3MNCA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. second stage of radiation damage
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mncA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mncA01
1HAXB 2FOAA 5JBBS 2FXRA 4X2WA 1ZTKA 2VIOA 2Y5FA 4X8TH 1ZYOA 3RXLA 1GVKB 1GL1A 1EKBB 3HPTB 6CHAC 3STIA 1E37B 3LU9B 2W26A 1GCTC 3RXKA 4ZKRU 3S0NA 2HWLB 3SN8A 1Y5BT 1TB6H 4NSVA 1BMMH 3EAJA 1OWDA 4UE7H 5AFZH 2EC9H 2H9TH 4CR9A 1GJ7B 1Y3WA 3ZZ6A 1TLDA 2ZQ1A 2CHAC 5DPAA 2QV1A 2OC0A 1LTOA 2XBVA 1O2SA 4BAHB 2OC8A 2W5EA 1UTPA 1GVZA 2W3KA 2XYAA 4YLUA 2GZ9A 4XE4A 1TMUH 1ZPCA 5C2ZA 2Y7XA 4ZMAH 4ISNA 2B0FA 2VWMA 1OWEA 1WU1A 3PMAB 3MO3A 1RTLA 4NZQA 4MLFB 1C2JA 1MD7A 1T8NA 2PTCE 4ASHA 2CMYA 2D1JA 3VPKA 8GCHG 3F9HA 1MD8A 4X1SU 1O3EA 1SGDE 2H1UA 2XTTB 4B71A 2ZFSA 1FY3A 4BAQB 2BQWB 1BTPA 4B2BA 4CRGA 4CRBA 4ZH8A 1VGCC 2Y81A 4Y8YA 1CU1A 2ZDAH 1IOEA 3V7TA 1SGRE 3KNXA 1C5TA 2ZU4A 1BUIA 3QUMP 1YP9A 1UCYE 1XUGA 5GJ4B 2VVUA 5I46H 1DWBH 2C90B 4ISOA 1EAIA 1HUTH 4AFUA 1TX8A 2EI7A 1PPEE 1BHXB 3E91A 4X6OA 1ZSLA 2BY6X 2I6SA 2BM2A 1TBZH 4KKDA 5LPFA 3TJVA 2ASUB 2YNBA 2XC0A 2B8OH 4LZ4B 1Z1IA 3QX5H 1D9IA 1FIZA 1V2TT 4ISIH 1HB0B 7KMEH 5TJXA 1GMHF 1GHAG 2VJ1A 2PKSB 3PTNA 1QBOA 1O2ZA 5ESBA 1G36A 1C5RA 3F9EA 1OXGA 3A85A 3KEEA 5K0HA 3UQVA 6GCHF 3I29A 1HV7A 3SHCH 4GCHG 1ANBA 1B0EA 2FOCA 4X1RU 1D3TB 1MKWH 1XKAC 3ESTA 2OD3B 1MTVA 2ZWLH 4JZEH 1DLKB 1O3MA 3LDXH 4YT6H 3HK3B 1WQVH 3A7VA 3SUEA 5FPSA 2Y6TA 1SBWA 2NU2E 2QAAA 3PMHB 3ZZ8A 3ATLA 2F3CE 3MFJA 4K60A 1Y3VA 2B9LA 1W14U 1GI0A 1LQEA 1F2SE 3TH4H 3BV9B 3MU5A 4WH6A 3MH4A 4YLQH 1O2MA 3QK1A 3BIVH 3A7XA 1K1OA 1MCVA 2FIRH 2O8TA 3GDVA 1OWKA 1H9LB 3V12A 1HNEE 1ZPZA 3B8JA 1EZSC 5HXFA 3RU4E 3GICB 1OWHA 4YTAA 3F9FA 1IQIA 1HIAB 1UO6A 1AHTH 4U30A 1PPBH 1T8OA 4UFDH 2J95A 2HOBA 3T28A 1KTSB 6LPRA 3RXDA 3L3TA 3GCTG 4JMYA 4ABGA 2WINI 2ZG0H 4OS4A 5FBIA 4DT7B 2PSYA 2ZFRH 2XNIA 2GCHG 4H6SB 3HK6B 4GSOA 5C67A 1O2QA 2Q6GA 3ZVEA 3RC5A 1GI3A 1AQ7A 4MDSA 3A8CA 3U8OH 5L6NH 3M36A 4HGCA 2NWNA 1DT2A 1P3EA 3IWMA 4BAMB 3VB6A 5LGOA 2TGDA 5EODA 1LPZB 1O2XA 5ETXA 1QBNA 1QJ1B 2ZU2A 1C5ZB 2XC5A 2V35A 5C1YA 1AY6H 1BRUP 1LDTT 1P02A 4A1XA 3P8FA 1MAXA 1O2JA 1C5LH 3BG8A 1SLWB 3T26A 4ZUHA 1XUHA 5I25A 1P12E 2XCNA 3QZQA 1H8IH 3SGBE 3SUFA 1FZZA 1TGTA 4A92A 5JPMH 1A4WH 1ACBE 1FUJA 5TCAA 1P2JA 2Y5GA 1S0QA 1B7XB 1SLVB 4U2WA 4TPIZ 2PKAB 2SGFE 4MNWA 4MNYA 3BTQE 1N8OB 2AYWA 1AVGH 1CBWC 8LPRA 4CHAC 1Y3XA 2FOMB 3LT3A 1MMJN 1OYTH 5JBCS 1FNIA 3BTKE 4Z6AH 1AE8H 1Y5AT 2SGEE 3MI4A 5C5NA 3RLYH 3A7TA 4ZKNU 4AG2A 2XBWA 1L2EA 2ZI2H 1QQUA 4IC6A 5C1UA 2GX4A 2PKSC 1QIXB 4FVDA 1MTUA 1SC8U 1AU8A 1DLEA 2BD9A 3UR6A 2A5AA 1MQ5A 1VCWA 4XOJA 3T5FH 2GDDA 2ODQA 3QDZB 5E0JA 1IQFA 1P10A 3P8GA 4H4FA 5FBEA 3BTGE 4JCNA 1EB1H 1C2IA 3BIUH 2ZKSA 2FI3E 1PQ8A 1GGDC 5EG4A 5T6GA 1J15A 1O3LA 1DY9A 2BOHB 1GMDF 3HGNA 4YOGA 3E90B 1CGHA 1WBGB 4NWKA 1T4UH 3QWCH 2FLRH 4SGBE 1MCTA 1ELAA 1EAXA 1YLDA 4GLYA 1KXDA 1AB9C 1LKAA 1O3DA 1DXWA 1M9UA 2QXGA 4IC5A 3UFAA 1EPTA 2HALA 1FY4A 3T29A 3TNSA 4E05H 3VXEH 3M3SA 1SHYA 1ABIH 4WMEA 4CH2B 1BTUA 2Y82A 3ZVCA 1A7SA 1FPHH 1CVWH 1E34B 1C5PA 3TNTA 1JOUB 1OS8A 1A2CH 1HXEH 5JDUB 3HATH 1O2PA 2BDAA 1RIWB 3TGJE 1BMLA 1O3PB 2VU8E 2BD2A 4ZHLU 2UUYA 1TAWA 3LH1A 1C1TA 3O8BA 3BEUA 4LZ1H 3U1IB 2A4GA 1GHWH 2ZCKP 3VFEA 4VGCC 1C2FA 4UD9H 2VINA 2NU0E 1NM6A 1O3AA 2OXSA 3SGAE 1DOJA 1HCGA 1W13U 4I8KA 5EPYA 1TNIA 1BBRH 1P2QA 2Z6BD 4Y8XA 1XKBC 1TQ0B 3D62A 2WUCA 3VB4A 4ABIA 3ATIA 1Y3UA 2GDEH 4ABJA 2AERH 2ZEBA 1LVOA 2BDGA 3P8NA 1C1VH 1EPTC 5F6MA 3I78A 4ZROA 4R8TB 1ZR0A 2A0QB 1LQDB 2TGPZ 4DCDA 1HJ8A 2QYIA 1VITG 2C4FH 4I32A 1SGCA 2DE8A 1JMOH 4X6PA 3RXQA 1BTZA 5L30H 1GBBA 2GMTC 2QY0B 4AYYB 1SQTA 2BOKA 3ZZ7A 5J4QA 8ESTE 2J94A 3RMNH 1L1JA 1DE7H 1HAIH 1ZMJA 1MZDA 1GMCF 2YNAA 2CN0H 1ELCA 3D23A 1L4ZA 1W0ZU 4DY7B 4Y0YE 3OU0A 2VIWA 3P92A 3FP7E 3AAVA 2VVCA 3A86A 1NS3A 5C3NA 1AFQC 1GJ5H 1O31A 3MO6A 2A45B 3M7TA 2BVRH 3RXTA 4I31A 2ZPQA 1ZGIA 4ZKOU 1YPHC 5JB8S 4XBCA 1GHBF 3KGPA 4I33A 4BANB 2XBXA 2R0LA 4AB9A 3QGJA 1ANCA 2BQ7B 3ZZCA 2BDYA 3VEQB 3LC3A 2BMGB 1ARBA 1EAWA 4R0IA 1AUJA 4NIXA 1N6YA 2VVVA 2ZU1A 1W7XH 1GBIA 1UVOA 2GV7A 1THPB 2R3YA 3K9XB 1GHVH 4UFFH 3U1JB 1MH0A 3DUXH 2HNTC 1JWTA 2BD5A 3SJOA 1BBRE 1K1JA 1Q2WA 1C2EA 1CGIE 2ZTXA 1EP6A 2C3SA 1K1NA 1EXFA 4Y79A 2FI4E 1MKXH 2CJIA 4AN7A 3B23B 3UNSA 4JK6A 1WTGH 2RCEA 1ELGA 2FDAA 2WPJS 2A31A 1XX9A 1PYTD 1QA7A 5HM2A 2ANYA 3KCGH 1HAZB 1BB0B 5DGJA 2IN2A 2CHAB 4B2CA 1ELBA 1GBKA 3LGVA 3RXIA 3RUOA 5T6FA 1WAYB 1A3BH 1O2HA 4B75A 4I8HA 1HPGA 1SGEE 1MTSA 1DSUA 3RXSA 2FX6A 1TRNA 1QQ4A 1DS2E 3NWUA 1TGSZ 2ODYB 2ZQ2A 3WY8A 3SV9A 2GP9B 4NA7A 2V6NA 1ELDE 2VWOA 4CRDA 3ZV8A 4WMDA 1A0JA 2ZIQH 1AO5A 1QB9A 1GDQA 4NIVA 4KTSA 2BD4A 4NWLA 4NIWA 2XRCA 4FU7A 1P2MA 1IQHA 1K1PA 1SLUB 2PTNA 1OOKB 3LC5A 5E0GA 1ELFA 2ZFQH 1UVUH 3SUDA 3ZV9A 3L33A 1P04A 2QF0A 1P9UA 4ESTE 2ZHQH 1AMHA 1V2LT 3ENSB 1V2UT 3RMLH 1NRNH 5CE1A 1DPOA 3CENA 4ZXYH 1GDNA 2Z3EA 1VR1H 3LGYA 2H5DA 5EPNA 3LKWA 2BLWA 1DANH 1BA8B 1NRPH 1TQ7B 4XDEA 4Y11E 1EP5A 3M5OA 4AFQA 3UTUH 1GHBG 1WV7H 1KYNA 1QJ6B 