3MNCA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. second stage of radiation damage
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mncA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mncA01
4BTUB 2AGGX 1UCYH 4DURA 1HUTH 2AS9A 1QQ4A 1ZLRA 2V3OH 1C5RA 2XBVA 4INKA 3SU5A 1HFDA 4JZEH 1DM4B 1HAXB 1W10U 2GGVB 2FI5E 2OP9A 5CE1A 2A2XH 3RXLA 3TH3H 1MBMA 3LC5A 1EOLA 2FYQA 1O5CB 1EAIA 1NT1A 2PUXB 1ZTKA 4AB9A 4CRGA 1QB9A 4YESB 1QBOA 4UFFH 3OY5U 1YM0A 1RD3B 1EJMA 1IOEA 2GCHG 3O8CA 1DE7H 1V2QT 1YPLH 2BLOA 2OLGA 3SW2B 1K1LA 1RRKA 4VGCC 1P11E 2FZZA 3SJ9A 4LK4A 3SGAE 1TQ7B 2HNTE 3PTNA 1A0LA 3UR9A 2ZFFH 2PV9B 5I46H 1VITF 4ABAA 1O2SA 3VB7A 2P95A 5C20A 1SMFE 4AOQA 2Z9IA 3GDVA 3PO1C 4DJZB 3W94A 5L6NH 1TGCA 2ZKSA 3ZZ5A 2PUQH 1EOJA 1FLEE 4JZDH 4ABJA 1C2MA 4FU7A 2CHAC 3BTWE 2NU1E 3LGIA 3U1JB 1H1BA 3FP7E 6ESTA 1KDQB 2WPLS 4JYTA 1G37A 4MPVA 1W7XH 4Q80A 1UTQA 1L4DA 5SGAE 2PKSB 1A3BH 3TK5A 2A7CA 3M3TA 1SGDE 1GJAB 4BTTB 3F9HA 4X6PA 1NFXA 2ZHFH 2IN2A 2F9UA 5A0CA 1BTYA 2R9PA 4Y76A 4B2CA 1ZJDA 1K1OA 4Y79A 1MQ6A 4ZUHA 1AI8H 4YO9A 1O3IA 1TBQH 4X8TH 1F5LA 2A2QH 1V2PT 2ASUB 3QGNB 1W2KH 1GVZA 2PTCE 1HB0B 1KTSB 2G00A 1LHGH 4AYVB 1SLUB 3TJUA 4WJG2 1NRSH 2WV5A 1XKAC 3TVJB 5C2ZA 4MNXA 2BD8A 2JKHA 2VB0A 4TPYA 1EJAA 4HFPB 1XMNB 3UTUH 8KME2 3UWIA 1BT7A 3TIUA 4BANB 5A8XA 1MH0A 1AU8A 3RXDA 1V2NT 1P02A 4IW4E 2Z7FE 1GBIA 2B9LA 1MTVA 5FX5A 1S83A 3AW0A 3LOXA 1MQ5A 5HMAA 1NC6A 3SUEA 1O3MA 2QXIA 3TNSA 4ABEA 1D4PB 5EXNA 2KAIB 4FUBA 1ZMNA 4FVDA 4QT8C 2EI6A 2ZGBH 1N1LA 1TRNA 1V2MT 1THRH 2ZDKA 1O5DH 4ISHH 3GYMA 3M36A 4AFZA 1NU9A 5F6MA 1BOQA 4THNH 3UFAA 5JB8S 1ZTJA 1SGRE 3RXBA 1NFWA 3LGVA 1C1UH 2EI8A 1YLDA 1SHHB 4VGCB 1A3EH 1G32B 2JH6D 1E35B 1TPAE 3QK1A 2FOFA 1WCZA 1ZRBA 1QIXB 2WYGA 4X2YA 5PTPA 1BQYA 2BD3A 3HGNA 3A7ZA 1BMMH 3UQVA 4INHA 3BIUH 1TALA 4ISIH 3PO1B 4X2VA 1XKBC 2GVFA 4CRCA 1O3KA 1ORFA 2VH6A 1DOJA 4ZHMU 5GXPA 3UPEA 2QXHA 2XXLA 1HAVB 2ZZUH 1F2SE 1FPHH 1L2EA 2OCVB 1C1PA 1C5PA 4YOGA 1BHXF 3RXJA 5ESBA 2C90B 1NPMA 2IJOB 2CF8H 2CHAB 4I8LA 4NFFA 2GKVE 4PROA 3SU1A 4NIYA 3RXVA 2GDEH 4WF8A 2THFB 1O2RA 1EAWA 1XX9A 2I6SA 2RA0A 3GY4A 1O2IA 4JZFH 1BTHH 1SGTA 2AEIH 1G9IE 1P12E 4BTIB 4X2XA 4ZXXH 1Z1IA 1P9UA 2FM2A 4U01A 1ANDA 3ZVBA 2AGEX 2F91A 4ZKOU 3A8DA 4INLA 2BY7X 3LJOA 2BB4A 3MHWU 4MPUA 1C5LH 4B1TA 3MWIU 4X1NU 5TCAA 1W11U 1W12U 3KF2A 4HI3A 3BTFE 3UNSA 3TGKE 4ZROA 1Z71A 3E0NB 3UUZA 3MH6A 1P0SH 1Y3UA 1RGQA 2FESH 4JK6A 1EZUC 1O36A 5BPEA 2G8TA 1FPCH 4A1TA 2VH0A 2A5IA 3RXQA 1HCGA 2PSXA 1LHDH 2TIOA 3C1KA 1NFYA 2ZFTA 1A2CH 1LVOA 2BD9A 3HK6B 3RC4A 3DD2H 3BIVH 4MDSA 3NCLA 2OC7A 3VEQB 4LZ4B 3RU4E 5GCHF 1J14A 2P16A 5T6GA 4ZKRU 2FOHA 1TPPA 4NZQA 3VGCC 1C5XB 1GMDG 3LGWA 1MBQA 1BTWA 3TJNA 1W8BH 1EB2A 1SGFA 2ZDNA 1BJUA 3FZDA 3TNTA 2VIWA 3Q3YA 3TU7H 1MD7A 1TWXB 2RG3A 4M7GA 1FDPA 3FP6E 1E37B 3SUDA 1MAXA 2ZHEH 2OD3B 3H5CB 2TGTA 3P8OA 3PMHB 1PFXC 1K9OE 4K2YA 5HGGA 4BAMB 1PYTD 4Q7ZA 4UFEH 4YT6H 4K5ZA 2V0BA 1KXCA 2Y6TA 3GCOA 3MO9A 4X8VH 6GCHG 1O2QA 1SL3A 1UTKA 2XC0A 2ZIQH 2FTLE 3A8CA 1C5NH 1KY9A 2WPKS 2QXJA 2PHBA 3GOVB 2SGDE 3K6YA 1QTFA 2AH4X 1IQKA 1TB6H 1MTSA 2P8OB 4NWKA 3ZV8A 4WXIA 5C5OA 3E8LA 7KMEH 3H7OA 3ESTA 3GDUA 2FI3E 2VIDA 2VVUA 3SOSA 3MNCA 5LPRA 2AYWA 1O3EA 3D65E 3FZZA 3Q76A 1GI0A 1T8OA 2BZAA 1QGFA 1S5SA 3E91A 3TK6A 2H9EH 4GCHF 3LJJA 4B2BA 4MNWA 4HZHA 1O5AB 4ZXYH 1SGYE 1ID5H 4J2YB 4Y71A 3SV8A 3VXEH 2XCNA 1C5TA 1PQ8A 1RFNA 3SU3A 1QCPA 1P01A 4GSOA 2ZO3H 4I8GA 3SV2H 1RTKA 4SGAE 2BOHB 3MU1A 1KLJH 2GT7A 1T31A 1TGNA 3SI3H 3O8DA 1CT4E 3AW1A 4E05H 7ESTE 1GI6A 1CA8B 2FS9A 3KNXA 1GJ8B 1IQJA 1EKBB 4SGBE 1C5WB 4ZHLU 3M5OA 1ELCA 1GJ6A 4A1XA 2P3TB 8LPRA 4U32A 3SNCA 1LQDB 1C4U2 1HXEH 1GBLA 1GBHA 3ODDA 2V6NA 5EW2H 1H9HE 1QA0A 1MU8B 5T3HA 2BD5A 4FUFA 1YP9A 1C1QA 4UFGH 4K60A 1NS3A 3PMBB 1O31A 4IN2A 5LPFA 5LGOA 1BA8B 5F8ZA 2ZDMA 1V2VT 1T8LA 3T29A 1IQIA 1O3BA 1TNLA 4H4FA 1E34B 1LKBA 1Y3VA 1OWEA 2G52A 3RC5A 3PMAB 2ZCHP 1TFXA 3SJKA 4ABIA 4FUIA 3BTQE 1JXPA 4HTCH 1GCTC 1TRMA 1XUFA 1FAXA 3MYWA 2P93A 3CS0A 1HPGA 1UVTH 1AIXH 3E16B 4MQAA 1TE0A 3SV9A 1DWCH 5DJ7A 3QZQA 2YNBA 3ZZ6A 2P94A 2BOKA 2O8WA 1LQEA 2RDLA 4ZH8A 3TJVA 1O35A 3EA7A 3TITA 2H5DA 2ZTZA 2RA3A 4UDWH 5FBEA 3RMMH 1C1VH 4Y0YE 1MKXK 1LPKB 1EPTC 2SNWA 1GJDB 2A5AA 4FUEA 3T27A 2BDBA 1JIMA 3U8OH 3BG4C 1EAUA 1THSH 4NG9H 1EUFA 1GHWH 3EYDA 2ZNKH 1GMHF 2TGDA 3QTVH 3U69H 4FXGH 1C2HA 4NGAH 1C1SA 4AZ2B 2BXTH 2GP9B 3Q77A 3HPTB 1NRQH 1YGCH 2Y5HA 1C4Y2 2VGCC 2VIOA 4JYVH 2WPMS 1DT2A 4AX9H 1A0JA 2Z9KA 2BY6X 2D2DA 1SFQB 2FO9A 1MTNC 2FLBH 4YM9A 1J8AA 1GHAF 3MNSA 3KQDA 1H8DH 1BMNH 1Y3WA 2BLVA 2FX6A 3M3SA 3BTME 3EE0B 1C5YB 3MO3A 1EATA 1EQ9A 5AFZH 3MH5A 3P8NA 2FDAA 1VJAU 3K2UA 3MNBA 2RCEA 1DDJA 5E2PA 1O2LA 3PYHA 4TY7A 2QF3A 4Y8YA 5DK1A 1O2WA 1C5UA 1NY22 1DWDH 2G4TA 3LGTA 4JZIA 4Q7YA 4IS5A 2PTNA 2H1UA 4YZUA 1B7XB 3LH1A 4O3UA 2O8LA 3ZZDA 4ASHA 1OWDA 2A4RA 3VB4A 4MVNA 4NIWA 1ELFA 3QGJA 1KDQA 4NIXA 3P6ZB 1S85A 1C1WH 4MG3A 1EZXC 1YPJH 3P17H 1UTPA 1K1MA 1V2KT 4X0WU 1ETTH 6CHAC 1AD8H 2GDDA 4CRDA 3O8RA 1QL8A 2CJIA 2ANKH 4ZKSU 4ABFA 4CRBA 1ZSLA 