3MNCA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. second stage of radiation damage
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mncA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mncA01
3S69A 1SLWB 2BY5X 3H7OA 5DP5A 2FPZA 2M5TA 1MKWK 4O03A 3LGVA 4A6LA 2BOHB 3GY8A 3V7TA 2GZ7A 1ZYOA 4D7GA 2ALVA 1GI4A 1V2WT 5CHAB 1THSH 4X8VH 1C1PA 1EASA 1SVPA 2Z9JA 2A4GA 4K3JA 3TNSA 2G4TA 1GHXH 2BD3A 2Z3CA 4U01A 1SGDE 2BQWB 4X6OA 1PQ8A 2RA3A 4XFQA 3W94A 4NFEA 1P11E 1OWIA 1RJXB 4JK5A 1UHBA 4CRGA 1ZSKA 1YC0A 1UVTH 1DXPA 1UHBB 1IQLA 1V2ST 3C27B 2OBOA 3ENSB 3P17H 1G3BA 1B0FA 3C1KA 1C2GA 1NRNH 3U1JB 2STBE 1GI7B 2I6SA 1NM6A 5GJ4B 1O2KA 2ODPA 4INKA 4B71A 3ESTA 1EOJA 1C2JA 7KMEH 4X2VA 4JZEH 4ASHA 1OP2A 3SNCA 1YPKH 4WXIA 5GWZA 3GY5A 2GV7A 3SU4A 1F5RA 1TWXB 5L2YH 1IQKA 3FZDA 1SQOA 3G01A 3M5LA 5FPSA 2FO9A 3N7OA 2VNTA 4ZKNU 4O3UA 1GJ8B 5J4SA 2PWXA 5JBAS 3SNEA 4WY3A 4DW2U 2JETB 2CHAC 2FOFA 2JH6D 1J17T 2OINA 4VGCC 1LPKB 1KLTA 3M5MA 5C5OA 2Z94A 3GDVA 1QQ4A 4ZHMU 2SGEE 3UNSA 1K2I1 4YO9A 3BG8A 1TMUH 4BAOB 2WYGA 4QT8C 3TK6A 1DY8A 2UUJB 3A82A 3TH2H 1QQUA 1DT2A 1A5GH 4I8KA 1HRTH 5FPYA 2QIQA 1NN6A 1OP8A 1TOCB 3GDUA 3ZZ6A 1ID5H 1ZTJA 1CGJE 1QB9A 1ELAA 3A7XA 4I31A 4O3TA 4NSYA 2ZU3A 5FBIA 4Q7YA 1FQ3A 3NK8A 1UTNA 1THRH 4ISHH 5GIBA 1GJ4H 3RP2A 3O8CA 1BTHH 3QO6A 2OXSA 3GISB 3AVZA 2XBXA 1C5UA 4OS2A 1LVBA 1GI6A 3LONA 3O8DA 3MTYA 3F9GA 1Z6EA 1MZDA 1JMOH 1MTSA 2VINA 4JZIA 5T3HA 3U69H 1HAGE 1FIWA 2PGQB 1JRTA 3P8FA 3NZIA 2O8TA 3I78A 4TPYA 1N1LA 1W2KH 3NCLA 1F0RA 2FOCA 3E90B 3O8RA 2B8OH 5EGMA 1WUNH 2R3UA 4JCNA 5JBBS 2HLCA 3BTME 4X1QU 1O2XA 4YESB 2BDIA 5EXNA 1QRZA 3A7YA 1SOZA 1FDPA 1ANCA 4MNWA 1ESBA 2FEQH 1XKAC 3RXHA 2ZCKP 1PQ7A 1SGNE 1SGYE 2P8OB 3MOCA 1GCTB 4X8SH 5DJ7A 1HV7A 1QJ1B 2G55A 1O3JA 5GPIB 2ZCHP 4B74A 1BHXF 1AB9B 2LNCA 1S81A 1BCUH 3SU2A 4TPIZ 3PLKA 8GCHF 1K1OA 2ZDLA 4CRBA 1F0TA 4ZKOU 1PYTC 5B6OA 3E91A 2V0BA 1P2OA 3K6YA 4J2YB 3RXFA 4FUDA 2TGPZ 4H4FA 3QUMP 4A1VA 3DT0H 3MO6A 2WPKS 4NA8A 1H4WA 1DOJA 5IDKA 1AGJA 1G36A 2OLGA 2ZC9H 2BXUH 4X8TH 3A81A 3LC3A 3RMMH 3MWIU 3A8DA 4JZDH 1ABJH 5ESBA 4IGDA 4AG1A 3M3TA 1HIAA 3P8GA 3FAOA 1HIAB 2CGAA 1NC6A 2VIOA 1P05A 3S9AA 3SV9A 1UTKA 1GMDG 1SHHB 5FX6A 1BQYA 1GHAG 2XBWA 3IG6B 1NRRH 1C1QA 1V2JT 2ZZUH 5A09A 2B7DH 1ZJKA 2ZHFH 5C67A 3Q3XA 3NPSA 3AAVA 1FY5A 1EQ9A 1QA7A 1EJNA 1RXPA 4Y76A 3T5FH 3AAUA 2IN2A 1S84A 1S6HA 2ZDKA 4NCYA 1PQAA 3RMOH 1HAOH 4DT7B 1YPMH 1QBOA 3SJ9A 1CU1A 3B9FH 3IWMA 4A92A 1O2HA 3VGCB 2SGDE 6GCHF 3VB4A 5LPEA 1BIOA 2B9LA 2ZU2A 1C5LH 1DXWA 3E1XB 1OSSA 2QN5T 1Y3WA 2ZHDA 4GUXA 2ZDVH 3EDXB 4ABGA 2W26A 1NY22 2ZGJA 4I8HA 1YKTA 2RA0A 1TX7A 1Z8RA 4ABHA 2IJOB 1GDUA 2VVVA 1AZZA 5F8TA 1NFYA 2THFB 2J95A 3MHWU 4ABBA 1AE5A 3RC6A 1C5NH 1PJPA 5FCRA 3SUDA 4KP0A 1CA8B 2XC5A 3RXQA 1SLUB 1W3CA 3FANA 2HGTH 1FI8A 2GVFA 1B0EA 2FOBA 1TA6A 3RXMA 2SGAA 3NXPA 1BTZA 1DICA 4ABAA 1SGRE 3O8BA 2SGFE 5DG6A 1SOTA 1KY9A 3OTJE 3SQEE 1FXYA 4U32A 1P12E 1SLVB 1BBRE 2QAAA 3BN9A 2FP7B 1PPZA 3TJUA 3KQEA 3AW1A 1D6RA 2GCTB 1MD7A 2AYWA 2ALPA 1BTYA 1Y5AT 4ABDA 4AFSA 3L33A 1GGDB 1C4V2 3PMJA 3ZVDA 4FXGH 2NU2E 3ODDA 2EEKA 2ZGXH 1Y5BT 2BY6X 4LOYH 1TGBA 4CHAB 3F68H 1KIGH 4FU9A 2FYQA 3HGPA 3UREA 1AHTH 1BTXA 1FY4A 2ESTE 4B75A 7LPRA 3F1SB 5CMXH 1FPCH 4Q7XA 1SQAA 1P03A 2Q6GA 2BOKA 1ETRH 2VIPA 5C3NA 2W7SA 1O2TA 4CREA 2XNIA 1C9PA 2ZDNA 1L4ZA 4GHQA 3M3VA 1TGNA 2FMJA 2FXRA 1Y3XA 3D23A 3M61U 3T25A 3T26A 2Y7ZA 3S0NA 1EP5A 3BF6H 5CE1A 5AHGH 1ZOMA 2H9EH 1EB2A 4X6NA 1YM0A 2ZECA 1P2KA 4X8UH 2J94A 3RXCA 2IOTA 1MKXH 4FUIA 6CHAB 1PPFE 2Z7FE 1LHDH 3GYLB 4DY7B 5GXPA 1DANH 1SG8B 2A7HA 1TLDA 2ZFPH 1DWCH 1V2LT 1BUIA 1ZMJA 4ISOA 2FZZA 2OCVB 2A32A 2GDEH 3TNTA 2VH6A 3SV2H 3SHCH 1CBWB 1WU1A 4DIHH 3LU9B 1F0SA 1V2TT 3VB5A 3TH3H 1RIWB 1O38A 2HNTF 1GJ5H 1V2RT 1DY9A 1LPGB 1FAKH 3EA7A 3RLWH 5DP7A 1WOFA 4I7YH 1Z1IA 4DVAU 1TRMA 2A7CA 3TPIZ 2ILNA 1GDQA 1MQ6A 3A8CA 1YYY1 3ZVEA 4FUHA 2BB4A 1SGFG 3HK3B 5E0JA 4FUEA 1A61H 1O3CA 3K65B 4FVBA 1SPJA 1ZSLA 4THNH 1BMAA 1EP6A 3SV7A 4K2YA 2UWPA 3PB1E 2OQ5A 5GCHG 1XXDA 1UVSH 1C4U2 2VWNA 1U6QA 5PTPA 1C5VA 5K7RA 3MU8A 1O3PB 3GCHB 3HGNA 4BTIB 3KIDU 3M5OA 4Y7AA 1EX3A 1JIRA 1C1UH 1CHOG 1OWEA 1A46H 4MNXA 1Y3UA 1T8MA 2BLVA 3OX7U 1MMJN 1ELDE 1T31A 4Z6AH 1EZSC 1MTUA 4OGYA 5TCCA 1GJBB 3ZVFA 1J15A 1KXFA 2PGBB 4OS4A 4KGAA 1TB6H 2ZIQH 7ESTE 1TX6A 1Y59T 3ZZDA 2OBQA 2WPJS 4MPUA 1EPTA 3SGQE 1GBIA 2H2ZA 2FX4A 1BITA 2P3FH 2PTNA 1NT1A 4K69A 3A8AA 2VGCB 1P9SA 4NIXA 1GBHA 4U30A 1W0YH 4YOIA 1DLEA 2J34A 1SGIB 5F8XA 1O34A 4Q7ZA 4I8GA 5EODA 1FPHH 2H9TH 1GHBG 4GLYA 5TCAA 1UK3A 1TNKA 1TPPA 3MH4A 3CS0A 3BTFE 1DLKB 2G8TA 1C5WB 1V3XA 4UDWH 1EJAA 1X7AC 2BXTH 2PUXB 3FZZA 1ZJDA 3NWUA 3DA9B 1DWEH 3VB3A 4TWYA 5EOKA 1BT7A 4WF8A 2A31A 5ABWA 3RXEA 1IQMA 5JDUB 1NZQH 2AFQB 3ITIA 2ZFRH 3UTUH 2YNBA 3KCGH 2ZFQH 4R8TB 1P04A 1Q3XA 2C8ZB 1QL8A 3GOVB 3DD2H 2WUBA 3SNBA 4Y7BA 1FMGA 2PR3A 1MBQA 1RS0A 4O97A 1MTWA 2O8UA 4MQAA 2EI6A 1FJSA 3DFLA 5E2OA 4IN2A 1TNGA 3AW0A 2ZCLP 1RFNA 2HOBA 3P8OA 3RU4T 1K9OE 1PPGE 1KXAA 1AU8A 1ZPZA 2BLOA 3LGTA 2GT8A 4E7NA 2PKSC 3RLYH 5HM2A 