3TITA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg81
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SARS coronavirus main protease
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3titA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA02
2G52A 1SGIB 2A32A 2RA0A 1HDTH 1CHGA 1BBRH 4INKA 1YGCH 1SQOA 2ZHFH 1Z7KA 3MNBA 1GDUA 3MH6A 2ODYB 2A7JA 5C20A 3D49H 3SU6A 4BAKB 1ZPZA 1F5LA 4GCHF 5DP6A 1SL3A 1IQHA 5I25A 1EPTB 1O3MA 1MU6B 2A7HA 2BZ6H 3MTYA 1NO9H 1NS3A 1RIWC 2GMTB 1JRSA 2V35A 1S84A 4A7IB 1ETTH 4YOIA 1NRQH 1TIOA 3U9AH 1TQ7B 2VB0A 2UUKB 1O3GA 2GCHF 1C5VA 1C5MD 4XOJA 1BRBE 4FUJA 1O2HA 1AO5A 1EJAA 3PO1C 1ELBA 2FX6A 2J38A 4I8JA 4DW2U 1WTHD 1GJ4H 1AZZA 4O97A 2VIPA 1PPHE 2ZPQA 3RXTA 1E37B 3U8TH 4XFQA 5DP4A 4XE4A 3PO1B 3M35A 1EJNA 4CRCA 3RXSA 3SGBE 1C5LH 3B8JA 7ESTE 1GHBG 4BOHA 5I46H 3RC4A 3KQEA 3ZVGA 1LVBA 2Z9JA 3ZZ9A 2F3CE 4D8NA 1RIWB 2GMTC 4I32A 3UPEA 1SGYE 2WPHS 2G5NA 1EPTC 1EAIA 1FIZA 2Q1JA 3I78A 4OGYA 1J8AA 3RXOA 4BANB 1LCYA 1UVTH 3P8NA 1OWJA 1HJAC 3SNEA 1SGRE 2BDYA 4OS4A 4MPXA 2A5KA 2FTLE 1DY9A 5DK1A 1ESBA 1GVZA 1FPCH 2SGFE 5EQRA 1Z8RA 3A87A 3KGPA 1AVXA 5JPMH 2FTMA 3MNXA 1FMGA 1C2IA 1WAYB 1TBZH 1DUEA 3IG6B 2QY0B 1P05A 5C67A 1ZRBA 4YZUA 1CHOG 2BTCE 4GCHG 2A7CA 2GDDA 1VITH 8GCHF 2SGAA 2FI5E 3SUEA 2OC1A 2BD2A 1IQMA 4WMFA 2NU1E 4Y8ZA 2ZHWH 1UHBB 3PLBA 1CA8B 1P9UA 1CBWC 3I29A 1MKXK 3HKJB 1O2ZA 3VFEA 2G55A 4DGJA 3M3TA 1CGJE 3H7OA 4Y7BA 1DWDH 1HPGA 1OWDA 2EA3A 1T31A 2PKAA 3RUOA 4AZ2B 3PB1E 3SBKA 2AERH 1TA2A 3OU0A 1PQ8A 4OS6A 2BVXH 2SNWA 2ZFFH 3LGYA 3GDUA 1W0YH 4NFEA 1AKSA 3HK3B 1YPHC 1BBRK 4TWYA 1C5TA 1K22H 1BRUP 4NA7A 1FY5A 5F03A 3Q3XA 5JBTA 2F9PA 1TPPA 4X6PA 1S0RA 3P92A 1GHXH 1UO6A 2QIQA 1O5EH 1ELFA 1KLTA 2Q6DA 1Y3UA 2J4IA 1SGDE 5L30H 1O3JA 3VB5A 4Q7ZA 3ZZ4A 2BD4A 3EA9A 1E0FD 2O8UA 4CR9A 3MU1A 1P11E 2Y5HA 1C1SA 2A4RA 5CHAC 1V2VT 1MQ6A 1BB0B 2BDAA 3LJJA 1PFXC 4ABHA 3FFGA 5A8XA 1TB6H 4K8BA 1THRH 2GX4A 2C8YB 2ZCKP 4FUCA 1UTOA 1O38A 5DP8A 4H6SB 2GZ8A 2BHGA 1O2RA 5F8XA 4ABJA 1GI7B 1OXGA 1O5DH 1GJBB 1G37A 1MAYA 3BSQA 1Z8GA 1SSXA 1F2SE 1YCPK 2B8OH 2CGAA 2QC2A 1EP5A 2J95A 3ZVAA 1YPMH 2QXGA 1LHCH 1G3EA 5EPYA 2VIQA 2G5VA 