2SGPE 4KKDA 2K1QA 1DITH 2GZ8A 1ZR0A 2ESTE 2J94A 1A5IA 1SOZA 2I6QA 1VITG 1HXFH 1K22H 1RTLA 2FOGA 5ETXA 4XE4A 9ESTA 5DO4H 1IQGA 1VJ9U 2ZGJA 1NTPA 4IMZA 3LH3A 2TPIZ 5T6FA 2Y7ZA 1UO6A 5GJ4B 4DCDA 1KXDA 3S9CA 3VB3A 2G81E 1KXAA 3SJ8A 1KIGH 2XBYA 1BRAA 1HNEE 1DPOA 2BX4A 1K21H 2PFEA 1GJ9B 3RXCA 1GCTB 2ZPSA 4I8JA 1UMAH 3M5NA 5DGJA 5DP9A 1O2GH 4CR9A 1L0ZA 4BAQB 4CREA 2VVVA 1DSTA 2FOCA 1ANEA 3RU4D 3MTYA 1FONA 3UWJH 1O3GA 1KXFA 2PW8H 2SGFE 1TIOA 5EU8A 4O9VA 4CBNA 1FIWA 5LH8A 1GWAA 3M7TA 1SOTA 1WU1A 3HKJB 3PM3A 3URCA 3ENSB 1D6RA 5K7RA 4K3JA 3A88A 1WTGH 4AFSA 1O2JA 1SGQE 3ODFA 2KAIA 3BG4B 4YOIA 1GBAA 3T28A 3HK3B 3QDZB 3GY3A 3SJOA 4H6SB 3S0NA 3D23A 1LDTT 1V2UT 3STIA 2OC8A 1FNIA 3URDA 3S9BA 1L1NA 3MH7A 2UWPA 2XTTB 3SU4A 3KL6A 1G3CA 2WPJS 2VGCB 3ZYDA 1AE8H 1TOCB 3PWCA 4DOQA 3TGIE 1TNHA 3HGPA 1DSUA 5A0BA 3V13A 1MTNB 1WQVH 1ZZZA 2QCYA 3KIDU 1PQAA 1A46H 3GY7A 4OS6A 3HATH 1F0RA 1P2QA 1TMBH 1CHGA 2QA9E 1O2NA 1LPZB 1CA0C 1SLWB 1C5OH 1HAHH 4Y11E 3P92A 1UK4A 1MZDA 1SB1H 3SNBA 1BBRK 1P3EA 4UD9H 2ZDVH 2LPRA 1EAXA 1PQ5A 4FUGA 3OTJE 4BXWA 3A82A 4MLFB 1HAVA 2FTMA 1CGIE 4B2AA 2XBWA 1SI5H 3BF6H 3BTHE 2Z9JA 2QXGA 1JWTA 1X7AC 5CMXH 2Q6DA 4D7FA 4DGJA 5IYTA 1G2MA 1OP2A 1W13U 2J4IA 2XW9A 2B5TB 3VB6A 1RS0A 1P2KA 3E0PB 6CHAB 1O3OA 4X6MA 4X8UH 1LKAA 1Z8RA 1XUJA 3I77A 3CP7A 2QV1A 1PPEE 3BN9A 1O2TA 5JDUB 2ILNA 5LPEA 1WOFA 1GI5A 2OQUA 1GI2A 1UK2A 2STBE 4A1VA 3M5LA 3PLPA 4HGCA 1QA7A 1AZZA 1IQMA 1C1OA 2HGTH 1TBZH 1XUIA 2DE8A 1O34A 4TYDA 3A84A 3RP2A 1LPGB 1GHBF 1A5HA 3A80A 2ALPA 1AE5A 2J92A 2UUJB 1O5BB 1VITH 2EC9H 5AF9H 3K9XB 4BAHB 4D9RA 1C2EA 3R3GB 1ESBA 3RMNH 5FHTA 1AO5A 2GZ7A 2Z94A 2LNCA 2ZGXH 2XC5A 4UFDH 3F1SB 1XVMA 2QYIA 5F8TA 1HDTH 1Y3XA 2ALVA 3PV4A 4WMDA 2ZU2A 1YPGH 2A4GA 4NSYA 5DP4A 2XC4A 2SNVA 1FY8E 1QRZA 3ZZCA 1TMUH 1IHTH 4NZLA 3QUMP 1CE5A 4TWYA 1ZSJA 1C4V2 4B74A 2Z3DA 4DT7B 1D6WA 3PB1E 4ZAEA 5JPMH 1SHYA 2BY9X 1UJ1A 1C9PA 1MMJN 3MFJA 1FAKH 1DWBH 1O2HA 2XWAA 3UY9A 5J4QA 2O9QA 3GY2A 1MKXH 2HWLB 3P70B 5GCHG 5L30H 2FOEA 5EGMA 2HOBA 1PYTC 1GJCB 3UQOA 4CHAC 1O3HA 3E3TA 1ELTA 3T25A 1FY1A 2ZG0H 1O3JA 4UEHH 3PWBA 1FY5A 2AFQB 1CA0B 1SSXA 1SGIB 3VXFH 3UR6A 1MKWK 1ELEE 1OX1A 1SBWA 2C8WB 5E0JA 5EXMA 3RLYH 5E0HA 2ZGCA 2C8ZB 2ZP0H 4X1RU 2A1DB 2TBSA 1GHXH 1YCPK 2W26A 4WXVA 3WY8A 4ESTE 1B0FA 2BD4A 1H8IH 1L4ZA 2PKAB 1FUJA 3F9GA 4CH2B 4DVAU 2D8WA 4XDEA 3MOCA 2ZHDA 1HJ9A 5DP8A 1GVKB 2Z9LA 1AB9C 1O3CA 1BBRE 1UVSH 2OBQA 4DIHH 3F68H 5E8EH 1TAWA 3SHAH 4I33A 3TPIZ 1GGDC 4X1SU 5L2ZH 3M5MA 2PR3A 1W0YH 2HNTC 2F9BH 4U30A 1EJNA 2ZQ1A 2CF9H 2B7DH 1THPB 2BM2A 2SFAA 4ISNA 1ZGVA 1TNKA 3AVZA 3BG8A 3RXAA 3RMOH 2QC2A 4IMQA 2GV6A 3A86A 3ATMA 2ZTXA 1VCPA 4BNRA 1YCPM 2XBXA 2VVCA 3ATIA 2BZ6H 2W3KA 1QQUA 4OS1A 2Z9GA 1QJ7B 4GCHG 1HAOH 3T2NA 4J1YA 3K6ZA 1GBKA 1QR3E 1NZQH 1C1NA 4XOJA 2JETC 4JYUH 5A0AE 1HAZB 4E7RG 2WV4A 1NM6A 2Z3EA 1ZHMA 1QJ1B 3P8FA 5FXLA 1SPJA 1OYQA 1D3DB 4GHTA 2OTVA 4O97A 2R0LA 3DFLA 1E0FD 4ABDA 3GCTF 1WBGB 3M35A 2NU2E 4CBOA 3OY6U 3K65B 2A4OA 3V7TA 1K2I1 1MAYA 1C2LA 1LMWB 3IG6B 1C1RA 2BTCE 8GCHF 1OWHA 3RM0H 5GIBA 1DICA 2CV3A 3NXPA 1WAYB 2FLRH 2ZCKP 5HM2A 1GBDA 4FUCA 1G3BA 4NCYA 1P3CA 3RLWH 3JZ2B 1OKXA 1Y59T 2UUFB 2D1JA 3VB5A 1FI8A 2ODPA 1BRCE 5A8ZA 3SU2A 2YNAA 4B75A 1C5SA 1IAUA 1AWFH 1BRBE 1P9SA 2A45B 2EA3A 2G5NA 1N6XA 1ESAA 3LGYA 2AIQA 1HJAC 1GBBA 1EASA 3LONA 4KP0A 1ARCA 1K1NA 4TY6A 5JBTA 3A7YA 1GL1A 1V2ST 4Y6DA 1TRYA 1HIAA 2FMJA 2ZC9H 3M7UA 1VCQA 4RKOB 1GJ4H 3LU9B 1OS8A 1FY4A 1T4UH 1SC8U 4K1EA 3T62A 1TMTH 4AORA 1PPCE 5ABWA 1O2VA 2FODA 4CHAB 1SGCA 4YT7H 3SV6A 1C2IA 1ZHRA 1P03A 1FIZA 3F6UH 1Y3YA 1QFKH 1ZPZA 2QF0A 4O03A 5IDKA 3ZZ8A 2ZEBA 5JB9S 1XVOA 4ZMAH 5DKMA 3RDZA 2Y80A 3RXGA 1UTNA 5AFYH 1O33A 1GDNA 2QGRA 1ELGA 3DT0H 3F9EA 1LO6A 2GT8A 2FS8A 3SHCH 3BSQA 5DG6A 4DIIH 1LHFH 2ULLA 3RXUA 3SGBE 1PPHE 3V0XA 4GHQA 1W7GH 3U9AH 4WY3A 2A31A 1P2NA 4A92A 1AKSB 2ZFPH 1YPMH 1GMHG 1QHRB 3ATLA 4CRAA 1EP5A 1XUHA 1GL0E 1AB9B 2Y7XA 5TCCA 5C67A 3SNEA 2BDCA 1G36A 3QO6A 3NZIA 1BBRH 4X1PU 1GGDB 4MPWA 1RXPA 3GDSA 4IGDA 2ZPRA 1FMGA 3ZVAA 3SNDA 1LHCH 2ZF0H 4KTSA 1V2JT 2HPQH 3MU8A 4O3TA 3D49H 1DY9A 2GCTC 4NFEA 5FCRA 1T8NA 1GHAG 5J4SA 1CSOE 1V2TT 3NWUA 5TJXA 1VGCC 3VGCB 3B8JA 3I29A 4GVUA 3GISB 1D3QB 1UHBA 1YKTA 5DP5A 1S82A 4Q7XA 5EPNA 1A1RA 1AGJA 3GCNA 1NU7B 1T8MA 4Y10E 2TGPZ 3M3VA 2FOBA 1TYNA 2VWMA 7GCHF 1DLKB 2BD2A 1L1JA 2JETB 1AMHA 1CT0E 1XXDA 2ZECA 3NKKA 2CMYA 5F8XA 1CT2E 5GWZA 2J34A 1XM1A 5H4IB 2DUCA 2ZFRH 3QN7A 1PPZA 2J95A 7LPRA 2O8TA 4AGJA 3S7KB 1O2ZA 2FPZA 4TWWA 1YC0A 1CHOG 1S84A 4WWYA 3SUGA 1MU6B 3ZYEA 4H42U 3EDXB 4WH8A 4X6NA 2FOAA 4JMYA 3RC6A 4B71A 4AN7A 2ZFSA 1BITA 3A85A 1ABJH 1D3PB 1HIAB 1SLVB 1GI8B 5A09A 1S81A 3VFEA 3RXEA 4TPIZ 1V3XA 1OXGA 1ZPCA 2BQ6B 2WUCA 1K1PA 2A5KA 4BAOB 8ESTE 1ETSH 1ZRKA 4CH8B 3NPSA 1TBRH 2V35A 1Q31A 1JMOH 4OS5A 2ZA5A 1EPTA 5FCKA 1WTHD 3ITIA 3P8GA 4BOHA 2G4UA 1Y5AT 1Z7KA 1JBUH 1UVPA 2ZPQA 1WV7H 4D8NA 1AVGH 3NK8A 3IWMA 1TOMH 1HBTH 1KXBA 1HJAB 5AVDA 3UREA 2GV7A 1V6DA 3S7HB 1TPSA 1O2PA 2W3IA 4E7NA 2OQ5A 1ABIH 1GBEA 4FU9A 1UTOA 2BDYA 1CHOF 2PKSC 5DP3A 