2WPLS 1DSTA 4GSOA 3BEUA 2FI5E 4DJZB 4BXSA 4XOJA 1H9HE 1HJAB 2XTTB 2QXIA 3OSYA 1DITH 5FCKA 4KTUA 1NTPA 2J4IA 1V2NT 1UJ1A 4ABEA 1OYQA 1GI2A 4YT6H 3BG4B 1C5XB 1YBWA 2AIPA 4UFEH 1GG6C 4AOQA 1NFUA 4X6PA 2AIQA 1W14U 1EAWA 4CR9A 1Y8TA 4X2XA 3TIUA 1LVOA 1XVMA 2B5TB 1FAXA 1C1OA 1WBGB 1ZMLA 4UFFH 1MZAA 1NRQH 2BZ6H 3RXUA 2XBYA 3URCA 3LC5A 2BY8X 1HFDA 1Z8JB 2CJIA 1O3MA 2BYAX 1LHEH 2A4RA 3D49H 3VPKA 3QX5H 1GJ6A 1GBKA 1VCQA 1SLXB 1AQ7A 1J8AA 2W3KA 1HXFH 2AGGX 2Y5FA 1Y3YA 1G37A 3U8RH 1VJAU 3SI3H 1CGIE 2GMTB 1LO6A 2FTMA 1O5FH 1EB1H 1AFEH 2QGRA 3A86A 3SORA 3SHAH 1GMHF 2AS9A 4BAQB 4Y79A 1W10U 2UUFB 1TBQH 2O8LA 1GBMA 1SFIA 3RU4E 4A1XA 4BAMB 3NUMA 2C90B 4WMFA 2OUAA 1UMAH 5C20A 3RXBA 1UCYH 2HWLB 1WTHD 1HAXB 5CHAC 1BMLA 3ZVCA 1ELBA 3QZQA 1XUJA 2SFAA 1OWKA 4WXVA 1QTFA 1K1IA 1NPMA 3UFAA 1O0DH 3L6PA 1PPBH 4Y0ZE 3KNXA 3EAJA 1LVYA 1SC8U 1L1JA 2ZNKH 3MI4A 2VWLA 1WV7H 1LHCH 2ZEBA 1BTWA 1DE7H 2BDBA 2G81E 1ZLRA 4MDSA 3Q76A 3P70B 3PWBA 2G00A 1QB6A 1MCVA 3A7TA 2G4UA 3RXPA 2ZHEH 1FLEE 4AZ2B 4O9VA 1ZGIA 3KQBA 1L0ZA 4A7IB 1QJ7B 2J9NA 5L2ZH 2BDGA 3T62A 8GCHG 4FU8A 3VFEA 2AEIH 2CF8H 1C5RA 4B2AA 5FXLA 1ZMNA 2Y7XA 3M37A 2BDAA 3ZV8A 4OS7A 1C5OH 1DWDH 1O30A 4TY7A 1SGQE 3RXGA 4YM9A 2ANWA 3ZZ5A 1LMWB 1AMHA 4ZMAH 1RD3B 3VXFH 1MCTA 1K1MA 3ZZ9A 1DUAA 1HPGA 4TWWA 4BXWA 3F6UH 2NU1E 2W7UA 2FLRH 1PQ5A 5ESTE 2K1QA 4GHTA 4SGAE 2JETC 1P9UA 1G30B 2A1DB 4AFQA 1ZR0A 1EZQA 3RC5A 4ZAEA 4SGBE 4NIWA 2UWLA 4Q2KA 3A7VA 4M7GA 4ZXXH 2HNTE 1BTPA 3SUEA 4XSKU 2P95A 2ZTXA 3VXEH 1O2GH 1G3CA 5C1UA 1J16A 1EATA 2ZQ1A 1JBUH 1F92A 1AKSA 3BTTE 4RKJB 1UK4A 4AORA 1AKSB 3M7UA 3UOPA 2VWMA 2R0KA 3RXRA 2H5CA 4JYTA 3SGAE 2UUYA 3KGPA 4CH2B 2H6MA 3KQDA 3P8NA 3BTWE 2FODA 5FBEA 6GCHG 5DKMA 1QFKH 2BX4A 3UNQA 1PFXC 2H5DA 3ZZ7A 2J92A 1AUTC 1GBLA 1P57B 1QJ6B 3SI4H 4D9RA 1VGCB 1VITF 2R2WU 3ZYEA 1BJUA 2IPHA 1ZTLA 3A7WA 2D1JA 4WH8A 5A8ZA 3ZZCA 2ZI2H 2FOMB 2P94A 2F91A 2A7JA 1DFPA 1NRPH 4YZUA 1AFQB 1O3OA 2UUKB 3MU5A 1DS2E 1ZPBA 3PWCA 5E8EH 3BTQE 3P92A 3SOSA 1TNJA 5LPFA 1HUTH 2XWAA 5DPAA 1K1LA 1THPB 2GX4A 3BTEE 2D2DA 1T4VH 3RXAA 2ZQ2A 3Q3YA 1FONA 5A2MH 3VB6A 4K1TA 1O36A 1GCDA 1HLTH 3TGKE 1RTKA 2Z6BD 1KYNA 1KLJH 3A7ZA 3BEFB 2D8WA 3GCNA 1MTNC 4I8JA 1O32A 3UWJH 1ETSH 2R0LA 2HPPH 3RXKA 1NFWA 1N8OB 3MH7A 5TJXA 3TH4H 3EA8A 2ULLA 4MLFB 2QXGA 1WQVH 1XX9A 1SHYA 1QL7A 2QF3A 1GCTC 1QA0A 4TY6A 2STAE 4Y8YA 3AASA 2F9VA 2BQ6B 3BIUH 2ZKSA 3ZZAA 2V6NA 5G4BA 4X1PU 1ARCA 2SGPE 1AB9C 1TGCA 4XE4A 1W8BH 4BANB 2EI7A 1ZTKA 4ISIH 2R9PA 4RKOB 1AVGH 1GVZA 2AGIX 2ZPRA 1NU7B 2V3HH 1YGCH 2ZHQH 1Z7KA 1J9CH 1HAYB 3KQCA 5LH8A 1TONA 1YF4A 4E7RG 4UFDH 1HAIH 2HRVA 1G2LA 1W0ZU 4MTBA 2ZPSA 1CSOE 2AMPA 1HGTH 2O8MA 1SGTA 2OQUA 1GBBA 1YCPH 1SGEE 3T28A 1TFXA 3T2NA 1TIOA 1YPEH 3ELAH 2F83A 4JYUH 1EOLA 1QBNA 3FP6E 1O33A 3TGIE 4ABJA 1WCZA 2EC9H 1O2QA 1P01A 1UTMA 3MU4A 4ZUHA 4YOJA 1GHVH 1GWAA 2AH4X 4ZHAA 4FUFA 2OC8A 2BTCE 1AWFH 1PPEE 5AF9H 5EG4A 2H9HA 2HNTC 1Q2WA 4NSVA 3MNBA 3LDXH 2BDHA 1UTPA 4B1TA 3MYWA 2EA3A 3BV9B 4IBLH 1YPHE 2ZWLH 3JZ2B 1GI9B 2GT7A 2OC1A 3F9FA 1GI3A 3GCOA 1OP0A 4HI3A 4DCDA 1QY6A 3VGCC 1GMCF 1S83A 2OD3B 1LHFH 1TRNA 5DP3A 2F9BH 1V2PT 1F0UA 1O2MA 1O2VA 2R3YA 1KLIH 3PLBA 1HCGA 2JH0D 5EPYA 1EUFA 2W3IA 3K6ZA 4YTAA 2P59A 3RU4D 2ZFTA 3GCTF 3HKIB 2A5AA 1O5AB 2G52A 3PMHB 1FUJA 2WPIS 1T32A 2GP9B 1QBVH 3S9BA 4INLA 1IQJA 2OP9A 2RG3A 1SB1H 5I46H 3LJJA 1GBCA 1OOKB 1TAWA 7GCHF 4CRAA 3ZVGA 1P09A 4DG4A 1RRKA 1K22H 2XBVA 2B0FA 2F9UA 4UFGH 3QGNB 1C1SA 2Y80A 3TGJE 2C8WB 3HPTB 4NIYA 1BB0B 1V2OT 1GPZA 2O9QA 1KXCA 4AGKA 1FY1A 1GGDC 1ZSJA 2ZP0H 2TGDA 4NZLA 3QDZB 4JYVH 4B73A 3OYPA 4ISLA 4CH8B 5H4IB 1XVOA 1IQGA 1O5DH 2FWWA 1QRXA 5A0BA 5A0CA 4CHAC 3KHVA 1XUGA 1OX1A 3MNSA 3MH5A 1FZZA 1RTFB 2A5KA 3ODFA 8LPRA 3SV8A 5JPMH 1E37B 2AMDA 1KXBA 4CRCA 1A4WH 1GVKB 4D8NA 5JYIA 1DVAH 1GL1A 5LPRA 2Z9IA 1ZHRA 3SV6A 1C1RA 1O2JA 1E38B 1AI8H 1TGTA 3VB7A 1WQSA 2GGVB 2XW9A 2P3TB 1H8IH 1O3IA 2AGEX 3TJNA 2O8WA 1EXFA 3MNXA 2Z9LA 1C5QA 3M3SA 2FI3E 4Y6DA 1P2IA 1K1NA 2WPHS 1C4Y2 3U9AH 2CV3A 1O39A 4MNYA 1BDAA 1P2JA 2XYAA 6CHAC 4YLUA 4XBDA 4K8BA 2XXLA 3LJOA 4Q80A 1TNLA 4Y8ZA 4BOHA 1CA0B 1BBRH 3LGYA 1ELCA 3STJA 2ZTZA 3FVFB 4OS5A 4KKDA 4U2WA 3NKKA 1HJ9A 3ZZ4A 1CBWC 3UWIA 5LGOA 3F9HA 1C9TA 1OWJA 2WV4A 1GJ7B 4JK6A 1RIWC 2C93B 4A5TS 5A0AE 1SMFE 3UUZA 1A5IA 2Q1JA 1OWDA 5HXFA 5EXMA 1K1PA 1YPHC 3S7HB 1O5EH 5T6GA 1O3LA 1WYKA 1BRBE 3E8LA 1C1NA 3CS7A 2FOHA 1NU9A 1MKWH 1O5GH 1Z71A 1C5TA 6LPRA 2FOAA 2C8XB 1B7XB 1D3DB 1FNIA 1XUIA 2BM2A 2ZTYA 3QK1A 5HM9A 2BLWA 1P8VC 1CT2E 4K8YA 1Y5UT 5EW1H 1HAVA 3SZNA 1GL0E 1AWHB 1HAVB 4WVPE 3UNRA 3GCHC 1LCYA 3DHKH 3QZRA 4X1NU 1O3AA 1XUKA 1GJ9B 2P16A 1KDQA 4HGCA 3U8OH 3ZV9A 3GY4A 1C2KA 2Z3DA 1NRSH 5JBCS 1KDQB 2V35A 1L4DA 3MO9A 2VU8E 2NU0E 4DURA 1C2FA 2V3OH 1IQIA 2VIWA 2PSYA 1A7SA 1C1TA 3V13A 1O2WA 1H9IE 4K1SA 3ATMA 2FLBH 1PPHE 1EPTC 8KME2 5DO4H 2VGCC 2ZGBH 1UVPA 1TX8A 4CBNA 3LKWA 1E36B 3OU0A 9ESTA 3QLPH 1A0LA 3M36A 1VCWA 1GMHG 3RMLH 1HDTH 2PKAA 3MU1A 1T8OA 4E06H 3K2UA 2PKAB 4NGAH 3HK6B 2NU4E 3PO1B 4J1YA 3FP7E 4OS1A 3ZZ3A 1GBDA 4BNRA 1GJCB 1N6YA 1TBZH 