4K5ZA

Crystal structure of human chymase in complex with fragment inhibitor 6-chloro-2,3-dihydro-1h-isoindol-1-one
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
220
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 220
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k5zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k5zA02
4OS6A 2VJ1A 3MH4A 3QGNB 4ABDA 3JZ2B 5AVDA 3VB5A 3RXPA 1QR3E 5E2PA 2TGDA 1D3QB 1P06A 3SHAH 2VWMA 2FI5E 2UUFB 2BB4A 1O3CA 3AW1A 4XOJA 3GDSA 4D76A 1GBHA 3V12A 1ZMJA 2BD7A 2ANWA 3RM0H 1CA0B 1ELFA 4PROA 2A4QA 2OC8A 5EXMA 1ZJDA 2FZZA 1DX5M 4F49A 4ZMAH 1LCYA 2P16A 1O5DH 3UOPA 1ELTA 3F9GA 8GCHF 4K60A 4ABAA 4ABIA 3VB4A 1EB2A 1EKBB 2Q6DA 4ZHMU 1P3CA 6ESTA 1N8OB 3FP6E 3EA7A 4IMZA 4YM9A 1THSH 2R3YA 1JIMA 2BLWA 3RXJA 1VGCC 3M5MA 2WPJS 4B73A 3RXOA 3ZVCA 2WPLS 1LHEH 3PM3A 4ABBA 5AHGH 4NA7A 4Y8YA 1UVOA 4OGXA 3I78A 2VIDA 1V2QT 1PPZA 1QB1A 3U69H 1SC8U 3SV2H 2VVUA 4JCNA 4NZLA 2ZEBA 2ZKSA 4I7YH 2BQ7B 1KXAA 1H9HE 2XXLA 2QGRA 2SGAA 2SNVA 2JH6D 1V2WT 1FIWA 1WV7H 3LU9B 9ESTA 5K7RA 3PLKA 3SUGA 1O2IA 3PO1B 3IG6B 3UNQA 4X1SU 1GHWH 2ASUB 1W0ZU 1X7AC 1PPCE 1VCQA 1WUNH 3FANA 2KAIB 1OWKA 1O2RA 2J92A 3ENSB 3UNRA 3I29A 1CA0C 2FS8A 5GWZA 1F0RA 4IW4E 2BDBA 3RXCA 1OXGA 1LKBA 1BRBE 3E6PH 3MI4A 7LPRA 5DK1A 1NY22 1UTQA 3UIRA 1N8OC 4INHA 4BOHA 2ZU5A 1FIZA 5T6GA 2FESH 2XBXA 2TGAA 1ELGA 1YPHE 4AFUA 5AF9H 1SGTA 1NRPH 1EAIA 1IAUA 4NWKA 4AB9A 1PQAA 5FCRA 1MAXA 1FONA 3ATLA 3MNSA 1CSOE 2Z94A 1EPTC 1RTLA 3BTWE 4NFEA 4X8VH 3RM2H 2BZ6H 4ZXYH 1ZGIA 1V2KT 1LQEA 1D3DB 3O8BA 1E0FD 1ZMNA 3U8RH 2Y5GA 4AB8A 1C1PA 3PWCA 4DIIH 4Z6AH 1P2NA 1BBRH 5L6NH 4Y7AA 4IC6A 3K65B 3F6UH 1EOLA 4YO9A 4ISIH 3ZVAA 3PO1C 4MDSA 1UK4A 4BAKB 1HPGA 1GPZA 1B0EA 5B6OA 4FU8A 4LXBH 4AGKA 1ELCA 1O2XA 1QURH 1CT4E 2ZU3A 2GVFA 2ZFQH 8KME2 1D9IA 2PUXB 4DOQA 1GI2A 2YOLA 3P6ZB 3Q77A 1BT7A 2GV6A 3PLPA 3SGQE 1MZAA 2P93A 1C4U2 1P04A 1T7CA 1ZGVA 3AAVA 2C4FH 1OSSA 1TBZH 3PV4A 2F3CE 6CHAB 2J34A 4H42U 1ABIH 1TGBA 2RA0A 1VCWA 3A8AA 1TQ0B 3FAOA 3BTME 4RSPA 4AYVB 3S7HB 2BDIA 5EW1H 2BQWB 2VGCB 1C5VA 1CE5A 2ZZUH 2P3TB 1HAVA 1GHAG 1S5SA 2PKAA 1GHAF 1LDTT 2NU2E 4E06H 1QBNA 2GCTB 4B76A 1VJ9U 1O2OA 1C9TA 2B8OH 3BTDE 4OGYA 2ZHFH 1W11U 2Q6GA 3TK6A 3RXDA 2FLRH 3MWIU 4BXWA 4BTUB 1L1GA 1NT1A 2ZHEH 1YC0A 2ZDNA 1YPLH 3S9AA 3GY5A 2OLGA 4OS5A 1TYNA 1CHOG 1KSNA 4YZUA 3SU6A 4J2YB 1NZQH 1F7ZA 1FMGA 3M36A 5HMAA 2B9LA 3ESTA 3LGTA 1Y5BT 4UE7H 1AVGH 1B7XB 1BIOA 1NPMA 5L2ZH 1GI7B 2H5DA 3QWCH 1HAGE 2WUBA 3NUMA 4CRBA 1V6DA 2ZDKA 2HNTF 1PQ7A 1ELEE 4ZROA 3SU5A 3LJJA 1O2SA 5F8ZA 4AGJA 1SR5C 1AHTH 1QL9A 2ANYA 4IN1A 1IHTH 1HAZB 1GHXH 3RXEA 1GJBB 1QQUA 1FY3A 1FI8A 3DUXH 1TA2A 2BD8A 1EUFA 1MAYA 1TABE 3D62A 2BDGA 2B0FA 1J8AA 2EI6A 3VGCB 3ZV9A 4ASHA 1O3LA 5LPEA 4UFDH 2VH6A 3T26A 2SGFE 1TWXB 1KXBA 3EGKH 1N6XA 1O2JA 1AZ8A 3BTQE 1WCZA 1K28D 2Z6BD 2GCTC 1C2GA 3ZVGA 2ZU2A 1CT2E 1DDJA 1XXFA 1ACBE 2W3KA 1QFKH 2ODQA 3NPSA 1ESTA 4K69A 1VITF 1LKAA 1LO6A 1GDNA 1Y8TA 1IQEA 1UHBB 3ZZ6A 1EZUC 5FPYA 2XBYA 2ILNA 1AB9B 4OS4A 2FDAA 2QF0A 1IQNA 2A31A 2ZI2H 3B9FH 2GDEH 1S0RA 3N7OA 4GCHG 3ATWA 2J4IA 1K1LA 1ZPZA 2ZPRA 1EZXC 2C8ZB 4I31A 4E7NA 4BAOB 4YTAA 1YCPK 1GBKA 1NU7B 2JKHA 2BD5A 4CREA 1C5PA 5JBTA 3BV9B 1QA7A 2J9NA 1DITH 5C5NA 1YKTA 3RXGA 1SHHB 1G32B 5FBIA 1FN8A 2BXUH 4X2VA 4XFQA 1YPEH 1WU1A 1HV7A 1YPHC 3TH3H 1RTFB 4AORA 2VIWA 1S0QA 1QJ1B 4X8TH 1LMWB 1B0FA 2TPIZ 1UVSH 4YOGA 3RXAA 1B5GH 1P10A 1TFXA 2NU0E 1ZZZA 2VIPA 5C1XA 4B1TA 2G55A 3TGJE 1BMMH 3VGCC 1G3DA 3RUOA 1O2UA 1J9CH 2V0BA 2FMJA 5DP5A 3UY9A 1CU1A 1XUKA 1SMFE 7KMEH 2W7UA 2XC4A 4FUHA 4FUCA 4OS2A 1IQGA 1H8IH 4LK4A 1A5HA 3QGJA 3LOXA 1GHBF 2A5IA 1UTOA 3URDA 4DCDA 1YPGH 4CRAA 3ZZ8A 1O37A 3BTTE 3LGUA 4JZIA 5GPIB 3FFGA 2VVCA 1TBQH 3LIWA 1AB9C 3UQVA 4JZEH 2VB0A 2FODA 4X0WU 5JB9S 2BQ6B 1LTOA 1TALA 4Y71A 1GJ9B 1PPEE 4FU7A 2QAAA 1EAWA 4KP0A 1SLUB 1JOUB 1G30B 1QL8A 3QDZB 1ZYOA 1A0JA 4FUFA 1QB6A 1C5UA 2FS9A 1L0ZA 1TMBH 1F92A 1THRH 3ZZ4A 1P09A 1CT0E 1DWBH 4DGJA 3RXQA 1GBBA 4DY7B 4AG1A 2RG3A 1A7SA 1HGTH 4UONA 1DSUA 4WY3A 4HFPB 5EXNA 3GISB 4FUJA 3UREA 1ELAA 2Z9GA 2HRVA 2PGBB 4X1NU 2PR3A 1AFQC 1Y3UA 1TPAE 4HTCH 5AFYH 1TNLA 1SL3A 1ID5H 4M7GA 2ZG0H 3GY3A 3LONA 1H9IE 3Q00A 5TJXA 1YM0A 3TK9A 2Y6TA 4A5TS 1ZHRA 1HJAC 2SGDE 5JBBS 1QQ4A 1BTPA 2PSYA 1C1UH 2ZQ1A 1EZQA 1T32A 1QRWA 1HJ9A 3ELAH 4F4OC 4IC5A 1E37B 5BRRE 1HIAA 2FYRA 1A61H 1ANEA 1MD8A 1G3BA 4I8JA 4AFSA 3VXFH 4ESTE 2FX6A 2H9TH 3M35A 3MU4A 1BHXB 1O2QA 2BM2A 2ZGXH 2VWLA 1IHSH 3ZVDA 2ZHDA 2UWOA 1SG8B 3PB1E 1ANBA 1GBFA 1TRNA 2ODPA 4CR9A 4WMFA 4B75A 3M7QA 4UFGH 3F9FA 4BTTB 1RD3B 1ZRKA 2AERH 2R2MB 1G37A 2A7HA 1L1NA 1HAVB 1NN6A 1BCUH 2Z7FE 3P8NA 1KXCA 2PKAB 1O0DH 1P2OA 1GJDB 2PWXA 2PTCE 4ISNA 3RLYH 3GDUA 3MMGA 4K8BA 4ABHA 1OWJA 2AGGX 2FYQA 1RFNA 1ANDA 3KQCA 4HZHA 7GCHG 3BEFB 1GI5A 3E16B 5F6MA 5C67A 7GCHF 2Q6FA 3SGAE 1GG6B 4WXIA 3UUZA 1EXFA 3SN8A 2ALVA 1C2DA 4U2WA 4A6LA 1GJAB 1VJAU 1GJ6A 2ZGHA 4D9QA 2J38A 3A7ZA 1C5XB 4Y7BA 2BYAX 5FX6A 2AMPA 4ZKNU 2QF3A 2ZQ2A 1C5TA 4I8HA 3O8DA 5FPSA 5A0CA 1FN6A 2V35A 1P9UA 4Y8ZA 2QV1A 3T27A 3M5LA 3V0XA 