3TITA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg81
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARS coronavirus main protease
molecule tags Hydrolase/hydrolase inhibitor
source organism Sars coronavirus
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3titA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA02
2TGAA 3VXEH 2Z9JA 4D8NA 1VGCC 2AMPA 2Z9LA 2AGIX 2VJ1A 2PTNA 2Q6DA 2ZCHP 5CHAB 1O2MA 5EXNA 3SV2H 2Y5GA 1EZQA 2VB0A 8GCHG 1QCPA 2BVSH 3A89A 4ABEA 1HAVB 2VU8E 4ABIA 3URDA 1LMWB 3F9GA 2G4UA 2BD2A 2ZFSA 3U98H 1ZYOA 4MQAA 3OY5U 3VB7A 1DPOA 1GMDF 3TK6A 4A5TS 2F9BH 1Z6JH 1SHHB 9LPRA 1C2JA 2CF8H 4NA8A 1LKBA 1DOJA 4JZEH 2HRVA 4WXVA 3UTUH 1QJ7B 3NUMA 3T5FH 1GHBF 1W2KH 4K2YA 3PYHA 2TRMA 3LKWA 1HAYB 2GCHG 2H9EH 1P2IA 2R2MB 3MU0A 2TBSA 1MD7A 2OD3B 1C5VA 4CH2B 1C1PA 3A87A 4CHAB 4GLYA 1TRMA 2ANMH 1EZUC 1BBRH 2SNWA 1UTKA 3LGTA 1SFQB 1O2WA 1GI2A 2H6MA 3KNXA 4LOYH 3MYWA 1VCQA 5FCKA 5ESBA 1Y3YA 2PKAA 1T31A 1AVXA 3GY2A 5BPEA 1PPEE 5HGGA 1B0EA 1YPKH 1Z8GA 4Y79A 1O5EH 4K1TA 1O2IA 1DITH 4X6NA 4JYVH 4B74A 1F92A 2ZFFH 1MKXH 2QXIA 2AH4X 2J2UA 2FOFA 3BF6H 5BRRE 4INKA 1O0DH 1RGQA 3PMHB 1FXYA 1G3DA 1Y5BT 5F03A 4THNH 1MKWK 1GL1A 1GDQA 3I29A 1B0FA 3RXUA 1GI0A 2ESTE 2HGTH 3FVFB 4JK6A 1ZSKA 3R3GB 4ZKOU 1THRH 2A5IA 4MVNA 1OWDA 2H5CA 1RXPA 4Y7AA 1PYTC 4NGAH 5CE1A 2SGFE 5EOKA 2Y7XA 5F6MA 5FHTA 3RXSA 3ZZ9A 2PWXA 1A5IA 3ZZDA 3LC5A 3GDUA 1OP2A 1AQ7A 2FDAA 1AFQB 1EZSC 1TX6A 1RIWB 2PSXA 3B9FH 4BAQB 1MQ6A 2P59A 3RLYH 3SNBA 1QBOA 1HAHH 1QB1A 1GHAF 2FI5E 1TA2A 2WUCA 3EBNA 1KXAA 3HKJB 2AMQA 2DE9A 3RM0H 2V3HH 4I32A 1FLEE 1LDTT 1NO9H 1OWJA 2ZU4A 1T4UH 3ATLA 2VWNA 1IQHA 1QR3E 5C1XA 1BTPA 1WQSA 2FOEA 1AHTH 4JYTA 2Y5FA 4WY3A 2ZPRA 1C2EA 1GI4A 3K9XB 3Q3XA 2FTMA 3A83A 1O3OA 2BY8X 2ZTXA 1F0RA 1RTLA 4YOIA 1EOLA 3TGJE 3U8TH 1ZRBA 3ZVBA 4D76A 3M5LA 3RU4D 1JIRA 2R9PA 1B7XB 2F3CE 4D9QA 2FZZA 1ANBA 2GDDA 3RMOH 4DVAU 1QQUA 2Y6TA 2EI7A 1C2GA 4WH8A 3V13A 3GISB 1FV9A 1Z6EA 3U1IB 1IAUA 1SGIB 1VITG 1XVMA 4GVUA 1DWDH 4SGBE 5JBCS 1EB2A 3BIUH 3RU4E 2ODYB 2LNCA 4D7FA 5L2YH 1AU8A 4HTCH 4FUGA 4A6LA 3ZZ4A 1BRBE 2ZU5A 1SQOA 2AGGX 3ATIA 1SPJA 1QRZA 1ZJKA 1BRCE 1QURH 1UVUH 3KGPA 3P8FA 1C5ZB 1PYTD 3CENA 4Y10E 1HAPH 3MOCA 1RTFB 1UTPA 3ESTA 5J4SA 4X8TH 2FESH 1O3NA 3MH5A 3KCGH 2J95A 1P9UA 1LHCH 1WV7H 1WYKA 3UR6A 1QB6A 2F9PA 1AZZA 1WQVH 4DIHH 2AERH 2VGCB 1C5TA 1QTFA 3PO1B 2GP9B 1TBZH 4CBOA 1XUJA 2NU2E 2A45B 1MTNB 1F7ZA 1YGCH 3F9EA 1W8BH 3HGNA 1NROH 1ZZZA 5ABWA 1LKAA 1RRKA 2AS9A 3ZVCA 2J94A 4MNYA 4A1XA 2GKVE 3L6PA 3SU2A 2QCYA 3RXIA 4FUBA 3GY5A 1Z71A 1HLTH 1AO5A 5C67A 1L1JA 1S6FA 4Y8XA 4AN7A 1O5GH 3E0NB 2BX3A 1T8MA 3ATMA 1TPAE 4BANB 3E91A 1QBNA 1DXWA 1MBMA 4TY7A 3RC6A 1OX1A 3SNAA 3O8CA 2ZU1A 1C2HA 1ACBE 5HXFA 2XBYA 4NFFA 5C20A 1IQLA 4Y8YA 2ZNKH 1W14U 3A84A 3F6UH 3MO6A 4AX9H 4DIIH 3A8BA 2A2XH 3MNCA 2BY6X 1O2JA 1MQ5A 1BT7A 2NU0E 1FMGA 1OWHA 3T27A 2VH0A 1DWEH 2ANKH 1O5AB 4X0WU 1YPHE 4XBBA 1AKSB 4IS5A 2P16A 3RP2A 1AFEH 1P57B 1NRPH 2XYAA 2Z9KA 1YYY1 4F49A 2FYRA 1F0TA 4TY6A 3CS0A 4YT7H 3VGCB 3E8LA 1J17T 1EPTB 4D9RA 1AKSA 4E7NA 1MTNC 2ZQ1A 1O3JA 1C1SA 3ZV8A 1E37B 1QL7A 1ABJH 2WPHS 3V12A 3BSQA 4ABJA 4WMFA 2ZIQH 2O9QA 1GJ8B 1K1JA 4K1EA 1YC0A 1HIAB 4XFQA 1BQYA 3AVZA 4BXWA 2ZHFH 1CU1A 4FU8A 1HAVA 1TQ0B 1V2RT 3PM3A 1H9IE 2PR3A 2TPIZ 4D7GA 1XUFA 2ASUB 4I31A 1VITF 3TNSA 1S82A 2AEIH 2XW9A 1UK2A 1GHBG 1SQTA 3LGWA 1ZTLA 2QYIA 3EA7A 1UMAH 2BY5X 2ODPA 1CSOE 2HPPH 4FVDA 2TIOA 4I8LA 4NIXA 1GBTA 1S0RA 8LPRA 3ZVFA 1AWHB 2OBOA 1C2DA 1QFKH 1GI6A 1AE5A 1WOFA 3M3TA 1AE8H 2SGAA 1N6YA 3K6ZA 5DP6A 3TGIE 2C93B 1S83A 2Q6GA 4KGAA 3UWJH 4ESTE 1XXFA 2BQ6B 1N6XA 3D62A 3RXAA 2GX4A 3P8NA 3SQEE 4TWYA 1HAXB 1ZGIA 4H6TA 2KAIB 4WH6A 2XC4A 2HOBA 3A85A 1XM1A 1SGDE 4DCDA 2ZGJA 1LCYA 1ZJDA 6GCHF 2F9UA 2QY0B 1NRSH 1KXEA 2OC7A 1EPTC 4Q2KA 3PMAB 4K8BA 1GI8B 3VB3A 1TOCB 2W7UA 4XBCA 4AFUA 2OC0A 3BIVH 1DFPA 3EA9A 1O3PB 1CA8B 1CT4E 3T62A 1CGJE 3GCHC 1MMJN 1OXGA 3EQ0H 4ZUHA 1AZ8A 2G52A 4JYUH 2ZCKP 3BTWE 1LPGB 1C1RA 1RFNA 1SOTA 4DG4A 1O2XA 3DD2H 3TJNA 1SGNE 1ETRH 1HV7A 1O34A 1CHOG 1J14A 4U30A 3BTQE 1C1UH 3IG6B 3ELAH 2BOKA 1AGJA 1CBWC 1J16A 1NN6A 2FLRH 2H9HA 4LZ4B 4DW2U 5J4QA 3RXVA 1GBKA 2SFAA 5T6DA 1A5GH 5L2ZH 1GBMA 3NPSA 4AFZA 1O2ZA 1ORFA 2WINI 5C1YA 3SJIA 1UO6A 2V0BA 4OS7A 3AAUA 1HXFH 3MU1A 1IQEA 5E0HA 3RLWH 2QXHA 2NU3E 1DWCH 2UWLA 4PROA 2C8WB 4CRDA 1O2UA 1GVLA 1P0SH 2J4IA 3SUEA 1ZR0A 1EJAA 4BTUB 2QV1A 1F5KU 2J34A 1GBCA 5L30H 4Q80A 1TGBA 5FX5A 1YCPM 5A8YA 1EUFA 3PLPA 2ZFTA 1S84A 2FXRA 1BZXE 2A32A 4AFSA 2GZ8A 1OSSA 3SZNA 1WSSH 1DXPA 1F2SE 2Z3CA 5DP7A 1TNKA 2Y7ZA 1N8OC 1XX9A 2ALPA 2PGBB 2FOHA 4U01A 1MU6B 3RXFA 5A0CA 2F9OA 2ZDLA 2XC0A 2TGTA 2BD9A 3VB5A 3T26A 2BDBA 1TGTA 2EI8A 1UVPA 1UCYH 3BTDE 3B23B 2PV9B 2QF0A 3GYLB 1WTGH 1KXDA 1ZPBA 1EP6A 1UTQA 1W7GH 2FI3E 1FPCH 1TOMH 5SGAE 3FAOA 1EJNA 1MTWA 4X2VA 2O8TA 2IJOB 3DFLA 1ZPCA 1SHYA 4U2WA 5EQRA 1ARBA 3RXQA 3M35A 4SGAE 3A82A 3V3MA 3SGQE 3MI4A 1DUEA 1UTLM 3S9BA 1GMCF 1GPZA 2DUCA 2ZKSA 1ZTJA 5DJ7A 1JXPA 1BMLA 3L33A 1GBIA 4AGJA 2XBWA 4AG2A 1QA0A 2I6QA 4GHTA 1IHTH 2GCTB 