2A2XH 1AIXH 1QURH 1O5CB 4ZXYH 3M7QA 2ZFFH 2ZU4A 3LGWA 4YLQH 1AD8H 1O2IA 3SNDA 5L30H 1IQHA 3T29A 3EGKH 4IS5A 1EAUA 2QXHA 3URDA 1QIXB 5A8XA 2YNAA 2PFEA 2GD4B 2ZPQA 4B76A 2ZGHA 3PM3A 3RXDA 3MNCA 5IYTA 1V6DA 5E0GA 1NROH 1BRUP 3D62A 2Y5HA 2CN0H 1EAIA 2Z9GA 2BDCA 2SNVA 4Y0YE 2NU3E 4IMQA 3PMAB 1SSXA 1DWBH 2GCHF 2ZA5A 3F9EA 4RSPA 2G51A 4BAHB 3UQVA 1ETTH 4K60A 3H5CB 1QCPA 4H6TA 3PTBA 2WUCA 1O31A 3TVJB 3HATH 3M35A 1H1BA 4CBOA 1HJAC 2OC7A 1S85A 3DUXH 1W11U 4JZ1A 4ISNA 4AB9A 4Y10E 3UY9A 1QNJA 1TE0A 1W12U 1QHRB 3KL6A 1YP9A 4B2CA 1LQDB 5E2PA 3SJ8A 1S0QA 2FI4E 4XDEA 4WH6A 1VITH 1AUJA 3BG4C 4FUJA 2VWOA 1WSSH 1DM4B 2FESH 1DX5M 1L2EA 4LZ1H 1C2EA 3PMBB 4OS6A 4IC5A 3I29A 1LDTT 3OY5U 3BTGE 2DUCA 2ZGCA 3P6ZB 1EKBB 4BAKB 5DP6A 2C8YB 2BVXH 2TGTA 5EQSA 1W13U 3E0PB 1T7CA 1TNHA 2PLXA 1A0JA 2F9OA 1Q31A 1K21H 2EI8A 1S82A 4A1TA 1O2ZA 2YOLA 1BHXB 1V2QT 1C5MD 3EE0B 1NS3A 2ZU5A 4ABIA 2ZG0H 3LH1A 3GDSA 3RUOA 3KN2A 3A89A 3SO3A 1WTGH 1KTTB 2CHAB 1VITG 1TBRH 2GMTC 4VGCB 3SUGA 1AVWA 1QB1A 1TQ7B 2VIQA 5F6MA 1TYNA 2FS8A 3SUFA 1YLCA 1TQ0B 5HGGA 1SGCA 1TABE 2P3UB 2XRCA 4BTTB 4CRDA 2PHBA 1HBTH 1O2PA 1XM1A 6ESTA 3WY8A 1P3EA 3Q00A 2PTCE 3V12A 1H8DH 1P2MA 2ZO3H 1GI8B 2Y6TA 1D9IA 2BD4A 3QGJA 1O2RA 4NWLA 1E35B 4LXBH 2WINI 1D3TB 3SJIA 3GY2A 3VEQB 5A8YA 1JXPA 2BLQA 1GDNA 5JB9S 4IN1A 5AFYH 3S9CA 2RCEA 1L1NA 1D4PB 4NZQA 1ZRKA 4GCHF 1HNEE 1JRSA 1OPHB 2FOEA 1BRAA 1GHZA 1C5PA 3KF2A 2TRMA 3Q3KA 3TU7H 1C2LA 2A4OA 4ZROA 3I77A 3GY6A 5K0HA 2C4FH 1A1RA 3PROA 3FP8E 2G5VA 2D26C 4YOGA 2A4QA 5AVDA 3RXOA 1DUEA 1Z8IB 3CENA 3SU6A 2FOGA 1GI5A 1GVLA 3M5NA 4WMDA 1FIZA 1O3FA 1V2VT 2I6QA 3MFJA 2XC0A 4KTCA 4AGJA 4TYDA 4NFFA 4UD9H 2BD2A 1ARBA 5F03A 2QYIA 1ZRBA 2CMYA 1MBMA 3L3TA 4DOQA 2WYJA 1UK2A 1DSUA 2ASUB 1TOMH 3SU1A 1JOUB 1C5ZB 1XMNB 1SQTA 1FN6A 1ORFA 3SU0A 4CRFA 1AN1E 2XCNA 1P02A 3RM0H 1UTOA 5FPTA 1VJ9U 1BRCE 3RXTA 3STIA 4NWKA 1QGFA 5FHTA 1GBFA 1E0FD 1CQQA 4ABFA 1IQNA 2Z9KA 2BDYA 4AFUA 4RN6A 3SJKA 1FN8A 4NA9H 5EU8A 1P0SH 1LVMA 1XUHA 1INCA 3Q77A 1EZUC 1GBTA 2A5IA 1LTOA 3HKJB 1MTNB 3UR9A 2BMGB 1SI5H 1ESAA 1BA8B 1HB0B 1NESE 2SGQE 5C2ZA 1A2CH 3PYHA 2DE8A 3RMNH 1F7ZA 1GMCG 1TPSA 3MU0A 1GI1A 4X2YA 1B5GH 1UCYK 2ZU1A 1LQEA 1KTSB 4R0IA 1P3CA 1IHTH 1VGCC 4X1SU 2ZDMA 4AB8A 2GZ8A 2Y82A 1P2NA 3ATIA 1KXEA 4IC6A 3EYDA 2P8OC 3GCTG 2BD9A 1AFQC 1C1VH 1F5LA 1O3HA 2JH5D 3RXLA 1ZPCA 2PSXA 5ETXA 3A83A 2HPQH 1GHWH 4Y8XA 2QCYA 2BD7A 5F8ZA 1TGSZ 1UVOA 1C1MA 7GCHG 4WWYA 5DP9A 2FX6A 4XBBA 1O3GA 1TMTH 1O2SA 1T4UH 3E16B 3DFJA 4NA7A 1UTLM 1D3QB 1CT4E 5EW2H 2GV6A 1XKBC 4PROA 2GKVE 1BJVA 1QL9A 2VJ1A 4H6SB 5L6NH 2FTLE 3TK9A 4JMYA 4WMEA 2ODYB 4NG9H 2R2MB 1N8OC 3QTOH 4K1EA 1BOQA 2TPIZ 1ELEE 2ODQA 1XXFA 3B23B 2A2QH 3TK5A 1J14A 1GJAB 1O3EA 2Y5GA 3LH3A 1SGPE 1SBWA 2BY9X 3ATLA 5HMAA 5HYOA 2QA9E 3BEIB 3OY6U 5EQRA 3A87A 1O3DA 4FVDA 2BD8A 1HXEH 4DGJA 1ESTA 3RXSA 3ATKA 4AYYB 1UO6A 1RTLA 3GICB 3SW2B 1FV9A 4UONA 2FIRH 1ELFA 2FM2A 1BMNH 2TBSA 1O2YA 3GY7A 3A8BA 4AYVB 3A80A 1BZXE 3P95A 1ANEA 1MH0A 2QV1A 3ZVBA 1CT0E 1BTUA 2VVCA 4ESTE 2VIVA 4YT7H 5BPEA 1C2HA 4AX9H 1DDJA 1GJDB 1C2MA 4E05H 1SR5C 3R0FA 2Y81A 4ZH8A 3SQHE 5C1XA 1C5SA 1C5YB 1MAYA 1RGQA 3FFGA 1GBJA 3R3GB 1CE5A 1TA2A 1C2DA 1QRWA 1G32B 2FDAA 1KSNA 1LKAA 1TPAE 2AMQA 2QC2A 4X1RU 2LPRA 5JB8S 2HALA 5GDSH 2QXJA 1MU6B 1LHGH 3BTKE 3JZ1B 3H7TA 3SGBE 1O3KA 5DGJA 2GTBA 1GHYH 2WV5A 1MUEB 1H9LB 2PUQH 2ZF0H 5SGAE 1PYTD 4ZHLU 4D7FA 3U98H 3SJOA 1XUFA 2GCTC 2BVRH 3LIWA 3PTNA 4GPGA 1FY8E 1LPZB 1NFXA 1V2KT 1GMDF 1TNIA 3A88A 4IMZA 4GVUA 4LK4A 2Z3EA 1GHAF 5C1YA 3UPEA 4B2BA 1O37A 2OC0A 5DP4A 1MTVA 1YPGH 3LGUA 2KAIA 1TALA 1CGHA 1CHGA 2OTVA 2SNWA 2KAIB 1IAUA 1F5KU 5J4QA 3LGIA 1VCPA 3V0XA 2ANYA 2C3SA 2XWBI 4HFPB 1G3EA 1MAXA 1O3BA 4WJG2 3RM2H 1A3EH 3TJVA 2H1UA 2RDLA 2PV9B 1HAPH 2QY0B 1SGFA 3ZZ8A 1ZGVA 3E6PH 1UVUH 3KEEA 4F4OC 1OS8A 4MPVA 1WAYB 3MH6A 1ANBA 2W5EA 1HAHH 2JKHA 1Y3VA 1O2OA 2VVUA 1PPCE 3K9XB 3QTVH 1E34B 2PW8H 5T6FA 2ANMH 2XC4A 1MQ5A 4IW4E 2J2UA 1C2IA 3BIVH 1ELVA 3BTDE 3U8TH 3E0NB 3M7TA 5I25A 4UE7H 4MG3A 1P2QA 5DK1A 1IOEA 4D76A 4ZKSU 8ESTE 1Z8GA 1OYTH 3SBKA 9LPRA 1YCPK 2BQ7B 3ZVAA 1TMBH 1A0HB 3ZZBA 2F3CE 3EA9A 1Z1JA 1W7GH 1NO9H 5EPNA 1UTQA 1YPLH 3ZYDA 2DE9A 1CO7E 3V3MA 1AY6H 3PV4A 5FAHA 1EAXA 4MPWA 1CVWH 1VZQH 1AVXA 2ANKH 1G3DA 2Q6DA 4OGXA 4LZ4B 1S6FA 4HTCH 4HZHA 3S7KB 1C1WH 1UTJA 5JBTA 1ANDA 3GYMA 2ZHWH 4AN7A 4XBCA 1F2SE 1BMMH 4MVNA 3IITA 5BRRE 1QR3E 1CA0C 5E0HA 4X0WU 2J38A 1K1JA 1ACBE 4Y11E 3LOXA 1N6XA 1A3BH 1IQEA 4H42U 1ABIH 1GI0A 2BY7X 1S0RA 4I8LA 4NIVA 1MD8A 3UIRA 2G5NA 2ZFSA 1ZHPA 1HJ8A 1P10A 1JWTA 1T8LA 2VIDA 4JZFH 3MO3A 3PLPA 1JIMA 2QF0A 1D3PB 2BHGA 2GCHG 1ZZZA 1MU8B 4K5ZA 2ZDAH 1O3NA 3A84A 3LPRA 3RDZA 3UR6A 2F9PA 5FX5A 1EPTB 3BTHE 3UOUA 4DIIH 1KXDA 4AFZA 2AERH 4F49A 3RC4A 4FUBA 4ZKRU 2TIOA 4KTSA 1IQFA 1YPJH 4GAWA 4INHA 3RXVA 1SFQB 3TITA 1VR1H 4Z0KA 3TJOA 4UEHH 1AO5A 1ELTA 2CF9H 2F9NA 5EQQA 2WPMS 2GZ9A 4CR5A 2FYRA 4BTUB 1S5SA 3E3TA 1P06A 1D6WA 2BZAA 2Q6FA 1OWHA 1HYLA 1MKXK 3QN7A 1OKXA 2NWNA 2TGAA 1G2MA 1O5BB 3RXJA 2VH0A 1T8NA 4X6MA 2CXVA 2PKSB 1G9IE 4FUGA 1O2LA 4I32A 3LT3A 1A5HA 1EZXC 2BX3A 1M9UA 2BVSH 2FS9A 3UQOA 3T27A 4KELA 1UCYE 4D9QA 4MNVA 3SU3A 1L1GA 3SN8A 1Z6JH 2HVXA 5GCHF 2VB0A 3MMGA 3CP7A 3W95A 1LKBA 5DP8A 3SNAA 3RXIA 5C5NA 3EQ0H 4Y71A 1SL3A 1GG6B 1DPOA 1GBAA 1TRYA 3TLOA 1ZHMA 1AE8H 2A0QB 1CHOF 5AFZH 3QWCH 4I33A 1AZ8A 3SU5A 4FUCA 3ATWA 3D65E 3PO1C 1O2UA 1O2NA 1OXGA 1V2MT 1BBRK 1O35A 1W7XH 5EXLA 1EJMA 4MPXA 4X2WA 2GDDA 1K28D 1YCPM 4FU7A 1TPOA 1ELGA 3U1IB 5T6DA 1FY3A 4AG2A 1V2UT 2P93A 2XCFA 3B8JA 1IHSH 2A45B 4GCHG 1GBEA 1HAZB 2BD5A 2UWOA 1YLDA 3A85A 3BSQA 3GY3A 1GHBF
