3PROA

Alpha-lytic protease complexed with c-terminal truncated pro region
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 56
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3proA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3proA01
1SLWB 1C1VH 5LGOA 3T62A 3RXSA 3ODDA 4ZXYH 1HXFH 8ESTE 3L33A 2WUBA 4UD9H 1O35A 4A1XA 1SQOA 3WY8A 2A4RA 1P11E 3T28A 2GTBA 4DIHH 1C5UA 4Y0YE 5DGJA 1EAXA 1O2NA 2PKAA 4K8YA 1CBWC 4LZ1H 3T29A 4YESB 1TA2A 2PUQH 1FDPA 5FPYA 1RRKA 3ZZ9A 3SJ9A 1P2IA 1TLDA 2W26A 4OS1A 1QIXB 3KCGH 3UREA 2BD5A 2FS9A 1FIZA 4INKA 1DVAH 5L2YH 1LKBA 3BTME 1EOLA 3QZQA 1C1RA 1FQ3A 1UJ1A 4JK6A 5K7RA 1Y5BT 3ZZCA 3VXEH 1Y3UA 1GHAG 1PYTC 2BXTH 4H42U 1A1RA 2GMTB 3MTYA 4ZHMU 3V7TA 1XUFA 1GL1A 5EODA 1SL3A 4TY6A 5A8XA 4AGKA 3PWCA 2ZCLP 3OX7U 4OS5A 3PO1C 5C20A 1GI3A 2CF9H 2FTMA 3FP7E 1TBQH 4WXVA 3RXFA 2QN5T 2AYWA 4WWYA 3MU4A 3UTUH 1MBMA 3MO6A 2FOGA 1P3EA 3GISB 1F7ZA 4U30A 1BQYA 1S84A 1RTFB 1A0LA 1O2UA 2BZ6H 4K69A 2P16A 1BOQA 1QA0A 1BRBE 2AMQA 3K9XB 3VB7A 9ESTA 2ZU1A 1EAUA 4FVDA 3HPTB 1GBIA 2GCHG 3RMNH 1IQEA 1C1SA 1VJAU 2PKSC 2BM2A 1EP5A 2Y80A 3A87A 2PR3A 1D3PB 3S7KB 2A31A 1Z6JH 3ATLA 3GCTG 1MUEB 1HAOH 2VIOA 1AVXA 3P17H 4E05H 1ZLRA 4B1TA 2PW8H 3DHKH 1YF4A 2A2XH 2TBSA 1INCA 4UFFH 2RG3A 4XSKU 1A0JA 2AERH 2UWPA 1IQFA 2XNIA 1AQ7A 1YC0A 4GUXA 3SUDA 4DG4A 5TJXA 3UOUA 3ATWA 1T8LA 3SJ8A 1V6DA 3EDXB 4X8TH 2CHAB 2ZC9H 3TH4H 4AX9H 2WYGA 4AYYB 2FMJA 2HRVA 2VB0A 3M5OA 3SU5A 4AFZA 1G30B 6CHAC 2SGPE 2YNAA 3Q77A 3FAOA 4ABGA 2J94A 4NIVA 3UR6A 1SB1H 3URDA 3SU1A 1RTKA 1BMLA 1HDTH 5DK1A 1UTLM 3MU5A 1P10A 5C1YA 3VFEA 3RM2H 2B7DH 3D49H 1VITG 5L2ZH 1ELTA 3EQ0H 3SO3A 1ZSLA 4NIXA 3TK9A 3DA9B 1G36A 4JYUH 1C5TA 3P8OA 1F2SE 2DE8A 2ANKH 1C5QA 2XC5A 1QJ1B 1AZ8A 2VIVA 1ANBA 1C2IA 3BTDE 4BAOB 1BRUP 1AKSB 1MZDA 4ABBA 1GBTA 2XBXA 4Q80A 1AVGH 1LPGB 2F83A 2H2ZA 1F0TA 1Y8TA 1SGFA 4KP0A 1SVPA 2VIQA 1UK4A 3K65B 1SFIA 3RXLA 7GCHF 3PYHA 1WCZA 2ZFQH 3F9GA 3RU4D 1BMAA 1G32B 1W0ZU 4K5ZA 1VITH 3A89A 3SV9A 1K1PA 1ZPZA 2GV6A 3VXFH 1FN6A 3A84A 2Z3CA 1WBGB 2R9PA 3ZZDA 1SMFE 1C2GA 2BYAX 2GV7A 1ZMJA 2JH5D 3P92A 1ZHRA 3T27A 3SHAH 3RXVA 5FBEA 2F9PA 3A8DA 3M37A 4ISNA 1O3GA 2FESH 4AYVB 5C5NA 4AZ2B 5T6FA 1JMOH 1C1PA 4CR5A 3A86A 2OD3B 1F0SA 4A92A 2BD2A 4ZAEA 3GY7A 2NU0E 4NGAH 2HNTE 3UQOA 2LNCA 5T3HA 1K21H 1EQ9A 3KQDA 3U8OH 1J14A 1TMUH 3K6ZA 2GGVB 1VZQH 3VB4A 4ASHA 1HLTH 3BEUA 2G4TA 1HAZB 1TPSA 1BITA 2Z7FE 4MNXA 3ZVBA 2NU4E 1LO6A 1TGBA 2ZF0H 4X8UH 1TYNA 1TNLA 4YLQH 1ZJKA 1BTPA 2G4UA 3PMAB 1YCPK 1HJAC 2R3UA 1O2SA 2GVFA 1IQNA 1YPEH 1SQTA 2HOBA 1HJAB 5EQQA 5E2PA 1O2XA 1YYY1 3MH5A 1HV7A 1ETRH 4X2YA 5J4QA 2XWAA 1JRTA 2GCTC 5CE1A 1WQSA 2OC1A 2R3YA 3F68H 4X6PA 2BD8A 1K9OE 1YPMH 2ZHWH 3GDVA 1UO6A 1S81A 2C8ZB 3A8BA 4I33A 4TPYA 5C2ZA 3UQVA 2Z3DA 4I8KA 1UTQA 1OXGA 1ZTJA 4ZKSU 1NN6A 2AGIX 5EPYA 1AN1E 2ZDVH 3EE0B 4RSPA 1CHOG 1SGNE 3E6PH 2W7SA 1BJUA 3BEIB 1QRXA 1SSXA 1C5RA 4X6NA 4JZ1A 2XRCA 1L4DA 3RC6A 6GCHG 3O8CA 4LOYH 2D2DA 1P8VC 4ISLA 3TJOA 1QB6A 2ZECA 4B2CA 2NU3E 4Y8XA 4ABEA 3UIRA 1C1TA 2BVXH 1C2LA 2XC0A 1EATA 2GMTC 3VPKA 1A5HA 1FIWA 1G3CA 2FOEA 3UWJH 5JBCS 1SGDE 3F9EA 3BG4C 4SGAE 1C5XB 1EZUC 5H4IB 1OWEA 3QK1A 4ZH8A 2CHAC 2KAIB 2J38A 4I8GA 1MAYA 3PTNA 1AB9B 1SLVB 2H9TH 8KME2 1QL9A 1AY6H 1WV7H 2VVUA 3U1IB 3RU4E 3PLBA 2BQ7B 1BBRK 5FPTA 2O8LA 1W7XH 4NZQA 3GCOA 3UOPA 4DW2U 4X6OA 5DP5A 2GKVE 2H5DA 3ZZ6A 3ZZ5A 2EC9H 1DWCH 3A7YA 1W11U 4FU7A 3QX5H 2K1QA 3V3MA 1V2QT 5LPEA 1T4UH 1HFDA 1HYLA 4CBOA 3GICB 1O2TA 2VNTA 2D8WA 1K2I1 1GHAF 4BAHB 1V2WT 2OCVB 3RXOA 5TCAA 1X7AC 1BJVA 1ZMLA 3L6PA 1BBRE 1BZXE 1O2PA 3M5MA 3ZVCA 4CRGA 1OP2A 3LH1A 4U32A 3RMLH 2R2MB 1QR3E 1FXYA 3FP8E 1N1LA 1UTJA 3CS0A 2R2WU 4GLYA 1EKBB 1OWJA 5HXFA 2TGDA 1F5RA 1C5OH 1O3JA 1GHVH 1CE5A 2SFAA 1LPKB 1C1MA 1O3FA 2GT8A 4NIYA 3KIDU 1TOCB 4D8NA 4AORA 8LPRA 1PPFE 2PKSB 5FAHA 5DPAA 8GCHF 4HGCA 1NRNH 1NU9A 1QBOA 4X2VA 1UVOA 1CA8B 3PMHB 2M5TA 2ALVA 1THSH 1YPLH 5EXNA 3O8BA 2G51A 2WINI 2P3TB 1V3XA 2B8OH 1T8OA 1JOUB 2CMYA 4Y79A 4YOIA 5DP9A 2ZPSA 5HM2A 3GCHC 1ID5H 4DT7B 3M35A 1QURH 5IYTA 2RCEA 1WUNH 1AO5A 5LPFA 5DP3A 2QGRA 3SBKA 1UVPA 1ELCA 1XKBC 1OWHA 4JCNA 4VGCC 4LXBH 1Z8GA 1IHTH 1TMBH 3BTTE 3PMBB 3T5FH 1QQ4A 2XYAA 3H7TA 1DICA 1O36A 1WQVH 4I8JA 2FOAA 2JH0D 1QB9A 1S83A 3OYPA 1C1QA 3PWBA 1TPOA 1P0SH 1E38B 2OLGA 1P04A 1KXDA 3F1SB 1L4ZA 5TCCA 2ESTE 1A46H 3LJOA 2QXJA 1K1OA 1LHEH 5AFYH 2OBOA 4INLA 4Y8ZA 3LC3A 3QGJA 2DUCA 3HK3B 2RDLA 1KXCA 5ABWA 3KQBA 2ZU5A 2ZDMA 1LMWB 4X1SU 2ZGHA 2ANYA 2BTCE 1ETTH 1YBWA 4LZ4B 2XWBI 4BAQB 2FZZA 2HALA 3EA8A 1O3KA 4YOGA 2FTLE 1EB1H 1FAXA 1PQ7A 1GI1A 1DWBH 3PB1E 3SNAA 1C5LH 3MNSA 1F0RA 1O2WA 1MTWA 2GX4A 2FOCA 4CRDA 1OWKA 1A5GH 1GHXH 4B71A 1UHBB 1VITF 3LDXH 1FY4A 1MCTA 4Y0ZE 4A1VA 1F92A 2C8XB 3P8FA 1AHTH 2VWLA 1J15A 1TGCA 2A2QH 3ZZAA 4DURA 2BLOA 3HGPA 2VJ1A 4X1PU 1FNIA 3IITA 1WYKA 1TWXB 1AFEH 2GCHF 1CGJE 1ZMNA 1GBLA 2QXHA 4Y10E 4D76A 9LPRA 4KTCA 4WH6A 2F9OA 2CJIA 2OQ5A 5T6GA 4GVUA 3TNSA 4FUBA 1THPB 1GI2A 2ZKSA 3M5LA 1XUGA 3PLKA 1A4WH 1XMNB 1NROH 1GDQA 2A4GA 3KQCA 3FZDA 4I31A 1GMDF 2XCFA 3GYLB 