1W8BH 2Y80A 3RXCA 1UMAH 4H42U 3RDZA 3VGCC 1QTFA 4OS5A 1YKTA 2ANWA 3NPSA 1TX7A 3QLPH 1O33A 3SJIA 4Y6DA 1KLTA 1C2DA 1ZJDA 2BLVA 2G8TA 2A1DB 1V2QT 1UCYH 3K65B 2BB4A 2FPZA 4ABBA 1C2KA 1DVAH 3L6PA 3RXMA 3SU4A 1N1LA 3JZ1B 3QGNB 2O8MA 5DP7A 3PYHA 3RXUA 2OBOA 7LPRA 4YZUA 1OX1A 1MBMA 3B9FH 5IDKA 1A5GH 1XXFA 2OTVA 4K5ZA 4K2YA 2VGCC 1V2NT 2A5KA 3CS0A 4E06H 3RC4A 1V6DA 3U8RH 3C1KA 4X6NA 1HAOH 4GPGA 1OWIA 2Z7FE 1HAGE 3AW1A 1HLTH 4WH8A 2P94A 3S7HB 4H6TA 2QC2A 1P3CA 3RM0H 3ATKA 3GCHC 4Q2KA 1WOFA 4O97A 1LHEH 3UWJH 3T27A 4MG3A 1LHGH 2PLXA 1FDPA 1GCDA 2A5IA 2XWBI 1V2RT 1UHBA 2JETC 5GCHG 2ZCLP 1TNLA 4YOIA 1A0HB 1EZUC 1SGIB 1D3QB 5ESTE 1C1QA 3SO3A 4K3JA 2BY7X 5FX6A 2WYJA 2UWPA 2M5TA 3RM2H 1J14A 1YC0A 4DVAU 1B0FA 1YCPH 3FAOA 1FAXA 2G55A 3RXBA 3GDUA 4NG9H 2Z3CA 3TH2H 1QRXA 3P17H 1GBEA 1O34A 3IG6B 4WY3A 3KF2A 4QT8C 3PMJA 1FIWA 4HTCH 5EQRA 2O8WA 3HGPA 3MNSA 1AUTC 4IW4E 1HJAC 4THNH 4XBBA 2AEIH 2F9PA 1CSOE 4MPUA 1EOLA 4BTTB 4AOQA 2STBE 3A84A 9LPRA 1YPEH 3LJJA 3PV4A 3RLWH 1RD3B 1EASA 1ZZZA 4RN6A 4Y8ZA 1L1GA 3SGQE 2RA0A 1CBWB 4CHAB 2CF8H 5DKMA 1C1OA 4ABAA 2ZDMA 2FODA 2JH6D 1UTOA 2W3IA 1LKBA 1KY9A 3LGIA 3GYMA 2ILNA 5F8ZA 1K1LA 1Z6EA 2IPHA 3MNXA 5EQSA 1P06A 2GTBA 1ELEE 3A7ZA 3PM3A 1XMNB 1TX6A 3PTBA 4RKOB 1AFEH 4UFEH 1EX3A 3NXPA 2KAIA 4Q80A 2SNVA 4X1NU 1V2ST 1O39A 2XWAA 1C5XB 1DITH 3GY5A 4J2YB 2ZGHA 3RU4T 3QZRA 2ZZUH 1ZMLA 1GGDB 3FP8E 4DGJA 5AHGH 3N7OA 1IHTH 1YCPM 2NU3E 2WUBA 1ESBA 1K2I1 2SGDE 9ESTA 1O2IA 2OINA 1MTWA 2AGGX 1ESAA 3A7WA 4IBLH 2P3UB 3F68H 3GY3A 1AZ8A 1ZMNA 3DA9B 3KL6A 1GI9B 1O2OA 3GDSA 4K8BA 4ABDA 1KIGH 2ZDKA 5A2MH 3MU8A 1KXEA 3PMBB 3HKIB 3GY7A 4GAWA 1XUIA 1CA8B 2J38A 3CS7A 1GBAA 5DP4A 1AB9B 4IS5A 3NKKA 1QL7A 2D26C 1GI4A 3E0PB 3FZDA 3A80A 3URCA 1C1WH 2WPHS 1C2MA 1W7GH 2P16A 2FOFA 1CO7E 1GDUA 2G00A 4OS2A 2J4IA 2J34A 1AGJA 1DWEH 2OBQA 3H7TA 4TY6A 3TJNA 1BT7A 1CQQA 1UVTH 1QRWA 1CA0C 1FQ3A 2ZP0H 3KQDA 1ZJKA 1HDTH 2BDIA 3C27B 4WVPE 2ZFPH 2A2QH 4J1YA 1CT0E 4VGCB 1O2RA 2BHGA 1AWHB 1VZQH 1V2JT 1NO9H 1NFYA 3BEIB 1IQLA 1O38A 3ITIA 4AB8A 1GPZA 1RGQA 2B5TB 1SL3A 4Y10E 1QGFA 1A61H 2XCFA 5C5OA 1BMNH 5DO4H 1RFNA 1SFIA 2XC4A 4GUXA 3SJ9A 1EPTB 2H6MA 1TWXB 3BTFE 4F49A 1ARCA 4ISLA 3BSQA 1LPKB 3A88A 5FPYA 4CREA 1AD8H 2ZGBH 3M3TA 3E8LA 4O3UA 4OS7A 3UPEA 1S84A 2Z9KA 1KSNA 2GMTB 4Z0KA 1WTHD 4RKJB 1P8VC 1GWAA 3TH3H 3TIUA 3TLOA 1O2LA 2BQ6B 2BVXH 1SR5C 1V2MT 2FYRA 5IYTA 1GMHG 1TNJA 1T7CA 3RP2A 3A8AA 3SI4H 5CHAC 1C5MD 2AGIX 5L2YH 1AFQB 6GCHG 5JBAS 2ZPSA 2P95A 1O3FA 1PFXC 4ABEA 1SOTA 4X2VA 3QN7A 2O9QA 4AGJA 1MKWK 1MTNC 2AS9A 4ZHMU 1UTKA 1TGNA 3KIDU 4MPWA 2TRMA 3SV2H 1TE0A 2BDHA 4JZIA 4JZ1A 1GI5A 1XUKA 1Z6JH 3SORA 3MH5A 2DUCA 3SNAA 2TGAA 2VH0A 3S9BA 3M7QA 1VJ9U 2FYQA 4OS6A 3FFGA 2WPLS 3TJOA 5A0CA 1ZRBA 2C93B 2XW9A 3V3MA 3BTTE 3OTJE 1KXFA 1BHXF 4AYVB 2VNTA 3UWIA 1BIOA 1CHGA 4UONA 1P2NA 1O5GH 1DX5M 3RXJA 4YESB 3KN2A 1TPOA 5JYIA 2FP7B 2XXLA 1QY6A 3VB3A 5BRRE 1LHCH 1CE5A 1Z7KA 4X8UH 1BTHH 1GJBB 2GZ8A 1TALA 2VIPA 1A5HA 1J16A 3SZNA 2FLBH 1O3KA 1MBQA 1G2MA 3PO1C 4RSPA 7ESTE 1RXPA 5L2ZH 1PQ5A 2BX3A 1C1UH 4YO9A 4A5TS 1UK3A 1KLJH 5TCCA 3M5LA 3MYWA 1PPFE 1G3BA 1TPAE 3G01A 3SHAH 1QNJA 1AN1E 3BF6H 1GG6C 1GI2A 2CF9H 3AVZA 1GJ9B 2ZHEH 1T8MA 1P03A 1C5UA 2CV3A 1ETRH 5LPRA 4KGAA 1UJ1A 4FUBA 2Z3DA 1HYLA 2YOLA 3EA9A 2PWXA 4GVUA 1P0SH 1NT1A 3Q3KA 3Q77A 2R3UA 2A4QA 3SJKA 1ORFA 1G3CA 3F1SB 3DHKH 3PWCA 5F8XA 1P2KA 4OGYA 4TYDA 1OP2A 4CRFA 1KLIH 1W3CA 4I8LA 3RC6A 1BTWA 1C4U2 2GVFA 4WF8A 3T2NA 4WMFA 5A8ZA 2GT8A 2W7SA 3ATWA 3K6YA 1YBWA 1EZQA 4INKA 1OP8A 2TBSA 1UTLM 3GCOA 1NROH 3TU7H 3NZIA 1NTPA 1FY1A 1O0DH 1CHOF 1G32B 1O3OA 1V2VT 1V2OT 3U8TH 4JK5A 1V2KT 3GCNA 1C1NA 1SOZA 4BAOB 1MQ6A 5E0HA 4MNVA 1G3DA 3RXFA 3ZVFA 3PROA 2R0KA 2Q6DA 1YPGH 2BDBA 4WJG2 3VGCB 1BTYA 4IN2A 1GI6A 7GCHF 4FXGH 5AF9H 4JYTA 3SJ8A 1O3CA 3KQEA 1F0TA 1BMAA 1GMDG 1O37A 2P3FH 1GBJA 1UK2A 1O5EH 3SOSA 2G4TA 5AVDA 2FS8A 3RXOA 3UY9A 1FI8A 2ZC9H 2P3TB 1OYQA 3I77A 5DP9A 1O3NA 4K69A 5DP3A 1O5FH 2HPQH 1Z8IB 1PPHE 3OX7U 1S6FA 1SVPA 1LHDH 3DT0H 3GY8A 4K1SA 1O2GH 2GT7A 3TGIE 2P93A 2FZZA 3T62A 3A83A 3M3VA 1SQAA 1C1RA 4NA9H 2VGCB 5DK1A 3SU3A 3TK5A 1ZGVA 1Y8TA 4AX9H 1F7ZA 3Q3YA 3RXPA 1LO6A 2H5CA 2A7HA 1YGCH 1SGTA 1E38B 3ZVGA 1DUAA 3MH6A 4OS1A 1VJAU 3U69H 2J92A 3UR9A 3DFLA 1UTJA 2DE9A 1ZSJA 4ZXXH 5E8EH 4KP0A 2ZTZA 3GCHB 4E7NA 1Y5UT 1C1SA 2A7JA 4IGDA 5GIBA 2EA3A 1BBRK 1EUFA 2Z9GA 1QBVH 2JETB 3SUGA 3UOUA 2VWLA 2HLCA 4ISHH 1RTFB 1YF4A 1THRH 1GI1A 3ZYEA 3SQEE 3V0XA 1GHXH 2OLGA 5DJ7A 5ABWA 1HAPH 1IQJA 1TOCB 2XBYA 1PPGE 2OCVB 3SBKA 3EDXB 5T6DA 1VCQA 1Y59T 2G5NA 1D3DB 4DW2U 1OKXA 1K9OE 4Y0ZE 2O8UA 3LPRA 5K7RA 2STAE 5EU8A 2ZECA 3PLKA 1BRCE 1GMCG 4HFPB 4DIHH 1T31A 1OSSA 1GHZA 1SGPE 4NFFA 1DM4B 1HJAB 4X1PU 2JH0D 1TNHA 2G51A 2H9HA 3KHVA 4K1TA 3D49H 3RXVA 3ZZ3A 4MPVA 1E0FD 1AIXH 4MTBA 4CBOA 2OQUA 1UHBB 2ZHWH 3E16B 1GBDA 1H8DH 2FS9A 3S69A 1SQOA 8GCHF 2F91A 1TABE 3SV8A 3ZZ4A 1F0RA 2WPIS 1DFPA 4A6LA 1DDJA 4INLA 1L4DA 4TWYA 5FHTA 3UREA 3P8OA 1C5VA 1XXDA 2J2UA 2GCTB 2R2WU 4CH8B 2QXHA 1D6RA 5HGGA 1AVXA 1NRRH 2Y5HA 2UWLA 5FXLA 2VH6A 