chains in the Genus database with same CATH superfamily
3S69A 1SLWB 2BY5X 3H7OA 5DP5A 2FPZA 2M5TA 1MKWK 4O03A 3LGVA 4A6LA 2BOHB 3GY8A 3V7TA 2GZ7A 1ZYOA 4D7GA 2ALVA 1GI4A 1V2WT 5CHAB 3DCLA 1THSH 4X8VH 1C1PA 1EASA 1SVPA 2Z9JA 2A4GA 4K3JA 3TNSA 2G4TA 1GHXH 2BD3A 2Z3CA 4U01A 1SGDE 2BQWB 4X6OA 1PQ8A 2RA3A 4XFQA 3W94A 4NFEA 1P11E 1OWIA 1RJXB 4JK5A 1UHBA 4CRGA 1ZSKA 1YC0A 1UVTH 1DXPA 1UHBB 1IQLA 1V2ST 3C27B 2OBOA 3ENSB 3P17H 1G3BA 1B0FA 3C1KA 1C2GA 1NRNH 3U1JB 2STBE 1GI7B 2I6SA 1NM6A 5GJ4B 1O2KA 2ODPA 4INKA 4B71A 3ESTA 1EOJA 1C2JA 7KMEH 4X2VA 4JZEH 4ASHA 1OP2A 1W0JD 3SNCA 1YPKH 4WXIA 5GWZA 3GY5A 2GV7A 3SU4A 1F5RA 1TWXB 5L2YH 1IQKA 3FZDA 1SQOA 3G01A 3M5LA 5FPSA 2FO9A 3N7OA 2VNTA 4ZKNU 4O3UA 1GJ8B 5J4SA 2PWXA 5JBAS 3SNEA 3WWFA 4WY3A 4DW2U 2JETB 2CHAC 2FOFA 2JH6D 1J17T 2OINA 4VGCC 1LPKB 2JJ2D 4F48B 1KLTA 3M5MA 5C5OA 2Z94A 3GDVA 1QQ4A 4ZHMU 2SGEE 3UNSA 1K2I1 4YO9A 3BG8A 1TMUH 4BAOB 2WYGA 4QT8C 3TK6A 1DY8A 2UUJB 3A82A 3TH2H 1QQUA 1DT2A 1A5GH 4I8KA 1HRTH 5FPYA 2QIQA 1NN6A 1OP8A 1TOCB 3GDUA 3ZZ6A 1ID5H 1ZTJA 1CGJE 1QB9A 1ELAA 3A7XA 4I31A 4O3TA 4NSYA 2ZU3A 5FBIA 4Q7YA 1FQ3A 3NK8A 1UTNA 1THRH 2EY4C 4ISHH 5GIBA 1GJ4H 3RP2A 3O8CA 1BTHH 3QO6A 2OXSA 3GISB 3AVZA 2XBXA 1C5UA 4OS2A 1LVBA 1GI6A 3LONA 3O8DA 3MTYA 3F9GA 1Z6EA 1MZDA 1JMOH 1MTSA 2VINA 4JZIA 5T3HA 3U69H 1HAGE 1FIWA 2PGQB 1JRTA 3P8FA 3NZIA 2O8TA 3I78A 4TPYA 1N1LA 1W2KH 3NCLA 1F0RA 2FOCA 3E90B 3O8RA 2B8OH 5EGMA 1WUNH 2R3UA 4JCNA 5JBBS 2HLCA 3BTME 4X1QU 1O2XA 4YESB 2BDIA 5EXNA 1QRZA 3A7YA 1SOZA 1VKYA 1FDPA 2WHXA 1ANCA 4MNWA 1ESBA 2FEQH 1XKAC 3RXHA 2ZCKP 1PQ7A 1SGNE 1SGYE 2P8OB 3MOCA 1GCTB 4X8SH 5DJ7A 1HV7A 5DSFA 1QJ1B 2G55A 1O3JA 5GPIB 2ZCHP 4B74A 5DN6D 1BHXF 1AB9B 2LNCA 1S81A 1BCUH 3SU2A 4TPIZ 3PLKA 8GCHF 1K1OA 2ZDLA 4CRBA 1F0TA 4ZKOU 1PYTC 4FOUC 5B6OA 3E91A 2V0BA 1P2OA 3K6YA 4J2YB 3RXFA 4FUDA 2TGPZ 4H4FA 3QUMP 4A1VA 3DT0H 3MO6A 2WPKS 4NA8A 1H4WA 1DOJA 5IDKA 1AGJA 1G36A 2OLGA 2ZC9H 2BXUH 4X8TH 5GNDA 3A81A 3LC3A 3RMMH 3MWIU 3A8DA 4JZDH 1ABJH 5ESBA 4IGDA 4AG1A 3M3TA 1HIAA 3P8GA 3FAOA 1HIAB 2CGAA 1NC6A 2VIOA 1P05A 3S9AA 3SV9A 1UTKA 1GMDG 1SHHB 5FX6A 1BQYA 1GHAG 2XBWA 3IG6B 1NRRH 1C1QA 1V2JT 2ZZUH 5A09A 2B7DH 1ZJKA 2ZHFH 5C67A 3Q3XA 3NPSA 3AAVA 1FY5A 1EQ9A 1QA7A 1EJNA 1RXPA 4Y76A 3T5FH 3AAUA 2IN2A 1S84A 1S6HA 2ZDKA 4NCYA 1PQAA 2J98A 3RMOH 1HAOH 4DT7B 1YPMH 1OHHD 1QBOA 2J98B 3SJ9A 1CU1A 3B9FH 3IWMA 4A92A 1O2HA 3VGCB 2SGDE 6GCHF 3F2HA 3VB4A 5LPEA 1BIOA 2B9LA 2ZU2A 1C5LH 1DXWA 3E1XB 1OSSA 2QN5T 1Y3WA 2ZHDA 4GUXA 2ZDVH 3EDXB 4ABGA 2W26A 1NY22 2ZGJA 4I8HA 1YKTA 2RA0A 1TX7A 1Z8RA 4ABHA 2IJOB 1GDUA 2VVVA 1AZZA 5F8TA 1NFYA 2THFB 2J95A 3MHWU 1E1RD 4ABBA 1AE5A 3RC6A 1C5NH 1PJPA 5FCRA 3ZIAD 3EE7A 3SUDA 4KP0A 1CA8B 2XC5A 3RXQA 1SLUB 1W3CA 3FANA 2HGTH 1FI8A 2GVFA 1B0EA 2FOBA 1TA6A 3RXMA 2SGAA 3NXPA 1BTZA 1DICA 4ABAA 1SGRE 3O8BA 2SGFE 5DG6A 1SOTA 1KY9A 3OTJE 3SQEE 4RI0A 1FXYA 4U32A 1P12E 1SLVB 1BBRE 2QAAA 3BN9A 2FP7B 1PPZA 3TJUA 3KQEA 3AW1A 1D6RA 2GCTB 1MD7A 2AYWA 2ALPA 1BTYA 1Y5AT 4ABDA 4AFSA 3L33A 1GGDB 1C4V2 3PMJA 3ZVDA 4FXGH 4HG6A 2NU2E 3ODDA 2EEKA 2ZGXH 1Y5BT 2BY6X 4LOYH 1TGBA 4CHAB 5KGOA 3F68H 1KIGH 4FU9A 2FYQA 3HGPA 3UREA 1AHTH 1BTXA 1FY4A 2ESTE 2QE7D 4B75A 7LPRA 3F1SB 5CMXH 1FPCH 4Q7XA 1SQAA 1P03A 2Q6GA 2BOKA 3H09A 1ETRH 2VIPA 5C3NA 2W7SA 1O2TA 4CREA 2XNIA 1C9PA 1SQRA 1L4ZA 2ZDNA 3M3VA 4GHQA 1TGNA 2FMJA 2FXRA 1Y3XA 3D23A 3M61U 3T25A 3T26A 2Y7ZA 3S0NA 1EP5A 3BF6H 5CE1A 5AHGH 1ZOMA 2H9EH 1EB2A 4X6NA 1YM0A 2ZECA 1P2KA 4X8UH 2J94A 3RXCA 2IOTA 1MKXH 4FUIA 6CHAB 1PPFE 2Z7FE 1LHDH 3GYLB 4DY7B 5GXPA 1DANH 1SG8B 2A7HA 1TLDA 1YWUA 2ZFPH 1DWCH 1V2LT 1BUIA 2QF5A 1ZMJA 4ISOA 2FZZA 2OCVB 2A32A 2GDEH 3TNTA 2VH6A 4P02A 3SV2H 4DT4A 3SHCH 1CBWB 1WU1A 4DIHH 3LU9B 1F0SA 1V2TT 3VB5A 3TH3H 1RIWB 1O38A 2HNTF 1GJ5H 1V2RT 1DY9A 1LPGB 1FAKH 3EA7A 3RLWH 5DP7A 1WOFA 4I7YH 1Z1IA 4DVAU 1TRMA 2A7CA 3TPIZ 2ILNA 1GDQA 1MQ6A 3A8CA 1YYY1 3ZVEA 4FUHA 2BB4A 1SGFG 3HK3B 5E0JA 4FUEA 1A61H 1O3CA 3K65B 4FVBA 1SPJA 1ZSLA 4THNH 1BMAA 1EP6A 3SV7A 4K2YA 2UWPA 3PB1E 2OQ5A 5GCHG 1XXDA 1UVSH 1C4U2 2VWNA 1U6QA 5PTPA 1C5VA 5K7RA 3MU8A 1O3PB 3GCHB 3HGNA 4BTIB 3KIDU 3M5OA 4Y7AA 3SZEA 1EX3A 1JIRA 1C1UH 1CHOG 1OWEA 1A46H 4MNXA 1Y3UA 3PV5A 3KYGA 1T8MA 2BLVA 3OX7U 1MMJN 1ELDE 1T31A 4Z6AH 1EZSC 1MTUA 4OGYA 5TCCA 1GJBB 3ZVFA 1J15A 1KXFA 2PGBB 4OS4A 4KGAA 1TB6H 2ZIQH 7ESTE 1TX6A 1Y59T 3ZZDA 2OBQA 2WPJS 4MPUA 1EPTA 3SGQE 1GBIA 2H2ZA 2FX4A 1BITA 2P3FH 2PTNA 1NT1A 4K69A 3A8AA 2VGCB 1P9SA 4NIXA 1GBHA 4U30A 1W0YH 