2ZTYA 3FP7E 2HNTE 2GCTB 3NCLA 3QZRA 2ZWLH 4I7YH 4AGJA 4CBNA 1TGNA 1GBDA 5DP9A 2GZ9A 4NFFA 3ESTA 1N6XA 3GCHB 3KHVA 2Y7ZA 3A88A 1LPZB 1IQJA 1SGFG 4K3JA 1BOQA 3M3SA 3MWIU 1K9OE 2J9NA 5LPFA 1IOEA 4IN1A 1ABJH 2C4FH 5E0GA 4INHA 1BCUH 1NFWA 1Y3XA 2XWBI 3BTFE 3MFJA 1ELEE 2NU4E 3PMBB 1G30B 1FV9A 1H9HE 3UIRA 1BTXA 2H9TH 3P17H 2EEKA 2ZPSA 3QLPH 3UNQA 3LONA 2ZHEH 3JZ1B 1Z1IA 1MD7A 1LKBA 1C5RA 3SU0A 3MU5A 2I6QA 1QJ6B 1SGFA 3TH2H 4ISHH 1XXFA 1NPMA 5C1XA 2OP9A 3SNCA 3RM2H 3TJOA 3U1IB 2P3TB 3V7TA 1DS2E 1W2KH 3GCTG 1WU1A 2A5IA 1V2TT 1BQYA 2AGEX 1ZZZA 1GCDA 1F5KU 1GBCA 3URDA 1LHEH 3AVZA 3SU2A 3QZQA 1O2GH 1TMTH 4CH8B 1YYY1 2TPIZ 4DURA 4D7GA 1TX8A 1JWTA 2BD5A 2FYRA 1QBOA 4ABAA 2GTBA 1P10A 4QT8C 1VJAU 3TJVA 1TONA 5CHAB 2HRVA 1UCYH 3BF6H 1A46H 1VITF 2Y5FA 1YCPM 1NFYA 1Z8IB 3RXGA 1OP8A 4CRFA 4INLA 1K1NA 1PJPA 2H5CA 4WXIA 3EE0B 4FXGH 1QRXA 1OWIA 1HXFH 5DJ7A 2OBQA 1J9CH 3M37A 1P2KA 2ZKSA 2G51A 2A1DB 1PPEE 1UK2A 2SGDE 1Y5AT 4DIHH 4ZUHA 1S81A 3F9EA 1W13U 2CF8H 1OS8A 1O2QA 1YPHE 1KIGH 1TNHA 1NC6A 1V2KT 1AVGH 1C5YB 1YKTA 1DUAA 4ZHMU 5EQQA 1O34A 2FM2A 2DUCA 1EP6A 1CBWB 3M7TA 3A7VA 1N6YA 2VWNA 4JZEH 4KP0A 2XXLA 3UQOA 3LJOA 3A8AA 3CENA 1A2CH 2VIDA 3GY5A 1C9TA 1N8OC 2OC8A 3QGJA 4OS1A 1L2EA 1MTSA 1QURH 1ZGVA 4XBCA 2Q6FA 1ZLRA 2FWWA 3LH1A 1S0QA 1TRYA 4ISNA 4X2XA 5A0BA 5C1UA 3QTOH 1P09A 3U8OH 4X8TH 2Z9LA 3IITA 3ZZ8A 1ZTKA 4Y71A 3FZDA 5IYTA 3BTEE 1HJAB 3MU8A 1EOLA 1FN8A 1O3BA 1GHAF 2C8WB 3ZVEA 2CV3A 1HNEE 2PUQH 3DA9B 4FUHA 1W12U 3RXEA 1OOKB 1XVOA 1DWEH 1O5BB 3RXPA 1EAWA 1WBGB 1LDTT 3GY3A 4UDWH 5FAHA 2ANMH 5EW1H 1GDQA 1JMOH 1C2EA 1AD8H 4UFFH 3MH5A 1KXFA 1ORFA 2FPZA 4HI3A 1ETSH 2ANWA 4JK6A 1YF4A 1BHXF 5A8YA 5K0HA 5AFYH 1EZSC 4NCYA 1ARBA 2F91A 2QA9E 2FLRH 2BVSH 2ZHQH 1C1OA 4Y8XA 1O36A 1TX6A 4AFQA 1KXAA 4R0IA 1O3CA 1GHYH 1TOMH 2Y81A 3A7WA 1K1MA 4DY7B 1EUFA 2PHBA 2BOHB 1AUTC 5GIBA 2F9NA 3RXUA 3TK6A 1T8NA 1DX5M 4BTTB 4O3TA 2ZFPH 1C5NH 1BMNH 1QA7A 2HALA 1LVOA 1JIRA 4TPIZ 4BAQB 1W7GH 3T28A 4CH2B 4UONA 1L4DA 2BY6X 4WF8A 6ESTA 1SGTA 4WMDA 1ELAA 1J14A 1TGCA 1SLWB 2AIPA 4VGCC 3SJOA 1NU7B 3ZZAA 2O8MA 2BLOA 3MO9A 2J34A 1AWHB 2QYIA 4A1VA 3MO3A 5TCCA 3MNCA 2I6SA 2AMPA 2C8ZB 1A5HA 