 2NU2E 1V2RT 4X1PU 3A8AA 2ESTE 1DXPA 1OHHD 1TE0A 2OC1A 1GBHA 2XCNA 1EZQA 3A87A 2QE7D 4YTAA 4ABBA 4CHAC 1BBRE 2KR7A 2NU0E 2BD9A 3SQHE 3I77A 3C1KA 1HAZB 2P3TB 1GJ5H 1K2I1 3SU3A 1C5UA 1QA0A 1ETTH 2EI8A 2XBVA 1UCYE 1THSH 3EQ0H 1QL8A 2J92A 4YO9A 2BB4A 2GZ8A 1PFXC 4YOGA 5FPTA 1HAIH 1W8BH 1ABJH 2FO9A 1Y3UA 4O03A 2OQ5A 1GBIA 1QJ6B 1AHTH 4OS2A 4LXBH 3A81A 1NFYA 5HKKD 1AIXH 2J2UA 3PV4A 4MNWA 1BMNH 3ZYDA 3VGCB 2FWWA 1TALA 2VH6A 1O38A 2XBXA 3OY6U 4X1QU 4MPXA 3VXFH 1RGQA 2ANYA 1C1PA 1CA0C 1P8VC 5JBCS 3RXSA 2BXTH 3G01A 1IAUA 4YZUA 3SU0A 5FBEA 4NGAH 4AYYB 1ESAA 2XW9A 4ZKOU 4IC5A 3VGCC 1HAOH 1F2SE 1AB9C 2G8TA 3M5OA 4ESTE 2ZDNA 2ZU1A 2BVSH 2F9PA 4ISOA 3SJ9A 1HIAB 1SKYE 2Q6FA 5C67A 4I31A 1E1RD 1TPOA 3SUGA 1KYNA 1G3CA 1NRSH 1RFNA 4ZCNA 1ARCA 4E05H 3M35A 1ZMJA 4YT6H 1GDNA 1TQ7B 6CHAB 1A3BH 3EA7A 3OTPA 3BN9A 2EQNA 4ZHLU 3BG8A 5HM2A 4VGCB 1FN8A 3ZVDA 3SZNA 2JKHA 1TBRH 2Z3DA 3QX5H 3SNEA 1NESE 1AFQC 1B0EA 4B76A 3DHKH 4B71A 1LPZB 4WXVA 3O8BA 3N7OA 2WYJA 4BTIB 4NWLA 4DT4A 2ZFFH 1IQJA 4INLA 1V2TT 1XUFA 1AKSB 1YP9A 3BTWE 1CGJE 1EKBB 1FPHH 1KLIH 5EQSA 3HK6B 1XKBC 1A5GH 2C3SA 3ENSB 1IQMA 2QV1A 5C20A 3KQCA 3TH4H 2Y7ZA 4OGXA 4P00A 4ZROA 1GWAA 3RMNH 1P2MA 1ELGA 1YPMH 3DSPA 2STAE 1A0JA 2C8XB 4AZ2B 4FU8A 3UAIC 5DP4A 4WVPE 5C1XA 2PTNA 1V2UT 7GCHG 1P57B
chains in the Genus database with same CATH topology
3UOPA 1SFQB 2BHGA 2J94A 3NKKA 2VIWA 1DXWA 2QN5T 3LPRA 1Y59T 2BDAA 1IQHA 1EB2A 3GDVA 1WTGH 2VIDA 1ZOMA 2RCEA 2WV4A 1AY6H 1BTHH 2STBE 3RXOA 2PUQH 1SGEE 1K1MA 4TWYA 1MQ5A 3SW2B 1MD7A 1QY6A 1VCWA 2HNTE 3LU9B 1LVYA 1GMHG 1V2KT 3VFEA 4X6OA 1C1TA 2A5AA 1MZDA 2J4IA 2WPMS 1LHDH 2FOHA 1AQ7A 4GAWA 3D49H 4ZXXH 1C5OH 2A4GA 1MU6B 4MQAA 1A61H 2ZDAH 5JB8S 4Y6DA 2SNWA 4BXWA 1YYY1 4A5TS 4H4FA 3AVZA 2SGDE 3H7OA 1K21H 2A2XH 1PPFE 1O3PB 3UNQA 5FPSA 1QJ1B 1P11E 1C5NH 1HYLA 2ZEBA 3UR9A 1YKTA 3RXJA 