3IITA 4CBNA 1TBRH 1IQMA 3STJA 1FXYA 2JH5D 1UVPA 1KDQA 1LVBA 1O3GA 2AMPA 2BYAX 3F9GA 5PTPA 1TA6A 1MKXK 1W12U 1C5SA 2CXVA 1HJ9A 3LONA 4A7IB 2IJOB 2HPPH 4MQAA 1YPKH 2OUAA 3KQBA 1ANEA 4NZLA 1F5RA 1K28D 1Y3YA 3KQCA 3MOCA 3BTWE 3Q76A 3UUZA 4YM9A 3JZ2B 2ZF0H 2BZ6H 1Z8GA 1TONA 2JKHA 1U6QA 1Q31A 5E2OA 3MHWU 2ZA5A 1O3IA 2SGPE 3NCLA 3SU2A 3HKJB 1NU7B 5DP8A 3GY4A 1P11E 2KAIB 1ZLRA 2B7DH 4GCHF 5FPTA 1C1PA 1SMFE 2QN5T 1WUNH 3RU4D 1QB6A 1SGQE 4X2YA 1AKSB 1A0LA 1EB2A 1CA0B 2BTCE 2OQ5A 1LCYA 2BXTH 3AAUA 3LGTA 4XBDA 1RRKA 2OP9A 4HI3A 2VWNA 3URDA 4BOHA 3UQOA 4FUCA 1F92A 2FX4A 2HNTE 1S85A 1TMBH 3A7YA 3H5CB 1F5LA 1WQSA 1JIRA 2P8OC 1LVMA 2ALVA 2HRVA 4X8SH 1XUJA 1ZTJA 3GOVB 1BZXE 1DXPA 2FMJA 5LH8A 2FI5E 4F4OC 2UUFB 1GL0E 1G30B 3GCTF 1NN6A 1C9TA 1JRSA 1UTQA 1XVOA 3A8DA 4Y7BA 1L1NA 4WXVA 1TFXA 3BG4B 2FOHA 2ZFTA 4FVBA 1TA2A 2AMDA 2Q6FA 4DOQA 2GCHF 2F9BH 3ZVDA 1IHSH 2FESH 3OY6U 2BDCA 3AASA 1JIMA 3E0NB 5A0BA 2PGQB 3W94A 1FJSA 1ABJH 5CHAB 1GJ4H 4K1EA 2QCYA 1EATA 2ZU3A 1LVYA 3ODDA 5T3HA 1J17T 1SHHB 1G3EA 3CP7A 4U32A 1FLEE 1PPZA 1P09A 3MNBA 1MTNB 1TNKA 2AH4X 2R2MB 1H9HE 1B5GH 1HFDA 1D3PB 1SPJA 1UCYK 2H9EH 3ELAH 3ATMA 1BCUH 4D8NA 4NCYA 5FX5A 1C1MA 1EJAA 1V2WT 1KXBA 3E3TA 1OP0A 4GHQA 1GBTA 2GCTC 2ZCHP 4BTUB 1AKSA 1BTXA 3TK9A 4YT7H 1TBQH 3UOPA 1A3EH 1V2PT 1WYKA 1QURH 4AFZA 3MU1A 1O2KA 4FUHA 4A1VA 2UUKB 5FCRA 5DP6A 1TRMA 2TPIZ 2A2XH 2QGRA 5EQQA 3RXEA 3SI3H 5GPIB 3ZZBA 1F0UA 3SU1A 4YOJA 1N6XA 2ANMH 2BY8X 1JRTA 2WPMS 3RMMH 4ZHAA 1AVWA 4FU8A 2PW8H 3M5MA 3ZZAA 1E35B 1Z71A 3GISB 1QCPA 3MMGA 2BY9X 2K1QA 2PR3A 3EA8A 2AIQA 1IQGA 1YPJH 3GY2A 3PO1B 1SGNE 2PV9B 1P05A 3PLPA 5AFYH 1FPCH 1QL8A 2FM2A 1P01A 1VCPA 1CT2E 5GDSH 3UNQA 1MUEB 5CMXH 3F6UH 1JBUH 1FV9A 3D65E 3ZZ9A 2FOGA 1XVMA 1S6HA 1NRSH 2H2ZA 5SGAE 1GG6B 1TGBA 1XM1A 3ZVBA 1O3JA 1YCPK 5EXLA 1RJXB 3SU5A 4JZDH 1NC6A 3QTOH 1MU8B 2FTMA 3O8RA 1TYNA 1HXFH 1GJ6A 1GI8B 1TOMH 4SGAE 1G2LA 2BXUH 3ODFA 4DG4A 3Q3XA 4D9QA 4Q7XA 1DY8A 1EZXC 4LXBH 2RG3A 3O8DA 4NFEA 1C2HA 1H1BA 3ZVAA 1D6WA 3BN9A 2PSXA 2UUJB 1ZSKA 3OY5U 1O2VA 3M37A 2QIQA 1C9PA 3S9AA 4B1TA 2ZNKH 4CR5A 2ZDNA 3MWIU 1T32A 3OYPA 3BG4C 4D9RA 1O2UA 1EOJA 3M5NA 1GBHA 1YPMH 2EEKA 1QHRB 1IQKA 1P57B 1YM0A 2ZTYA 2NU1E 1IAUA 1QR3E 1SI5H 3TITA 3LGUA 4I8GA 4AG1A 3ZYDA 5FAHA 4IMZA 2FOBA 2QXIA 4M7GA 3SW2B 1F5KU 3TK6A 3SQHE 1C4V2 4TPYA 1KTTB 5A0AE 1V3XA 1TPSA 1F0SA 2BVSH 4NA8A 4ZAEA 5GWZA 1FY5A 1AE5A 2G4UA 5A8YA 1VITF 3LJOA 3BTHE 1S0RA 3QTVH 3EQ0H 5HM9A 5JBTA 1W11U 4I8JA 2A4OA 2FEQH 1YYY1 2PUXB 1EJNA 1SLXB 5C20A 2W7UA 5A09A 1QFKH 2Z9JA 2Y7ZA 3NUMA 2SGAA 4FUGA 4Q7ZA 2V3HH 5EXMA 4I7YH 4UEHH 3PLBA 3A89A 3R0FA 2WPKS 1HIAA 5BPEA 4Y7AA 1S83A 4E7RG 1NESE 3O8CA 4FUEA 2Q1JA 1INCA 1ELVA 4WXIA 1UTMA 5H4IB 4B2AA 1YPLH 4IN1A 2ZGJA 3FANA 4K8YA 1QA0A 2A4RA 1O35A 1TIOA 1K22H 1SGFA 1VITH 2HVXA 3LGWA 3RXHA 3SV7A 3SU0A 3DFJA 1SSXA 1JXPA 1EAUA 1O3BA 4AZ2B 2SNWA 2ZU5A 5EGMA 5FCKA 4ABFA 1YLCA 3GY6A 3VXFH 1P2IA 2GKVE 1AWFH 1TGCA 3ZZDA 4MVNA 1BRAA 5DG6A 4X6MA 3SNCA 1ZPBA 1BJUA 4PROA 2EI6A 1W0YH 4ZKSU 3W95A 3RXGA 4WWYA 4FUFA 3Q00A 4MNXA 1TRYA 3LOXA 3BTME 2IOTA 4U01A 2C8ZB 2ZO3H 1LMWB 1BRBE 1KXAA 2HGTH 4B74A 2GV6A 2R9PA 1P2OA 2AFQB 1C4Y2 1DWCH 1FAKH 1S82A 4NIYA 1NZQH 1MZAA 2ODPA 2ZGCA 1THSH 1DSTA 4X8VH 4XSKU 3SNDA 1ETSH 2CGAA 1HGTH 2PKAA 1BITA 1O5AB 3TPIZ 1GJAB 1UVSH 1A5IA 2BD8A 1NFWA 1PPCE 1NRQH 5LPEA 1ZHRA 2NU4E 1FONA 3E6PH 2PUQH 2UWOA 2G81E 4BTIB 5C1XA 1O2YA 1WSSH 2F9NA 1S81A 4KTCA 3S7KB 4AGKA 2G5VA 2RDLA 4OGXA 5F8TA 1HAVB 2O8LA 1FN8A 2ANKH 4KELA 2SGQE 3MH7A 4CRCA 1G37A 3EA7A 3EYDA 2AIPA 1G9IE 4JYUH 4Y71A 3E1XB 4FUJA 3A82A 1O5BB 1ID5H 3MU0A 1QJ7B 2ZDVH 1MU6B 5EXNA 5HYOA 2BLOA 3P95A 1C2GA 3K2UA 1IQEA 8KME2 2Z9IA 4DURA 3FVFB 1ESTA 3NK8A 3P70B 3A81A 3R3GB 2TIOA 3RMOH 1UK4A 1C5QA 3MTYA 4D7FA 3K6ZA 2F83A 3M61U 5B6OA 1N8OC 2FO9A 3EGKH 1BOQA 3VB5A 1Z8JB 1D4PB 1WCZA 4O3TA 1GJDB 2ZHDA 1C2LA 1Z1JA 1PJPA 3TJUA 1C5NH 3M35A 1FMGA 1O2WA 5EW1H 1ETTH 4BNRA 1SGYE 5G4BA 3U98H 3SNEA 3A87A 1DUEA 2PGBB 3MU4A 5EW2H 4HZHA 2LPRA 3BTEE 2OC1A 3H7OA 4TWWA 1HAYB 4FUDA 4KTUA 4BXWA 1A1RA 2LNCA 1NFXA 1RTKA 1GJCB 3FP6E 1K1MA 4TY7A 1GJ8B 2ALPA 4FU9A 4X0WU 3S9CA 1J8AA 3TGKE 2FWWA 1SFQB 1T8LA 4X2XA 1TMTH 5DP5A 4BXSA 1O2TA 3OSYA 1QRZA 1RS0A 1TNGA 1PYTC 2A32A 2WV5A 4JZFH 1O2NA 2BY5X 1NY22 1BQYA 1HAHH 2EI8A 1H9IE 3M7UA 3PWBA 2A7CA 1IQNA 1C5OH 1K21H 1O3HA 1SG8B 2Z94A 5E2PA 6CHAB 1CGJE 4AORA 3AW0A 1GVLA 3RXRA 1GBMA 1GCTB 1KDQB 5J4SA 1O5CB 1NFUA 1HAVA 4LOYH 4AFSA 1ANDA 2GGVB 1EQ9A 4ABHA 2D2DA 1CT4E 1O5DH 1A46H 1L0ZA 1HRTH 2P8OB 5EOKA 2V3OH 2HNTF 1MAYA 1DWDH 4XFQA 3SV6A 4CRAA 4GHTA 3V13A 2TGTA 4Q7YA 1RIWC 4JYVH 1TPPA 2P59A 4NSYA 1Q3XA 1BJVA 2FOEA 2ZDLA 1SB1H 1HBTH 3FZZA 4O9VA 3EE0B 3TVJB 1NPMA 1ZTLA 1UTNA 3BEFB 1GHYH 1SGFG 2D8WA 1ZRKA 1CHOG 1KXCA 2BD7A 4UFGH 1O30A 1T4VH 1ELTA 2PHBA 1H4WA 2ZPRA 4O03A 3DD2H 3RXAA 1NU9A 5GCHF 3UNRA 2C8XB 1LPGB 2SFAA 3VB7A 1J9CH 3QO6A 1AZZA 1VGCB 2Z9LA 1GBCA 2ESTE 4DIIH 1ZHMA 7GCHG 5HMAA 1ZHPA 4B76A 2J9NA 1C5YB 3SU6A 2OC7A 2QA9E 2PFEA 4D76A 4UDWH 5GXPA 2VIQA 5A8XA 1W10U 2V0BA 2GZ7A 1PQ7A 2C8YB 1PQAA 1XUFA 1P9SA 3PB1E 1Z8RA 2GD4B 4BAKB 1O36A 1X7AC 2BX4A 1QB1A 2THFB 3MNCA 4A1TA 2ULLA 1GBLA 1FN6A 1O32A 2I6QA 4DJZB 1AI8H 2VIDA 3U9AH 5JB9S 1E36B 2VIVA 2F9OA 2RA3A 2WYGA 2C8WB 3T25A 1W2KH 1K1IA 3BTDE 4LK4A 2G52A 2VB0A 3GYLB 5F03A 2F9UA 3SNBA 4MPXA 1GBFA 3ZZ5A 3LH3A 1OPHB 2WV4A 2FTLE 4NGAH 2AGEX 6ESTA 3MO9A 2QXJA 1EJMA 1LHFH 2BLQA 3LIWA 2ZFFH 1OWJA 1FY8E 1DICA 3A8BA 4B73A 4X1QU 1GI7B 1GHAF 2F9VA 3P6ZB 3UIRA 4Y76A 2QF3A 1S5SA 1BDAA 1ZOMA 4FUIA 4D7GA 1YPHE 4INHA 4IMQA 1QL9A 2BD3A 2BZAA 2ZGXH 2AMQA 1C5WB 2ZHFH