1QB1A 4ABEA 2VVCA 2V6NA 1AU8A 3H5CB 1PPGE 3TGJE 1OWKA 2CN0H 5EODA 5FXLA 3GDSA 1XX9A 5BPEA 4HFPB 3UUZA 1D3DB 1GWAA 1HIAB 1A0HB 1O3AA 4X1SU 3F6UH 2AEIH 2G00A 1PPZA 4K60A 4TWWA 1GJ9B 2HVXA 2FOBA 3UREA 4U30A 1GGDC 1VR1H 1C2LA 1ZMLA 3MMGA 2QCYA 5T6FA 1C2DA 1TALA 1PPCE 1ANDA 1YBWA 3ZZ3A 2QXHA 2FODA 4Q7YA 3WY8A 4BNRA 3BN9A 2ZFQH 5HM9A 3SNDA 5FX6A 3P8OA 4X6OA 1HAOH 1ZGIA 1BUIA 1O3PB 4UEHH 1O5AB 4NIVA 3MI4A 2B0FA 4HZHA 3UR6A 2WYJA 3IWMA 1CE5A 2QGRA 2VU8E 1QBVH 2PKSC 3MU0A 8KME2 3EA7A 3RXVA 1BTUA 2ZECA 2FMJA 3M36A 1XM1A 3GCNA 3PLPA 4ISLA 3M3VA 1C1TA 2LPRA 1CHOF 1SLXB 2PLXA 4ABFA 2FXRA 4NGAH 1G36A 1O3DA 1UTKA 1UVOA 2R9PA 3D62A 3GY7A 5DP7A 3BIUH 3SV2H 2AS9A 5FX5A 3V12A 1E34B 3DT0H 1AFQC 3R3GB 5LPRA 1RJXB 2BLQA 1HAZB 2O9QA 4B75A 1O3EA 1D3TB 1GI4A 1QHRB 1TBRH 2OQ5A 1YC0A 2BMGB 1HYLA 1PQ5A 1ELGA 1GI5A 4FU7A 1O2XA 3URCA 3M5NA 1V2UT 4E7NA 4YESB 3S9CA 5E0JA 3BTGE 2WPMS 3RU4D 4CRDA 2PGQB 3PLKA 3MHWU 4MNVA 1WV7H 1TAWA 3DHKH 1FY8E 4YTAA 1LVYA 2AGIX 3V0XA 2ANYA 2Y5GA 1Y5BT 4MPWA 3A82A 1JRTA 1GJAB 1GI3A 1RXPA 3SQHE 4JYVH 1WOFA 3SU5A 3RMNH 3S9AA 1WCZA 1GBBA 2XBXA 2ZEBA 3SORA 1GBFA 1F92A 1WQSA 4TY7A 2EC9H 2TGTA 1QQ4A 1IQGA 1MTNB 1ZHMA 1VCQA 1ID5H 3MYWA 1O2VA 4U2WA 2AIQA 1F0UA 2ASUB 2ZDAH 4K2YA 2GP9B 5EXMA 4K5ZA 1O2LA 3C1KA 1HGTH 2XWAA 2EI6A 4IBLH 1FY4A 4YM9A 3VB4A 1IAUA 3LIWA 4RKOB 2P93A 3A89A 3L3TA 3BG8A 4AOQA 5DGJA 3GDVA 1LHDH 3NUMA 1O3FA 1C5OH 1AIXH 3SHAH 2HOBA 1YM0A 1C1UH 4K1EA 1LQDB 4CHAB 2H5DA 2ZCHP 4K1TA 1O5CB 4MNYA 1CT0E 3A84A 1FPHH 1S6HA 2BDCA 1NFUA 4AORA 1O2WA 5ETXA 1D4PB 1K21H 1C2JA 1Q2WA 2QF3A 1S85A 4K1SA 1FLEE 3ZV9A 1P3CA 1P9SA 1LKAA 1TFXA 5F8TA 3AW0A 1O3LA 3K65B 3O8BA 3V3MA 2LIZA 5AFZH 1A0JA 5ESTE 3TU7H 2FO9A 1OP2A 1V2OT 3I77A 1B0EA 4NIYA 5ABWA 1PYTC 3M61U 3PTNA 2PGBB 4YO9A 2D26C 2ZFSA 3SN8A 1SR5C 3STIA 2NWNA 1HAVB 1VITG 1O2NA 4NZLA 1MUEB 3RXJA 4CBOA 1D9IA 1KSNA 1LPKB 1NY22 2DE9A 4I31A 2LNCA 1MBMA 1MQ5A 2AH4X 2ZDVH 5FPSA 2ULLA 3BEFB 1AE8H 4MLFB 2R2MB 4DIIH 3ZZDA 4U01A 2FP7B 2XCNA 2P3UB 5G4BA 1BITA 4MDSA 2BQ7B 3UR9A 1C1PA 2BD8A 1KXCA 4DG4A 3ZZCA 1B5GH 4JYUH 3RXLA 1W3CA 1FN6A 3LDXH 1T8MA 4THNH 3BTWE 1BMMH 3UQVA 1SGCA 1ZSLA 2EI8A 3S7HB 1WYKA 