3PROA

Alpha-lytic protease complexed with c-terminal truncated pro region
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Lysobacter enzymogenes
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
total genus 56
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3proA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3proA01
1HBTH 4R8TB 2GKVE 2FYRA 3T2NA 1C5ZB 5FPTA 1SBWA 5FBIA 4D7GA 4I8GA 4WXVA 3M61U 3BG4C 3U8TH 3LGUA 1Y5BT 1HAIH 2VNTA 4XBDA 3UQOA 1O2OA 2QCYA 2BD3A 3LGTA 5DP4A 1ZMLA 4AN7A 4UFGH 2C8ZB 2M5TA 1C5NH 1IHTH 4MPUA 2QAAA 3QK1A 1Y5UT 1Z8IB 3E16B 2R9PA 3C1KA 3SOSA 2ZFRH 4WY3A 3RC5A 3ESTA 1QL9A 4K60A 1K9OE 3RM0H 3MNSA 1DT2A 1GBHA 4BTIB 2JH5D 1KXAA 2OXSA 3EAJA 3RXKA 4K8YA 3SNDA 1ZGIA 3MI4A 2AGIX 1QJ6B 2XXLA 4IS5A 3UR9A 5C5OA 2P8OB 3PLBA 3SV7A 3E90B 4FVBA 2P3UB 3ZZ3A 3ATMA 1BT7A 5LPFA 1N8OB 1P2OA 3BEUA 2I6SA 2ZEBA 3LGYA 2ZU4A 4DIIH 1G3DA 1A4WH 2DE8A 4DVAU 4K2YA 2ZCHP 2ZU2A 1VCQA 1O33A 1L2EA 1V2NT 2BQWB 5GCHG 2BD2A 3MNBA 1FIZA 1YPKH 4I32A 4A1XA 2AS9A 2OTVA 1V3XA 3SZNA 1QRXA 5JBCS 1KTSB 2SNVA 1UK3A 1V2MT 4D76A 5I46H 1BITA 1C2KA 1YCPK 3LPRA 1QIXB 3HGPA 1MCTA 3S9AA 1T4VH 1O38A 2ZFQH 5G4BA 3RXUA 4CREA 1GBFA 2SGAA 1HDTH 4ZUHA 1H8DH 2O8TA 1MQ6A 3UPEA 1NFXA 2FIRH 1PPBH 1G2LA 3ATWA 4MPWA 3SGQE 1D4PB 1G36A 2J38A 3SUGA 3OY6U 1AZZA 2TGPZ 1GI9B 2VIDA 1C2LA 3LT3A 1V2KT 1VJAU 6GCHG 5DP5A 1HV7A 2FEQH 3T26A 2A7CA 1P12E 4AGKA 1TGNA 4WXIA 4A1TA 1CT2E 4J1YA 2O9QA 3DD2H 1K21H 1SVPA 1FN8A 2XC0A 1GMCG 2ODYB 2ILNA 1VCWA 3TPIZ 1GMHF 2ZPSA 1YP9A 4YLUA 3SJIA 5JPMH 1ESAA 1BCUH 2V3HH 2FOFA 1H9LB 1NESE 5FBEA 1P2QA 3A7WA 3QWCH 1EOJA 2EEKA 1TPAE 1A1RA 1ANBA 3E91A 1O3HA 2FODA 2FMJA 1ETTH 2ZQ2A 1NS3A 3ZZ9A 3UWJH 3Q3KA 1DPOA 5TJXA 4YOIA 3RMOH 1UCYK 2TGDA 2WPJS 1SB1H 1SFIA 1A5HA 1S85A 1SLUB 2OP9A 4X1PU 5DPAA 5JDUB 3VEQB 4CRBA 1GBDA 3FZDA 5FCRA 3T62A 4Q7ZA 1OYTH 5L2ZH 1LPKB 1HFDA 2BYAX 5PTPA 4MPXA 3FANA 2XRCA 3GY3A 2ZC9H 2ZG0H 3D49H 1AFQC 3RLWH 3PLKA 2Q6GA 2WYGA 1LHGH 1VZQH 1C5WB 2ZDNA 1TX6A 1GI0A 1KLTA 3SO3A 1EAUA 8GCHF 3TJOA 1QGFA 1GJ9B 2AEIH 3Q77A 1C4Y2 4ABBA 4AX9H 3D62A 3S0NA 2QF3A 1ELGA 3GYMA 1FY5A 3BTTE 3RU4E 1BUIA 4UFFH 1MMJN 2BM2A 5LPEA 1P11E 5EU8A 2XWAA 1TALA 1ZJDA 1O3IA 2CV3A 3S69A 4SGBE 4O97A 1YPMH 1ELAA 4CR9A 2PUXB 4B75A 1DUAA 1YPJH 4QT8C 3RXOA 2BDYA 1HAHH 2ZIQH 2BZAA 1Q31A 2P16A 1KY9A 1MTNB 2XYAA 1O2KA 1TLDA 3BTHE 1NC6A 4AG1A 2CF9H 4O9VA 2FOHA 1QA7A 2R2WU 2XNIA 4OS7A 1VGCC 3A84A 4AB8A 1QFKH 1P2IA 2FOCA 2P3TB 4GCHF 3KQDA 1ZHMA 1IHSH 2G8TA 1A3EH 1NZQH 1EX3A 2R3UA 4NSYA 1K1OA 4LZ4B 1OP0A 1YPEH 2R0LA 1O3OA 1ZPZA 3PMBB 3WY8A 1V2WT 1F7ZA 2Q6DA 2BY9X 1YPLH 1RTKA 1FAKH 1TOCB 2Z6BD 2ULLA 5ABWA 1HAGE 5TCAA 1O2UA 4NCYA 2ZI2H 1C1WH 4UFEH 1EB2A 1MUEB 1ZLRA 5AVDA 1A3BH 2BVSH 2YNAA 4Z0KA 3IITA 2ZHQH 4X2WA 4GSOA 3SNEA 1OPHB 1GHZA 1O2TA 1O2ZA 1ZPBA 1CGHA 3CS0A 3K2UA 1ACBE 1BDAA 3NCLA 2Z9LA 2G81E 3GOVB 1TA6A 1V2PT 3O8DA 1BRBE 4Y11E 4H6SB 2PSYA 4AFZA 4Y0ZE 1V2TT 3VFEA 2OINA 3TLOA 4INHA 2PKSC 4E05H 4CH2B 1UCYH 3ZZBA 3MYWA 4JZFH 4YM9A 2KAIA 1C2JA 2AERH 2Y5GA 1OKXA 1GL0E 1FY4A 4B73A 1HLTH 1W13U 1TMUH 4OS1A 2CHAB 4RSPA 1GMDG 1BMMH 2ZHDA 5FX6A 2K1QA 4XBBA 3UWIA 1NFYA 1A7SA 5CHAC 2G5NA 2VIPA 2W26A 1YM0A 4NIXA 1EZQA 1DXPA 3TVJB 1GI1A 1SGQE 3SNAA 1GBTA 2H2ZA 1C5SA 1PFXC 3P95A 1DUEA 2BD7A 2QGRA 1BB0B 1QY6A 2C8WB 2VGCC 1EZXC 2ZA5A 1INCA 3VXEH 2FZZA 3SHCH 4I8JA 1S84A 1IQJA 1FDPA 5E2PA 4MG3A 3TIUA 2A5AA 1BRUP 3EA9A 2CF8H 1EXFA 4CR5A 3GDUA 3RMMH 7GCHG 2BXUH 2TIOA 1LVBA 4Q2KA 5E8EH 1K1LA 1HGTH 1SGRE 2HPQH 4X8TH 1Z8JB 3ZZ4A 2V35A 4TYDA 1FAXA 3RLYH 3GICB 1AE5A 3P6ZB 1QR3E 1O2SA 1H9HE 3UY9A 4ZHLU 3AVZA 1WOFA 5JBTA 4ISLA 2FYQA 8ESTE 1J9CH 1P2KA 2ODPA 1LO6A 4OS5A 1SQAA 5IDKA 1EKBB 1FY1A 1F0SA 2WPLS 1E35B 4KKDA 1O31A 2NU0E 3B23B 4NFEA 3V3MA 2BZ6H 2TGAA 1HXFH 1TONA 1XUGA 1LHEH 2GZ7A 3F9EA 1MTSA 2Y5FA 2RDLA 4KELA 2A4RA 1PPZA 3A81A 1O2WA 2CJIA 1TGBA 4Q80A 3KIDU 4Y10E 4R0IA 1O5AB 5GWZA 1UTLM 4Z6AH 3A85A 1S81A 4X8UH 4ASHA 1C2HA 1QRZA 4WVPE 1OWDA 2BX3A 2FOGA 3ZZDA 3N7OA 4I8KA 3EDXB 2ZGXH 3DHKH 5J4QA 1TGTA 1G32B 2BLWA 2UWOA 1YGCH 5DO4H 1HB0B 1VITG 4IMQA 2V3OH 3ZV8A 2VWNA 3QTOH 1C9PA 1GI3A 1LTOA 4JK6A 5EW2H 4DIHH 1FNIA 2LPRA 3VXFH 4X2XA 1RTFB 1QTFA 6CHAB 1HAOH 2JKHA 5GJ4B 1JBUH 3RXDA 2IJOB 3SN8A 1BHXF 1ZTKA 1UMAH 1OWHA 3MNCA 1GBIA 1DS2E 1C5VA 3GCNA 4CHAC 1BTWA 1OWJA 1OP2A 1EPTB 1GDNA 1GBAA 3F6UH 4X8SH 4JYUH 4B2CA 2QC2A 3GCHB 2QY0B 1FZZA 2C3SA 1JIRA 4BANB 1YYY1 3SU4A 2CMYA 5DP7A 1D3TB 1O2IA 2VVCA 5FHTA 1FN6A 5HMAA 1Y3WA 1C2GA 1K2I1 1TQ7B 4GPGA 4JYVH 4ZKNU 3TITA 2AYWA 4DOQA 1IOEA 1GMHG 1O2NA 3ATIA 1BBRE 4ISIH 2D2DA 3OSYA 2AH4X 5JYIA 1HPGA 7ESTE 4AYYB 1OXGA 4I33A 1SGEE 1IQLA 3ZZCA 2FLRH 1ZOMA 1WU1A 2FOAA 2Q6FA 1SHYA 3ZYEA 4CBOA 5CE1A 1UHBA 2UWPA 1E38B 2ZDAH 3MH6A 3T29A 4AFQA 2GD4B 4FVDA 2F83A 2UWLA 3EA7A 3MTYA 4Y8ZA 8LPRA 1TABE 1SG8B 3Q3XA 1K1PA 2F9BH 1EJNA 2FTLE 3ZZ7A 4GHTA 3VB3A 1GHAG 5DP3A 1H9IE 1W7XH 2UUFB 3TNTA 4ABEA 3MO3A 1CO7E 5CMXH 2HGTH 1O3JA 3UQVA 5C1XA 3MU1A 1TBQH 3LDXH 3SJ8A 2A4OA 1GJ7B 4IC5A 2VH0A 1P09A 3TGKE 1TGCA 1ZPCA 1P05A 2AIQA 2BDHA 3KQBA 2G4UA 