2BLQA 2QIQA 1AN1E 1BUIA 1G2LA 3PROA 1W0ZU 1SQTA 5C1UA 2F3CE 1EB1H 2SGQE 3QZRA 2J9NA 1VR1H 1O2KA 2W7UA 3RXPA 4U2WA 4IBLH 1O38A 1DX5M 4KELA 2EEKA 2A7JA 1HV7A 1ELBA 3M61U 1E38B 3RXIA 3SU0A 4XSKU 3OU0A 3Q3KA 5EW1H 3RXOA 3TGJE 1UHBB 2WINI 4RN6A 1HAPH 1O39A 3P95A 2CN0H 2C93B 1MKWH 1GBJA 3LPRA 2BXUH 2OC1A 5K0HA 5HM9A 2AERH 1NFUA 1KYNA 1N8OC 1OP8A 1FN8A 1YCPH 4NWLA 4JZ1A 2GX4A 2VWOA 2F83A 3O8BA 1P04A 1J16A 1RJXB 3SQEE 1O5EH 2GCTB 1AFEH 1F0TA 1S6FA 5FAHA 1ZMJA 1ESTA 4E06H 2C3SA 1TABE 1VGCB 5B6OA 2BY5X 1ELAA 3T5FH 4YTAA 3ZVGA 3SV7A 2ZU5A 5F03A 1C5MD 4OS4A 1D3TB 3AASA 1GVLA 6LPRA 1CGHA 1EXFA 1SGFG 4KTCA 4I8HA 1G3DA 1KTTB 5FX6A 4MNYA 3MU4A 2IPHA 5EQSA 1TX7A 1AQ7A 3M37A 3ZZAA 3Q3XA 3M7QA 2C8YB 3BTKE 3AAVA 1SQOA 1YPHE 3TLOA 1OOKB 2AMQA 4ABBA 1GJBB 1EPTB 3FAOA 1A0HB 2O8MA 3RM2H 3GY6A 3LC3A 3UNRA 1IHSH 2OBOA 3MMGA 1G3EA 4ISOA 2QAAA 3SI4H 1H9IE 3ZVDA 4KTUA 1N6YA 4MPXA 2VU8E 3U1IB 4R8TB 3TH2H 1SVPA 1VZQH 1PQ7A 1TNGA 5FBIA 1D9IA 3ZZBA 2QN5T 4Z0KA 3OSYA 4D7GA 2P3FH 5HXFA 1ARBA 2AIPA 1RTFB 5JBBS 1HRTH 2DE9A 2VWLA 3BTGE 4IC5A 4D9QA 1K1IA 2ZTYA 1LVBA 1WSSH 1PPBH 4XBCA 1QL9A 2V3HH 4Q2KA 3HKIB 2B0FA 3BTDE 1C2KA 1GBFA 1QJ6B 5GDSH 4B73A 3A87A 4JK5A 4F49A 1P06A 2Q1JA 1Z8GA 1UTJA 5HYOA 2NWNA 3DFJA 2PLXA 2FYRA 1FY3A 3MNXA 2Y5FA 1UVOA 2VWNA 3EAJA 5C3NA 2A4QA 1GHBG 1GBCA 1LCYA 1OWKA 3QTOH 2UUKB 1U6QA 4YLQH 1QBNA 2W7SA 3SO3A 1BCUH 2AMPA 4R0IA 1IQEA 2Y5GA 3SORA 2J2UA 3W95A 3G01A 1Z8IB 1ELVA 2GD4B 2P59A 1SR5C 4AB8A 4AFUA 1OYTH 2A0QB 4AGKA 2HNTF 1AFQC 2R0KA 2UUYA 1O37A 1Z8JB 1GCDA 1UK3A 4LOYH 5GPIB 1GHVH 2STAE 2GCHF 4WMEA 1HAGE 1QBVH 4X2WA 3ZZ9A 4OS2A 1ACBE 1JRTA 2O8UA 3RUOA 3RXSA 4Y7BA 1QB1A 1EZSC 2PGQB 3R0FA 1B5GH 5ESTE 1GDQA 2ZHWH 2HALA 4RSPA 1FZZA 1F92A 1FJSA 1C5ZB 2JH0D 1O2XA 1W3CA 4GUXA 4UONA 1UVUH 5A8YA 3TJOA 1NRRH 1XXFA 2BHGA 4WMFA 2R3UA 5FPTA 1BJVA 1VCWA 1ZPBA 1JIRA 2TGAA 1YLCA 2PKAA 1NESE 4ABGA 3U98H 2UWOA 4NA8A 3RU4T 3OX7U 3EA8A 4AYYB 4FVBA 1AY6H 1A7SA 2ZGHA 5FPSA 2Q6GA 1DXWA 1N8OB 2BX3A 4A5TS 2A32A 4X1QU 1MTWA 3EA9A 2BVRH 2ZWLH 4ZKNU 1C2GA 4A7IB 1KLTA 1W14U 3ATWA 4DW2U 1TNJA 1SGNE 2F9OA 1ANBA 1O30A 1BTXA 4I32A 2AGIX 1C1MA 1C2JA 3KN2A 1SG8B 1G30B 1GI7B 4WVPE 1O2UA 2OC0A 2GZ9A 2PGBB 3CENA 3ZZ3A 5C1XA 3MU0A 1DFPA 2Y81A 5CHAC 2ZU1A 2OINA 3GCHC 4F4OC 1TNIA 1BIOA 4OGXA 1YF4A 1BTZA 1C5QA 1QRXA 2M5TA 2VINA 1KSNA 1V2RT 5C5NA 1DWEH 1O2YA 4IN1A 1SFIA 2GTBA 3SU6A 2P8OC 2ODQA 1NROH 3FANA 1OP0A 1NO9H 1YYY1 4K1TA 3NUMA 1GI1A 2ZHQH 2BYAX 3UIRA 3V3MA 4I31A 4OGYA 3VPKA 5T6DA 1O3DA 1CO7E 3RXTA 2C8XB 1KLIH 2BDAA 1IQHA 1TONA 1S0RA 3SJIA 2WUBA 3GYLB 1RIWC 2F9PA 2Z6BD 2BY8X 1TPOA 3ELAH 3QLPH 1BB0B 1EZQA 4XBDA 4I7YH 5A2MH 1IQLA 2BDGA 3SQHE 3BEFB 4MNVA 2NU4E 5C1YA 1FV9A 2ANYA 1BTPA 1GG6C 3AAUA 3SZNA 4ISLA 4LXBH 2BVXH 2VIQA 2GMTC 4KGAA 1QY6A 1UCYK 2FIRH 3DHKH 2ZI2H 1O3LA 3SNAA 4MTBA 4K8BA 3GCTG 1BZXE 1AFQB 1C2FA 2Z3CA 3A8BA 3DUXH 1DS2E 2VIPA 1JRSA 3UNQA 8GCHG 3U8RH 1YPHC 3RXKA 1F5RA 2VNTA 2HVXA 2PWXA 4AFQA 2XCFA 4I8KA 4WH6A 1P10A 2BDHA 4CR5A 5JBAS 3U8TH 1AUTC 2H5CA 1QRWA 3S9AA 3B23B 3SBKA 1WUNH 1PJPA 1CVWH 4LZ1H 1P2MA 1NRNH 3L6PA 1J9CH 1PPGE 3BEIB 1ELDE 3RXFA 2BD7A 1QURH 1EX3A 3TH4H 1AKSA 3DA9B 4Y7AA 1E36B 1V2WT 3EGKH 3SUFA 3GICB 2NU3E 1HAYB 1GMCG 2C4FH 3RMLH 1ZGIA 3MU5A 1GPZA 3KQEA 2VIVA 1UTLM 2CXVA 1P09A 2H2ZA 1O0DH 1XUKA 4B76A 3ZVFA 1P2JA 3QWCH 3RXHA 1Q2WA 1FN6A 5I25A 4NSVA 1L1GA 3ZV9A 1Y5BT 4DY7B 3LIWA 5CHAB 3GCHB 1TA6A 4ZHAA 2R3YA 1GBMA 1ANCA 1AWHB 2BDIA 1CGJE 2H9HA 3A7XA 3D62A 1MZAA 2JH5D 4FUJA 1LHEH 1KXEA 1O3FA 1ZJKA 3BV9B 4NA7A 1CBWC 1YPKH 1BMAA 2CGAA 1C5VA 4CRFA 3MO6A 1QL7A 3KHVA 2Q6FA 3RXRA 1F5KU 1A4WH 4NA9H 4XBBA 1BMLA 3BTTE 4GPGA 4YOJA 1GMCF 1GMDF 4OS7A 1TX6A 1YPEH 3A7VA 1S6HA 2HLCA 2HRVA 1C1TA 4K1SA 1O2MA 5E0GA 2OUAA 3F9FA 2G51A 2G55A 2XNIA 1P05A 2Y82A 1RIWB 2YOLA 1MCTA 2ZU4A 2H9TH 3E6PH 3A7TA 3T26A 3STJA 1Y5UT 1P2OA 1BRUP 7GCHG 2XWBI 4FU8A 1GG6B 5EG4A 1HJ8A 1OWJA 2OXSA 1O3PB 2ZU3A 1J17T 2GMTB 2FXRA 1FQ3A 2FOMB 1DVAH 1HLTH 2ZFQH 3MI4A 3GY5A 1O5FH 3TK9A 4ABHA 2WPIS 2A7HA 2ZCLP 6GCHF 1H4WA 5DP6A 1P57B 3E1XB 1AUJA 1GJ7B 1V2OT 3ATKA 1NN6A 4Y8XA 1ZTLA 2XRCA 3A7WA 3SGQE 1HYLA 1Z6JH 3E90B 5E2OA 1WQSA 3KCGH 4XFQA 5DP7A 2B8OH 1GHYH 4BAKB 2P3UB 2ANMH 1TQ0B 2BVSH 1NRPH 1UCYE 3MH4A 5AHGH 3BTEE 1INCA 3Q00A 1QNJA 4UE7H 2FX4A 1HGTH 1IQFA 1F0UA 1CU1A 2W5EA 5JYIA 5EXLA 3LGUA 1M9UA 3L3TA 1TX8A 2HPPH 1MCVA 3QX5H 1GI9B 1IQNA 5EQRA 1LVMA 4RKJB 2TRMA 4NIVA 2SGEE 1GDUA 3FVFB 4BXSA 1AVWA 4H6TA 2F9VA 5EOKA 3ZVEA 4A6LA 3KEEA 1ZMLA 4X8SH 4DG4A 5BRRE 1T7CA 3ZZ4A 4FUDA 1A5GH 4GLYA 1WYKA 1ETRH 2BQ7B 1Q3XA 3OYPA 3LDXH 2D26C 1H9LB 3LT3A 4X6OA 2BMGB 1SGEE 3EQ0H 1OPHB 2ZQ2A 3UOUA 4YLUA 1TLDA 9LPRA 3UOPA 4K8YA 1SLXB 3GY8A 5EPYA 1PPFE 1A61H 2BQWB 1Z1JA 1AVXA 3B9FH 3A81A 1LTOA 1O3NA 2F9NA 4GAWA 2R2WU 3KQCA 5DPAA 4K69A 1TGTA 3PLKA 1TGSZ 5EODA 1EP6A 1OSSA 1ZYOA 3KQBA 1UTMA 4FUHA 2QY0B 2FI4E 1GBTA 3RXMA 1T32A 1CBWB 1SGPE 2FP7B 3V12A 1BDAA 2BLWA 1MUEB 2AMDA 1S0QA 3H7TA 1F7ZA 1DUAA 4Y8ZA 5G4BA 1MTUA 2FEQH 2G5VA 1OWIA 3N7OA 2ZDAH 5L2YH 1DLEA 5JBCS 5FPYA 1DY8A 2VJ1A 3A83A 2H6MA 2EI7A 1ZSKA 4JCNA 1TGBA 1O5GH 1SQAA 1Z6EA 4AG2A 1MD8A 1J15A 1XUGA 1O32A 1QB6A 2WPHS 1K28D 2SGAA 1YBWA 3LKWA 1AZ8A 1K1JA 2XYAA 3PMJA 1GHZA 3BEUA 3C27B 3KGPA 3FFGA 3ZVCA 1F0SA 1Y8TA 1LVYA 1DUEA 1P2IA 2ODYB 1TA2A 2ZDLA 1GI3A 1BTUA 2NU0E 4IC6A 1CQQA 1P8VC 1GI4A 1GJ5H 2J38A 3I78A 1ZHPA 4Z6AH 1DANH 2PSYA 2R2MB 1BHXB 2FWWA 1B0EA 2UWLA 4D76A 1HAIH 3ZZ7A 1V2LT 1O2OA 3CS7A 3JZ1B 1T4VH 2WYJA 3A8AA 1O3AA 5EQQA 4AG1A 3FP8E 3L33A 1JOUB 3PLBA 3A89A 1C2DA 3IITA 2ANWA 2IOTA 4Y0ZE 1AHTH 3SN8A 1DXPA 3PTBA 1ZOMA 1FXYA 1C9TA 3S69A