chains in the Genus database with same CATH superfamily
1HAXB 2FOAA 5JBBS 2FXRA 4X2WA 1ZTKA 2VIOA 2Y5FA 4X8TH 1ZYOA 3F2GA 3N7DA 3RXLA 1GVKB 1GL1A 1EKBB 3HPTB 5EIYA 6CHAC 4I86A 2GJGA 3STIA 1E37B 3LU9B 2W26A 1GCTC 3RXKA 4TSFD 4ZKRU 3S0NA 2HWLB 2V3MA 3SN8A 1Y5BT 1TB6H 4NSVA 1BMMH 3EAJA 1OWDA 4UE7H 5AFZH 1MABB 2EC9H 2H9TH 4CR9A 2WPDD 1GJ7B 1Y3WA 4P00A 3ZZ6A 1TLDA 2ZQ1A 2CHAC 5DPAA 2QV1A 2OC0A 1LTOA 2XBVA 1O2SA 4BAHB 2OC8A 2W5EA 1UTPA 1GVZA 2W3KA 2XYAA 4YLUA 2GZ9A 4XE4A 1TMUH 1ZPCA 5C2ZA 2Y7XA 4ZMAH 4ISNA 2B0FA 2VWMA 1OWEA 1WU1A 3PMAB 3MO3A 1RTLA 4NZQA 5T1VA 4MLFB 1C2JA 1MD7A 1T8NA 2PTCE 4ASHA 2CMYA 2D1JA 3VPKA 8GCHG 3F9HA 1MD8A 4X1SU 1O3EA 1SGDE 2H1UA 2XTTB 4B71A 1H8HD 2ZFSA 1FY3A 4BAQB 2BQWB 1BTPA 4B2BA 4CRGA 4CRBA 4ZH8A 1VGCC 2Y81A 4Y8YA 1CU1A 2ZDAH 1IOEA 3V7TA 1SGRE 3KNXA 1C5TA 2ZU4A 1BUIA 3QUMP 1YP9A 1UCYE 1XUGA 5GJ4B 2VVUA 5I46H 4Q63A 1DWBH 2C90B 3U28C 4ISOA 1EAIA 1HUTH 4AFUA 3WW7A 2JJ1D 1TX8A 2EI7A 1PPEE 1BHXB 3E91A 4X6OA 1ZSLA 2BY6X 2M2AA 2I6SA 2BM2A 1TBZH 4KKDA 5LPFA 3TJVA 3WWBA 2ASUB 2YNBA 2XC0A 2B8OH 4LZ4B 1Z1IA 3QX5H 1D9IA 1FIZA 1V2TT 4ISIH 2JDID 1HB0B 7KMEH 5TJXA 1GMHF 1GHAG 2VJ1A 2PKSB 3PTNA 1QBOA 1O2ZA 5ESBA 1G36A 1C5RA 3F9EA 1OXGA 3A85A 3KEEA 5K0HA 3UQVA 6GCHF 3I29A 1HV7A 3SHCH 4GCHG 1ANBA 1B0EA 2FOCA 4X1RU 1D3TB 1MKWH 1XKAC 3ESTA 2OD3B 1MTVA 2ZWLH 4JZEH 1DLKB 1O3MA 3LDXH 4YT6H 3HK3B 1WQVH 3A7VA 3SUEA 5FPSA 2Y6TA 1SBWA 2NU2E 2QAAA 3PMHB 3ZZ8A 3ATLA 2F3CE 3MFJA 4K60A 1Y3VA 2B9LA 1W14U 1GI0A 1LQEA 1F2SE 3TH4H 1S6LA 3BV9B 3MU5A 4WH6A 3MH4A 4YLQH 1O2MA 3QK1A 3BIVH 3A7XA 1K1OA 1MCVA 2FIRH 2O8TA 3GDVA 1OWKA 1H9LB 3V12A 1HNEE 1ZPZA 3B8JA 1EZSC 5HXFA 3RU4E 5F53A 3GICB 1OWHA 4YTAA 3F9FA 1IQIA 1HIAB 1UO6A 1AHTH 4U30A 1PPBH 1T8OA 4UFDH 2J95A 2HOBA 3T28A 1KTSB 6LPRA 3RXDA 3L3TA 3EE7A 3GCTG 4JMYA 4ABGA 2WINI 2ZG0H 4OS4A 5FBIA 4DT7B 2PSYA 2ZFRH 2XNIA 2GCHG 4H6SB 3HK6B 4GSOA 5C67A 1O2QA 2Q6GA 3ZVEA 3RC5A 1GI3A 1AQ7A 4MDSA 3A8CA 3U8OH 1E1RD 3M36A 5L6NH 4HGCA 2NWNA 1DT2A 4ACAA 1P3EA 3IWMA 4BAMB 3VB6A 5LGOA 2TGDA 5EODA 1LPZB 1O2XA 5ETXA 1QBNA 1QJ1B 2ZU2A 1C5ZB 2XC5A 2V35A 5C1YA 1AY6H 1BRUP 1LDTT 1P02A 4A1XA 3P8FA 1MAXA 1O2JA 1EFRD 1C5LH 3BG8A 1SLWB 3T26A 4ZUHA 1XUHA 5I25A 1P12E 2XCNA 3QZQA 1H8IH 3SGBE 3SUFA 1FZZA 1TGTA 4A92A 5JPMH 1A4WH 1ACBE 1FUJA 5TCAA 1P2JA 2Y5GA 1S0QA 1B7XB 1SLVB 4U2WA 4TPIZ 2PKAB 2SGFE 4MNWA 2WZQA 4MNYA 3BTQE 1N8OB 2AYWA 1AVGH 1CBWC 8LPRA 4CHAC 1Y3XA 2FOMB 3LT3A 1MMJN 1OYTH 5JBCS 1FNIA 3BTKE 4Z6AH 1AE8H 1Y5AT 2SGEE 3MI4A 5C5NA 3RLYH 3A7TA 4ZKNU 4AG2A 2XBWA 1L2EA 2ZI2H 1QQUA 4IC6A 5C1UA 2GX4A 2PKSC 1QIXB 4FVDA 1MTUA 1W0KD 1SC8U 1AU8A 1DLEA 2BD9A 3UR6A 2A5AA 1MQ5A 1VCWA 4XOJA 3T5FH 2GDDA 1W0JD 2ODQA 4AC9A 3QDZB 5E0JA 1IQFA 3AK5A 1P10A 3P8GA 4H4FA 5FBEA 3BTGE 4JCNA 1EB1H 1C2IA 3BIUH 2ZKSA 2FI3E 1PQ8A 1GGDC 5EG4A 5T6GA 1J15A 1O3LA 1DY9A 2BOHB 1GMDF 3HGNA 4YOGA 3E90B 1CGHA 1WBGB 4NWKA 1T4UH 3QWCH 2FLRH 4SGBE 1MCTA 1ELAA 1EAXA 2EQNA 4ACBA 3DSOA 1YLDA 4GLYA 1KXDA 1AB9C 1LKAA 1O3DA 1DXWA 1M9UA 2QXGA 4IC5A 3UFAA 1EPTA 2HALA 1FY4A 3T29A 3TNSA 4E05H 3VXEH 3M3SA 1SHYA 1ABIH 4WMEA 4CH2B 1BTUA 2Y82A 3ZVCA 1A7SA 1FPHH 2F4LA 1CVWH 1E34B 1C5PA 3TNTA 5CHBA 1JOUB 1COWD 1OS8A 1A2CH 1HXEH 5JDUB 3HATH 1O2PA 2BDAA 1RIWB 3TGJE 1BMLA 1O3PB 2PP6A 2VU8E 3F2HA 2BD2A 1E1QD 4ZHLU 2UUYA 1TAWA 3LH1A 1C1TA 3O8BA 3BEUA 4LZ1H 3U1IB 2A4GA 1KMHB 1GHWH 2ZCKP 3VFEA 4VGCC 1C2FA 4UD9H 2VINA 2NU0E 1NM6A 1O3AA 2OXSA 3SGAE 1DOJA 1HCGA 1W13U 4I8KA 5EPYA 1TNIA 1BBRH 1P2QA 2Z6BD 4Y8XA 1XKBC 1TQ0B 3D62A 2WUCA 3VB4A 4ABIA 3ATIA 5EJ1A 1Y3UA 2GDEH 4ABJA 2AERH 2ZEBA 1LVOA 2BDGA 3P8NA 1C1VH 2QF4A 1EPTC 5F6MA 3I78A 4ZROA 4R8TB 1ZR0A 2A0QB 1LQDB 2TGPZ 4DCDA 1HJ8A 2QYIA 1VITG 2C4FH 4I32A 1SGCA 2DE8A 1JMOH 4X6PA 3RXQA 1BTZA 5L30H 1GBBA 2GMTC 2QY0B 4AYYB 1SQTA 2BOKA 3ZZ7A 5J4QA 8ESTE 2J94A 3RMNH 1L1JA 1DE7H 5EJZA 1HAIH 1ZMJA 1MZDA 1GMCF 2YNAA 2CN0H 1ELCA 3D23A 1L4ZA 1W0ZU 4DY7B 4Y0YE 3OU0A 2VIWA 3P92A 3FP7E 3AAVA 2VVCA 3A86A 1NS3A 5C3NA 1AFQC 1GJ5H 2K8IA 1O31A 3MO6A 2A45B 3M7TA 2BVRH 3RXTA 4I31A 2ZPQA 1ZGIA 4ZKOU 1YPHC 5JB8S 4XBCA 1GHBF 3KGPA 4I33A 4BANB 2XBXA 2R0LA 2YMSD 4AB9A 3QGJA 1ANCA 2BQ7B 3ZZCA 2BDYA 3VEQB 3LC3A 2BMGB 3FKSD 1ARBA 1EAWA 4R0IA 1AUJA 4NIXA 1N6YA 2IJD1 2VVVA 2ZU1A 1W7XH 1GBIA 1UVOA 2GV7A 1THPB 2R3YA 3K9XB 1GHVH 4UFFH 3U1JB 1MH0A 3DUXH 2HNTC 1JWTA 2BD5A 3SJOA 1BBRE 1K1JA 1Q2WA 1C2EA 1CGIE 2ZTXA 1EP6A 2C3SA 1K1NA 1EXFA 4Y79A 2FI4E 1MKXH 2CJIA 4AN7A 3B23B 3PV2A 3UNSA 4JK6A 1WTGH 2RCEA 1ELGA 2FDAA 2WPJS 2A31A 