2HNTC 3P8GA 1K1MA 5EW2H 3UUZA 4B2BA 4BAKB 2UUJB 2QA9E 2Y5HA 1BJUA 4TYDA 1EAWA 3Q3KA 1P01A 2ALVA 4K60A 3A7YA 3NCLA 4B75A 4ZROA 1NU9A 3ZV9A 1B5GH 1JOUB 1MAYA 1YM0A 3VB4A 3C27B 1VR1H 4FUCA 1TNHA 4UDWH 1CO7E 2GT8A 2C8ZB 1P02A 3STIA 1C1QA 1NFXA 4Z6AH 3LJJA 4JCNA 5FX6A 3LGVA 3JZ2B 1L1GA 1YP9A 2P93A 4Q7YA 5ETXA 1G30B 1G36A 4GCHF 5JB9S 1HAOH 2OLGA 1KY9A 3ZYDA 2ZPSA 2IOTA 4Y76A 3QTVH 2ZFQH 1JRSA 1EATA 1C1MA 3K6YA 3PTNA 1A7SA 5EXMA 1FIZA 1TONA 5G4BA 1KXFA 1YPGH 3OSYA 3SJOA 1V3XA 1W3CA 1HAIH 7GCHF 1V6DA 1UTMA 2VVCA 2UUYA 2ZI2H 3RMLH 2Y82A 1HFDA 2UUKB 2P95A 1GI1A 2ZGBH 1AY6H 4IN1A 5GWZA 1GVKB 3SOSA 3STJA 2EA3A 2FYQA 1SBWA 1UTJA 2R3UA 2ZFPH 1BTYA 4X6OA 4UD9H 2M5TA 2Z6BD 3SGAE 1WBGB 3BTME 5LPFA 4TPYA 4AZ2B 3OY6U 3TIUA 1DLKB 2QIQA 1DY8A 2BB4A 4ABDA 4ISNA 4OS1A 2SGEE 2ZPQA 4RN6A 4NFEA 5FPSA 1DY9A 3DA9B 2OQ5A 1FJSA 4NSYA 1GMCG 2A1DB 5IYTA 3SJ9A 1TGSZ 2WPKS 1XVOA 2W5EA 5AFYH 1ZGVA 1LHFH 3A88A 1P06A 1UHBB 1IQNA 3OTJE 3SI4H 1HJAC 4KKDA 1K1IA 4MLFB 1TFXA 3PMJA 3H5CB 1KDQA 2NWNA 3U8OH 3NK8A 1XKAC 2CXVA 1AUTC 1QBVH 3O8BA 5FPTA 4DY7B 5E0JA 1V2LT 1SGYE 1E38B 3KQCA 3M37A 1P04A 3KQBA 1O36A 1IQGA 3SU1A 1ELGA 1V2OT 4AG1A 3UNSA 1HAZB 1PFXC 1D3QB 2XRCA 1C5NH 1MH0A 4JMYA 3PB1E 1HJAB 2VIVA 3GICB 5L6NH 1LVOA 3EGKH 2HPQH 2ZHWH 4NIWA 1IQJA 1W7XH 4CRAA 2JETC 3PO1C 2BHGA 4VGCB 3ZZ3A 6ESTA 2GV6A 1DT2A 1O5BB 3BTGE 2D2DA 1XUGA 1ELCA 3BTEE 3ZZ5A 1K21H 1Y8TA 2FIRH 1NC6A 1QJ1B 1V2KT 2OCVB 3PLKA 3TVJB 2AYWA 1GI7B 1GJ4H 4LK4A 1G2MA 1BMMH 1W0YH 3M7QA 1K9OE 4ZKSU 3HK6B 1HGTH 2OBQA 2W3IA 4Y0YE 2CGAA 1SGCA 4KELA 4TPIZ 3RU4T 1TE0A 4OGXA 3T29A 2GVFA 4DGJA 1P2QA 1YPEH 4GSOA 1ELFA 1UK4A 3KEEA 2JETB 3RM2H 2UUFB 4GAWA 3V7TA 1MZDA 3BG4B 4FU9A 4CBNA 3BEUA 1YCPH 3A86A 3K65B 3TJVA 3MFJA 1QY6A 5PTPA 1KTSB 2WPIS 1GHAG 2BQ7B 1V2UT 2SGQE 2A7CA 1MKWH 3KN2A 3GYMA 1KSNA 3QO6A 1NPMA 1O2TA 3NZIA 3U1JB 1P10A 1PQ8A 1V2JT 1TRYA 2BOHB 1N8OB 4XOJA 4ZMAH 2BLVA 2ZEBA 4Y6DA 1T4VH 2HALA 2V35A 2LPRA 2PFEA 1H9HE 1FZZA 1EB1H 1QGFA 1EAIA 2B9LA 2UWOA 4MPWA 1LQEA 4E7RG 1ELVA 3GY7A 1P2OA 1C5RA 2CHAC 4ZHMU 1YCPK 2VIWA 1MTUA 3FZDA 1PPZA 2A4RA 4CH8B 1C4U2 1Z1JA 3MTYA 3S7HB 1OP0A 1G3EA 1ZLRA 5C5OA 1EAUA 1Y59T 3LOXA 1SGFA 2FOGA 1L4DA 1HB0B 2JKHA 1QA7A 1P2JA 1TX8A 1HRTH 1O2RA 1BMAA 2XBXA 4ISOA 3SHAH 4Y11E 2KAIA 5C1UA 5EPYA 2RA3A 4X1NU 1HJ9A 2GCTC 1A46H 2R3YA 5LPEA 1C5QA 1DE7H 1V2QT 2ZZUH 1O2VA 1O2HA 1Y5AT 4Q7XA 4UFEH 4OGYA 3BTHE 3ODDA 3A8AA 3LJOA 2GZ7A 1SLVB 1SGTA 1NT1A 3L3TA 3SORA 5K7RA 3AW0A 4UFGH 1GGDC 3DUXH 5GCHF 2RDLA 4ABBA 4YLUA 3MH7A 1NRRH 2G4TA 4QT8C 1G3CA 3GY3A 2QF3A 1P09A 1UCYE 2A5KA 1TBQH 1C1VH 1TNGA 1BB0B 2FX4A 5I25A 2JH6D 4DOQA 2QN5T 2VIDA 5JB8S 4BTIB 1V2WT 5CHAC 3E90B 3A7TA 4BAMB 3UY9A 1EASA 2ZU3A 4JZDH 1GJDB 1OS8A 5HMAA 3VB6A 3ZZ8A 1XKBC 3LDXH 4H6SB 2WYJA 1BTXA 1C5XB 2BD3A 2VGCC 4GCHG 5DG6A 5DKMA 5EPNA 1DSTA 3ATKA 4J2YB 1L2EA 5FBEA 1G32B 3UREA 2ZFRH 1S6HA 2B8OH 3A7XA 1C2FA 3ODFA 1O3BA 3SU5A 3I77A 4ABGA 3GOVB 2Z3DA 3UPEA 1FUJA 1ZMJA 3EE0B 1PQ5A 2GT7A 1O5DH 4LXBH 1O3GA 4MPXA 4B1TA 2QXGA 1XXDA 1NTPA 3BV9B 3S9AA 5GPIB 1EAXA 3SU6A 3QGJA 2EEKA 1EJMA 1EQ9A 4OS4A 3GDSA 1Q31A 1SOZA 1C9TA 3PV4A 2BDCA 1BHXB 1HYLA 4AFQA 4WMEA 2ZG0H 4ISLA 1GBAA 4MTBA 2G55A 5A0BA 4IGDA 2ZCLP 2YNAA 2JH0D 3SU4A 4JK5A 1TBRH 4A7IB 1GJCB 3DFJA 1E0FD 1FAXA 1ELAA 3EAJA 3HATH 1KTTB 3MMGA 1ZHPA 1SLXB 2A4GA 2AIQA 4IBLH 1FI8A 5JBTA 2LIZA 4YT6H 1C5WB 1ELBA 3SNEA 1K2I1 4K5ZA 3LPRA 1GMHF 3VXFH 3U69H 4X1SU 1SLUB 7KMEH 1C5PA 1T8LA 5AHGH 3RXTA 1S0QA 1W13U 1YPLH 2YNBA 3UOPA 3OU0A 1EPTA 1A1RA 1GJ6A 3T2NA 3S7KB 5HM2A 1TRNA 1K1NA 1VCPA 1FNIA 3QDZB 2PSYA 1A4WH 1TMUH 1BTZA 1TX7A 4WXIA 4MG3A 5B6OA 4B71A 1ZSJA 2VVUA 1LVBA 1TPOA 2I6SA 3MNXA 2XWBI 4BTTB 1BJVA 4LZ1H 1GMDG 4NWLA 5EU8A 3LONA 3QLPH 1QJ6B 3A81A 4AORA 3FFGA 3QX5H 2CN0H 4ZXXH 5F8TA 1HAGE 3UNQA 2O8MA 1V2MT 3FANA 4BOHA 3TJUA 1NY22 1W12U 1CT2E 1GCTC 3OX7U 1VJ9U 1GHYH 2G5VA 2QC2A 2H9TH 1GBEA 4Y0ZE 1MKXK 1RTKA 3UQVA 4OS5A 4A1TA 2CMYA 1BTUA 2RG3A 1GDUA 4CR5A 1MTSA 1H9LB 1HPGA 2V6NA 4MNXA 3PLBA 1LO6A 5A8XA 1Z8IB 1AVGH 1SG8B 1FN8A 3T25A 3ZZCA 4E06H 2ZTZA 2C4FH 2A4OA 5AFZH 1G2LA 3RC5A 3RXCA 1DX5M 4INHA 3M3SA 1C5YB 3ATWA 1FY5A 2BY9X 2STAE 2B0FA 1GHWH 4OS2A 4UE7H 3ZVDA 1KLTA 2WYGA 4MDSA 2FPZA 2STBE 1EXFA 1INCA 3GCTF 3T28A 1OP8A 3TGKE 1P8VC 3GCNA 3R0FA 2NU1E 1CBWB 3SUGA 1NM6A 4YZUA 1OWKA 4FUDA 1TPPA 3EYDA 1SMFE 4CRFA 3LIWA 4X8VH 3TK5A 3VEQB 2A0QB 2W3KA 4ABAA 4A92A 2Z9IA 5K0HA 1GHVH 1FPHH 2ANYA 1ZMNA 2ZP0H 5EG4A 4YESB 2XTTB 1O3AA 1Y3XA 3SI3H 4AYVB 1GJBB 4KP0A 4FXGH 4R8TB 5H4IB 5A8ZA 2OUAA 3RDZA 6CHAC 1F5LA 5LGOA 3U9AH 1Q3XA 2ZECA 2ZGCA 4O97A 3D65E 1D9IA 3SQHE 1GJ5H 3GCOA 3PTBA 3G01A 4AYYB 3M5OA 1DANH 1ZHMA 2CJIA 2GV7A 5F8XA 3SUDA 4J1YA 1DS2E 1TGCA 2W7SA 3ZZAA 2ZDKA 3P70B 3HK3B 2H5DA 5DP4A 1RS0A 3O8DA 4I8GA 4X6MA 1HDTH 2A7JA 4A1VA 2G8TA 1FN6A 1SGQE 1FY8E 1GCTB 2J38A 1O2YA 1ZSLA 2Q1JA 3LC3A 3KF2A 2A4QA 2GCHF 2EI6A 1DICA 1TNLA 4YM9A 5DK1A 4UEHH 4VGCC 2G5NA 2RCEA 2BQWB 3M5NA 2FOBA 1EP5A 1O5CB 5T6GA 1YPHC 2H2ZA 3C1KA 1KYNA 3GY4A 2BDGA 1WCZA 2XCFA 4OS6A 1PPBH 3IITA 1H4WA 2AMDA 3FP7E 1W0ZU 2F91A 4WJG2 