1EUFA 1P2IA 4NIVA 1OWJA 2A7HA 1NU9A 2BX3A 2R3YA 2ZCKP 4X6NA 2XWAA 3KL6A 1WYKA 1H8DH 3CS0A 1JRTA 3ZVBA 5BPEA 1N6YA 3ZYEA 1SOZA 1WQVH 1BMLA 3GY8A 1KDQA 2VINA 1PQ8A 2FI3E 3B9FH 3IG6B 1BBRK 4OS6A 5AF9H 2YOLA 1MZAA 2G51A 2OD3B 1WSSH 4UFDH 1B5GH 3PMHB 3MNCA 1UCYK 2QY0B 2VVCA 4DVAU 1MKXK 1Y3VA 1GJAB 3BG4B 3QZQA 4Q7YA 2FTLE 1RS0A 4U30A 3TJNA 2AFQB 3LGIA 4I8GA 3RUOA 1AWHB 3P8GA 1NO9H 2H5CA 3ZZAA 1ZGIA 2PSXA 3BSQA 3QN7A 4GSOA 1BJUA 5DG6A 2YNBA 1OWIA 5FX6A 1O3JA 1ZMLA 3RLYH 1FONA 2VIPA 3LC5A 3LGTA 1DUAA 1LCYA 4KELA 2TBSA 1GI7B 2ALVA 1Q2WA 1UHBA 4ZMAH 1P9UA 4CRGA 2FEQH 1UHBB 1LVOA 1ETSH 1Z1IA 2DUCA 1S0QA 1D6RA 1YPKH 2WPIS 2F9BH 3A7XA 1NU7B 2OUAA 3MO9A 1ANBA 2UUKB 3VB5A 1GJ7B 1GJBB 1F5RA 8GCHF 3RM0H 1UO6A 1C1UH 3GY7A 1TNLA 2Y5GA 4FUCA 1P3CA 4DW2U 5LPEA 2ZU4A 1ZGVA 1GJDB 4HGCA 2Z9JA 1HLTH 3ZZCA 3UWJH 1P9SA 1A0LA 2GDDA 5LPFA 2AERH 2CMYA 1SOTA 2NWNA 3UWIA 1P03A 3PROA 3UIRA 4Q2KA 2P95A 2V0BA 1BTWA 3L33A 4K1TA 2ZP0H 1OWHA 3PMJA 1DPOA 1C4Y2 4KTUA 2WINI 3TPIZ 1P2NA 3M5LA 1DWCH 4NA7A 3CS7A 1FY8E 1O39A 1AE5A 3Q3YA 3RXPA 1PPCE 2ZPSA 3F68H 1J16A 3W95A 1MCVA 4CREA 1O2QA 5DO4H 2GMTB 4OGYA 4A7IB 5JB9S 3SQEE 1P2OA 3VXEH 2ZKSA 4DIHH 3SNAA 4DT7B 1QBNA 2TGPZ 2F9NA 2P93A 3EA9A 4FVDA 1C2KA 3AAVA 3PLKA 2BM2A 4CRDA 1TRNA 4AG2A 3PO1B 1QR3E 2A31A 1K1IA 1CHGA 1P06A 1HUTH 1FIZA 3S9BA 1O2NA 1EXFA 1SI5H 2GMTC 3FFGA 1TONA 3O8CA 1LHEH 1NFWA 3TNSA 1M9UA 1DICA 1C5QA 3UQVA 1A4WH 1C1QA 1ARBA 1BT7A 2A32A 1XUKA 3SJOA 3SJKA 1DITH 4JZFH 2RA0A 4LK4A 3MH6A 1UTPA 2BZAA 1O5CB 1SGFG 2ZPRA 1ORFA 4K2YA 1RD3B 3KHVA 4E06H 5EW1H 1OKXA 1SQAA 2TRMA 2BLWA 4O9VA 1GI1A 3U9AH 2ZTZA 4BXSA 3NK8A 1DLEA 1FXYA 1C1VH 1Q3XA 4XE4A 1QNJA 1XUJA 1XXFA 1K1OA 3TK9A 3ESTA 3NWUA 3TITA 3SI4H 1HCGA 4I33A 2WYGA 4I8LA 1BITA 1T8OA 5HXFA 3BEIB 1Y8TA 3A84A 1KXEA 3MTYA 4AX9H 3HATH 5H4IB 2ZU2A 4YESB 5EXNA 2HGTH 1QGFA 4R0IA 1BQYA 3MH5A 