chains in the Genus database with same CATH superfamily
4BTUB 2AGGX 1UCYH 4DURA 1HUTH 2AS9A 1QQ4A 1ZLRA 2V3OH 1C5RA 2XBVA 4INKA 3SU5A 1HFDA 4JZEH 1DM4B 1HAXB 1W10U 2GGVB 2FI5E 2OP9A 5CE1A 2A2XH 3RXLA 3TH3H 1MBMA 3LC5A 1EOLA 3F3BA 2FYQA 1O5CB 1EAIA 1NT1A 2PUXB 4RT1A 1ZTKA 4AB9A 4CRGA 1QB9A 4YESB 1QBOA 4UFFH 3OY5U 1YM0A 1RD3B 1EJMA 1IOEA 2GCHG 5EJ1A 3O8CA 1DE7H 1V2QT 1YPLH 2BLOA 2OLGA 3SW2B 1K1LA 1K0HA 1RRKA 4VGCC 1P11E 3N99A 5KGOA 1NBME 2FZZA 3SJ9A 4LK4A 3SGAE 3SZEA 2JJ2D 1TQ7B 2HNTE 3PTNA 1A0LA 3UR9A 2ZFFH 2PV9B 5I46H 1VITF 4ABAA 1O2SA 3VB7A 2P95A 5C20A 1SMFE 4AOQA 2Z9IA 3GDVA 3PO1C 4DJZB 3W94A 5L6NH 5C94A 2VBCA 1TGCA 2ZKSA 3ZZ5A 2PUQH 1EOJA 1FLEE 4JZDH 4ABJA 1C2MA 4FU7A 2CHAC 3BTWE 2NU1E 3LGIA 3U1JB 1H1BA 3FP7E 6ESTA 1COWD 1KDQB 2WPLS 4JYTA 1G37A 4MPVA 1W7XH 4Q80A 1UTQA 1L4DA 5SGAE 2PKSB 1A3BH 3TK5A 2A7CA 1FX0B 3M3TA 1SGDE 1GJAB 4BTTB 3F9HA 4X6PA 1NFXA 2ZHFH 2IN2A 2F9UA 5A0CA 1BTYA 2R9PA 5EJZA 4Y76A 4B2CA 1ZJDA 1K1OA 4Y79A 1MQ6A 4ZUHA 1AI8H 2GJGA 4YO9A 1O3IA 1TBQH 4X8TH 1F5LA 2A2QH 1V2PT 2ASUB 3QGNB 1W2KH 1GVZA 2PTCE 1HB0B 1KTSB 2G00A 1LHGH 4AYVB 1SLUB 3TJUA 4WJG2 1NRSH 2WV5A 1XKAC 3TVJB 5C2ZA 4MNXA 2BD8A 2JKHA 2VB0A 4TPYA 2M2AA 2F43B 1EJAA 4HFPB 1XMNB 3UTUH 8KME2 3UWIA 1BT7A 3TIUA 4BANB 5A8XA 1MH0A 1AU8A 3DCLA 3RXDA 1V2NT 1P02A 4IW4E 2Z7FE 1WXRA 1GBIA 2B9LA 1MTVA 5FX5A 1S83A 3AW0A 3LOXA 1MQ5A 5HMAA 1NC6A 3SUEA 1O3MA 2QXIA 3TNSA 4ABEA 1D4PB 5EXNA 2KAIB 4FUBA 1ZMNA 4FVDA 4QT8C 2EI6A 4Z1MD 2ZGBH 1N1LA 1TRNA 1V2MT 1THRH 2ZDKA 1O5DH 4ISHH 3GYMA 3M36A 4AFZA 1NU9A 4OM9A 5F6MA 1BOQA 4THNH 3UFAA 5JB8S 1ZTJA 1SGRE 3RXBA 1NFWA 3LGVA 1C1UH 2EI8A 1YLDA 1SHHB 4VGCB 3F2GA 1A3EH 1G32B 2JH6D 1E35B 1TPAE 3QK1A 2FOFA 1WCZA 1ZRBA 1QIXB 2WYGA 4X2YA 5PTPA 1BQYA 2BD3A 3HGNA 3PRBA 3A7ZA 1BMMH 3UQVA 4INHA 3BIUH 1TALA 4ISIH 3PO1B 4X2VA 1XKBC 2GVFA 4CRCA 1O3KA 1ORFA 2VH6A 1DOJA 4ZHMU 5GXPA 3UPEA 2QXHA 2XXLA 1HAVB 2ZZUH 1F2SE 1FPHH 1L2EA 2OCVB 1C1PA 1C5PA 4YOGA 1BHXF 3RXJA 5ESBA 2C90B 1NPMA 2IJOB 2CF8H 2CHAB 4I8LA 4NFFA 2GKVE 4PROA 3SU1A 4NIYA 3RXVA 2GDEH 4WF8A 2THFB 3W1EA 1O2RA 1EAWA 1XX9A 2I6SA 2RA0A 3FOAA 3GY4A 1O2IA 4JZFH 1BTHH 3FKSD 1SGTA 2AEIH 1G9IE 1P12E 3WWFA 4BTIB 4X2XA 4ZXXH 2JJ1D 1Z1IA 1P9UA 2FM2A 4U01A 3KYFA 1ANDA 3ZVBA 2AGEX 2F91A 4ZKOU 3A8DA 4INLA 2BY7X 3LJOA 2BB4A 3MHWU 4MPUA 1C5LH 4B1TA 3MWIU 4X1NU 5TCAA 1W11U 4P00A 1W12U 3KF2A 4HI3A 3BTFE 3UNSA 3TGKE 4ZROA 1Z71A 4ACAA 3E0NB 3UUZA 3MH6A 1P0SH 2RFKC 1Y3UA 1RGQA 2FESH 4JK6A 1EZUC 1O36A 5BPEA 2G8TA 1FPCH 4A1TA 2VH0A 2A5IA 3RXQA 1HCGA 2PSXA 1LHDH 2TIOA 3C1KA 2XNDD 1NFYA 2ZFTA 1A2CH 1LVOA 2BD9A 3HK6B 3RC4A 3DD2H 3BIVH 4MDSA 3NCLA 2OC7A 3VEQB 4LZ4B 3RU4E 5GCHF 1J14A 2P16A 5T6GA 2F4LA 4ZKRU 2FOHA 1TPPA 4NZQA 3VGCC 1C5XB 1GMDG 3LGWA 1MBQA 1BTWA 3TJNA 1W8BH 1EB2A 1SGFA 2ZDNA 1BJUA 3FZDA 3TNTA 2VIWA 3Q3YA 3TU7H 1MD7A 1TWXB 2RG3A 4M7GA 1FDPA 3F0OA 3FP6E 1E37B 2KCAA 3SUDA 1MAXA 2ZHEH 2OD3B 3H5CB 2TGTA 3P8OA 3PMHB 1PFXC 1K9OE 4K2YA 5HGGA 4BAMB 1PYTD 4Q7ZA 4UFEH 4YT6H 4K5ZA 2V0BA 1KXCA 2Y6TA 3GCOA 2EY4C 3MO9A 4X8VH 5CHBA 6GCHG 4FOUC 1O2QA 1SL3A 1UTKA 2XC0A 2ZIQH 2FTLE 4ACBA 3PRDA 3A8CA 1C5NH 1KY9A 2WPKS 2QXJA 2PHBA 2YMSC 3GOVB 2SGDE 3K6YA 1QTFA 2AH4X 1IQKA 1TB6H 1MTSA 2P8OB 4NWKA 3ZV8A 4WXIA 5C5OA 3F0PA 3E8LA 7KMEH 3H7OA 4AC9A 3ESTA 3GDUA 2FI3E 2VIDA 2VVUA 3SOSA 3MNCA 5LPRA 2AYWA 1O3EA 3D65E 3FZZA 3Q76A 1GI0A 1T8OA 2BZAA 1QGFA 1S5SA 3E91A 1NBMD 3TK6A 2WV9A 2H9EH 4GCHF 5C0UA 3LJJA 4B2BA 4MNWA 3F2FA 4HZHA 5B6LA 1O5AB 4ZXYH 1SGYE 1ID5H 4J2YB 4Y71A 3SV8A 3VXEH 2XCNA 1C5TA 1PQ8A 1RFNA 3SU3A 1QCPA 1P01A 4GSOA 2ZO3H 4I8GA 3SV2H 1RTKA 4SGAE 2BOHB 3MU1A 1KLJH 2GT7A 1T31A 1TGNA 3SI3H 3O8DA 1BMFD 1CT4E 3AW1A 4E05H 7ESTE 1GI6A 1CA8B 2FS9A 3KNXA 1GJ8B 1IQJA 1EKBB 4SGBE 1C5WB 4ZHLU 3M5OA 1ELCA 1GJ6A 4A1XA 1S6LA 2P3TB 8LPRA 4U32A 3SNCA 1LQDB 1C4U2 1HXEH 1GBLA 1GBHA 3ODDA 2V6NA 5EW2H 1H9HE 1QA0A 1MU8B 5T3HA 2BD5A 4FUFA 5DSFA 1YP9A 1C1QA 2YMSD 4UFGH 4K60A 1NS3A 3PMBB 1O31A 4IN2A 5LPFA 5LGOA 1BA8B 5F8ZA 2ZDMA 1V2VT 1T8LA 3T29A 1IQIA 1O3BA 1TNLA 4H4FA 5T1VA 1E34B 1LKBA 1Y3VA 1OWEA 2KFWA 3AK5A 2G52A 3RC5A 5IK2D 3PMAB 2ZCHP 1TFXA 3SJKA 4ABIA 4FUIA 5KECA 3BTQE 1JXPA 4HTCH 1GCTC 1TRMA 1XUFA 1FAXA 3MYWA 3VG8A 2P93A 3CS0A 1HPGA 1UVTH 1AIXH 3E16B 4MQAA 1TE0A 3SV9A 1DWCH 5DJ7A 4RT0A 3QZQA 2YNBA 3ZZ6A 2P94A 2BOKA 2O8WA 1LQEA 2RDLA 4ZH8A 3ZIAD 3TJVA 1O35A 5C17A 3EA7A 2RDEA 3TITA 2H5DA 2ZTZA 2RA3A 4UDWH 5FBEA 3RMMH 1C1VH 4Y0YE 1MKXK 1LPKB 1EPTC 2SNWA 1GJDB 2A5AA 4FUEA 3T27A 2BDBA 1JIMA 