1O2NA 2BD8A 5TCAA 1TQ7B 1OYTH 1V2ST 1SL3A 4X6PA 1LVMA 1BUIA 3MHWU 3LGYA 4IMZA 5GJ4B 3TH4H 1O2LA 1JMOH 1XUIA 3VPKA 4FUIA 4K1SA 3P8OA 4XSKU 1CHOF 1JIMA 3TPIZ 3SW2B 2O8WA 1TNJA 3QZQA 1SI5H 1GJ9B 2FODA 5JPMH 4AB9A 4F4OC 4YOJA 2G00A 2QAAA 4K69A 1TGNA 3KHVA 1ZTKA 2BDYA 3V0XA 1QB9A 2RA0A 1C1WH 2PUQH 1AIXH 4X2YA 1GBFA 2GTBA 2WV5A 1VCWA 4I8HA 4WF8A 4B76A 1ELDE 4RSPA 1Y3WA 2R0KA 1C2MA 1LPZB 5LPRA 4ISIH 2GMTB 3PROA 1EKBB 1UVTH 2IN2A 5FCRA 5DP5A 1L1NA 1S85A 1W10U 4BAHB 2BXUH 3QWCH 3NXPA 3GY6A 4ASHA 2O8LA 1G37A 2BLOA 1O3MA 4X1RU 3SGBE 2PGQB 4IMQA 1O31A 4JZFH 3TJOA 1DVAH 1LTOA 1GDNA 1P2MA 2XC5A 2P8OB 5JBAS 1P3CA 1SFIA 2F9NA 3CS7A 4WMDA 1GWAA 1W11U 1ZRKA 5JBBS 2NU4E 3TH3H 1O3HA 3A7ZA 5GIBA 1CHGA 2CV3A 1WAYB 1WU1A 3BTTE 1MAXA 1Y3UA 5EGMA 1M9UA 5EQQA 1DM4B 4CR9A 4CRGA 2BX4A 3BEFB 2A31A 3FP8E 2HLCA 5C5NA 1WTHD 3SO3A 1K22H 2BD7A 1O3DA 1N1LA 4IN2A 3S69A 1E36B 5DP3A 7LPRA 2PTCE 2UWPA 1A5HA 2AFQB 4M7GA 1KLIH 1O2OA 1Y3VA 2ZHEH 3A7VA 1THPB 5HYOA 3A80A 1LPKB 1TLDA 1JBUH 2GZ9A 2PHBA 1MD8A 5DGJA 2ZGXH 1P3EA 2VWOA 1FY4A 3RC4A 1CE5A 3SNCA 1AMHA 2FI4E 1FY3A 1BMNH 4UFDH 2W26A 4HFPB 9ESTA 3A8DA 3RUOA 1TA6A 4FVBA 2OP9A 1Q2WA 1BIOA 1GGDB 4GHQA 1PPCE 3VFEA 1ETSH 3HKIB 1QNJA 1C5OH 4XBDA 4ZH8A 3VGCC 1TMTH 1PQ7A 2FTLE 2G51A 4Q7ZA 1OOKB 1J15A 3ZZBA 5C2ZA 4TWWA 2BLWA 1KLJH 3BN9A 4X1PU 3AW1A 3FZZA 1JWTA 1O2GH 1O37A 2SGDE 3F68H 4X1QU 1Y5UT 3SV7A 2FOAA 2HNTF 3CP7A 1FQ3A 1ANDA 1P03A 2EC9H 1TPSA 3P92A 2PLXA 3KL6A 1C9PA 4K3JA 2HNTE 5A09A 2HVXA 5E2PA 1YPMH 4FUHA 3DT0H 1GVZA 4KTSA 1GJ7B 2P8OC 5DP8A 4Z0KA 1E34B 4R0IA 4NWKA 4FUFA 3H7TA 1GI9B 2VWMA 1UTNA 3MU5A 2XNIA 2B7DH 1O30A 6GCHG 3UFAA 4HGCA 1T7CA 2R0LA 1O32A 1T32A 5EW1H 1P2KA 5JDUB 1SGFG 1VJAU 3MU8A 1ZMLA 2K7XA 3SN8A 1Z8RA 3UIRA 1ESTA 1P12E 1KXCA 2BYAX 2FLBH 1P9SA 3OYPA 3TH2H 1PQAA 2ZDVH 3BTKE 2C90B 3RMNH 3LU9B 4O3UA 3O8RA 1IOEA 1OWIA 1VITH 2F9VA 3ZZ7A 1K28D 1HUTH 4GPGA 1P11E 1RIWC 1NFWA 4O03A 5GDSH 4DJZB 3S9CA 4GUXA 2Z94A 1SVPA 2P3UB 1GI3A 1SR5C 1LHDH 2HWLB 1SC8U 5JYIA 1PPFE 5GCHG 1A3EH 2ZDMA 2ULLA 3E6PH 4I7YH 3P6ZB 3AASA 3E0PB 1NFYA 1J9CH 3Q00A 1TIOA 2Y81A 8ESTE 3A8CA 1BBRE 2WPMS 1MZAA 1FONA 3RXPA 4NZLA 1GBBA 1PJPA 1ESBA 1CA0C 1Z7KA 1EX3A 2BDHA 3GDVA 2ANWA 1ESAA 3BG4C 4ZHLU 2XBVA 5E8EH 3M5MA 4RKJB 2JH5D 1QRWA 3MNSA 4NIVA 2A2QH 1RD3B 3D23A 2GGVB 3KIDU 2WPJS 4YO9A 2BD5A 2ZDAH 1ELTA 2BTCE 2WV4A 4RKOB 1EZXC 1OYQA 3Q77A 3MU4A 2ZGHA 6LPRA 1O5FH 2FM2A 1D3DB 1C4V2 3JZ1B 5AVDA 4ISHH 3SU0A 1A2CH 1LVYA 4ZKRU 3U8RH 2SNVA 1O2QA 2FS9A 3EA8A 3TNTA 1G3BA 5F8ZA 1CA0B 1U6QA 1BRUP 1X7AC 2CF9H 2SGPE 2J9NA 3RXHA 1O3FA 2IPHA 4MNWA 3URCA 5CMXH 5I46H 4NSVA 5FAHA 1G9IE 2FX6A 1AB9C 2FEQH 1T8NA 3UWIA 3UQOA 1O3LA 1CGHA 1F0SA 1UTOA 3DHKH 3P95A 2B5TB 4HI3A 2FP7B 2ZDNA 1ZHRA 1FIWA 1TYNA 2OXSA 1HJ8A 1ABIH 1KIGH 3LT3A 2BDIA 1YPJH 2FMJA 4Y8ZA 4HZHA 4U32A 1C1NA 1OWEA 1RJXB 2P3TB 4KTUA 3B8JA 2CHAB 4IC5A 5A0AE 4JZIA 2QXJA 3MH4A 3UR9A 4NG9H 2G81E 1BCUH 4XDEA 1QIXB 1NRNH 1E35B 1SGRE 1S81A 1GJAB 1H8IH 1ZOMA 5TJXA 3SV6A 1ANCA 2OC1A 2PW8H 2BM2A 2A5AA 3RXLA 1BTHH 3SUFA 1TALA 2VH6A 4B2CA 1TB6H 2BZ6H 1GBJA 1GBDA 5DO4H 1SB1H 1IQMA 2FOMB 2VINA 2WPLS 1UVOA 1IHSH 5FPYA 3WY8A 1HIAA 2OQUA 4AB8A 4XE4A 4AGKA 3QN7A 2THFB 1UJ1A 3LH1A 1DDJA 2GDEH 8KME2 2ZHDA 1O39A 4Y7BA 1QHRB 1H8DH 4DT7B 1L0ZA 2PKSB 2J92A 4O3TA 1CVWH 1OPHB 1TABE 1AB9B 4FUEA 1S5SA 5C3NA 1DSUA 3RXMA 6CHAB 1SGEE 2C8XB 1XUKA 3TU7H 4X8UH 4X2WA 7ESTE 2TGPZ 1UHBA 4E05H 1A0JA 5E0GA 3SJKA 2P3FH 1NESE 1GHZA 1A3BH 1C2LA 2P94A 1IQIA 1T8OA 5HM9A 2C8YB 3QK1A 4YTAA 1C5SA 1GBLA 1GCDA 1GMHG 1K1LA 3RXEA 8GCHF 3S0NA 4KTCA 4ZAEA 1ARCA 1K1PA 4I33A 4BNRA 1AN1E 2FS8A 4NZQA 3KQDA 1Z1IA 1QRXA 1IQKA 1BDAA 5FBIA 5AF9H 3MO9A 1GG6C 3LGUA 3P17H 3W95A 1DWBH 1YLCA 1YKTA 4X8SH 1GI5A 1QL9A 2AGEX 1C2KA 2VNTA 1LHGH 1GBHA 1O3CA 4ABFA 4WVPE 1SSXA 1FAKH 1MCTA 3N7OA 4AOQA 3SBKA 3RXGA 1F0UA 1D6WA 1TMBH 1LHEH 1GHXH 4O9VA 3QZRA 1PPHE 2AIPA 1C1OA 5DP9A 1O33A 4ZXYH 1AI8H 3I78A 1VZQH 1YLDA 3ZVGA 1O2SA 2BY7X 4CREA 3PMBB 1BRAA 5T3HA 1MU8B 2ILNA 1GG6B 3UOUA 4B2AA 1A61H 1D3PB 1CGIE 3F9HA 2VIPA 2V3OH 4UFFH 1BITA 1KXBA 1SGPE 1OKXA 4CRBA 5FXLA 3ENSB 3TLOA 1V2PT 2Z7FE 7GCHG 1P05A 4WWYA 3M7UA 3GCHB 1V2NT 3K2UA 2YOLA 2BLQA 1C2IA 1K1OA 3RXBA 2PKSC 2TGDA 1O38A 2VVVA 4CRCA 2ZWLH 2ODQA 4NA7A 1D3TB 1J8AA 3ZVAA 1HXEH 1DUAA 1ID5H 1C4Y2 4ZHAA 1FY1A 1THSH 4BAOB 1UK3A 2GD4B 1ELEE 5A2MH 1AVWA 1NZQH 3Q76A 1C1TA 1MTVA 2BVRH 3GCTG 4NA9H 2GMTC 1O3KA 3SV8A 1BBRK 2FO9A 1O3IA 2Z9GA 4ABHA 4IC6A 1FDPA 3QUMP 3A7WA 1GL0E 2ZA5A 4MNVA 1HCGA 3MNBA 1DLEA 3TITA 5E2OA 5TCCA 1AFQC 1V2VT 4X2XA 5EODA 1UCYK 3E1XB 2ZO3H 1IQFA 2FWWA 2VIOA 1YBWA 4FUJA 3RXKA 3RXOA 2D1JA 3W94A 3M7TA 2Y80A 5T6FA 3QGNB 1A0HB 1MUEB 2QGRA 3LGIA 4MPVA 4YLQH 1HNEE 1KDQB 2D8WA 3NKKA 3M36A 5DPAA 3PWCA 2DE8A 3H7OA 2BZAA 3D49H 1ETTH 1C5UA 2F83A 3HPTB 1SLWB 2Z3EA 2VWLA 3SNDA 4UONA 1NFUA 4INLA 4B73A 2BXTH 3M61U 3ITIA 3QTOH 1BHXF 3RXJA 5ESTE 2BVXH 2ZTYA 1ANEA 1C5MD 3E16B 1LQDB 3EDXB 1D6RA 2OTVA 4NIYA 2OC8A 1ZPZA 4H42U 2K1QA 2WUBA 1QL8A 1O2PA 4Y71A 4YOGA 1TWXB 2A7HA 1H1BA 4FU7A 4CHAC 3ZZ6A 1HBTH 2Q6FA 2BMGB 3RXDA 3BG8A 1AUJA 1AWFH 3BEIB 1XUHA 1C5LH 2ZC9H 2PUXB 3M3VA 1A0LA 1P2NA 5GXPA 3NWUA 1MCVA 2H1UA 3UNRA 4I8JA 2O8UA 1L4ZA 1BA8B 1CQQA 4IW4E 2D26C 3HGPA 1D4PB 1TAWA 1Z8JB 2PKAB 4H4FA 1V2TT 3KQEA 2XXLA 3TK9A 3RMMH 3E3TA 3GY8A 5IDKA 1O2KA 4JZ1A 1O3EA 3MH6A 1WUNH 1AD8H 4I8KA 2ZQ2A 5LH8A 2R2WU 1UVSH 3LH3A 1NU7B 1MBQA 3RXRA 2FOCA 3BTFE 1QQ4A 1BTWA 2BDAA 4K8YA 1TNIA 1BOQA 2C3SA 2ZU2A 4MPUA 1NRQH 2OINA 1VGCB 2XCNA 4DURA 3FP6E 3F9FA 3PWBA 3IWMA 1YF4A 3F1SB 4NCYA 5EQSA 4ZKNU 3ZYEA 1SQAA 5EXLA 2VIQA 1JRTA 1F5RA 2BD4A 2ZHQH 3Q3YA 1XMNB 4BXSA 3AAVA 3MWIU 1PPGE 2ZF0H 3SJ8A 3SHCH 1EOJA 1NS3A 3SV9A 3ZVEA 1O35A 3SU3A 2XWAA 3MO3A 1CT0E