1C5RA 3ZZBA 1C5PA 3RXQA 1IQLA 2BD2A 3ATKA 2XCFA 1CO7E 5E8EH 1DVAH 3Q3KA 3ZV8A 4XBCA 3LT3A 2C8WB 1O2GH 3QTVH 1QL7A 1GHAG 4BAKB 5C1UA 3AW0A 4LZ1H 2H9TH 4FUJA 1NZQH 2BLVA 4ABJA 3S0NA 1WU1A 2ZFTA 2B7DH 2W5EA 5EU8A 2VWOA 4TPYA 1EATA 4NA9H 2VWLA 1G3DA 1O2TA 3AAUA 1W13U 1KXDA 4UONA 1CE5A 1EPTA 2ZGXH 3AASA 4FUEA 1GHVH 3SV9A 1EPTB 1C2EA 1GBCA 1FJSA 4X1SU 3M3TA 1NFXA 1RIWB 3VPKA 1FPCH 2Z9IA 2VIOA 4GHQA 4Y79A 1P2KA 2FESH 2R0KA 3K6YA 1G2LA 2OBQA 3FZZA 3MI4A 1SGTA 3GICB 1UTOA 3DT0H 3T29A 4DCDA 1T7CA 6GCHG 1O3OA 1W14U 5FPYA 2Z9KA 1IQGA 4JYTA 1EX3A 2A7JA 3MO3A 4FU7A 4K5ZA 3F9HA 2AIPA 1HGTH 4THNH 4TY7A 5ETXA 3GCHC 1C9TA 3OTJE 1AMHA 4IGDA 1C1NA 1NC6A 1KLJH 2BTCE 4XOJA 2R2WU 2BD8A 1UMAH 3MU5A 3UREA 3SGBE 4WXIA 2QCYA 1D4PB 1FN6A 2FLRH 3VB6A 4NCYA 1NFUA 1TOCB 4WMEA 2WUBA 3ZZ4A 1MCTA 4ABDA 4H42U 1VZQH 3M37A 1YLCA 2GCTC 1J15A 2CF8H 4DURA 1JXPA 5T6GA 5C1YA 1LHGH 3SOSA 3UNSA 1W12U 1IHTH 2SFAA 4CR9A 1Z7KA 2SGQE 1BA8B 2HVXA 2I6QA 1O5FH 4RKOB 1C5ZB 3ZVEA 1O2SA 1UTQA 3RXEA 3ZZ5A 1S84A 1FY1A 2FX4A 1TPSA 2OP9A 4WMFA 1GGDC 1SQTA 4CBOA 2AGIX 1HAHH 1WBGB 5FBIA 1ELVA 3QLPH 3OSYA 5AFZH 4PROA 1V2QT 3A8CA 1MU8B 1LHCH 3KQDA 2NU1E 1SLVB 2HNTC 1TX8A 2Z9GA 4HFPB 3RC5A 4CHAB 1AVGH 4XSKU 1QA7A 1BRAA 5AFYH 2AYWA 5EXMA 1QURH 4JK6A 2Z7FE 2BX4A 1TX6A 3U8RH 1CT0E 1SG8B 1OX1A 2VGCC 5E0HA 4X2WA 2PHBA 1SFIA 4Y8XA 1HXFH 4OS7A 4IW4E 2V3OH 5DP7A 5L6NH 4Z0KA 2Y82A 4JMYA 1E35B 1IQIA 1C5LH 1QQ4A 1F0TA 2A0QB 1GHXH 2A7CA 1DDJA 2IN2A 5DP6A 4ZXYH 4UFFH 3RXRA 1LDTT 4MDSA 4DGJA 3SNCA 4ABEA 1ZTKA 1Z6EA 1F0UA 2ANKH 1ELAA 2PGBB 3MU1A 1V2PT 3ZZDA 2A45B 3A83A 1CA0B 1UK2A 2JH6D 3A8BA 1YPLH 2D8WA 4ABAA 4ZKSU 1QB9A 2BDGA 1O35A 2RA3A 3MWIU 3GCTF 1SQOA 2P59A 3R0FA 2RG3A 4H6TA 1A1RA 4X8TH 1O3KA 4D7FA 4A6LA 1S85A 1AB9B 2FX6A 1XM1A 1QB1A 1GMDG 1QRZA 1D9IA 5DPAA 5HGGA 8KME2 1BHXF 3KQEA 2JETB 1MQ6A 2GZ7A 4IC6A 3DFLA 