1GBAA 2ZDNA 2ANMH 2ZDKA 1OWDA 4XFQA 3LGVA 5HGGA 2NU2E 2ZFPH 4D7FA 2ALPA 4NFEA 1GG6C 4MNYA 1KDQB 1XVMA 1V2OT 4SGBE 3RXAA 1BT7A 4FU9A 3S9AA 4Y7AA 4ZKRU 3MYWA 4ZUHA 1GGDB 1L1GA 4K8BA 1XVOA 1EAIA 1AIXH 6CHAB 3S7HB 1Z8RA 2AMPA 2AIPA 2FYQA 2IJOB 1HB0B 1Z1JA 1RS0A 1EZXC 3BTFE 1C5MD 1CU1A 1NRRH 1ZRKA 3H7OA 1O2LA 1TBRH 5LPRA 2XCNA 2BD7A 1HAPH 3SJKA 2AIQA 1C2EA 1VCPA 1AE8H 2XW9A 4TY7A 2WPHS 4BTIB 1LKAA 1UVSH 3RXIA 4BTUB 1O32A 1D3QB 1MU6B 1O2KA 2BY6X 3QO6A 1AD8H 1GBJA 2OBQA 2C8YB 3TGJE 3BTEE 3OTJE 2ZFRH 1SFQB 1RFNA 4O3TA 1F0UA 5EU8A 1ZSKA 4FU8A 3OY5U 5F03A 2TGTA 2UWOA 1BA8B 1HAGE 3UFAA 2Y82A 4Y8YA 1C2JA 5GCHG 4D7GA 4K3JA 2ZGCA 1DDJA 3SOSA 3NUMA 1GBBA 1DM4B 3MH7A 2OQUA 2PUXB 2QXIA 1JIRA 2A5AA 3A85A 4CRCA 2Q1JA 1K22H 1GMCF 3STIA 2EI6A 3ZVDA 1J17T 3DD2H 1TB6H 3RUOA 3MH4A 4Z6AH 3W94A 5C67A 1AE5A 2VVCA 2FI3E 3LC5A 1UK2A 2OP9A 1HGTH 3RC5A 2FEQH 1TPPA 1HJ9A 1GHYH 4JYTA 2IN2A 4DOQA 3SI3H 1PPZA 3TLOA 1EPTB 2FI5E 4HFPB 2STAE 4WF8A 2BOKA 2UWLA 2J9NA 3PM3A 1Y3YA 4A7IB 1SQAA 4Y6DA 2WV4A 2PWXA 4ISHH 5JB8S 2ZA5A 1H9IE 1PQ8A 1QGFA 1ZHPA 1G2MA 1O2HA 5JDUB 4OS6A 2F3CE 3GY3A 3SV7A 4DJZB 1T32A 3S9CA 2TGAA 2FM2A 3F9HA 1VCWA 1UVUH 2WPKS 1BMMH 1TE0A 4X8VH 1P05A 4NA8A 3B23B 3SN8A 5CMXH 5PTPA 2ZEBA 1TRMA 1DXPA 3SU2A 1HIAA 1S5SA 3TK6A 4AOQA 1H4WA 1S0RA 3M5NA 1CO7E 3RXJA 1NT1A 5DP7A 3ZV8A 1GI4A 1O3MA 3UWIA 1O2QA 3RC4A 1K1MA 1ZSJA 4KGAA 1SGEE 4FUIA 1EJAA 3LGTA 2V6NA 4IW4E 1S85A 1Q2WA 1N8OC 5EQRA 3Q00A 2O8TA 4BANB 3MMGA 1FZZA 2C3SA 1UK3A 3M7QA 5K0HA 1HAYB 3DFJA 3T2NA 1FJSA 2PLXA 2VGCC 1KY9A 1UCYE 1PPEE 3FVFB 1W0YH 1MKWH 4ZROA 1P3CA 2QAAA 2BY5X 1G3DA 5JB9S 1P12E 2BDAA 4ABHA 2HNTC 1A5IA 3MWIU 3LGIA 3SV6A 3SGBE 1QL8A 2PSYA 3ZZBA 3ENSB 1NRSH 5I46H 2O9QA 2FI4E 2BLQA 2PTCE 3VGCB 1AFQC 5EXLA 2UUJB 4FUCA 3MI4A 3GY2A 4NWKA 3SUGA 2Y7ZA 2ZU4A 4F49A 1B0FA 2PTNA 3S9BA 1ELAA 4TPIZ 3F6UH 4K1EA 1UTMA 3MO9A 2O8MA 3QDZB 1LVBA 3ZYDA 2B9LA 2H6MA 3S0NA 3LU9B 1ABIH 3KHVA 1O3BA 5C3NA 1W8BH 1SHHB 4CRBA 5A0CA 1QJ6B 2BDIA 2P3UB 1F5KU 1BTZA 1P06A 1CA0C 1JRSA 2DE9A 3EA9A 1HXEH 1W3CA 5FCRA 1FY3A 4K2YA 3LT3A 2ZHDA 3A80A 4DCDA 3MOCA 4GCHF 4BXWA 1OOKB 1AGJA 3TVJB 3RXCA 4O03A 1QNJA 2JH6D 2G5NA 1GBKA 6ESTA 4MDSA 2BDGA 2VVVA 1TX8A 1H9LB 1NZQH 3A83A 2QC2A 4DY7B 1ZR0A 3DT0H 3SNDA 2Q6DA 3M7TA 4ISOA 2A7CA 2RA0A 2CN0H 3MNCA 3P8NA 5AHGH 3U8TH 3ZVAA 1A0HB 1DUEA 4OGXA 4CHAB 1V2RT 1EPTC 2Z9LA 4E06H 1FMGA 1DANH 3Q3KA 2R0KA 2UUKB 1BIOA 3D23A 3K2UA 1EASA 1DWDH 1KIGH 4B2AA 4D9QA 4X6MA 3C1KA 1SG8B 1TFXA 2LPRA 2D1JA 2WV5A 1GHWH 1GMHF 3SNCA 1HAVA 1C5ZB 2B0FA 1O3IA 1E36B 1ESTA 2QA9E 3AAVA 7KMEH 5E0JA 1S6FA 3QN7A 1XKAC 5GXPA 3UNRA 2ZFSA 2VWMA 1TIOA 4B74A 1ESBA 1O33A 1WU1A 2G8TA 4ZMAH 2QIQA 1PQ5A 3ESTA 4F4OC 1RIWC 1O30A 1QY6A 1A3BH 1IAUA 1KXBA 1PPGE 2VWNA 1ANEA 1TGSZ 1QTFA 4UFDH 1Y5AT 1O34A 3ZVEA 1QJ7B 2WPMS 4RKJB 1UTNA 2ZHEH 1WAYB 3M3VA 2XBYA 1EZSC 1GDNA 2AFQB 1IOEA 1L0ZA 3SU6A 5FCKA 1C5SA 1GJ9B 1BDAA 4GSOA 4B2BA 3BF6H 1G3BA 5GCHF 2P8OC 3RMOH 1LCYA 4PROA 1AVWA 3MU0A 1HCGA 3D62A 5ETXA 4YOJA 1QFKH 1KSNA 2FOMB 1MKXK 3BTKE 1ELGA 4NZLA 3V13A 3PMJA 4XBCA 3O8DA 1IHSH 4ZKNU 3SQEE 3U1JB 3TGIE 1B0EA 2XXLA 3EA7A 1NY22 1T4VH 3BG4B 3GCNA 3IG6B 1GG6B 1NU7B 5A8ZA 1DE7H 3U9AH 2HPPH 3ZVGA 1C9PA 5EQSA 1P2MA 2UUYA 2AH4X 4Y71A 1P01A 4UEHH 1O3EA 4AG1A 1GPZA 5E0HA 3RXQA 3BTQE 3RLWH 1L2EA 1ANCA 2HGTH 1UTKA 5B6OA 1C5YB 1RTLA 2A32A 2Y6TA 1H8DH 1ANDA 4IN1A 4BTTB 3KEEA 1PYTD 1E34B 3ZV9A 3W95A 3PV4A 1QQUA 1JIMA 1V2TT 4O3UA 1FI8A 1RXPA 3ZZ7A 4Q2KA 1ZTLA 2IOTA 2XC4A 3LJJA 2FS8A 4XBBA 3SV8A 5GPIB 1HBTH 4JZEH 2P8OB 1FUJA 2B5TB 5ESTE 4K1SA 3RXTA 5FX5A 1SGFG 5JYIA 1GJ4H 1MD7A 1V2ST 1KLIH 1DS2E 3UPEA 1BUIA 2Z9KA 1DLKB 2A7HA 3ZYEA 3A82A 4CH2B 4BXSA 4ABAA 3QTVH 2C8WB 2PV9B 3ATIA 1DY9A 5E2OA 2ZPQA 4J2YB 2VIWA 1ELFA 4NCYA 3LIWA 4ZKOU 1KLTA 4D9RA 3BN9A 1P9UA 2PKAB 3ZZ3A 1SR5C 1MU8B 3BV9B 3NXPA 1GJCB 2G5VA 4DVAU 1SOZA 3V0XA 2J4IA 4DIIH 4AGJA 1GHZA 4AB8A 4CRAA 4GHQA 1VR1H 1MKXH 3JZ1B 2C90B 3SUEA 3MFJA 1DT2A 1W12U 1W2KH 1PPBH 4K1TA 1P2KA 1PQAA 3STJA 1T7CA 3U69H 3ZVFA 4Y7BA 1A2CH 2A5KA 3LPRA 5E8EH 1D3DB 3SJOA 1IQIA 1FAKH 1LVOA 2XTTB 4KTUA 4VGCB 4Y11E 2O8UA 1YPKH 2I6QA 1QB1A 2ODPA 1EAWA 1IQGA 1YCPM 3RDZA 1DX5M 3HKJB 5C5OA 1C4U2 2Y5GA 2SGDE 4X2WA 1P2NA 1MAXA 2ZU3A 4YTAA 3G01A 1L1JA 3QZRA 1AUJA 1DLEA 2QCYA 3ZZ8A 5GDSH 5EPNA 2BDYA 1MTNC 1ZTKA 1LHFH 2BOHB 3KNXA 1C5NH 1Y59T 1YPHE 4ZXXH 1ELDE 3E91A 3KGPA 5FHTA 1SGRE 1GBEA 3TJVA 1O5EH 1OSSA 1DY8A 1O3DA 3NPSA 1TGNA 1Z6EA 2BY9X 2W5EA 3KL6A 1H1BA 2JETC 2W7UA 1FPCH 1HPGA 2W3KA 1O3CA 5FPSA 2SGQE 5F8ZA 3A8AA 1S6HA 1TMTH 1SGYE 1ZRBA 4IMZA 4ZHAA 2F9BH 1GCTB 1V2MT 1IQHA 1TNGA 2Z94A 3M7UA 3PO1B 3R0FA 2CF8H 2SGEE 1MQ6A 1GI7B 1QL7A 5DJ7A 1O2YA 2VU8E 1JBUH 1SI5H 1SGQE 1LHGH 2OXSA 2PSXA 3MH6A 3VB3A 1RIWB 2OTVA 1MTVA 2O8WA 5CHAC 2J92A 4JZIA 4OS4A 4NSVA 4R0IA 4HI3A 2GT7A 1LHDH 1Z71A 4FUFA 2OINA 1TRYA 1O39A 2STBE 4BNRA 1TOMH 1V2VT 2IPHA 3RM0H 5FXLA 1C1NA 1J16A 1XUHA 4GAWA 1NPMA 1O3HA 4B75A 1TNIA 2WPLS 2GDEH 2BX4A 5ESBA 2QXGA 2GZ7A 1LPZB 1YCPH 1LVYA 3PTBA 1VGCC 2GDDA 1P2OA 3N7OA 3P70B 4WMFA 4I7YH 2C93B 1C9TA 