chains in the Genus database with same CATH superfamily
2TGAA 3VXEH 4RT0A 2Z9JA 4D8NA 1VGCC 2AMPA 2Z9LA 2AGIX 2VJ1A 2PTNA 2Q6DA 2ZCHP 5CHAB 1O2MA 5EXNA 3SV2H 2Y5GA 1EZQA 2VB0A 8GCHG 1QCPA 2BVSH 1WXRA 3A89A 4ABEA 1HAVB 2VU8E 4ABIA 3URDA 1LMWB 3F9GA 2G4UA 2BD2A 2ZFSA 3U98H 1ZYOA 4MQAA 3OY5U 3VB7A 1DPOA 1GMDF 3TK6A 4A5TS 2F9BH 1Z6JH 1SHHB 9LPRA 1C2JA 2CF8H 4NA8A 1LKBA 1DOJA 4JZEH 2HRVA 4WXVA 3UTUH 1QJ7B 2XOKD 3NUMA 3T5FH 1GHBF 1W2KH 4K2YA 3PYHA 2TRMA 3LKWA 1HAYB 2GCHG 2H9EH 1P2IA 2R2MB 3MU0A 2TBSA 3DCLA 1MD7A 2OD3B 1C5VA 4CH2B 1C1PA 3A87A 4CHAB 4GLYA 1TRMA 2ANMH 1EZUC 1BBRH 2SNWA 1UTKA 3LGTA 5HIYA 1SFQB 1O2WA 1GI2A 2H6MA 3KNXA 4LOYH 3MYWA 1VCQA 5FCKA 5ESBA 1Y3YA 2PKAA 1BMFD 1AVXA 1T31A 3GY2A 5BPEA 1PPEE 5HGGA 1B0EA 2L6OA 1YPKH 1Z8GA 4Y79A 1O5EH 4K1TA 1O2IA 3FN8A 3PV5A 1DITH 4X6NA 4JYVH 4B74A 1F92A 2ZFFH 1MKXH 2QXIA 2AH4X 2J2UA 2FOFA 3BF6H 5BRRE 4INKA 1O0DH 1RGQA 3PMHB 1FXYA 1G3DA 1Y5BT 5F03A 4THNH 1MKWK 1GL1A 1GDQA 3I29A 1B0FA 3RXUA 1GI0A 2ESTE 2HGTH 3FVFB 2LELA 1ZSKA 3R3GB 4JK6A 4ZKOU 1THRH 2A5IA 4MVNA 1OWDA 2H5CA 1RXPA 4Y7AA 1PYTC 4NGAH 5CE1A 2SGFE 5EOKA 3F2HA 2Y7XA 5F6MA 5FHTA 3RXSA 3ZZ9A 2PWXA 1A5IA 3ZZDA 3LC5A 3GDUA 1OP2A 1AQ7A 3DSGA 2FDAA 1AFQB 1EZSC 1TX6A 1RIWB 2PSXA 3B9FH 4BAQB 1MQ6A 2P59A 3RLYH 3SNBA 1QBOA 1HAHH 1QB1A 2V3MA 1GHAF 2FI5E 1TA2A 2WUCA 3EBNA 1KXAA 3HKJB 2AMQA 2DE9A 2QE7D 3RM0H 2V3HH 4I32A 1FLEE 1LDTT 1NO9H 1OWJA 1W0JD 2ZU4A 1T4UH 3ATLA 2VWNA 1IQHA 1QR3E 5C1XA 1BTPA 1WQSA 2FOEA 1AHTH 4JYTA 2Y5FA 4WY3A 2ZPRA 1C2EA 1GI4A 3K9XB 3Q3XA 2FTMA 3A83A 1O3OA 2BY8X 2ZTXA 1F0RA 1RTLA 4YOIA 1EOLA 3TGJE 3U8TH 1ZRBA 3ZVBA 4D76A 2KM0A 3M5LA 3RU4D 1JIRA 2R9PA 1B7XB 2F3CE 4D9QA 2FZZA 1ANBA 2GDDA 3RMOH 4DVAU 1QQUA 2Y6TA 2EI7A 1C2GA 2WZQA 4WH8A 3V13A 3GISB 1FV9A 1Z6EA 3U1IB 1IAUA 1SGIB 1VITG 1XVMA 4GVUA 1DWDH 4SGBE 5JBCS 1EB2A 3BIUH 3RU4E 2ODYB 2JJ2D 2LNCA 4D7FA 5L2YH 1AU8A 4HTCH 4FUGA 4A6LA 3ZZ4A 1BRBE 2ZU5A 2KCAA 1SQOA 2AGGX 3ATIA 1SPJA 1QRZA 1ZJKA 1BRCE 1QURH 1UVUH 3KGPA 3P8FA 1C5ZB 1PYTD 3CENA 4Y10E 5B6LA 1HAPH 3MOCA 1RTFB 4XRNA 1UTPA 3ESTA 5J4SA 4X8TH 2FESH 1O3NA 3MH5A 3KCGH 2J95A 1P9UA 1LHCH 1WV7H 1WYKA 3UR6A 1QB6A 2F9PA 3KQ5A 1AZZA 1WQVH 4DIHH 2AERH 2VGCB 1C5TA 1QTFA 3PO1B 2GP9B 1TBZH 5C94A 4CBOA 1XUJA 2NU2E 2A45B 1MTNB 1F7ZA 1YGCH 3F9EA 1W8BH 3HGNA 1NROH 1ZZZA 5ABWA 5FL7D 1LKAA 1RRKA 2AS9A 3ZVCA 2J94A 4MNYA 4A1XA 2GKVE 3L6PA 3SU2A 2QCYA 3RXIA 4FUBA 3GY5A 1Z71A 1HLTH 1AO5A 5C67A 1L1JA 1S6FA 4Y8XA 4AN7A 1O5GH 3E0NB 2BX3A 1T8MA 3ATMA 1TPAE 4BANB 3E91A 1QBNA 1DXWA 1MBMA 4TY7A 3RC6A 1OX1A 3SNAA 3O8CA 2ZU1A 1C2HA 1ACBE 5HXFA 2XBYA 4NFFA 5C20A 1IQLA 4Y8YA 2ZNKH 1W14U 3A84A 3F6UH 3MO6A 4AX9H 4DIIH 3A8BA 3SYJA 2A2XH 3MNCA 2BY6X 4M9FA 1O2JA 1MQ5A 1BT7A 2NU0E 1FMGA 1OWHA 3T27A 2VH0A 1DWEH 2ANKH 1O5AB 4X0WU 1YPHE 4XBBA 1AKSB 4IS5A 2P16A 3RP2A 1AFEH 1P57B 1NRPH 2XYAA 2Z9KA 1YYY1 4F49A 2FYRA 1F0TA 4TY6A 3CS0A 4YT7H 3VGCB 3E8LA 1J17T 1EPTB 4D9RA 1AKSA 4E7NA 1MTNC 2ZQ1A 1O3JA 3N99A 1C1SA 3ZV8A 1E37B 1QL7A 1ABJH 2WPHS 3V12A 3BSQA 4ABJA 4WMFA 2ZIQH 2O9QA 1GJ8B 1K1JA 4K1EA 1YC0A 1HIAB 2J98B 4XFQA 1BQYA 3AVZA 4BXWA 2ZHFH 1CU1A 4FU8A 1HAVA 1TQ0B 1V2RT 3PM3A 1H9IE 2PR3A 2TPIZ 4D7GA 1XUFA 2ASUB 4I31A 1VITF 3TNSA 1S82A 2AEIH 2XW9A 1UK2A 1GHBG 1SQTA 3LGWA 1ZTLA 2QYIA 2F4LA 3EA7A 1UMAH 2BY5X 2ODPA 1CSOE 2HPPH 4FVDA 2TIOA 4I8LA 4NIXA 1GBTA 1S0RA 8LPRA 3ZVFA 1AWHB 2OBOA 1C2DA 1QFKH 1GI6A 1AE5A 1WOFA 3M3TA 1AE8H 2SGAA 1N6YA 2WV9A 3K6ZA 5DP6A 1YY3A 3TGIE 2C93B 1S83A 2Q6GA 4KGAA 3UWJH 4ESTE 1XXFA 2BQ6B 1N6XA 3D62A 3RXAA 2GX4A 3P8NA 3SQEE 4TWYA 1HAXB 1ZGIA 4H6TA 2KAIB 4WH6A 2XC4A 2HOBA 3A85A 1XM1A 1SGDE 4DCDA 3PRDA 2ZGJA 1LCYA 1ZJDA 6GCHF 2F9UA 2QY0B 1NRSH 1KXEA 2OC7A 1EPTC 4Q2KA 3PMAB 4K8BA 1GI8B 3VB3A 1TOCB 2W7UA 4XBCA 4AFUA 2OC0A 3BIVH 1DFPA 3EA9A 1O3PB 1CA8B 1CT4E 3T62A 1CGJE 3GCHC 1MMJN 1OXGA 3EQ0H 4ZUHA 1AZ8A 2G52A 4JYUH 2ZCKP 3BTWE 1LPGB 1C1RA 1RFNA 1SOTA 4DG4A 1O2XA 3DD2H 3TJNA 1SGNE 1ETRH 1HV7A 1O34A 1CHOG 1J14A 4U30A 3BTQE 1C1UH 3IG6B 3ELAH 2BOKA 1AGJA 1CBWC 1J16A 1NN6A 2FLRH 2H9HA 4LZ4B 4DW2U 5J4QA 3RXVA 1GBKA 2SFAA 5T6DA 1A5GH 5L2ZH 1GBMA 3NPSA 4AFZA 1O2ZA 1ORFA 2WINI 5C1YA 3SJIA 1UO6A 2V0BA 4OS7A 3AAUA 1HXFH 3MU1A 1IQEA 5E0HA 3RLWH 2LP6A 2QXHA 2NU3E 1DWCH 2UWLA 4PROA 2C8WB 4CRDA 1O2UA 1GVLA 1P0SH 2J4IA 3SUEA 1ZR0A 1EJAA 4BTUB 2QV1A 1F5KU 2J34A 1GBCA 5L30H 4Q80A 1TGBA 2KX4A 5FX5A 1YCPM 5A8YA 1EUFA 3PLPA 2ZFTA 1S84A 