2A5KA 1D6RA 1HCGA 1ID5H 1TNGA 1RRKA 4X0WU 1O3LA 1XVMA 3U1IB 1P02A 2VWLA 4ABGA 5DP8A 3LONA 1FUJA 5A8XA 4A92A 1LKAA 1TOMH 4BAMB 1SC8U 1O3EA 2ANKH 3K65B 1GBJA 1GJ8B 3M3SA 4H6TA 1AQ7A 6GCHF 3E0NB 3FP8E 1SMFE 4Y8XA 2PW8H 4JYTA 1L1GA 3ZVCA 2HVXA 1QHRB 1JMOH 5HM9A 5L6NH 3MO6A 3UNSA 2NU3E 2ZPRA 1MU8B 1PPHE 3E8LA 4JZDH 1BTUA 1SGPE 4YOJA 2B9LA 1THSH 2BDCA 2FS8A 1BBRK 1RJXB 2VU8E 2A31A 1AU8A 1P0SH 4I8LA 1DWCH 5FXLA 3H7OA 2F9VA 3FZZA 1V2OT 4HFPB 1MU6B 2ZFFH 2XBXA 2WV5A 4YOGA 4IMZA 5EXMA 1O2VA 1SGDE 2A0QB 1GBMA 1BTXA 1ZSKA 2XW9A 1SHHB 4WJG2 1AWHB 1A61H 4U2WA 1YPHC 1CSOE 1C1VH 5EQRA 1O36A 3VGCB 2F9UA 2YNBA 4FUCA 1K22H 3SU1A 1P2JA 5BRRE 1WTHD 4XDEA 1E34B 2QXJA 3MOCA 1OYQA 3SU6A 2BMGB 4H42U 3HGNA 1MBMA 1HIAB 2VWMA 1N6XA 4A7IB 4O3TA 1O2QA 2O8MA 3EGKH 1DFPA 1KLJH 4ABDA 3RC6A 5C5NA 1ZSJA 1ZGVA 1NRRH 3QTVH 7KMEH 1B7XB 2ZFPH 8GCHG 2BY8X 2H5CA 4IN1A 2OD3B 3RXHA 4ZXYH 1GVKB 1IQHA 1V2VT 5LH8A 1QL8A 2STBE 5GIBA 4KP0A 4AOQA 5HM2A 1O5GH 3SGBE 1IQMA 4NIWA 1AKSB 2BHGA 1O35A 2F91A 2ZU3A 5E0JA 1HNEE 2Z3EA 1FIWA 4BAKB 1GI5A 1O2JA 1S83A 2ZCLP 1UK4A 2CXVA 3FVFB 3A83A 5T6FA 3TH4H 4DURA 1AN1E 1BTYA 1QB1A 1KYNA 1SGCA 3M7UA 1Y59T 4WWYA 1DSUA 1QJ1B 3VGCC 1P3EA 2FI4E 2A2XH 4LZ1H 1FQ3A 3E1XB 2RA0A 4A1VA 1GHAF 1AIXH 3A8CA 4ISNA 1A0JA 1UO6A 3TJUA 3BTGE 2XBVA 2NU2E 3QGNB 5CHAB 2H6MA 3D65E 3W94A 3MMGA 7LPRA 3T5FH 3KL6A 4DW2U 3V0XA 1V2RT 3R0FA 1T7CA 4DJZB 3MO9A 3RXSA 2P95A 4UONA 2VJ1A 3CS7A 9ESTA 1AE8H 1MQ5A 3SV2H 3S7KB 1DICA 3RMNH 3LGVA 1Y3UA 3AAVA 2F9NA 3TK5A 2HRVA 2GTBA 4X2YA 2DUCA 5DJ7A 4D8NA 3RXCA 2BDBA 2FI5E 1P2NA 3PMAB 2ANYA 2D26C 2WINI 3BTQE 3SNBA 2Z7FE 5IYTA 4B2AA 2PWXA 2BY6X 4F49A 3VB4A 3LJJA 1NRPH 2FM2A 5DG6A 3HK3B 4Y7AA 1BMAA 2AGEX 1EATA 2EC9H 4AZ2B 3ITIA 4DGJA 1Q2WA 5DGJA 3DFJA 1Z1JA 1EAXA 1CA0B 1UHBB 4Y6DA 2BLQA 2G51A 2C8XB 5A09A 1BIOA 1CGIE 2EI8A 1BJVA 1XM1A 1MKXK 5EGMA 2VVUA 1ZSLA 1EASA 4XE4A 1J15A 3A7ZA 3U9AH 3HK6B 2WPIS 3CP7A 4NIYA 1GMCF 4NFFA 4UD9H 3ZVGA 2BDGA 4NG9H 1GJ4H 1IQFA 3LH3A 2ZGHA 1O5CB 3LU9B 1F0UA 2OLGA 1CE5A 1QBVH 3IG6B 3RXLA 4FUIA 1PPEE 1C2IA 1PQ5A 3PWBA 3BIVH 1BRAA 4I7YH 1THRH 5A8YA 1AVGH 3UFAA 4MQAA 1XMNB 3SU3A 5JBAS 3L3TA 2BD5A 1C5RA 2UUKB 4JZEH 4IC6A 3BTME 2G5VA 4TPIZ 2BOKA 4BXWA 4CRFA 1ZTJA 4Y71A 1CU1A 1PQ8A 1TPPA 1AWFH 2GV6A 1MTNC 4ZROA 3Q3YA 1N8OC 3RM2H 4BAHB 1AUTC 3GY4A 2WV4A 1D3PB 7GCHF 1PPGE 4IBLH 3S9CA 3RU4D 2GZ8A 4E7NA 1O3BA 1AVXA 1C5TA 5F8XA 1S5SA 4MVNA 3TNSA 4ZHMU 2PHBA 1TX8A 2ZDVH 2OC1A 1S82A 2ZP0H 1Q3XA 1VCPA 1LHFH 3M7TA 1ZRBA 1GJAB 1Z8GA 1ELFA 1QRWA 2FESH 2QXIA 2Z9GA 1ANEA 2IPHA 4MNXA 1G3BA 2Y80A 1YLCA 3B8JA 1HRTH 1UTOA 1MCVA 1L1JA 4BAQB 1FY8E 1KSNA 1S0QA 1K1IA 1ELEE 1F0TA 2RA3A 3BV9B 2FO9A 4IN2A 4ISOA 2ZNKH 4WH6A 2V6NA 1ZYOA 1W2KH 1WV7H 2ZPQA 2SGPE 3B9FH 5J4SA 1NROH 2B7DH 1C5YB 2ZF0H 4UE7H 2FOBA 2PR3A 1LVYA 1WAYB 5L30H 3V12A 1HUTH 4FUGA 1DVAH 2AMDA 1T8OA 2KAIB 1O3DA 1JWTA 3SUFA 2ZFSA 4ABFA 3MH4A 4CRAA 1MKWK 1QA0A 1NT1A 1VJ9U 2ASUB 3SV8A 1S6FA 3AW1A 1FPCH 1T31A 1YCPM 1AFEH 1FI8A 2J92A 5BPEA 1ZZZA 3UUZA 3SORA 1MTWA 3RXTA 1U6QA 3ZZAA 2FOEA 1BTZA 1NRSH 1GHYH 1TNLA 1P8VC 1V6DA 2J4IA 1EUFA 2GDEH 3ATLA 4Y0YE 5EPYA 4BOHA 5C2ZA 1BTPA 3ZV9A 1C1PA 3RXAA 4GHQA 2Y7XA 3A88A 3O8CA 2PGQB 1QCPA 2GMTB 4X1RU 3RXFA 1GCTC 1SOTA 3PMJA 1CHGA 2VH6A 1K1NA 1AHTH 3BTKE 3S9BA 3TH2H 3NWUA 4X6NA 2ZHEH 1W3CA 1D3DB 4XSKU 5FAHA 3RXEA 2GT8A 1CQQA 1UCYE 2SGEE 1O3MA 1UVTH 3KCGH 3F68H 3GDSA 1XUJA 1O5DH 4ZMAH 3UNRA 1PJPA 1H1BA 1WYKA 5LPRA 1O30A 3SJOA 2GMTC 1ESBA 4BAOB 3A7TA 5EW1H 1P57B 5C3NA 5A0AE 2A32A 1HIAA 1GI6A 1P9SA 2QXHA 3BTWE 3GDVA 3STIA 2BVRH 1TMBH 1V2LT 2I6QA 1EZSC 2XC5A 1GCDA 1TRMA 4ZHAA 4AB9A 1EOLA 4ZH8A 6CHAC 1GHXH 3VB5A 3EE0B 3L6PA 4MNVA 3KHVA 1TE0A 3HKJB 1C2FA 1XKAC 1EB1H 2BQ7B 1C4V2 5AFZH 3M35A 2SGQE 4ABAA 1XUIA 2BDAA 5ESTE 1PPFE 3PO1C 1DWDH 1C2DA 1MTVA 2D8WA 5C1YA 3PTBA 3L33A 1TWXB 1SGTA 4RN6A 1DM4B 1GBLA 2BY5X 1ZMJA 3UOUA 3RXQA 2ALPA 1AVWA 3RXBA 1FJSA 2GZ9A 2PKAA 1XX9A 3JZ1B 1DWEH 2RCEA 1JXPA 2STAE 1FMGA 2ZCKP 3W95A 2BY7X 1O2GH 3DFLA 4M7GA 3QDZB 3M5LA 3E3TA 1PQAA 2P93A 1XUKA 2OBQA 2V0BA 1PYTD 2VB0A 5HGGA 5C67A 1PYTC 1J14A 1F5KU 1KXDA 3RXMA 4YZUA 1EP6A 1UVSH 1O5BB 3RXRA 2GCTB 4DT7B 3HPTB 3EQ0H 4JCNA 1XVOA 1P01A 4NIVA 3PROA 3PB1E 2ZHFH 2BD9A 1T8LA 1Z1IA 2JH6D 4OGYA 2FXRA 3MH7A 3M5NA 3F9HA 5DP6A 3SI4H 3ZVEA 3JZ2B 1JRSA 1ELDE 3VPKA 5C20A 1M9UA 4CRDA 2ZGJA 4X1QU 1GGDC 1SGIB 1G37A 1W0ZU 2C93B 4KTCA 4NZLA 2AFQB 1RXPA 1CA8B 1UVOA 2G4TA 1O37A 1JRTA 3GCTG 1NN6A 3TK6A 3V7TA 1F2SE 3OYPA 3VB6A 1C9TA 2WPMS 2ZECA 3RDZA 1IQEA 1HJAC 2BX4A 1HAZB 3AASA 1MAXA 2XC4A 1EAWA 4UEHH 4CHAB 1B5GH 2ESTE 4HI3A 3OY5U 1K1JA 4MPVA 3VB7A 1UTMA 1BJUA 1P04A 3FP6E 1LQEA 1OP8A 1BOQA 5F6MA 1C4U2 1QQ4A 1ZR0A 1SLWB 3MU5A 1ARBA 1MBQA 5L2YH 3AAUA 4ZXXH 4X6OA 2XBWA 1GDQA 2W3IA 3AW0A 2Z9IA 1AZ8A 2Z3CA 2Y5HA 3GY6A 1GI7B 2PTNA 3F1SB 4WF8A 1DDJA 2P8OC 3M7QA 2PFEA 2WPKS 2FX6A 1C2EA 1TIOA 3A89A 2O8WA 3FFGA 1DE7H 4E7RG 2OC0A 3F9GA 2UUJB 3K6ZA 1GBEA 2PUQH 2ZQ1A 5F8ZA 3BTFE 3EA8A 4JZ1A 1RIWB 4TY6A 1BRCE 3GCHC 5EXNA 1TPSA 3KQCA 1EPTC 2C90B 4ZKSU 1MKWH 2PKSB 1LMWB 2GVFA 2Y82A 