1KTSB 3GY5A 1YP9A 3VEQB 3ITIA 4IMQA 1NFYA 2GD4B 1TALA 4NA7A 4IBLH 3VB5A 1C4V2 1D9IA 1CGIE 1SGTA 3SNEA 1AKSA 3KF2A 4X8SH 3CENA 1AWFH 1NRPH 1NS3A 1YPJH 3TGKE 1GMHG 2I6SA 1MH0A 3U8RH 2P93A 1P2JA 1EJMA 1ETSH 3RXPA 2ZTZA 3E1XB 1MCVA 1N6XA 2EA3A 1EB2A 3IWMA 5EOKA 5I25A 3SI4H 1O5AB 3A7WA 5HYOA 1WTGH 1LQEA 2BVSH 1KXFA 5F8TA 2Z9IA 5FBIA 1O38A 1YLCA 5EG4A 2ODQA 3K6YA 3A8CA 3BSQA 3RXMA 2KAIA 3HKIB 4E7RG 1RD3B 4FUJA 4OS2A 3RXKA 2D26C 4YLUA 1BRCE 3GYMA 4WMEA 3SQHE 1DITH 4XE4A 5EGMA 3PROA 3VGCC 1ARCA 2VINA 2BD3A 1O5CB 3UY9A 4MNVA 2SGFE 2ZQ2A 1N6YA 1IQMA 1LHCH 4CREA 3GDSA 4HZHA 4U2WA 4YT7H 1BTUA 5L30H 1WSSH 1W7GH 1HJ8A 4YM9A 2ZP0H 3EYDA 2JETB 1GVKB 2Y81A 3HGNA 1N8OB 3HK6B 3H5CB 2FYRA 2ZFTA 3RXEA 3TIUA 1D4PB 3FZZA 1O3LA 2AS9A 2A5IA 2YNBA 4NSYA 2FOFA 3BIUH 1BTHH 3Q3YA 4MVNA 3I29A 5AF9H 2F9UA 2AGGX 4M7GA 3E0NB 5F8XA 3GOVB 3SW2B 4WVPE 4O9VA 1O2GH 1V2KT 4TWWA 1CT4E 2ZNKH 1S0QA 3TJNA 2GCTB 3RXUA 3F9FA 1O2VA 3RXDA 4BAKB 1NO9H 1GWAA 3AVZA 2G52A 1K1NA 4R8TB 2QYIA 4DGJA 3MNXA 3NWUA 4TYDA 2A7JA 1GVZA 5GJ4B 1GBCA 1ZGIA 1V2LT 1AU8A 2BLVA 1C1UH 3UNSA 3AAUA 2AGEX 2V35A 1K28D 2GP9B 4WMDA 3SGQE 1ACBE 1EOJA 4AB9A 3ATKA 2HVXA 1QCPA 3T25A 5SGAE 3BG8A 1G3EA 3MO3A 3M61U 1DSTA 4UONA 4WXIA 2ZPRA 1AI8H 1UVTH 2FWWA 1C5VA 1TX7A 1O2ZA 2PFEA 1IQLA 3VB6A 8GCHG 3E3TA 4FUHA 4TWYA 7ESTE 3QUMP 1A7SA 2HWLB 2FDAA 1CBWB 1C2HA 1D3TB 2THFB 1BMNH 3B9FH 4GHTA 4X1RU 3D65E 3A7ZA 3SU4A 2BLWA 1NC6A 4JMYA 4MLFB 1TONA 4WY3A 5HMAA 1JXPA 1K1JA 1O2JA 2Z6BD 5EW2H 4MPXA 5DO4H 1TBZH 3EAJA 1BTWA 1SBWA 3SU0A 1BBRH 1J8AA 1KYNA 3P6ZB 1O3PB 5CHAB 4ABJA 1FY8E 3TNTA 2ODYB 2FIRH 4XBDA 1M9UA 3MU8A 2OUAA 2ULLA 4ISIH 1BCUH 2CXVA 1HAIH 3ZZ4A 1D6WA 4ABIA 1PPHE 1W10U 2OC8A 4A1TA 1UHBA 4UDWH 2FLBH 3TPIZ 1SHYA 7LPRA 4FVBA 1HAXB 5J4SA 2Z9GA 3OU0A 4UFGH 2RA3A 1XUKA 1O5GH 5DKMA 1XUIA 3MU1A 1G2LA 5AVDA 2FO9A 5F6MA 1EP6A 3SNBA 3S69A 4A5TS 1P9SA 1P02A 1CQQA 1Y3XA 4H6TA 2BB4A 1S82A 2ZDLA 2BQ6B 2BQWB 1T8MA 2VIPA 1KLJH 3UNQA 3A7TA 4JK5A 4XOJA 5A2MH 4E7NA 2FX4A 1W13U 1O3AA 1RGQA 1V2UT 5AFZH 1QA7A 3Q76A 3QWCH 2BX3A 1E37B 4X1NU 1O3NA 4CH8B 4MG3A 1Y5UT 1IQKA 3E8LA 3TH3H 1GHBG 3RMMH 1NRQH 1XXFA 2OC0A 4THNH 2Z3EA 2NU1E 3ELAH 3SU3A 3RU4T 4YT6H 2A4OA 2ZI2H 4MTBA 4O97A 5G4BA 4ESTE 2VGCB 4Q7ZA 3I77A 5JPMH 1PPCE 3TH2H 2BDHA 2G00A 1ZZZA 2CGAA 3U98H 1C4Y2 3SJIA 1GJ8B 3LGYA 1YPGH 1T31A 1UMAH 1O37A 4I8LA 1BRAA 1P09A 3LGUA 2BY8X 1PJPA 1D6RA 1XX9A 3M3TA 3B8JA 3GDUA 4WH8A 4I8HA 2BZAA 2J2UA 3BTWE 3I78A 3A81A 2GZ9A 3KQEA 4AFUA 2ZTXA 1NFWA 3R3GB 1YKTA 1ZHMA 1QHRB 4MPWA 1DUAA 4CHAC 4CR9A 4UFEH 3AW1A 1VCQA 3C27B 2V0BA 2XBWA 1EJNA 2F9VA 2ZZUH 1GBHA 1QRZA 2P95A 3O8RA 5E0GA 1F5LA 2XBVA 3SORA 1CVWH 1Q3XA 1GMCG 2FXRA 1K1IA 1BB0B 2G55A 5C1UA 4JZDH 2HPQH 1HRTH 5DP8A 1LVMA 1TQ0B 2ANWA 1ELBA 3BTGE 1V2NT 4ABDA 3LONA 4UE7H 5DP4A 1EZQA 2H9EH 4IC5A 3UUZA 1TNKA 5T6DA 2ZCKP 2BVRH 2P94A 1CGHA 1W14U 1AMHA 3RXBA 1OYTH 3TU7H 1TGTA 4MNWA 4IGDA 1FONA 2ZGJA 1C1OA 1TA6A 1ESAA 2QF3A 3DUXH 1MBQA 1DFPA 4FUEA 1ABJH 3RXHA 2ZGBH 1O2MA 1MTNB 2FODA 1ZGVA 1PFXC 1EPTA 1NTPA 3SV2H 3QGNB 2FX6A 3FP6E 4OGYA 1GI6A 5JBBS 1P2QA 1XXDA 2QV1A 4NA9H 5IDKA 1HNEE 1SPJA 3AASA 5JBAS 2F91A 2R0LA 3RLYH 1O0DH 2AMDA 3AW0A 1TRNA 1AZZA 5A09A 2NWNA 1MQ5A 3E16B 1MMJN 1HAHH 1L1NA 1KXEA 1NFXA 3DFLA 1MD8A 1V2JT 2ILNA 1RJXB 1DSUA 4AG2A 1EXFA 1B5GH 2Y5FA 2ZDAH 1YPHC 4AN7A 2OC7A 2FP7B 5GWZA 1QBNA 1TNJA 1GDUA 1KDQA 2EEKA 3GCTF 4X2XA 1ARBA 2FOHA 1AFQB 1CHOF 4A6LA 1SGPE 1ZJDA 4B73A 2HLCA 1FPHH 3A88A 1UTOA 1Y3VA 3SHCH 1O5FH 2TIOA 1C1WH 2C4FH 3RXRA 4U01A 1A3EH 3OSYA 1ZYOA 2UUFB 2WUCA 2ZIQH 1BTXA 2HNTF 1ORFA 2WYJA 3TITA 2BY7X 2BD4A 1OP8A 1YGCH 1EUFA 4Q7YA 1GMDG 3SZNA 1O5DH 2WPIS 1JWTA 1P03A 1GJ6A 1O2IA 7GCHG 2ZFFH 1DPOA 4I32A 3BIVH 3SUFA 1GL0E 1H8IH 4NWLA 5EW1H 1E0FD 4Z0KA 1GCDA 1DXWA 3T26A 5EXMA 1P57B 3A7VA 1QRWA 1GJDB 4Q7XA 4MPUA 1FY1A 2SNVA 1NFUA 1UCYK 4KTSA 1GJAB 1IQJA 5GIBA 1GI9B 1UTPA 3BEFB 5FX6A 1T8NA 5L6NH 1TPAE 1NESE 1C5WB 2H1UA 3GY4A 1SLUB 4CRFA 1VJ9U 1DWEH 1ELVA 2TGPZ 1CT2E 3E0PB 1MTSA 6LPRA 2A45B 3GY6A 1TAWA 4J1YA 1MZAA 3QLPH 2ZHFH 3NKKA 1BHXF 4ABFA 3PLPA 5LH8A 2H9HA 3RP2A 1GJBB 3LGWA 1AWHB 4JZFH 4MQAA 2ZG0H 1THRH 1Y3WA 4FXGH 1MKWK 3FFGA 1G9IE 3MHWU 1FV9A 3P8GA 2A1DB 2BHGA 4HTCH 2BMGB 2Y5HA 1TNHA 4YZUA 1GCTC 1VGCB 2PGBB 2PHBA 2WPJS 1TABE 3Q3XA 1O2OA 1Z8IB 4H4FA 5BRRE 1AUTC 3FANA 4XDEA 1O3OA 1GI8B 2F9NA 4BOHA 4AFQA 1C2MA 3L3TA 3P95A 2GZ8A 2TPIZ 2ZU2A 1WOFA 3ATMA 3V12A 1GBMA 1Z7KA 2P3FH 2J95A 2ZGXH 3BTHE 3OY6U 1FLEE 2EI7A 3CS7A 4CBNA 1SLXB 4GPGA 1O5BB 2W3IA 3QTOH 3NK8A 4AFSA 1HIAB 1BTYA 2ASUB 4GCHG 1HAVB 2BDBA 1U6QA 1TX6A 1KTTB 2CV3A 1XM1A 3GCHB 1XUJA 2P59A 2H5CA 3EGKH 1OWIA 2ZWLH 4RN6A 6GCHF 1GBFA 1YM0A 4KELA 5JBTA 3E90B 4IC6A 1C2DA 1YLDA 3GY8A 1UCYH 1QBVH 1FN8A 2YOLA 1GI0A 3LKWA 1HUTH 3NCLA 1OX1A 1B7XB 2SNWA 2J34A 2TRMA 1ZPBA 2V3HH 2ZO3H 2BXUH 3RXGA 1C2FA 4RKOB 3SGAE 1GBDA 1SC8U 1Z1IA 2Z9JA 1Z8JB 1O31A 4KKDA 1J9CH 3URCA 1H9HE 1SOTA 2FOBA 2BDCA 4Y76A 1NM6A 1ZOMA 4INHA 2VH0A 2PGQB 4WJG2 2VIDA 4ZHLU 2Y7XA 4K60A 1WTHD 3LOXA 1OYQA 2QY0B 4QT8C 1A61H 3M3SA 4BAMB 4NFFA 1LDTT 3A7XA 2VWOA 2Q6FA 1LTOA 4MPVA 1C2KA 3NZIA 4LK4A 1SGIB 4OS7A 1MTUA 1GHBF 1EX3A 3LH3A 3ODFA 4YO9A 1O2RA 3TK5A 1CSOE 1G37A 1GJ7B 1CHGA 2G81E 3KN2A 1OPHB 1C5PA 1SGCA 4NIWA 1CA0B 1K1LA 4H6SB 1OP0A 2VH6A 4IN2A 1DOJA 1GI5A 1FY5A 3M36A 4JYVH 2ZCHP 2AEIH 3JZ2B 4IS5A 2QF0A 4FUDA 5DP6A 2ZHQH 2ZTYA 5BPEA 3UR9A 5A0AE 1GJ5H 5A0BA 1BHXB 1ELEE 2V3OH 1TQ7B 5DG6A 1AB9C 1E35B 2BD9A 1GGDC 4FUGA 2SGAA 1OKXA 3HATH 1V2PT 2ZQ1A 5A8YA 5HM9A 5C1XA 2JKHA 1ZPCA 2Q6GA 2FLRH 1LQDB 3TJUA 1KXAA 4X0WU 1Q31A 4X1QU 2A0QB 2FPZA 3CP7A 1CT0E 1OS8A 2A4QA 3MNBA 4NG9H 4B76A 2EI8A 1GVLA