5EIYA 2FXRA 1K0HA 1BZXE 2A32A 4AFSA 2GZ8A 1OSSA 3SZNA 1WSSH 1DXPA 1F2SE 2Z3CA 5DP7A 1TNKA 2Y7ZA 1N8OC 1XX9A 2ALPA 2PGBB 5DSFA 2FOHA 4U01A 1MU6B 3RXFA 5A0CA 2F9OA 2ZDLA 2XC0A 2TGTA 2BD9A 3VB5A 3T26A 2BDBA 1TGTA 2EI8A 1UVPA 1UCYH 3BTDE 3B23B 2PV9B 2QF0A 3GYLB 1WTGH 1KXDA 1ZPBA 1EP6A 1UTQA 1W7GH 2FI3E 1FPCH 1TOMH 5SGAE 3FAOA 1EJNA 1MTWA 4X2VA 2O8TA 2IJOB 3DFLA 1ZPCA 1SHYA 4U2WA 5EQRA 1ARBA 3RXQA 3M35A 4SGAE 3A82A 5DN6D 3V3MA 3SGQE 3MI4A 1DUEA 1UTLM 3S9BA 1GMCF 1GPZA 2DUCA 1E1RD 2ZKSA 1ZTJA 5KGOA 5DJ7A 1JXPA 1BMLA 4F55A 1VKYA 3L33A 1GBIA 2K8IA 4AGJA 2XBWA 4AG2A 3KYGA 1QA0A 2I6QA 4GHTA 1IHTH 2GCTB 2HNTC 2YMSC 3P8GA 1K1MA 5EW2H 3UUZA 4B2BA 4BAKB 2UUJB 2QA9E 2Y5HA 1BJUA 4TYDA 1EAWA 3Q3KA 1P01A 2ALVA 4K60A 3A7YA 3NCLA 4B75A 4ZROA 1NU9A 3ZV9A 1B5GH 1JOUB 1MAYA 1YM0A 3VB4A 3C27B 1VR1H 4FUCA 1TNHA 4UDWH 1CO7E 2GT8A 5KEDA 2C8ZB 1P02A 3STIA 1C1QA 1NFXA 4Z6AH 3LJJA 4JCNA 5FX6A 3LGVA 3WW7A 3JZ2B 1L1GA 1YP9A 2P93A 4Q7YA 5ETXA 1G30B 1G36A 4GCHF 5JB9S 1HAOH 2OLGA 4RI0A 1KY9A 3ZYDA 2ZPSA 2IOTA 4Y76A 3QTVH 4B6FA 2ZFQH 1JRSA 1EATA 1C1MA 3K6YA 3PTNA 1A7SA 5EXMA 1FIZA 1TONA 5G4BA 1KXFA 5GNDA 1YPGH 3OSYA 3SJOA 1V3XA 1W3CA 1HAIH 3F0PA 5HKKD 7GCHF 1V6DA 4YXWD 1UTMA 2VVCA 2UUYA 2ZI2H 3RMLH 2Y82A 1HFDA 2UUKB 2P95A 1GI1A 2ZGBH 1AY6H 4IN1A 5GWZA 1GVKB 3SOSA 3STJA 2EA3A 2FYQA 1SBWA 1UTJA 4Q63A 2R3UA 2ZFPH 3DSOA 1BTYA 4X6OA 4UD9H 2M5TA 2Z6BD 3SGAE 1WBGB 3BTME 5LPFA 4TPYA 4AZ2B 3OY6U 3TIUA 1DLKB 2QF5A 2QIQA 1DY8A 2BB4A 4ABDA 4ISNA 4OS1A 2SGEE 2ZPQA 4RN6A 4NFEA 5FPSA 1DY9A 3DA9B 2OQ5A 1FJSA 4NSYA 1GMCG 2A1DB 5IYTA 3SJ9A 1TGSZ 2WPKS 1XVOA 2W5EA 5AFYH 1ZGVA 1LHFH 2KCOA 3A88A 1P06A 3PV2A 1UHBB 1IQNA 3OTJE 3SI4H 4DT4A 1HJAC 2L74A 3ZIAD 4KKDA 1K1IA 4MLFB 1TFXA 3PMJA 3H5CB 1KDQA 2NWNA 3U8OH 3NK8A 1XKAC 2CXVA 1AUTC 1QBVH 3O8BA 5FPTA 4DY7B 5E0JA 1V2LT 1SGYE 1E38B 3KQCA 3M37A 1P04A 3KQBA 1O36A 1IQGA 3SU1A 1ELGA 1V2OT 4ACBA 3UNSA 1HAZB 1PFXC 4AG1A 1D3QB 2XRCA 1C5NH 1MH0A 4JMYA 3PB1E 3H09A 1HJAB 2VIVA 3GICB 5L6NH 1LVOA 3EGKH 2HPQH 2ZHWH 4NIWA 1IQJA 1W7XH 4CRAA 2JETC 3PO1C 2BHGA 4VGCB 3ZZ3A 6ESTA 2GV6A 1DT2A 1O5BB 3BTGE 2D2DA 1XUGA 1ELCA 3BTEE 3ZZ5A 1K21H 1Y8TA 2FIRH 1NC6A 1QJ1B 1V2KT 2OCVB 3PLKA 3TVJB 2AYWA 1GI7B 1GJ4H 4LK4A 1G2MA 1BMMH 1W0YH 3M7QA 1EFRD 1K9OE 4ZKSU 3HK6B 1HGTH 2OBQA 2W3IA 4Y0YE 2CGAA 1SGCA 4KELA 4TPIZ 3RU4T 1TE0A 4OGXA 3T29A 2GVFA 4DGJA 1P2QA 1YPEH 4GSOA 5F53A 1ELFA 1UK4A 3KEEA 2JETB 3RM2H 2UUFB 4GAWA 3V7TA 1MABB 1MZDA 3BG4B 4FU9A 4CBNA 3BEUA 1YCPH 2YMSD 3A86A 3K65B 3TJVA 3MFJA 1QY6A 5PTPA 1KTSB 2WPIS 1GHAG 2BQ7B 1V2UT 2SGQE 2A7CA 1MKWH 3KN2A 3GYMA 1KSNA 1OHHD 2CK3D 3QO6A 1NPMA 1O2TA 3NZIA 3U1JB 1P10A 1PQ8A 1V2JT 4FETA 1TRYA 2BOHB 1N8OB 4XOJA 4ZMAH 2BLVA 2ZEBA 4Y6DA 1T4VH 2HALA 2V35A 2LPRA 1S6LA 2PFEA 1H9HE 1FZZA 1EB1H 1QGFA 1EAIA 2B9LA 2UWOA 4MPWA 1LQEA 4E7RG 1ELVA 3GY7A 1P2OA 1C5RA 2CHAC 4Z1MD 4ZHMU 1YCPK 2VIWA 1MTUA 3FZDA 1PPZA 2A4RA 3OEED 4CH8B 1C4U2 1Z1JA 3MTYA 3S7HB 1OP0A 1G3EA 1ZLRA 5C5OA 1EAUA 1Y59T 3LOXA 1SGFA 2FOGA 1L4DA 1HB0B 2JKHA 1QA7A 1P2JA 1TX8A 1HRTH 1O2RA 1BMAA 2XBXA 4ISOA 5C0UA 3SHAH 4Y11E 2KAIA 5C1UA 5EPYA 2RA3A 4X1NU 1HJ9A 2GCTC 2YMSB 1A46H 2R3YA 5LPEA 1C5QA 1DE7H 3EE7A 1V2QT 2ZZUH 1O2VA 1O2HA 1Y5AT 4Q7XA 4UFEH 4OGYA 3BTHE 1SQRA 3ODDA 3A8AA 3LJOA 2GZ7A 1SLVB 1SGTA 1NT1A 3L3TA 3SORA 5K7RA 3AW0A 2JIZD 4UFGH 1GGDC 3DUXH 5GCHF 2RDLA 4ABBA 4YLUA 3MH7A 1NRRH 2G4TA 4QT8C 1G3CA 3GY3A 2QF3A 1P09A 1UCYE 2A5KA 1TBQH 1C1VH 1TNGA 1BB0B 2FX4A 5I25A 2JH6D 4DOQA 2QN5T 2VIDA 2RFKC 5JB8S 4BTIB 1V2WT 5CHAC 3E90B 3A7TA 4BAMB 3UY9A 1EASA 2ZU3A 4JZDH 1GJDB 1OS8A 5HMAA 3VB6A 3ZZ8A 1XKBC 3LDXH 4H6SB 2WYJA 1BTXA 1C5XB 2BD3A 2VGCC 3F2GA 4GCHG 5DG6A 5DKMA 5EPNA 1DSTA 3ATKA 4J2YB 1L2EA 5FBEA 1G32B 3OFND 3UREA 2ZFRH 1S6HA 2B8OH 3A7XA 1C2FA 3ODFA 1O3BA 3SU5A 3I77A 4ABGA 3GOVB 2Z3DA 3UPEA 1FUJA 1ZMJA 3EE0B 1PQ5A 2GT7A 1O5DH 4LXBH 1O3GA 4MPXA 4B1TA 2QXGA 1XXDA 2PP6A 1NTPA 3BV9B 3S9AA 5GPIB 1EAXA 3SU6A 3QGJA 2EEKA 1EJMA 2HVYB 1EQ9A 4OS4A 3GDSA 2KFWA 1Q31A 1SOZA 1C9TA 3PV4A 2BDCA 1BHXB 1HYLA 4AFQA 4WMEA 2ZG0H 4ISLA 1GBAA 4MTBA 3AK5A 1YWUA 2G55A 5A0BA 4IGDA 2ZCLP 2YNAA 2JH0D 3SU4A 4JK5A 1TBRH 4A7IB 1GJCB 3DFJA 1E0FD 1FAXA 1ELAA 3EAJA 3HATH 1KTTB 3MMGA 1ZHPA 1SLXB 2A4GA 2AIQA 4IBLH 1FI8A 5JBTA 2LIZA 4YT6H 1C5WB 1ELBA 3SNEA 1K2I1 4K5ZA 3LPRA 1GMHF 3VXFH 3U69H 4X1SU 1SLUB 7KMEH 1C5PA 1T8LA 5AHGH 3RXTA 1S0QA 1W13U 1YPLH 2YNBA 3OAAD 3UOPA 3OU0A 1EPTA 1A1RA 1GJ6A 3T2NA 3S7KB 5HM2A 2WPDD 1TRNA 1K1NA 1VCPA 2VBCA 1FNIA 3QDZB 1NBME 2PSYA 1A4WH 1TMUH 1BTZA 1TX7A 4WXIA 4MG3A 2AHME 5B6OA 4B71A 1ZSJA 2VVUA 1LVBA 1TPOA 2I6SA 3MNXA 2XWBI 4BTTB 1BJVA 4LZ1H 1GMDG 4NWLA 5EU8A 3LONA 3QLPH 1QJ6B 3A81A 4AORA 3FFGA 3QX5H 2CN0H 4ZXXH 5F8TA 1HAGE 3UNQA 2O8MA 1V2MT 3FANA 4BOHA 3TJUA 1NY22 1W12U 1CT2E 1GCTC 3OX7U 1VJ9U 1GHYH 2K0QA 2G5VA 2QC2A 2H9TH 1GBEA 4Y0ZE 1MKXK 1RTKA 3UQVA 4OS5A 4A1TA 2CMYA 1BTUA 2RG3A 1GDUA 4CR5A 1MTSA 1H9LB 1HPGA 2V6NA 4MNXA 3PLBA 1LO6A 5A8XA 1Z8IB 1AVGH 1SG8B 1FN8A 3T25A 3ZZCA 4E06H 2ZTZA 2C4FH 2A4OA 5AFZH 2KR7A 1SKYE 1G2LA 3RC5A 3RXCA 1DX5M 4INHA 3M3SA 