4YOIA 1DLEA 2J34A 1SGIB 5F8XA 1O34A 2HLDD 4I8GA 4Q7ZA 5EODA 1FPHH 2H9TH 1GHBG 4GLYA 5TCAA 1UK3A 1TNKA 1TPPA 3MH4A 3GS9A 3CS0A 3BTFE 1DLKB 2WZQA 2G8TA 1C5WB 1V3XA 4UDWH 1EJAA 1X7AC 2KZ4A 5C0TA 2BXTH 2PUXB 3FZZA 1ZJDA 3NWUA 3DA9B 1DWEH 3VB3A 4TWYA 5EOKA 1BT7A 4M9FA 4WF8A 2A31A 5ABWA 3RXEA 1IQMA 5JDUB 1NZQH 2AFQB 3ITIA 2ZFRH 3UTUH 2YNBA 3KCGH 2ZFQH 4R8TB 1P04A 1Q3XA 2C8ZB 1QL8A 3GOVB 3DD2H 2WUBA 3SNBA 4Y7BA 1FMGA 2PR3A 1MBQA 1RS0A 3OTPA 4O97A 1MTWA 2O8UA 4MQAA 2EI6A 1FJSA 3DFLA 5E2OA 2JJ1D 4IN2A 1TNGA 3AW0A 2ZCLP 1RFNA 2HOBA 3P8OA 3RU4T 1K9OE 1PPGE 1KXAA 3W1EA 1AU8A 1ZPZA 2BLOA 3LGTA 2GT8A 3F0OA 4E7NA 2PKSC 3RLYH 3NRLA 5HM2A 2WPLS 1DSTA 4GSOA 3BEUA 2FI5E 4DJZB 4BXSA 4XOJA 1H9HE 1HJAB 2XTTB 2QXIA 3OSYA 1DITH 5EJLA 5FCKA 4KTUA 1NTPA 2J4IA 1H8ED 3F3BA 1V2NT 1UJ1A 5CDFE 4ABEA 5C94A 1OYQA 1GI2A 4YT6H 3BG4B 1C5XB 1YBWA 2AIPA 4UFEH 1GG6C 4AOQA 1NFUA 4X6PA 2AIQA 1W14U 1EAWA 4CR9A 1Y8TA 4X2XA 3TIUA 1LVOA 1XVMA 2B5TB 1FAXA 1C1OA 1WBGB 1ZMLA 4UFFH 1MZAA 1NRQH 2BZ6H 3RXUA 2XBYA 3URCA 3LC5A 2BY8X 2VBCA 1HFDA 1Z8JB 2CJIA 1O3MA 2BYAX 1LHEH 2A4RA 3D49H 2JDID 3QX5H 1GJ6A 1GBKA 3VPKA 1VCQA 1SLXB 1AQ7A 1J8AA 2W3KA 1HXFH 2AGGX 2Y5FA 1Y3YA 1G37A 3U8RH 1VJAU 3SI3H 1CGIE 2GMTB 1LO6A 2FTMA 1O5FH 3KQ5A 1EB1H 1AFEH 2QGRA 3A86A 3SORA 3SHAH 1SKYE 1GMHF 2AS9A 4BAQB 4P00A 4Y79A 4TT3D 1W10U 2UUFB 1TBQH 2O8LA 1GBMA 1SFIA 3RU4E 4A1XA 4BAMB 3NUMA 2C90B 4WMFA 2OUAA 1UMAH 5C20A 3RXBA 1UCYH 2HWLB 1WTHD 1HAXB 5CHAC 1BMLA 3ZVCA 1ELBA 3QZQA 1XUJA 2SFAA 1OWKA 4WXVA 1QTFA 1K1IA 1NPMA 3UFAA 1O0DH 3L6PA 1PPBH 4Y0ZE 3KNXA 3EAJA 1LVYA 1SC8U 1L1JA 2ZNKH 3MI4A 2VWLA 1WV7H 1LHCH 2ZEBA 1BTWA 1DE7H 2BDBA 2XNDD 2G81E 1ZLRA 5F53A 4MDSA 3Q76A 3P70B 2KCYA 2G00A 3PWBA 1QB6A 4Q63A 1MCVA 3A7TA 2G4UA 3RXPA 2ZHEH 1FLEE 4AZ2B 4O9VA 1ZGIA 3KQBA 1H8HD 1L0ZA 4A7IB 1QJ7B 2J9NA 5L2ZH 2BDGA 3T62A 8GCHG 4FU8A 3VFEA 2AEIH 2CF8H 1C5RA 4B2AA 5FXLA 2J5UA 4AC9A 1ZMNA 2Y7XA 3M37A 2BDAA 3ZV8A 4OS7A 1C5OH 2LP6A 1DWDH 1O30A 4TY7A 1SGQE 3RXGA 2W6ID 4YM9A 2ANWA 3ZZ5A 1LMWB 1AMHA 4ZMAH 1RD3B 3VXFH 1MCTA 1K1MA 3ZZ9A 1DUAA 1HPGA 4TWWA 4BXWA 3F6UH 2NU1E 2W7UA 2FLRH 1FX0B 1PQ5A 5ESTE 2K1QA 4GHTA 4SGAE 2JETC 2WSSD 1P9UA 1G30B 2A1DB 4AFQA 1ZR0A 1EZQA 2LELA 2YMSB 3RC5A 4ZAEA 4Z1MD 4SGBE 4B6EA 4NIWA 3PV2A 3F0PA 2UWLA 4Q2KA 3A7VA 4M7GA 4ZXXH 2HNTE 1BTPA 3SUEA 4XSKU 2P95A 2ZTXA 3VXEH 1O2GH 1G3CA 5C1UA 1J16A 1EATA 2ZQ1A 1JBUH 1F92A 1AKSA 3BTTE 4RKJB 1UK4A 4AORA 5EJZA 1AKSB 3M7UA 3UOPA 2VWMA 2R0KA 3RXRA 2H5CA 4JYTA 3SGAE 2UUYA 3KGPA 4CH2B 2H6MA 3KQDA 3P8NA 3BTWE 2FODA 5FBEA 3DSPA 6GCHG 5DKMA 1QFKH 2BX4A 3UNQA 1PFXC 2H5DA 3ZZ7A 2J92A 1AUTC 1GBLA 1P57B 1QJ6B 1YY3A 1EFRD 3SI4H 4D9RA 1VGCB 1VITF 2R2WU 3ZYEA 1BJUA 2IPHA 2RDEA 1ZTLA 3A7WA 2D1JA 4XD7D 4WH8A 5A8ZA 3ZZCA 2ZI2H 2FOMB 2P94A 2F91A 2A7JA 1DFPA 1NRPH 4YZUA 1AFQB 1O3OA 2UUKB 3MU5A 1DS2E 1ZPBA 3PWCA 5E8EH 3BTQE 3P92A 3SOSA 1TNJA 5LPFA 1HUTH 2XWAA 5DPAA 1K1LA 1THPB 2GX4A 3BTEE 2D2DA 3N7EA 5T1VA 1T4VH 3RXAA 2ZQ2A 3Q3YA 1FONA 5A2MH 3VB6A 4K1TA 1O36A 1GCDA 1HLTH 3TGKE 1RTKA 2Z6BD 1KYNA 1KLJH 3A7ZA 3BEFB 2D8WA 3GCNA 1MTNC 4I8JA 1O32A 3UWJH 1ETSH 2R0LA 2HPPH 3RXKA 1NFWA 1N8OB 3MH7A 5TJXA 3TH4H 3EA8A 2ULLA 4MLFB 2QXGA 1WQVH 1XX9A 1SHYA 1QL7A 2QF3A 1GCTC 1QA0A 4TY6A 2STAE 4Y8YA 3AASA 2F9VA 2BQ6B 3BIUH 2ZKSA 3ZZAA 2JIZD 2V6NA 5G4BA 4X1PU 1ARCA 2SGPE 1AB9C 1TGCA 4XE4A 1W8BH 4BANB 2EI7A 1ZTKA 4ISIH 4OM9A 2R9PA 4RKOB 1AVGH 1GVZA 2AGIX 2ZPRA 1NU7B 2V3HH 1YGCH 3VG8A 2ZHQH 1Z7KA 1J9CH 1HAYB 3KQCA 5LH8A 1TONA 1YF4A 4E7RG 4UFDH 1HAIH 2HRVA 1G2LA 1W0ZU 4MTBA 2ZPSA 1CSOE 2AMPA 1HGTH 2O8MA 1SGTA 1GBBA 1YCPH 2OQUA 1SGEE 3T28A 1TFXA 3T2NA 1TIOA 1YPEH 3ELAH 2F83A 4JYUH 1EOLA 1QBNA 3FP6E 1O33A 3TGIE 3FO8D 4ABJA 2KR7A 1WCZA 2EC9H 2XOKD 1O2QA 1P01A 1UTMA 3MU4A 4ZUHA 4YOJA 1GHVH 1GWAA 2AH4X 4ZHAA 4FUFA 2OC8A 2BTCE 1AWFH 1PPEE 5AF9H 5EG4A 2H9HA 2HNTC 1Q2WA 1NBME 4NSVA 3MNBA 3LDXH 2BDHA 1UTPA 4B1TA 3MYWA 2EA3A 3BV9B 4IBLH 1YPHE 2ZWLH 3JZ2B 1GI9B 2GT7A 2OC1A 3F9FA 1GI3A 3GCOA 1OP0A 4HI3A 4DCDA 1QY6A 3VGCC 1GMCF 3MQKC 1S83A 2OD3B 1LHFH 4YXWD 5C17A 1TRNA 5DP3A 2F9BH 1V2PT 1F0UA 1O2MA 1O2VA 2R3YA 1KLIH 3PLBA 1HCGA 2JH0D 5EPYA 1EUFA 2W3IA 3K6ZA 4YTAA 2P59A 3RU4D 2ZFTA 3GCTF 4XRNA 3HKIB 2A5AA 1O5AB 2G52A 3PMHB 1FUJA 2WPIS 1T32A 2GP9B 1QBVH 3S9BA 4INLA 1IQJA 2OP9A 2RG3A 1SB1H 5I46H 3LJJA 1GBCA 1OOKB 1TAWA 7GCHF 4CRAA 3ZVGA 1P09A 4DG4A 1RRKA 1K22H 2XBVA 2B0FA 2F9UA 4UFGH 3QGNB 1C1SA 5HKKD 2KFWA 2Y80A 3TGJE 2C8WB 3HPTB 4NIYA 1BB0B 1V2OT 1GPZA 2O9QA 1KXCA 4AGKA 2EQNA 1FY1A 1GGDC 1ZSJA 2ZP0H 2TGDA 4NZLA 3QDZB 4JYVH 4B73A 3OYPA 4ISLA 4CH8B 5H4IB 1XVOA 3OAAD 1IQGA 1O5DH 2FWWA 1QRXA 5A0BA 5A0CA 4CHAC 3KHVA 1XUGA 1OX1A 3MNSA 3MH5A 1FZZA 1RTFB 2A5KA 3ODFA 8LPRA 3SV8A 5JPMH 1E37B 2AMDA 1KXBA 4CRCA 1A4WH 1GVKB 4D8NA 5JYIA 1DVAH 1GL1A 5LPRA 2Z9IA 1ZHRA 2OK5A 3SV6A 1C1RA 2WPDD 1O2JA 1E38B 1AI8H 1TGTA 3VB7A 1WQSA 2GGVB 2XW9A 2P3TB 1H8IH 1O3IA 2AGEX 3TJNA 2O8WA 1EXFA 3MNXA 2Z9LA 1C5QA 3M3SA 2FI3E 5KECA 4Y6DA 1P2IA 5CHBA 1K1NA 2WPHS 1C4Y2 3U9AH 2CV3A 1O39A 4MNYA 1WDIA 1BDAA 1P2JA 2XYAA 