chains in the Genus database with same CATH superfamily
1SLWB 1C1VH 3KQ5A 5LGOA 3T62A 3RXSA 3ODDA 4ZXYH 1HXFH 8ESTE 3L33A 2WUBA 4UD9H 1O35A 4A1XA 1SQOA 3WY8A 2A4RA 1P11E 3T28A 2GTBA 4DIHH 1C5UA 4Y0YE 5DGJA 1EAXA 1O2NA 2PKAA 4K8YA 1CBWC 4LZ1H 3T29A 4YESB 4I86A 1TA2A 2PUQH 1FDPA 5FPYA 1RRKA 3ZZ9A 3SJ9A 1P2IA 1TLDA 2W26A 4OS1A 1QIXB 3KCGH 3UREA 2BD5A 2FS9A 1FIZA 4INKA 1DVAH 5L2YH 1LKBA 3BTME 1EOLA 3QZQA 1C1RA 1FQ3A 1UJ1A 4JK6A 5K7RA 1Y5BT 3ZZCA 3VXEH 1Y3UA 1GHAG 1PYTC 2BXTH 3F0PA 1A1RA 2GMTB 3MTYA 4H42U 4ZHMU 3V7TA 1XUFA 3VG8A 1GL1A 5EODA 1SL3A 4TY6A 5A8XA 4AGKA 3PWCA 2ZCLP 3OX7U 4OS5A 3PO1C 5C20A 1GI3A 2CF9H 2FTMA 3FP7E 1TBQH 4WXVA 3RXFA 2QN5T 2AYWA 4WWYA 1QZ8A 3MU4A 3UTUH 1MBMA 3MO6A 2FOGA 1P3EA 3GISB 1F7ZA 4U30A 1BQYA 1S84A 1RTFB 1A0LA 1O2UA 2BZ6H 4K69A 2P16A 1BOQA 1QA0A 1BRBE 2AMQA 3K9XB 3VB7A 9ESTA 2ZU1A 1EAUA 4FVDA 3HPTB 1GBIA 2GCHG 3RMNH 1IQEA 1C1SA 1VJAU 2PKSC 2BM2A 1EP5A 2Y80A 3A87A 2PR3A 1D3PB 3S7KB 5DSFA 5F53A 1NBME 2A31A 1Z6JH 3ATLA 3GCTG 1MUEB 1HAOH 4XD7D 2VIOA 1AVXA 3P17H 4E05H 1ZLRA 4B1TA 2PW8H 3DHKH 1YF4A 2A2XH 2TBSA 1INCA 4UFFH 2RG3A 4XSKU 3ZIAD 1A0JA 3U28C 2AERH 2UWPA 1IQFA 2XNIA 1AQ7A 1YC0A 4GUXA 3SUDA 4DG4A 5TJXA 3UOUA 3ATWA 1T8LA 3SJ8A 1V6DA 3EDXB 4X8TH 2CHAB 2ZC9H 3TH4H 4AX9H 2WYGA 4AYYB 2FMJA 2HRVA 2VB0A 3M5OA 3SU5A 4AFZA 2LELA 1G30B 6CHAC 2SGPE 2YNAA 3Q77A 3FAOA 4ABGA 2J94A 4NIVA 3WWFA 3UR6A 1SB1H 3URDA 3SU1A 1RTKA 1BMLA 1HDTH 5DK1A 1UTLM 3MU5A 1P10A 5C1YA 3CNRA 3VFEA 3RM2H 2B7DH 3D49H 1VITG 5L2ZH 1ELTA 3EQ0H 3SO3A 1ZSLA 4NIXA 3TK9A 3DA9B 1G36A 4JYUH 1C5TA 2YMSD 3P8OA 1F2SE 2DE8A 2ANKH 1C5QA 2XC5A 1QJ1B 1AZ8A 2VIVA 1ANBA 1C2IA 3BTDE 4BAOB 1BRUP 1AKSB 1MZDA 4ABBA 1GBTA 2XBXA 4Q80A 1AVGH 1LPGB 2F83A 2H2ZA 1F0TA 1Y8TA 1SGFA 4KP0A 5CDFE 1SVPA 2VIQA 1UK4A 3K65B 5GNDA 1SFIA 3RXLA 7GCHF 3PYHA 5B6LA 5DN6D 1WCZA 2ZFQH 3F9GA 3RU4D 1BMAA 1G32B 1W0ZU 4K5ZA 1VITH 3A89A 3SV9A 1K1PA 1ZPZA 2GV6A 3VXFH 1FN6A 3A84A 2Z3CA 1WBGB 2R9PA 3ZZDA 1SMFE 1C2GA 2BYAX 2GV7A 1ZMJA 2JH5D 3P92A 1ZHRA 3T27A 3SHAH 3RXVA 5FBEA 2F9PA 3A8DA 3M37A 4ISNA 1O3GA 2FESH 4AYVB 5C5NA 4AZ2B 3KYFA 5T6FA 1JMOH 1C1PA 4CR5A 3A86A 2OD3B 1F0SA 4A92A 2BD2A 4ZAEA 3GY7A 2NU0E 4FOUC 4NGAH 2HNTE 3UQOA 2LNCA 5T3HA 1K21H 3F0OA 1EQ9A 3KQDA 3U8OH 2KCPA 1J14A 1TMUH 1WDIA 3K6ZA 2GGVB 1VZQH 3VB4A 4ASHA 1HLTH 3BEUA 2G4TA 1HAZB 1TPSA 1BITA 2Z7FE 4MNXA 3ZVBA 2NU4E 1LO6A 1TGBA 2ZF0H 4X8UH 1TYNA 1TNLA 4YLQH 1ZJKA 3GS9A 1BTPA 2G4UA 3PMAB 1YCPK 1HJAC 2R3UA 1O2SA 2GVFA 1IQNA 4OM9A 5CHBA 1YPEH 1SQTA 2HOBA 1HJAB 4YXWD 5EQQA 5E2PA 1O2XA 1YYY1 3MH5A 1HV7A 1ETRH 4X2YA 5J4QA 2XWAA 1JRTA 2GCTC 2VBCA 5CE1A 1WQSA 2OC1A 2R3YA 3F68H 4X6PA 2BD8A 1K9OE 1YPMH 2ZHWH 3GDVA 3KYGA 1UO6A 1S81A 2C8ZB 3A8BA 4I33A 4TPYA 5C2ZA 3UQVA 2Z3DA 4I8KA 1UTQA 1OXGA 1ZTJA 4ZKSU 1NN6A 2AGIX 5EPYA 2IPQX 1AN1E 2ZDVH 3EE0B 4RSPA 2F43B 1CHOG 1SGNE 4ACBA 3E6PH 2W7SA 1BJUA 3BEIB 1QRXA 4DT4A 1SSXA 1C5RA 4X6NA 4JZ1A 2XRCA 1L4DA 3RC6A 6GCHG 3O8CA 4LOYH 2D2DA 1P8VC 4ISLA 3TJOA 1QB6A 2ZECA 4B2CA 2NU3E 4Y8XA 4ABEA 3UIRA 1C1TA 2BVXH 1C2LA 1EATA 2XC0A 2GMTC 3VPKA 1A5HA 1FIWA 1G3CA 2FOEA 3UWJH 5JBCS 1SGDE 3F9EA 3BG4C 4SGAE 1C5XB 1EZUC 5H4IB 1OWEA 3QK1A 4ZH8A 2CHAC 2KAIB 2J38A 4I8GA 3PRDA 2RFKC 1MAYA 3PTNA 1AB9B 1SLVB 2H9TH 8KME2 1QL9A 1AY6H 1WV7H 2VVUA 3U1IB 3RU4E 3PLBA 2BQ7B 1BBRK 5FPTA 2O8LA 1W7XH 4NZQA 3GCOA 3UOPA 4DW2U 4X6OA 5DP5A 2GKVE 4FETA 2H5DA 3ZZ6A 3ZZ5A 2EC9H 1DWCH 3A7YA 1W11U 4FU7A 3QX5H 2K1QA 3V3MA 1V2QT 5LPEA 1T4UH 1HFDA 1HYLA 4CBOA 3GICB 1O2TA 3N99A 2D8WA 2VNTA 1K2I1 1GHAF 4BAHB 1V2WT 2OCVB 3RXOA 5TCAA 1X7AC 1BJVA 1ZMLA 3L6PA 1BBRE 1BZXE 1O2PA 3M5MA 3ZVCA 4CRGA 1OP2A 3LH1A 4U32A 3RMLH 2R2MB 1QR3E 1FXYA 3FP8E 1N1LA 1UTJA 3CS0A 2R2WU 4GLYA 1EKBB 1OWJA 2K0QA 5HXFA 2TGDA 1F5RA 1C5OH 1O3JA 1GHVH 1CE5A 2SFAA 1LPKB 1C1MA 4B6EA 1O3FA 2GT8A 4NIYA 3KIDU 1TOCB 4D8NA 4AORA 4ACAA 8LPRA 1PPFE 2PKSB 5FAHA 5DPAA 8GCHF 4HGCA 1NRNH 1NU9A 1QBOA 4X2VA 1UVOA 1CA8B 3PMHB 2M5TA 2ALVA 1THSH 1YPLH 5EXNA 3O8BA 2G51A 2WINI 2P3TB 1V3XA 2B8OH 1T8OA 1JOUB 2CMYA 4Y79A 4YOIA 5DP9A 2ZPSA 5HM2A 3GCHC 1ID5H 4DT7B 3M35A 1QURH 5IYTA 2RCEA 1WUNH 1AO5A 5LPFA 5DP3A 2QGRA 3SBKA 1UVPA 1ELCA 1XKBC 1OWHA 4JCNA 4VGCC 4LXBH 1Z8GA 1IHTH 1TMBH 3BTTE 3PMBB 3T5FH 1QQ4A 2XYAA 3H7TA 1DICA 1O36A 1WQVH 4I8JA 2FOAA 2JH0D 1QB9A 1S83A 2YMSB 3OYPA 1C1QA 3PWBA 1TPOA 1P0SH 1E38B 2OLGA 1P04A 1KXDA 3F1SB 1L4ZA 5TCCA 2ESTE 1A46H 3LJOA 2QXJA 1K1OA 1LHEH 5AFYH 2OBOA 4INLA 4Y8ZA 3LC3A 3QGJA 2DUCA 