1W12U 2JETB 4WMEA 1P9UA 2BXTH 4B71A 5EOKA 3SW2B 1C1MA 1FPHH 1O2HA 3M5OA 2XTTB 1N6YA 5AF9H 2WUBA 1MZDA 1A0HB 2Y6TA 1Z7KA 1V2JT 2ZGCA 2VWOA 3TK9A 4MNYA 3MFJA 1ELCA 1UVUH 4YO9A 5I25A 1A2CH 4AORA 4B2BA 1ZRKA 3SV9A 2RG3A 1GBBA 4D9QA 1ZMNA 1QQUA 4FUJA 1TQ0B 2VIWA 2H5DA 1NFWA 5DKMA 3SV6A 1GBCA 3LGIA 1DITH 2GDDA 1Z6JH 4X6MA 1SFQB 3K6YA 1TGSZ 1O3KA 1CT4E 1GHBF 4D9RA 1SR5C 3NUMA 1F92A 2C8YB 2J94A 3TH3H 3FP7E 2R0KA 1HAVA 3ATKA 3LIWA 1RTLA 1ESTA 4GVUA 4FUBA 3BSQA 4DG4A 2R3YA 1J17T 2ANWA 4X8VH 4LOYH 1X7AC 1D9IA 4ZKOU 5FPSA 4LK4A 1C1RA 3OU0A 2ZDMA 1IAUA 4LXBH 3NXPA 4FU9A 3QUMP 1UTKA 4X1SU 2IOTA 2ZU1A 2R2MB 1XKBC 1Z8RA 1UTJA 1NTPA 1TFXA 4Y79A 1QBOA 2PV9B 1THPB 2CHAC 1WTGH 3PM3A 3OX7U 5DK1A 1MH0A 1NRNH 3OTJE 2JH0D 4FUDA 1GPZA 2EA3A 1NFUA 1QJ7B 2A7JA 3H5CB 2Y7ZA 3A87A 3PTNA 1TRNA 4RKOB 3GCTF 1EZUC 1YPGH 4J2YB 1TB6H 4Y7BA 1G9IE 2WPHS 1GHBG 1AY6H 1SLVB 2A5IA 1UTNA 4MDSA 2ANMH 3QZQA 2QA9E 2ZWLH 1BHXB 4MLFB 3CENA 1DY9A 3QLPH 1ETSH 3T27A 2CGAA 4JK5A 1UK2A 2A1DB 5F03A 4NA8A 4K3JA 4YTAA 3V13A 1GDUA 3A8AA 1AKSA 2P3FH 4KTUA 1J8AA 1VR1H 4O3UA 1O2YA 2HLCA 4A5TS 4OGXA 1HYLA 3KN2A 5LGOA 3KNXA 2BD4A 2B0FA 1ELVA 1NY22 1SGFA 1SSXA 1G3EA 3NZIA 1O5EH 5EG4A 1G2MA 1S6HA 3RXJA 1CBWC 1NU9A 1P06A 3E6PH 1EAIA 1EPTA 1A0LA 2HWLB 3DA9B 3ODDA 2OBOA 1O3NA 1J16A 4BTTB 3TU7H 1Y5AT 4SGAE 3A8BA 1GGDB 4B74A 1T8NA 1W11U 3HATH 1MAYA 1W8BH 2B8OH 3UR6A 2OQUA 2AMQA 4GAWA 4BTUB 3A7VA 1KXCA 1FONA 4GUXA 2GGVB 5AHGH 1ZHPA 3BG4B 3GY2A 2D1JA 1A5IA 4GLYA 2GT7A 3RU4T 4NZQA 3SI3H 3RMLH 1B0EA 1AI8H 2TPIZ 3QN7A 1TNIA 4INLA 1GVLA 1C5MD 3SU5A 2OCVB 2VIOA 2W7SA 5FPYA 3TJVA 1RFNA 4UDWH 1TA2A 4O03A 4NWLA 3BN9A 3ZVAA 3S7HB 1O2PA 3SUDA 5JB8S 1FV9A 1KXFA 5A8ZA 2ZZUH 4Y76A 3NKKA 1SQOA 3SJ9A 2Y81A 5GPIB 2ZU5A 3Q00A 5C1UA 2ZKSA 3TGJE 1TYNA 1C1QA 1RD3B 1O2RA 2SFAA 1BMNH 5K7RA 4FUHA 1D3QB 1AGJA 3PYHA 2GP9B 2BLOA 1O5FH 4IGDA 3A80A 1OSSA 3BEFB 1C2MA 1Y3XA 3QX5H 2QF0A 2ZTXA 3LOXA 4TWYA 1O3CA 3M36A 3RP2A 3ZZ8A 1NU7B 1C1TA 4FU8A 4ZAEA 1WBGB 4K1EA 3MHWU 3GY7A 1O0DH 1O3GA 1WUNH 2EI6A 1TMTH 3IWMA 5JB9S 4OS2A 1NPMA 3RXPA 1C5QA 2XWBI 3ELAH 1O3FA 1SLXB 1OX1A 4NWKA 3NK8A 2VIQA 3DT0H 1A46H 1GVZA 3A82A 1WSSH 3SBKA 1E36B 3SU0A 1KDQB 1HAXB 1AMHA 1IQGA 2H9EH 3BEIB 2BD8A 1GG6B 3M3VA 3RXVA 1P2MA 1YCPH 6LPRA 3ZVBA 4YT6H 1QBNA 2GX4A 2NWNA 1CHOG 4IW4E 2O8UA 1AFQB 4U32A 3SJKA 1DY8A 1RGQA 3LJOA 6ESTA 3GY5A 1A5GH 3P17H 4NGAH 2Z9JA 4TY7A 1ZHRA 1KLIH 1O3AA 3UNQA 2QN5T 1JIMA 3K9XB 2AGGX 4AYVB 3RUOA 2PTCE 1AUJA 5T6DA 3MWIU 1PPCE 4ESTE 3P8GA 1FXYA 5JBBS 5HXFA 1C5LH 1DLEA 2SNWA 2OUAA 2LNCA 3ZVFA 2J2UA 2HPPH 4UFDH 3Q76A 1O34A 1PQ7A 3I77A 1OOKB 1OWKA 2EI7A 3RXGA 4Y8YA 1HJAB 1NO9H 9LPRA 3ODFA 1L4DA 3R3GB 1LHDH 3GY8A 1TAWA 1KIGH 1Y3VA 3SNCA 1SGFG 1GL1A 2BVXH 1V2UT 2DE9A 3STJA 1GJBB 1GJDB 2TGTA 3SQHE 1LKBA 5FCKA 2F9PA 3C27B 1TRYA 2Z9KA 1GBKA 1SPJA 1DOJA 2NU1E 1W14U 2C4FH 3P70B 2TBSA 3PWCA 1YF4A 3U8RH 2J9NA 3BF6H 3SGAE 4A6LA 1L4ZA 1QB9A 1DLKB 2CN0H 1AD8H 4I31A 3A7XA 2ZDLA 3A7YA 1HAPH 3KEEA 4Q7XA 1WQVH 2G55A 1GMDF 3T28A 2ZDKA 5EPNA 2WYJA 2J95A 1BBRH 3ZVDA 2NU4E 5DP9A 1H4WA 3QZRA 2GCHF 1E37B 3ENSB 4DY7B 1GJ6A 2BLVA 3UTUH 1FLEE 2FWWA 2H1UA 1XXFA 2AIPA 3LKWA 5F8TA 3LGWA 4INKA 1LPGB 2OC8A 3F9FA 4FXGH 4K8BA 1GI8B 3O8RA 1DX5M 1ZTLA 3ZZ5A 2ZO3H 2Q1JA 1ZJKA 5GCHF 1MD7A 1HJ8A 2W5EA 1MZAA 3LH1A 1S0RA 1BTHH 2VVVA 5E0HA 1NRQH 1FY3A 3SUEA 3PO1B 2VGCB 1EJAA 4AGJA 3MH5A 4B76A 3O8BA 1YLDA 1BQYA 1W7GH 4TWWA 5EQQA 1ELTA 1XXDA 2ODQA 4XFQA 2H9TH 1OWIA 4WH8A 2OQ5A 1T32A 4ABJA 3I29A 1C5PA 4KGAA 4ABHA 2ZGBH 4X6PA 1B0FA 2A45B 2IN2A 1O2XA 2GCHG 4K1TA 1BMLA 1TNJA 4FUEA 4Q7YA 1OWEA 3URDA 1F5LA 2FS9A 2WUCA 3A8DA 8KME2 1C5UA 1GI4A 4F4OC 3LC3A 1KXBA 2ZFTA 1Z6EA 5H4IB 2FX4A 3U69H 2FP7B 1ELBA 1P03A 3KQEA 1YPHE 5EQSA 1VITH 1OS8A 1SGYE 2A2QH 1N1LA 4U30A 3FAOA 4K5ZA 4RKJB 4CRCA 2ZHWH 1SGNE 1Z71A 1ABIH 1GHWH 1GCTB 3SU2A 1ETRH 1CA0C 1EP5A 3U1JB 1LQDB 3KGPA 1LHCH 3UIRA 1QB6A 2O8LA 1SL3A 1CHOF 2HNTF 2G00A 1L1NA 4ISHH 1LDTT 3GYLB 4NA7A 2PGBB 4HZHA 5EODA 4AFSA 1C1SA 4JZIA 5AFYH 2XCFA 5K0HA 4TPYA 1LCYA 4CBNA 5GDSH 4XBCA 1CGJE 2H9HA 2QYIA 1BZXE 3BTDE 3E0PB 1CBWB 2HOBA 4YLQH 4BXSA 4DCDA 1QL7A 1GJ5H 3G01A 3D23A 1XUFA 1TBRH 4K69A 1CT0E 4VGCC 2FOMB 2P59A 5TCCA 2BQ6B 1VGCB 2F3CE 2BOHB 5T6GA 1DWBH 1MD8A 1V2QT 1HAYB 3ZZ6A 2B5TB 1KXEA 1XUHA 2TRMA 2VINA 2QIQA 1G3CA 2FPZA 2BTCE 1C5OH 4FUFA 3DUXH 1BA8B 1TBZH 4JMYA 1C1OA 1EJMA 1TX7A 3MU8A 1Y3YA 2BB4A 3PV4A 2QXGA 2PSXA 1F5RA 1SI5H 2J34A 1O3PB 1QNJA 1T4UH 1P10A 2ZTZA 4HGCA 4OS4A 2GCTC 2AMPA 1QURH 2A4QA 4E06H 3BIUH 1TNHA 2XCNA 5HYOA 1DXWA 1RIWC 4HTCH 4NSVA 1D6WA 5ETXA 3TJNA 1HAVB 1O2LA 2HNTE 3H7TA 5B6OA 1LVMA 1TNKA 1K1MA 2HALA 4X2VA 2W3KA 1ARCA 5E2OA 1ABJH 2A4GA 2QV1A 1ANCA 3P8FA 4B1TA 1P3CA 2PLXA 4CRGA 1TPOA 1SQTA 4YT7H 4NA9H 2UUYA 1UTPA 3UREA 1HJ9A 2OC7A 4GCHG 1LPZB 1LVOA 1RS0A 3QO6A 1UTQA 1E0FD 4OS6A 1UJ1A 3P8OA 3ZYDA 3BTEE 3M5MA 2PKAB 1AB9C 3MU0A 1C5XB 1T8MA 4D7FA 4AG2A 1DANH 1AB9B 4WMFA 3URCA 2SGFE 4FU7A 4CH8B 1EQ9A 3A86A 2VIVA 4VGCB 1C1NA 3M3TA 2BDIA 3U98H 5A0BA 3SQEE 3M37A 3BG8A 1O39A 2FTMA 3PMHB 1YC0A 1W10U 3T25A 1C1UH 3SHAH 1JOUB 2A7HA 3PLPA 5GXPA 4KTSA 1L0ZA 2SGDE 4I8HA 4X1NU 1SOZA 3MNXA 3TGIE 4PROA 1UVPA 3QGJA 3RXIA 5T3HA 1GJCB 4THNH 1MKXH 2P94A 3GCOA 2Z3DA 4ZKRU 3RC4A 1DSTA 1ANDA 5E0GA 1Y8TA 1O2MA 3KF2A 1HXEH 1KDQA 1GHVH 4U01A 3U8OH 2JETC 2FLBH 1IQNA 1GG6C 1CVWH 4K1SA 3GISB 5FX5A 1NM6A 2HNTC 3MU4A 1K28D 5SGAE 2FI3E 2XBYA 3HKIB 1V2ST 4MNWA 2FDAA 5EXLA 1H8IH 1MTUA 3I78A 1YKTA 2YOLA 2F9OA 1KTTB 5ESBA 4H4FA 1WQSA 1O32A 2W7UA 2ZTYA 2Z94A 1GI2A 3LC5A 2ALVA 3NPSA 1AO5A 5A0CA 1ORFA 4ABIA 1VITF 1F0RA 1GWAA 4BNRA 1W0YH 4AFUA 1IQIA 3EYDA 5A2MH 3P8NA 4YESB 4XOJA 1YBWA 2GV7A 1G30B 1IQKA 1WCZA 4WMDA 4MTBA 2G52A 2THFB 3UOPA 3P92A