6CHAC 4YLUA 4XBDA 4K8BA 2XXLA 3LJOA 4Q80A 1TNLA 4Y8ZA 4BOHA 1CA0B 1BBRH 3LGYA 1ELCA 3STJA 2ZTZA 3FVFB 2KCAA 4OS5A 4KKDA 4U2WA 3NKKA 1HJ9A 3ZZ4A 1CBWC 3UWIA 5LGOA 2K8IA 3F9HA 1C9TA 1OWJA 3OEHD 2WV4A 1GJ7B 4JK6A 2RFKC 1RIWC 2C93B 4A5TS 5A0AE 1SMFE 3UUZA 1A5IA 2Q1JA 1OWDA 5HXFA 5EXMA 1K1PA 1YPHC 3S7HB 1O5EH 5T6GA 1O3LA 1WYKA 1BRBE 3E8LA 1C1NA 3CS7A 2FOHA 1NU9A 1MKWH 1O5GH 1Z71A 1COWD 1C5TA 6LPRA 2FOAA 2C8XB 1B7XB 1D3DB 1FNIA 1XUIA 2BM2A 2ZTYA 3QK1A 5HM9A 2BLWA 1P8VC 1CT2E 4K8YA 1Y5UT 5EW1H 1HAVA 3SZNA 1GL0E 1AWHB 1HAVB 4WVPE 3UNRA 3GCHC 5HIZA 1LCYA 3DHKH 3QZRA 4Q4LA 4X1NU 1O3AA 1XUKA 1GJ9B 2P16A 1KDQA 4HGCA 3U8OH 3ZV9A 3GY4A 2F4LA 1C2KA 2CK3D 2Z3DA 1NRSH 5JBCS 1KDQB 1E79D 2V35A 1L4DA 3MO9A 2VU8E 2NU0E 4DURA 1C2FA 2V3OH 1IQIA 2VIWA 2PSYA 1A7SA 1C1TA 3V13A 1O2WA 1H9IE 4K1SA 4RT0A 4ZCNA 3ATMA 2FLBH 1PPHE 1EPTC 8KME2 5DO4H 2VGCC 2ZGBH 1UVPA 1TX8A 4CBNA 3LKWA 1E36B 1W0KD 3OU0A 9ESTA 3QLPH 1A0LA 3M36A 1VCWA 1GMHG 3RMLH 2KM0A 1HDTH 2PKAA 3MU1A 1T8OA 4E06H 3K2UA 2PKAB 4NGAH 3HK6B 2NU4E 3PO1B 4J1YA 3FP7E 4OS1A 3ZZ3A 1GBDA 4BNRA 1GJCB 1N6YA 1TBZH 2A2XH 1AIXH 1QURH 1O5CB 4ZXYH 3M7QA 2ZFFH 2ZU4A 3LGWA 4YLQH 1AD8H 1O2IA 3SNDA 5L30H 1IQHA 3T29A 3EGKH 4IS5A 1KMHB 1EAUA 2QXHA 3URDA 1QIXB 5A8XA 2YNAA 2PFEA 2GD4B 2ZPQA 1NBMD 4B76A 3CNRA 3PRBA 2ZGHA 3PM3A 3RXDA 3MNCA 5IYTA 1V6DA 3N99A 5E0GA 1NROH 1BRUP 3D62A 2Y5HA 2CN0H 1EAIA 2Z9GA 3KYFA 2BDCA 2SNVA 4Y0YE 2NU3E 4IMQA 3PMAB 1SSXA 1DWBH 2GCHF 2ZA5A 3F9EA 4RSPA 2G51A 4BAHB 3UQVA 1ETTH 4K60A 3H5CB 1QCPA 4H6TA 3PTBA 2WUCA 1O31A 3TVJB 3HATH 3M35A 1H1BA 4CBOA 1HJAC 2OC7A 1S85A 3DUXH 1W11U 4JZ1A 4ISNA 4AB9A 4Y10E 3UY9A 1QNJA 1TE0A 1W12U 1QHRB 3KL6A 1YP9A 4B2CA 1LQDB 5E2PA 3SJ8A 1S0QA 2FI4E 4XDEA 4WH6A 1VITH 1AUJA 3BG4C 4FUJA 2VWOA 1WSSH 1DM4B 2FESH 1DX5M 1L2EA 4I86A 4F55A 1C2EA 4LZ1H 3WWBA 2IJD1 3PMBB 1BMFD 4OS6A 4IC5A 3I29A 1LDTT 3OY5U 3BTGE 2IPQX 2DUCA 2ZGCA 3P6ZB 1EKBB 4BAKB 5DP6A 2C8YB 2BVXH 2TGTA 5EQSA 1W13U 3E0PB 1T7CA 1TNHA 2PLXA 1A0JA 2F9OA 1Q31A 1K21H 2EI8A 2F43B 1S82A 4A1TA 1O2ZA 2YOLA 1MABB 1BHXB 1V2QT 1C5MD 3EE0B 1NS3A 2ZU5A 4ABIA 2ZG0H 3LH1A 5C0UA 3GDSA 3RUOA 3KN2A 3A89A 3SO3A 1WTGH 1KTTB 2CHAB 1VITG 1TBRH 2GMTC 4VGCB 3SUGA 1AVWA 1QB1A 1TQ7B 2VIQA 5F6MA 1TYNA 2FS8A 3SUFA 1YLCA 1TQ0B 2L6OA 1SGCA 1TABE 5HGGA 2P3UB 2XRCA 4BTTB 4CRDA 2PHBA 1HBTH 1O2PA 1XM1A 6ESTA 3WY8A 1P3EA 3Q00A 5EIYA 2PTCE 3V12A 1H8DH 1P2MA 2ZO3H 1GI8B 2Y6TA 1D9IA 2BD4A 3QGJA 1O2RA 4NWLA 1E35B 4LXBH 2WINI 1D3TB 3SJIA 3GY2A 3VEQB 5A8YA 1JXPA 2BLQA 1GDNA 5JB9S 4IN1A 5AFYH 3S9CA 2RCEA 1L1NA 1D4PB 4NZQA 1ZRKA 4GCHF 1HNEE 1JRSA 1OPHB 2FOEA 1BRAA 1GHZA 1C5PA 3KF2A 2TRMA 3Q3KA 3TU7H 1C2LA 1QZ8A 2A4OA 4ZROA 3I77A 3GY6A 5K0HA 2C4FH 1A1RA 3PROA 3FP8E 2G5VA 2D26C 4YOGA 2A4QA 5AVDA 3RXOA 1DUEA 1Z8IB 3CENA 3SU6A 2J97A 2FOGA 1GI5A 1GVLA 3M5NA 4WMDA 1FIZA 1O3FA 1V2VT 2I6QA 3MFJA 2XC0A 4KTCA 4AGJA 4TYDA 4NFFA 4UD9H 2BD2A 1ARBA 5F03A 2QYIA 1ZRBA 3F2FA 2CMYA 1MBMA 3L3TA 4DOQA 2WYJA 1UK2A 1DSUA 2V3MA 2ASUB 1WXRA 1TOMH 3SU1A 1JOUB 1C5ZB 1XMNB 1SQTA 1FN6A 1ORFA 3SU0A 4CRFA 1AN1E 2XCNA 1P02A 3RM0H 1UTOA 5FPTA 1VJ9U 1S6LA 1BRCE 2YMSC 3RXTA 3STIA 4NWKA 1QGFA 5FHTA 1GBFA 1E0FD 1CQQA 4ABFA 1IQNA 2Z9KA 2BDYA 4AFUA 4RN6A 3SJKA 1FN8A 4NA9H 3DSOA 5EU8A 1P0SH 1LVMA 1XUHA 1INCA 3Q77A 1EZUC 1GBTA 2A5IA 1LTOA 3HKJB 1MTNB 3UR9A 2BMGB 1SI5H 1ESAA 1BA8B 1HB0B 1NESE 2SGQE 3U28C 5C2ZA 1A2CH 3PYHA 2DE8A 3RMNH 1F7ZA 1GMCG 1TPSA 3MU0A 1GI1A 4X2YA 1B5GH 1UCYK 2ZU1A 1LQEA 1KTSB 4R0IA 1P3CA 1IHTH 1VGCC 4X1SU 2ZDMA 5IK2D 4AB8A 2GZ8A 2Y82A 1P2NA 3ATIA 1KXEA 4IC6A 1E1QD 3EYDA 2P8OC 3GCTG 2BD9A 1AFQC 3N7DA 1C1VH 1F5LA 1O3HA 2JH5D 3RXLA 1ZPCA 2PSXA 5ETXA 3A83A 2HPQH 5FL7D 1GHWH 4Y8XA 2QCYA 2BD7A 5F8ZA 1TGSZ 1UVOA 1C1MA 7GCHG 4WWYA 5DP9A 2FX6A 4XBBA 1O3GA 1TMTH 1O2SA 3FN8A 1T4UH 3E16B 3DFJA 4NA7A 1UTLM 1D3QB 1CT4E 5EW2H 2GV6A 1XKBC 4PROA 2GJGA 2GKVE 1BJVA 1QL9A 2VJ1A 4H6SB 5L6NH 2FTLE 3TK9A 4JMYA 4WMEA 2ODYB 3SYJA 4NG9H 2R2MB 1N8OC 3QTOH 4K1EA 1BOQA 2TPIZ 1ELEE 2ODQA 1XXFA 3B23B 2A2QH 3TK5A 1J14A 1GJAB 1O3EA 2Y5GA 3LH3A 1SGPE 2K0QA 1SBWA 2BY9X 3ATLA 5HMAA 5HYOA 2QA9E 3BEIB 3OY6U 5EQRA 5HIYA 3A87A 3UB0A 1O3DA 4FVDA 2BD8A 1HXEH 4DGJA 1ESTA 3RXSA 3ATKA 3FKSD 1UO6A 4AYYB 1RTLA 5B6LA 3GICB 3SW2B 1FV9A 5KEDA 4UONA 2FIRH 1ELFA 2FM2A 1BMNH 2TBSA 1O2YA 3GY7A 3A8BA 2YMSD 4AYVB 3A80A 1BZXE 3P95A 1ANEA 1MH0A 2QV1A 3ZVBA 1CT0E 1BTUA 2VVCA 4ESTE 2VIVA 4YT7H 5BPEA 1C2HA 4AX9H 1DDJA 1GJDB 1C2MA 4E05H 1SR5C 3R0FA 2Y81A 4ZH8A 3SQHE 5C1XA 1C5SA 1C5YB 1MAYA 1RGQA 3FFGA 1GBJA 4FETA 3R3GB 1CE5A 1TA2A 1C2DA 1QRWA 1G32B 2FDAA 1KSNA 1LKAA 1TPAE 2AMQA 2QC2A 4X1RU 2LPRA 5JB8S 2HALA 5GDSH 2QXJA 1MU6B 1LHGH 3BTKE 3JZ1B 3H7TA 3SGBE 1O3KA 2M2AA 2GTBA 5DGJA 1GHYH 2WV5A 4RT1A 1MUEB 3PRDA 1H9LB 2PUQH 2ZF0H 5SGAE 1PYTD 4ZHLU 4D7FA 3U98H 3FOAA 3SJOA 1XUFA 2GCTC 2BVRH 3LIWA 3PTNA 4GPGA 1FY8E 1LPZB 1UW7A 1NFXA 1V2KT 1GMDF 1TNIA 3A88A 4IMZA 4GVUA 4LK4A 2Z3EA 1GHAF 5C1YA 3UPEA 4B2BA 1O37A 2OC0A 5DP4A 1MTVA 1YPGH 3LGUA 2KAIA 1TALA 1CGHA 1CHGA 2OTVA 2SNWA 2KAIB 1IAUA 1F5KU 5J4QA 3LGIA 