3HK3B 2RDLA 1KXCA 5ABWA 3KQBA 2ZU5A 2ZDMA 1LMWB 5KECA 4X1SU 2ZGHA 2ANYA 2BTCE 1ETTH 1YBWA 4LZ4B 2XWBI 4BAQB 2FZZA 2HALA 3EA8A 1O3KA 4YOGA 2FTLE 1EB1H 5EJ1A 1FAXA 1PQ7A 1GI1A 1DWBH 3PB1E 2GJGA 3FN8A 3SNAA 1C5LH 3MNSA 1F0RA 1O2WA 1MTWA 2GX4A 2FOCA 3EE7A 4CRDA 1OWKA 1A5GH 1GHXH 4B71A 1UHBB 1VITF 3LDXH 1FY4A 1MCTA 4Y0ZE 4A1VA 1F92A 2C8XB 3P8FA 1AHTH 2VWLA 1J15A 1TGCA 2A2QH 3ZZAA 4DURA 2BLOA 3HGPA 2VJ1A 4X1PU 1FNIA 3IITA 1WYKA 1TWXB 1AFEH 2GCHF 1CGJE 1ZMNA 1GBLA 2QXHA 4Y10E 4D76A 9LPRA 4KTCA 4WH6A 2F9OA 2CJIA 2OQ5A 5T6GA 4GVUA 3TNSA 4FUBA 1THPB 5C0TA 1GI2A 2ZKSA 3M5LA 1XUGA 3PLKA 1A4WH 1XMNB 1NROH 1GDQA 2A4GA 3KQCA 3FZDA 2KZ4A 4I31A 1GMDF 2XCFA 3GYLB 1GBAA 2ZDNA 2ANMH 2ZDKA 5C17A 1OWDA 4XFQA 3LGVA 5HGGA 2NU2E 2ZFPH 3WWBA 4D7FA 2ALPA 4NFEA 1GG6C 4MNYA 1KDQB 1XVMA 1V2OT 4SGBE 2AHME 3RXAA 1BT7A 4FU9A 3S9AA 4Y7AA 4ZKRU 5C94A 3MYWA 4ZUHA 1GGDB 1L1GA 4K8BA 1XVOA 1EAIA 1AIXH 6CHAB 3S7HB 1Z8RA 2AMPA 2AIPA 2FYQA 2IJOB 1HB0B 1Z1JA 1RS0A 1EZXC 3BTFE 1C5MD 1CU1A 1NRRH 1ZRKA 3H7OA 1O2LA 1TBRH 5LPRA 2XCNA 2BD7A 1HAPH 3SJKA 2AIQA 1C2EA 1VCPA 1AE8H 2XW9A 4TY7A 2WPHS 4BTIB 1LKAA 1UVSH 3RXIA 4BTUB 1O32A 1D3QB 1MU6B 1O2KA 2BY6X 1OHHD 3QO6A 1AD8H 1GBJA 2OBQA 2KCYA 2C8YB 3TGJE 3BTEE 3OTJE 2ZFRH 1SFQB 1RFNA 4O3TA 1F0UA 5EU8A 3F2FA 1ZSKA 4FU8A 3OY5U 5F03A 2TGTA 2UWOA 1BA8B 3PV2A 1HAGE 3UFAA 2Y82A 4Y8YA 1C2JA 5GCHG 4D7GA 4K3JA 2ZGCA 1DDJA 3SOSA 3NUMA 1GBBA 1DM4B 3MH7A 2OQUA 2PUXB 2QXIA 1JIRA 2A5AA 3A85A 4CRCA 2Q1JA 1K22H 1GMCF 3STIA 2EI6A 3ZVDA 1J17T 3DD2H 1TB6H 3RUOA 3MH4A 4Z6AH 3W94A 5C67A 1AE5A 2VVCA 2FI3E 3LC5A 1UK2A 2OP9A 1HGTH 3RC5A 2FEQH 1TPPA 1HJ9A 1GHYH 4JYTA 2IN2A 4DOQA 3SI3H 1PPZA 3TLOA 1EPTB 2FI5E 4M9FA 4HFPB 2STAE 2J5UA 4F55A 4WF8A 3OFND 2BOKA 2UWLA 2J9NA 3PM3A 1Y3YA 4A7IB 1SQAA 2XNDD 4Y6DA 4XRNA 2WV4A 2PWXA 4ISHH 5JB8S 2ZA5A 1H9IE 1PQ8A 1QGFA 1ZHPA 1G2MA 1O2HA 5JDUB 4OS6A 2F3CE 3GY3A 3SV7A 4DJZB 1T32A 3S9CA 2TGAA 2FM2A 3F9HA 1VCWA 1UVUH 2WPKS 1BMMH 1TE0A 4X8VH 1P05A 2PP6A 4NA8A 3B23B 3SN8A 5CMXH 5PTPA 2ZEBA 1TRMA 1DXPA 3SU2A 1HIAA 1S5SA 3TK6A 4AOQA 1H4WA 1S0RA 3M5NA 1CO7E 3RXJA 1NT1A 5DP7A 3ZV8A 1GI4A 1O3MA 3UWIA 1O2QA 3RC4A 1K1MA 1ZSJA 4KGAA 1SGEE 4FUIA 1EJAA 3LGTA 2KR7A 2V6NA 4IW4E 1S85A 1Q2WA 1N8OC 5EQRA 3FOAA 3Q00A 2O8TA 4TSFD 4BANB 3MMGA 1FZZA 2C3SA 1UK3A 3M7QA 5K0HA 1HAYB 3DFJA 3T2NA 1FJSA 3SZEA 2PLXA 2VGCC 1KY9A 1UCYE 1PPEE 3FVFB 1W0YH 1MKWH 4ZROA 1P3CA 2QAAA 2BY5X 1G3DA 5JB9S 1P12E 2BDAA 2F4LA 2HNTC 4ABHA 1A5IA 3MWIU 3LGIA 3SV6A 3SGBE 1QL8A 2PSYA 5HIZA 3ZZBA 3ENSB 5HIYA 1NRSH 5I46H 2O9QA 2EY4C 2FI4E 2BLQA 2OK5A 2EQNA 2PTCE 3VGCB 1AFQC 5EXLA 2UUJB 4FUCA 3MI4A 3GY2A 4NWKA 3SUGA 2Y7ZA 2ZU4A 4F49A 1B0FA 2PTNA 3S9BA 1ELAA 4TPIZ 3F6UH 4K1EA 1UTMA 3MO9A 2O8MA 2QF5A 3QDZB 1LVBA 3ZYDA 2B9LA 2H6MA 3S0NA 3LU9B 1ABIH 3KHVA 1O3BA 5C3NA 1W8BH 1SHHB 4CRBA 5A0CA 2P3UB 2QE7D 1QJ6B 2BDIA 1MABB 1F5KU 1BTZA 2WPDD 1P06A 1CA0C 1JRSA 2DE9A 3EA9A 1HXEH 1W3CA 5FCRA 1FY3A 4K2YA 3LT3A 2ZHDA 3A80A 4DCDA 3MOCA 4GCHF 4BXWA 1OOKB 1AGJA 3TVJB 3RXCA 4O03A 1QNJA 2JH6D 2G5NA 1GBKA 3F2HA 6ESTA 4MDSA 2BDGA 2VVVA 1TX8A 1H9LB 1NZQH 3A83A 2QC2A 4DY7B 1ZR0A 3DT0H 3SNDA 2Q6DA 3M7TA 4ISOA 2A7CA 2RA0A 2CN0H 3MNCA 3P8NA 5AHGH 3U8TH 3ZVAA 1A0HB 1DUEA 4OGXA 4CHAB 1V2RT 1EPTC 2Z9LA 4E06H 5EJLA 1FMGA 1DANH 3Q3KA 2R0KA 2UUKB 1BIOA 3D23A 3K2UA 1EASA 1DWDH 1KIGH 4B2AA 4D9QA 4X6MA 3C1KA 1SG8B 1TFXA 2LPRA 2D1JA 2WV5A 1GHWH 1GMHF 3SNCA 1HAVA 1C5ZB 2B0FA 1O3IA 1E36B 1ESTA 2QA9E 3AAVA 7KMEH 5E0JA 1S6FA 3QN7A 1XKAC 5GXPA 3UNRA 2ZFSA 2VWMA 1TIOA 4B74A 1ESBA 1O33A 1WU1A 2G8TA 4ZMAH 2QIQA 1PQ5A 3ESTA 1YLNA 4F4OC 1RIWC 1O30A 1QY6A 1A3BH 1YWUA 1IAUA 1KXBA 1PPGE 2VWNA 1ANEA 1TGSZ 1QTFA 1K0HA 4UFDH 1Y5AT 1O34A 3ZVEA 1QJ7B 2WPMS 4RKJB 1UTNA 2ZHEH 1WAYB 3M3VA 2XBYA 1EZSC 1GDNA 2AFQB 1IOEA 1L0ZA 3SU6A 5FCKA 1C5SA 1GJ9B 1BDAA 4GSOA 4B2BA 3BF6H 1G3BA 5GCHF 2P8OC 3RMOH 1LCYA 4PROA 1AVWA 2L6OA 3MU0A 1HCGA 3D62A 5ETXA 4YOJA 1QFKH 1KSNA 2FOMB 1MKXK 3BTKE 1ELGA 4NZLA 3V13A 3PMJA 4XBCA 3O8DA 1IHSH 4ZKNU 3SQEE 3U1JB 5IK2D 3TGIE 1B0EA 2XXLA 3EA7A 1NY22 1T4VH 3BG4B 3GCNA 3IG6B 1GG6B 1NU7B 5A8ZA 1DE7H 3U9AH 2HPPH 3ZVGA 1C9PA 5EQSA 1P2MA 2UUYA 2AH4X 4Y71A 1P01A 4UEHH 1O3EA 4AG1A 2WHXA 1GPZA 5E0HA 3RXQA 3BTQE 3RLWH 1L2EA 1ANCA 2HGTH 1UTKA 5B6OA 1C5YB 1RTLA 2A32A 2Y6TA 1H8DH 1ANDA 4IN1A 4BTTB 3KEEA 1PYTD 1E34B 3ZV9A 3W95A 2W6JD 3PV4A 1QQUA 1JIMA 1V2TT 4O3UA 1FI8A 1RXPA 3W1EA 4Q2KA 3ZZ7A 1ZTLA 4Q4LA 2IOTA 2XC4A 3LJJA 2FS8A 4XBBA 3SV8A 5GPIB 1HBTH 4JZEH 2P8OB 1FUJA 2B5TB 5ESTE 4K1SA 3RXTA 5FX5A 1SGFG 5JYIA 1GJ4H 1MD7A 1V2ST 1KLIH 1DS2E 3UPEA 1BUIA 2Z9KA 1DLKB 2A7HA 3UAIC 3ZYEA 3A82A 4CH2B 4BXSA 4ABAA 3QTVH 2C8WB 2PV9B 3ATIA 1DY9A 5E2OA 2ZPQA 4J2YB 2VIWA 1ELFA 4NCYA 3LIWA 4ZKOU 1KLTA 4D9RA 3BN9A 1P9UA 2PKAB 3ZZ3A 1SR5C 1MU8B 3BV9B 3NXPA 1GJCB 2G5VA 4DVAU 1SOZA 3V0XA 2J4IA 4DIIH 4AGJA 1GHZA 4AB8A 4CRAA 4GHQA 1VR1H 1MKXH 1SKYE 3JZ1B 2C90B 3SUEA 3MFJA 1DT2A 1W12U 1W2KH 1PPBH 4K1TA 1P2KA 1PQAA 3STJA 1T7CA 3U69H 3ZVFA 4Y7BA 1A2CH 2A5KA 3LPRA 5E8EH 1D3DB 3SJOA 1IQIA 1FAKH 1LVOA 2XTTB 4KTUA 