chains in the Genus database with same CATH superfamily
3DSPA 1HBTH 4R8TB 2GKVE 2FYRA 3T2NA 1C5ZB 5FPTA 1SBWA 3FKSD 5FBIA 4D7GA 4I8GA 4WXVA 3M61U 4TT3D 2KM0A 3BG4C 3U8TH 3LGUA 1Y5BT 1HAIH 2VNTA 4XBDA 2IJD1 3UQOA 1O2OA 2QCYA 2BD3A 3LGTA 5DP4A 1ZMLA 4AN7A 4UFGH 1YLNA 2C8ZB 2M5TA 1C5NH 1IHTH 4MPUA 2QAAA 3QK1A 1Y5UT 1Z8IB 3E16B 3N99A 2R9PA 3C1KA 3SOSA 2ZFRH 4RT0A 4WY3A 3RC5A 3ESTA 1QL9A 4K60A 1K9OE 3RM0H 3MNSA 1DT2A 1GBHA 4BTIB 2JH5D 1KXAA 2OXSA 3EAJA 3RXKA 4K8YA 3SNDA 1ZGIA 3UB0A 3MI4A 2AGIX 1QJ6B 2XXLA 4IS5A 3UR9A 5C5OA 2P8OB 3PLBA 1E1RD 3SV7A 3E90B 4FVBA 2P3UB 3F3BA 3ZZ3A 3ATMA 1BT7A 5LPFA 1N8OB 1P2OA 3BEUA 2I6SA 2ZEBA 3LGYA 2ZU4A 4DIIH 3NRLA 1G3DA 1A4WH 2DE8A 4DVAU 4K2YA 2ZCHP 2ZU2A 1VCQA 1O33A 2QF5A 1L2EA 1V2NT 2BQWB 5GCHG 2BD2A 3MNBA 2KX4A 1FIZA 1YPKH 4I32A 4A1XA 2AS9A 2OTVA 1V3XA 3SZNA 1QRXA 5JBCS 1KTSB 2SNVA 1UK3A 1V2MT 4D76A 5I46H 1BITA 1C2KA 1YCPK 3LPRA 1QIXB 3HGPA 1MCTA 3S9AA 1T4VH 1O38A 2ZFQH 5G4BA 3RXUA 4CREA 1GBFA 2J98A 2SGAA 1HDTH 4ZUHA 1H8DH 2O8TA 1MQ6A 3UPEA 1NFXA 2FIRH 1PPBH 1G2LA 3ATWA 4MPWA 3SGQE 1D4PB 5T1VA 1G36A 2J38A 3SUGA 3OY6U 1AZZA 2TGPZ 1GI9B 2KCOA 2VIDA 1C2LA 3LT3A 1V2KT 1VJAU 6GCHG 5DP5A 1HV7A 2FEQH 3T26A 2A7CA 1P12E 4AGKA 1TGNA 4WXIA 4A1TA 1CT2E 4J1YA 2O9QA 3DD2H 1K21H 1SVPA 1FN8A 2XC0A 1GMCG 2ODYB 2ILNA 1VCWA 3TPIZ 1GMHF 2ZPSA 1YP9A 4YLUA 3SJIA 5JPMH 1ESAA 1BCUH 2V3HH 2FOFA 1H9LB 1NESE 4DT4A 5FBEA 1P2QA 3A7WA 3QWCH 1EOJA 2EEKA 5DSFA 1TPAE 1A1RA 1ANBA 3E91A 1O3HA 2FODA 2FMJA 1ETTH 4F48B 2ZQ2A 1NS3A 3ZZ9A 3UWJH 3Q3KA 1DPOA 5TJXA 4YOIA 3RMOH 1UCYK 2TGDA 2WPJS 1SB1H 1SFIA 1A5HA 1S85A 1SLUB 2OP9A 4X1PU 5DPAA 5JDUB 3VEQB 4CRBA 1GBDA 3FZDA 5FCRA 3T62A 4Q7ZA 1OYTH 5L2ZH 1LPKB 1HFDA 2BYAX 5PTPA 4MPXA 3FANA 2XRCA 3GY3A 2ZC9H 2ZG0H 3D49H 1AFQC 3RLWH 3PLKA 2Q6GA 1NBME 2WYGA 1LHGH 1VZQH 3GS9A 1C5WB 1W0KD 2ZDNA 1TX6A 1GI0A 1KLTA 3SO3A 1EAUA 8GCHF 3TJOA 1QGFA 1GJ9B 2AEIH 3Q77A 1C4Y2 4ABBA 4AX9H 3D62A 3S0NA 2QF3A 1ELGA 3GYMA 1FY5A 5CHBA 3BTTE 3RU4E 1BUIA 4UFFH 1MMJN 2BM2A 5LPEA 1P11E 5EU8A 2XWAA 1TALA 3PV2A 1ZJDA 1O3IA 2CV3A 3S69A 4SGBE 4O97A 1YPMH 1ELAA 5IK2D 4CR9A 2PUXB 4B75A 1DUAA 1YPJH 4QT8C 3RXOA 2BDYA 1HAHH 2ZIQH 2IPQX 1Q31A 2BZAA 2P16A 1KY9A 1MTNB 2XYAA 1O2KA 1TLDA 3BTHE 1NC6A 3F2GA 4AG1A 2CF9H 4O9VA 2FOHA 1QA7A 2R2WU 2XNIA 4OS7A 1VGCC 3A84A 4AB8A 1QFKH 1P2IA 2FOCA 2P3TB 4Q63A 4GCHF 3KQDA 1ZHMA 1IHSH 2G8TA 1A3EH 2KCYA 1NZQH 1EX3A 2R3UA 4NSYA 1K1OA 4LZ4B 1OP0A 1YPEH 2R0LA 1O3OA 1ZPZA 3PMBB 3WY8A 1V2WT 1F7ZA 2Q6DA 2BY9X 1YPLH 1RTKA 1FAKH 1TOCB 2Z6BD 2ULLA 5ABWA 1HAGE 5TCAA 1O2UA 4NCYA 2ZI2H 1YY3A 1C1WH 4UFEH 1EB2A 1MUEB 1ZLRA 5AVDA 1A3BH 2BVSH 2YNAA 4Z0KA 3IITA 2ZHQH 4X2WA 4GSOA 3SNEA 1OPHB 1GHZA 1O2TA 1O2ZA 1ZPBA 1CGHA 3CS0A 3K2UA 1ACBE 1BDAA 3NCLA 2Z9LA 2G81E 3GOVB 1TA6A 1V2PT 3O8DA 1BRBE 4Y11E 4H6SB 2PSYA 4AFZA 4Y0ZE 1V2TT 3VFEA 2OINA 3TLOA 4INHA 2PKSC 4E05H 4CH2B 1UCYH 3ZZBA 3MYWA 4JZFH 4YM9A 2KAIA 1C2JA 2AERH 2L6OA 2Y5GA 1OKXA 1GL0E 1FY4A 4B73A 1HLTH 1W13U 5EJ1A 1TMUH 4OS1A 2KCAA 2CHAB 4RSPA 1GMDG 1BMMH 2ZHDA 5FX6A 2K1QA 2F4LA 4XBBA 3DCLA 3UWIA 1NFYA 1A7SA 1K0HA 5CHAC 2G5NA 2VIPA 3WW7A 2W26A 1YM0A 4NIXA 1EZQA 1DXPA 3TVJB 1GI1A 1SGQE 3SNAA 1GBTA 2H2ZA 1C5SA 1PFXC 3P95A 1DUEA 2BD7A 2QGRA 1BB0B 1QY6A 2C8WB 2VGCC 1EZXC 2ZA5A 1INCA 3VXEH 2FZZA 3SHCH 3DSGA 4I8JA 1S84A 1IQJA 1FDPA 5E2PA 4MG3A 3TIUA 2A5AA 2K0QA 1BRUP 3EA9A 2CF8H 1EXFA 4CR5A 2W6ID 3GDUA 3RMMH 7GCHG 2BXUH 2TIOA 1LVBA 4Q2KA 5E8EH 1K1LA 1HGTH 1SGRE 2HPQH 3MQKC 4X8TH 1Z8JB 3N7EA 3ZZ4A 2V35A 4TYDA 1FAXA 3RLYH 3GICB 1AE5A 3P6ZB 1QR3E 1O2SA 1H9HE 3UY9A 4ZHLU 3AVZA 1WOFA 5JBTA 4ISLA 2FYQA 8ESTE 1J9CH 1P2KA 2ODPA 1LO6A 4OS5A 1SQAA 5IDKA 1COWD 1EKBB 1FY1A 1F0SA 2JIZD 2WPLS 1E35B 4KKDA 1O31A 2NU0E 3B23B 4NFEA 3V3MA 2BZ6H 3KQ5A 2TGAA 1HXFH 1TONA 1XUGA 1LHEH 2GZ7A 3F9EA 1MTSA 2HLDD 4B6FA 2Y5FA 2JJ2D 2QF4A 2RDLA 4KELA 2A4RA 1PPZA 3A81A 1O2WA 2CJIA 1TGBA 4Q80A 3KIDU 2EY4C 4Y10E 4R0IA 1O5AB 5GWZA 1UTLM 4Z6AH 3A85A 1S81A 4X8UH 4ASHA 2WZQA 1C2HA 1QRZA 4WVPE 1OWDA 1OHHD 2BX3A 2FOGA 3ZZDA 3N7OA 4I8KA 3EDXB 2ZGXH 3DHKH 5J4QA 1TGTA 1G32B 2BLWA 2UWOA 1YGCH 5DO4H 1HB0B 1VITG 4IMQA 2V3OH 3ZV8A 2VWNA 3QTOH 1C9PA 1GI3A 1LTOA 4JK6A 5EW2H 4DIHH 1FNIA 2LPRA 3VXFH 4X2XA 1RTFB 1QTFA 6CHAB 1HAOH 2JKHA 5GJ4B 1JBUH 3RXDA 2IJOB 3SN8A 1BHXF 1ZTKA 1UMAH 1OWHA 3MNCA 4Q4LA 1GBIA 1DS2E 1C5VA 3GCNA 4CHAC 1BTWA 1OWJA 1OP2A 1EPTB 1GDNA 1GBAA 3F6UH 4X8SH 4JYUH 4B2CA 