4TY6A 1QB6A 3LC3A 1IQIA 5JBAS 1W11U 2EI7A 1C1RA 2F83A 4AFUA 1P03A 1ZOMA 3RXFA 1L4ZA 4BAMB 1GI0A 3RXQA 2VWOA 3K2UA 1AKSB 5F8ZA 1HAGE 2W3IA 1O2MA 1RS0A 2FYQA 1P06A 1ZJKA 3VB6A 3RXCA 3AAVA 1TNJA 1BTWA 5A0CA 3GCOA 2VH0A 4KGAA 3RM0H 3RC5A 1BMAA 3RXHA 1P2QA 2Z9IA 1O2IA 4YT7H 3E0PB 3ZVBA 4B2AA 3UY9A 1UTPA 1HJ8A 1RD3B 1AWFH 4ZHAA 2R2WU 2UWOA 5EG4A 4YLUA 1K1OA 4NZQA 1GJ8B 1D3QB 1EXFA 1PPFE 1V2RT 4AG2A 1YLDA 1BJUA 1UMAH 3QTVH 4IGDA 1LO6A 4LOYH 3A86A 1P2OA 2FI4E 3ATMA 2QN5T 5CMXH 1C5PA 2Z9KA 1HBTH 1ESAA 2ZGJA 3PMHB 3PROA 1D3PB 2JKHA 3VPKA 1C2HA 4JZIA 4XSKU 1UTNA 3MU4A 3U98H 2ZDMA 3S0NA 1P2MA 5J4SA 1KXEA 3GY4A 2GT8A 4OGXA 4E05H 4FUDA 4YLQH 1GMHG 1P02A 1SBWA 1SGQE 4FVBA 1BBRE 1BIOA 1PPBH 2VGCC 1ETRH 1TLDA 1SFIA 3KQDA 3UTUH 2CF9H 4MG3A 4KTUA 1W8BH 1TWXB 3NK8A 6GCHG 4A6LA 1Q3XA 4Y7AA 2ZIQH 1MU8B 3FAOA 1SGPE 1TGBA 2ZQ2A 3S7KB 1ZSKA 1GJ7B 1T7CA 1ZSJA 2AMQA 3ODDA 1TABE 4LZ1H 1G3BA 3P8FA 1J17T 5A09A 1UVUH 4NWKA 1MH0A 3LOXA 1GBEA 4AX9H 5C5NA 1GBKA 5FHTA 6GCHF 4LK4A 3F1SB 1GI2A 3LGVA 3OX7U 1FNIA 3EGKH 4B2CA 4Z6AH 2ZFRH 4ISOA 2AYWA 3NPSA 4D7FA 1MKXH 2PTCE 1O2PA 2BD7A 2V0BA 2C93B 4Y0ZE 1GCTB 4Q80A 5EXNA 1ABIH 2A0QB 4WH6A 3ZZ5A 3KQBA 3SUFA 3LGIA 3TIUA 1GI9B 1T4UH 1D6RA 1DPOA 1P2IA 3RC6A 5FCRA 2TGAA 1G32B 5AVDA 1O5GH 1YCPH 2JETB 3LGUA 2HGTH 5E0HA 5E2PA 4BAHB 5DO4H 4NIWA 1TRMA 3ZZ6A 2YNAA 4X0WU 3SGAE 1F0SA 1EB2A 3PTBA 4BXSA 1C2MA 3T5FH 1AI8H 3K9XB 1O3OA 1DITH 3SV9A 1A0LA 4Y79A 2G81E 3B23B 1QJ1B 2BD9A 4WJG2 1C5XB 4IW4E 5HGGA 1ESTA 1GBTA 3A85A 1WSSH 3MH4A 2R0KA 1ZPCA 2ODPA 2GD4B 1BRCE 4DOQA 4YOJA 2VWMA 1SQAA 3E1XB 3RLWH 3P8GA 2K7XA 1J15A 3P95A 3HK6B 1DY8A 3VGCB 4FUFA 1HAIH 1GBLA 4X8UH 7KMEH 3RXMA 4H4FA 1NFXA 2FOMB 1OKXA 1VZQH 1TA6A 2D8WA 3O8DA 4RN6A 3NZIA 1JXPA 1EZQA 2AFQB 2THFB 3ZVFA 3QX5H 2A2XH 1AHTH 3GISB 1EPTA 5FPTA 1C1VH 1KY9A 3VGCC 8ESTE 1HAPH 1TPSA 4TPYA 1CGIE 1UCYK 4HTCH 1MMJN 3HATH 4UD9H 1C1MA 4MNWA 3VXEH 1HCGA 2GV7A 7LPRA 3Q3KA 1YPKH 2VVVA 3LT3A 3TLOA 1QJ7B 2G4TA 4CRAA 4A1TA 2FOEA 2Z7FE 2ZHDA 2STAE 5FPYA 2F9UA 2M5TA 1L1NA 1ANCA 5AF9H 4JCNA 1DANH 3GICB 4YOGA 1K1LA 2XC4A 2OQUA 3PM3A 1O39A 1F0RA 1DSTA 1QY6A 3ATKA 4A5TS 3U8RH 1GHVH 2AGGX 1BJVA 1NRSH 