1Y3XA 2AGEX 2D2DA 2BDYA 3HPTB 5GXPA 1ARBA 2A1DB 5J4QA 4U01A 2BVRH 1MTUA 3M3SA 3BTFE 2P3UB 2QIQA 1DANH 2TIOA 1YP9A 3MU1A 1SPJA 1FUJA 1C5ZB 1MKWK 1GJ7B 5ESTE 5TCCA 2HGTH 1HAIH 3TJNA 3OY5U 2BX3A 2XYAA 1EASA 1L1JA 3M7UA 1TNKA 2OQUA 4Z0KA 4A1VA 2ODYB 1O2WA 2Y81A 4MNVA 1GJCB 3QTOH 1C2IA 2ZFRH 5DP3A 1GVKB 1NFYA 3SU0A 3PTNA 3U9AH 3EA9A 2IPHA 1AGJA 3W95A 1ETTH 4K1SA 1GBLA 4I32A 4AG2A 5T6FA 1J14A 3QZQA 1GG6C 1XUIA 2SGPE 1YLCA 3M61U 4GAWA 1D6RA 1C2MA 4KTCA 1GMDG 2A4GA 3ODFA 1MKXH 1ZJKA 3OX7U 1OKXA 2ZFSA 2G81E 1UK2A 1C2LA 1GHZA 4YOIA 5A8YA 1FDPA 1BBRE 1INCA 1JRTA 1Y3YA 2XWAA 2FOAA 3VB7A 2OXSA 2WPKS 1WTHD 1Y3VA 4NIVA 3T5FH 1TLDA 1TRMA 5CE1A 3A84A 2R2WU 2F9BH 1UCYH 1ABJH 1T4UH 4IGDA 2PSXA 3MH5A 1QJ7B 4NSYA 2EI8A 1O2NA 1EPTB 4ISOA 2FOGA 1N1LA 5JYIA 4Q2KA 3ZVFA 1FY4A 1AI8H 1XUHA 3MH6A 4MNWA 1O34A 4Q7XA 5C1UA 3TGIE 1TOMH 1MCVA 3KGPA 1C2FA 4UEHH 1OWDA 3BEIB 3SNAA 1XUFA 1YPJH 4FXGH 4MVNA 5JBCS 1O5BB 1KDQB 3RXRA 3OU0A 3MU0A 4K1TA 5EU8A 1BTXA 2A32A 1V2LT 1LHDH 1Z71A 1ANCA 2H2ZA 3F9EA 4GUXA 4YLQH 2BD2A 1HAXB 2XCFA 1KTSB 1OWHA 3GY8A 1BITA 2BLOA 1BRUP 1OP2A 1UVPA 2G00A 2Z9KA 2H9EH 2JH5D 2ZF0H 4ZH8A 4ZKSU 5FCKA 2W3IA 2BZAA 1NO9H 2F9NA 2R0LA 2AIQA 1O2HA 1AKSA 2UUJB 2ZPSA 1SQOA 5E0HA 3RC4A 3A80A 4UD9H 1DVAH 1S82A 1O5CB 1YPKH 2VVVA 4ZXXH 1O5EH 2FOCA 2WV4A 4Q80A 2Y7ZA 1EOJA 1GI1A 1ZMLA 3K2UA 3PWBA 1O30A 2Z9JA 1DPOA 5EG4A 3F1SB 3A86A 1BJVA 1UJ1A 2NWNA 2G5NA 4Q7YA 3LJOA 3RXBA 2XRCA 3MTYA 1A46H 1TB6H 3GCTG 1BMLA 1AUTC 3GCTF 1CBWB 1U6QA 1QRZA 3MNCA 3P70B 5HM2A 3G01A 5A0BA 4NIXA 3SORA 2SFAA 2OP9A 4X8UH 2BY9X 3TLOA 3ZZ5A 3O8RA 3TH4H 1G36A 4AZ2B 4TPIZ 3SNCA 3LH1A 1UTJA 2Y80A 1ZTKA 1CO7E 1QCPA 1GHVH 1SQTA 5LPFA 1F0SA 2F83A 1HIAB 4VGCB 3KHVA 1O3GA 3FZDA 5E0GA 2GP9B 4X6PA 1DOJA 1S85A 4Y11E 2GCHG 4MPWA 2Y5HA 2A7CA 2O8MA 3QUMP 2RCEA 3H7TA 1CGJE 4UFFH 4AFZA 1NC6A 2WINI 3SJKA 3LKWA 1J15A 3BIVH 5PTPA 1QIXB 2GV7A 2BLQA 1P01A 4X1PU 1P3EA 2ZHWH 4BNRA 2R0KA 2WV5A 4Y10E 2J95A 1TPSA 1DSTA 3RU4D 1IQIA 3AVZA 4TY7A 3ZVEA 2BDAA 2AMDA 2D8WA 5EQSA 2RDLA 3CENA 1BUIA 3A7YA 1GI8B 4ZKOU 1BOQA 5EPNA 1AVXA 4JMYA 1TNHA 2R9PA 2ANKH 1V2TT 1W8BH 2STAE 1A2CH 1CBWC 1MTVA 1EP5A 1BBRK 2SGQE 2XBVA 4ABGA 2XW9A 1ZTJA 5IDKA 1SSXA 3GCNA 1Z8JB 1NU9A 2GD4B 2FP7B 2VWOA 4Y76A 1HXFH 2BY6X 1T8NA 1UTLM 4TWYA 1O5AB 1XKBC 3EAJA 1T4VH 3HKIB 2XCNA 3LGVA 4KELA 2OBOA 3STIA 1WTGH 1BTWA 2A0QB 2TRMA 1UO6A 1AWHB 1ELVA 4VGCC 1P2KA 4XBBA 1Y5UT 1AZZA 4WH8A 1JWTA 5A0AE 2BX4A 1CHOF 2TGPZ 1P57B 3P17H 1GBMA 3P8FA 1QA0A 5FXLA 4AX9H 3HK3B 3MYWA 3P8GA 3LGWA 2BXTH 2H5CA 1AQ7A 1KLJH 4X8SH 2UUKB 4MTBA 2J2UA 3RMOH 1WOFA 1YLDA 3BEUA 2PFEA 3D65E 2WPHS 3SJ9A 2A5AA 1W12U 1TX6A 3GCOA 3P95A 1C5QA 2BVXH 2SGEE 5JPMH 4IMQA 2A4RA 4MLFB 3TIUA 3SJ8A 3TNTA 1H4WA 2GZ7A 1E34B 4WJG2 3SBKA 3LGYA 3O8CA 5DJ7A 1PPBH 1HBTH 1GBAA 1SGQE 1XVOA 4NIYA 5A8XA 3K9XB 1LHFH 2FIRH 3TK5A 1ZPCA 2H6MA 4K8YA 2G51A 1QJ6B 2G5VA 1Z8GA 2OBQA 2GZ9A 2V3HH 2ZDLA 1TGTA 2F91A 1AU8A 3RU4E 1PJPA 1A0HB 2CXVA 2G52A 2O9QA 5TCAA 3U98H 1IOEA 4BAQB 5LGOA 1AFEH 4R0IA 4KKDA 1OWEA 3GY6A 3EYDA 4O3TA 4O9VA 1YF4A 1L4DA 1V2JT 5HGGA 4K5ZA 1FV9A 1LHGH 5FHTA 1UTKA 3A88A 2OUAA 2ZCLP 2FOMB 1W10U 3QN7A 6GCHG 3RXHA 3SJOA 3AW0A 1OP0A 3PMAB 4CRCA 1C4Y2 1GBCA 1MQ6A 2QYIA 3A89A 3SV9A 4GCHF 3MU8A 4O03A 2EA3A 5BPEA 1PPGE 1BMNH 3ZZ7A 1UVUH 3RXSA 1KXFA 2DUCA 4WWYA 4LZ1H 1CGIE 1V2PT 1NS3A 5I25A 3F9HA 5IYTA 1W2KH 1OS8A 3NK8A 1ZLRA 2XC5A 1EJAA 1P03A 4O97A 3GICB 2EC9H 1TGCA 2I6SA 1UK3A 2H1UA 1TONA 3RU4T 1O3IA 2HWLB 3A7XA 3ZZAA 1P0SH 3UFAA 4X6NA 1V2VT 1AFQB 4OS7A 1SQAA 4JYVH 1HDTH 3KCGH 1ZSLA 3C1KA 3TH2H 1YPMH 3KF2A 5SGAE 1HJAB 1UTNA 4WH6A 1VITH 1BTUA 1F5KU 2P95A 1GL1A 3IWMA 3DFJA 3E3TA 3MO3A 5A2MH 1V2UT 2F9OA 1EAUA 3UNSA 1KLTA 2JH0D 1UTMA 3RP2A 4BAHB 1SGFA 1GMHG 2CHAC 2PGQB 3W94A 3SNEA 3ZZDA 1EP6A 1GMCG 1MTSA 1KY9A 1Y3WA 4TPYA 3TITA 2VINA 3MH7A 2FO9A 5C2ZA 1V2MT 3BN9A 7ESTE 3DD2H 4NWLA 3UWJH 1GI4A 5HXFA 2ZCHP 1BHXF 3FZZA 1ESAA 2YNBA 3S9BA 2GMTB 3EDXB 4AOQA 5H4IB 4DURA 1O2GH 1O31A 2PW8H 1GGDB 3VEQB 1QHRB 1ETSH 4BAMB 2WPMS 1AE5A 3A81A 4AFQA 1HAHH 1O3MA 1WQSA 4SGBE 1C1RA 1TPOA 4HI3A 1MQ5A 2SNWA 1ARCA 4X1RU 1P9SA 2GZ8A 1SI5H 2BY5X 2TGTA 5C20A 1K21H 2FOFA 3KL6A 1BRAA 4X2YA 5DP4A 5T3HA 1C9PA 3CP7A 4RN6A 2CF9H 1MTNB 3EE0B 1EZSC 1MZDA 3A8CA 4X6OA 1TOCB 1Z7KA 1FXYA 3ZZCA 1IQJA 3H7OA 1S6FA 5CMXH 3LT3A 2C93B 3SU3A 3KQEA 5G4BA 3U8OH 4A1XA 2VU8E 1GBDA 4XBCA 3MU5A 2XNIA 1OP8A 1XX9A 2CGAA 3TNSA 2IJOB 4B2CA 4YOJA 1J16A 1FJSA 1HAOH 1Q3XA 5L30H 3RMNH 1XUJA 1SGIB 2B5TB 3FP8E 3SV6A 2NU1E 1HFDA 4ZUHA 4ABFA 2ZDAH 1KYNA 5DO4H 2GMTC 1AE8H 5C1YA 4FU9A 1TAWA 3L3TA 1DLEA 2BTCE 1GGDC 3TGKE 1C1SA 3P8OA 4DT7B 4I8KA 3GY7A 3HKJB 3S0NA 3KQBA 3E0PB 1W7XH 2AGIX 4AN7A 1O32A 1ZSJA 3BF6H 2XWBI 1G3EA 3V13A 1QBVH 4I33A 4Y0ZE 1HAPH 1TNGA 1Z1JA 3LH3A 3RLWH 3SV8A 2IOTA 4I8GA 1UCYE 2HLCA 2VIOA 5DP7A 1SFIA 3A85A 2C3SA 2UWLA 1OX1A 1CA8B 1HJ8A 1P2JA 2Z3CA 3Q76A 3BTKE 1DUAA 4HGCA 2ZPQA 1MTNC 1O3FA 3DFLA 2C8WB 1O38A 1LQDB 3L6PA 1W0YH 1AIXH 1A3EH 2AMQA 3I77A 1RGQA 2EEKA 3BTGE 1LPZB 1UTPA 1H9LB 1KLIH 4BXSA 4ISHH 1NFUA 1O2KA 1E38B 2O8LA 3GCHB 