2QC2A 3GCHB 2QY0B 1FZZA 2C3SA 1JIRA 4BANB 1YYY1 3SU4A 2CMYA 5DP7A 1D3TB 1O2IA 2VVCA 5FHTA 1FN6A 5HMAA 1Y3WA 1C2GA 1K2I1 1TQ7B 4GPGA 4JYVH 4ZKNU 3TITA 2AYWA 4DOQA 1IOEA 3CNRA 1GMHG 1O2NA 3ATIA 1BBRE 4ISIH 2D2DA 3OSYA 2AH4X 5JYIA 1HPGA 7ESTE 4AYYB 1OXGA 4I33A 1SGEE 1IQLA 3ZZCA 2FLRH 1ZOMA 1WU1A 2FOAA 2Q6FA 1SHYA 3ZYEA 4CBOA 5CE1A 1UHBA 2UWPA 1E38B 2ZDAH 3MH6A 3T29A 4AFQA 2GD4B 4FVDA 2F83A 2UWLA 3EA7A 3MTYA 4Y8ZA 8LPRA 1TABE 1SG8B 3Q3XA 1K1PA 2F9BH 1EJNA 2FTLE 2J5UA 3ZZ7A 4GHTA 3VB3A 1GHAG 1W0JD 5DP3A 1H9IE 1W7XH 2UUFB 3TNTA 4ABEA 3MO3A 1CO7E 5CMXH 2HGTH 1O3JA 3UQVA 5C1XA 3MU1A 1TBQH 3LDXH 3SJ8A 4FETA 2A4OA 1GJ7B 4IC5A 2VH0A 1P09A 3TGKE 4TSFD 1TGCA 1BMFD 1ZPCA 1P05A 2AIQA 2BDHA 3KQBA 2G4UA 2A5KA 1D6RA 1HCGA 1ID5H 1TNGA 1RRKA 4X0WU 1O3LA 1XVMA 3U1IB 1P02A 2VWLA 4ABGA 5DP8A 3LONA 1FUJA 5A8XA 4A92A 1LKAA 1TOMH 4BAMB 5C0TA 1SC8U 1O3EA 2ANKH 3K65B 1GBJA 1GJ8B 3M3SA 4H6TA 1AQ7A 6GCHF 3E0NB 3FP8E 1SMFE 4Y8XA 2PW8H 4JYTA 1L1GA 3ZVCA 2HVXA 1QHRB 1JMOH 5HM9A 5L6NH 3MO6A 3UNSA 2NU3E 4HG6A 2ZPRA 1MU8B 1PPHE 3E8LA 2JJ1D 4JZDH 1BTUA 1SGPE 4YOJA 2B9LA 1THSH 2BDCA 2FS8A 1BBRK 1RJXB 2A31A 2VU8E 3WWFA 1AU8A 1P0SH 4I8LA 1DWCH 5FXLA 3H7OA 2F9VA 3FZZA 1V2OT 4HFPB 1MU6B 2ZFFH 2XBXA 2WV5A 4YOGA 4IMZA 5EXMA 1O2VA 1SGDE 2A0QB 1GBMA 1BTXA 4Z1MD 1ZSKA 2XW9A 1SHHB 4WJG2 3OE7D 1AWHB 1A61H 4U2WA 1YPHC 1CSOE 1C1VH 5EQRA 1O36A 3VGCB 2F9UA 2YNBA 4FUCA 1K22H 3SU1A 1P2JA 5BRRE 1WTHD 4XDEA 1E34B 2QXJA 3MOCA 1OYQA 3PRDA 3SU6A 2BMGB 4H42U 3HGNA 1MBMA 1HIAB 2VWMA 1N6XA 3FOAA 4A7IB 4O3TA 1O2QA 2O8MA 2LP6A 3EGKH 1DFPA 1KLJH 4ABDA 1EFRD 3RC6A 5C5NA 1ZSJA 1ZGVA 1NRRH 3QTVH 7KMEH 1B7XB 2ZFPH 8GCHG 2BY8X 2H5CA 4IN1A 2OD3B 3RXHA 4ZXYH 1GVKB 1IQHA 1V2VT 5LH8A 1QL8A 2STBE 3FN8A 5GIBA 4KP0A 4AOQA 5HM2A 1O5GH 3SGBE 1IQMA 4NIWA 1AKSB 2BHGA 1O35A 2F91A 2ZU3A 5E0JA 1HNEE 2Z3EA 1FIWA 4BAKB 1GI5A 4OM9A 1O2JA 1S83A 2ZCLP 1UK4A 2CXVA 3FVFB 3A83A 5T6FA 3TH4H 4DURA 1AN1E 1BTYA 1QB1A 1KYNA 1SGCA 3M7UA 1Y59T 4WWYA 1KMHB 1DSUA 1QJ1B 3VGCC 1P3EA 2FI4E 2A2XH 4LZ1H 1FQ3A 5HIYA 3E1XB 2RA0A 4A1VA 4ASUD 1GHAF 1AIXH 3A8CA 4ISNA 1A0JA 1UO6A 3TJUA 3BTGE 2XBVA 4P00A 2NU2E 3QGNB 5CHAB 2H6MA 3D65E 3W94A 3MMGA 7LPRA 3T5FH 3KL6A 4DW2U 3V0XA 1V2RT 3R0FA 1T7CA 4DJZB 3MO9A 3ZIAD 3RXSA 2P95A 1E79D 4UONA 2VJ1A 3CS7A 9ESTA 1AE8H 1MQ5A 3SV2H 3S7KB 1DICA 3RMNH 3LGVA 4ZCNA 1Y3UA 3AAVA 2F9NA 3TK5A 3W1EA 2HRVA 2GTBA 4X2YA 2DUCA 5DJ7A 4D8NA 3RXCA 2BDBA 2FI5E 1P2NA 3OEHD 3PMAB 2ANYA 2D26C 2WINI 3BTQE 3SNBA 2Z7FE 5IYTA 4B2AA 2PWXA 3WWBA 2BY6X 4F49A 3VB4A 3LJJA 1NRPH 2FM2A 5DG6A 3HK3B 4Y7AA 1BMAA 2AGEX 1EATA 2EC9H 4AZ2B 3ITIA 4DGJA 1Q2WA 5DGJA 3DFJA 1Z1JA 1EAXA 1CA0B 1UHBB 4Y6DA 2BLQA 2G51A 5CDFE 2C8XB 5A09A 1BIOA 1CGIE 1E1QD 5EJZA 2EI8A 1BJVA 1XM1A 1MKXK 5EGMA 2VVUA 1ZSLA 1EASA 4XE4A 1J15A 3A7ZA 2KZ4A 3HK6B 3U9AH 2WPIS 3CP7A 4NIYA 1GMCF 4NFFA 4UD9H 4ACBA 3ZVGA 2BDGA 4NG9H 1GJ4H 1IQFA 2EQNA 2ZGHA 3LH3A 1O5CB 3LU9B 1F0UA 2OLGA 1CE5A 1QBVH 3IG6B 3RXLA 4FUIA 1PPEE 1C2IA 1PQ5A 3PWBA 3BIVH 1BRAA 4I7YH 1THRH 5A8YA 1AVGH 3UFAA 4MQAA 1XMNB 3SU3A 5JBAS 3L3TA 2BD5A 1C5RA 2UUKB 4JZEH 3KYFA 4IC6A 3BTME 2G5VA 4TPIZ 2BOKA 4BXWA 4CRFA 1ZTJA 4Y71A 1CU1A 1PQ8A 1TPPA 1AWFH 2GV6A 1MTNC 2GJGA 4ZROA 3Q3YA 1N8OC 3RM2H 4BAHB 1AUTC 3GY4A 2WV4A 1D3PB 7GCHF 3OFND 1PPGE 4IBLH 3S9CA 3RU4D 2GZ8A 5KGOA 4RT1A 4E7NA 1O3BA 1AVXA 1C5TA 5F8XA 1S5SA 4MVNA 3TNSA 4ZHMU 2PHBA 1TX8A 2ZDVH 2OC1A 1S82A 2ZP0H 1Q3XA 1VCPA 1LHFH 3M7TA 1ZRBA 1GJAB 3PV5A 1Z8GA 1ELFA 1QRWA 2FESH 2QXIA 2Z9GA 1ANEA 2IPHA 4MNXA 1G3BA 2Y80A 1YLCA 3B8JA 1HRTH 5KECA 1UTOA 1MCVA 1L1JA 4BAQB 1FY8E 1KSNA 1S0QA 1K1IA 1ELEE 1F0TA 2RA3A 3BV9B 2FO9A 4IN2A 4ISOA 2ZNKH 4WH6A 2V6NA 1ZYOA 1W2KH 1WV7H 2L74A 2ZPQA 2SGPE 3B9FH 5J4SA 1NROH 2B7DH 1C5YB 2ZF0H 4UE7H 2FOBA 1SKYE 2PR3A 1LVYA 1WAYB 5L30H 3V12A 1HUTH 4FUGA 1DVAH 2AMDA 1T8OA 2KAIB 1O3DA 1JWTA 3SUFA 2ZFSA 4ABFA 3MH4A 2KCPA 4CRAA 1MKWK 1QA0A 1NT1A 1VJ9U 2ASUB 3SV8A 1S6FA 3AW1A 1FPCH 1T31A 1YCPM 1H8ED 1AFEH 1FI8A 2J92A 5BPEA 1ZZZA 3UUZA 3SORA 1MTWA 3RXTA 1U6QA 3ZZAA 2FOEA 1BTZA 1NRSH 1GHYH 1TNLA 1QZ8A 1P8VC 1V6DA 2J4IA 1EUFA 2GDEH 3ATLA 4Y0YE 5EPYA 4BOHA 5C2ZA 1BTPA 3UAIC 3ZV9A 1C1PA 3RXAA 4GHQA 2Y7XA 3A88A 3O8CA 2PGQB 1QCPA 2GMTB 4X1RU 3RXFA 1GCTC 1SOTA 3PMJA 1CHGA 2VH6A 1K1NA 4ACAA 1AHTH 3BTKE 3S9BA 3TH2H 3NWUA 4X6NA 2ZHEH 1W3CA 1D3DB 4XSKU 5FAHA 3RXEA 2GT8A 1CQQA 1UCYE 2SGEE 1O3MA 1UVTH 3KCGH 3F68H 3GDSA 1XUJA 1O5DH 4ZMAH 3UNRA 1PJPA 1H1BA 5C17A 1WYKA 5LPRA 1O30A 3SJOA 2GMTC 1ESBA 4BAOB 3A7TA 3PRBA 5EW1H 1P57B 5C3NA 5A0AE 2A32A 1HIAA 1GI6A 1P9SA 2QXHA 3BTWE 3GDVA 3STIA 2BVRH 1TMBH 1V2LT 2I6QA 1EZSC 2XC5A 1GCDA 1TRMA 4ZHAA 4YXWD 4AB9A 1EOLA 4ZH8A 6CHAC 1GHXH 3VB5A 3EE0B 3H09A 3L6PA 4MNVA 3KHVA 1TE0A 3HKJB 1C2FA 1XKAC 1EB1H 5DN6D 2BQ7B 1C4V2 5AFZH 3M35A 2SGQE 4ABAA 1XUIA 2BDAA 5ESTE 1PPFE 3PO1C 1DWDH 1C2DA 1MTVA 2D8WA 5C1YA 3PTBA 3L33A 1TWXB 1SGTA 4RN6A 1DM4B 1GBLA 2BY5X 1ZMJA 3UOUA 3RXQA 2ALPA 1AVWA 3RXBA 1FJSA 2GZ9A 2PKAA 1XX9A 3JZ1B 1DWEH 2RCEA 1JXPA 2STAE 1FMGA 2ZCKP 3W95A 2BY7X 1O2GH 3DFLA 4M7GA 3QDZB 3M5LA 3E3TA 1PQAA 