1EATA 4O9VA 3BEUA 1O2TA 1Q31A 3DFLA 1UTLM 1MKWK 1K1PA 1E36B 1UTJA 3BIVH 1DM4B 1A7SA 2DE8A 2WUCA 2JH0D 3U69H 1GDNA 1G9IE 4SGBE 4O3UA 2BD3A 1THPB 4ABDA 2RA3A 1Y3YA 1PQAA 3G01A 1O0DH 4NSVA 1IQKA 2ZQ1A 1N1LA 1AB9C 5T3HA 2HLCA 1YLCA 4WVPE 1O2KA 2WV4A 2SNVA 2H1UA 1A3EH 1TX7A 1EKBB 1UVPA 1XMNB 2R0LA 4GUXA 1DDJA 3RXRA 1HRTH 1T8OA 1VCWA 3PYHA 4HGCA 3ODFA 1CVWH 1Y8TA 2P8OB 1C2FA 1QRZA 1RTKA 2WUBA 4SGAE 3RDZA 5GDSH 2NU3E 4I8LA 1C2GA 2OINA 4LZ4B 3A7YA 4FUGA 3UWIA 4B76A 1FJSA 4MTBA 3PWBA 4X8SH 4X2WA 1GJCB 1C4V2 3VB7A 2A4QA 1GL0E 1VGCB 1RFNA 3W94A 1C5QA 1AQ7A 5JB9S 1OPHB 1FIWA 1SVPA 1UVSH 3ITIA 3TH4H 4E7RG 1S83A 2HPQH 1ELTA 1IHTH 4IC5A 3SU4A 3A7ZA 2VIOA 3PV4A 1QCPA 3A8CA 2GVFA 2VJ1A 1O3KA 1H9IE 3UOPA 1FZZA 2ODQA 1O33A 2WV5A 1AFEH 1L0ZA 4F49A 3SZNA 5JYIA 1YP9A 1GG6B 1ZPBA 3SJIA 1FAKH 3SV7A 3PMAB 1C5WB 3GYLB 4ZAEA 3SUGA 4NIXA 5EU8A 4TYDA 2NU2E 1CSOE 4WH8A 4X1QU 3D23A 1MTVA 2ALPA 2W7UA 1EQ9A 1FQ3A 1TMBH 2VIWA 1LTOA 3LC5A 2PW8H 1TYNA 1DWBH 1ELVA 4JZFH 4I8GA 1CT4E 2ZF0H 1P2JA 1RRKA 1F5RA 2Z3DA 1TE0A 3FP6E 2P95A 2OLGA 3F9HA 3T25A 1SMFE 1BMLA 4ZROA 1ZYOA 1SG8B 5LPEA 3TVJB 5EW2H 1SPJA 2P16A 4GLYA 5DG6A 1AGJA 2Y82A 3W95A 1L1GA 1F7ZA 4FU8A 1XUJA 1P12E 4ZHLU 3QDZB 2J94A 1MAXA 2GDEH 1HFDA 2D2DA 2HPPH 1QIXB 4ZKRU 2SGPE 2CHAB 1CA0B 3BG4B 1DICA 4WWYA 5GPIB 2BDIA 1EOJA 1XUIA 1QTFA 1SGNE 1PQ7A 5DKMA 2PSXA 3DUXH 3ZVDA 6CHAB 4B2BA 1LHFH 2ZA5A 1PYTD 1SC8U 4GPGA 2QXIA 3SQEE 4Y10E 2FOHA 1RGQA 1Z6EA 6CHAC 3N7OA 1RTLA 1MBQA 2OC0A 1LPGB 3QN7A 3BG4C 4D76A 1CA0C 2CHAC 3KNXA 3LPRA 4AB9A 1GHBF 2W26A 4B73A 2KAIB 3AASA 3OYPA 3SV8A 3TNSA 3FVFB 4UE7H 1V2ST 2PR3A 1EZUC 2HWLB 1A5GH 1EB1H 1KTTB 4ZXXH 3SNAA 1O31A 3RXAA 1HB0B 1EX3A 2B9LA 1G3CA 1MTUA 2XBVA 3QWCH 1FXYA 5FBEA 2FDAA 2BDHA 2OUAA 3RP2A 1P57B 2Y6TA 2BQWB 1Z8JB 5GXPA 1QBNA 2SGQE 4PROA 3CP7A 1K28D 2PV9B 1Y5UT 1ZJDA 1DE7H 1NRNH 1KDQB 2ZU3A 3A7TA 1GJ5H 2ZU1A 3MNSA 2K1QA 2H9EH 2XBYA 1OSSA 2VNTA 5EOKA 5BRRE 2B7DH 1BRAA 1THSH 1BZXE 1Y3WA 1O37A 1GG6C 1GJ6A 2UUYA 4K8YA 4I8HA 2JH6D 3SJKA 2H9HA 1MCTA 1V2PT 3GOVB 1BTHH 4AYYB 4Y6DA 1B7XB 1A1RA 2PFEA 2ANKH 4CHAC 1DXWA 5C2ZA 1MTWA 2GT7A 3LGWA 1IQEA 7GCHF 1Z1JA 1QL9A 1SLUB 3KCGH 