3U8OH 3BG4C 1EAUA 1THSH 4NG9H 1EUFA 1GHWH 3EYDA 2ZNKH 1GMHF 2TGDA 3QTVH 3U69H 4FXGH 1C2HA 4NGAH 1C1SA 4AZ2B 2BXTH 2GP9B 3Q77A 3HPTB 1NRQH 1YGCH 3DSOA 2Y5HA 1C4Y2 2VGCC 2VIOA 4JYVH 2WPMS 4YXWD 1DT2A 4AX9H 1A0JA 2Z9KA 2BY6X 2D2DA 1SFQB 2FO9A 1MTNC 2FLBH 5C0TA 4YM9A 1J8AA 1GHAF 3MNSA 3KQDA 1H8DH 1BMNH 1Y3WA 2BLVA 2FX6A 3M3SA 3BTME 3EE0B 1C5YB 3MO3A 1EATA 1EQ9A 5AFZH 3MH5A 3P8NA 2FDAA 1VJAU 3K2UA 3MNBA 2RCEA 1DDJA 5E2PA 1O2LA 3PYHA 4TY7A 2QF3A 4Y8YA 5DK1A 1O2WA 1C5UA 1H8HD 1NY22 1DWDH 2G4TA 3LGTA 4JZIA 4Q7YA 4IS5A 2PTNA 2H1UA 4YZUA 1B7XB 3LH1A 4O3UA 2O8LA 3ZZDA 2KR7A 4ASHA 1OWDA 2A4RA 3VB4A 4MVNA 4NIWA 1ELFA 3QGJA 1KDQA 4NIXA 3P6ZB 1S85A 1C1WH 4MG3A 1EZXC 1YPJH 3P17H 1UTPA 1K1MA 1V2KT 4X0WU 1ETTH 2CK3D 6CHAC 1AD8H 2GDDA 4CRDA 3O8RA 1QL8A 2CJIA 2ANKH 4ZKSU 4ABFA 4CRBA 1ZSLA 2SGPE 4KKDA 2K1QA 1DITH 2GZ8A 1ZR0A 2ESTE 2J94A 1A5IA 1SOZA 2I6QA 1VITG 3N7DA 1HXFH 1K22H 1RTLA 2FOGA 5ETXA 4XE4A 9ESTA 5DO4H 1IQGA 1VJ9U 2ZGJA 1NTPA 4IMZA 3LH3A 2TPIZ 5T6FA 2Y7ZA 1UO6A 5GJ4B 4DCDA 1KXDA 3S9CA 3VB3A 2G81E 1KXAA 3SJ8A 1KIGH 2XBYA 1BRAA 1HNEE 1DPOA 2BX4A 1K21H 2PFEA 1GJ9B 3RXCA 1GCTB 2ZPSA 4I8JA 1UMAH 3M5NA 5DGJA 5DP9A 1O2GH 4CR9A 1L0ZA 4BAQB 4CREA 2VVVA 1DSTA 2FOCA 1ANEA 3RU4D 3MTYA 1FONA 3UWJH 1O3GA 1KXFA 2PW8H 2SGFE 1TIOA 5EU8A 4HG6A 4O9VA 4CBNA 1FIWA 5LH8A 1GWAA 3M7TA 1SOTA 1WU1A 3HKJB 3PM3A 3URCA 3ENSB 1D6RA 5K7RA 2QF4A 4K3JA 3A88A 1WTGH 4AFSA 1O2JA 1SGQE 3ODFA 2KAIA 3BG4B 4YOIA 1GBAA 3T28A 3HK3B 3QDZB 3GY3A 3SJOA 4H6SB 4P02A 3S0NA 3D23A 1LDTT 1V2UT 3STIA 2OC8A 1FNIA 3URDA 3S9BA 1L1NA 3MH7A 2UWPA 2XTTB 3SU4A 3KL6A 1G3CA 2WPJS 2VGCB 3ZYDA 1AE8H 1TOCB 3PWCA 4DOQA 3TGIE 1TNHA 3HGPA 1DSUA 5A0BA 3V13A 1MTNB 1WQVH 1ZZZA 2QCYA 3KIDU 1PQAA 1A46H 1H8ED 3GY7A 4OS6A 2KCOA 3HATH 1F0RA 1P2QA 1TMBH 1CHGA 2QA9E 1O2NA 1LPZB 1CA0C 1SLWB 1C5OH 1HAHH 4Y11E 3P92A 1UK4A 1MZDA 1SB1H 3DSPA 3SNBA 1BBRK 1P3EA 4UD9H 2ZDVH 2LPRA 1EAXA 1PQ5A 4FUGA 3OTJE 4BXWA 3A82A 4MLFB 1HAVA 2FTMA 1CGIE 4B2AA 2AHME 2XBWA 1SI5H 3BF6H 3BTHE 4XD7D 2Z9JA 2QXGA 1SKYE 1JWTA 1X7AC 5CMXH 2Q6DA 4D7FA 4DGJA 5IYTA 1G2MA 1OP2A 1W13U 1W0JD 2J4IA 2XW9A 2B5TB 3VB6A 1RS0A 1P2KA 3E0PB 6CHAB 1O3OA 4X6MA 4X8UH 1LKAA 2PP6A 1Z8RA 1XUJA 3I77A 3CP7A 2QV1A 1PPEE 5F53A 3BN9A 1O2TA 5JDUB 2ILNA 5LPEA 1WOFA 1GI5A 2OQUA 1GI2A 1UK2A 2STBE 4A1VA 3M5LA 1VKYA 3PLPA 4HGCA 1QA7A 1AZZA 1IQMA 1C1OA 2HGTH 1TBZH 1XUIA 2DE8A 1O34A 4TYDA 3A84A 3RP2A 1LPGB 1GHBF 1A5HA 3A80A 2ALPA 1AE5A 2J92A 2UUJB 1O5BB 1VITH 2EC9H 5AF9H 3K9XB 4BAHB 4D9RA 1C2EA 3R3GB 1ESBA 3RMNH 5FHTA 1AO5A 2GZ7A 2Z94A 3U28C 2LNCA 2ZGXH 2XC5A 4UFDH 3F1SB 1XVMA 2QYIA 5F8TA 1HDTH 1Y3XA 2ALVA 3PV4A 4WMDA 3PV5A 2ZU2A 1YPGH 2A4GA 2WPDD 4NSYA 5DP4A 2XC4A 2SNVA 1FY8E 1QRZA 3ZZCA 1TMUH 1IHTH 4NZLA 3QUMP 1CE5A 4TWYA 1ZSJA 1QZ8A 1C4V2 4B74A 2Z3DA 4DT7B 1D6WA 2J97A 3PB1E 4ZAEA 5JPMH 1SHYA 2BY9X 1UJ1A 1C9PA 1MMJN 3MFJA 1FAKH 1DWBH 1O2HA 2XWAA 3OE7D 3UB0A 3UY9A 2O9QA 5J4QA 3GY2A 1MKXH 2HWLB 3P70B 5GCHG 5L30H 2FOEA 5EGMA 2QE7D 3PV2A 2HOBA 1PYTC 1GJCB 3UQOA 2XOKD 4CHAC 1O3HA 3E3TA 1ELTA 3T25A 1FY1A 2ZG0H 1YY3A 1O3JA 2JIZD 4UEHH 3PWBA 1FY5A 2AFQB 1CA0B 1SSXA 1SGIB 3DSGA 3UR6A 1MKWK 3VXFH 1ELEE 1OX1A 1SBWA 2K8IA 2C8WB 5E0JA 5EXMA 3RLYH 5E0HA 2ZGCA 2C8ZB 2ZP0H 4X1RU 2A1DB 2TBSA 1GHXH 1YCPK 2W26A 4WXVA 2LP6A 3WY8A 4ESTE 1B0FA 2BD4A 1H8IH 1L4ZA 2PKAB 1FUJA 3F9GA 4CH2B 4DVAU 2D8WA 4XDEA 3MOCA 2ZHDA 1HJ9A 5DP8A 1GVKB 2Z9LA 1AB9C 1O3CA 1BBRE 1UVSH 2OBQA 4DIHH 3F68H 5E8EH 1TAWA 3SHAH 4I33A 3TPIZ 1GGDC 4X1SU 5L2ZH 3M5MA 2PR3A 1W0YH 2HNTC 2F9BH 4U30A 1EJNA 2ZQ1A 2CF9H 2B7DH 1THPB 2BM2A 2SFAA 4ISNA 1ZGVA 1TNKA 3AVZA 3BG8A 3RXAA 3RMOH 2QC2A 4IMQA 2GV6A 3A86A 3ATMA 2ZTXA 1VCPA 4BNRA 1YCPM 2XBXA 4Q4LA 2VVCA 3ATIA 5GNDA 2BZ6H 2W3KA 1QQUA 4OS1A 2Z9GA 1QJ7B 4GCHG 1HAOH 3T2NA 3N7EA 3K6ZA 1GBKA 1QR3E 4J1YA 1NZQH 1C1NA 4XOJA 2JETC 4JYUH 5A0AE 1HAZB 4E7RG 2WV4A 1NM6A 2Z3EA 1ZHMA 1QJ1B 3P8FA 5FXLA 1SPJA 1OYQA 1D3DB 4GHTA 2OTVA 4O97A 2R0LA 3DFLA 1E0FD 1EFRD 4ABDA 3GCTF 1WBGB 3M35A 2NU2E 4CBOA 3OY6U 3K65B 2A4OA 3V7TA 1K2I1 1MAYA 1C2LA 1LMWB 3IG6B 1C1RA 2BTCE 8GCHF 1OWHA 3RM0H 5GIBA 1DICA 2CV3A 2KZ4A 3NXPA 1WAYB 2FLRH 2ZCKP 5HM2A 1GBDA 4FUCA 1G3BA 4NCYA 1P3CA 3RLWH 3JZ2B 1OKXA 1Y59T 2UUFB 2D1JA 3VB5A 1FI8A 1SQRA 2ODPA 1BRCE 5A8ZA 3SU2A 2YNAA 4B75A 1C5SA 1IAUA 1AWFH 1BRBE 1P9SA 1OHHD 2A45B 2EA3A 2G5NA 1N6XA 1ESAA 3LGYA 2AIQA 1HJAC 1GBBA 1EASA 3LONA 4KP0A 1ARCA 1K1NA 4TY6A 5JBTA 3A7YA 1GL1A 1V2ST 4Y6DA 1TRYA 1HIAA 2FMJA 2ZC9H 3M7UA 1VCQA 4RKOB 1GJ4H 3LU9B 1OS8A 1FY4A 1T4UH 1SC8U 4K1EA 3T62A 1TMTH 4AORA 1PPCE 5ABWA 1O2VA 2FODA 4CHAB 1SGCA 4YT7H 3SV6A 1C2IA 1ZHRA 1P03A 1FIZA 3F6UH 1Y3YA 1QFKH 1ZPZA 2QF0A 4O03A 5IDKA 3ZZ8A 2ZEBA 5JB9S 1XVOA 4ZMAH 5DKMA 3RDZA 2Y80A 3RXGA 1UTNA 5AFYH 1O33A 1GDNA 2QGRA 1ELGA 3DT0H 3F9EA 1LO6A 2GT8A 5KEDA 2FS8A 3SHCH 3BSQA 5DG6A 4DIIH 1LHFH 2ULLA 3RXUA 3SGBE 1PPHE 3V0XA 4GHQA 1W7GH 3U9AH 2W6JD 4WY3A 2A31A 1P2NA 2L74A 4A92A 1AKSB 2ZFPH 1YPMH 3OTPA 1GMHG 1QHRB 3ATLA 4CRAA 1EP5A 1XUHA 1GL0E 1AB9B 2Y7XA 5TCCA 5C67A 3SNEA 2BDCA 1G36A 3QO6A 3NZIA 