3T28A 1HBTH 1GVLA 1SGPE 2BMGB 4GCHG 1VJ9U 4Y0ZE 5T6DA 1HIAA 1OS8A 3ZVGA 3MU8A 4Q7XA 1SGIB 3KGPA 1TGTA 3ATWA 4KKDA 1AU8A 4D76A 2XNIA 1W7GH 1AUJA 1ELEE 1RTKA 2ZFSA 3E6PH 1AFQB 2JETC 1SHHB 2BLQA 4F4OC 1FI8A 1DFPA 3KNXA 3TJOA 1E34B 1C4V2 1SC8U 1OOKB 3U98H 5E0GA 2F9VA 1HAVB 3P95A 3AW1A 3GY3A 3LIWA 4CRCA 1T8LA 2VH0A 2XYAA 1C5MD 3FP8E 1FY4A 3PMAB 1O2XA 1BRBE 1YPEH 2V35A 1P12E 2UUFB 2G4UA 4XDEA 4DJZB 4K8BA 1GI2A 2ZWLH 2BD5A 3QZRA 1EASA 5GWZA 3KEEA 1AWFH 2C90B 2OLGA 4AB8A 5ABWA 1TMTH 2ZGJA 4UE7H 1DWDH 7KMEH 3STJA 1LQDB 4J1YA 3SORA 2PFEA 1RTFB 3NPSA 1AKSA 2FTMA 5A0AE 1WOFA 3HK3B 2DE9A 1OP8A 1SGDE 2B8OH 4AOQA 1PQ5A 2SGPE 3QUMP 3OYPA 5F6MA 3RDZA 3SV8A 1SGQE 2RDLA 1O34A 3A7ZA 1DWEH 2FS9A 1QTFA 4YT7H 4NSYA 4AG1A 2FOCA 2FI4E 1ETRH 5HM9A 1HAGE 2KAIB 2D1JA 3RMLH 1VJAU 4O3TA 2FOBA 1LVMA 1A5IA 3SN8A 4Y8YA 3M61U 4DG4A 3D65E 1YPHC 5TCCA 5SGAE 5L2YH 1UTLM 1ZMNA 3BV9B 1U6QA 2ZQ2A 2CV3A 5EG4A 2Z9LA 4BAQB 1TNGA 1S81A 1P05A 2BD4A 1BCUH 4RSPA 4ASHA 4JYVH 1EZUC 1GVKB 1ZZZA 1J14A 4NIWA 3QGJA 2IJOB 1G3BA 1MH0A 1NRRH 2P16A 2Y5HA 2V3HH 2Z3EA 3GY4A 4Q7ZA 3FP6E 3M5MA 5C3NA 4Y10E 2PKAB 3GY6A 1BTUA 4JCNA 1HNEE 2WPLS 1BTPA 2SGAA 1AZ8A 5JBTA 1HB0B 3P8OA 1SL3A 2Y6TA 1TPAE 1Z8GA 4TPIZ 1Z6JH 3HGNA 4K1EA 1T31A 2D26C 1GCTC 1C2JA 5C5NA 2GGVB 2BQ7B 1D3TB 3UR6A 1WV7H 1TX7A 1GDQA 2GVFA 3S9AA 1ANEA 1GCDA 1EOLA 3T5FH 1C5VA 3A80A 1Y3WA 1DOJA 2O8TA 3MH4A 3UTUH 1FIWA 2SNVA 2OCVB 5CE1A 2FIRH 4BOHA 2I6SA 1CT2E 1Y3YA 3SU2A 2J9NA 1BTXA 5GCHF 3SU1A 1E36B 4CH8B 1HJAC 1S6HA 3GY5A 1OWDA 1GHBF 3LGYA 4O3UA 4WH8A 3TK6A 1YC0A 3URCA 1O3BA 1HAPH 5K7RA 3BEFB 1KXAA 1XKAC 3RXGA 2OBOA 3PB1E 3K2UA 1MAYA 1C1OA 3RU4T 2A4RA 5IYTA 4ABIA 2ZO3H 1HXEH 3K9XB 2TIOA 2BVXH 1FAKH 3I29A 2P3UB 3SJ8A 2UUJB 1PPBH 1PQAA 1DANH 2NU4E 2O8MA 1MTSA 3PYHA 5GXPA 1A7SA 3M36A 2B0FA 4WY3A 2ZGCA 5FCKA 1F92A 1PQ7A 2AMPA 3U69H 2ZHQH 4AFUA 