1LMWB 3EQ0H 3TJNA 2PWXA 1VGCC 1TBQH 1TOCB 2FZZA 1FDPA 1VJ9U 4Z0KA 3T27A 1HUTH 1EZXC 3TK5A 3SV6A 5E2OA 3SNBA 3HGPA 2GCHG 2P8OC 2STBE 1V2QT 1SI5H 1Y3VA 1DFPA 2Z6BD 1HAYB 4XBDA 1NRRH 3EDXB 2J2UA 3S9BA 1HIAA 4WXVA 5L6NH 2ZU5A 3RXKA 4D9QA 1BTZA 1F0TA 2BDGA 1UCYE 3RXIA 2WPLS 4WY3A 1YPEH 5B6OA 2W5EA 1AB9B 2A45B 4NSYA 3VB3A 2P3FH 1XUGA 3L33A 2IJOB 2ZGBH 2F9OA 3M7UA 4DVAU 3EAJA 1BTYA 3TK9A 4E06H 1VCPA 1O2JA 3U1JB 1V6DA 4GHQA 4R8TB 1TNKA 1H8IH 3E90B 1OYTH 3JZ2B 4NWLA 3RLYH 3Q00A 2PTNA 1IQNA 4I8KA 1J16A 3ATWA 1KTSB 1XUFA 2PSYA 1TNIA 2Y80A 3ATIA 5PTPA 4J2YB 3K6ZA 2BYAX 1TGTA 5FCKA 1E35B 2SGEE 3PMJA 2A31A 1LVMA 2Z3EA 3HKIB 3MO6A 3A81A 4BAOB 3OY6U 5GWZA 1TPAE 1QL8A 1X7AC 3UWJH 4B1TA 1XVMA 1NROH 2HNTC 1UHBA 3NWUA 2XTTB 1GBJA 1K1JA 1H4WA 5HXFA 3KIDU 2A2QH 3BTQE 2CXVA 4NA9H 4KTSA 9LPRA 3O8CA 2FOAA 3F68H 1M9UA 5C3NA 1HAXB 2NU0E 1OX1A 2XCFA 2QAAA 2ZDLA 4Y76A 1GVLA 1Z71A 3OTJE 2FEQH 1ZTLA 5AHGH 1KXDA 5C5OA 1SFQB 2PUXB 1QQUA 1QFKH 2VINA 1KDQA 1NN6A 1HXEH 1DVAH 3T29A 4AFZA 3E0NB 1GBAA 2V3OH 4KTCA 1MKWH 1AE5A 1GGDB 1YPGH 4KKDA 3SI4H 2ESTE 4YT6H 4BTUB 1GPZA 5LH8A 1WTGH 4GSOA 5LGOA 3FANA 5FBIA 8GCHG 3ZYDA 1DOJA 2QV1A 1GMDG 1K1IA 2ZU2A 2CMYA 2ILNA 4M7GA 3QUMP 1SGEE 2BXUH 4F4OC 4ZXYH 4JK5A 1S5SA 3TNTA 1P3EA 3SU3A 2D1JA 3O8RA 1V2NT 1O30A 3AW1A 3UNSA 2B5TB 1ZMNA 1FI8A 2RDLA 2HNTF 2VIVA 1C4Y2 2P94A 1QRWA 1LQEA 3PWCA 1QR3E 3BV9B 4VGCB 5T6GA 4D9RA 1XXDA 1G2MA 3LGTA 5TCAA 3UNRA 4AN7A 2ZTXA 4AYVB 3GY8A 4ZH8A 1GVKB 2XNIA 5H4IB 4CR5A 2JETC 4IN2A 3EA8A 3ELAH 1HV7A 1G2LA 2ZDKA 1CQQA 1DLEA 3KL6A 1XKAC 3E6PH 4ESTE 1BT7A 1HAHH 1T4VH 5GCHG 1A5IA 2OBOA 3TJUA 2FOGA 4OS5A 1ELDE 4JZDH 4X2VA 2TRMA 3GCTF 3KQCA 4Y11E 1GCTC 1QL7A 1A4WH 1O3NA 3NKKA 1SHYA 1ZMJA 1NM6A 1A3BH 2FOCA 5SGAE 1XUKA 1SOTA 4Q7XA 2FIRH 2SFAA 2A4GA 4FU9A 4ASHA 1P0SH 1TMUH 1W7XH 1ZHPA 1CT2E 3M5LA 1IHSH 2BZAA 1ZR0A 3VXFH 2BQ6B 5K7RA 1A61H 3RU4E 1AMHA 5HMAA 1V2MT 1C9PA 3ZZ7A 1TNGA 1GI8B 2C8XB 4U32A 3A80A 1IQLA 1D6WA 1FUJA 3NXPA 4X1PU 1GHWH 2BY7X 1DXPA 1GMCG 2TGDA 2A4OA 5EQSA 4X1NU 5DP5A 2TGPZ 1UK4A 1GBHA 3SW2B 1QNJA 1Y59T 2A5AA 5JBCS 1O2YA 2VGCB 2ALVA 2ZG0H 3HPTB 1ZHRA 1SB1H 2XYAA 4Y8YA 4DT7B 4MVNA 3QK1A 2VVUA 