4ZCNA 4VGCB 4Y11E 2O8UA 1YPKH 2I6QA 1QB1A 2ODPA 1EAWA 1IQGA 1YCPM 3RDZA 1DX5M 3HKJB 5C5OA 1C4U2 2Y5GA 2SGDE 1BMFD 4X2WA 1P2NA 3PV5A 1MAXA 2ZU3A 5FL7D 4YTAA 3G01A 1L1JA 3QZRA 1AUJA 1DLEA 2QCYA 3ZZ8A 5GDSH 5EPNA 2BDYA 1MTNC 1ZTKA 1LHFH 2BOHB 3KNXA 1C5NH 1Y59T 1YPHE 1UW7A 4ZXXH 1ELDE 3E91A 3KGPA 5FHTA 1SGRE 1GBEA 3TJVA 1O5EH 1OSSA 1DY8A 1O3DA 3NPSA 1TGNA 1Z6EA 2BY9X 2W5EA 3KL6A 1H1BA 2JETC 2W7UA 1FPCH 1HPGA 2W3KA 1O3CA 5FPSA 2SGQE 5F8ZA 3A8AA 1S6HA 1TMTH 1SGYE 1ZRBA 4IMZA 4ZHAA 2F9BH 1GCTB 1V2MT 1IQHA 1TNGA 2Z94A 3M7UA 3FO8D 3PO1B 3R0FA 2CF8H 2SGEE 1MQ6A 1GI7B 1QL7A 5DJ7A 1O2YA 2VU8E 1JBUH 1SI5H 1SGQE 1LHGH 2OXSA 2PSXA 3MH6A 3VB3A 1RIWB 2OTVA 4B6FA 1MTVA 2O8WA 5CHAC 2J92A 2LP6A 4JZIA 4OS4A 4NSVA 4R0IA 4HI3A 2GT7A 1LHDH 1Z71A 4FUFA 2OINA 1TRYA 1O39A 2STBE 4BNRA 1TOMH 4F48B 1V2VT 2IPHA 3RM0H 4HG6A 5FXLA 1C1NA 1J16A 3FKSD 1XUHA 1FX0B 4GAWA 1NPMA 2J98B 1O3HA 4B75A 1TNIA 2WPLS 2GDEH 4Q63A 2KFWA 2BX4A 5ESBA 2QXGA 1YY3A 2GZ7A 1LPZB 1YCPH 2KCAA 1LVYA 3PTBA 1VGCC 2GDDA 1P2OA 3N7OA 3P70B 4WMFA 4I7YH 2C93B 1C9TA 1KTSB 3GY5A 1YP9A 3VEQB 3ITIA 4IMQA 1NFYA 2GD4B 1TALA 4NA7A 1W0KD 4IBLH 3VB5A 1C4V2 1D9IA 1CGIE 1SGTA 3SNEA 1AKSA 3KF2A 4X8SH 3CENA 1AWFH 1NRPH 2K8IA 1NS3A 1YPJH 3TGKE 1GMHG 2I6SA 1MH0A 3U8RH 2P93A 1P2JA 1EJMA 1ETSH 3RXPA 2ZTZA 3E1XB 1MCVA 1N6XA 2EA3A 1EB2A 3IWMA 5EOKA 5I25A 3SI4H 1O5AB 3A7WA 5HYOA 1WTGH 1LQEA 2BVSH 1KXFA 5F8TA 2Z9IA 5FBIA 1O38A 1YLCA 5EG4A 2ODQA 3K6YA 3A8CA 1E79D 2J98A 3BSQA 3RXMA 2KAIA 3HKIB 4E7RG 1RD3B 4FUJA 4OS2A 3RXKA 2D26C 4YLUA 1BRCE 3GYMA 4WMEA 3SQHE 1DITH 4XE4A 5EGMA 4RT1A 3PROA 3VGCC 1ARCA 2VINA 2HVYB 2BD3A 2KCOA 1O5CB 3UY9A 2V3MA 4MNVA 2SGFE 2ZQ2A 1N6YA 1IQMA 1LHCH 3N7DA 4CREA 3GDSA 4HZHA 4U2WA 4YT7H 1BTUA 5L30H 1WSSH 1W7GH 1HJ8A 2J97A 4YM9A 5T1VA 2ZP0H 3EYDA 2JETB 1GVKB 2Y81A 3HGNA 1N8OB 3HK6B 3H5CB 2FYRA 2ZFTA 3RXEA 3TIUA 1D4PB 3FZZA 1O3LA 2AS9A 2A5IA 2YNBA 4NSYA 2FOFA 3BIUH 1BTHH 3Q3YA 4MVNA 3I29A 5AF9H 2F9UA 2AGGX 4M7GA 3E0NB 5F8XA 3GOVB 3SW2B 4WVPE 2W6ID 3OTPA 4O9VA 1O2GH 1V2KT 4TWWA 1CT4E 2ZNKH 1S0QA 3TJNA 2GCTB 3RXUA 3F9FA 1O2VA 3RXDA 2YMSC 1NO9H 4BAKB 1GWAA 3PRBA 3AVZA 1NBMD 2G52A 1K1NA 4R8TB 2QYIA 4DGJA 3MNXA 3NWUA 4TYDA 2A7JA 1GVZA 5GJ4B 1GBCA 1ZGIA 1V2LT 1AU8A 2BLVA 1C1UH 3UNSA 3AAUA 2AGEX 2V35A 1K28D 2GP9B 3H09A 4WMDA 3SGQE 1ACBE 1EOJA 4AB9A 3ATKA 2HVXA 1QCPA 3T25A 5SGAE 3BG8A 1G3EA 3MO3A 3M61U 1DSTA 4UONA 4WXIA 2ZPRA 1AI8H 1UVTH 2FWWA 1C5VA 1TX7A 1O2ZA 2PFEA 1IQLA 1COWD 3VB6A 8GCHG 3E3TA 4FUHA 5KEDA 4TWYA 7ESTE 3QUMP 1A7SA 2HWLB 2FDAA 1CBWB 1C2HA 1D3TB 2THFB 1BMNH 3B9FH 4GHTA 4X1RU 3D65E 3A7ZA 3SU4A 2BLWA 1NC6A 4JMYA 4MLFB 1TONA 1SQRA 4WY3A 5HMAA 1JXPA 1K1JA 4RT0A 1O2JA 3DSPA 2Z6BD 5EW2H 4MPXA 5DO4H 1TBZH 3EAJA 2XOKD 1BTWA 2WZQA 1SBWA 3OEED 3SU0A 1BBRH 1J8AA 1KYNA 3P6ZB 1O3PB 5CHAB 4ABJA 1FY8E 3TNTA 2ODYB 2FIRH 4XBDA 1M9UA 3MU8A 2OUAA 2ULLA 4ISIH 1BCUH 2CXVA 1HAIH 3ZZ4A 1D6WA 4ABIA 1PPHE 1W10U 2OC8A 4A1TA 1UHBA 4UDWH 2FLBH 3TPIZ 1SHYA 7LPRA 4FVBA 1HAXB 5J4SA 2CK3D 3WW7A 2Z9GA 3MQKC 3OU0A 4UFGH 2RA3A 1XUKA 1O5GH 5DKMA 1XUIA 3MU1A 1G2LA 5AVDA 2FO9A 5F6MA 1EP6A 3SNBA 3S69A 4A5TS 3N7EA 2IJD1 1P9SA 1P02A 1CQQA 1Y3XA 4H6TA 2BB4A 1S82A 2ZDLA 2BQ6B 2BQWB 1T8MA 2VIPA 1KLJH 1W0JD 3UNQA 3A7TA 4JK5A 4XOJA 5A2MH 4E7NA 2FX4A 1W13U 1O3AA 1RGQA 1V2UT 5AFZH 1QA7A 3Q76A 3QWCH 2BX3A 1E37B 4X1NU 1O3NA 4CH8B 4MG3A 1Y5UT 1IQKA 3E8LA 4TT3D 2JDID 3TH3H 1GHBG 3RMMH 1NRQH 1XXFA 2OC0A 4THNH 2Z3EA 2M2AA 2NU1E 3ELAH 3SU3A 3RU4T 4YT6H 2A4OA 2ZI2H 4MTBA 4O97A 5G4BA 5C0UA 4ESTE 2VGCB 4Q7ZA 3I77A 5JPMH 1PPCE 3TH2H 2BDHA 2G00A 1ZZZA 2CGAA 3U98H 1C4Y2 3SJIA 1GJ8B 3LGYA 1YPGH 1T31A 1UMAH 1O37A 4I8LA 1BRAA 1P09A 3LGUA 2BY8X 1PJPA 1D6RA 1XX9A 3M3TA 3B8JA 3GDUA 4WH8A 1H8HD 4I8HA 1H8ED 2BZAA 2J2UA 3BTWE 3I78A 3A81A 2GZ9A 3KQEA 4AFUA 2ZTXA 1NFWA 3R3GB 1YKTA 1ZHMA 1QHRB 4MPWA 1DUAA 4CHAC 4CR9A 4UFEH 3AW1A 1VCQA 3OE7D 3C27B 2V0BA 2XBWA 1EJNA 2F9VA 2ZZUH 1GBHA 1QRZA 2P95A 3O8RA 5E0GA 1F5LA 2XBVA 3SORA 1CVWH 1Q3XA 1GMCG 2FXRA 1K1IA 1BB0B 2G55A 5C1UA 4JZDH 2HPQH 1HRTH 3DCLA 5DP8A 1LVMA 1TQ0B 2ANWA 1ELBA 3BTGE 1V2NT 4ABDA 3LONA 4UE7H 5DP4A 1EZQA 2QF4A 2H9EH 4IC5A 3UUZA 1TNKA 5T6DA 2ZCKP 2BVRH 2P94A 1CGHA 1W14U 1AMHA 3RXBA 1OYTH 3TU7H 1TGTA 4MNWA 4IGDA 1FONA 2ZGJA 1C1OA 1TA6A 1ESAA 2QF3A 3DUXH 1MBQA 1DFPA 4FUEA 1ABJH 3RXHA 2ZGBH 1O2MA 1MTNB 2FODA 1ZGVA 1PFXC 1EPTA 1NTPA 3SV2H 3QGNB 2FX6A 3FP6E 4OGYA 1GI6A 1S6LA 5JBBS 1P2QA 1XXDA 2QV1A 4P02A 4NA9H 5IDKA 1HNEE 1SPJA 3AASA 5JBAS 2F91A 2R0LA 3RLYH 1EFRD 1E1QD 1O0DH 2AMDA 1WXRA 3AW0A 1TRNA 1AZZA 5A09A 2NWNA 1MQ5A 3E16B 1MMJN 1HAHH 1L1NA 4RI0A 1KXEA 1NFXA 3DFLA 1MD8A 1V2JT 2ILNA 1RJXB 1DSUA 4AG2A 2HLDD 1EXFA 1B5GH 2Y5FA 2ZDAH 4Z1MD 1YPHC 4AN7A 2OC7A 2FP7B 5GWZA 1QBNA 1TNJA 1GDUA 1KDQA 2EEKA 2JJ1D 2L74A 3GCTF 4X2XA 1ARBA 2FOHA 3F2GA 1AFQB 1CHOF 3UB0A 1SGPE 4A6LA 1ZJDA 4B73A 2HLCA 1FPHH 3A88A 1UTOA 1Y3VA 3SHCH 1O5FH 2TIOA 1C1WH 2C4FH 3RXRA 1KMHB 4U01A 1A3EH 3OSYA 1ZYOA 2UUFB 2WUCA 2ZIQH 1BTXA 2HNTF 1ORFA 2WYJA 3TITA 2BY7X 2BD4A 1OP8A 1YGCH 1EUFA 5HKKD 4Q7YA 1GMDG 