5IK2D 1XX9A 1PYTD 1QA7A 5HM2A 2ANYA 3KCGH 1HAZB 1BB0B 5DGJA 2XOKD 2IN2A 2CHAB 4B2CA 1ELBA 1GBKA 3LGVA 3RXIA 3RUOA 5T6FA 1WAYB 1A3BH 1O2HA 4B75A 4I8HA 1HPGA 1SGEE 1MTSA 1DSUA 3RXSA 2FX6A 1TRNA 1QQ4A 1DS2E 3NWUA 1TGSZ 2ODYB 2ZQ2A 3WY8A 3SV9A 2GP9B 4NA7A 2V6NA 1ELDE 2VWOA 4CRDA 3ZV8A 4WMDA 1A0JA 2ZIQH 1AO5A 1QB9A 1GDQA 4NIVA 4XD7D 4KTSA 2BD4A 4NWLA 1SKYE 4NIWA 2XRCA 4FU7A 1P2MA 1IQHA 1K1PA 1SLUB 2PTNA 1OOKB 3LC5A 5E0GA 1ELFA 2ZFQH 1UVUH 3SUDA 3ZV9A 3L33A 1P04A 2QF0A 5C0TA 1P9UA 4ESTE 2ZHQH 1AMHA 1V2LT 3ENSB 1V2UT 4RT1A 3RMLH 1NRNH 5CE1A 1DPOA 3CENA 4ZXYH 1GDNA 2Z3EA 4B6EA 1VR1H 3LGYA 2H5DA 5EPNA 3LKWA 2BLWA 1DANH 1BA8B 1NRPH 1TQ7B 3F0OA 4XDEA 4Y11E 1EP5A 3M5OA 4AFQA 3UTUH 1GHBG 1WV7H 1KYNA 2KCPA 1QJ6B 1W8BH 2WSSD 1WXRA 2Y80A 3RXCA 1UMAH 3SZEA 4H42U 3RDZA 3VGCC 1QTFA 4OS5A 1YKTA 2ANWA 3NPSA 1TX7A 3QLPH 1O33A 2RDEA 3SJIA 4Y6DA 1KLTA 1C2DA 1ZJDA 2BLVA 2G8TA 2LP6A 2A1DB 1V2QT 1UCYH 3K65B 2BB4A 2FPZA 4ABBA 1C2KA 1DVAH 3L6PA 3RXMA 3SU4A 1N1LA 3JZ1B 3QGNB 2O8MA 5DP7A 3PYHA 3RXUA 2OBOA 7LPRA 4YZUA 1OX1A 1MBMA 3B9FH 5IDKA 1A5GH 1XXFA 2OTVA 4K5ZA 4K2YA 2VGCC 1V2NT 2A5KA 3CS0A 4E06H 3RC4A 1V6DA 3U8RH 3C1KA 4X6NA 1HAOH 4GPGA 1OWIA 2Z7FE 1HAGE 3AW1A 1HLTH 4WH8A 2P94A 3S7HB 4H6TA 2QC2A 1P3CA 3RM0H 3ATKA 3GCHC 4Q2KA 1WOFA 4O97A 1LHEH 2KCYA 3UWJH 3T27A 4MG3A 1LHGH 2PLXA 1FDPA 1GCDA 2A5IA 2XWBI 1V2RT 1UHBA 2JETC 4HG6A 2ZCLP 5GCHG 1TNLA 4YOIA 1A0HB 1EZUC 1SGIB 1D3QB 5ESTE 1C1QA 3SO3A 4K3JA 2BY7X 5FX6A 2WYJA 3DCLA 2UWPA 2M5TA 3RM2H 1J14A 1YC0A 4DVAU 1B0FA 1YCPH 3FAOA 3MQKC 1FAXA 2G55A 3RXBA 3GDUA 4NG9H 2Z3CA 3TH2H 1QRXA 3P17H 1GBEA 1O34A 3IG6B 4WY3A 3KF2A 4QT8C 3PMJA 1FIWA 4HTCH 5EQRA 2O8WA 3HGPA 3MNSA 1AUTC 4IW4E 1HJAC 4THNH 4XBBA 2AEIH 2F9PA 1CSOE 4MPUA 1EOLA 4BTTB 4AOQA 2STBE 3A84A 9LPRA 1YPEH 3LJJA 3PV4A 3RLWH 1RD3B 1EASA 1ZZZA 4RN6A 4Y8ZA 1L1GA 3SGQE 5C17A 2RA0A 1CBWB 4CHAB 2CF8H 5DKMA 1C1OA 4ABAA 2ZDMA 2FODA 2JH6D 1UTOA 2W3IA 1LKBA 1KY9A 3LGIA 3GYMA 2ILNA 5F8ZA 1K1LA 1Z6EA 2IPHA 3MNXA 5EQSA 1P06A 2GTBA 1ELEE 3A7ZA 3PM3A 1XMNB 1TX6A 2JIZD 3PTBA 4RKOB 1AFEH 4UFEH 1EX3A 3NXPA 2KAIA 4Q80A 2SNVA 4X1NU 1V2ST 1O39A 2XWAA 1C5XB 1DITH 3GY5A 4J2YB 2ZGHA 3RU4T 5HKKD 3QZRA 4FETA 2ZZUH 1ZMLA 1GGDB 3FP8E 4DGJA 5AHGH 3N7OA 1IHTH 1YCPM 2NU3E 2WUBA 1ESBA 1K2I1 2SGDE 9ESTA 1O2IA 1MTWA 2OINA 2AGGX 3OTPA 1ESAA 3OE7D 3A7WA 4IBLH 2P3UB 3F68H 3GY3A 1AZ8A 1ZMNA 3DA9B 3KL6A 1GI9B 1O2OA 3GDSA 4K8BA 4ABDA 1KIGH 2ZDKA 5A2MH 3MU8A 1KXEA 3PMBB 3HKIB 3GY7A 4GAWA 1XUIA 1CA8B 2J38A 3CS7A 1GBAA 5DP4A 1AB9B 4IS5A 3NKKA 1QL7A 2D26C 1GI4A 3E0PB 1H8ED 3A80A 3FZDA 3URCA 1C1WH 2WPHS 1C2MA 1W7GH 2FOFA 2P16A 1CO7E 1GDUA 2G00A 4OS2A 2J4IA 2J34A 1AGJA 1DWEH 2OBQA 2KZ4A 3H7TA 4TY6A 3TJNA 1BT7A 2VBCA 1CQQA 1UVTH 1QRWA 1CA0C 1FQ3A 2ZP0H 3KQDA 1ZJKA 2J5UA 1HDTH 2AHME 2BDIA 3C27B 4WVPE 2ZFPH 2A2QH 4J1YA 1CT0E 4VGCB 1O2RA 2BHGA 2V7QD 1AWHB 1VZQH 1V2JT 1NO9H 1NFYA 3BEIB 5FL7D 1IQLA 1O38A 3ITIA 4AB8A 1GPZA 1RGQA 2B5TB 1SL3A 4Y10E 1QGFA 1A61H 2XCFA 5C5OA 1BMNH 5DO4H 1RFNA 1SFIA 2XC4A 4GUXA 3SJ9A 1EPTB 2H6MA 1TWXB 3BTFE 4F49A 1ARCA 4ISLA 3BSQA 1LPKB 3A88A 5FPYA 4CREA 1AD8H 2ZGBH 3M3TA 3E8LA 4O3UA 4OS7A 3UPEA 1S84A 2Z9KA 1KSNA 2GMTB 4Z0KA 1WTHD 4RKJB 1P8VC 1GWAA 3TH3H 3TIUA 3TLOA 1O2LA 2BQ6B 2BVXH 1SR5C 1V2MT 2FYRA 5IYTA 1GMHG 1TNJA 1T7CA 3RP2A 3A8AA 3SI4H 5CHAC 1C5MD 2AGIX 5L2YH 4F55A 1WDIA 1AFQB 6GCHG 5JBAS 2ZPSA 2P95A 1O3FA 1PFXC 2HVYB 4ABEA 1SOTA 4X2VA 3QN7A 2O9QA 4AGJA 1MKWK 1MTNC 2AS9A 4ZHMU 1UTKA 1TGNA 3KIDU 4MPWA 3VG8A 2TRMA 3SV2H 1TE0A 2BDHA 4JZIA 4JZ1A 1GI5A 2OK5A 1XUKA 1Z6JH 3SORA 3MH5A 2DUCA 3SNAA 2TGAA 2VH0A 3S9BA 3M7QA 1VJ9U 2FYQA 4OS6A 3FFGA 2WPLS 3TJOA 5A0CA 1ZRBA 2C93B 2XW9A 3V3MA 3BTTE 3OTJE 1KXFA 1BHXF 4AYVB 2VNTA 3UWIA 1BIOA 2QF5A 1CHGA 4UONA 1P2NA 1O5GH 1DX5M 3RXJA 4YESB 3KN2A 1TPOA 5JYIA 2FP7B 4P02A 2XXLA 1QY6A 3VB3A 5BRRE 1LHCH 1CE5A 1Z7KA 2KCOA 3FOAA 4X8UH 1BTHH 1GJBB 2GZ8A 1TALA 2VIPA 1A5HA 1J16A 3SZNA 2FLBH 1O3KA 1MBQA 1G2MA 3PO1C 4RSPA 7ESTE 1RXPA 5L2ZH 1PQ5A 2BX3A 1C1UH 4YO9A 4A5TS 1UK3A 1KLJH 5TCCA 3M5LA 3MYWA 1PPFE 1G3BA 1TPAE 3G01A 3SHAH 1QNJA 1AN1E 3BF6H 1GG6C 1GI2A 2CF9H 3AVZA 3OEED 1GJ9B 2ZHEH 1T8MA 1P03A 1C5UA 2CV3A 1ETRH 5LPRA 4KGAA 1UJ1A 4FUBA 2Z3DA 1HYLA 2YOLA 3EA9A 2PWXA 4GVUA 1P0SH 1NT1A 3Q3KA 3Q77A 2EY4C 1YWUA 2R3UA 2A4QA 3SJKA 1ORFA 1G3CA 3F1SB 3DHKH 3PWCA 2KCAA 5F8XA 1P2KA 4OGYA 4TYDA 1OP2A 4CRFA 1KLIH 1W3CA 4I8LA 3RC6A 1BTWA 1C4U2 2GVFA 4WF8A 3T2NA 4WMFA 5A8ZA 2GT8A 2W7SA 3ATWA 3K6YA 1YBWA 1EZQA 4INKA 1OP8A 2TBSA 1UTLM 5KGOA 3GCOA 1NROH 4OM9A 3TU7H 3NZIA 1NTPA 1FY1A 2K0QA 1O0DH 1CHOF 1G32B 1O3OA 1V2VT 1V2OT 3U8TH 3DSGA 4JK5A 1V2KT 3GCNA 1C1NA 1SOZA 2W6ID 4BAOB 1MQ6A 5E0HA 4MNVA 2J98A 1SQRA 1G3DA 3RXFA 3ZVFA 3PROA 2R0KA 2Q6DA 1YPGH 3ZIAD 2BDBA 4WJG2 3VGCB 1BTYA 4IN2A 1GI6A 7GCHF 4FXGH 5AF9H 4JYTA 3SJ8A 1O3CA 3KQEA 2KFWA 1F0TA 1BMAA 1GMDG 1O37A 2P3FH 1GBJA 1UK2A 1O5EH 3SOSA 2G4TA 5AVDA 2FS8A 3RXOA 3UY9A 1FI8A 2ZC9H 2P3TB 1OYQA 3I77A 5DP9A 1O3NA 3CNRA 4K69A 5DP3A 1O5FH 2HPQH 1Z8IB 1PPHE 3OX7U 1S6FA 1SVPA 1LHDH 3DT0H 3GY8A 