1RIWB 1C4V2 3UWIA 1MU8B 1GJ8B 2R3UA 4RKOB 3RXVA 3KQDA 1C5OH 1F5LA 1JXPA 2XBWA 1RJXB 3C27B 3RDZA 1C5MD 2PTNA 4THNH 1Q31A 1C5YB 3HGNA 2QXJA 5DPAA 5JBAS 2FLBH 1C1TA 4JZ1A 1S81A 2QXIA 3EQ0H 3D23A 1P05A 1P2QA 4OS1A 3SI4H 1XM1A 1GVLA 2FEQH 1XVMA 3PYHA 1ESBA 1V3XA 3QZRA 3BSQA 1T31A 1GL0E 3A7TA 1QGFA 4FVBA 3SUFA 1O3HA 2FI3E 1UVTH 1SVPA 1FY5A 3BG4B 1TGSZ 1JIRA 5FX5A 2OCVB 4NZQA 5GCHG 1DE7H 3UTUH 3ZV8A 4K3JA 2O8TA 3TJVA 4Y6DA 1FPCH 2XTTB 2A4OA 4UDWH 2W26A 1DICA 2FOEA 1GMDF 2W5EA 2B7DH 3PLBA 3SV7A 1Z8RA 1SOTA 2CN0H 4NIWA 1P2IA 1H8DH 1C2JA 1ZPBA 1A1RA 4LOYH 4CH8B 3RXIA 4MPXA 3GCHC 1SGEE 1RIWC 4YT6H 1O3JA 2ZP0H 3D49H 2W7SA 1QB9A 2ZGBH 1SGPE 1UHBA 3SW2B 2UWPA 4NG9H 2G4UA 3URCA 8GCHG 1V2OT 2BD9A 2ZU1A 4H6SB 3SO3A 1OYTH 3H5CB 3U8TH 1FNIA 2VIQA 1LVBA 1O3OA 1JBUH 4KGAA 3UR9A 5ESBA 1NFWA 1V2ST 1GWAA 4CBNA 1T8MA 4WVPE 2GTBA 8LPRA 1HRTH 1K1OA 1MH0A 4WF8A 1SLVB 1MBMA 1LVMA 4YT7H 3M5OA 1G9IE 1PYTC 1WQVH 4O3UA 2O8WA 1HCGA 3OSYA 1IQFA 3BG4C 1SGRE 1O39A 4INLA 2LPRA 2QXHA 1C1OA 1HUTH 1VR1H 1OOKB 1P2MA 2PLXA 1P8VC 1O2PA 3SU2A 5JDUB 1MKXK 1THPB 2A7JA 1GHYH 1HLTH 3ATKA 2STBE 2VWNA 3LPRA 5ABWA 5E8EH 1NRSH 3TVJB 4X2XA 4NA9H 4INKA 5DP6A 4CH2B 3IITA 2VNTA 4JK6A 1TX7A 1DWEH 3MNBA 2OQ5A 4I8LA 2ALPA 2H9HA 4JZDH 4CRFA 5GIBA 2UUYA 4LZ4B 2HOBA 3UOUA 1F5RA 2BY7X 1FY8E 4JZFH 1ZOMA 1SGDE 4CRGA 2D26C 4D7FA 3PMHB 1PPHE 1UCYK 1Q2WA 2XC0A 1LHCH 3GDVA 1T8LA 1FLEE 4TWWA 3A7VA 3A8DA 2ZCKP 3OYPA 1BA8B 1O2LA 2WPIS 1IQHA 1SLXB 2AEIH 1GVZA 1CVWH 2FTLE 3DA9B 1AUJA 1Z6EA 1BB0B 2Z3DA 1N6YA 4MPUA 1MU6B 1SBWA 1TNJA 3K6ZA 3ATIA 2ULLA 1RTKA 1TX8A 1AN1E 4XBDA 2Y5FA 1DM4B 4FUGA 3P92A 1GDQA 4B2BA 2P94A 1FAKH 5E0JA 4ABEA 1H1BA 1L4ZA 2ANMH 5LH8A 3UPEA 2BHGA 4GPGA 3BTEE 1QBOA 2HVXA 3A87A 5ETXA 3TJUA 5EGMA 1BRCE 4GSOA 1OYQA 4E7RG 3B23B 1QRXA 4WMDA 3RXTA 4ZHLU 1ORFA 3GOVB 1BTYA 1LVYA 1Z8IB 2O8UA 1PQ5A 2DE8A 2ZC9H 1AWFH 1O5GH 1C1MA 2FOHA 2PHBA 9LPRA 1ELBA 3SQEE 1ETRH 4NCYA 3FP7E 4XSKU 1IQLA 2GCHF 3QK1A 3OY6U 2BDCA 1ZTLA 2V6NA 3VXEH 1TRYA 3QO6A 3DT0H 2A2QH 2FI4E 4Y79A 4MNYA 1DLKB 2DE9A 1XXDA 2AH4X 2F9PA 4WXVA 5K0HA 1XKAC 2RA3A 1TGNA 3PROA 4FUDA 3RC5A 4GVUA 1K1IA 3TPIZ 3RXKA 3SUDA 1RS0A 1S83A 3CS7A 4B74A 4B2AA 1KXEA 4FUIA 3QX5H 2I6QA 3V7TA 2FWWA 3ZZ9A 4MNXA 4U32A 2HNTE 5EODA 1BTHH 1DXPA 1GCTB 4ISLA 2ZO3H 3NWUA 4E05H 1OPHB 1VCPA 4SGAE 1Z1IA 2IN2A 2VH0A 4Q7ZA 1DS2E 2HPPH 1EX3A 5C5OA 1W13U 4MQAA 1HXEH 2D1JA 1A0LA 2BD4A 2OINA 2PV9B 1AY6H 5DG6A 1O3AA 1XMNB 4AYYB 1A5GH 2YNAA 1WAYB 3VPKA 4ZAEA 1WYKA 3E0NB 1TMTH 2FOBA 1FPHH 3M37A 1MD7A 4DG4A 1P02A 3LGIA 4NSVA 4CHAB 1GBEA 5EOKA 3ODDA 1NESE 1BTZA 1A5IA 3CS0A 1LVOA 3RXFA 3V3MA 3DHKH 1O2YA 1O35A 4X1QU 3SNBA 1IQMA 3S69A 1V2RT 3U1IB 1QL7A 1V2NT 3L33A 5LPRA 1C5WB 1O36A 1DY8A 1YCPH 3RXLA 2P8OB 2QXGA 2AIPA 1O3EA 8ESTE 6LPRA 3SZNA 1HAYB 1K2I1 1C5NH 1SHYA 3MO9A 1GCTC 1ZHPA 2AS9A 1DFPA 3GY4A 4FUBA 6CHAC 5L2YH 2ZFTA 4NGAH 1TIOA 1NFXA 2G8TA 1F0TA 3A7WA 2ZFFH 5FAHA 1FY1A 3ITIA 4BTIB 1HB0B 2CHAB 4CR5A 1D6WA 2GX4A 1KIGH 2VGCC 2Q1JA 3T25A 1K22H 2WYJA 3SI3H 1C2KA 2Y82A 6GCHF 1T8OA 3MOCA 4A92A 1NRRH 1SGYE 1EATA 3RC6A 4QT8C 3PMBB 1CHGA 3MHWU 1VITG 3HGPA 2BMGB 3HATH 3SU1A 3UR6A 4JK5A 1BJUA 2ZA5A 3KIDU 1MUEB 2QC2A 2M5TA 1NRNH 2BDHA 1PPFE 2THFB 3SHCH 1C1QA 3PTBA 4RKJB 4KTUA 2ZDMA 3JZ1B 1PYTD 4GHTA 4CHAC 4X2WA 2P59A 1GBIA 1O3DA 2AFQB 5EW2H 1D3TB 5A8ZA 1O3KA 2Z3EA 2GT7A 2P3FH 3PMJA 2PKSB 3OTJE 3T29A 2GKVE 3RXMA 3VB3A 1ZRBA 1SB1H 4D8NA 2OC0A 1E35B 2VIVA 4A1TA 1SLWB 3ZZ3A 1HNEE 3NCLA 1NM6A 1PQ8A 1J17T 3ZYDA 2P8OC 1KTTB 2GT8A 4MG3A 1TBRH 1K1MA 1AD8H 1AO5A 2ZNKH 5F8XA 1FZZA 5EPYA 3Q3KA 1EPTA 1PFXC 3ZYEA 4H4FA 2OD3B 5GJ4B 1DY9A 4K2YA 1DT2A 5EQRA 1BQYA 2ESTE 3Q3YA 4YESB 1AVWA 2CMYA 1SGCA 1JRSA 2FPZA 1AKSB 1BZXE 1M9UA 1MTWA 3NXPA 4KTSA 1GMHF 3NKKA 1KDQA 3F68H 1JMOH 1GMCF 2HPQH 1GJ4H 2OTVA 3SGBE 1K1PA 4XE4A 1L2EA 1P11E 3VB6A 1GHBG 5HM9A 3RMLH 2AYWA 1KXDA 1SFQB 5JB8S 4JYTA 2F9UA 2Z9IA 3FVFB 4FVDA 2TBSA 5DP9A 2FXRA 2HALA 1DWDH 1O2TA 1F2SE 1WSSH 2KAIA 3E91A 4JYUH 1MMJN 2G4TA 4XDEA 1C2EA 3WY8A 3M3TA 1C2HA 1XUGA 4YLUA 1BDAA 3TU7H 4MPVA 5E2OA 1E36B 2BOKA 1SGNE 2A45B 5I46H 1TNIA 3B8JA 2A5KA 2PKSC 3QLPH 4WMEA 1O2ZA 1GI6A 2JETB 2BD3A 5F8TA 4J1YA 2CV3A 1DWCH 1TMUH 2CJIA 3RMMH 3EA8A 4D9RA 2HNTC 2QA9E 3LC3A 1NRQH 3S9CA 2F9VA 4GLYA 2OC7A 3SNDA 3T28A 1C1NA 1GBJA 1A4WH 2ZTXA 1K1JA 1P12E 5F03A 1O3NA 1EB1H 1NTPA 2CF8H 4Y0YE 3HK6B 1GI0A 3GYLB 4DVAU 1O2MA 3MO6A 3MNXA 2WUCA 1YCPM 4IN2A 4R8TB 1C5RA 5T6DA 3T2NA 1O33A 2QN5T 1GJ5H 1W3CA 2ZU4A 1DXWA 3M7TA 1W7GH 3BG8A 1CGHA 1WBGB 1GCDA 2ZECA 1FQ3A 1EJNA 4U30A 4TYDA 2EI7A 5A09A 1Y59T 4ZKRU 2BVSH 2ZGCA 1C1WH 1EQ9A 1NROH 1MBQA 1YBWA 3A82A 5FBEA 2Y7XA 4UFEH 1C1VH 1O2VA 1GBTA 4GHQA 4DIHH 1OWIA 1TQ7B 1GI9B 5CHAB 1SOZA 1O3PB 2LNCA 5FPTA 1RXPA 3E8LA 3ATMA 3T62A 4NA8A 4Y8XA 3QTVH 1A3BH 3RXUA 2QCYA 4ABJA 1YYY1 3LDXH 1TPPA 5EQQA 2JETC 2NU3E 2J94A 1D3PB 3VFEA 2FM2A 1UMAH 1GI3A 1ZR0A 2K1QA 1F0UA 3A83A 1EJMA 3Q3XA 1MCTA 1G2LA 1TA6A 1ZSKA 2PUQH 2ZFPH 1MKWH 3AAUA 1S6HA 4IBLH 1LPKB 2ZTZA 3UQOA 2Z9LA 3SQHE 3TJOA 3LC5A 3M5NA 5HYOA 3SU4A 1Y5AT 1QTFA 5DP8A 1C5LH 3KN2A 4DJZB 3NZIA 4A7IB 1YGCH 1QNJA 5EXLA 1BMAA 2GGVB 3SOSA 1W14U 2ZTYA 4CBOA 3ZZBA 1C5SA 2C8YB 5DKMA 1D4PB 2V3OH 3R3GB 2WYGA 3KEEA 1K1NA 2OC1A 1O5FH 1AMHA 4ZHAA 3MFJA 5DGJA 3KNXA 2FX4A 1DUEA 2GDDA 2NU4E 4NFFA 3U1JB 3SUEA 3E1XB 1CQQA 1IQKA 3K6YA 5GDSH 3STJA 5C3NA 1ZHMA 1O3BA 1ELDE 2BY8X 1LPGB 3S7KB 3ZVBA 1VGCB 3GY2A 1QY6A 2C90B 4H6TA 4IS5A 4K1EA 1FAXA 5CHAC 2ZHQH 4X6MA 3GYMA 1RRKA 1K9OE 2FTMA 3A8BA 3E90B 3BIUH 2ZDVH 2A2XH 2BOHB 3BTHE 3M3VA 4D7GA 4CRDA 1S84A 3AASA 2ZIQH 4BANB 1G3CA 1Z6JH 4FUEA 1GDUA 2ZWLH 1VZQH 5GCHF 1EAXA 4B71A 2C8XB 5J4SA 3SJIA 1TE0A 1HYLA 2QY0B 1G2MA 5AFZH 4TY6A 3R0FA 1SGFG 2ZGJA 2BLVA 4DW2U