3SZNA 1O5DH 1VKYA 1JWTA 1P03A 1GJ6A 1O2IA 2WPIS 7GCHG 2ZFFH 1DPOA 4I32A 3BIVH 3SUFA 1GL0E 1H8IH 4NWLA 5EW1H 1E0FD 2JJ2D 4Z0KA 1GCDA 1DXWA 3T26A 5EXMA 1P57B 3A7VA 1QRWA 1GJDB 4Q7XA 4MPUA 1FY1A 2SNVA 1NFUA 1UCYK 4KTSA 1GJAB 1IQJA 5GIBA 1GI9B 1UTPA 3BEFB 5FX6A 1T8NA 5L6NH 1TPAE 1NESE 1C5WB 2H1UA 3GY4A 1SLUB 4CRFA 1VJ9U 1DWEH 1ELVA 2TGPZ 1CT2E 3E0PB 1MTSA 6LPRA 2A45B 3GY6A 1TAWA 4J1YA 1MZAA 3QLPH 2WSSD 2ZHFH 3NKKA 1BHXF 4ABFA 3PLPA 5LH8A 2H9HA 3RP2A 1GJBB 3LGWA 2JIZD 1AWHB 4JZFH 4MQAA 2ZG0H 1THRH 1Y3WA 4FXGH 1MKWK 3FFGA 1G9IE 2KX4A 1FV9A 3MHWU 3P8GA 2A1DB 2BHGA 4HTCH 2BMGB 5EJZA 2Y5HA 1TNHA 4YZUA 1GCTC 1VGCB 2PGBB 2PHBA 2WPJS 1TABE 3Q3XA 1E1RD 1O2OA 1Z8IB 4H4FA 5BRRE 1AUTC 3FANA 4XDEA 1O3OA 1GI8B 2F9NA 5KGOA 4BOHA 4AFQA 1C2MA 3L3TA 3P95A 2GZ8A 2TPIZ 2ZU2A 1WOFA 3ATMA 3V12A 1GBMA 1Z7KA 2P3FH 2J95A 2ZGXH 3BTHE 3OY6U 1FLEE 2EI7A 3AK5A 3CS7A 4CBNA 1SLXB 4GPGA 3NRLA 1O5BB 2W3IA 3QTOH 3NK8A 4P00A 4AFSA 1HIAB 4ASUD 1BTYA 2ASUB 4GCHG 1HAVB 2BDBA 1U6QA 1TX6A 1KTTB 2CV3A 1XM1A 3GCHB 1XUJA 2P59A 2H5CA 3EGKH 1OWIA 2ZWLH 4RN6A 6GCHF 1GBFA 1YM0A 4KELA 5JBTA 3E90B 4IC6A 1C2DA 1YLDA 3GY8A 1UCYH 3DSGA 1QBVH 1FN8A 3SYJA 2YOLA 1GI0A 3LKWA 1HUTH 3NCLA 1OX1A 1B7XB 2SNWA 2J34A 2TRMA 1ZPBA 2V3HH 2RDEA 2ZO3H 2BXUH 3RXGA 1C2FA 3OEHD 4RKOB 1GBDA 1SC8U 1Z1IA 2Z9JA 3SGAE 1Z8JB 1O31A 4KKDA 1J9CH 3URCA 1H9HE 1SOTA 2FOBA 2BDCA 4Y76A 1NM6A 1ZOMA 4INHA 2VH0A 2PGQB 4WJG2 2KM0A 2VIDA 4ZHLU 2Y7XA 4K60A 1WTHD 3LOXA 1OYQA 2QY0B 4QT8C 1A61H 3M3SA 4BAMB 4NFFA 1LDTT 3A7XA 2VWOA 2Q6FA 1LTOA 4MPVA 1C2KA 3NZIA 4LK4A 2WV9A 1SGIB 4OS7A 1MTUA 1GHBF 1EX3A 3LH3A 3ODFA 4YO9A 1O2RA 3TK5A 1CSOE 1G37A 1GJ7B 1CHGA 2G81E 3DSOA 3KN2A 1OPHB 1C5PA 1SGCA 4NIWA 1CA0B 1K1LA 4H6SB 1OP0A 2VH6A 4IN2A 1DOJA 5EIYA 1GI5A 1FY5A 3M36A 4JYVH 2ZCHP 2AEIH 3JZ2B 4IS5A 2QF0A 4FUDA 5DP6A 2ZHQH 2ZTYA 5BPEA 3UR9A 5A0AE 1GJ5H 5A0BA 1BHXB 3F3BA 1ELEE 2V3OH 2V7QD 1TQ7B 5DG6A 1AB9C 1E35B 2BD9A 1GGDC 4FUGA 2SGAA 1OKXA 3HATH 4AC9A 1V2PT 2ZQ1A 5A8YA 5HM9A 5C1XA 2JKHA 1ZPCA 2Q6GA 2FLRH 1LQDB 3TJUA 1KXAA 4X0WU 1Q31A 4X1QU 2A0QB 2FPZA 3CP7A 1CT0E 1OS8A 2A4QA 3MNBA 4NG9H 4B76A 3OAAD 2EI8A 1GVLA
chains in the Genus database with same CATH topology
1SLWB 1C1VH 5LGOA 3T62A 3RXSA 3ODDA 4ZXYH 1HXFH 8ESTE 3L33A 2WUBA 4UD9H 1O35A 4A1XA 1SQOA 3WY8A 2A4RA 1P11E 3T28A 2GTBA 4DIHH 1C5UA 4Y0YE 5DGJA 1EAXA 1O2NA 2PKAA 4K8YA 1CBWC 4LZ1H 3T29A 4YESB 1TA2A 2PUQH 1FDPA 5FPYA 1RRKA 3ZZ9A 3SJ9A 1P2IA 1TLDA 2W26A 4OS1A 1QIXB 3KCGH 3UREA 2BD5A 2FS9A 1FIZA 4INKA 1DVAH 5L2YH 1LKBA 3BTME 1EOLA 3QZQA 1C1RA 1FQ3A 1UJ1A 4JK6A 5K7RA 1Y5BT 3ZZCA 3VXEH 1Y3UA 1GHAG 1PYTC 2BXTH 4H42U 1A1RA 2GMTB 3MTYA 4ZHMU 3V7TA 1XUFA 1GL1A 5EODA 1SL3A 4TY6A 5A8XA 4AGKA 3PWCA 2ZCLP 3OX7U 4OS5A 3PO1C 5C20A 1GI3A 2CF9H 2FTMA 3FP7E 1TBQH 4WXVA 3RXFA 2QN5T 2AYWA 4WWYA 3MU4A 3UTUH 1MBMA 3MO6A 2FOGA 1P3EA 3GISB 1F7ZA 4U30A 1BQYA 1S84A 1RTFB 1A0LA 1O2UA 2BZ6H 4K69A 2P16A 1BOQA 1QA0A 1BRBE 2AMQA 3K9XB 3VB7A 9ESTA 2ZU1A 1EAUA 4FVDA 3HPTB 1GBIA 2GCHG 3RMNH 1IQEA 1C1SA 1VJAU 2PKSC 2BM2A 1EP5A 2Y80A 3A87A 2PR3A 1D3PB 3S7KB 2A31A 1Z6JH 3ATLA 3GCTG 1MUEB 1HAOH 2VIOA 1AVXA 3P17H 4E05H 1ZLRA 4B1TA 2PW8H 3DHKH 1YF4A 2A2XH 2TBSA 1INCA 4UFFH 2RG3A 4XSKU 1A0JA 2AERH 2UWPA 1IQFA 2XNIA 1AQ7A 1YC0A 4GUXA 3SUDA 4DG4A 5TJXA 3UOUA 3ATWA 1T8LA 3SJ8A 1V6DA 3EDXB 4X8TH 2CHAB 2ZC9H 3TH4H 4AX9H 2WYGA 4AYYB 2FMJA 2HRVA 2VB0A 3M5OA 3SU5A 4AFZA 1G30B 6CHAC 2SGPE 2YNAA 3Q77A 3FAOA 4ABGA 2J94A 4NIVA 3UR6A 1SB1H 3URDA 3SU1A 1RTKA 1BMLA 1HDTH 5DK1A 1UTLM 3MU5A 1P10A 5C1YA 3VFEA 3RM2H 2B7DH 3D49H 1VITG 5L2ZH 1ELTA 3EQ0H 3SO3A 1ZSLA 4NIXA 3TK9A 3DA9B 1G36A 4JYUH 1C5TA 3P8OA 1F2SE 2DE8A 2ANKH 1C5QA 2XC5A 1QJ1B 1AZ8A 2VIVA 1ANBA 1C2IA 3BTDE 4BAOB 1BRUP 1AKSB 1MZDA 4ABBA 1GBTA 2XBXA 4Q80A 1AVGH 1LPGB 2F83A 2H2ZA 1F0TA 1Y8TA 1SGFA 4KP0A 1SVPA 2VIQA 1UK4A 3K65B 1SFIA 3RXLA 7GCHF 3PYHA 1WCZA 2ZFQH 3F9GA 3RU4D 1BMAA 1G32B 1W0ZU 4K5ZA 1VITH 3A89A 3SV9A 1K1PA 1ZPZA 2GV6A 3VXFH 1FN6A 3A84A 2Z3CA 1WBGB 2R9PA 3ZZDA 1SMFE 1C2GA 2BYAX 2GV7A 1ZMJA 2JH5D 3P92A 1ZHRA 3T27A 3SHAH 3RXVA 5FBEA 2F9PA 3A8DA 3M37A 4ISNA 1O3GA 2FESH 4AYVB 5C5NA 4AZ2B 5T6FA 1JMOH 1C1PA 4CR5A 3A86A 2OD3B 1F0SA 4A92A 2BD2A 4ZAEA 3GY7A 2NU0E 4NGAH 2HNTE 3UQOA 2LNCA 5T3HA 1K21H 1EQ9A 3KQDA 3U8OH 1J14A 1TMUH 3K6ZA 2GGVB 1VZQH 3VB4A 4ASHA 1HLTH 3BEUA 2G4TA 1HAZB 1TPSA 1BITA 2Z7FE 4MNXA 3ZVBA 2NU4E 1LO6A 1TGBA 2ZF0H 4X8UH 1TYNA 1TNLA 4YLQH 1ZJKA 1BTPA 2G4UA 3PMAB 1YCPK 1HJAC 2R3UA 1O2SA 2GVFA 1IQNA 1YPEH 1SQTA 2HOBA 1HJAB 5EQQA 5E2PA 1O2XA 1YYY1 3MH5A 1HV7A 1ETRH 4X2YA 5J4QA 2XWAA 1JRTA 2GCTC 5CE1A 1WQSA 2OC1A 2R3YA 3F68H 4X6PA 2BD8A 1K9OE 1YPMH 2ZHWH 3GDVA 1UO6A 1S81A 2C8ZB 3A8BA 4I33A 4TPYA 5C2ZA 3UQVA 2Z3DA 4I8KA 1UTQA 1OXGA 1ZTJA 4ZKSU 1NN6A 2AGIX 5EPYA 1AN1E 2ZDVH 3EE0B 4RSPA 1CHOG 1SGNE 3E6PH 2W7SA 1BJUA 3BEIB 1QRXA 1SSXA 1C5RA 4X6NA 4JZ1A 2XRCA 1L4DA 3RC6A 6GCHG 3O8CA 4LOYH 2D2DA 1P8VC 4ISLA 3TJOA 1QB6A 2ZECA 4B2CA 2NU3E 4Y8XA 4ABEA 3UIRA 1C1TA 2BVXH 1C2LA 2XC0A 1EATA 2GMTC 3VPKA 1A5HA 1FIWA 1G3CA 2FOEA 3UWJH 5JBCS 