2P93A 1XUKA 2OBQA 2V0BA 1PYTD 2VB0A 5HGGA 5C67A 1PYTC 2XOKD 1J14A 1F5KU 1KXDA 3RXMA 4YZUA 1EP6A 1UVSH 1O5BB 3RXRA 2GCTB 4DT7B 2XNDD 3HPTB 3EQ0H 4JCNA 1XVOA 1P01A 4NIVA 3PROA 3PB1E 2ZHFH 2BD9A 1T8LA 1Z1IA 2JH6D 4OGYA 2FXRA 3MH7A 3M5NA 3F9HA 5DP6A 3SI4H 3ZVEA 3JZ2B 1JRSA 1ELDE 3VPKA 2KFWA 5C20A 2PP6A 1M9UA 4CRDA 2ZGJA 4X1QU 1GGDC 1SGIB 1G37A 1W0ZU 2C93B 4KTCA 4NZLA 2AFQB 1RXPA 1CA8B 1UVOA 2G4TA 1O37A 1JRTA 3GCTG 1NN6A 3TK6A 3V7TA 1F2SE 3OYPA 3VB6A 1C9TA 2WPMS 2ZECA 3RDZA 1IQEA 1HJAC 2BX4A 1HAZB 3AASA 1MAXA 2XC4A 1EAWA 4UEHH 4CHAB 1B5GH 2ESTE 4HI3A 2V3MA 3OY5U 1K1JA 4MPVA 3VB7A 1UTMA 1BJUA 1P04A 3FP6E 1LQEA 1OP8A 1BOQA 5F6MA 1C4U2 1QQ4A 3AK5A 1ZR0A 1SLWB 3MU5A 1ARBA 1MBQA 5L2YH 3AAUA 4ZXXH 4X6OA 2XBWA 1GDQA 2W3IA 3AW0A 2Z9IA 1AZ8A 2Z3CA 2Y5HA 3GY6A 1GI7B 2PTNA 3F1SB 4WF8A 1DDJA 2P8OC 4XD7D 3M7QA 2PFEA 2WPKS 2FX6A 1C2EA 1TIOA 3A89A 4I86A 2O8WA 3FFGA 3N7DA 1DE7H 4P02A 4E7RG 2OC0A 3F9GA 2UUJB 3K6ZA 1GBEA 2PUQH 2ZQ1A 5F8ZA 3BTFE 3EA8A 4JZ1A 1RIWB 4TY6A 1BRCE 3GCHC 5EXNA 1TPSA 3KQCA 1EPTC 2C90B 4ZKSU 1MKWH 2PKSB 1LMWB 2GVFA 2Y82A 1W12U 2JETB 4WMEA 1P9UA 2BXTH 4B71A 5EOKA 3SW2B 2JDID 1C1MA 1FPHH 1O2HA 3M5OA 2XTTB 1N6YA 5AF9H 2WUBA 1MZDA 5F53A 1A0HB 2K8IA 2Y6TA 1Z7KA 1V2JT 2ZGCA 2VWOA 3TK9A 4MNYA 3MFJA 1ELCA 1UVUH 4YO9A 5I25A 1A2CH 4AORA 4B2BA 1ZRKA 3SV9A 2RG3A 1GBBA 4D9QA 1ZMNA 1QQUA 4FUJA 1TQ0B 2VIWA 2H5DA 1NFWA 5DKMA 3SV6A 1GBCA 3LGIA 1DITH 2GDDA 1Z6JH 4X6MA 1SFQB 3K6YA 2RFKC 1TGSZ 1O3KA 1CT4E 1GHBF 4D9RA 1SR5C 3NUMA 2J97A 1F92A 2C8YB 5HIZA 2J94A 3TH3H 3FP7E 2R0KA 1HAVA 3ATKA 3LIWA 1RTLA 1ESTA 4GVUA 4FUBA 3BSQA 4DG4A 2R3YA 1J17T 2ANWA 4X8VH 4LOYH 1X7AC 1D9IA 4ZKOU 5FPSA 4LK4A 1C1RA 3OU0A 2J98B 2ZDMA 1IAUA 4LXBH 3NXPA 4FU9A 3QUMP 1UTKA 4X1SU 2IOTA 2ZU1A 2R2MB 1XKBC 1Z8RA 1UTJA 1NTPA 1TFXA 4Y79A 1QBOA 2PV9B 1THPB 2CHAC 3DSOA 2AHME 1WTGH 3PM3A 3OX7U 5DK1A 1MH0A 1NRNH 3OTJE 2JH0D 4FOUC 4FUDA 1GPZA 2EA3A 1NFUA 1QJ7B 2A7JA 5FL7D 3H5CB 2Y7ZA 3A87A 3PTNA 1TRNA 4RKOB 3GCTF 1EZUC 1YPGH 4J2YB 1TB6H 1H8HD 4Y7BA 1G9IE 1GHBG 1AY6H 1SLVB 2A5IA 2WPHS 1UTNA 4MDSA 2ANMH 3QZQA 2QA9E 2ZWLH 1BHXB 4MLFB 3CENA 1DY9A 3QLPH 1ETSH 3T27A 2CGAA 4JK5A 1UK2A 2A1DB 5F03A 4NA8A 4K3JA 4YTAA 3V13A 1GDUA 3A8AA 1AKSA 1YWUA 2P3FH 4KTUA 1J8AA 3U28C 1VR1H 4O3UA 1O2YA 2HLCA 4A5TS 4OGXA 1HYLA 3KN2A 5LGOA 3KNXA 2BD4A 2B0FA 1ELVA 1NY22 1SGFA 1SSXA 1G3EA 3KYGA 1O5EH 3NZIA 5EG4A 1G2MA 1S6HA 3RXJA 1CBWC 1NU9A 1P06A 3E6PH 1EAIA 2WHXA 1WXRA 1EPTA 1A0LA 2HWLB 3DA9B 3ODDA 2OBOA 1O3NA 1J16A 4BTTB 3TU7H 1Y5AT 4SGAE 3A8BA 1GGDB 4B74A 1T8NA 1W11U 3HATH 1MAYA 1W8BH 2B8OH 3UR6A 2M2AA 2OQUA 2AMQA 2WSSD 4GAWA 4BTUB 3A7VA 1KXCA 1FONA 4GUXA 2GGVB 5AHGH 4B6EA 1ZHPA 3BG4B 3GY2A 2D1JA 1A5IA 4GLYA 2GT7A 3RU4T 4NZQA 3SI3H 3RMLH 2YMSD 1B0EA 1AI8H 2TPIZ 3QN7A 1TNIA 4INLA 1GVLA 1C5MD 3SU5A 2OCVB 2VIOA 2W7SA 5FPYA 3TJVA 1RFNA 4UDWH 1TA2A 4O03A 4NWLA 3BN9A 3ZVAA 3S7HB 1O2PA 2RDEA 3SUDA 5JB8S 1FV9A 1KXFA 5A8ZA 2ZZUH 4Y76A 3NKKA 1SQOA 3SJ9A 1UW7A 2Y81A 5GPIB 2ZU5A 3Q00A 5C1UA 2ZKSA 3F0PA 1TYNA 3TGJE 1C1QA 1RD3B 1O2RA 2SFAA 1BMNH 5K7RA 3VG8A 4FUHA 1D3QB 1AGJA 3PYHA 2WPDD 2GP9B 2BLOA 1O5FH 4IGDA 3A80A 1OSSA 3BEFB 1C2MA 1Y3XA 3QX5H 2QF0A 2ZTXA 3LOXA 4TWYA 1O3CA 3M36A 3RP2A 3ZZ8A 1NU7B 1C1TA 4FU8A 4ZAEA 1WBGB 4K1EA 3MHWU 3GY7A 1O0DH 1O3GA 1WUNH 2EI6A 1TMTH 3IWMA 5JB9S 4OS2A 1NPMA 3RXPA 2YMSB 1C5QA 2XWBI 3ELAH 1O3FA 5C0UA 1SLXB 1OX1A 4NWKA 3NK8A 2VIQA 3DT0H 3SYJA 1A46H 1GVZA 3A82A 1WSSH 1MABB 3SBKA 1E36B 3SU0A 1KDQB 1HAXB 1AMHA 1IQGA 2H9EH 3BEIB 2BD8A 1GG6B 3M3VA 3RXVA 1P2MA 1YCPH 6LPRA 3ZVBA 4YT6H 1QBNA 2GX4A 2NWNA 1CHOG 4IW4E 2O8UA 1AFQB 4U32A 3SJKA 1DY8A 1RGQA 3LJOA 6ESTA 3GY5A 1A5GH 3P17H 4NGAH 2Z9JA 4TY7A 1ZHRA 1KLIH 1O3AA 3UNQA 2QN5T 1JIMA 3K9XB 2AGGX 4AYVB 3RUOA 2PTCE 1AUJA 5T6DA 3MWIU 1PPCE 4ESTE 3P8GA 1FXYA 5JBBS 5HXFA 5GNDA 1C5LH 1DLEA 2SNWA 2OUAA 2LNCA 3ZVFA 2J2UA 2HPPH 4UFDH 3Q76A 1O34A 1PQ7A 2WV9A 3I77A 1OOKB 1OWKA 2EI7A 3RXGA 5B6LA 4Y8YA 1HJAB 1NO9H 9LPRA 3ODFA 1L4DA 3R3GB 1LHDH 3GY8A 1TAWA 1KIGH 2W6JD 1Y3VA 3SNCA 1SGFG 1GL1A 2BVXH 1V2UT 2DE9A 3STJA 1GJBB 1GJDB 2TGTA 3SQHE 1LKBA 5FCKA 2F9PA 3C27B 1TRYA 2Z9KA 1GBKA 1SPJA 1DOJA 2NU1E 1W14U 2C4FH 3P70B 2TBSA 3PWCA 3OTPA 1YF4A 3U8RH 2J9NA 3BF6H 3SGAE 4A6LA 1L4ZA 1QB9A 1DLKB 2CN0H 1AD8H 4I31A 3OEED 3A7XA 2ZDLA 3A7YA 1HAPH 3KEEA 4Q7XA 1WQVH 2G55A 5EIYA 1GMDF 3T28A 2ZDKA 5EPNA 2WYJA 2J95A 1BBRH 3ZVDA 2NU4E 5DP9A 1H4WA 3QZRA 2GCHF 1E37B 3ENSB 4DY7B 1GJ6A 2BLVA 3UTUH 1FLEE 2FWWA 2H1UA 1XXFA 2AIPA 3LKWA 4M9FA 5F8TA 3LGWA 4INKA 1LPGB 2OC8A 3F9FA 4FXGH 2KR7A 4K8BA 1GI8B 3O8RA 1DX5M 1ZTLA 3ZZ5A 2ZO3H 2Q1JA 1ZJKA 5GCHF 1MD7A 1HJ8A 2W5EA 1MZAA 3LH1A 4F55A 1S0RA 1BTHH 2VVVA 5E0HA 1NRQH 1FY3A 3SUEA 3PO1B 2VGCB 1EJAA 2HVYB 2CK3D 4AGJA 3MH5A 3F2FA 4B76A 3O8BA 3SZEA 1YLDA 1BQYA 1W7GH 4TWWA 5EQQA 1ELTA 1XXDA 2ODQA 3F0OA 4XFQA 2H9TH 1OWIA 4WH8A 4RI0A 2OQ5A 1T32A 4ABJA 3I29A 1C5PA 4KGAA 4ABHA 2ZGBH 4X6PA 1B0FA 2A45B 2IN2A 1O2XA 2GCHG 4K1TA 1BMLA 1TNJA 4FUEA 4Q7YA 1OWEA 3URDA 1F5LA 2FS9A 2WUCA 3A8DA 8KME2 1C5UA 1GI4A 4F4OC 3LC3A 1KXBA 2ZFTA 1Z6EA 2YMSC 