1BBRH 4X1PU 1GGDB 4MPWA 2JDID 1RXPA 3GDSA 4IGDA 2ZPRA 1FMGA 3ZVAA 3SNDA 1LHCH 2ZF0H 4M9FA 4KTSA 4ASUD 1V2JT 2HPQH 3MU8A 4O3TA 3D49H 1DY9A 2GCTC 4NFEA 5FCRA 1T8NA 1GHAG 5J4SA 1CSOE 1V2TT 3NWUA 5TJXA 1VGCC 3VGCB 3B8JA 3I29A 4GVUA 3GISB 3FN8A 1D3QB 1UHBA 1YKTA 5DP5A 1S82A 4Q7XA 5EPNA 1A1RA 1AGJA 3NRLA 3GCNA 1NU7B 1T8MA 4Y10E 2TGPZ 3M3VA 2WSSD 2FOBA 1TYNA 2VWMA 7GCHF 1DLKB 2BD2A 1L1JA 2JETB 1AMHA 1CT0E 1XXDA 2ZECA 3NKKA 2CMYA 5F8XA 1CT2E 5GWZA 2J34A 1XM1A 5H4IB 2DUCA 2ZFRH 3QN7A 2HLDD 1PPZA 2J95A 3SYJA 7LPRA 2O8TA 4AGJA 3S7KB 1O2ZA 2FPZA 4TWWA 1YC0A 1CHOG 1S84A 4WWYA 3SUGA 1MU6B 3ZYEA 3CNRA 4H42U 3EDXB 4WH8A 4X6NA 2FOAA 4JMYA 3RC6A 4B71A 2YMSB 4AN7A 2ZFSA 1BITA 3A85A 1ABJH 1D3PB 1HIAB 1SLVB 1GI8B 5A09A 1S81A 3VFEA 3RXEA 4TPIZ 1V3XA 1OXGA 1ZPCA 2BQ6B 2WUCA 1K1PA 2A5KA 4BAOB 8ESTE 1ETSH 1ZRKA 4CH8B 3NPSA 1TBRH 2V35A 1Q31A 1MABB 1JMOH 4OS5A 2ZA5A 1EPTA 5FCKA 1WTHD 3ITIA 3P8GA 4BOHA 4XRNA 2G4UA 1Y5AT 1Z7KA 1JBUH 1UVPA 2ZPQA 1WV7H 4D8NA 1AVGH 3NK8A 3IWMA 1TOMH 1HBTH 1KXBA 2KX4A 1HJAB 5AVDA 3UREA 2GV7A 1V6DA 3S7HB 1TPSA 1O2PA 2W3IA 4E7NA 2OQ5A 1ABIH 1GBEA 4FU9A 1UTOA 2BDYA 1CHOF 2PKSC 4TT3D 5DP3A 2BLQA 2QIQA 1AN1E 1BUIA 1G2LA 3PROA 1W0ZU 1SQTA 5C1UA 2F3CE 3OEHD 1EB1H 2SGQE 3QZRA 2J9NA 5HIZA 1VR1H 1O2KA 2W7UA 3RXPA 4U2WA 4IBLH 1O38A 1DX5M 4KELA 2EEKA 2A7JA 1HV7A 1ELBA 3M61U 1E38B 3RXIA 3SU0A 4XSKU 3OU0A 3Q3KA 5EW1H 3RXOA 3TGJE 1UHBB 2WINI 4RN6A 1HAPH 1O39A 3P95A 3OFND 2CN0H 2C93B 1MKWH 1GBJA 3LPRA 2BXUH 2OC1A 5K0HA 2LELA 5HM9A 2AERH 4TSFD 1NFUA 1KYNA 1N8OC 1OP8A 1FN8A 1YCPH 4NWLA 4JZ1A 2V7QD 2GX4A 2VWOA 2F83A 3O8BA 1P04A 1J16A 1RJXB 3SQEE 1O5EH 2GCTB 1AFEH 1F0TA 1S6FA 5FAHA 1ZMJA 1ESTA 4E06H 2C3SA 1TABE 1VGCB 5B6OA 2BY5X 1ELAA 3T5FH 4YTAA 3ZVGA 3SV7A 2ZU5A 5F03A 1C5MD 4OS4A 1D3TB 3AASA 1GVLA 6LPRA 1CGHA 1EXFA 1SGFG 4KTCA 2V3MA 4I8HA 1G3DA 1KTTB 5FX6A 4MNYA 3MU4A 2IPHA 5EQSA 1TX7A 1AQ7A 3M37A 3ZZAA 3Q3XA 3M7QA 2C8YB 3BTKE 3AAVA 1SQOA 1YPHE 3TLOA 1OOKB 2AMQA 4ABBA 1GJBB 1EPTB 3FAOA 1A0HB 2O8MA 3RM2H 3GY6A 3LC3A 3UNRA 1IHSH 2OBOA 3MMGA 1G3EA 4ISOA 2QAAA 3SI4H 1H9IE 3ZVDA 4KTUA 1N6YA 4MPXA 2VU8E 3U1IB 4R8TB 3TH2H 1SVPA 3GS9A 1VZQH 1PQ7A 1TNGA 5FBIA 1D9IA 3ZZBA 2QN5T 4Z0KA 3OSYA 4D7GA 2P3FH 2WHXA 1UW7A 5HXFA 1ARBA 2AIPA 1RTFB 5JBBS 1HRTH 2DE9A 2VWLA 3BTGE 4IC5A 4D9QA 1K1IA 2ZTYA 1LVBA 1WSSH 1PPBH 4XBCA 1QL9A 2V3HH 4Q2KA 3HKIB 2B0FA 3BTDE 1C2KA 1GBFA 1QJ6B 5GDSH 4B73A 3A87A 4JK5A 4F49A 1P06A 2Q1JA 1W0KD 1Z8GA 1UTJA 5HYOA 2NWNA 3DFJA 2PLXA 2FYRA 1FY3A 3MNXA 2Y5FA 1UVOA 2VWNA 2J98B 3EAJA 5C3NA 2A4QA 1GHBG 1GBCA 1LCYA 1OWKA 3QTOH 2UUKB 1U6QA 4YLQH 1QBNA 2W7SA 3SO3A 1BCUH 2AMPA 4R0IA 1IQEA 2Y5GA 3SORA 2J2UA 3W95A 3G01A 1Z8IB 1ELVA 2GD4B 2P59A 1SR5C 4AB8A 4AFUA 1OYTH 2A0QB 4AGKA 2HNTF 1AFQC 2R0KA 2UUYA 1O37A 1Z8JB 1GCDA 1UK3A 4LOYH 5GPIB 1GHVH 2STAE 2GCHF 4WMEA 1HAGE 1QBVH 4X2WA 3ZZ9A 4OS2A 1ACBE 1JRTA 3KYGA 2O8UA 3RUOA 3RXSA 4Y7BA 1QB1A 4RI0A 1EZSC 2PGQB 3OAAD 3R0FA 1B5GH 5ESTE 1GDQA 2K0QA 3WWBA 2ZHWH 2HALA 4RSPA 1FZZA 1F92A 1FJSA 1C5ZB 2JH0D 1O2XA 1W3CA 4GUXA 4UONA 1UVUH 5A8YA 3TJOA 1NRRH 1XXFA 2BHGA 4WMFA 2WZQA 2R3UA 5FPTA 1BJVA 1VCWA 1ZPBA 1JIRA 2TGAA 1YLCA 2PKAA 1NESE 4ABGA 3U98H 2UWOA 4NA8A 3RU4T 3OX7U 3EA8A 4AYYB 4FVBA 1AY6H 1A7SA 2ZGHA 5FPSA 2Q6GA 1DXWA 1N8OB 2KM0A 2BX3A 4A5TS 2A32A 4X1QU 1MTWA 3EA9A 2BVRH 5EIYA 3F2HA 2ZWLH 4ZKNU 1C2GA 4A7IB 1KLTA 1W14U 3ATWA 4DW2U 1TNJA 1SGNE 2F9OA 2IPQX 1ANBA 1O30A 1BTXA 4I32A 2AGIX 1C1MA 1C2JA 3KN2A 1SG8B 1G30B 1GI7B 4WVPE 1O2UA 2OC0A 2GZ9A 2PGBB 3CENA 3ZZ3A 5C1XA 3MU0A 1DFPA 2Y81A 5CHAC 2ZU1A 2OINA 3GCHC 4F4OC 1TNIA 1BIOA 4OGXA 1YF4A 1BTZA 1C5QA 1QRXA 2M5TA 3MQKC 2VINA 1KSNA 1V2RT 5C5NA 1DWEH 1O2YA 4IN1A 1SFIA 2GTBA 3SU6A 2P8OC 2ODQA 1NROH 3FANA 1OP0A 1NO9H 1YYY1 4FETA 4K1TA 3NUMA 1GI1A 2ZHQH 2BYAX 3UIRA 3V3MA 4I31A 4OGYA 3VPKA 5T6DA 1O3DA 1CO7E 3RXTA 2C8XB 1KLIH 2BDAA 1IQHA 1TONA 1S0RA 3SJIA 2WUBA 3GYLB 1RIWC 2F9PA 2Z6BD 2BY8X 1TPOA 2J5UA 3ELAH 3QLPH 1BB0B 1EZQA 4XBDA 4I7YH 5A2MH 1IQLA 2BDGA 3SQHE 3BEFB 4MNVA 2NU4E 5C1YA 1FV9A 2ANYA 1BTPA 1GG6C 3AAUA 3SZNA 4ISLA 4LXBH 2BVXH 2VIQA 2GMTC 4KGAA 1QY6A 1UCYK 2FIRH 3DHKH 2ZI2H 1O3LA 3SNAA 4MTBA 4K8BA 3GCTG 1KMHB 1BZXE 1AFQB 1WDIA 1C2FA 2Z3CA 3A8BA 3DUXH 1DS2E 2VIPA 1JRSA 3UNQA 8GCHG 3U8RH 1YPHC 3RXKA 1F5RA 2VNTA 2HVXA 2PWXA 4AFQA 2XCFA 4I8KA 4WH6A 1P10A 2BDHA 4CR5A 5JBAS 3U8TH 1AUTC 2H5CA 4ZCNA 1QRWA 3S9AA 1E79D 3B23B 5DN6D 3SBKA 1WUNH 1PJPA 1CVWH 4LZ1H 1P2MA 1NRNH 3L6PA 1J9CH 1PPGE 3BEIB 1ELDE 5HKKD 3RXFA 2BD7A 1QURH 1EX3A 3TH4H 1AKSA 3DA9B 4Y7AA 3PTBA 1E36B 1V2WT 3EGKH 3SUFA 3GICB 2NU3E 4F48B 1HAYB 1GMCG 2C4FH 1E1RD 3RMLH 1ZGIA 3MU5A 1GPZA 3KQEA 2VIVA 1UTLM 2CXVA 1P09A 2H2ZA 1O0DH 1XUKA 4B76A 3ZVFA 1P2JA 3QWCH 3RXHA 1Q2WA 1FN6A 5I25A 4NSVA 1L1GA 3ZV9A 1Y5BT 4DY7B 3LIWA 5CHAB 3GCHB 1TA6A 4ZHAA 2R3YA 1GBMA 1ANCA 1AWHB 2BDIA 1CGJE 2H9HA 3A7XA 3D62A 1MZAA 2JH5D 4FUJA 1LHEH 1KXEA 1O3FA 1ZJKA 3BV9B 4NA7A 1CBWC 1YPKH 1BMAA 2CGAA 1C5VA 4CRFA 3MO6A 1QL7A 3KHVA 2Q6FA 3RXRA 1F5KU 1A4WH 4NA9H 4XBBA 5CDFE 1BMLA 3BTTE 4GPGA 4YOJA 1YLNA 