1FX0B 1C5YB 3ATWA 1FY5A 2BY9X 2STAE 2W6ID 2B0FA 4P00A 1GHWH 4OS2A 4UE7H 3ZVDA 4XD7D 1KLTA 2WYGA 4MDSA 2FPZA 2STBE 1EXFA 1INCA 3GCTF 3T28A 1OP8A 4TSFD 3TGKE 1P8VC 3GCNA 3R0FA 2NU1E 1CBWB 3SUGA 1NM6A 4YZUA 1OWKA 4FUDA 1TPPA 3EYDA 1SMFE 4CRFA 3LIWA 4X8VH 3TK5A 3VEQB 2A0QB 2W3KA 4ABAA 4A92A 2Z9IA 5K0HA 1GHVH 1FPHH 2ANYA 5T1VA 1ZMNA 2ZP0H 5EG4A 4YESB 2XTTB 1O3AA 1Y3XA 3SI3H 4AYVB 1GJBB 4KP0A 4FXGH 4R8TB 5H4IB 5A8ZA 2OUAA 3RDZA 6CHAC 1F5LA 5LGOA 3U9AH 1Q3XA 2ZECA 2ZGCA 4O97A 3D65E 1D9IA 3SQHE 1GJ5H 3GCOA 3PTBA 3G01A 4AYYB 3M5OA 1DANH 1ZHMA 2CJIA 2GV7A 5F8XA 3SUDA 4J1YA 1DS2E 1TGCA 2W7SA 3ZZAA 2ZDKA 3P70B 1E1QD 2H5DA 3HK3B 5DP4A 1RS0A 3O8DA 4I8GA 4X6MA 1HDTH 2A7JA 4A1VA 2G8TA 1FN6A 1SGQE 1FY8E 1GCTB 2J38A 1O2YA 1ZSLA 2Q1JA 3LC3A 3KF2A 2A4QA 2GCHF 2IPQX 2EI6A 1DICA 1TNLA 2RDEA 4YM9A 5DK1A 4UEHH 4VGCC 2G5NA 2RCEA 2BQWB 3M5NA 2FOBA 1EP5A 1O5CB 5T6GA 1YPHC 2H2ZA 3C1KA 1KYNA 3GY4A 4OM9A 2BDGA 1WCZA 2XCFA 4OS6A 1PPBH 3IITA 1H4WA 2AMDA 3GS9A 3FP7E 1W0ZU 2F91A 4WJG2 1O2NA 2BD8A 5TCAA 1TQ7B 1OYTH 1V2ST 2EY4C 3W1EA 1SL3A 4X6PA 1WDIA 1LVMA 1BUIA 3MHWU 3LGYA 4IMZA 5GJ4B 3TH4H 1O2LA 1JMOH 1XUIA 1UW7A 3VPKA 4FUIA 4K1SA 3P8OA 4XSKU 1CHOF 1JIMA 3TPIZ 5KECA 3SW2B 2O8WA 1TNJA 3QZQA 1SI5H 1GJ9B 2FODA 5JPMH 4AB9A 4F4OC 4YOJA 2G00A 2QAAA 4K69A 1TGNA 3KHVA 1ZTKA 2BDYA 3V0XA 1QB9A 4TT3D 2RA0A 1C1WH 2PUQH 1AIXH 4X2YA 1GBFA 2GTBA 2WV5A 1VCWA 3OE7D 4I8HA 2GJGA 4WF8A 4B76A 1ELDE 4RSPA 1Y3WA 2R0KA 1C2MA 1LPZB 5LPRA 4ISIH 2GMTB 3PROA 1EKBB 1UVTH 2IN2A 5FCRA 5DP5A 1L1NA 1S85A 1W10U 4BAHB 2BXUH 3QWCH 3NXPA 3GY6A 4ASHA 2O8LA 1G37A 2BLOA 1O3MA 4X1RU 3SGBE 2PGQB 4IMQA 1O31A 4JZFH 3TJOA 1DVAH 1LTOA 1GDNA 1P2MA 2XC5A 2P8OB 5JBAS 1P3CA 1SFIA 2F9NA 3CS7A 4WMDA 1GWAA 1W11U 1ZRKA 5JBBS 2NU4E 3TH3H 1O3HA 3A7ZA 5GIBA 1CHGA 2CV3A 1WAYB 1WU1A 3BTTE 1MAXA 1Y3UA 5EGMA 1M9UA 4FOUC 5EQQA 2JDID 1DM4B 4CR9A 4CRGA 2BX4A 3BEFB 2A31A 3FP8E 1H8HD 2HLCA 3NRLA 5C5NA 1WTHD 3SO3A 1K22H 2BD7A 1O3DA 3F2FA 1N1LA 4IN2A 3S69A 1E36B 5DP3A 7LPRA 2PTCE 2UWPA 1A5HA 2AFQB 4M7GA 1KLIH 1O2OA 1Y3VA 2ZHEH 3A7VA 1THPB 5HYOA 3A80A 1LPKB 5IK2D 1TLDA 1JBUH 2GZ9A 2PHBA 1MD8A 5DGJA 2ZGXH 1P3EA 2VWOA 1FY4A 3FO8D 3RC4A 1H8ED 1CE5A 3SNCA 1AMHA 2FI4E 1FY3A 2KZ4A 1BMNH 2OK5A 4UFDH 2W26A 4HFPB 9ESTA 3A8DA 3RUOA 1TA6A 4FVBA 2OP9A 1Q2WA 1BIOA 1GGDB 4GHQA 1PPCE 3VFEA 1ETSH 3HKIB 1QNJA 1C5OH 4XBDA 4ZH8A 2WSSD 3VGCC 1TMTH 1PQ7A 2FTLE 2G51A 4Q7ZA 1OOKB 1J15A 3ZZBA 5C2ZA 4TWWA 2BLWA 1KLJH 3BN9A 4X1PU 3AW1A 3FZZA 1JWTA 1O2GH 1O37A 2SGDE 3F68H 4X1QU 1Y5UT 3SV7A 2FOAA 2HNTF 3CP7A 1FQ3A 1ANDA 1P03A 2EC9H 1TPSA 3P92A 2PLXA 3KL6A 1C9PA 4K3JA 2HNTE 5A09A 2HVXA 5E2PA 1YPMH 4FUHA 3DT0H 3UB0A 5C17A 1GVZA 4KTSA 1GJ7B 2P8OC 5DP8A 4Z0KA 1E34B 4R0IA 4NWKA 4FUFA 3H7TA 1GI9B 2VWMA 2F43B 1UTNA 2XNIA 3MU5A 2B7DH 1O30A 6GCHG 2EQNA 3UFAA 4HGCA 1T7CA 2R0LA 1O32A 1T32A 5EW1H 1P2KA 5JDUB 1SGFG 1VJAU 3MU8A 1ZMLA 2K7XA 3SN8A 1Z8RA 3UIRA 1ESTA 1P12E 1KXCA 2BYAX 2FLBH 1P9SA 3OYPA 3TH2H 1PQAA 2ZDVH 3BTKE 2C90B 3RMNH 3LU9B 4O3UA 3O8RA 1NBMD 1IOEA 1OWIA 1VITH 2F9VA 3ZZ7A 1K28D 1HUTH 3MQKC 4GPGA 1P11E 1RIWC 1NFWA 4O03A 5GDSH 4DJZB 3S9CA 4GUXA 2Z94A 1SVPA 2P3UB 1GI3A 1SR5C 2HLDD 1LHDH 2HWLB 1SC8U 2V7QD 1PPFE 5GCHG 5JYIA 1A3EH 2ZDMA 2ULLA 3E6PH 4I7YH 3P6ZB 3AASA 3E0PB 1NFYA 1W0KD 1J9CH 3Q00A 1TIOA 2Y81A 8ESTE 3A8CA 1BBRE 2WPMS 1MZAA 1FONA 3RXPA 4NZLA 1GBBA 1PJPA 1ESBA 1CA0C 1Z7KA 1EX3A 2BDHA 3GDVA 2ANWA 1ESAA 3BG4C 4ZHLU 2XBVA 5E8EH 3M5MA 4RKJB 2JH5D 1QRWA 3WWFA 3MNSA 4NIVA 2A2QH 1RD3B 3D23A 2GGVB 3KIDU 2WPJS 4YO9A 2BD5A 2ZDAH 1ELTA 2BTCE 2WV4A 4RKOB 1EZXC 1OYQA 3Q77A 3MU4A 2ZGHA 6LPRA 1O5FH 3CNRA 2FM2A 1D3DB 1C4V2 3JZ1B 5AVDA 4ISHH 3SU0A 1A2CH 1LVYA 3OTPA 4ZKRU 3U8RH 2SNVA 1O2QA 2FS9A 3EA8A 3TNTA 1G3BA 5F8ZA 1CA0B 1U6QA 1BRUP 1X7AC 2CF9H 2SGPE 2J9NA 3RXHA 1O3FA 2IPHA 4MNWA 3URCA 5CMXH 5I46H 3OEHD 4NSVA 5FAHA 1G9IE 2FX6A 1AB9C 2FEQH 1T8NA 3UWIA 3UQOA 1O3LA 1CGHA 1F0SA 1UTOA 3DHKH 3P95A 2B5TB 4HI3A 2J97A 2FP7B 2ZDNA 1ZHRA 1FIWA 1TYNA 2OXSA 1YLNA 1HJ8A 1ABIH 1KIGH 5EJZA 3LT3A 2BDIA 1YPJH 2FMJA 4Y8ZA 4HZHA 4U32A 1C1NA 1OWEA 1RJXB 2P3TB 4KTUA 3B8JA 2CHAB 4IC5A 5A0AE 4JZIA 2QXJA 3MH4A 3SZEA 3UR9A 4NG9H 5HIZA 2G81E 1BCUH 4XDEA 1QIXB 1NRNH 1E35B 1SGRE 1S81A 1GJAB 1H8IH 1ZOMA 5TJXA 3SV6A 1ANCA 2OC1A 2PW8H 2BM2A 2A5AA 3RXLA 1BTHH 3SUFA 1TALA 2VH6A 4B2CA 1TB6H 2BZ6H 1GBJA 1GBDA 4I86A 5DO4H 1SB1H 1IQMA 2FOMB 2VINA 2WPLS 2W6JD 1UVOA 1IHSH 5FPYA 3WY8A 1HIAA 2J98A 2OQUA 4AB8A 4XE4A 4AGKA 3QN7A 2THFB 1UJ1A 3LH1A 1DDJA 5CDFE 2GDEH 8KME2 2ZHDA 1O39A 4Y7BA 1QHRB 3WWBA 1H8DH 4DT7B 1L0ZA 2PKSB 2J92A 4O3TA 1CVWH 1OPHB 1TABE 1AB9B 4FUEA 1S5SA 5C3NA 1DSUA 3RXMA 6CHAB 1SGEE 2C8XB 1XUKA 3TU7H 4X8UH 4X2WA 7ESTE 2TGPZ 1UHBA 2JJ1D 4E05H 1A0JA 5E0GA 3SJKA 2P3FH 1NESE 1GHZA 1A3BH 1C2LA 2P94A 1IQIA 1T8OA 5HM9A 5EJ1A 2C8YB 3QK1A 4YTAA 1C5SA 1GBLA 1GCDA 1GMHG 1K1LA 4AC9A 3RXEA 8GCHF 4ZCNA 3S0NA 4KTCA 4ZAEA 1ARCA 1K1PA 4I33A 4BNRA 1AN1E 2FS8A 4NZQA 3KQDA 1Z1IA 1QRXA 1KMHB 1IQKA 1BDAA 5FBIA 5AF9H 3MO9A 1GG6C 3LGUA 3P17H 3W95A 1DWBH 1YLCA 1YKTA 4X8SH 1GI5A 1QL9A 2AGEX 