3UY9A 4YLQH 4A1XA 5F8ZA 2UUYA 1GMCF 5LGOA 3BTQE 1SHYA 2VNTA 1P01A 2GKVE 1K22H 2ANMH 1EQ9A 1MD8A 2PR3A 1SPJA 4UFEH 1BMAA 2ULLA 5I46H 4ABFA 4QT8C 1NN6A 4X8UH 4B74A 2BQWB 2OXSA 4GPGA 2ZNKH 5J4QA 5GPIB 1ZPZA 4JZIA 3TH2H 1JOUB 1UVPA 2WPKS 1PJPA 2PSYA 3M7QA 1GI9B 1L1NA 1O2LA 2A1DB 1QB6A 1PPGE 2GCHF 2W26A 5FHTA 1T4UH 2O8WA 1FAXA 1PPEE 1V2LT 1AN1E 1TNKA 4U01A 1C9PA 1KIGH 1D6WA 3LKWA 3URDA 4IS5A 1O30A 4DY7B 1KXCA 4Y0YE 1V2MT 2W3IA 3ODDA 1F5LA 4ZKNU 1EAWA 3SGAE 2A4QA 4RKJB 3BTFE 2GP9B 3RXBA 1VGCC 1CHOF 3E91A 1Y5UT 2UWLA 3RXHA 3SUFA 4SGBE 1ZPCA 4AYVB 7LPRA 4UEHH 5DGJA 3E1XB 1ZPBA 1SR5C 3KF2A 1Z8IB 3PM3A 1YPHE 1O3NA 1UJ1A 1MBQA 5C5OA 5LH8A 1HJ8A 2ASUB 4K60A 3SI3H 3RM2H 2BOHB 1BRUP 1EP5A 1KXFA 1GL0E 1UK4A 1W2KH 4ISIH 1CGIE 1JIMA 2O8UA 2ZFPH 3ZVFA 1HFDA 3M3SA 1GBEA 4TWWA 1O32A 1AD8H 3I78A 1BRCE 3GISB 1LVBA 4CR5A 1RXPA 4GVUA 2XBYA 3V0XA 1VCPA 1E38B 5J4SA 2HPPH 3F1SB 4UD9H 2EI6A 1C5SA 4A1VA 2Q6DA 1NPMA 2ZHWH 2SGEE 3ATMA 2ZDVH 3QGNB 3GDUA 2ZC9H 3L3TA 1BDAA 1PYTC 1T32A 1H1BA 3TJVA 5L2ZH 3TK5A 2H5DA 4I8JA 4ZHAA 4KP0A 1C5WB 1P09A 1TGCA 3SO3A 6LPRA 4K8YA 1XXDA 4XBBA 2VB0A 4AFZA 4MG3A 5DJ7A 3UQOA 1C1SA 4A1TA 3RMOH 2FOFA 4CRBA 1JWTA 3VB7A 5DP3A 1Z1JA 3RC4A 3F9GA 1F0SA 2BY9X 4JYUH 3RC6A 3P8FA 3EA8A 1XX9A 4Y7BA 1HDTH 1MTUA 3TIUA 3P6ZB 2AS9A 1N6XA 4B75A 3PWCA 1JRSA 1QJ7B 1NROH 1LPGB 4WF8A 2ZZUH 5CHAB 3PTNA 5A0BA 1GBBA 1CBWC 1CT4E 1QQUA 1QBOA 3MNXA 2A2QH 5PTPA 3RXKA 2QYIA 3V7TA 2ZGBH 1GJ4H 2FOEA 3LGVA 1SGNE 3V12A 7ESTE 2G4TA 4B2BA 3GCOA 1C2DA 3E0PB 5CHAC 4K69A 4Q80A 1EAIA 3U1JB 1OYTH 2WUCA 1Z8RA 3RXMA 1QRWA 3PLPA 2BDBA 1GG6B 4FVBA 2Y81A 3GYMA 2F91A 1WUNH 3GOVB 1SGYE 1TBZH 3D62A 2ALPA 1SGRE 2G5NA 4FU9A 2CJIA 2Y5FA 3R3GB 4FUBA 4U32A 4ZHMU 4AN7A 2OC7A 5GIBA 3A85A 4I32A 1L0ZA 5E0JA 1VITH 2ZFQH 4AFQA 1GG6C 3A7WA 1H9IE 2A5KA 2PLXA 1MKWH 2AGEX 4B73A 2Y80A 3RXAA 3PTBA 4LZ4B 1CU1A