chains in the Genus database with same CATH superfamily
4OS6A 2VJ1A 3MH4A 3QGNB 4ABDA 3JZ2B 5AVDA 3VB5A 3RXPA 1QR3E 5E2PA 2TGDA 1D3QB 1P06A 3SHAH 2VWMA 2FI5E 2UUFB 1YLNA 1O3CA 2BB4A 3AW1A 4XOJA 3GDSA 4D76A 1GBHA 3V12A 1QZ8A 1ZMJA 2BD7A 2ANWA 3RM0H 1CA0B 1ELFA 4PROA 2A4QA 2OC8A 5EXMA 1ZJDA 2FZZA 1DX5M 4F49A 4ZMAH 1LCYA 2P16A 1O5DH 3UOPA 1ELTA 3F9GA 8GCHF 4K60A 4ABAA 4ABIA 3VB4A 1EB2A 1EKBB 2Q6DA 4ZHMU 1P3CA 6ESTA 1N8OB 3FP6E 3EA7A 4IMZA 4YM9A 1THSH 2R3YA 1JIMA 2BLWA 3RXJA 1VGCC 3M5MA 2WPJS 4B73A 3PRDA 3RXOA 3ZVCA 2WPLS 1LHEH 3PM3A 4ABBA 5AHGH 4NA7A 4Y8YA 2M2AA 2RDEA 1UVOA 4OGXA 3I78A 2VIDA 1V2QT 1PPZA 1QB1A 3OAAD 3U69H 3GS9A 1SC8U 3SV2H 2VVUA 4JCNA 4NZLA 2ZEBA 2ZKSA 4I7YH 2JIZD 2BQ7B 1KXAA 1H9HE 2XXLA 2QGRA 2SGAA 2SNVA 2JH6D 1V2WT 1FIWA 1WV7H 3LU9B 9ESTA 4TT3D 5K7RA 3PLKA 3SUGA 1O2IA 3PO1B 3IG6B 3UNQA 4F55A 4X1SU 4ZCNA 1GHWH 2ASUB 1W0ZU 1X7AC 1PPCE 1VCQA 1WUNH 3FANA 2KAIB 1OWKA 1O2RA 2J92A 3ENSB 3UNRA 3I29A 1CA0C 2FS8A 5GWZA 1F0RA 4IW4E 2BDBA 3RXCA 1OXGA 1LKBA 1BRBE 3E6PH 3MI4A 7LPRA 5DK1A 1NY22 1UTQA 3UIRA 1N8OC 4INHA 4BOHA 2ZU5A 1FIZA 5T6GA 2FESH 2XBXA 2TGAA 1ELGA 1YPHE 4AFUA 5AF9H 3SZEA 1SGTA 1NRPH 1EAIA 1IAUA 4NWKA 4AB9A 1PQAA 5FCRA 1MAXA 1FONA 3ATLA 3MNSA 1CSOE 2Z94A 1EPTC 1RTLA 3BTWE 4NFEA 4X8VH 3AK5A 3RM2H 2BZ6H 4ZXYH 1ZGIA 1V2KT 1LQEA 1D3DB 3O8BA 2J5UA 1E0FD 1ZMNA 3U8RH 4B6EA 2Y5GA 4AB8A 1C1PA 3PWCA 4DIIH 4Z6AH 1P2NA 1BBRH 5L6NH 4Y7AA 4IC6A 3K65B 3F6UH 1EOLA 4YO9A 4ISIH 3ZVAA 3PO1C 4MDSA 1UK4A 4BAKB 1HPGA 1GPZA 1B0EA 5B6OA 4FU8A 4LXBH 4AGKA 1ELCA 1O2XA 1QURH 2OK5A 1CT4E 2ZU3A 2GVFA 2ZFQH 8KME2 1D9IA 2PUXB 4DOQA 1GI2A 2YOLA 3P6ZB 3Q77A 1BT7A 2GV6A 3PLPA 3SGQE 1MZAA 2P93A 1C4U2 1P04A 1T7CA 2J98B 1ZGVA 3AAVA 2C4FH 1OSSA 1TBZH 3PV4A 2F3CE 6CHAB 2EQNA 2J34A 4H42U 1ABIH 1TGBA 2RA0A 1VCWA 3A8AA 1TQ0B 3FAOA 3BTME 4RSPA 4AYVB 3S7HB 2BDIA 5EW1H 2BQWB 2VGCB 1C5VA 1CE5A 2ZZUH 2P3TB 1HAVA 1GHAG 1S5SA 2PKAA 1GHAF 1LDTT 2NU2E 4E06H 1QBNA 2GCTB 4B76A 1VJ9U 1O2OA 1C9TA 2B8OH 3BTDE 1E1RD 4OGYA 2ZHFH 1W11U 2Q6GA 3TK6A 3RXDA 2FLRH 3MWIU 4BXWA 4BTUB 1L1GA 1NT1A 2ZHEH 1YC0A 2ZDNA 1YPLH 3S9AA 3GY5A 2OLGA 4OS5A 1TYNA 1CHOG 2KCAA 1KSNA 4YZUA 3SU6A 4J2YB 1NZQH 1F7ZA 1OHHD 1FMGA 3M36A 5HMAA 2B9LA 3ESTA 3LGTA 1Y5BT 4UE7H 1AVGH 1B7XB 1BIOA 1NPMA 5L2ZH 1GI7B 2H5DA 3QWCH 1HAGE 2WUBA 3NUMA 4CRBA 1V6DA 2ZDKA 2HNTF 1PQ7A 1ELEE 4ZROA 3SU5A 3LJJA 5C17A 1O2SA 5F8ZA 4AGJA 1SR5C 1WDIA 1AHTH 1QL9A 2ANYA 4IN1A 1IHTH 2XNDD 1HAZB 5T1VA 1GHXH 3RXEA 1GJBB 1QQUA 1FY3A 1FI8A 3DUXH 1TA2A 2BD8A 1EUFA 1MAYA 1TABE 2IJD1 3D62A 2BDGA 2B0FA 1J8AA 2EI6A 3VGCB 3ZV9A 4ASHA 1O3LA 5LPEA 4UFDH 2VH6A 3T26A 2SGFE 1TWXB 1KXBA 3EGKH 1N6XA 1O2JA 1AZ8A 3BTQE 1WCZA 1K28D 2Z6BD 2GCTC 1C2GA 3ZVGA 2ZU2A 1CT2E 1DDJA 1XXFA 1WXRA 1ACBE 2W3KA 1QFKH 2ODQA 3NPSA 1ESTA 4K69A 1VITF 1LKAA 1LO6A 4F48B 1GDNA 1Y8TA 1IQEA 1UHBB 3ZZ6A 1EZUC 5FPYA 2XBYA 2ILNA 1AB9B 4OS4A 2FDAA 2QF0A 1IQNA 2A31A 2ZI2H 3B9FH 2GDEH 1S0RA 3N7OA 4GCHG 3ATWA 2J4IA 1K1LA 1ZPZA 2ZPRA 1EZXC 2C8ZB 4I31A 4E7NA 4BAOB 4YTAA 1YCPK 1E1QD 1GBKA 1NU7B 2JKHA 2BD5A 4CREA 1C5PA 5JBTA 3BV9B 1QA7A 2J9NA 1DITH 5C5NA 1YKTA 3RXGA 1SHHB 1G32B 5FBIA 1FN8A 2BXUH 4X2VA 4XFQA 1YPEH 1WU1A 1HV7A 1YPHC 3TH3H 1RTFB 4AORA 2VIWA 5HIZA 1S0QA 2W6JD 1QJ1B 4X8TH 1LMWB 1B0FA 2TPIZ 1UVSH 4YOGA 3RXAA 1B5GH 1P10A 1TFXA 2NU0E 1ZZZA 2VIPA 5C1XA 4B1TA 2G55A 3TGJE 1BMMH 3VGCC 1G3DA 3RUOA 1O2UA 1J9CH 2V0BA 4FOUC 2FMJA 5DP5A 3UY9A 1CU1A 1XUKA 1SMFE 7KMEH 2W7UA 2XC4A 4FUHA 4HG6A 4FUCA 4OS2A 1IQGA 1H8IH 4LK4A 1A5HA 3QGJA 3LOXA 1GHBF 2A5IA 1UTOA 3URDA 4DCDA 1YPGH 4CRAA 3ZZ8A 1O37A 3BTTE 3LGUA 4JZIA 5GPIB 3FFGA 2VVCA 2CK3D 1TBQH 3KYGA 3LIWA 1AB9C 4YXWD 4JZEH 3UQVA 2VB0A 2FODA 4X0WU 5JB9S 2BQ6B 1LTOA 1TALA 4Y71A 1GJ9B 1PPEE 3N7DA 4FU7A 2QAAA 1EAWA 4KP0A 1SLUB 1JOUB 1G30B 1QL8A 3QDZB 1ZYOA 1A0JA 4FUFA 1QB6A 1C5UA 2FS9A 1L0ZA 1TMBH 1F92A 1THRH 3ZZ4A 1P09A 1CT0E 1DWBH 4DGJA 3RXQA 1GBBA 4DY7B 4AG1A 2RG3A 1A7SA 1HGTH 4UONA 1DSUA 4WY3A 4HFPB 5EXNA 3GISB 4FUJA 3UREA 1ELAA 2Z9GA 2HRVA 2PGBB 4X1NU 2PR3A 1AFQC 1Y3UA 1TPAE 4HTCH 5AFYH 1TNLA 2YMSB 1SL3A 1ID5H 4M7GA 2ZG0H 3GY3A 3LONA 1H9IE 3Q00A 5TJXA 1YM0A 3TK9A 2Y6TA 4A5TS 1ZHRA 1HJAC 2W6ID 2SGDE 5JBBS 1QQ4A 1BTPA 2PSYA 1C1UH 2ZQ1A 1EZQA 1T32A 1QRWA 1HJ9A 3ELAH 4F4OC 4IC5A 1E37B 5BRRE 1HIAA 2FYRA 1A61H 1ANEA 1MD8A 2WSSD 1G3BA 4I8JA 4AFSA 3VXFH 4ESTE 2FX6A 2H9TH 3M35A 3MU4A 3PV5A 1BHXB 3OTPA 1O2QA 2RFKC 2BM2A 2ZGXH 