1GMCF 1GMDF 4OS7A 1TX6A 1YPEH 3A7VA 1S6HA 2HLCA 2HRVA 1C1TA 4K1SA 1O2MA 5E0GA 2OUAA 3F9FA 2G51A 2G55A 2XNIA 1P05A 2Y82A 1RIWB 2YOLA 1MCTA 2ZU4A 2H9TH 3E6PH 3A7TA 3T26A 3STJA 1Y5UT 1P2OA 1BRUP 7GCHG 2XWBI 4FU8A 1GG6B 5EG4A 1HJ8A 1OWJA 2OXSA 1O3PB 2ZU3A 1J17T 2GMTB 2FXRA 1FQ3A 2FOMB 1DVAH 1HLTH 2ZFQH 3MI4A 3GY5A 1O5FH 3TK9A 4ABHA 2WPIS 2A7HA 2ZCLP 6GCHF 1H4WA 2L6OA 5DP6A 1P57B 3E1XB 1AUJA 1GJ7B 1V2OT 3ATKA 1NN6A 4Y8XA 1ZTLA 2XRCA 3A7WA 3SGQE 1HYLA 1Z6JH 3E90B 5E2OA 1WQSA 3KCGH 4XFQA 4I86A 5DP7A 2B8OH 1GHYH 4BAKB 2P3UB 2ANMH 1TQ0B 2BVSH 1NRPH 1UCYE 4B6FA 3MH4A 5AHGH 3BTEE 1INCA 3Q00A 1QNJA 4UE7H 2FX4A 1HGTH 1IQFA 1F0UA 1CU1A 2W5EA 5JYIA 3UAIC 5EXLA 3LGUA 1M9UA 2KCPA 3L3TA 1TX8A 2HPPH 1MCVA 3QX5H 1GI9B 1IQNA 2KCYA 5EQRA 1LVMA 4RKJB 2TRMA 4NIVA 2SGEE 1GDUA 3FVFB 4BXSA 1AVWA 4H6TA 2F9VA 5EOKA 3ZVEA 4A6LA 3H09A 3KEEA 1ZMLA 4X8SH 4DG4A 5BRRE 1T7CA 3ZZ4A 4FUDA 1A5GH 4GLYA 1WYKA 1ETRH 4Q63A 2BQ7B 1Q3XA 3OYPA 3LDXH 2D26C 1H9LB 3LT3A 4X6OA 2BMGB 1SGEE 3EQ0H 1OPHB 2ZQ2A 3UOUA 4YLUA 1TLDA 9LPRA 3UOPA 4K8YA 1SLXB 3GY8A 5EPYA 1PPFE 1A61H 2BQWB 4B6EA 3FO8D 1Z1JA 1AVXA 3B9FH 3A81A 1LTOA 1O3NA 2F9NA 4GAWA 2R2WU 3KQCA 5DPAA 4K69A 1TGTA 3PLKA 1TGSZ 5EODA 1EP6A 1OSSA 1ZYOA 3KQBA 1UTMA 4FUHA 2QY0B 2FI4E 3WW7A 1GBTA 3RXMA 1T32A 1CBWB 1SGPE 2FP7B 3V12A 1BDAA 2BLWA 1MUEB 2AMDA 1S0QA 3H7TA 1F7ZA 1DUAA 4Y8ZA 5G4BA 1MTUA 2FEQH 2G5VA 5EJLA 1OWIA 3N7OA 2ZDAH 5L2YH 1DLEA 2EQNA 5JBCS 5FPYA 1DY8A 2VJ1A 3A83A 2H6MA 2EI7A 1ZSKA 4JCNA 1TGBA 1O5GH 1SQAA 1Z6EA 4AG2A 1MD8A 1J15A 1XUGA 5HIYA 1O32A 3EE7A 1QB6A 2WPHS 1K28D 2IJD1 2SGAA 1YBWA 3LKWA 1AZ8A 1K1JA 2OK5A 3KQ5A 2XYAA 3OEED 3PMJA 1GHZA 3BEUA 3C27B 3KGPA 3FFGA 3ZVCA 1F0SA 1Y8TA 1LVYA 4F55A 1DUEA 1P2IA 2ODYB 1TA2A 2ZDLA 1GI3A 2J98A 1BTUA 2NU0E 4IC6A 1CQQA 1P8VC 1GI4A 1GJ5H 2J38A 5FL7D 3I78A 1ZHPA 2QF5A 4Z6AH 1DANH 2PSYA 2R2MB 1BHXB 2HVYB 2FWWA 1B0EA 2UWLA 4D76A 1HAIH 2W6ID 3ZZ7A 1V2LT 1O2OA 3CS7A 3JZ1B 1T4VH 4DT4A 2WYJA 3A8AA 1O3AA 5EQQA 4AG1A 3FP8E 3L33A 1JOUB 3PLBA 3A89A 1C2DA 3IITA 2ANWA 2IOTA 4Y0ZE 1AHTH 1E1QD 1DXPA 3SN8A 1YWUA 1ZOMA 1FXYA 1C9TA 3S69A
chains in the Genus database with same CATH topology
4BTUB 2AGGX 1UCYH 4DURA 1HUTH 2AS9A 1QQ4A 1ZLRA 2V3OH 1C5RA 2XBVA 4INKA 3SU5A 1HFDA 4JZEH 1DM4B 1HAXB 1W10U 2GGVB 2FI5E 2OP9A 5CE1A 2A2XH 3RXLA 3TH3H 1MBMA 3LC5A 1EOLA 2FYQA 1O5CB 1EAIA 1NT1A 2PUXB 1ZTKA 4AB9A 4CRGA 1QB9A 4YESB 1QBOA 4UFFH 3OY5U 1YM0A 1RD3B 1EJMA 1IOEA 2GCHG 3O8CA 1DE7H 1V2QT 1YPLH 2BLOA 2OLGA 3SW2B 1K1LA 1RRKA 4VGCC 1P11E 2FZZA 3SJ9A 4LK4A 3SGAE 1TQ7B 2HNTE 3PTNA 1A0LA 3UR9A 2ZFFH 2PV9B 5I46H 1VITF 4ABAA 1O2SA 3VB7A 2P95A 5C20A 1SMFE 4AOQA 2Z9IA 3GDVA 3PO1C 4DJZB 3W94A 5L6NH 1TGCA 2ZKSA 3ZZ5A 2PUQH 1EOJA 1FLEE 4JZDH 4ABJA 1C2MA 4FU7A 2CHAC 3BTWE 2NU1E 3LGIA 3U1JB 1H1BA 3FP7E 6ESTA 1KDQB 2WPLS 4JYTA 1G37A 4MPVA 1W7XH 4Q80A 1UTQA 1L4DA 5SGAE 2PKSB 1A3BH 3TK5A 2A7CA 3M3TA 1SGDE 1GJAB 4BTTB 3F9HA 4X6PA 1NFXA 2ZHFH 2IN2A 2F9UA 5A0CA 1BTYA 2R9PA 4Y76A 4B2CA 1ZJDA 1K1OA 4Y79A 1MQ6A 4ZUHA 1AI8H 4YO9A 1O3IA 1TBQH 4X8TH 1F5LA 2A2QH 1V2PT 2ASUB 3QGNB 1W2KH 1GVZA 2PTCE 1HB0B 1KTSB 2G00A 1LHGH 4AYVB 1SLUB 3TJUA 4WJG2 1NRSH 2WV5A 1XKAC 3TVJB 5C2ZA 4MNXA 2BD8A 2JKHA 2VB0A 4TPYA 1EJAA 4HFPB 1XMNB 3UTUH 8KME2 3UWIA 1BT7A 3TIUA 4BANB 5A8XA 1MH0A 1AU8A 3RXDA 1V2NT 1P02A 4IW4E 2Z7FE 1GBIA 2B9LA 1MTVA 5FX5A 1S83A 3AW0A 3LOXA 1MQ5A 5HMAA 1NC6A 3SUEA 1O3MA 2QXIA 3TNSA 4ABEA 1D4PB 5EXNA 2KAIB 4FUBA 1ZMNA 4FVDA 4QT8C 2EI6A 2ZGBH 1N1LA 1TRNA 1V2MT 1THRH 2ZDKA 1O5DH 4ISHH 3GYMA 3M36A 4AFZA 1NU9A 5F6MA 1BOQA 4THNH 3UFAA 5JB8S 1ZTJA 1SGRE 3RXBA 1NFWA 3LGVA 1C1UH 2EI8A 1YLDA 1SHHB 4VGCB 1A3EH 1G32B 2JH6D 1E35B 1TPAE 3QK1A 2FOFA 1WCZA 1ZRBA 1QIXB 2WYGA 4X2YA 5PTPA 1BQYA 2BD3A 3HGNA 3A7ZA 1BMMH 3UQVA 4INHA 3BIUH 1TALA 4ISIH 3PO1B 4X2VA 1XKBC 2GVFA 4CRCA 1O3KA 1ORFA 2VH6A 1DOJA 4ZHMU 5GXPA 3UPEA 2QXHA 2XXLA 1HAVB 2ZZUH 1F2SE 1FPHH 1L2EA 2OCVB 1C1PA 1C5PA 4YOGA 1BHXF 3RXJA 5ESBA 2C90B 1NPMA 2IJOB 2CF8H 2CHAB 4I8LA 4NFFA 2GKVE 4PROA 3SU1A 4NIYA 3RXVA 2GDEH 4WF8A 2THFB 1O2RA 1EAWA 1XX9A 2I6SA 2RA0A 3GY4A 1O2IA 4JZFH 1BTHH 1SGTA 2AEIH 1G9IE 1P12E 4BTIB 4X2XA 4ZXXH 1Z1IA 1P9UA 2FM2A 4U01A 1ANDA 3ZVBA 2AGEX 2F91A 4ZKOU 3A8DA 4INLA 2BY7X 3LJOA 2BB4A 3MHWU 4MPUA 1C5LH 4B1TA 3MWIU 4X1NU 5TCAA 1W11U 1W12U 3KF2A 4HI3A 3BTFE 3UNSA 3TGKE 4ZROA 1Z71A 3E0NB 3UUZA 3MH6A 1P0SH 1Y3UA 1RGQA 2FESH 4JK6A 1EZUC 1O36A 5BPEA 2G8TA 1FPCH 4A1TA 2VH0A 2A5IA 3RXQA 1HCGA 2PSXA 1LHDH 2TIOA 3C1KA 1NFYA 2ZFTA 1A2CH 1LVOA 2BD9A 3HK6B 3RC4A 3DD2H 3BIVH 4MDSA 3NCLA 2OC7A 3VEQB 4LZ4B 3RU4E 5GCHF 1J14A 2P16A 5T6GA 4ZKRU 2FOHA 1TPPA 4NZQA 3VGCC 1C5XB 1GMDG 3LGWA 1MBQA 1BTWA 3TJNA 1W8BH 1EB2A 1SGFA 2ZDNA 1BJUA 3FZDA 3TNTA 2VIWA 3Q3YA 3TU7H 1MD7A 1TWXB 2RG3A 4M7GA 1FDPA 3FP6E 1E37B 3SUDA 1MAXA 2ZHEH 2OD3B 3H5CB 2TGTA 3P8OA 3PMHB 1PFXC 1K9OE 4K2YA 5HGGA 4BAMB 1PYTD 4Q7ZA 4UFEH 4YT6H 4K5ZA 2V0BA 1KXCA 2Y6TA 3GCOA 3MO9A 4X8VH 6GCHG 1O2QA 1SL3A 1UTKA 2XC0A 2ZIQH 2FTLE 3A8CA 1C5NH 1KY9A 2WPKS 2QXJA 2PHBA 3GOVB 2SGDE 3K6YA 1QTFA 2AH4X 