4K1SA 1O2GH 2GT7A 3TGIE 4FOUC 2P93A 2FZZA 3T62A 3A83A 3M3VA 1SQAA 1C1RA 4NA9H 4ZCNA 2VGCB 5DK1A 3SU3A 2LELA 3F3BA 3TK5A 1ZGVA 1Y8TA 4AX9H 1F7ZA 3Q3YA 3RXPA 1LO6A 3OEHD 2H5CA 2A7HA 1YGCH 1SGTA 3PRBA 1E38B 3ZVGA 1DUAA 3MH6A 3W1EA 4OS1A 1VJAU 3U69H 2J92A 3UR9A 3DFLA 1UTJA 2DE9A 1ZSJA 4ZXXH 5E8EH 4KP0A 2ZTZA 3GCHB 4E7NA 1Y5UT 1C1SA 2A7JA 4IGDA 5GIBA 2EA3A 1BBRK 1EUFA 3KYFA 2Z9GA 1QBVH 2JETB 1FX0B 3SUGA 3UOUA 2VWLA 2HLCA 4ISHH 1RTFB 1YF4A 1THRH 1GI1A 3ZYEA 3SQEE 3V0XA 1GHXH 2OLGA 5DJ7A 5ABWA 1HAPH 4Z1MD 1IQJA 1TOCB 2XBYA 1PPGE 2OCVB 3SBKA 3EDXB 5T6DA 1VCQA 1Y59T 2G5NA 1D3DB 5GNDA 4DW2U 1OKXA 1K9OE 4Y0ZE 2O8UA 3LPRA 2CK3D 5K7RA 2STAE 5EU8A 2ZECA 3PLKA 1BRCE 1GMCG 4HFPB 4DIHH 1T31A 1OSSA 1GHZA 1SGPE 3DSPA 4NFFA 1DM4B 1HJAB 4X1PU 2JH0D 1TNHA 2G51A 3KYGA 2H9HA 3KHVA 4K1TA 3D49H 3RXVA 3ZZ3A 4MPVA 1E0FD 1AIXH 4MTBA 4CBOA 2OQUA 1UHBB 2ZHWH 3E16B 1GBDA 1H8DH 2FS9A 3S69A 1YLNA 1SQOA 8GCHF 2F91A 1TABE 3SV8A 3ZZ4A 1F0RA 2WPIS 1DFPA 4TT3D 4A6LA 1DDJA 4INLA 1L4DA 4TWYA 5FHTA 3UREA 3P8OA 1C5VA 1XXDA 2J2UA 2GCTB 2J97A 2R2WU 4CH8B 2QXHA 1D6RA 3F2FA 5HGGA 1AVXA 1NRRH 2Y5HA 2UWLA 5FXLA 4DT4A 2VH6A 3IITA 4CBNA 1TBRH 1IQMA 3STJA 1FXYA 2JH5D 1UVPA 2IPQX 1KDQA 1LVBA 3UAIC 1O3GA 2AMPA 3UB0A 2BYAX 3F9GA 5PTPA 1TA6A 1MKXK 1W12U 1C5SA 2CXVA 1HJ9A 3LONA 4A7IB 2IJOB 2HPPH 4MQAA 1YPKH 2OUAA 3KQBA 1ANEA 4NZLA 1F5RA 1K28D 1Y3YA 3KQCA 3MOCA 3BTWE 3Q76A 3UUZA 4YM9A 3JZ2B 2ZF0H 2BZ6H 1Z8GA 1TONA 2JKHA 1U6QA 1Q31A 5E2OA 3MHWU 2ZA5A 1O3IA 2SGPE 3NCLA 3SU2A 3HKJB 1NU7B 5DP8A 3GY4A 1P11E 2KAIB 1ZLRA 2B7DH 4GCHF 5FPTA 1C1PA 1SMFE 2QN5T 1WUNH 3RU4D 1QB6A 1SGQE 4X2YA 1AKSB 1A0LA 1EB2A 1CA0B 1UW7A 2BTCE 2OQ5A 1LCYA 2BXTH 3AAUA 4ASUD 3LGTA 4XBDA 1RRKA 2OP9A 4HI3A 2VWNA 3URDA 4BOHA 3UQOA 4FUCA 1F92A 2FX4A 2HNTE 1S85A 1TMBH 3A7YA 3H5CB 4Q4LA 1F5LA 1WQSA 1JIRA 2P8OC 1LVMA 2ALVA 2HRVA 4X8SH 1XUJA 1ZTJA 3GOVB 1BZXE 1DXPA 2FMJA 5LH8A 2FI5E 3PV5A 4F4OC 3N7EA 2UUFB 1GL0E 1G30B 3GCTF 1NN6A 1C9TA 1JRSA 1UTQA 1XVOA 3A8DA 4Y7BA 1L1NA 4WXVA 1TFXA 3BG4B 2WHXA 2FOHA 2ZFTA 4FVBA 1TA2A 2AMDA 2Q6FA 4DOQA 2GCHF 2F9BH 3ZVDA 1IHSH 2FESH 3OY6U 2BDCA 3AASA 1JIMA 3E0NB 5A0BA 2PGQB 3W94A 1FJSA 1ABJH 5CHAB 1GJ4H 4K1EA 2QCYA 1EATA 2ZU3A 1LVYA 3ODDA 5T3HA 1J17T 1SHHB 1G3EA 3CP7A 4U32A 3SYJA 1FLEE 1PPZA 1P09A 3MNBA 1MTNB 1TNKA 2AH4X 2R2MB 1H9HE 1B5GH 1HFDA 4RT0A 1D3PB 1SPJA 1UCYK 2H9EH 3ELAH 3ATMA 1BCUH 2KX4A 4D8NA 4NCYA 5FX5A 1C1MA 1EJAA 3N99A 1V2WT 1KXBA 3E3TA 1OP0A 4GHQA 1GBTA 2GCTC 1OHHD 2ZCHP 4BTUB 1AKSA 1BTXA 3TK9A 4YT7H 1TBQH 3UOPA 1A3EH 1V2PT 2WV9A 1WYKA 1QURH 4AFZA 3MU1A 1O2KA 4FUHA 4A1VA 2UUKB 5FCRA 5DP6A 1TRMA 1E79D 2TPIZ 2A2XH 2QGRA 5EQQA 3RXEA 3SI3H 5GPIB 3ZZBA 1F0UA 3SU1A 4YOJA 1N6XA 2ANMH 2BY8X 1JRTA 2WPMS 3RMMH 4ZHAA 1AVWA 4FU8A 2PW8H 3M5MA 3ZZAA 1E35B 1Z71A 3GISB 1QCPA 3MMGA 2BY9X 2K1QA 2PR3A 3EA8A 2AIQA 1IQGA 1YPJH 2QE7D 3GY2A 3PO1B 1SGNE 2PV9B 1P05A 3PLPA 5AFYH 1FPCH 1QL8A 2FM2A 1BMFD 1P01A 1VCPA 1CT2E 5GDSH 3UNQA 1MUEB 5CMXH 3F6UH 1JBUH 1FV9A 3D65E 3ZZ9A 2FOGA 5HIYA 1XVMA 1S6HA 1NRSH 2H2ZA 5SGAE 1GG6B 3NRLA 1TGBA 1XM1A 3ZVBA 1O3JA 1YCPK 5EXLA 1RJXB 3SU5A 4JZDH 1NC6A 1QZ8A 3QTOH 1MU8B 2FTMA 3O8RA 1TYNA 1HXFH 1GJ6A 1GI8B 1TOMH 4B6FA 4RI0A 4SGAE 1G2LA 2BXUH 3ODFA 4DG4A 3Q3XA 4D9QA 4Q7XA 1YY3A 1DY8A 1EZXC 4LXBH 2RG3A 3O8DA 4NFEA 1C2HA 1H1BA 3ZVAA 1D6WA 3BN9A 2PSXA 2UUJB 1ZSKA 3OY5U 1O2VA 3M37A 2QIQA 1C9PA 3S9AA 4B1TA 2ZNKH 4CR5A 2ZDNA 3MWIU 1T32A 3OYPA 3BG4C 4D9RA 1O2UA 1EOJA 2W6JD 3M5NA 1GBHA 1YPMH 2EEKA 1QHRB 1IQKA 1P57B 1YM0A 5DSFA 2ZTYA 5HIZA 5DN6D 2NU1E 1IAUA 1QR3E 1SI5H 3TITA 3LGUA 4I8GA 4AG1A 3ZYDA 5FAHA 4IMZA 2FOBA 2QXIA 4M7GA 3SW2B 2RFKC 1F5KU 3TK6A 3SQHE 1C4V2 4TPYA 1KTTB 5A0AE 1V3XA 1TPSA 1F0SA 2BVSH 4NA8A 4ZAEA 5GWZA 1FY5A 1AE5A 2G4UA 5A8YA 1VITF 3LJOA 3BTHE 1S0RA 2YMSB 1VKYA 3QTVH 3EQ0H 5HM9A 5JBTA 1W11U 4I8JA 2A4OA 2FEQH 1YYY1 2PUXB 1EJNA 1SLXB 5C20A 2W7UA 5A09A 1QFKH 2Z9JA 2Y7ZA 3NUMA 2SGAA 4FUGA 4Q7ZA 2V3HH 5EXMA 4I7YH 4UEHH 3PLBA 3A89A 3R0FA 2WPKS 1HIAA 5BPEA 4Y7AA 1S83A 4E7RG 1NESE 3O8CA 4FUEA 2Q1JA 1INCA 1ELVA 4WXIA 1NBMD 1UTMA 5H4IB 4B2AA 1YPLH 4IN1A 2ZGJA 3FANA 3OAAD 4K8YA 2J98B 1QA0A 2A4RA 1O35A 1TIOA 1K22H 1SGFA 1VITH 2HVXA 3LGWA 3RXHA 3SV7A 3SU0A 3GS9A 3DFJA 1SSXA 1JXPA 3F0PA 1EAUA 1O3BA 4AZ2B 2SNWA 2ZU5A 5EGMA 5FCKA 4ABFA 1YLCA 3GY6A 3VXFH 1P2IA 2GKVE 1AWFH 1TGCA 3ZZDA 4MVNA 1BRAA 5DG6A 4X6MA 3SNCA 1ZPBA 1BJUA 4PROA 2EI6A 1W0YH 4ZKSU 3W95A 3RXGA 4WWYA 4FUFA 3Q00A 3FN8A 4MNXA 1TRYA 3LOXA 3BTME 2IOTA 4U01A 4F48B 2C8ZB 2ZO3H 1LMWB 1BRBE 3KQ5A 1KXAA 3OFND 2HGTH 4B74A 2GV6A 2R9PA 5CDFE 1P2OA 2AFQB 1C4Y2 1DWCH 1FAKH 1S82A 4NIYA 1NZQH 1K0HA 1MZAA 2ODPA 2ZGCA 1THSH 1DSTA 4X8VH 4XSKU 3SNDA 1ETSH 2CGAA 1HGTH 2PKAA 1BITA 1O5AB 3TPIZ 1GJAB 1UVSH 1A5IA 2BD8A 1NFWA 1PPCE 1NRQH 5LPEA 1ZHRA 2NU4E 1FONA 3E6PH 2PUQH 2UWOA 2G81E 4BTIB 5C1XA 1O2YA 1WSSH 2F9NA 1S81A 4KTCA 3S7KB 4AGKA 2G5VA 2RDLA 2L74A 4OGXA 5F8TA 1HAVB 2O8LA 1FN8A 2ANKH 4KELA 2SGQE 3MH7A 4CRCA 1G37A 3EA7A 3EYDA 2AIPA 1G9IE 4JYUH 4Y71A 3E1XB 4FUJA 3A82A 1O5BB 1ID5H 3MU0A 1QJ7B 2ZDVH 