5H4IB 2FX4A 3U69H 2FP7B 1ELBA 1P03A 3KQEA 1YPHE 5EQSA 1VITH 1OS8A 1SGYE 2A2QH 1N1LA 1WDIA 4U30A 3FAOA 2V7QD 4K5ZA 4RKJB 4CRCA 2ZHWH 1SGNE 1Z71A 1ABIH 1GHWH 1GCTB 3SU2A 1ETRH 1CA0C 1EP5A 1SQRA 3U1JB 1LQDB 3KGPA 1LHCH 3UIRA 1QB6A 2O8LA 1SL3A 1CHOF 2HNTF 2G00A 1L1NA 4ISHH 1LDTT 3GYLB 4NA7A 2PGBB 4HZHA 5EODA 4AFSA 1C1SA 4JZIA 5AFYH 2XCFA 5K0HA 4TPYA 1LCYA 4CBNA 5GDSH 4XBCA 1CGJE 2H9HA 2QYIA 1BZXE 3BTDE 3E0PB 1CBWB 2HOBA 4YLQH 4BXSA 4DCDA 1QL7A 1GJ5H 3G01A 3D23A 1XUFA 1TBRH 4K69A 1CT0E 4VGCC 2FOMB 2P59A 5TCCA 2BQ6B 1VGCB 2F3CE 2BOHB 5T6GA 1DWBH 1MD8A 1V2QT 1HAYB 3ZZ6A 2B5TB 1KXEA 1XUHA 2TRMA 2VINA 2QIQA 1G3CA 2FPZA 2BTCE 1C5OH 4FUFA 2F43B 3DUXH 1BA8B 1TBZH 1FX0B 4JMYA 1C1OA 1EJMA 1TX7A 3MU8A 1Y3YA 2BB4A 3PV4A 2QXGA 2PSXA 1F5RA 1SI5H 2J34A 1O3PB 1QNJA 1T4UH 1P10A 2ZTZA 4HGCA 4OS4A 2GCTC 2AMPA 1QURH 2A4QA 4E06H 3BIUH 1TNHA 2XCNA 5HYOA 1DXWA 1RIWC 4HTCH 4NSVA 1D6WA 5ETXA 3TJNA 1HAVB 1O2LA 2HNTE 3H7TA 5B6OA 1LVMA 1TNKA 1K1MA 2HALA 5KEDA 4X2VA 2W3KA 1ARCA 2VBCA 5E2OA 2LELA 1ABJH 2A4GA 2QV1A 1ANCA 3P8FA 4B1TA 1P3CA 2PLXA 4CRGA 1TPOA 1SQTA 4YT7H 4NA9H 2UUYA 2OK5A 1UTPA 3UREA 1HJ9A 4AC9A 2OC7A 4GCHG 1LPZB 1LVOA 1RS0A 3QO6A 1UTQA 1E0FD 4OS6A 1UJ1A 3P8OA 3ZYDA 3BTEE 3M5MA 2PKAB 1AB9C 3MU0A 1C5XB 1T8MA 4D7FA 4AG2A 1DANH 1AB9B 4WMFA 1NBMD 2SGFE 3URCA 4FU7A 4CH8B 1EQ9A 3OAAD 3A86A 2VIVA 4VGCB 4XRNA 1C1NA 3M3TA 2BDIA 3U98H 5A0BA 3SQEE 3M37A 3BG8A 1O39A 2FTMA 3PMHB 1YC0A 1W10U 3T25A 1C1UH 3SHAH 1JOUB 2A7HA 3PLPA 5EJLA 5GXPA 4KTSA 1L0ZA 2SGDE 4I8HA 1S6LA 4X1NU 1SOZA 3MNXA 3TGIE 4PROA 1UVPA 3QGJA 3RXIA 5T3HA 1GJCB 5HKKD 4THNH 1MKXH 2P94A 3FO8D 3GCOA 2Z3DA 5C94A 4ZKRU 3RC4A 1DSTA 1ANDA 3F2HA 5E0GA 1Y8TA 1O2MA 3KF2A 1HXEH 3EE7A 1KDQA 1GHVH 4U01A 3U8OH 2JETC 2FLBH 1IQNA 1GG6C 1CVWH 4K1SA 3GISB 5FX5A 1NM6A 2HNTC 3MU4A 1K28D 5SGAE 2FI3E 2XBYA 3HKIB 1V2ST 4MNWA 2FDAA 2QE7D 5EXLA 1H8IH 1MTUA 3I78A 1YKTA 2YOLA 2F9OA 1KTTB 5ESBA 4H4FA 1WQSA 1O32A 2W7UA 2ZTYA 2Z94A 1GI2A 3LC5A 2ALVA 3NPSA 1AO5A 5A0CA 1ORFA 4ABIA 1VITF 1F0RA 1GWAA 4BNRA 1W0YH 4AFUA 1IQIA 3EYDA 5A2MH 3P8NA 1VKYA 4YESB 4XOJA 1YBWA 2GV7A 1G30B 1IQKA 1WCZA 4WMDA 4MTBA 2G52A 2THFB 3UOPA 3P92A
chains in the Genus database with same CATH topology
1HBTH 4R8TB 2GKVE 2FYRA 3T2NA 1C5ZB 5FPTA 1SBWA 5FBIA 4D7GA 4I8GA 4WXVA 3M61U 3BG4C 3U8TH 3LGUA 1Y5BT 1HAIH 2VNTA 4XBDA 3UQOA 1O2OA 2QCYA 2BD3A 3LGTA 5DP4A 1ZMLA 4AN7A 4UFGH 2C8ZB 2M5TA 1C5NH 1IHTH 4MPUA 2QAAA 3QK1A 1Y5UT 1Z8IB 3E16B 2R9PA 3C1KA 3SOSA 2ZFRH 4WY3A 3RC5A 3ESTA 1QL9A 4K60A 1K9OE 3RM0H 3MNSA 1DT2A 1GBHA 4BTIB 2JH5D 1KXAA 2OXSA 3EAJA 3RXKA 4K8YA 3SNDA 1ZGIA 3MI4A 2AGIX 1QJ6B 2XXLA 4IS5A 3UR9A 5C5OA 2P8OB 3PLBA 3SV7A 3E90B 4FVBA 2P3UB 3ZZ3A 3ATMA 1BT7A 5LPFA 1N8OB 1P2OA 3BEUA 2I6SA 2ZEBA 3LGYA 2ZU4A 4DIIH 1G3DA 1A4WH 2DE8A 4DVAU 4K2YA 2ZCHP 2ZU2A 1VCQA 1O33A 1L2EA 1V2NT 2BQWB 5GCHG 2BD2A 3MNBA 1FIZA 1YPKH 4I32A 4A1XA 2AS9A 2OTVA 1V3XA 3SZNA 1QRXA 5JBCS 1KTSB 2SNVA 1UK3A 1V2MT 4D76A 5I46H 1BITA 1C2KA 1YCPK 3LPRA 1QIXB 3HGPA 1MCTA 3S9AA 1T4VH 1O38A 2ZFQH 5G4BA 3RXUA 4CREA 1GBFA 2SGAA 1HDTH 4ZUHA 1H8DH 2O8TA 1MQ6A 3UPEA 1NFXA 2FIRH 1PPBH 1G2LA 3ATWA 4MPWA 3SGQE 1D4PB 1G36A 2J38A 3SUGA 3OY6U 1AZZA 2TGPZ 1GI9B 2VIDA 1C2LA 3LT3A 1V2KT 1VJAU 6GCHG 5DP5A 1HV7A 2FEQH 3T26A 2A7CA 1P12E 4AGKA 1TGNA 4WXIA 4A1TA 1CT2E 4J1YA 2O9QA 3DD2H 1K21H 1SVPA 1FN8A 2XC0A 1GMCG 2ODYB 2ILNA 1VCWA 3TPIZ 1GMHF 2ZPSA 1YP9A 4YLUA 3SJIA 5JPMH 1ESAA 1BCUH 2V3HH 2FOFA 1H9LB 1NESE 5FBEA 1P2QA 3A7WA 3QWCH 1EOJA 2EEKA 1TPAE 1A1RA 1ANBA 3E91A 1O3HA 2FODA 2FMJA 1ETTH 2ZQ2A 1NS3A 3ZZ9A 3UWJH 3Q3KA 1DPOA 5TJXA 4YOIA 3RMOH 1UCYK 2TGDA 2WPJS 1SB1H 1SFIA 1A5HA 1S85A 1SLUB 2OP9A 4X1PU 5DPAA 5JDUB 3VEQB 4CRBA 1GBDA 3FZDA 5FCRA 3T62A 4Q7ZA 1OYTH 5L2ZH 1LPKB 1HFDA 2BYAX 5PTPA 4MPXA 3FANA 2XRCA 3GY3A 2ZC9H 2ZG0H 3D49H 1AFQC 3RLWH 3PLKA 2Q6GA 2WYGA 1LHGH 1VZQH 1C5WB 2ZDNA 1TX6A 1GI0A 1KLTA 3SO3A 1EAUA 8GCHF 3TJOA 1QGFA 1GJ9B 2AEIH 3Q77A 1C4Y2 4ABBA 4AX9H 3D62A 3S0NA 2QF3A 1ELGA 3GYMA 1FY5A 3BTTE 3RU4E 1BUIA 4UFFH 1MMJN 2BM2A 5LPEA 1P11E 5EU8A 2XWAA 1TALA 1ZJDA 1O3IA 2CV3A 3S69A 4SGBE 4O97A 1YPMH 1ELAA 4CR9A 2PUXB 4B75A 1DUAA 1YPJH 4QT8C 3RXOA 2BDYA 1HAHH 2ZIQH 2BZAA 1Q31A 2P16A 1KY9A 1MTNB 2XYAA 1O2KA 1TLDA 3BTHE 1NC6A 4AG1A 2CF9H 4O9VA 2FOHA 1QA7A 2R2WU 2XNIA 4OS7A 1VGCC 3A84A 4AB8A 1QFKH 1P2IA 2FOCA 2P3TB 4GCHF 3KQDA 1ZHMA 1IHSH 2G8TA 1A3EH 1NZQH 1EX3A 2R3UA 4NSYA 1K1OA 4LZ4B 1OP0A 1YPEH 2R0LA 1O3OA 1ZPZA 3PMBB 3WY8A 1V2WT 1F7ZA 2Q6DA 2BY9X 1YPLH 1RTKA 1FAKH 1TOCB 2Z6BD 2ULLA 5ABWA 1HAGE 5TCAA 1O2UA 4NCYA 2ZI2H 1C1WH 4UFEH 1EB2A 1MUEB 1ZLRA 5AVDA 1A3BH 2BVSH 2YNAA 4Z0KA 3IITA 2ZHQH 4X2WA 4GSOA 3SNEA 1OPHB 1GHZA 1O2TA 1O2ZA 1ZPBA 1CGHA 3CS0A 3K2UA 1ACBE 1BDAA 3NCLA 2Z9LA 2G81E 3GOVB 1TA6A 1V2PT 3O8DA 1BRBE 4Y11E 4H6SB 2PSYA 4AFZA 4Y0ZE 1V2TT 3VFEA 2OINA 3TLOA 4INHA 2PKSC 4E05H 4CH2B 1UCYH 3ZZBA 3MYWA 4JZFH 4YM9A 2KAIA 1C2JA 2AERH 2Y5GA 1OKXA 1GL0E 1FY4A 4B73A 1HLTH 1W13U 1TMUH 4OS1A 2CHAB 4RSPA 1GMDG 1BMMH 2ZHDA 5FX6A 2K1QA 4XBBA 3UWIA 1NFYA 1A7SA 5CHAC 2G5NA 2VIPA 2W26A 