4NG9H 1BDAA 3KEEA 4GVUA 1ZRKA 1WQVH 3DD2H 2C90B 1FY3A 2QF0A 1O32A 1UTMA 2O8WA 4AGKA 5A2MH 1JBUH 1QA0A 1BTPA 4X6MA 2WPKS 1T32A 1KYNA 2ZI2H 3GY2A 2OCVB 1S82A 2W3KA 3SOSA 3BTME 3E16B 2OTVA 1ANEA 1NU9A 5T6DA 3ZZBA 4BXWA 3FZZA 5JBBS 2UWLA 1RTFB 4BTIB 5EPNA 1N8OB 3ZVCA 3T26A 2H2ZA 1QB9A 4ZKNU 2BVRH 1ARCA 4MQAA 2BXTH 3Q76A 2TBSA 4B71A 2IN2A 2J92A 4CREA 1GHAG 3SJ8A 3SUDA 1UK3A 1JIMA 3RMMH 3SGQE 2OXSA 2GZ7A 2CJIA 2WINI 1EAXA 3UOUA 1XKBC 1ELCA 5F6MA 1NTPA 2IOTA 4MPUA 3K6YA 1W0ZU 1C4U2 5GCHF 4UFDH 4DJZB 4OS7A 1FONA 3SHCH 3QGNB 4JZ1A 2WPJS 3EBNA 4X8VH 1L1JA 4J1YA 3SU1A 3P6ZB 2BDBA 4JMYA 2F9BH 4ISIH 4X1RU 1DSUA 3F9GA 5E8EH 2ZGXH 1C5SA 2UUFB 2GV6A 4IMQA 1V2WT 1TGSZ 2BM2A 2FS8A 3GY6A 4UFGH 5JB8S 3D65E 2BB4A 4AG1A 1OWEA 2R3UA 1U6QA 1FY1A 4IS5A 2FOFA 3V13A 2W7SA 3EYDA 1C1NA 4FUIA 1EJMA 1KLIH 4O03A 1S6FA 4XDEA 5DPAA 1NZQH 1UJ1A 5J4QA 3M7QA 4FUBA 5IDKA 4Q2KA 1JOUB 2WYGA 2BOKA 3CS7A 4LXBH 4MPVA 1P8VC 2XBWA 3RU4T 1H9LB 2BX3A 4ABGA 2QXJA 6LPRA 4ZMAH 5TJXA 3TITA 2VH6A 1YPLH 2GKVE 1UTQA 1GI1A 2ZGCA 1O5FH 1C1WH 3SJ9A 1LHGH 3STJA 4KELA 1GBMA 3ZV8A 1NRPH 2C3SA 1MD8A 5C1YA 3RMLH 3BTKE 1HAVA 1KLJH 1MZAA 3M5MA 2F9VA 3M5OA 1B0FA 3LU9B 3RXDA 4FUEA 3VEQB 3KN2A 3L6PA 2Z3CA 1C5ZB 3A8BA 4AFSA 4H6TA 3BTTE 3QO6A 2OC7A 2ZCLP 3LKWA 3BTDE 7GCHG 2OD3B 1TQ0B 2FI3E 5L2ZH 3MH7A 4RSPA 2BLWA 2FX4A 1V2LT 5CE1A 1OP0A 3Q77A 3ATLA 3T62A 4GHTA 1GBIA 2XC5A 1C1QA 3GCHC 1GMHF 1MTNC 2ZGHA 2R3YA 2YOLA 2ZO3H 5EGMA 1AZ8A 3E91A 4B74A 2GCTC 2ZNKH 4IC6A 4OS2A 1NESE 1QGFA 3P70B 3CS0A 3MOCA 4I33A 1H1BA 5ESBA 1GJDB 4WMEA 4X6NA 2ZP0H 1KXBA 2VWLA 4NA8A 3OY5U 4IMZA 1P04A 5DP3A 3TPIZ 1BHXB 2O8LA 3BTHE 1WUNH 1CU1A 4A92A 4DCDA 1O3HA 4JYTA 2FLBH 1SQTA 2RCEA 1AUJA 1Z6JH 1E38B 5L2YH 2AMDA 3F9FA 1AVWA 1IQFA 1C5UA 2XW9A 1GL1A 4CRBA 1BA8B 4ZKOU 2ZPRA 2BLVA 3RXBA 1YPJH 1MZDA 1AN1E 1EASA 3BEIB 3ZYEA 5A0AE 2ZFTA 1DLKB 3ENSB 3C27B 2O8TA 1V2JT 4AB8A 1SOZA 9ESTA 1XUHA 1K2I1 1O35A 3RMOH 2BY5X 3B9FH 1ACBE 4RKJB 1O3IA 1INCA 2G8TA 3TGKE 3H7TA 2ZZUH 3KF2A 2JH5D 1H8DH 4MNXA 1AFQB 8LPRA 3SI3H 2ZTZA 2Z9GA 4UFEH 1FAXA 2RG3A 1W10U 1NT1A 2TIOA 3FP8E 5A8ZA 1HLTH 2BY9X 2GGVB 1O2SA 2Y7XA 4K69A 4ZKSU 1O2UA 1HJ9A 5HYOA 4GAWA 