1SGDE 3F9EA 3BG4C 4SGAE 1C5XB 1EZUC 5H4IB 1OWEA 3QK1A 4ZH8A 2CHAC 2KAIB 2J38A 4I8GA 1MAYA 3PTNA 1AB9B 1SLVB 2H9TH 8KME2 1QL9A 1AY6H 1WV7H 2VVUA 3U1IB 3RU4E 3PLBA 2BQ7B 1BBRK 5FPTA 2O8LA 1W7XH 4NZQA 3GCOA 3UOPA 4DW2U 4X6OA 5DP5A 2GKVE 2H5DA 3ZZ6A 3ZZ5A 2EC9H 1DWCH 3A7YA 1W11U 4FU7A 3QX5H 2K1QA 3V3MA 1V2QT 5LPEA 1T4UH 1HFDA 1HYLA 4CBOA 3GICB 1O2TA 2VNTA 2D8WA 1K2I1 1GHAF 4BAHB 1V2WT 2OCVB 3RXOA 5TCAA 1X7AC 1BJVA 1ZMLA 3L6PA 1BBRE 1BZXE 1O2PA 3M5MA 3ZVCA 4CRGA 1OP2A 3LH1A 4U32A 3RMLH 2R2MB 1QR3E 1FXYA 3FP8E 1N1LA 1UTJA 3CS0A 2R2WU 4GLYA 1EKBB 1OWJA 5HXFA 2TGDA 1F5RA 1C5OH 1O3JA 1GHVH 1CE5A 2SFAA 1LPKB 1C1MA 1O3FA 2GT8A 4NIYA 3KIDU 1TOCB 4D8NA 4AORA 8LPRA 1PPFE 2PKSB 5FAHA 5DPAA 8GCHF 4HGCA 1NRNH 1NU9A 1QBOA 4X2VA 1UVOA 1CA8B 3PMHB 2M5TA 2ALVA 1THSH 1YPLH 5EXNA 3O8BA 2G51A 2WINI 2P3TB 1V3XA 2B8OH 1T8OA 1JOUB 2CMYA 4Y79A 4YOIA 5DP9A 2ZPSA 5HM2A 3GCHC 1ID5H 4DT7B 3M35A 1QURH 5IYTA 2RCEA 1WUNH 1AO5A 5LPFA 5DP3A 2QGRA 3SBKA 1UVPA 1ELCA 1XKBC 1OWHA 4JCNA 4VGCC 4LXBH 1Z8GA 1IHTH 1TMBH 3BTTE 3PMBB 3T5FH 1QQ4A 2XYAA 3H7TA 1DICA 1O36A 1WQVH 4I8JA 2FOAA 2JH0D 1QB9A 1S83A 3OYPA 1C1QA 3PWBA 1TPOA 1P0SH 1E38B 2OLGA 1P04A 1KXDA 3F1SB 1L4ZA 5TCCA 2ESTE 1A46H 3LJOA 2QXJA 1K1OA 1LHEH 5AFYH 2OBOA 4INLA 4Y8ZA 3LC3A 3QGJA 2DUCA 3HK3B 2RDLA 1KXCA 5ABWA 3KQBA 2ZU5A 2ZDMA 1LMWB 4X1SU 2ZGHA 2ANYA 2BTCE 1ETTH 1YBWA 4LZ4B 2XWBI 4BAQB 2FZZA 2HALA 3EA8A 1O3KA 4YOGA 2FTLE 1EB1H 1FAXA 1PQ7A 1GI1A 1DWBH 3PB1E 3SNAA 1C5LH 3MNSA 1F0RA 1O2WA 1MTWA 2GX4A 2FOCA 4CRDA 1OWKA 1A5GH 1GHXH 4B71A 1UHBB 1VITF 3LDXH 1FY4A 1MCTA 4Y0ZE 4A1VA 1F92A 2C8XB 3P8FA 1AHTH 2VWLA 1J15A 1TGCA 2A2QH 3ZZAA 4DURA 2BLOA 3HGPA 2VJ1A 4X1PU 1FNIA 3IITA 1WYKA 1TWXB 1AFEH 2GCHF 1CGJE 1ZMNA 1GBLA 2QXHA 4Y10E 4D76A 9LPRA 4KTCA 4WH6A 2F9OA 2CJIA 2OQ5A 5T6GA 4GVUA 3TNSA 4FUBA 1THPB 1GI2A 2ZKSA 3M5LA 1XUGA 3PLKA 1A4WH 1XMNB 1NROH 1GDQA 2A4GA 3KQCA 3FZDA 4I31A 1GMDF 2XCFA 3GYLB 1GBAA 2ZDNA 2ANMH 2ZDKA 1OWDA 4XFQA 3LGVA 5HGGA 2NU2E 2ZFPH 4D7FA 2ALPA 4NFEA 1GG6C 4MNYA 1KDQB 1XVMA 1V2OT 4SGBE 3RXAA 1BT7A 4FU9A 3S9AA 4Y7AA 4ZKRU 3MYWA 4ZUHA 1GGDB 1L1GA 4K8BA 1XVOA 1EAIA 1AIXH 6CHAB 3S7HB 1Z8RA 2AMPA 2AIPA 2FYQA 2IJOB 1HB0B 1Z1JA 1RS0A 1EZXC 3BTFE 1C5MD 1CU1A 1NRRH 1ZRKA 3H7OA 1O2LA 1TBRH 5LPRA 2XCNA 2BD7A 1HAPH 3SJKA 2AIQA 1C2EA 1VCPA 1AE8H 2XW9A 4TY7A 2WPHS 4BTIB 1LKAA 1UVSH 3RXIA 4BTUB 1O32A 1D3QB 1MU6B 1O2KA 2BY6X 3QO6A 1AD8H 1GBJA 2OBQA 2C8YB 3TGJE 3BTEE 3OTJE 2ZFRH 1SFQB 1RFNA 4O3TA 1F0UA 5EU8A 1ZSKA 4FU8A 3OY5U 5F03A 2TGTA 2UWOA 1BA8B 1HAGE 3UFAA 2Y82A 4Y8YA 1C2JA 5GCHG 4D7GA 4K3JA 2ZGCA 1DDJA 3SOSA 3NUMA 1GBBA 1DM4B 3MH7A 2OQUA 2PUXB 2QXIA 1JIRA 2A5AA 3A85A 4CRCA 2Q1JA 1K22H 1GMCF 3STIA 2EI6A 3ZVDA 1J17T 3DD2H 1TB6H 3RUOA 3MH4A 4Z6AH 3W94A 5C67A 1AE5A 2VVCA 2FI3E 3LC5A 1UK2A 2OP9A 1HGTH 3RC5A 2FEQH 1TPPA 1HJ9A 1GHYH 4JYTA 2IN2A 4DOQA 3SI3H 1PPZA 3TLOA 1EPTB 2FI5E 4HFPB 2STAE 4WF8A 2BOKA 2UWLA 2J9NA 3PM3A 1Y3YA 4A7IB 1SQAA 4Y6DA 2WV4A 2PWXA 4ISHH 5JB8S 2ZA5A 1H9IE 1PQ8A 1QGFA 1ZHPA 1G2MA 1O2HA 5JDUB 4OS6A 2F3CE 3GY3A 3SV7A 4DJZB 1T32A 3S9CA 2TGAA 2FM2A 3F9HA 1VCWA 1UVUH 2WPKS 1BMMH 1TE0A 4X8VH 1P05A 4NA8A 3B23B 3SN8A 5CMXH 5PTPA 2ZEBA 1TRMA 1DXPA 3SU2A 1HIAA 1S5SA 3TK6A 4AOQA 1H4WA 1S0RA 3M5NA 1CO7E 3RXJA 1NT1A 5DP7A 3ZV8A 1GI4A 1O3MA 3UWIA 1O2QA 3RC4A 1K1MA 1ZSJA 4KGAA 1SGEE 4FUIA 1EJAA 3LGTA 2V6NA 4IW4E 1S85A 1Q2WA 1N8OC 5EQRA 3Q00A 2O8TA 4BANB 3MMGA 1FZZA 2C3SA 1UK3A 3M7QA 5K0HA 1HAYB 3DFJA 3T2NA 1FJSA 2PLXA 2VGCC 1KY9A 1UCYE 1PPEE 3FVFB 1W0YH 1MKWH 4ZROA 1P3CA 2QAAA 2BY5X 1G3DA 5JB9S 1P12E 2BDAA 4ABHA 2HNTC 1A5IA 3MWIU 3LGIA 3SV6A 3SGBE 1QL8A 2PSYA 3ZZBA 3ENSB 1NRSH 5I46H 2O9QA 2FI4E 2BLQA 2PTCE 3VGCB 1AFQC 5EXLA 2UUJB 4FUCA 3MI4A 3GY2A 4NWKA 3SUGA 2Y7ZA 2ZU4A 4F49A 1B0FA 2PTNA 3S9BA 1ELAA 4TPIZ 3F6UH 4K1EA 1UTMA 3MO9A 2O8MA 3QDZB 1LVBA 3ZYDA 2B9LA 2H6MA 3S0NA 3LU9B 1ABIH 3KHVA 1O3BA 5C3NA 1W8BH 1SHHB 4CRBA 5A0CA 1QJ6B 2BDIA 2P3UB 1F5KU 1BTZA 1P06A 1CA0C 1JRSA 2DE9A 3EA9A 1HXEH 1W3CA 5FCRA 1FY3A 4K2YA 3LT3A 2ZHDA 3A80A 4DCDA 3MOCA 4GCHF 4BXWA 1OOKB 1AGJA 3TVJB 3RXCA 4O03A 1QNJA 2JH6D 2G5NA 1GBKA 6ESTA 4MDSA 2BDGA 2VVVA 1TX8A 1H9LB 1NZQH 3A83A 2QC2A 4DY7B 1ZR0A 3DT0H 3SNDA 2Q6DA 3M7TA 4ISOA 2A7CA 2RA0A 2CN0H 3MNCA 3P8NA 5AHGH 3U8TH 3ZVAA 1A0HB 1DUEA 4OGXA 4CHAB 1V2RT 1EPTC 2Z9LA 4E06H 1FMGA 1DANH 3Q3KA 2R0KA 2UUKB 1BIOA 3D23A 3K2UA 1EASA 1DWDH 1KIGH 4B2AA 4D9QA 4X6MA 3C1KA 1SG8B 1TFXA 2LPRA 2D1JA 2WV5A 1GHWH 1GMHF 3SNCA 1HAVA 1C5ZB 2B0FA 1O3IA 1E36B 1ESTA 2QA9E 3AAVA 7KMEH 5E0JA 1S6FA 3QN7A 1XKAC 5GXPA 3UNRA 2ZFSA 2VWMA 1TIOA 4B74A 1ESBA 1O33A 1WU1A 2G8TA 4ZMAH 2QIQA 1PQ5A 3ESTA 4F4OC 1RIWC 1O30A 1QY6A 1A3BH 1IAUA 1KXBA 1PPGE 2VWNA 1ANEA 1TGSZ 1QTFA 4UFDH 1Y5AT 1O34A 3ZVEA 1QJ7B 2WPMS 4RKJB 1UTNA 2ZHEH 1WAYB 3M3VA 2XBYA 1EZSC 1GDNA 2AFQB 1IOEA 1L0ZA 3SU6A 5FCKA 1C5SA 1GJ9B 1BDAA 4GSOA 4B2BA 3BF6H 1G3BA 5GCHF 2P8OC 3RMOH 1LCYA 4PROA 1AVWA 3MU0A 1HCGA 3D62A 5ETXA 4YOJA 1QFKH 1KSNA 2FOMB 1MKXK 3BTKE 1ELGA 4NZLA 3V13A 3PMJA 4XBCA 3O8DA 1IHSH 4ZKNU 3SQEE 3U1JB 3TGIE