1YM0A 4NIXA 1EZQA 1DXPA 3TVJB 1GI1A 1SGQE 3SNAA 1GBTA 2H2ZA 1C5SA 1PFXC 3P95A 1DUEA 2BD7A 2QGRA 1BB0B 1QY6A 2C8WB 2VGCC 1EZXC 2ZA5A 1INCA 3VXEH 2FZZA 3SHCH 4I8JA 1S84A 1IQJA 1FDPA 5E2PA 4MG3A 3TIUA 2A5AA 1BRUP 3EA9A 2CF8H 1EXFA 4CR5A 3GDUA 3RMMH 7GCHG 2BXUH 2TIOA 1LVBA 4Q2KA 5E8EH 1K1LA 1HGTH 1SGRE 2HPQH 4X8TH 1Z8JB 3ZZ4A 2V35A 4TYDA 1FAXA 3RLYH 3GICB 1AE5A 3P6ZB 1QR3E 1O2SA 1H9HE 3UY9A 4ZHLU 3AVZA 1WOFA 5JBTA 4ISLA 2FYQA 8ESTE 1J9CH 1P2KA 2ODPA 1LO6A 4OS5A 1SQAA 5IDKA 1EKBB 1FY1A 1F0SA 2WPLS 1E35B 4KKDA 1O31A 2NU0E 3B23B 4NFEA 3V3MA 2BZ6H 2TGAA 1HXFH 1TONA 1XUGA 1LHEH 2GZ7A 3F9EA 1MTSA 2Y5FA 2RDLA 4KELA 2A4RA 1PPZA 3A81A 1O2WA 2CJIA 1TGBA 4Q80A 3KIDU 4Y10E 4R0IA 1O5AB 5GWZA 1UTLM 4Z6AH 3A85A 1S81A 4X8UH 4ASHA 1C2HA 1QRZA 4WVPE 1OWDA 2BX3A 2FOGA 3ZZDA 3N7OA 4I8KA 3EDXB 2ZGXH 3DHKH 5J4QA 1TGTA 1G32B 2BLWA 2UWOA 1YGCH 5DO4H 1HB0B 1VITG 4IMQA 2V3OH 3ZV8A 2VWNA 3QTOH 1C9PA 1GI3A 1LTOA 4JK6A 5EW2H 4DIHH 1FNIA 2LPRA 3VXFH 4X2XA 1RTFB 1QTFA 6CHAB 1HAOH 2JKHA 5GJ4B 1JBUH 3RXDA 2IJOB 3SN8A 1BHXF 1ZTKA 1UMAH 1OWHA 3MNCA 1GBIA 1DS2E 1C5VA 3GCNA 4CHAC 1BTWA 1OWJA 1OP2A 1EPTB 1GDNA 1GBAA 3F6UH 4X8SH 4JYUH 4B2CA 2QC2A 3GCHB 2QY0B 1FZZA 2C3SA 1JIRA 4BANB 1YYY1 3SU4A 2CMYA 5DP7A 1D3TB 1O2IA 2VVCA 5FHTA 1FN6A 5HMAA 1Y3WA 1C2GA 1K2I1 1TQ7B 4GPGA 4JYVH 4ZKNU 3TITA 2AYWA 4DOQA 1IOEA 1GMHG 1O2NA 3ATIA 1BBRE 4ISIH 2D2DA 3OSYA 2AH4X 5JYIA 1HPGA 7ESTE 4AYYB 1OXGA 4I33A 1SGEE 1IQLA 3ZZCA 2FLRH 1ZOMA 1WU1A 2FOAA 2Q6FA 1SHYA 3ZYEA 4CBOA 5CE1A 1UHBA 2UWPA 1E38B 2ZDAH 3MH6A 3T29A 4AFQA 2GD4B 4FVDA 2F83A 2UWLA 3EA7A 3MTYA 4Y8ZA 8LPRA 1TABE 1SG8B 3Q3XA 1K1PA 2F9BH 1EJNA 2FTLE 3ZZ7A 4GHTA 3VB3A 1GHAG 5DP3A 1H9IE 1W7XH 2UUFB 3TNTA 4ABEA 3MO3A 1CO7E 5CMXH 2HGTH 1O3JA 3UQVA 5C1XA 3MU1A 1TBQH 3LDXH 3SJ8A 2A4OA 1GJ7B 4IC5A 2VH0A 1P09A 3TGKE 1TGCA 1ZPCA 1P05A 2AIQA 2BDHA 3KQBA 2G4UA 2A5KA 1D6RA 1HCGA 1ID5H 1TNGA 1RRKA 4X0WU 1O3LA 1XVMA 3U1IB 1P02A 2VWLA 4ABGA 5DP8A 3LONA 1FUJA 5A8XA 4A92A 1LKAA 1TOMH 4BAMB 1SC8U 1O3EA 2ANKH 3K65B 1GBJA 1GJ8B 3M3SA 4H6TA 1AQ7A 6GCHF 3E0NB 3FP8E 1SMFE 4Y8XA 2PW8H 4JYTA 1L1GA 3ZVCA 2HVXA 1QHRB 1JMOH 5HM9A 5L6NH 3MO6A 3UNSA 2NU3E 2ZPRA 1MU8B 1PPHE 3E8LA 4JZDH 1BTUA 1SGPE 4YOJA 2B9LA 1THSH 2BDCA 2FS8A 1BBRK 1RJXB 2VU8E 2A31A 1AU8A 1P0SH 4I8LA 1DWCH 5FXLA 3H7OA 2F9VA 3FZZA 1V2OT 4HFPB 1MU6B 2ZFFH 2XBXA 2WV5A 4YOGA 4IMZA 5EXMA 1O2VA 1SGDE 2A0QB 1GBMA 1BTXA 1ZSKA 2XW9A 1SHHB 4WJG2 1AWHB 1A61H 4U2WA 1YPHC 1CSOE 1C1VH 5EQRA 1O36A 3VGCB 2F9UA 2YNBA 4FUCA 1K22H 3SU1A 1P2JA 5BRRE 1WTHD 4XDEA 1E34B 2QXJA 3MOCA 1OYQA 3SU6A 2BMGB 4H42U 3HGNA 1MBMA 1HIAB 2VWMA 1N6XA 4A7IB 4O3TA 1O2QA 2O8MA 3EGKH 1DFPA 1KLJH 4ABDA 3RC6A 5C5NA 1ZSJA 1ZGVA 1NRRH 3QTVH 7KMEH 1B7XB 2ZFPH 8GCHG 2BY8X 2H5CA 4IN1A 2OD3B 3RXHA 4ZXYH 1GVKB 1IQHA 1V2VT 5LH8A 1QL8A 2STBE 5GIBA 4KP0A 4AOQA 5HM2A 1O5GH 3SGBE 1IQMA 4NIWA 1AKSB 2BHGA 1O35A 2F91A 2ZU3A 5E0JA 1HNEE 2Z3EA 1FIWA 4BAKB 1GI5A 1O2JA 1S83A 2ZCLP 1UK4A 2CXVA 3FVFB 3A83A 5T6FA 3TH4H 4DURA 1AN1E 1BTYA 1QB1A 1KYNA 1SGCA 3M7UA 1Y59T 4WWYA 1DSUA 1QJ1B 3VGCC 1P3EA 2FI4E 2A2XH 4LZ1H 1FQ3A 3E1XB 2RA0A 4A1VA 1GHAF 1AIXH 3A8CA 4ISNA 1A0JA 1UO6A 3TJUA 3BTGE 2XBVA 2NU2E 3QGNB 5CHAB 2H6MA 3D65E 3W94A 3MMGA 7LPRA 3T5FH 3KL6A 4DW2U 3V0XA 1V2RT 3R0FA 1T7CA 4DJZB 3MO9A 3RXSA 2P95A 4UONA 2VJ1A 3CS7A 9ESTA 1AE8H 1MQ5A 3SV2H 3S7KB 1DICA 3RMNH 3LGVA 1Y3UA 3AAVA 2F9NA 3TK5A 2HRVA 2GTBA 4X2YA 2DUCA 5DJ7A 4D8NA 3RXCA 2BDBA 2FI5E 1P2NA 3PMAB 2ANYA 2D26C 2WINI 3BTQE 3SNBA 2Z7FE 5IYTA 4B2AA 2PWXA 2BY6X 4F49A 3VB4A 3LJJA 1NRPH 2FM2A 5DG6A 3HK3B 4Y7AA 1BMAA 2AGEX 1EATA 2EC9H 4AZ2B 3ITIA 4DGJA 1Q2WA 5DGJA 3DFJA 1Z1JA 1EAXA 1CA0B 1UHBB 4Y6DA 2BLQA 2G51A 2C8XB 5A09A 1BIOA 1CGIE 2EI8A 1BJVA 1XM1A 1MKXK 5EGMA 2VVUA 1ZSLA 1EASA 4XE4A 1J15A 3A7ZA 3U9AH 3HK6B 2WPIS 3CP7A 4NIYA 1GMCF 4NFFA 4UD9H 3ZVGA 2BDGA 4NG9H 1GJ4H 1IQFA 3LH3A 2ZGHA 1O5CB 3LU9B 1F0UA 2OLGA 1CE5A 1QBVH 3IG6B 3RXLA 4FUIA 1PPEE 1C2IA 1PQ5A 3PWBA 3BIVH 1BRAA 4I7YH 1THRH 5A8YA 1AVGH 3UFAA 4MQAA 1XMNB 3SU3A 5JBAS 3L3TA 2BD5A 1C5RA 2UUKB 4JZEH 4IC6A 3BTME 2G5VA 4TPIZ 2BOKA 4BXWA 4CRFA 1ZTJA 4Y71A 1CU1A 1PQ8A 1TPPA 1AWFH 2GV6A 1MTNC 4ZROA 3Q3YA 1N8OC 3RM2H 4BAHB 1AUTC 3GY4A 2WV4A 1D3PB 7GCHF 1PPGE 4IBLH 3S9CA 3RU4D 2GZ8A 4E7NA 1O3BA 1AVXA 1C5TA 5F8XA 1S5SA 4MVNA 3TNSA 4ZHMU 2PHBA 1TX8A 2ZDVH 2OC1A 1S82A 2ZP0H 1Q3XA 1VCPA 1LHFH 3M7TA 1ZRBA 1GJAB 1Z8GA 1ELFA 1QRWA 2FESH 2QXIA 2Z9GA 1ANEA 2IPHA 4MNXA 1G3BA 2Y80A 1YLCA 3B8JA 1HRTH 1UTOA 1MCVA 1L1JA 4BAQB 1FY8E 1KSNA 1S0QA 1K1IA 1ELEE 1F0TA 2RA3A 3BV9B 2FO9A 4IN2A 4ISOA 2ZNKH 4WH6A 2V6NA 1ZYOA 1W2KH 1WV7H 2ZPQA 2SGPE 3B9FH 5J4SA 1NROH 2B7DH 1C5YB 2ZF0H 4UE7H 2FOBA 2PR3A 1LVYA 1WAYB 5L30H 3V12A 1HUTH 4FUGA 1DVAH 2AMDA 1T8OA 2KAIB 1O3DA 1JWTA 3SUFA 2ZFSA 4ABFA 3MH4A 4CRAA 1MKWK 1QA0A 1NT1A 1VJ9U 2ASUB 3SV8A 1S6FA 3AW1A 1FPCH 1T31A 1YCPM 1AFEH 1FI8A 2J92A 5BPEA 1ZZZA 3UUZA 3SORA 1MTWA 3RXTA 1U6QA 3ZZAA 2FOEA 1BTZA 1NRSH 1GHYH 1TNLA 1P8VC 1V6DA 2J4IA 1EUFA 2GDEH 3ATLA 4Y0YE 5EPYA 4BOHA 5C2ZA 1BTPA 3ZV9A 1C1PA 3RXAA 4GHQA 2Y7XA 3A88A