2VWLA 1IHSH 3ZVDA 2ZHDA 2UWOA 1SG8B 3PB1E 1ANBA 1GBFA 1TRNA 2ODPA 4CR9A 4WMFA 4B75A 3M7QA 4UFGH 3F9FA 4BTTB 1RD3B 1ZRKA 2AERH 2R2MB 1G37A 2A7HA 1L1NA 1HAVB 1NN6A 1BCUH 2Z7FE 3P8NA 1KXCA 2PKAB 1O0DH 1P2OA 1GJDB 2PWXA 3PV2A 2PTCE 4ISNA 3RLYH 3GDUA 3MMGA 4K8BA 4ABHA 1OWJA 2AGGX 2YMSC 2FYQA 1RFNA 1ANDA 3KQCA 4HZHA 7GCHG 3BEFB 1GI5A 3E16B 5F6MA 5C67A 7GCHF 2Q6FA 3SGAE 1GG6B 4WXIA 3UUZA 1EXFA 3SN8A 2ALVA 3F0OA 3KQ5A 1C2DA 4U2WA 4A6LA 1GJAB 1VJAU 3MQKC 1GJ6A 2ZGHA 4D9QA 3U28C 1FX0B 2J38A 3A7ZA 1C5XB 4Y7BA 2BYAX 5FX6A 2AMPA 4ZKNU 2QF3A 2ZQ2A 1C5TA 4I8HA 3O8DA 5FPSA 3OEED 5A0CA 1FN6A 2V35A 1P9UA 4Y8ZA 2QV1A 3T27A 2JDID 1EFRD 3M5LA 3V0XA 1Y3XA 2AGEX 2D2DA 2BDYA 3ZIAD 3HPTB 5GXPA 1ARBA 2A1DB 5J4QA 4U01A 2BVRH 1MTUA 3M3SA 3BTFE 2P3UB 2QIQA 1DANH 2TIOA 1YP9A 2WPDD 3MU1A 1SPJA 1FUJA 1C5ZB 1MKWK 1GJ7B 5ESTE 5TCCA 2HGTH 1HAIH 3TJNA 1H8ED 3OY5U 2BX3A 2XYAA 1EASA 1L1JA 3M7UA 1TNKA 2OQUA 4Z0KA 4A1VA 2ODYB 1O2WA 2Y81A 4MNVA 3DCLA 1GJCB 3QTOH 1C2IA 2ZFRH 5DP3A 1GVKB 1NFYA 3SU0A 1YY3A 3PTNA 3U9AH 3EA9A 2IPHA 1AGJA 4RI0A 3W95A 1ETTH 4K1SA 1GBLA 3EE7A 4I32A 4AG2A 5T6FA 1J14A 3QZQA 3DSOA 1GG6C 1XUIA 2SGPE 1YLCA 3M61U 4GAWA 1D6RA 1C2MA 4KTCA 1GMDG 2A4GA 3ODFA 1MKXH 1ZJKA 3OX7U 1OKXA 2ZFSA 2G81E 1UK2A 3DSGA 1C2LA 1GHZA 4YOIA 5A8YA 1FDPA 4P00A 1BBRE 1INCA 1JRTA 1Y3YA 2KR7A 2XWAA 2FOAA 3VB7A 2OXSA 2WPKS 1WTHD 1Y3VA 4NIVA 3T5FH 1TLDA 1TRMA 5CE1A 3A84A 2R2WU 2F9BH 1UCYH 3FO8D 1ABJH 1T4UH 4IGDA 2PSXA 3MH5A 1QJ7B 4NSYA 2EI8A 1O2NA 1EPTB 4ISOA 4ACAA 2FOGA 1N1LA 5JYIA 4Q2KA 3ZVFA 1FY4A 1AI8H 1XUHA 3MH6A 4MNWA 1O34A 4Q7XA 5C1UA 3TGIE 1TOMH 1MCVA 3KGPA 1C2FA 4UEHH 1OWDA 3BEIB 3SNAA 1XUFA 1YPJH 4FXGH 4MVNA 5JBCS 1O5BB 1KDQB 3RXRA 3OU0A 3MU0A 4K1TA 5EU8A 1BTXA 2A32A 1V2LT 2KFWA 1LHDH 1Z71A 1ANCA 2H2ZA 3F9EA 4GUXA 4YLQH 2BD2A 1HAXB 2XCFA 1KTSB 1OWHA 3GY8A 1BITA 2BLOA 1BRUP 1OP2A 1UVPA 2G00A 2Z9KA 2XOKD 2H9EH 2JH5D 2ZF0H 4ZH8A 5CDFE 4ZKSU 5FCKA 2W3IA 2BZAA 1NO9H 2F9NA 2R0LA 2AIQA 1O2HA 1AKSA 4OM9A 2UUJB 2ZPSA 1SQOA 5E0HA 3RC4A 3A80A 4UD9H 1DVAH 1S82A 1O5CB 1YPKH 2VVVA 4ZXXH 1O5EH 3WW7A 2FOCA 2WV4A 4Q80A 2Y7ZA 1EOJA 1GI1A 1ZMLA 3K2UA 4FETA 3PWBA 1O30A 2Z9JA 1DPOA 5EG4A 3F1SB 3A86A 1BJVA 1UJ1A 2NWNA 2G5NA 4Q7YA 3LJOA 3RXBA 2XRCA 3MTYA 1A46H 2L74A 1TB6H 3GCTG 1BMLA 1AUTC 3GCTF 1CBWB 1U6QA 2F43B 1QRZA 3MNCA 3FOAA 3P70B 5HM2A 3G01A 5A0BA 4NIXA 3SORA 2SFAA 2OP9A 4X8UH 2BY9X 3TLOA 3ZZ5A 3O8RA 3TH4H 1G36A 4AZ2B 3OEHD 4TPIZ 3SNCA 3LH1A 1UTJA 2Y80A 1ZTKA 1CO7E 1QCPA 1GHVH 1SQTA 5LPFA 1F0SA 2F83A 1HIAB 4VGCB 3KHVA 1O3GA 3FZDA 5E0GA 2GP9B 4X6PA 1DOJA 1S85A 4Y11E 2GCHG 4MPWA 2Y5HA 2A7CA 2O8MA 3QUMP 2RCEA 3H7TA 1CGJE 4UFFH 4AFZA 1W0KD 1NC6A 2WINI 3SJKA 3LKWA 1J15A 3BIVH 5PTPA 1QIXB 2GV7A 2BLQA 1P01A 4B6FA 4X1PU 2YMSD 1P3EA 2ZHWH 4BNRA 2R0KA 5FL7D 2WV5A 4Y10E 2J95A 1TPSA 1DSTA 3RU4D 1IQIA 3AVZA 4TY7A 3ZVEA 2BDAA 2AMDA 2D8WA 5EQSA 2RDLA 3CENA 1BUIA 3A7YA 3F2FA 1GI8B 4ZKOU 1BOQA 5EPNA 1AVXA 4JMYA 1TNHA 2R9PA 2ANKH 1V2TT 1W8BH 2STAE 1A2CH 1CBWC 1MTVA 1EP5A 1BBRK 2SGQE 2XBVA 4ABGA 2XW9A 1ZTJA 5IDKA 1SSXA 3GCNA 1Z8JB 1NU9A 2GD4B 2FP7B 2VWOA 4Y76A 1HXFH 2BY6X 1T8NA 1UTLM 4TWYA 1O5AB 1XKBC 3EAJA 1T4VH 3HKIB 2XCNA 3LGVA 4KELA 2OBOA 3STIA 1WTGH 1BTWA 2A0QB 2TRMA 1UO6A 1AWHB 1ELVA 4VGCC 5KEDA 1P2KA 4XBBA 1Y5UT 1AZZA 4WH8A 1JWTA 5A0AE 2BX4A 1CHOF 2TGPZ 1P57B 3P17H 1GBMA 3P8FA 1QA0A 2IPQX 5FXLA 4AX9H 3HK3B 3MYWA 3P8GA 3LGWA 2BXTH 2H5CA 1AQ7A 1KLJH 4X8SH 2UUKB 2KCYA 4MTBA 2J2UA 3RMOH 1WOFA 1YLDA 3BEUA 2PFEA 3D65E 2WPHS 3SJ9A 2A5AA 1W12U 1TX6A 3GCOA 3P95A 1C5QA 2BVXH 2SGEE 5JPMH 4IMQA 2A4RA 4MLFB 3TIUA 3SJ8A 3TNTA 1H4WA 1K0HA 2GZ7A 3UAIC 1E34B 4WJG2 3SBKA 3LGYA 3O8CA 5DJ7A 1PPBH 1HBTH 1GBAA 1SGQE 1XVOA 5C0UA 4NIYA 5A8XA 3K9XB 1LHFH 2FIRH 3TK5A 1ZPCA 2H6MA 4K8YA 2G51A 1QJ6B 2G5VA 1Z8GA 2OBQA 2GZ9A 5KGOA 2V3HH 2ZDLA 1TGTA 2F91A 1AU8A 2L6OA 1PJPA 1A0HB 3RU4E 2CXVA 2G52A 2O9QA 5TCAA 3U98H 1IOEA 4BAQB 5LGOA 1AFEH 4R0IA 4KKDA 1OWEA 3GY6A 3EYDA 4O3TA 4O9VA 1YF4A 1L4DA 1V2JT 5HGGA 4K5ZA 1FV9A 1LHGH 5FHTA 1UTKA 3A88A 2OUAA 2ZCLP 2FOMB 1W10U 3QN7A 6GCHG 3RXHA 3SJOA 3AW0A 1OP0A 3PMAB 4CRCA 1C4Y2 1GBCA 1MQ6A 2QYIA 3A89A 3SV9A 4GCHF 3MU8A 4O03A 2EA3A 5BPEA 1PPGE 1BMNH 3ZZ7A 1UVUH 3RXSA 1KXFA 2DUCA 4WWYA 4LZ1H 1CGIE 1V2PT 1NS3A 5I25A 3F9HA 5IYTA 1W2KH 1OS8A 5GNDA 3NK8A 1ZLRA 2XC5A 5DN6D 1EJAA 1P03A 4O97A 3GICB 2EC9H 1TGCA 2I6SA 1SQRA 1UK3A 2H1UA 1TONA 3RU4T 1O3IA 2HWLB 3A7XA 3ZZAA 1P0SH 3UFAA 4X6NA 1V2VT 1AFQB 4OS7A 4ASUD 1SQAA 4JYVH 1HDTH 3KCGH 1ZSLA 3C1KA 3TH2H 1YPMH 3KF2A 5SGAE 2JJ2D 2V7QD 1HJAB 1UTNA 4WH6A 1VITH 2K8IA 1BTUA 1F5KU 2P95A 1GL1A 3IWMA 3DFJA 3E3TA 3MO3A 5A2MH 1V2UT 2F9OA 1EAUA 3UNSA 1KLTA 2JH0D 1UTMA 3RP2A 4I86A 4BAHB 1SGFA 1GMHG 2CHAC 2PGQB 3W94A 3SNEA 3ZZDA 1EP6A 1GMCG 1MTSA 1KY9A 1Y3WA 4TPYA 3TITA 2VINA 3MH7A 2FO9A 5C2ZA 1V2MT 3BN9A 7ESTE 3DD2H 4NWLA 3UWJH 1GI4A 5HXFA 2ZCHP 1BHXF 3FZZA 1ESAA 2YNBA 5EJLA 5HIYA 3SYJA 3S9BA 2J97A 2GMTB 3EDXB 4AOQA 5H4IB 4DURA 1O2GH 1O31A 2PW8H 1GGDB 3VEQB 1QHRB 3OE7D 4Q63A 1ETSH 4BAMB 2WPMS 1AE5A 3A81A 4AFQA 1HAHH 1O3MA 1WQSA 4SGBE 1C1RA 