1IQKA 1TB6H 1MTSA 2P8OB 4NWKA 3ZV8A 4WXIA 5C5OA 3E8LA 7KMEH 3H7OA 3ESTA 3GDUA 2FI3E 2VIDA 2VVUA 3SOSA 3MNCA 5LPRA 2AYWA 1O3EA 3D65E 3FZZA 3Q76A 1GI0A 1T8OA 2BZAA 1QGFA 1S5SA 3E91A 3TK6A 2H9EH 4GCHF 3LJJA 4B2BA 4MNWA 4HZHA 1O5AB 4ZXYH 1SGYE 1ID5H 4J2YB 4Y71A 3SV8A 3VXEH 2XCNA 1C5TA 1PQ8A 1RFNA 3SU3A 1QCPA 1P01A 4GSOA 2ZO3H 4I8GA 3SV2H 1RTKA 4SGAE 2BOHB 3MU1A 1KLJH 2GT7A 1T31A 1TGNA 3SI3H 3O8DA 1CT4E 3AW1A 4E05H 7ESTE 1GI6A 1CA8B 2FS9A 3KNXA 1GJ8B 1IQJA 1EKBB 4SGBE 1C5WB 4ZHLU 3M5OA 1ELCA 1GJ6A 4A1XA 2P3TB 8LPRA 4U32A 3SNCA 1LQDB 1C4U2 1HXEH 1GBLA 1GBHA 3ODDA 2V6NA 5EW2H 1H9HE 1QA0A 1MU8B 5T3HA 2BD5A 4FUFA 1YP9A 1C1QA 4UFGH 4K60A 1NS3A 3PMBB 1O31A 4IN2A 5LPFA 5LGOA 1BA8B 5F8ZA 2ZDMA 1V2VT 1T8LA 3T29A 1IQIA 1O3BA 1TNLA 4H4FA 1E34B 1LKBA 1Y3VA 1OWEA 2G52A 3RC5A 3PMAB 2ZCHP 1TFXA 3SJKA 4ABIA 4FUIA 3BTQE 1JXPA 4HTCH 1GCTC 1TRMA 1XUFA 1FAXA 3MYWA 2P93A 3CS0A 1HPGA 1UVTH 1AIXH 3E16B 4MQAA 1TE0A 3SV9A 1DWCH 5DJ7A 3QZQA 2YNBA 3ZZ6A 2P94A 2BOKA 2O8WA 1LQEA 2RDLA 4ZH8A 3TJVA 1O35A 3EA7A 3TITA 2H5DA 2ZTZA 2RA3A 4UDWH 5FBEA 3RMMH 1C1VH 4Y0YE 1MKXK 1LPKB 1EPTC 2SNWA 1GJDB 2A5AA 4FUEA 3T27A 2BDBA 1JIMA 3U8OH 3BG4C 1EAUA 1THSH 4NG9H 1EUFA 1GHWH 3EYDA 2ZNKH 1GMHF 2TGDA 3QTVH 3U69H 4FXGH 1C2HA 4NGAH 1C1SA 4AZ2B 2BXTH 2GP9B 3Q77A 3HPTB 1NRQH 1YGCH 2Y5HA 1C4Y2 2VGCC 2VIOA 4JYVH 2WPMS 1DT2A 4AX9H 1A0JA 2Z9KA 2BY6X 2D2DA 1SFQB 2FO9A 1MTNC 2FLBH 4YM9A 1J8AA 1GHAF 3MNSA 3KQDA 1H8DH 1BMNH 1Y3WA 2BLVA 2FX6A 3M3SA 3BTME 3EE0B 1C5YB 3MO3A 1EATA 1EQ9A 5AFZH 3MH5A 3P8NA 2FDAA 1VJAU 3K2UA 3MNBA 2RCEA 1DDJA 5E2PA 1O2LA 3PYHA 4TY7A 2QF3A 4Y8YA 5DK1A 1O2WA 1C5UA 1NY22 1DWDH 2G4TA 3LGTA 4JZIA 4Q7YA 4IS5A 2PTNA 2H1UA 4YZUA 1B7XB 3LH1A 4O3UA 2O8LA 3ZZDA 4ASHA 1OWDA 2A4RA 3VB4A 4MVNA 4NIWA 1ELFA 3QGJA 1KDQA 4NIXA 3P6ZB 1S85A 1C1WH 4MG3A 1EZXC 1YPJH 3P17H 1UTPA 1K1MA 1V2KT 4X0WU 1ETTH 6CHAC 1AD8H 2GDDA 4CRDA 3O8RA 1QL8A 2CJIA 2ANKH 4ZKSU 4ABFA 4CRBA 1ZSLA 2SGPE 4KKDA 2K1QA 1DITH 2GZ8A 1ZR0A 2ESTE 2J94A 1A5IA 1SOZA 2I6QA 1VITG 1HXFH 1K22H 1RTLA 2FOGA 5ETXA 4XE4A 9ESTA 5DO4H 1IQGA 1VJ9U 2ZGJA 1NTPA 4IMZA 3LH3A 2TPIZ 5T6FA 2Y7ZA 1UO6A 5GJ4B 4DCDA 1KXDA 3S9CA 3VB3A 2G81E 1KXAA 3SJ8A 1KIGH 2XBYA 1BRAA 1HNEE 1DPOA 2BX4A 1K21H 2PFEA 1GJ9B 3RXCA 1GCTB 2ZPSA 4I8JA 1UMAH 3M5NA 5DGJA 5DP9A 1O2GH 4CR9A 1L0ZA 4BAQB 4CREA 2VVVA 1DSTA 2FOCA 1ANEA 3RU4D 3MTYA 1FONA 3UWJH 1O3GA 1KXFA 2PW8H 2SGFE 1TIOA 5EU8A 4O9VA 4CBNA 1FIWA 5LH8A 1GWAA 3M7TA 1SOTA 1WU1A 3HKJB 3PM3A 3URCA 3ENSB 1D6RA 5K7RA 4K3JA 3A88A 1WTGH 4AFSA 1O2JA 1SGQE 3ODFA 2KAIA 3BG4B 4YOIA 1GBAA 3T28A 3HK3B 3QDZB 3GY3A 3SJOA 4H6SB 3S0NA 3D23A 1LDTT 1V2UT 3STIA 2OC8A 1FNIA 3URDA 3S9BA 1L1NA 3MH7A 2UWPA 2XTTB 3SU4A 3KL6A 1G3CA 2WPJS 2VGCB 3ZYDA 1AE8H 1TOCB 3PWCA 4DOQA 3TGIE 1TNHA 3HGPA 1DSUA 5A0BA 3V13A 1MTNB 1WQVH 1ZZZA 2QCYA 3KIDU 1PQAA 1A46H 3GY7A 4OS6A 3HATH 1F0RA 1P2QA 1TMBH 1CHGA 2QA9E 1O2NA 1LPZB 1CA0C 1SLWB 1C5OH 1HAHH 4Y11E 3P92A 1UK4A 1MZDA 1SB1H 3SNBA 1BBRK 1P3EA 4UD9H 2ZDVH 2LPRA 1EAXA 1PQ5A 4FUGA 3OTJE 4BXWA 3A82A 4MLFB 1HAVA 2FTMA 1CGIE 4B2AA 2XBWA 1SI5H 3BF6H 3BTHE 2Z9JA 2QXGA 1JWTA 1X7AC 5CMXH 2Q6DA 4D7FA 4DGJA 5IYTA 1G2MA 1OP2A 1W13U 2J4IA 2XW9A 2B5TB 3VB6A 1RS0A 1P2KA 3E0PB 6CHAB 1O3OA 4X6MA 4X8UH 1LKAA 1Z8RA 1XUJA 3I77A 3CP7A 2QV1A 1PPEE 3BN9A 1O2TA 5JDUB 2ILNA 5LPEA 1WOFA 1GI5A 2OQUA 1GI2A 1UK2A 2STBE 4A1VA 3M5LA 3PLPA 4HGCA 1QA7A 1AZZA 1IQMA 1C1OA 2HGTH 1TBZH 1XUIA 2DE8A 1O34A 4TYDA 3A84A 3RP2A 1LPGB 1GHBF 1A5HA 3A80A 2ALPA 1AE5A 2J92A 2UUJB 1O5BB 1VITH 2EC9H 5AF9H 3K9XB 4BAHB 4D9RA 1C2EA 3R3GB 1ESBA 3RMNH 5FHTA 1AO5A 2GZ7A 2Z94A 2LNCA 2ZGXH 2XC5A 4UFDH 3F1SB 1XVMA 2QYIA 5F8TA 1HDTH 1Y3XA 2ALVA 3PV4A 4WMDA 2ZU2A 1YPGH 2A4GA 4NSYA 5DP4A 2XC4A 2SNVA 1FY8E 1QRZA 3ZZCA 1TMUH 1IHTH 4NZLA 3QUMP 1CE5A 4TWYA 1ZSJA 1C4V2 4B74A 2Z3DA 4DT7B 1D6WA 3PB1E 4ZAEA 5JPMH 1SHYA 2BY9X 1UJ1A 1C9PA 1MMJN 3MFJA 1FAKH 1DWBH 1O2HA 2XWAA 3UY9A 5J4QA 2O9QA 3GY2A 1MKXH 2HWLB 3P70B 5GCHG 5L30H 2FOEA 5EGMA 2HOBA 1PYTC 1GJCB 3UQOA 4CHAC 1O3HA 3E3TA 1ELTA 3T25A 1FY1A 2ZG0H 1O3JA 4UEHH 3PWBA 1FY5A 2AFQB 1CA0B 1SSXA 1SGIB 3VXFH 3UR6A 1MKWK 1ELEE 1OX1A 1SBWA 2C8WB 5E0JA 5EXMA 3RLYH 5E0HA 2ZGCA 2C8ZB 2ZP0H 4X1RU 2A1DB 2TBSA 1GHXH 1YCPK 2W26A 4WXVA 3WY8A 4ESTE 1B0FA 2BD4A 1H8IH 1L4ZA 2PKAB 1FUJA 3F9GA 4CH2B 4DVAU 2D8WA 4XDEA 3MOCA 2ZHDA 1HJ9A 5DP8A 1GVKB 2Z9LA 1AB9C 1O3CA 1BBRE 1UVSH 2OBQA 4DIHH 3F68H 5E8EH 1TAWA 3SHAH 4I33A 3TPIZ 1GGDC 4X1SU 5L2ZH 3M5MA 2PR3A 1W0YH 2HNTC 2F9BH 4U30A 1EJNA 2ZQ1A 2CF9H 2B7DH 1THPB 2BM2A 2SFAA 4ISNA 1ZGVA 1TNKA 3AVZA 3BG8A 3RXAA 3RMOH 2QC2A 4IMQA 2GV6A 3A86A 3ATMA 2ZTXA 1VCPA 4BNRA 1YCPM 2XBXA 2VVCA 3ATIA 2BZ6H 2W3KA 1QQUA 4OS1A 2Z9GA 1QJ7B 4GCHG 1HAOH 3T2NA 4J1YA 3K6ZA 1GBKA 1QR3E 1NZQH 1C1NA 4XOJA 2JETC 4JYUH 5A0AE 1HAZB 4E7RG 2WV4A 1NM6A 2Z3EA 1ZHMA 1QJ1B 3P8FA 5FXLA 1SPJA 1OYQA 1D3DB 4GHTA 2OTVA 4O97A 2R0LA 3DFLA 1E0FD 4ABDA 3GCTF 1WBGB 3M35A 2NU2E 4CBOA 3OY6U 3K65B 2A4OA 3V7TA 1K2I1 1MAYA 1C2LA 1LMWB 3IG6B 1C1RA 2BTCE 8GCHF 1OWHA 3RM0H 5GIBA 1DICA 2CV3A 3NXPA 1WAYB 2FLRH