1MU6B 5EXNA 5HYOA 2BLOA 3P95A 1C2GA 3K2UA 1IQEA 8KME2 2Z9IA 4DURA 3FVFB 1ESTA 3PRDA 3NK8A 3P70B 3A81A 3R3GB 2TIOA 4XRNA 3RMOH 1UK4A 1C5QA 3MTYA 4D7FA 3K6ZA 2F83A 3M61U 5B6OA 1N8OC 2FO9A 3EGKH 1BOQA 2YMSC 3VB5A 1Z8JB 1D4PB 1WCZA 4O3TA 1GJDB 2ZHDA 1C2LA 1Z1JA 1PJPA 3TJUA 1C5NH 3M35A 1FMGA 1O2WA 5EW1H 1ETTH 4BNRA 1SGYE 5G4BA 5B6LA 3U98H 3SNEA 3A87A 1DUEA 2PGBB 3MU4A 5EW2H 4HZHA 2LPRA 2F43B 2OC1A 3BTEE 3H7OA 4TWWA 5C94A 1HAYB 4FUDA 4KTUA 4BXWA 1A1RA 2LNCA 1NFXA 1RTKA 1GJCB 3FP6E 1K1MA 4TY7A 1GJ8B 2ALPA 4FU9A 4X0WU 1NBME 3S9CA 1J8AA 3TGKE 2FWWA 1SFQB 1T8LA 4X2XA 1TMTH 5DP5A 4BXSA 1O2TA 3OSYA 1QRZA 1RS0A 1TNGA 1PYTC 2A32A 2WV5A 4JZFH 1O2NA 2BY5X 1NY22 1BQYA 1HAHH 2EI8A 1H9IE 3M7UA 3PWBA 2A7CA 5KECA 1IQNA 1C5OH 1K21H 1O3HA 1SG8B 2Z94A 5E2PA 6CHAB 1CGJE 4AORA 5KEDA 3AW0A 1GVLA 3RXRA 1GBMA 1GCTB 1KDQB 5J4SA 1O5CB 1NFUA 1HAVA 4LOYH 3H09A 4AFSA 1ANDA 2GGVB 1EQ9A 4ABHA 2D2DA 1CT4E 1O5DH 1A46H 1L0ZA 1HRTH 2P8OB 5EOKA 2V3OH 2HNTF 1MAYA 3WWFA 1DWDH 4XFQA 3SV6A 4CRAA 4GHTA 2KM0A 5C0UA 3V13A 2TGTA 3FO8D 4Q7YA 1RIWC 4JYVH 1TPPA 2P59A 4NSYA 1Q3XA 1BJVA 2FOEA 2ZDLA 1SB1H 1HBTH 3FZZA 4O9VA 3EE0B 3TVJB 1NPMA 1ZTLA 1UTNA 3BEFB 1GHYH 1SGFG 2D8WA 1ZRKA 1CHOG 1KXCA 2BD7A 4UFGH 1O30A 1T4VH 1ELTA 2PHBA 1H4WA 2ZPRA 4O03A 3DD2H 3RXAA 1NU9A 5GCHF 3UNRA 2C8XB 1LPGB 2SFAA 3VB7A 1J9CH 4M9FA 3QO6A 1AZZA 1VGCB 2Z9LA 1GBCA 2ESTE 4DIIH 1ZHMA 7GCHG 5HMAA 1ZHPA 4B76A 2J9NA 1C5YB 3SU6A 2OC7A 2QA9E 2PFEA 4D76A 4UDWH 5GXPA 2VIQA 5A8XA 1W10U 2V0BA 2HLDD 2GZ7A 1PQ7A 2C8YB 1PQAA 1XUFA 1P9SA 3PB1E 1Z8RA 2GD4B 2KR7A 4BAKB 1O36A 1X7AC 2BX4A 1QB1A 2THFB 3MNCA 4A1TA 2ULLA 1GBLA 1FN6A 1O32A 2I6QA 4DJZB 1AI8H 2VIDA 3U9AH 5JB9S 1E36B 2VIVA 2F9OA 2RA3A 2XNDD 2WYGA 2C8WB 3T25A 1W2KH 1K1IA 2JJ2D 3BTDE 4LK4A 2G52A 2VB0A 3GYLB 5F03A 2F9UA 3SNBA 4MPXA 1GBFA 3ZZ5A 3LH3A 1OPHB 2WV4A 2FTLE 4NGAH 2AGEX 6ESTA 3MO9A 2QXJA 1EJMA 1LHFH 2BLQA 3LIWA 2ZFFH 1OWJA 1FY8E 1DICA 3A8BA 4B73A 4X1QU 1GI7B 5EJLA 1GHAF 2F9VA 3P6ZB 3UIRA 4YXWD 4Y76A 2QF3A 1S5SA 1BDAA 1ZOMA 4FUIA 4D7GA 1YPHE 4INHA 4IMQA 2L6OA 1QL9A 2BD3A 2BZAA 2ZGXH 2AMQA 1C5WB 2ZHFH
chains in the Genus database with same CATH topology
1HAXB 2FOAA 5JBBS 2FXRA 4X2WA 1ZTKA 2VIOA 2Y5FA 4X8TH 1ZYOA 3RXLA 1GVKB 1GL1A 1EKBB 3HPTB 6CHAC 3STIA 1E37B 3LU9B 2W26A 1GCTC 3RXKA 4ZKRU 3S0NA 2HWLB 3SN8A 1Y5BT 1TB6H 4NSVA 1BMMH 3EAJA 1OWDA 4UE7H 5AFZH 2EC9H 2H9TH 4CR9A 1GJ7B 1Y3WA 3ZZ6A 1TLDA 2ZQ1A 2CHAC 5DPAA 2QV1A 2OC0A 1LTOA 2XBVA 1O2SA 4BAHB 2OC8A 2W5EA 1UTPA 1GVZA 2W3KA 2XYAA 4YLUA 2GZ9A 4XE4A 1TMUH 1ZPCA 5C2ZA 2Y7XA 4ZMAH 4ISNA 2B0FA 2VWMA 1OWEA 1WU1A 3PMAB 3MO3A 1RTLA 4NZQA 4MLFB 1C2JA 1MD7A 1T8NA 2PTCE 4ASHA 2CMYA 2D1JA 3VPKA 8GCHG 3F9HA 1MD8A 4X1SU 1O3EA 1SGDE 2H1UA 2XTTB 4B71A 2ZFSA 1FY3A 4BAQB 2BQWB 1BTPA 4B2BA 4CRGA 4CRBA 4ZH8A 1VGCC 2Y81A 4Y8YA 1CU1A 2ZDAH 1IOEA 3V7TA 1SGRE 3KNXA 1C5TA 2ZU4A 1BUIA 3QUMP 1YP9A 1UCYE 1XUGA 5GJ4B 2VVUA 5I46H 1DWBH 2C90B 4ISOA 1EAIA 1HUTH 4AFUA 1TX8A 2EI7A 1PPEE 1BHXB 3E91A 4X6OA 1ZSLA 2BY6X 2I6SA 2BM2A 1TBZH 4KKDA 5LPFA 3TJVA 2ASUB 2YNBA 2XC0A 2B8OH 4LZ4B 1Z1IA 3QX5H 1D9IA 1FIZA 1V2TT 4ISIH 1HB0B 7KMEH 5TJXA 1GMHF 1GHAG 2VJ1A 2PKSB 3PTNA 1QBOA 1O2ZA 5ESBA 1G36A 1C5RA 3F9EA 1OXGA 3A85A 3KEEA 5K0HA 3UQVA 6GCHF 3I29A 1HV7A 3SHCH 4GCHG 1ANBA 1B0EA 2FOCA 4X1RU 1D3TB 1MKWH 1XKAC 3ESTA 2OD3B 1MTVA 2ZWLH 4JZEH 1DLKB 1O3MA 3LDXH 4YT6H 3HK3B 1WQVH 3A7VA 3SUEA 5FPSA 2Y6TA 1SBWA 2NU2E 2QAAA 3PMHB 3ZZ8A 3ATLA 2F3CE 3MFJA 4K60A 1Y3VA 2B9LA 1W14U 1GI0A 1LQEA 1F2SE 3TH4H 3BV9B 3MU5A 4WH6A 3MH4A 4YLQH 1O2MA 3QK1A 3BIVH 3A7XA 1K1OA 1MCVA 2FIRH 2O8TA 3GDVA 1OWKA 1H9LB 3V12A 1HNEE 1ZPZA 3B8JA 1EZSC 5HXFA 3RU4E 3GICB 1OWHA 4YTAA 3F9FA 1IQIA 1HIAB 1UO6A 1AHTH 4U30A 1PPBH 1T8OA 4UFDH 2J95A 2HOBA 3T28A 1KTSB 6LPRA 3RXDA 3L3TA 3GCTG 4JMYA 4ABGA 2WINI 2ZG0H 4OS4A 5FBIA 4DT7B 2PSYA 2ZFRH 2XNIA 2GCHG 4H6SB 3HK6B 4GSOA 5C67A 1O2QA 2Q6GA 3ZVEA 3RC5A 1GI3A 1AQ7A 4MDSA 3A8CA 3U8OH 5L6NH 3M36A 4HGCA 2NWNA 1DT2A 1P3EA 3IWMA 4BAMB 3VB6A 5LGOA 2TGDA 5EODA 1LPZB 1O2XA 5ETXA 1QBNA 1QJ1B 2ZU2A 1C5ZB 2XC5A 2V35A 5C1YA 1AY6H 1BRUP 1LDTT 1P02A 4A1XA 3P8FA 1MAXA 1O2JA 1C5LH 3BG8A 1SLWB 3T26A 4ZUHA 1XUHA 5I25A 1P12E 2XCNA 3QZQA 1H8IH 3SGBE 3SUFA 1FZZA 1TGTA 4A92A 5JPMH 1A4WH 1ACBE 1FUJA 5TCAA 1P2JA 2Y5GA 1S0QA 1B7XB 1SLVB 4U2WA 4TPIZ 2PKAB 2SGFE 4MNWA 4MNYA 3BTQE 1N8OB 2AYWA 1AVGH 1CBWC 8LPRA 4CHAC 1Y3XA 2FOMB 3LT3A 1MMJN 1OYTH 5JBCS 1FNIA 3BTKE 4Z6AH 1AE8H 1Y5AT 2SGEE 3MI4A 5C5NA 3RLYH 3A7TA 4ZKNU 4AG2A 2XBWA 1L2EA 2ZI2H 1QQUA 4IC6A 5C1UA 2GX4A 2PKSC 1QIXB 4FVDA 1MTUA 1SC8U 1AU8A 1DLEA 2BD9A 3UR6A 2A5AA 1MQ5A 1VCWA 4XOJA 3T5FH 2GDDA 2ODQA 3QDZB 5E0JA 1IQFA 1P10A 3P8GA 4H4FA 5FBEA 3BTGE 4JCNA 1EB1H 1C2IA 3BIUH 2ZKSA 2FI3E 1PQ8A 1GGDC 5EG4A 5T6GA 1J15A 1O3LA 1DY9A 2BOHB 1GMDF 3HGNA 4YOGA 3E90B 1CGHA 1WBGB 4NWKA 1T4UH 3QWCH 2FLRH 4SGBE 1MCTA 1ELAA 1EAXA 1YLDA 4GLYA 1KXDA 1AB9C 1LKAA 1O3DA 1DXWA 1M9UA 2QXGA 4IC5A 3UFAA 1EPTA 2HALA 1FY4A 3T29A 3TNSA 4E05H 3VXEH 3M3SA 1SHYA 1ABIH 4WMEA 4CH2B 1BTUA 2Y82A 3ZVCA 1A7SA 1FPHH 1CVWH 