1TPOA 4HI3A 1MQ5A 2SNWA 1ARCA 4X1RU 1P9SA 2GZ8A 5CHBA 1SI5H 2BY5X 2TGTA 4TSFD 5C20A 1K21H 2FOFA 3KL6A 3WWFA 1BRAA 4X2YA 5DP4A 5T3HA 1C9PA 3CP7A 4RN6A 2CF9H 1MTNB 3EE0B 1EZSC 1MZDA 3A8CA 4X6OA 1TOCB 1Z7KA 1FXYA 3ZZCA 1IQJA 3H7OA 1S6FA 5CMXH 3LT3A 2C93B 3SU3A 3KQEA 5G4BA 3U8OH 4A1XA 2VU8E 1GBDA 4XBCA 3MU5A 2XNIA 1OP8A 1XX9A 2CGAA 3TNSA 2IJOB 4B2CA 4YOJA 1J16A 1FJSA 1HAOH 1Q3XA 5L30H 3RMNH 1XUJA 1SGIB 2B5TB 3FP8E 3SV6A 2NU1E 1HFDA 4ZUHA 4ABFA 2ZDAH 1KYNA 5DO4H 2GMTC 1AE8H 4XD7D 1UW7A 5KECA 5C1YA 4FU9A 1TAWA 3N7EA 3L3TA 1DLEA 2BTCE 1GGDC 3TGKE 1C1SA 3P8OA 4DT7B 4I8KA 3GY7A 3HKJB 2WHXA 3S0NA 3KQBA 3E0PB 1W7XH 2AGIX 4AN7A 1O32A 1ZSJA 3BF6H 2XWBI 1G3EA 3V13A 1QBVH 4I33A 4Y0ZE 1HAPH 1TNGA 1Z1JA 3LH3A 3RLWH 3SV8A 2IOTA 4I8GA 1UCYE 2HLCA 2VIOA 5DP7A 1SFIA 3A85A 2C3SA 2UWLA 1OX1A 1CA8B 1HJ8A 1P2JA 2Z3CA 3Q76A 3BTKE 1DUAA 4HGCA 2ZPQA 1MTNC 1O3FA 3DFLA 2C8WB 1O38A 1LQDB 3L6PA 1W0YH 1AIXH 1A3EH 2AMQA 3I77A 1RGQA 2EEKA 3BTGE 2QF5A 1LPZB 1UTPA 1H9LB 1KLIH 4BXSA 4ISHH 1NFUA 1O2KA 1E38B 2O8LA 1S6LA 3GCHB 1RIWB 1C4V2 3UWIA 1MU8B 1GJ8B 2R3UA 4RKOB 3RXVA 3KQDA 1C5OH 1F5LA 4RT1A 1JXPA 2XBWA 1RJXB 3C27B 3RDZA 1C5MD 2QE7D 2PTNA 4THNH 1Q31A 1C5YB 3HGNA 2QXJA 5DPAA 5JBAS 2FLBH 1C1TA 4JZ1A 1S81A 2QXIA 3EQ0H 3D23A 1P05A 3F2HA 1P2QA 4OS1A 3SI4H 1XM1A 1GVLA 2FEQH 1XVMA 3PYHA 1ESBA 1V3XA 3QZRA 3BSQA 1T31A 1GL0E 3A7TA 1QGFA 4FVBA 3SUFA 1O3HA 2FI3E 1UVTH 1SVPA 1FY5A 3BG4B 1VKYA 1TGSZ 1JIRA 5FX5A 2OCVB 4NZQA 5GCHG 1DE7H 3UTUH 3ZV8A 4K3JA 2O8TA 3CNRA 3TJVA 4Y6DA 1FPCH 2XTTB 2A4OA 4UDWH 2W26A 1DICA 2FOEA 1GMDF 2W5EA 2B7DH 3PLBA 3SV7A 1Z8RA 1SOTA 2CN0H 4NIWA 1P2IA 1H8DH 1C2JA 1ZPBA 1A1RA 4LOYH 4CH8B 2KM0A 3RXIA 4MPXA 3GCHC 1SGEE 1RIWC 4YT6H 1O3JA 2ZP0H 3D49H 2W7SA 1QB9A 2ZGBH 1SGPE 1UHBA 3SW2B 2UWPA 4NG9H 2G4UA 3URCA 8GCHG 1V2OT 2BD9A 2ZU1A 4H6SB 4RT0A 3SO3A 1OYTH 3H5CB 3U8TH 3NRLA 1FNIA 2VIQA 1LVBA 5EJ1A 1O3OA 1JBUH 4KGAA 3UR9A 5ESBA 1NFWA 1V2ST 1GWAA 4CBNA 1T8MA 4WVPE 2GTBA 8LPRA 1HRTH 1K1OA 1MH0A 4WF8A 1SLVB 1MBMA 3W1EA 1NBMD 1LVMA 4YT7H 3M5OA 1G9IE 1PYTC 1WQVH 4O3UA 2O8WA 1HCGA 3OSYA 1IQFA 3BG4C 1SGRE 1O39A 4INLA 2LPRA 2QXHA 5F53A 1C1OA 1HUTH 1VR1H 1OOKB 1P2MA 2PLXA 1P8VC 1O2PA 3SU2A 5JDUB 1MKXK 1THPB 2A7JA 1GHYH 1HLTH 3ATKA 2STBE 2VWNA 3LPRA 5ABWA 5E8EH 1NRSH 3TVJB 4X2XA 4NA9H 4INKA 5DP6A 4CH2B 5C94A 3IITA 2VNTA 4JK6A 1TX7A 1DWEH 3MNBA 2OQ5A 4I8LA 2ALPA 2H9HA 4JZDH 4CRFA 5GIBA 2UUYA 4LZ4B 2HOBA 3UOUA 1F5RA 2BY7X 1FY8E 4JZFH 1ZOMA 1SGDE 4CRGA 2D26C 1YWUA 4D7FA 3PMHB 1PPHE 1UCYK 1Q2WA 2XC0A 1BMFD 1LHCH 3GDVA 1T8LA 1FLEE 4TWWA 2K0QA 3A7VA 3A8DA 2ZCKP 3OYPA 1BA8B 1O2LA 2WPIS 1IQHA 4Q4LA 3PRBA 1SLXB 2AEIH 1GVZA 1CVWH 2FTLE 3DA9B 1AUJA 1Z6EA 1BB0B 2Z3DA 1N6YA 4MPUA 1MU6B 1SBWA 1TNJA 3K6ZA 3ATIA 2ULLA 1RTKA 1TX8A 1AN1E 4XBDA 2Y5FA 1DM4B 4FUGA 1KMHB 3P92A 1GDQA 4B2BA 2P94A 1FAKH 5E0JA 4ABEA 2F4LA 1H1BA 1L4ZA 2ANMH 5LH8A 3UPEA 2BHGA 4GPGA 3BTEE 3H09A 1QBOA 2HVXA 3A87A 5ETXA 3TJUA 1NBME 5EGMA 1BRCE 4AC9A 4GSOA 1OYQA 4E7RG 3B23B 1QRXA 4WMDA 3RXTA 4ZHLU 1ORFA 3GOVB 1BTYA 1LVYA 1Z8IB 2O8UA 1PQ5A 2DE8A 2ZC9H 1AWFH 1O5GH 1C1MA 5IK2D 2FOHA 2PHBA 9LPRA 1ELBA 3SQEE 1ETRH 4NCYA 3FP7E 4XSKU 1IQLA 2GCHF 3QK1A 3OY6U 2BDCA 1ZTLA 2V6NA 3VXEH 1TRYA 3QO6A 2EY4C 4DT4A 3DT0H 2A2QH 2FI4E 4Y79A 3DSPA 4MNYA 3F3BA 1DLKB 2DE9A 1XXDA 2AH4X 2F9PA 4WXVA 5K0HA 1XKAC 2RA3A 1TGNA 3PROA 4FUDA 3RC5A 4GVUA 1COWD 1K1IA 2WZQA 3TPIZ 3RXKA 3SUDA 1RS0A 1S83A 3CS7A 4B74A 4B2AA 2V3MA 1KXEA 4FUIA 3QX5H 2I6QA 3V7TA 2KX4A 2FWWA 3ZZ9A 4MNXA 4U32A 2HNTE 5EODA 1BTHH 1DXPA 1GCTB 4ISLA 2ZO3H 3NWUA 4E05H 1OPHB 1VCPA 4SGAE 1Z1IA 2IN2A 2VH0A 4Q7ZA 1DS2E 2HPPH 1EX3A 5C5OA 1W13U 4MQAA 1HXEH 2D1JA 1A0LA 2BD4A 2OINA 2PV9B 1W0JD 1AY6H 5DG6A 1O3AA 1XMNB 4AYYB 1A5GH 2YNAA 1WAYB 3VPKA 4ZAEA 1WYKA 5C0TA 3E0NB 1TMTH 2FOBA 1FPHH 3M37A 1MD7A 4DG4A 1P02A 3LGIA 4NSVA 4CHAB 1GBEA 3F2GA 5EOKA 3ODDA 1NESE 1BTZA 1A5IA 3CS0A 1LVOA 2QF4A 3RXFA 3V3MA 3DHKH 1O2YA 1O35A 4X1QU 3SNBA 1IQMA 3S69A 1V2RT 3U1IB 1QL7A 1V2NT 3L33A 5LPRA 1C5WB 1O36A 4ACBA 1DY8A 1YCPH 3RXLA 2P8OB 2QXGA 2AIPA 1O3EA 8ESTE 6LPRA 3KYFA 3SZNA 1HAYB 1K2I1 1C5NH 1SHYA 3MO9A 3OFND 1GCTC 1ZHPA 2AS9A 1DFPA 3GY4A 1E79D 4FUBA 6CHAC 2ZFTA 4NGAH 5L2YH 1TIOA 1NFXA 2G8TA 1F0TA 3A7WA 2ZFFH 5FAHA 1FY1A 3ITIA 4BTIB 1HB0B 2CHAB 4CR5A 1D6WA 2GX4A 4P02A 1KIGH 2VGCC 3FKSD 2Q1JA 3T25A 1K22H 2WYJA 3UB0A 3SI3H 1C2KA 2Y82A 6GCHF 1T8OA 3MOCA 4A92A 1NRRH 1SGYE 1EATA 3RC6A 5EJZA 4QT8C 3PMBB 1CHGA 3MHWU 1VITG 3WWBA 3HGPA 2BMGB 3HATH 3SU1A 3UR6A 4JK5A 1BJUA 2ZA5A 5EIYA 3KIDU 1MUEB 2QC2A 2M5TA 1NRNH 2BDHA 1PPFE 2THFB 3SHCH 1C1QA 4Z1MD 3PTBA 4RKJB 2AHME 4KTUA 2ZDMA 3JZ1B 1PYTD 4GHTA 4CHAC 3F0PA 4X2WA 2P59A 1GBIA 1O3DA 2AFQB 5EW2H 1D3TB 5A8ZA 1O3KA 2Z3EA 2GT7A 2KCOA 2P3FH 3PMJA 2PKSB 3OTJE 3T29A 2GKVE 3RXMA 3VB3A 1ZRBA 1SB1H 4D8NA 2OC0A 1E35B 2VIVA 4A1TA 1SLWB 2JJ1D 3ZZ3A 1HNEE 3NCLA 1NM6A 1PQ8A 1J17T 3ZYDA 2P8OC 1KTTB 2GT8A 4MG3A 1TBRH 1K1MA 1AD8H 1AO5A 2ZNKH 5F8XA 1FZZA 5EPYA 3Q3KA 1EPTA 1PFXC 2HLDD 3ZYEA 2KCPA 4H4FA 2OD3B 5GJ4B 1DY9A 4K2YA 1DT2A 5EQRA 1BQYA 2ESTE 3Q3YA 4YESB 1AVWA 