1VCPA 3V0XA 2ANYA 2C3SA 2XWBI 4HFPB 1G3EA 1MAXA 1O3BA 4WJG2 3RM2H 1A3EH 3TJVA 2H1UA 2RDLA 2PV9B 1HAPH 2QY0B 3AK5A 3UAIC 2KCOA 1SGFA 3ZZ8A 1ZGVA 3E6PH 1UVUH 3KEEA 4F4OC 1OS8A 4MPVA 1WAYB 3MH6A 3OEED 1ANBA 2W5EA 1HAHH 2JKHA 1Y3VA 1O2OA 2VVUA 1PPCE 3K9XB 3QTVH 1E34B 2PW8H 5T6FA 2KX4A 2ANMH 2XC4A 1MQ5A 4IW4E 2J2UA 1C2IA 3BIVH 1ELVA 3BTDE 3U8TH 4ASUD 3E0NB 3M7TA 5I25A 4UE7H 4MG3A 1P2QA 5DK1A 1IOEA 4D76A 4ZKSU 8ESTE 1Z8GA 1OYTH 3SBKA 9LPRA 1YCPK 2BQ7B 3ZVAA 1TMBH 1A0HB 3ZZBA 2F3CE 4ACAA 3EA9A 1Z1JA 1W7GH 1NO9H 5EPNA 1UTQA 1YPLH 3ZYDA 2DE9A 1CO7E 3V3MA 1AY6H 3PV4A 5FAHA 1EAXA 4MPWA 1CVWH 1VZQH 1AVXA 2ANKH 1G3DA 2Q6DA 4OGXA 4LZ4B 1S6FA 4HTCH 4HZHA 3S7KB 1C1WH 1UTJA 5JBTA 1ANDA 3GYMA 2QF4A 3OFND 2ZHWH 4AN7A 4XBCA 1F2SE 1BMMH 4B6FA 4MVNA 3IITA 5BRRE 1QR3E 1CA0C 5E0HA 4X0WU 2J38A 1K1JA 1ACBE 4Y11E 3LOXA 1N6XA 1YLNA 1A3BH 2PP6A 1IQEA 4H42U 1ABIH 1GI0A 2BY7X 1S0RA 4I8LA 4NIVA 1MD8A 3UIRA 2G5NA 2ZFSA 1ZHPA 1HJ8A 1P10A 1JWTA 1T8LA 2VIDA 4JZFH 3MO3A 3PLPA 1JIMA 3WW7A 2L74A 2QF0A 1D3PB 2BHGA 2GCHG 1ZZZA 1MU8B 4K5ZA 2ZDAH 1O3NA 3A84A 3LPRA 3RDZA 3UR6A 2HVYB 2F9PA 5FX5A 1EPTB 3BTHE 2WV9A 3UOUA 4DIIH 1KXDA 4AFZA 2AERH 4F49A 3RC4A 4FUBA 4ZKRU 2TIOA 4KTSA 1IQFA 1YPJH 4GAWA 4INHA 3RXVA 1SFQB 3TITA 1VR1H 4Z0KA 3TJOA 4UEHH 1AO5A 1ELTA 2CF9H 2F9NA 5EQQA 2WPMS 2GZ9A 4CR5A 2FYRA 4BTUB 1S5SA 4TSFD 3E3TA 1P06A 1D6WA 2BZAA 2Q6FA 1OWHA 1HYLA 1MKXK 3QN7A 1OKXA 2NWNA 2TGAA 1G2MA 1O5BB 3RXJA 2VH0A 1T8NA 2AHME 4X6MA 2CXVA 2PKSB 1G9IE 4FUGA 1O2LA 4I32A 3LT3A 1A5HA 1EZXC 2BX3A 1M9UA 2BVSH 2FS9A 3UQOA 3T27A 4KELA 1UCYE 4D9QA 4MNVA 3SU3A 1L1GA 3SN8A 1Z6JH 2HVXA 3F2GA 5GCHF 2VB0A 2V7QD 3MMGA 3CP7A 2KCPA 3W95A 1LKBA 5DP8A 3SNAA 3RXIA 5C5NA 3EQ0H 4Y71A 1SL3A 1GG6B 1DPOA 1GBAA 1TRYA 3TLOA 1ZHMA 1AE8H 2A0QB 1CHOF 5AFZH 3QWCH 4I33A 1AZ8A 2W6JD 3SU5A 4FUCA 3DSGA 3ATWA 3D65E 3PO1C 1O2UA 1O2NA 1OXGA 1V2MT 1BBRK 1O35A 1W7XH 5EXLA 1EJMA 4MPXA 4X2WA 2GDDA 1K28D 1YCPM 4FU7A 1TPOA 1ELGA 3U1IB 5T6DA 1FY3A 4AG2A 1V2UT 3OE7D 2P93A 1K0HA 2XCFA 3B8JA 1IHSH 2A45B 4GCHG 1GBEA 4ACBA 1HAZB 2BD5A 2UWOA 1YLDA 3A85A 3BSQA 3GY3A 5EJ1A 1GHBF
chains in the Genus database with same CATH topology
3S69A 1SLWB 2BY5X 3H7OA 5DP5A 2FPZA 2M5TA 1MKWK 4O03A 3LGVA 4A6LA 2BOHB 3GY8A 3V7TA 2GZ7A 1ZYOA 4D7GA 2ALVA 1GI4A 1V2WT 5CHAB 1THSH 4X8VH 1C1PA 1EASA 1SVPA 2Z9JA 2A4GA 4K3JA 3TNSA 2G4TA 1GHXH 2BD3A 2Z3CA 4U01A 1SGDE 2BQWB 4X6OA 1PQ8A 2RA3A 4XFQA 3W94A 4NFEA 1P11E 1OWIA 1RJXB 4JK5A 1UHBA 4CRGA 1ZSKA 1YC0A 1UVTH 1DXPA 1UHBB 1IQLA 1V2ST 3C27B 2OBOA 3ENSB 3P17H 1G3BA 1B0FA 3C1KA 1C2GA 1NRNH 3U1JB 2STBE 1GI7B 2I6SA 1NM6A 5GJ4B 1O2KA 2ODPA 4INKA 4B71A 3ESTA 1EOJA 1C2JA 7KMEH 4X2VA 4JZEH 4ASHA 1OP2A 3SNCA 1YPKH 4WXIA 5GWZA 3GY5A 2GV7A 3SU4A 1F5RA 1TWXB 5L2YH 1IQKA 3FZDA 1SQOA 3G01A 3M5LA 5FPSA 2FO9A 3N7OA 2VNTA 4ZKNU 4O3UA 1GJ8B 5J4SA 2PWXA 5JBAS 3SNEA 4WY3A 4DW2U 2JETB 2CHAC 2FOFA 2JH6D 1J17T 2OINA 4VGCC 1LPKB 1KLTA 3M5MA 5C5OA 2Z94A 3GDVA 1QQ4A 4ZHMU 2SGEE 3UNSA 1K2I1 4YO9A 3BG8A 1TMUH 4BAOB 2WYGA 4QT8C 3TK6A 1DY8A 2UUJB 3A82A 3TH2H 1QQUA 1DT2A 1A5GH 4I8KA 1HRTH 5FPYA 2QIQA 1NN6A 1OP8A 1TOCB 3GDUA 3ZZ6A 1ID5H 1ZTJA 1CGJE 1QB9A 1ELAA 3A7XA 4I31A 4O3TA 4NSYA 2ZU3A 5FBIA 4Q7YA 1FQ3A 3NK8A 1UTNA 1THRH 4ISHH 5GIBA 1GJ4H 3RP2A 3O8CA 1BTHH 3QO6A 2OXSA 3GISB 3AVZA 2XBXA 1C5UA 4OS2A 1LVBA 1GI6A 3LONA 3O8DA 3MTYA 3F9GA 1Z6EA 1MZDA 1JMOH 1MTSA 2VINA 4JZIA 5T3HA 3U69H 1HAGE 1FIWA 2PGQB 1JRTA 3P8FA 3NZIA 2O8TA 3I78A 4TPYA 1N1LA 1W2KH 3NCLA 1F0RA 2FOCA 3E90B 3O8RA 2B8OH 5EGMA 1WUNH 2R3UA 4JCNA 5JBBS 2HLCA 3BTME 4X1QU 1O2XA 4YESB 2BDIA 5EXNA 1QRZA 3A7YA 1SOZA 1FDPA 1ANCA 4MNWA 1ESBA 2FEQH 1XKAC 3RXHA 2ZCKP 1PQ7A 1SGNE 1SGYE 2P8OB 3MOCA 1GCTB 4X8SH 5DJ7A 1HV7A 1QJ1B 2G55A 1O3JA 5GPIB 2ZCHP 4B74A 1BHXF 1AB9B 2LNCA 1S81A 1BCUH 3SU2A 4TPIZ 3PLKA 8GCHF 1K1OA 2ZDLA 4CRBA 1F0TA 4ZKOU 1PYTC 5B6OA 3E91A 2V0BA 1P2OA 3K6YA 4J2YB 3RXFA 4FUDA 2TGPZ 4H4FA 3QUMP 4A1VA 3DT0H 3MO6A 2WPKS 4NA8A 1H4WA 1DOJA 5IDKA 1AGJA 1G36A 2OLGA 2ZC9H 2BXUH 4X8TH 3A81A 3LC3A 3RMMH 3MWIU 3A8DA 4JZDH 1ABJH 5ESBA 4IGDA 4AG1A 3M3TA 1HIAA 3P8GA 3FAOA 1HIAB 2CGAA 1NC6A 2VIOA 1P05A 3S9AA 3SV9A 1UTKA 1GMDG 1SHHB 5FX6A 1BQYA 1GHAG 2XBWA 3IG6B 1NRRH 1C1QA 1V2JT 2ZZUH 5A09A 2B7DH 1ZJKA 2ZHFH 5C67A 3Q3XA 3NPSA 3AAVA 1FY5A 1EQ9A 1QA7A 1EJNA 1RXPA 4Y76A 3T5FH 3AAUA 2IN2A 1S84A 1S6HA 2ZDKA 4NCYA 1PQAA 3RMOH 1HAOH 4DT7B 1YPMH 1QBOA 3SJ9A 1CU1A 3B9FH 3IWMA 4A92A 1O2HA 3VGCB 2SGDE 6GCHF 3VB4A 5LPEA 1BIOA 2B9LA 2ZU2A 1C5LH 1DXWA 3E1XB 1OSSA 2QN5T 1Y3WA 2ZHDA 4GUXA 2ZDVH 3EDXB 4ABGA 2W26A 1NY22 2ZGJA 4I8HA 1YKTA 2RA0A 1TX7A 1Z8RA 4ABHA 2IJOB 1GDUA 2VVVA 1AZZA 5F8TA 1NFYA 2THFB 2J95A 3MHWU 4ABBA 1AE5A 3RC6A 1C5NH 1PJPA 5FCRA 3SUDA 4KP0A 1CA8B 2XC5A 3RXQA 1SLUB 1W3CA 3FANA 2HGTH 1FI8A 2GVFA 1B0EA 2FOBA 1TA6A 3RXMA 2SGAA 3NXPA 1BTZA 1DICA 4ABAA 1SGRE 3O8BA 2SGFE 5DG6A 1SOTA 1KY9A 3OTJE 3SQEE 1FXYA 4U32A 1P12E 1SLVB 1BBRE 2QAAA 3BN9A 2FP7B 1PPZA 3TJUA 3KQEA 3AW1A 1D6RA 2GCTB 1MD7A 2AYWA 2ALPA 1BTYA 1Y5AT 4ABDA 4AFSA 3L33A 1GGDB 1C4V2 3PMJA 3ZVDA 