1C2KA 2VNTA 1COWD 1LHGH 1GBHA 1O3CA 4ABFA 3FOAA 4WVPE 1SSXA 1FAKH 1MCTA 3N7OA 4RT1A 4AOQA 3SBKA 3RXGA 1F0UA 1D6WA 1TMBH 1LHEH 1GHXH 4O9VA 3QZRA 1PPHE 2AIPA 1C1OA 5DP9A 1O33A 4ZXYH 1AI8H 3DSPA 3I78A 1VZQH 1YLDA 3ZVGA 1O2SA 2M2AA 2BY7X 4CREA 3PMBB 1BRAA 4B6EA 5T3HA 1MU8B 2ILNA 1GG6B 3UOUA 4B2AA 1A61H 5CHBA 1D3PB 1CGIE 3F9HA 1E79D 2VIPA 2V3OH 4UFFH 1BITA 1KXBA 1SGPE 1OKXA 4CRBA 5FXLA 3ENSB 3TLOA 1V2PT 2Z7FE 7GCHG 1P05A 4WWYA 3M7UA 3GCHB 1V2NT 3K2UA 2YOLA 2BLQA 1C2IA 1K1OA 2WHXA 3RXBA 2PKSC 3VG8A 4P02A 2TGDA 1O38A 2VVVA 4CRCA 3F3BA 2ZWLH 2ODQA 4NA7A 1D3TB 1J8AA 3ZVAA 1HXEH 1DUAA 1ID5H 1C4Y2 4ZHAA 1FY1A 1THSH 4BAOB 1UK3A 2GD4B 1ELEE 3F0OA 5A2MH 1AVWA 1NZQH 3Q76A 1C1TA 1MTVA 2BVRH 3GCTG 4NA9H 2GMTC 1O3KA 3SV8A 3N7EA 1BBRK 2FO9A 1O3IA 2Z9GA 4ABHA 4IC6A 1FDPA 3QUMP 3A7WA 1GL0E 2ZA5A 4MNVA 1HCGA 3MNBA 1DLEA 3TITA 5E2OA 5TCCA 1AFQC 1V2VT 4X2XA 5EODA 1UCYK 3E1XB 2ZO3H 1IQFA 2FWWA 2VIOA 1YBWA 4FUJA 3RXKA 3RXOA 2D1JA 3W94A 3M7TA 2Y80A 5T6FA 3QGNB 1A0HB 1MUEB 2QGRA 3LGIA 4MPVA 4YLQH 1HNEE 1KDQB 2D8WA 2QF4A 3NKKA 3M36A 3N7DA 5DPAA 2IJD1 3PWCA 2DE8A 3H7OA 2BZAA 2J5UA 3D49H 1ETTH 1C5UA 2F83A 3PRBA 3HPTB 1SLWB 2Z3EA 2VWLA 3SNDA 4UONA 1NFUA 4INLA 4B73A 2BXTH 3M61U 3ITIA 3QTOH 2KCYA 1BHXF 3RXJA 5ESTE 3FKSD 2BVXH 2ZTYA 1ANEA 1C5MD 3E16B 1LQDB 3EDXB 1D6RA 2OTVA 4NIYA 2OC8A 1ZPZA 4H42U 2K1QA 2WUBA 1QL8A 1O2PA 4Y71A 4YOGA 1TWXB 3U28C 5C0TA 2KCPA 2A7HA 1H1BA 4FU7A 4CHAC 3ZZ6A 1HBTH 3UAIC 2Q6FA 2BMGB 3RXDA 3BG8A 1AUJA 1AWFH 3BEIB 1XUHA 1C5LH 2ZC9H 2PUXB 3M3VA 1A0LA 3KYFA 1P2NA 5GXPA 3NWUA 1MCVA 2H1UA 3UNRA 4I8JA 2O8UA 1L4ZA 1BA8B 1CQQA 4IW4E 4ACAA 2D26C 3HGPA 1D4PB 1TAWA 1Z8JB 2PKAB 2XNDD 4H4FA 1V2TT 3KQEA 2XXLA 3TK9A 3RMMH 3E3TA 3GY8A 5IDKA 1O2KA 4JZ1A 4ASUD 1O3EA 3MH6A 1WUNH 1AD8H 4I8KA 2ZQ2A 5LH8A 2R2WU 1UVSH 3LH3A 1NU7B 1MBQA 3RXRA 2FOCA 3BTFE 1QQ4A 1BTWA 2BDAA 4K8YA 1TNIA 1BOQA 2C3SA 2ZU2A 4MPUA 4F48B 1NRQH 2OINA 1VGCB 2XCNA 4DURA 3FP6E 3F9FA 3PWBA 3IWMA 1YF4A 3F1SB 4NCYA 5EQSA 4ZKNU 3ZYEA 1SQAA 5EXLA 2VIQA 1JRTA 1F5RA 2BD4A 2ZHQH 3Q3YA 1QZ8A 1XMNB 4BXSA 4HG6A 3AAVA 3MWIU 1PPGE 2ZF0H 3SJ8A 3SHCH 4Q4LA 1EOJA 1NS3A 3SV9A 3ZVEA 1O35A 5EJLA 2XWAA 3SU3A 3MO3A 1CT0E
chains in the Genus database with same CATH topology
2TGAA 3VXEH 2Z9JA 4D8NA 1VGCC 2AMPA 2Z9LA 2AGIX 2VJ1A 2PTNA 2Q6DA 2ZCHP 5CHAB 1O2MA 5EXNA 3SV2H 2Y5GA 1EZQA 2VB0A 8GCHG 1QCPA 2BVSH 3A89A 4ABEA 1HAVB 2VU8E 4ABIA 3URDA 1LMWB 3F9GA 2G4UA 2BD2A 2ZFSA 3U98H 1ZYOA 4MQAA 3OY5U 3VB7A 1DPOA 1GMDF 3TK6A 4A5TS 2F9BH 1Z6JH 1SHHB 9LPRA 1C2JA 2CF8H 4NA8A 1LKBA 1DOJA 4JZEH 2HRVA 4WXVA 3UTUH 1QJ7B 3NUMA 3T5FH 1GHBF 1W2KH 4K2YA 3PYHA 2TRMA 3LKWA 1HAYB 2GCHG 2H9EH 1P2IA 2R2MB 3MU0A 2TBSA 1MD7A 2OD3B 1C5VA 4CH2B 1C1PA 3A87A 4CHAB 4GLYA 1TRMA 2ANMH 1EZUC 1BBRH 2SNWA 1UTKA 3LGTA 1SFQB 1O2WA 1GI2A 2H6MA 3KNXA 4LOYH 3MYWA 1VCQA 5FCKA 5ESBA 1Y3YA 2PKAA 1T31A 1AVXA 3GY2A 5BPEA 1PPEE 5HGGA 1B0EA 1YPKH 1Z8GA 4Y79A 1O5EH 4K1TA 1O2IA 1DITH 4X6NA 4JYVH 4B74A 1F92A 2ZFFH 1MKXH 2QXIA 2AH4X 2J2UA 2FOFA 3BF6H 5BRRE 4INKA 1O0DH 1RGQA 3PMHB 1FXYA 1G3DA 1Y5BT 5F03A 4THNH 1MKWK 1GL1A 1GDQA 3I29A 1B0FA 3RXUA 1GI0A 2ESTE 2HGTH 3FVFB 4JK6A 1ZSKA 3R3GB 4ZKOU 1THRH 2A5IA 4MVNA 1OWDA 2H5CA 1RXPA 4Y7AA 1PYTC 4NGAH 5CE1A 2SGFE 5EOKA 2Y7XA 5F6MA 5FHTA 3RXSA 3ZZ9A 2PWXA 1A5IA 3ZZDA 3LC5A 3GDUA 1OP2A 1AQ7A 2FDAA 1AFQB 1EZSC 1TX6A 1RIWB 2PSXA 3B9FH 4BAQB 1MQ6A 2P59A 3RLYH 3SNBA 1QBOA 1HAHH 1QB1A 1GHAF 2FI5E 1TA2A 2WUCA 3EBNA 1KXAA 3HKJB 2AMQA 2DE9A 3RM0H 2V3HH 4I32A 1FLEE 1LDTT 1NO9H 1OWJA 2ZU4A 1T4UH 3ATLA 2VWNA 1IQHA 1QR3E 5C1XA 1BTPA 1WQSA 2FOEA 1AHTH 4JYTA 2Y5FA 4WY3A 2ZPRA 1C2EA 1GI4A 3K9XB 3Q3XA 2FTMA 3A83A 1O3OA 2BY8X 2ZTXA 1F0RA 1RTLA 4YOIA 1EOLA 3TGJE 3U8TH 1ZRBA 3ZVBA 4D76A 3M5LA 3RU4D 1JIRA 2R9PA 1B7XB 2F3CE 4D9QA 2FZZA 1ANBA 2GDDA 3RMOH 4DVAU 1QQUA 2Y6TA 2EI7A 1C2GA 4WH8A 3V13A 3GISB 1FV9A 1Z6EA 3U1IB 1IAUA 1SGIB 1VITG 1XVMA 4GVUA 1DWDH 4SGBE 5JBCS 1EB2A 3BIUH 3RU4E 2ODYB 2LNCA 4D7FA 5L2YH 1AU8A 4HTCH 4FUGA 4A6LA 3ZZ4A 1BRBE 2ZU5A 1SQOA 2AGGX 3ATIA 1SPJA 1QRZA 1ZJKA 1BRCE 1QURH 1UVUH 3KGPA 3P8FA 1C5ZB 1PYTD 3CENA 4Y10E 1HAPH 3MOCA 1RTFB 1UTPA 3ESTA 5J4SA 4X8TH 2FESH 1O3NA 3MH5A 3KCGH 2J95A 1P9UA 1LHCH 1WV7H 1WYKA 3UR6A 1QB6A 2F9PA 1AZZA 1WQVH 4DIHH 2AERH 2VGCB 1C5TA 1QTFA 3PO1B 2GP9B 1TBZH 4CBOA 1XUJA 2NU2E 2A45B 1MTNB 1F7ZA 1YGCH 3F9EA 1W8BH 3HGNA 1NROH 1ZZZA 5ABWA 1LKAA 1RRKA 2AS9A 3ZVCA 2J94A 4MNYA 4A1XA 2GKVE 3L6PA 3SU2A 2QCYA 3RXIA 4FUBA 3GY5A 1Z71A 1HLTH 1AO5A 5C67A 1L1JA 1S6FA 4Y8XA 4AN7A 1O5GH 3E0NB 2BX3A 1T8MA 3ATMA 1TPAE 4BANB 3E91A 1QBNA 1DXWA 1MBMA 4TY7A 3RC6A 1OX1A 3SNAA 3O8CA 2ZU1A 1C2HA 1ACBE 5HXFA 2XBYA 4NFFA 5C20A 1IQLA 4Y8YA 2ZNKH 1W14U 3A84A 3F6UH 3MO6A 4AX9H 4DIIH 3A8BA 2A2XH 3MNCA 2BY6X 1O2JA 1MQ5A 1BT7A 2NU0E 1FMGA 1OWHA 3T27A 2VH0A 1DWEH 2ANKH 1O5AB 4X0WU 1YPHE 4XBBA 1AKSB 4IS5A 2P16A 3RP2A 1AFEH 1P57B 1NRPH 2XYAA 2Z9KA 1YYY1 4F49A 2FYRA 1F0TA 4TY6A 3CS0A 4YT7H 3VGCB 3E8LA 1J17T 1EPTB 4D9RA 1AKSA 4E7NA 1MTNC 2ZQ1A 1O3JA 1C1SA 3ZV8A 1E37B 1QL7A 1ABJH 2WPHS 3V12A 3BSQA 4ABJA 4WMFA 2ZIQH 