2CMYA 1SGCA 1JRSA 2FPZA 1AKSB 1SKYE 1BZXE 1M9UA 1MTWA 3NXPA 4KTSA 1GMHF 3NKKA 1KDQA 3F68H 1JMOH 1GMCF 2HPQH 1GJ4H 2OTVA 3SGBE 1K1PA 2HVYB 4XE4A 1L2EA 1P11E 3VB6A 1GHBG 5HM9A 3RMLH 2AYWA 1KXDA 1SFQB 5JB8S 4JYTA 2F9UA 2Z9IA 3FVFB 4FVDA 2TBSA 5DP9A 2FXRA 2HALA 1DWDH 1O2TA 1F2SE 1WSSH 2KAIA 3E91A 4JYUH 1MMJN 2G4TA 4XDEA 1C2EA 3WY8A 3M3TA 1C2HA 1XUGA 4XRNA 4YLUA 1BDAA 3TU7H 4MPVA 5E2OA 1E36B 2BOKA 1SGNE 2A45B 2KZ4A 5I46H 1TNIA 3B8JA 2A5KA 2PKSC 3QLPH 4WMEA 1O2ZA 1GI6A 2JETB 2BD3A 5F8TA 4J1YA 2CV3A 1DWCH 1TMUH 2CJIA 3RMMH 3EA8A 4D9RA 2HNTC 2VBCA 2QA9E 3LC3A 1NRQH 3S9CA 2F9VA 4GLYA 2OC7A 3SNDA 3T28A 1C1NA 1GBJA 1A4WH 2ZTXA 1K1JA 1P12E 5HKKD 5F03A 1O3NA 1EB1H 1NTPA 2CF8H 4Y0YE 3HK6B 1GI0A 3GYLB 4DVAU 1O2MA 3MO6A 3MNXA 2WUCA 1YCPM 4IN2A 4R8TB 1C5RA 5T6DA 3T2NA 1O33A 2QN5T 1GJ5H 1W3CA 2ZU4A 1DXWA 3M7TA 1W7GH 3BG8A 1CGHA 1WBGB 1GCDA 2ZECA 1FQ3A 1EJNA 4U30A 4TYDA 2EI7A 5A09A 1Y59T 4ZKRU 2BVSH 2ZGCA 1C1WH 1EQ9A 1NROH 1MBQA 1YBWA 3A82A 5FBEA 2Y7XA 4UFEH 1C1VH 5DSFA 1O2VA 1GBTA 4GHQA 4DIHH 1OWIA 1TQ7B 1GI9B 5CHAB 1SOZA 2LELA 1O3PB 2LNCA 2LP6A 2GJGA 5FPTA 1RXPA 2J98A 3E8LA 3ATMA 3T62A 4NA8A 4Y8XA 3QTVH 1A3BH 3RXUA 2QCYA 4ABJA 1YYY1 3LDXH 1TPPA 5EQQA 2JETC 2NU3E 2J94A 1D3PB 3VFEA 2FM2A 1UMAH 1GI3A 1ZR0A 2K1QA 1F0UA 3A83A 1EJMA 3Q3XA 1MCTA 1G2LA 1TA6A 1ZSKA 2PUQH 2ZFPH 1MKWH 3AAUA 1S6HA 4IBLH 1LPKB 2ZTZA 3UQOA 2Z9LA 3SQHE 3TJOA 3LC5A 1H8HD 3M5NA 5HYOA 3SU4A 1Y5AT 1QTFA 5DP8A 1C5LH 3KN2A 4DJZB 3NZIA 4A7IB 1YGCH 1QNJA 5EXLA 5B6LA 1BMAA 2GGVB 1MABB 3SOSA 1W14U 2ZTYA 4CBOA 3ZZBA 1C5SA 2C8YB 5DKMA 1D4PB 2V3OH 3R3GB 2WYGA 3KEEA 1K1NA 2OC1A 1O5FH 1AMHA 4ZHAA 3MFJA 5DGJA 3KNXA 2FX4A 1DUEA 2GDDA 2NU4E 4NFFA 4M9FA 3U1JB 3SUEA 3E1XB 1CQQA 1IQKA 3K6YA 5GDSH 3STJA 5C3NA 1ZHMA 3VG8A 1O3BA 2WV9A 1ELDE 2BY8X 1LPGB 3S7KB 3ZVBA 3N99A 1VGCB 3GY2A 1QY6A 2C90B 4H6TA 2PP6A 4IS5A 4K1EA 1FAXA 5CHAC 2ZHQH 4X6MA 3GYMA 1RRKA 1K9OE 2FTMA 3A8BA 3E90B 3BIUH 2ZDVH 2A2XH 2BOHB 3BTHE 3M3VA 4D7GA 4CRDA 1S84A 3AASA 2ZIQH 4BANB 1G3CA 1Z6JH 4FUEA 1GDUA 3FN8A 2ZWLH 1VZQH 5GCHF 1EAXA 4B71A 2C8XB 5J4SA 3SJIA 1TE0A 1HYLA 2QY0B 1G2MA 5AFZH 4TY6A 3R0FA 1SGFG 2ZGJA 2BLVA 4DW2U
chains in the Genus database with same CATH topology
4OS6A 2VJ1A 3MH4A 3QGNB 4ABDA 3JZ2B 5AVDA 3VB5A 3RXPA 1QR3E 5E2PA 2TGDA 1D3QB 1P06A 3SHAH 2VWMA 2FI5E 2UUFB 2BB4A 1O3CA 3AW1A 4XOJA 3GDSA 4D76A 1GBHA 3V12A 1ZMJA 2BD7A 2ANWA 3RM0H 1CA0B 1ELFA 4PROA 2A4QA 2OC8A 5EXMA 1ZJDA 2FZZA 1DX5M 4F49A 4ZMAH 1LCYA 2P16A 1O5DH 3UOPA 1ELTA 3F9GA 8GCHF 4K60A 4ABAA 4ABIA 3VB4A 1EB2A 1EKBB 2Q6DA 4ZHMU 1P3CA 6ESTA 1N8OB 3FP6E 3EA7A 4IMZA 4YM9A 1THSH 2R3YA 1JIMA 2BLWA 3RXJA 1VGCC 3M5MA 2WPJS 4B73A 3RXOA 3ZVCA 2WPLS 1LHEH 3PM3A 4ABBA 5AHGH 4NA7A 4Y8YA 1UVOA 4OGXA 3I78A 2VIDA 1V2QT 1PPZA 1QB1A 3U69H 1SC8U 3SV2H 2VVUA 4JCNA 4NZLA 2ZEBA 2ZKSA 4I7YH 2BQ7B 1KXAA 1H9HE 2XXLA 2QGRA 2SGAA 2SNVA 2JH6D 1V2WT 1FIWA 1WV7H 3LU9B 9ESTA 5K7RA 3PLKA 3SUGA 1O2IA 3PO1B 3IG6B 3UNQA 4X1SU 1GHWH 2ASUB 1W0ZU 1X7AC 1PPCE 1VCQA 1WUNH 3FANA 2KAIB 1OWKA 1O2RA 2J92A 3ENSB 3UNRA 3I29A 1CA0C 2FS8A 5GWZA 1F0RA 4IW4E 2BDBA 3RXCA 1OXGA 1LKBA 1BRBE 3E6PH 3MI4A 7LPRA 5DK1A 1NY22 1UTQA 3UIRA 1N8OC 4INHA 4BOHA 2ZU5A 1FIZA 5T6GA 2FESH 2XBXA 2TGAA 1ELGA 1YPHE 4AFUA 5AF9H 1SGTA 1NRPH 1EAIA 1IAUA 4NWKA 4AB9A 1PQAA 5FCRA 1MAXA 1FONA 3ATLA 3MNSA 1CSOE 2Z94A 1EPTC 1RTLA 3BTWE 4NFEA 4X8VH 3RM2H 2BZ6H 4ZXYH 1ZGIA 1V2KT 1LQEA 1D3DB 3O8BA 1E0FD 1ZMNA 3U8RH 2Y5GA 4AB8A 1C1PA 3PWCA 4DIIH 4Z6AH 1P2NA 1BBRH 5L6NH 4Y7AA 4IC6A 3K65B 3F6UH 1EOLA 4YO9A 4ISIH 3ZVAA 3PO1C 4MDSA 1UK4A 4BAKB 1HPGA 1GPZA 1B0EA 5B6OA 4FU8A 4LXBH 4AGKA 1ELCA 1O2XA 1QURH 1CT4E 2ZU3A 2GVFA 2ZFQH 8KME2 1D9IA 2PUXB 4DOQA 1GI2A 2YOLA 3P6ZB 3Q77A 1BT7A 2GV6A 3PLPA 3SGQE 1MZAA 2P93A 1C4U2 1P04A 1T7CA 1ZGVA 3AAVA 2C4FH 1OSSA 1TBZH 3PV4A 2F3CE 6CHAB 2J34A 4H42U 1ABIH 1TGBA 2RA0A 1VCWA 3A8AA 1TQ0B 3FAOA 3BTME 4RSPA 4AYVB 3S7HB 2BDIA 5EW1H 2BQWB 2VGCB 1C5VA 1CE5A 2ZZUH 2P3TB 1HAVA 1GHAG 1S5SA 2PKAA 1GHAF 1LDTT 2NU2E 4E06H 1QBNA 2GCTB 4B76A 1VJ9U 1O2OA 1C9TA 2B8OH 3BTDE 4OGYA 2ZHFH 1W11U 2Q6GA 3TK6A 3RXDA 2FLRH 3MWIU 4BXWA 4BTUB 1L1GA 1NT1A 2ZHEH 1YC0A 2ZDNA 1YPLH 3S9AA 3GY5A 2OLGA 4OS5A 1TYNA 1CHOG 1KSNA 4YZUA 3SU6A 4J2YB 1NZQH 1F7ZA 1FMGA 3M36A 5HMAA 2B9LA 3ESTA 3LGTA 1Y5BT 4UE7H 1AVGH 1B7XB 1BIOA 1NPMA 5L2ZH 1GI7B 2H5DA 3QWCH 1HAGE 2WUBA 3NUMA 4CRBA 1V6DA 2ZDKA 2HNTF 1PQ7A 1ELEE 4ZROA 3SU5A 3LJJA 1O2SA 5F8ZA 4AGJA 1SR5C 1AHTH 1QL9A 2ANYA 4IN1A 1IHTH 1HAZB 1GHXH 3RXEA 1GJBB 1QQUA 1FY3A 1FI8A 3DUXH 1TA2A 2BD8A 1EUFA 1MAYA 1TABE 3D62A 2BDGA 2B0FA 1J8AA 2EI6A 3VGCB 3ZV9A 4ASHA 1O3LA 5LPEA 4UFDH 2VH6A 3T26A 2SGFE 1TWXB 1KXBA 3EGKH 1N6XA 1O2JA 1AZ8A 3BTQE 1WCZA 1K28D 2Z6BD 2GCTC 1C2GA 3ZVGA 2ZU2A 1CT2E 1DDJA 1XXFA 1ACBE 2W3KA 1QFKH 2ODQA 3NPSA 1ESTA 4K69A 1VITF 1LKAA 1LO6A 1GDNA 1Y8TA 1IQEA 1UHBB 3ZZ6A 1EZUC 5FPYA 2XBYA 2ILNA 1AB9B 4OS4A 2FDAA 2QF0A 1IQNA 2A31A 2ZI2H 3B9FH 2GDEH 1S0RA 3N7OA 4GCHG 3ATWA 2J4IA 1K1LA 1ZPZA 2ZPRA 1EZXC 2C8ZB 4I31A 4E7NA 4BAOB 4YTAA 1YCPK 1GBKA 1NU7B 2JKHA 2BD5A 4CREA 1C5PA 