4FXGH 2NU2E 3ODDA 2EEKA 2ZGXH 1Y5BT 2BY6X 4LOYH 1TGBA 4CHAB 3F68H 1KIGH 4FU9A 2FYQA 3HGPA 3UREA 1AHTH 1BTXA 1FY4A 2ESTE 4B75A 7LPRA 3F1SB 5CMXH 1FPCH 4Q7XA 1SQAA 1P03A 2Q6GA 2BOKA 1ETRH 2VIPA 5C3NA 2W7SA 1O2TA 4CREA 2XNIA 1C9PA 2ZDNA 1L4ZA 4GHQA 3M3VA 1TGNA 2FMJA 2FXRA 1Y3XA 3D23A 3M61U 3T25A 3T26A 2Y7ZA 3S0NA 1EP5A 3BF6H 5CE1A 5AHGH 1ZOMA 2H9EH 1EB2A 4X6NA 1YM0A 2ZECA 1P2KA 4X8UH 2J94A 3RXCA 2IOTA 1MKXH 4FUIA 6CHAB 1PPFE 2Z7FE 1LHDH 3GYLB 4DY7B 5GXPA 1DANH 1SG8B 2A7HA 1TLDA 2ZFPH 1DWCH 1V2LT 1BUIA 1ZMJA 4ISOA 2FZZA 2OCVB 2A32A 2GDEH 3TNTA 2VH6A 3SV2H 3SHCH 1CBWB 1WU1A 4DIHH 3LU9B 1F0SA 1V2TT 3VB5A 3TH3H 1RIWB 1O38A 2HNTF 1GJ5H 1V2RT 1DY9A 1LPGB 1FAKH 3EA7A 3RLWH 5DP7A 1WOFA 4I7YH 1Z1IA 4DVAU 1TRMA 2A7CA 3TPIZ 2ILNA 1GDQA 1MQ6A 3A8CA 1YYY1 3ZVEA 4FUHA 2BB4A 1SGFG 3HK3B 5E0JA 4FUEA 1A61H 1O3CA 3K65B 4FVBA 1SPJA 1ZSLA 4THNH 1BMAA 1EP6A 3SV7A 4K2YA 2UWPA 3PB1E 2OQ5A 5GCHG 1XXDA 1UVSH 1C4U2 2VWNA 1U6QA 5PTPA 1C5VA 5K7RA 3MU8A 1O3PB 3GCHB 3HGNA 4BTIB 3KIDU 3M5OA 4Y7AA 1EX3A 1JIRA 1C1UH 1CHOG 1OWEA 1A46H 4MNXA 1Y3UA 1T8MA 2BLVA 3OX7U 1MMJN 1ELDE 1T31A 4Z6AH 1EZSC 1MTUA 4OGYA 5TCCA 1GJBB 3ZVFA 1J15A 1KXFA 2PGBB 4OS4A 4KGAA 1TB6H 2ZIQH 7ESTE 1TX6A 1Y59T 3ZZDA 2OBQA 2WPJS 4MPUA 1EPTA 3SGQE 1GBIA 2H2ZA 2FX4A 1BITA 2P3FH 2PTNA 1NT1A 4K69A 3A8AA 2VGCB 1P9SA 4NIXA 1GBHA 4U30A 1W0YH 4YOIA 1DLEA 2J34A 1SGIB 5F8XA 1O34A 4Q7ZA 4I8GA 5EODA 1FPHH 2H9TH 1GHBG 4GLYA 5TCAA 1UK3A 1TNKA 1TPPA 3MH4A 3CS0A 3BTFE 1DLKB 2G8TA 1C5WB 1V3XA 4UDWH 1EJAA 1X7AC 2BXTH 2PUXB 3FZZA 1ZJDA 3NWUA 3DA9B 1DWEH 3VB3A 4TWYA 5EOKA 1BT7A 4WF8A 2A31A 5ABWA 3RXEA 1IQMA 5JDUB 1NZQH 2AFQB 3ITIA 2ZFRH 3UTUH 2YNBA 3KCGH 2ZFQH 4R8TB 1P04A 1Q3XA 2C8ZB 1QL8A 3GOVB 3DD2H 2WUBA 3SNBA 4Y7BA 1FMGA 2PR3A 1MBQA 1RS0A 4O97A 1MTWA 2O8UA 4MQAA 2EI6A 1FJSA 3DFLA 5E2OA 4IN2A 1TNGA 3AW0A 2ZCLP 1RFNA 2HOBA 3P8OA 3RU4T 1K9OE 1PPGE 1KXAA 1AU8A 1ZPZA 2BLOA 3LGTA 2GT8A 4E7NA 2PKSC 3RLYH 5HM2A 2WPLS 1DSTA 4GSOA 3BEUA 2FI5E 4DJZB 4BXSA 4XOJA 1H9HE 1HJAB 2XTTB 2QXIA 3OSYA 1DITH 5FCKA 4KTUA 1NTPA 2J4IA 1V2NT 1UJ1A 4ABEA 1OYQA 1GI2A 4YT6H 3BG4B 1C5XB 1YBWA 2AIPA 4UFEH 1GG6C 4AOQA 1NFUA 4X6PA 2AIQA 1W14U 1EAWA 4CR9A 1Y8TA 4X2XA 3TIUA 1LVOA 1XVMA 2B5TB 1FAXA 1C1OA 1WBGB 1ZMLA 4UFFH 1MZAA 1NRQH 2BZ6H 3RXUA 2XBYA 3URCA 3LC5A 2BY8X 1HFDA 1Z8JB 2CJIA 1O3MA 2BYAX 1LHEH 2A4RA 3D49H 3VPKA 3QX5H 1GJ6A 1GBKA 1VCQA 1SLXB 1AQ7A 1J8AA 2W3KA 1HXFH 2AGGX 2Y5FA 1Y3YA 1G37A 3U8RH 1VJAU 3SI3H 1CGIE 2GMTB 1LO6A 2FTMA 1O5FH 1EB1H 1AFEH 2QGRA 3A86A 3SORA 3SHAH 1GMHF 2AS9A 4BAQB 4Y79A 1W10U 2UUFB 1TBQH 2O8LA 1GBMA 1SFIA 3RU4E 4A1XA 4BAMB 3NUMA 2C90B 4WMFA 2OUAA 1UMAH 5C20A 3RXBA 1UCYH 2HWLB 1WTHD 1HAXB 5CHAC 1BMLA 3ZVCA 1ELBA 3QZQA 1XUJA 2SFAA 1OWKA 4WXVA 1QTFA 1K1IA 1NPMA 3UFAA 1O0DH 3L6PA 1PPBH 4Y0ZE 3KNXA 3EAJA 1LVYA 1SC8U 1L1JA 2ZNKH 3MI4A 2VWLA 1WV7H 1LHCH 2ZEBA 1BTWA 1DE7H 2BDBA 2G81E 1ZLRA 4MDSA 3Q76A 3P70B 3PWBA 2G00A 1QB6A 1MCVA 3A7TA 2G4UA 3RXPA 2ZHEH 1FLEE 4AZ2B 4O9VA 1ZGIA 3KQBA 1L0ZA 4A7IB 1QJ7B 2J9NA 5L2ZH 2BDGA 3T62A 8GCHG 4FU8A 3VFEA 2AEIH 2CF8H 1C5RA 4B2AA 5FXLA 1ZMNA 2Y7XA 3M37A 2BDAA 3ZV8A 4OS7A 1C5OH 1DWDH 1O30A 4TY7A 1SGQE 3RXGA 4YM9A 2ANWA 3ZZ5A 1LMWB 1AMHA 4ZMAH 1RD3B 3VXFH 1MCTA 1K1MA 3ZZ9A 1DUAA 1HPGA 4TWWA 4BXWA 3F6UH 2NU1E 2W7UA 2FLRH 1PQ5A 5ESTE 2K1QA 4GHTA 4SGAE 2JETC 1P9UA 1G30B 2A1DB 4AFQA 1ZR0A 1EZQA 3RC5A 4ZAEA 4SGBE 4NIWA 2UWLA 4Q2KA 3A7VA 4M7GA 4ZXXH 2HNTE 1BTPA 3SUEA 4XSKU 2P95A 2ZTXA 3VXEH 1O2GH 1G3CA 5C1UA 1J16A 1EATA 2ZQ1A 1JBUH 1F92A 1AKSA 3BTTE 4RKJB 1UK4A 4AORA 1AKSB 3M7UA 3UOPA 2VWMA 2R0KA 3RXRA 2H5CA 4JYTA 3SGAE 2UUYA 3KGPA 4CH2B 2H6MA 3KQDA 3P8NA 3BTWE 2FODA 5FBEA 6GCHG 5DKMA 1QFKH 2BX4A 3UNQA 1PFXC 2H5DA 3ZZ7A 2J92A 1AUTC 1GBLA 1P57B 1QJ6B 3SI4H 4D9RA 1VGCB 1VITF 2R2WU 3ZYEA 1BJUA 2IPHA 1ZTLA 3A7WA 2D1JA 4WH8A 5A8ZA 3ZZCA 2ZI2H 2FOMB 2P94A 2F91A 2A7JA 1DFPA 1NRPH 4YZUA 1AFQB 1O3OA 2UUKB 3MU5A 1DS2E 1ZPBA 3PWCA 5E8EH 3BTQE 3P92A 3SOSA 1TNJA 5LPFA 1HUTH 2XWAA 5DPAA 1K1LA 1THPB 2GX4A 3BTEE 2D2DA 1T4VH 3RXAA 2ZQ2A 3Q3YA 1FONA 5A2MH 3VB6A 4K1TA 1O36A 1GCDA 1HLTH 3TGKE 1RTKA 2Z6BD 1KYNA 1KLJH 3A7ZA 3BEFB 2D8WA 3GCNA 1MTNC 4I8JA 1O32A 3UWJH 1ETSH 2R0LA 2HPPH 3RXKA 1NFWA 1N8OB 3MH7A 5TJXA 3TH4H 3EA8A 2ULLA 4MLFB 2QXGA 1WQVH 1XX9A 1SHYA 1QL7A 2QF3A 1GCTC 1QA0A 4TY6A 2STAE 4Y8YA 3AASA 2F9VA 2BQ6B 3BIUH 2ZKSA 3ZZAA 2V6NA 5G4BA 4X1PU 1ARCA 2SGPE 1AB9C 1TGCA 4XE4A 1W8BH 4BANB 2EI7A 1ZTKA 4ISIH 2R9PA 4RKOB 1AVGH 1GVZA 2AGIX 2ZPRA 1NU7B 2V3HH 1YGCH 2ZHQH 1Z7KA 1J9CH 1HAYB 3KQCA 5LH8A 1TONA 1YF4A 4E7RG 4UFDH 1HAIH 2HRVA 1G2LA 1W0ZU 4MTBA 2ZPSA 1CSOE 2AMPA 1HGTH 2O8MA 1SGTA 2OQUA 1GBBA 1YCPH 1SGEE 3T28A 1TFXA 3T2NA 1TIOA 1YPEH 3ELAH 2F83A 4JYUH 1EOLA 1QBNA 3FP6E 1O33A 3TGIE 4ABJA 1WCZA 2EC9H 1O2QA 1P01A 1UTMA 3MU4A 4ZUHA 4YOJA 1GHVH 1GWAA 2AH4X 4ZHAA 4FUFA 2OC8A 2BTCE 1AWFH 1PPEE 5AF9H 5EG4A 2H9HA 2HNTC 1Q2WA 4NSVA 3MNBA 3LDXH 2BDHA 1UTPA 4B1TA 3MYWA 2EA3A 3BV9B 4IBLH 1YPHE 2ZWLH 3JZ2B 1GI9B 2GT7A 2OC1A 3F9FA 1GI3A 3GCOA 1OP0A 4HI3A 4DCDA 1QY6A 3VGCC 1GMCF 1S83A 2