2O9QA 1GJ8B 1K1JA 4K1EA 1YC0A 1HIAB 4XFQA 1BQYA 3AVZA 4BXWA 2ZHFH 1CU1A 4FU8A 1HAVA 1TQ0B 1V2RT 3PM3A 1H9IE 2PR3A 2TPIZ 4D7GA 1XUFA 2ASUB 4I31A 1VITF 3TNSA 1S82A 2AEIH 2XW9A 1UK2A 1GHBG 1SQTA 3LGWA 1ZTLA 2QYIA 3EA7A 1UMAH 2BY5X 2ODPA 1CSOE 2HPPH 4FVDA 2TIOA 4I8LA 4NIXA 1GBTA 1S0RA 8LPRA 3ZVFA 1AWHB 2OBOA 1C2DA 1QFKH 1GI6A 1AE5A 1WOFA 3M3TA 1AE8H 2SGAA 1N6YA 3K6ZA 5DP6A 3TGIE 2C93B 1S83A 2Q6GA 4KGAA 3UWJH 4ESTE 1XXFA 2BQ6B 1N6XA 3D62A 3RXAA 2GX4A 3P8NA 3SQEE 4TWYA 1HAXB 1ZGIA 4H6TA 2KAIB 4WH6A 2XC4A 2HOBA 3A85A 1XM1A 1SGDE 4DCDA 2ZGJA 1LCYA 1ZJDA 6GCHF 2F9UA 2QY0B 1NRSH 1KXEA 2OC7A 1EPTC 4Q2KA 3PMAB 4K8BA 1GI8B 3VB3A 1TOCB 2W7UA 4XBCA 4AFUA 2OC0A 3BIVH 1DFPA 3EA9A 1O3PB 1CA8B 1CT4E 3T62A 1CGJE 3GCHC 1MMJN 1OXGA 3EQ0H 4ZUHA 1AZ8A 2G52A 4JYUH 2ZCKP 3BTWE 1LPGB 1C1RA 1RFNA 1SOTA 4DG4A 1O2XA 3DD2H 3TJNA 1SGNE 1ETRH 1HV7A 1O34A 1CHOG 1J14A 4U30A 3BTQE 1C1UH 3IG6B 3ELAH 2BOKA 1AGJA 1CBWC 1J16A 1NN6A 2FLRH 2H9HA 4LZ4B 4DW2U 5J4QA 3RXVA 1GBKA 2SFAA 5T6DA 1A5GH 5L2ZH 1GBMA 3NPSA 4AFZA 1O2ZA 1ORFA 2WINI 5C1YA 3SJIA 1UO6A 2V0BA 4OS7A 3AAUA 1HXFH 3MU1A 1IQEA 5E0HA 3RLWH 2QXHA 2NU3E 1DWCH 2UWLA 4PROA 2C8WB 4CRDA 1O2UA 1GVLA 1P0SH 2J4IA 3SUEA 1ZR0A 1EJAA 4BTUB 2QV1A 1F5KU 2J34A 1GBCA 5L30H 4Q80A 1TGBA 5FX5A 1YCPM 5A8YA 1EUFA 3PLPA 2ZFTA 1S84A 2FXRA 1BZXE 2A32A 4AFSA 2GZ8A 1OSSA 3SZNA 1WSSH 1DXPA 1F2SE 2Z3CA 5DP7A 1TNKA 2Y7ZA 1N8OC 1XX9A 2ALPA 2PGBB 2FOHA 4U01A 1MU6B 3RXFA 5A0CA 2F9OA 2ZDLA 2XC0A 2TGTA 2BD9A 3VB5A 3T26A 2BDBA 1TGTA 2EI8A 1UVPA 1UCYH 3BTDE 3B23B 2PV9B 2QF0A 3GYLB 1WTGH 1KXDA 1ZPBA 1EP6A 1UTQA 1W7GH 2FI3E 1FPCH 1TOMH 5SGAE 3FAOA 1EJNA 1MTWA 4X2VA 2O8TA 2IJOB 3DFLA 1ZPCA 1SHYA 4U2WA 5EQRA 1ARBA 3RXQA 3M35A 4SGAE 3A82A 3V3MA 3SGQE 3MI4A 1DUEA 1UTLM 3S9BA 1GMCF 1GPZA 2DUCA 2ZKSA 1ZTJA 5DJ7A 1JXPA 1BMLA 3L33A 1GBIA 4AGJA 2XBWA 4AG2A 1QA0A 2I6QA 4GHTA 1IHTH 2GCTB 2HNTC 3P8GA 1K1MA 5EW2H 3UUZA 4B2BA 4BAKB 2UUJB 2QA9E 2Y5HA 1BJUA 4TYDA 1EAWA 3Q3KA 1P01A 2ALVA 4K60A 3A7YA 3NCLA 4B75A 4ZROA 1NU9A 3ZV9A 1B5GH 1JOUB 1MAYA 1YM0A 3VB4A 3C27B 1VR1H 4FUCA 1TNHA 4UDWH 1CO7E 2GT8A 2C8ZB 1P02A 3STIA 1C1QA 1NFXA 4Z6AH 3LJJA 4JCNA 5FX6A 3LGVA 3JZ2B 1L1GA 1YP9A 2P93A 4Q7YA 5ETXA 1G30B 1G36A 4GCHF 5JB9S 1HAOH 2OLGA 1KY9A 3ZYDA 2ZPSA 2IOTA 4Y76A 3QTVH 2ZFQH 1JRSA 1EATA 1C1MA 3K6YA 3PTNA 1A7SA 5EXMA 1FIZA 1TONA 5G4BA 1KXFA 1YPGH 3OSYA 3SJOA 1V3XA 1W3CA 1HAIH 7GCHF 1V6DA 1UTMA 2VVCA 2UUYA 2ZI2H 3RMLH 2Y82A 1HFDA 2UUKB 2P95A 1GI1A 2ZGBH 1AY6H 4IN1A 5GWZA 1GVKB 3SOSA 3STJA 2EA3A 2FYQA 1SBWA 1UTJA 2R3UA 2ZFPH 1BTYA 4X6OA 4UD9H 2M5TA 2Z6BD 3SGAE 1WBGB 3BTME 5LPFA 4TPYA 4AZ2B 3OY6U 3TIUA 1DLKB 2QIQA 1DY8A 2BB4A 4ABDA 4ISNA 4OS1A 2SGEE 2ZPQA 4RN6A 4NFEA 5FPSA 1DY9A 3DA9B 2OQ5A 1FJSA 4NSYA 1GMCG 2A1DB 5IYTA 3SJ9A 1TGSZ 2WPKS 1XVOA 2W5EA 5AFYH 1ZGVA 1LHFH 3A88A 1P06A 1UHBB 1IQNA 3OTJE 3SI4H 1HJAC 4KKDA 1K1IA 4MLFB 1TFXA 3PMJA 3H5CB 1KDQA 2NWNA 3U8OH 3NK8A 1XKAC 2CXVA 1AUTC 1QBVH 3O8BA 5FPTA 4DY7B 5E0JA 1V2LT 1SGYE 1E38B 3KQCA 3M37A 1P04A 3KQBA 1O36A 1IQGA 3SU1A 1ELGA 1V2OT 4AG1A 3UNSA 1HAZB 1PFXC 1D3QB 2XRCA 1C5NH 1MH0A 4JMYA 3PB1E 1HJAB 2VIVA 3GICB 5L6NH 1LVOA 3EGKH 2HPQH 2ZHWH 4NIWA 1IQJA 1W7XH 4CRAA 2JETC 3PO1C 2BHGA 4VGCB 3ZZ3A 6ESTA 2GV6A 1DT2A 1O5BB 3BTGE 2D2DA 1XUGA 1ELCA 3BTEE 3ZZ5A 1K21H 1Y8TA 2FIRH 1NC6A 1QJ1B 1V2KT 2OCVB 3PLKA 3TVJB 2AYWA 1GI7B 1GJ4H 4LK4A 1G2MA 1BMMH 1W0YH 3M7QA 1K9OE 4ZKSU 3HK6B 1HGTH 2OBQA 2W3IA 4Y0YE 2CGAA 1SGCA 4KELA 4TPIZ 3RU4T 1TE0A 4OGXA 3T29A 2GVFA 4DGJA 1P2QA 1YPEH 4GSOA 1ELFA 1UK4A 3KEEA 2JETB 3RM2H 2UUFB 4GAWA 3V7TA 1MZDA 3BG4B 4FU9A 4CBNA 3BEUA 1YCPH 3A86A 3K65B 3TJVA 3MFJA 1QY6A 5PTPA 1KTSB 2WPIS 1GHAG 2BQ7B 1V2UT 2SGQE 2A7CA 1MKWH 3KN2A 3GYMA 1KSNA 3QO6A 1NPMA 1O2TA 3NZIA 3U1JB 1P10A 1PQ8A 1V2JT 1TRYA 2BOHB 1N8OB 4XOJA 4ZMAH 2BLVA 2ZEBA 4Y6DA 1T4VH 2HALA 2V35A 2LPRA 2PFEA 1H9HE 1FZZA 1EB1H 1QGFA 1EAIA 2B9LA 2UWOA 4MPWA 1LQEA 4E7RG 1ELVA 3GY7A 1P2OA 1C5RA 2CHAC 4ZHMU 1YCPK 2VIWA 1MTUA 3FZDA 1PPZA 2A4RA 4CH8B 1C4U2 1Z1JA 3MTYA 3S7HB 1OP0A 1G3EA 1ZLRA 5C5OA 1EAUA 1Y59T 3LOXA 1SGFA 2FOGA 1L4DA 1HB0B 2JKHA 1QA7A 1P2JA 1TX8A 1HRTH 1O2RA 1BMAA 2XBXA 4ISOA 3SHAH 4Y11E 2KAIA 5C1UA 5EPYA 2RA3A 4X1NU 1HJ9A 2GCTC 1A46H 2R3YA 5LPEA 1C5QA 1DE7H 1V2QT 2ZZUH 1O2VA 1O2HA 1Y5AT 4Q7XA 4UFEH 4OGYA 3BTHE 3ODDA 3A8AA 3LJOA 2GZ7A 1SLVB 1SGTA 1NT1A 3L3TA 3SORA 5K7RA 3AW0A 4UFGH 1GGDC 3DUXH 5GCHF 2RDLA 4ABBA 4YLUA 3MH7A 1NRRH 2G4TA 4QT8C 1G3CA 3GY3A 2QF3A 1P09A 1UCYE 2A5KA 1TBQH 1C1VH 1TNGA 1BB0B 2FX4A 5I25A 2JH6D 4DOQA 2QN5T 2VIDA 5JB8S 4BTIB 1V2WT 5CHAC 3E90B 3A7TA 4BAMB 3UY9A 1EASA 2ZU3A 4JZDH 1GJDB 1OS8A 5HMAA 3VB6A 3ZZ8A 1XKBC 3LDXH 4H6SB 2WYJA 1BTXA 1C5XB 2BD3A 2VGCC 4GCHG 5DG6A 5DKMA 5EPNA 1DSTA 3ATKA 4J2YB 1L2EA 5FBEA 1G32B 3UREA 2ZFRH 1S6HA 2B8OH 3A7XA 1C2FA 3ODFA 1O3BA 3SU5A 3I77A 4ABGA 3GOVB 2Z3DA 3UPEA 1FUJA 1ZMJA 3EE0B 1PQ5A 2GT7A 1O5DH 4LXBH 1O3GA 4MPXA 4B1TA 2QXGA 1XXDA 1NTPA 3BV9B 3S9AA 5GPIB 1EAXA 3SU6A 3QGJA 2EEKA 1EJMA 1EQ9A 4OS4A 3GDSA 1Q31A 1SOZA 1C9TA 3PV4A 2BDCA 1BHXB 1HYLA 4AFQA 4WMEA 2ZG0H 4ISLA 1GBAA