1E34B 1C5PA 3TNTA 1JOUB 1OS8A 1A2CH 1HXEH 5JDUB 3HATH 1O2PA 2BDAA 1RIWB 3TGJE 1BMLA 1O3PB 2VU8E 2BD2A 4ZHLU 2UUYA 1TAWA 3LH1A 1C1TA 3O8BA 3BEUA 4LZ1H 3U1IB 2A4GA 1GHWH 2ZCKP 3VFEA 4VGCC 1C2FA 4UD9H 2VINA 2NU0E 1NM6A 1O3AA 2OXSA 3SGAE 1DOJA 1HCGA 1W13U 4I8KA 5EPYA 1TNIA 1BBRH 1P2QA 2Z6BD 4Y8XA 1XKBC 1TQ0B 3D62A 2WUCA 3VB4A 4ABIA 3ATIA 1Y3UA 2GDEH 4ABJA 2AERH 2ZEBA 1LVOA 2BDGA 3P8NA 1C1VH 1EPTC 5F6MA 3I78A 4ZROA 4R8TB 1ZR0A 2A0QB 1LQDB 2TGPZ 4DCDA 1HJ8A 2QYIA 1VITG 2C4FH 4I32A 1SGCA 2DE8A 1JMOH 4X6PA 3RXQA 1BTZA 5L30H 1GBBA 2GMTC 2QY0B 4AYYB 1SQTA 2BOKA 3ZZ7A 5J4QA 8ESTE 2J94A 3RMNH 1L1JA 1DE7H 1HAIH 1ZMJA 1MZDA 1GMCF 2YNAA 2CN0H 1ELCA 3D23A 1L4ZA 1W0ZU 4DY7B 4Y0YE 3OU0A 2VIWA 3P92A 3FP7E 3AAVA 2VVCA 3A86A 1NS3A 5C3NA 1AFQC 1GJ5H 1O31A 3MO6A 2A45B 3M7TA 2BVRH 3RXTA 4I31A 2ZPQA 1ZGIA 4ZKOU 1YPHC 5JB8S 4XBCA 1GHBF 3KGPA 4I33A 4BANB 2XBXA 2R0LA 4AB9A 3QGJA 1ANCA 2BQ7B 3ZZCA 2BDYA 3VEQB 3LC3A 2BMGB 1ARBA 1EAWA 4R0IA 1AUJA 4NIXA 1N6YA 2VVVA 2ZU1A 1W7XH 1GBIA 1UVOA 2GV7A 1THPB 2R3YA 3K9XB 1GHVH 4UFFH 3U1JB 1MH0A 3DUXH 2HNTC 1JWTA 2BD5A 3SJOA 1BBRE 1K1JA 1Q2WA 1C2EA 1CGIE 2ZTXA 1EP6A 2C3SA 1K1NA 1EXFA 4Y79A 2FI4E 1MKXH 2CJIA 4AN7A 3B23B 3UNSA 4JK6A 1WTGH 2RCEA 1ELGA 2FDAA 2WPJS 2A31A 1XX9A 1PYTD 1QA7A 5HM2A 2ANYA 3KCGH 1HAZB 1BB0B 5DGJA 2IN2A 2CHAB 4B2CA 1ELBA 1GBKA 3LGVA 3RXIA 3RUOA 5T6FA 1WAYB 1A3BH 1O2HA 4B75A 4I8HA 1HPGA 1SGEE 1MTSA 1DSUA 3RXSA 2FX6A 1TRNA 1QQ4A 1DS2E 3NWUA 1TGSZ 2ODYB 2ZQ2A 3WY8A 3SV9A 2GP9B 4NA7A 2V6NA 1ELDE 2VWOA 4CRDA 3ZV8A 4WMDA 1A0JA 2ZIQH 1AO5A 1QB9A 1GDQA 4NIVA 4KTSA 2BD4A 4NWLA 4NIWA 2XRCA 4FU7A 1P2MA 1IQHA 1K1PA 1SLUB 2PTNA 1OOKB 3LC5A 5E0GA 1ELFA 2ZFQH 1UVUH 3SUDA 3ZV9A 3L33A 1P04A 2QF0A 1P9UA 4ESTE 2ZHQH 1AMHA 1V2LT 3ENSB 1V2UT 3RMLH 1NRNH 5CE1A 1DPOA 3CENA 4ZXYH 1GDNA 2Z3EA 1VR1H 3LGYA 2H5DA 5EPNA 3LKWA 2BLWA 1DANH 1BA8B 1NRPH 1TQ7B 4XDEA 4Y11E 1EP5A 3M5OA 4AFQA 3UTUH 1GHBG 1WV7H 1KYNA 1QJ6B 1W8BH 2Y80A 3RXCA 1UMAH 4H42U 3RDZA 3VGCC 1QTFA 4OS5A 1YKTA 2ANWA 3NPSA 1TX7A 3QLPH 1O33A 3SJIA 4Y6DA 1KLTA 1C2DA 1ZJDA 2BLVA 2G8TA 2A1DB 1V2QT 1UCYH 3K65B 2BB4A 2FPZA 4ABBA 1C2KA 1DVAH 3L6PA 3RXMA 3SU4A 1N1LA 3JZ1B 3QGNB 2O8MA 5DP7A 3PYHA 3RXUA 2OBOA 7LPRA 4YZUA 1OX1A 1MBMA 3B9FH 5IDKA 1A5GH 1XXFA 2OTVA 4K5ZA 4K2YA 2VGCC 1V2NT 2A5KA 3CS0A 4E06H 3RC4A 1V6DA 3U8RH 3C1KA 4X6NA 1HAOH 4GPGA 1OWIA 2Z7FE 1HAGE 3AW1A 1HLTH 4WH8A 2P94A 3S7HB 4H6TA 2QC2A 1P3CA 3RM0H 3ATKA 3GCHC 4Q2KA 1WOFA 4O97A 1LHEH 3UWJH 3T27A 4MG3A 1LHGH 2PLXA 1FDPA 1GCDA 2A5IA 2XWBI 1V2RT 1UHBA 2JETC 5GCHG 2ZCLP 1TNLA 4YOIA 1A0HB 1EZUC 1SGIB 1D3QB 5ESTE 1C1QA 3SO3A 4K3JA 2BY7X 5FX6A 2WYJA 2UWPA 2M5TA 3RM2H 1J14A 1YC0A 4DVAU 1B0FA 1YCPH 3FAOA 1FAXA 2G55A 3RXBA 3GDUA 4NG9H 2Z3CA 3TH2H 1QRXA 3P17H 1GBEA 1O34A 3IG6B 4WY3A 3KF2A 4QT8C 3PMJA 1FIWA 4HTCH 5EQRA 2O8WA 3HGPA 3MNSA 1AUTC 4IW4E 1HJAC 4THNH 4XBBA 2AEIH 2F9PA 1CSOE 4MPUA 1EOLA 4BTTB 4AOQA 2STBE 3A84A 9LPRA 1YPEH 3LJJA 3PV4A 3RLWH 1RD3B 1EASA 1ZZZA 4RN6A 4Y8ZA 1L1GA 3SGQE 2RA0A 1CBWB 4CHAB 2CF8H 5DKMA 1C1OA 4ABAA 2ZDMA 2FODA 2JH6D 1UTOA 2W3IA 1LKBA 1KY9A 3LGIA 3GYMA 2ILNA 5F8ZA 1K1LA 1Z6EA 2IPHA 3MNXA 5EQSA 1P06A 2GTBA 1ELEE 3A7ZA 3PM3A 1XMNB 1TX6A 3PTBA 4RKOB 1AFEH 4UFEH 1EX3A 3NXPA 2KAIA 4Q80A 2SNVA 4X1NU 1V2ST 1O39A 2XWAA 1C5XB 1DITH 3GY5A 4J2YB 2ZGHA 3RU4T 3QZRA 2ZZUH 1ZMLA 1GGDB 3FP8E 4DGJA 5AHGH 3N7OA 1IHTH 1YCPM 2NU3E 2WUBA 1ESBA 1K2I1 2SGDE 9ESTA 1O2IA 2OINA 1MTWA 2AGGX 1ESAA 3A7WA 4IBLH 2P3UB 3F68H 3GY3A 1AZ8A 1ZMNA 3DA9B 3KL6A 1GI9B 1O2OA 3GDSA 4K8BA 4ABDA 1KIGH 2ZDKA 5A2MH 3MU8A 1KXEA 3PMBB 3HKIB 3GY7A 4GAWA 1XUIA 1CA8B 2J38A 3CS7A 1GBAA 5DP4A 1AB9B 4IS5A 3NKKA 1QL7A 2D26C 1GI4A 3E0PB 3FZDA 3A80A 3URCA 1C1WH 2WPHS 1C2MA 1W7GH 2P16A 2FOFA 1CO7E 1GDUA 2G00A 4OS2A 2J4IA 2J34A 1AGJA 1DWEH 2OBQA 3H7TA 4TY6A 3TJNA 1BT7A 1CQQA 1UVTH 1QRWA 1CA0C 1FQ3A 2ZP0H 3KQDA 1ZJKA 1HDTH 2BDIA 3C27B 4WVPE 2ZFPH 2A2QH 4J1YA 1CT0E 4VGCB 1O2RA 2BHGA 1AWHB 1VZQH 1V2JT 1NO9H 1NFYA 3BEIB 1IQLA 1O38A 3ITIA 4AB8A 1GPZA 1RGQA 2B5TB 1SL3A 4Y10E 1QGFA 1A61H 2XCFA 5C5OA 1BMNH 5DO4H 1RFNA 1SFIA 2XC4A 4GUXA 3SJ9A 1EPTB 2H6MA 1TWXB 3BTFE 4F49A 1ARCA 4ISLA 3BSQA 1LPKB 3A88A 5FPYA 4CREA 1AD8H 2ZGBH 3M3TA 3E8LA 4O3UA 4OS7A 3UPEA 1S84A 2Z9KA 1KSNA 2GMTB 4Z0KA 1WTHD 4RKJB 1P8VC 1GWAA 3TH3H 3TIUA 3TLOA 1O2LA 2BQ6B 2BVXH 1SR5C 1V2MT 2FYRA 5IYTA 1GMHG 1TNJA 1T7CA 3RP2A 3A8AA 3SI4H 5CHAC 1C5MD 2AGIX 5L2YH 1AFQB 6GCHG 5JBAS 2ZPSA 2P95A 1O3FA 1PFXC 4ABEA 1SOTA 4X2VA 3QN7A 2O9QA 4AGJA 1MKWK 1MTNC 2AS9A 4ZHMU 1UTKA 1TGNA 3KIDU 4MPWA 2TRMA 3SV2H 1TE0A 2BDHA 4JZIA 4JZ1A 1GI5A 1XUKA 1Z6JH 3SORA 3MH5A 2DUCA 3SNAA 2TGAA 2VH0A 3S9BA 3M7QA 1VJ9U 2FYQA 4OS6A 3FFGA 2WPLS 3TJOA 5A0CA 1ZRBA 2C93B 2XW9A 3V3MA 3BTTE 3OTJE 1KXFA 1BHXF 4AYVB 2VNTA 3UWIA 1BIOA 1CHGA 4UONA 1P2NA 1O5GH 1DX5M 3RXJA 4YESB 3KN2A 1TPOA 5JYIA 2FP7B 2XXLA 1QY6A 3VB3A 5BRRE 1LHCH 1CE5A 1Z7KA 4X8UH 1BTHH 1GJBB 2GZ8A 1TALA 2VIPA 1A5HA 1J16A 3SZNA 2FLBH 1O3KA 1MBQA 1G2MA 3PO1C 4RSPA 7ESTE 1RXPA 5L2ZH 1PQ5A 2BX3A 1C1UH 4YO9A 4A5TS 1UK3A 1KLJH 5TCCA