5JBTA 3BV9B 1QA7A 2J9NA 1DITH 5C5NA 1YKTA 3RXGA 1SHHB 1G32B 5FBIA 1FN8A 2BXUH 4X2VA 4XFQA 1YPEH 1WU1A 1HV7A 1YPHC 3TH3H 1RTFB 4AORA 2VIWA 1S0QA 1QJ1B 4X8TH 1LMWB 1B0FA 2TPIZ 1UVSH 4YOGA 3RXAA 1B5GH 1P10A 1TFXA 2NU0E 1ZZZA 2VIPA 5C1XA 4B1TA 2G55A 3TGJE 1BMMH 3VGCC 1G3DA 3RUOA 1O2UA 1J9CH 2V0BA 2FMJA 5DP5A 3UY9A 1CU1A 1XUKA 1SMFE 7KMEH 2W7UA 2XC4A 4FUHA 4FUCA 4OS2A 1IQGA 1H8IH 4LK4A 1A5HA 3QGJA 3LOXA 1GHBF 2A5IA 1UTOA 3URDA 4DCDA 1YPGH 4CRAA 3ZZ8A 1O37A 3BTTE 3LGUA 4JZIA 5GPIB 3FFGA 2VVCA 1TBQH 3LIWA 1AB9C 3UQVA 4JZEH 2VB0A 2FODA 4X0WU 5JB9S 2BQ6B 1LTOA 1TALA 4Y71A 1GJ9B 1PPEE 4FU7A 2QAAA 1EAWA 4KP0A 1SLUB 1JOUB 1G30B 1QL8A 3QDZB 1ZYOA 1A0JA 4FUFA 1QB6A 1C5UA 2FS9A 1L0ZA 1TMBH 1F92A 1THRH 3ZZ4A 1P09A 1CT0E 1DWBH 4DGJA 3RXQA 1GBBA 4DY7B 4AG1A 2RG3A 1A7SA 1HGTH 4UONA 1DSUA 4WY3A 4HFPB 5EXNA 3GISB 4FUJA 3UREA 1ELAA 2Z9GA 2HRVA 2PGBB 4X1NU 2PR3A 1AFQC 1Y3UA 1TPAE 4HTCH 5AFYH 1TNLA 1SL3A 1ID5H 4M7GA 2ZG0H 3GY3A 3LONA 1H9IE 3Q00A 5TJXA 1YM0A 3TK9A 2Y6TA 4A5TS 1ZHRA 1HJAC 2SGDE 5JBBS 1QQ4A 1BTPA 2PSYA 1C1UH 2ZQ1A 1EZQA 1T32A 1QRWA 1HJ9A 3ELAH 4F4OC 4IC5A 1E37B 5BRRE 1HIAA 2FYRA 1A61H 1ANEA 1MD8A 1G3BA 4I8JA 4AFSA 3VXFH 4ESTE 2FX6A 2H9TH 3M35A 3MU4A 1BHXB 1O2QA 2BM2A 2ZGXH 2VWLA 1IHSH 3ZVDA 2ZHDA 2UWOA 1SG8B 3PB1E 1ANBA 1GBFA 1TRNA 2ODPA 4CR9A 4WMFA 4B75A 3M7QA 4UFGH 3F9FA 4BTTB 1RD3B 1ZRKA 2AERH 2R2MB 1G37A 2A7HA 1L1NA 1HAVB 1NN6A 1BCUH 2Z7FE 3P8NA 1KXCA 2PKAB 1O0DH 1P2OA 1GJDB 2PWXA 2PTCE 4ISNA 3RLYH 3GDUA 3MMGA 4K8BA 4ABHA 1OWJA 2AGGX 2FYQA 1RFNA 1ANDA 3KQCA 4HZHA 7GCHG 3BEFB 1GI5A 3E16B 5F6MA 5C67A 7GCHF 2Q6FA 3SGAE 1GG6B 4WXIA 3UUZA 1EXFA 3SN8A 2ALVA 1C2DA 4U2WA 4A6LA 1GJAB 1VJAU 1GJ6A 2ZGHA 4D9QA 2J38A 3A7ZA 1C5XB 4Y7BA 2BYAX 5FX6A 2AMPA 4ZKNU 2QF3A 2ZQ2A 1C5TA 4I8HA 3O8DA 5FPSA 5A0CA 1FN6A 2V35A 1P9UA 4Y8ZA 2QV1A 3T27A 3M5LA 3V0XA 1Y3XA 2AGEX 2D2DA 2BDYA 3HPTB 5GXPA 1ARBA 2A1DB 5J4QA 4U01A 2BVRH 1MTUA 3M3SA 3BTFE 2P3UB 2QIQA 1DANH 2TIOA 1YP9A 3MU1A 1SPJA 1FUJA 1C5ZB 1MKWK 1GJ7B 5ESTE 5TCCA 2HGTH 1HAIH 3TJNA 3OY5U 2BX3A 2XYAA 1EASA 1L1JA 3M7UA 1TNKA 2OQUA 4Z0KA 4A1VA 2ODYB 1O2WA 2Y81A 4MNVA 1GJCB 3QTOH 1C2IA 2ZFRH 5DP3A 1GVKB 1NFYA 3SU0A 3PTNA 3U9AH 3EA9A 2IPHA 1AGJA 3W95A 1ETTH 4K1SA 1GBLA 4I32A 4AG2A 5T6FA 1J14A 3QZQA 1GG6C 1XUIA 2SGPE 1YLCA 3M61U 4GAWA 1D6RA 1C2MA 4KTCA 1GMDG 2A4GA 3ODFA 1MKXH 1ZJKA 3OX7U 1OKXA 2ZFSA 2G81E 1UK2A 1C2LA 1GHZA 4YOIA 5A8YA 1FDPA 1BBRE 1INCA 1JRTA 1Y3YA 2XWAA 2FOAA 3VB7A 2OXSA 2WPKS 1WTHD 1Y3VA 4NIVA 3T5FH 1TLDA 1TRMA 5CE1A 3A84A 2R2WU 2F9BH 1UCYH 1ABJH 1T4UH 4IGDA 2PSXA 3MH5A 1QJ7B 4NSYA 2EI8A 1O2NA 1EPTB 4ISOA 2FOGA 1N1LA 5JYIA 4Q2KA 3ZVFA 1FY4A 1AI8H 1XUHA 3MH6A 4MNWA 1O34A 4Q7XA 5C1UA 3TGIE 1TOMH 1MCVA 3KGPA 1C2FA 4UEHH 1OWDA 3BEIB 3SNAA 1XUFA 1YPJH 4FXGH 4MVNA 5JBCS 1O5BB 1KDQB 3RXRA 3OU0A 3MU0A 4K1TA 5EU8A 1BTXA 2A32A 1V2LT 1LHDH 1Z71A 1ANCA 2H2ZA 3F9EA 4GUXA 4YLQH 2BD2A 1HAXB 2XCFA 1KTSB 1OWHA 3GY8A 1BITA 2BLOA 1BRUP 1OP2A 1UVPA 2G00A 2Z9KA 2H9EH 2JH5D 2ZF0H 4ZH8A 4ZKSU 5FCKA 2W3IA 2BZAA 1NO9H 2F9NA 2R0LA 2AIQA 1O2HA 1AKSA 2UUJB 2ZPSA 1SQOA 5E0HA 3RC4A 3A80A 4UD9H 1DVAH 1S82A 1O5CB 1YPKH 2VVVA 4ZXXH 1O5EH 2FOCA 2WV4A 4Q80A 2Y7ZA 1EOJA 1GI1A 1ZMLA 3K2UA 3PWBA 1O30A 2Z9JA 1DPOA 5EG4A 3F1SB 3A86A 1BJVA 1UJ1A 2NWNA 2G5NA 4Q7YA 3LJOA 3RXBA 2XRCA 3MTYA 1A46H 1TB6H 3GCTG 1BMLA 1AUTC 3GCTF 1CBWB 1U6QA 1QRZA 3MNCA 3P70B 5HM2A 3G01A 5A0BA 4NIXA 3SORA 2SFAA 2OP9A 4X8UH 2BY9X 3TLOA 3ZZ5A 3O8RA 3TH4H 1G36A 4AZ2B 4TPIZ 3SNCA 3LH1A 1UTJA 2Y80A 1ZTKA 1CO7E 1QCPA 1GHVH 1SQTA 5LPFA 1F0SA 2F83A 1HIAB 4VGCB 3KHVA 1O3GA 3FZDA 5E0GA 2GP9B 4X6PA 1DOJA 1S85A 4Y11E 2GCHG 4MPWA 2Y5HA 2A7CA 2O8MA 3QUMP 2RCEA 3H7TA 1CGJE 4UFFH 4AFZA 1NC6A 2WINI 3SJKA 3LKWA 1J15A 3BIVH 5PTPA 1QIXB 2GV7A 2BLQA 1P01A 4X1PU 1P3EA 2ZHWH 4BNRA 2R0KA 2WV5A 4Y10E 2J95A 1TPSA 1DSTA 3RU4D 1IQIA 3AVZA 4TY7A 3ZVEA 2BDAA 2AMDA 2D8WA 5EQSA 2RDLA 3CENA 1BUIA 3A7YA 1GI8B 4ZKOU 1BOQA 5EPNA 1AVXA 4JMYA 1TNHA 2R9PA 2ANKH 1V2TT 1W8BH 2STAE 1A2CH 1CBWC 1MTVA 1EP5A 1BBRK 2SGQE 2XBVA 4ABGA 2XW9A 1ZTJA 5IDKA 1SSXA 3GCNA 1Z8JB 1NU9A 2GD4B 2FP7B 2VWOA 4Y76A 1HXFH 2BY6X 1T8NA 1UTLM 4TWYA 1O5AB 1XKBC 3EAJA 1T4VH 3HKIB 2XCNA 3LGVA 4KELA 2OBOA 3STIA 1WTGH 1BTWA 2A0QB 2TRMA 1UO6A 1AWHB 1ELVA 4VGCC 1P2KA 4XBBA 1Y5UT 1AZZA 4WH8A 1JWTA 5A0AE 2BX4A 1CHOF 2TGPZ 1P57B 3P17H 1GBMA 3P8FA 1QA0A 5FXLA 4AX9H 3HK3B 3MYWA 3P8GA 3LGWA 2BXTH 2H5CA 1AQ7A 1KLJH 4X8SH 2UUKB 4MTBA 2J2UA 3RMOH 1WOFA 1YLDA 3BEUA 2PFEA 3D65E 2WPHS 3SJ9A 2A5AA 1W12U 1TX6A 3GCOA 3P95A 1C5QA 2BVXH 2SGEE 5JPMH 4IMQA 2A4RA 4MLFB 3TIUA 3SJ8A 3TNTA 1H4WA 2GZ7A 1E34B 4WJG2 3SBKA 3LGYA 3O8CA 5DJ7A 1PPBH 1HBTH 1GBAA 1SGQE 1XVOA 4NIYA 5A8XA 3K9XB 1LHFH 2FIRH 3TK5A 1ZPCA 2H6MA 4K8YA 2G51A 1QJ6B 2G5VA 1Z8GA 2OBQA 2GZ9A 2V3HH 2ZDLA 1TGTA 2F91A 1AU8A 3RU4E 1PJPA 1A0HB 2CXVA 2G52A 2O9QA 5TCAA 3U98H 1IOEA 4BAQB 5LGOA 1AFEH 4R0IA 4KKDA 1OWEA 3GY6A 3EYDA 4O3TA 4O9VA 1YF4A 1L4DA 1V2JT 5HGGA 4K5ZA 1FV9A 1LHGH 5FHTA 1UTKA 3A88A 2OUAA 2ZCLP 2FOMB 1W10U 3QN7A 6GCHG 3RXHA 3SJOA 3AW0A 1OP0A 3PMAB 4CRCA 1C4Y2 1GBCA