1O2OA 2KAIA 3LH3A 3DFJA 5EXLA 1ZTJA 1TPOA 1W14U 4A1XA 3S69A 4CRGA 1P2NA 1CGHA 3E8LA 3Q3YA 2V3HH 3A7XA 1SLVB 2PKSB 1DWCH 1GHZA 3TGIE 3E3TA 1DT2A 3A83A 4H42U 1GMCF 3SO3A 3TH3H 3R0FA 4ABIA 3HGNA 2G4UA 1GI6A 1G3DA 2Z94A 2XC0A 1C2KA 2UUJB 2ZDNA 5GJ4B 1OYQA 1TRNA 2BY8X 2YNBA 4FVDA 2ZC9H 1P01A 1TNLA 3UFAA 3AAUA 2BX4A 2ZU4A 2H6MA 3GYMA 2WPIS 3OSYA 4Y0YE 5HM2A 1T8LA 2PKAB 4ABBA 1GMDF 1SHHB 2FESH 4X2YA 1AY6H 3A8DA 2XRCA 1EAUA 1ANBA 3T2NA 2P59A 1CO7E 2IPHA 2UWPA 4XBBA 5JDUB 2FS9A 1MCVA 2Q6GA 1V3XA 1OWHA
chains in the Genus database with same CATH superfamily
2G52A 1SGIB 2A32A 2RA0A 1HDTH 1CHGA 1BBRH 1UW7A 4INKA 1YGCH 1SQOA 2ZHFH 1Z7KA 3MNBA 1GDUA 3MH6A 2ODYB 2A7JA 5C20A 3D49H 1K0HA 3SU6A 4BAKB 1ZPZA 1F5LA 4GCHF 5DP6A 1SL3A 1IQHA 5I25A 1EPTB 1O3MA 1MU6B 2A7HA 2BZ6H 3MTYA 1FX0B 1NO9H 1NS3A 1RIWC 2GMTB 1JRSA 2V35A 1S84A 4A7IB 1ETTH 4YOIA 1NRQH 1TIOA 1EFRD 3U9AH 1TQ7B 2VB0A 2UUKB 1O3GA 2GCHF 1C5VA 3DSPA 1C5MD 4P02A 4XOJA 1BRBE 4FUJA 1O2HA 1AO5A 1EJAA 3DSOA 3PO1C 1ELBA 2FX6A 2J38A 4I8JA 4DW2U 3OE7D 1WTHD 1GJ4H 1AZZA 4O97A 2VIPA 1PPHE 2ZPQA 3RXTA 1E37B 3U8TH 2LELA 4XFQA 5DP4A 4XE4A 3PO1B 3M35A 1EJNA 4CRCA 3RXSA 3SGBE 1C5LH 3B8JA 7ESTE 1GHBG 4BOHA 5I46H 3RC4A 3KQEA 3ZVGA 1LVBA 2Z9JA 3ZZ9A 2F3CE 4D8NA 1RIWB 2GMTC 4I32A 3UPEA 1SGYE 2WPHS 2G5NA 1EPTC 1EAIA 1FIZA 2WV9A 2Q1JA 3I78A 4OGYA 1J8AA 3RXOA 4BANB 1LCYA 1UVTH 3F2FA 3P8NA 1OWJA 1HJAC 3SNEA 1SGRE 2BDYA 4OS4A 4MPXA 2A5KA 2FTLE 1DY9A 5DK1A 1ESBA 1GVZA 1FPCH 2SGFE 3H09A 5EQRA 1Z8RA 3A87A 3KGPA 1AVXA 5JPMH 2FTMA 3MNXA 1FMGA 1C2IA 1WAYB 1TBZH 1DUEA 3IG6B 2QY0B 1P05A 5C67A 1ZRBA 4YZUA 1CHOG 2BTCE 4GCHG 2A7CA 2GDDA 1VITH 8GCHF 2SGAA 2FI5E 3SUEA 2OC1A 2BD2A 1IQMA 4WMFA 2NU1E 4Y8ZA 2ZHWH 1UHBB 3PLBA 1CA8B 1P9UA 1CBWC 3I29A 1MKXK 3HKJB 1O2ZA 3VFEA 2G55A 4DGJA 3M3TA 1CGJE 3H7OA 4Y7BA 1DWDH 1HPGA 1OWDA 2EA3A 2F43B 1T31A 2PKAA 2W6JD 3RUOA 4AZ2B 3PB1E 3SBKA 2AERH 1TA2A 5CHBA 3OU0A 1PQ8A 4OS6A 5B6LA 2BVXH 2SNWA 2ZFFH 3LGYA 3GDUA 1W0YH 4NFEA 4TSFD 1AKSA 3HK3B 1YPHC 1BBRK 4TWYA 1C5TA 1K22H 1BRUP 4NA7A 1FY5A 2YMSB 5F03A 2K8IA 3Q3XA 5JBTA 2F9PA 1TPPA 4X6PA 1S0RA 3P92A 1GHXH 1UO6A 2QIQA 1O5EH 1ELFA 1KLTA 2Q6DA 1Y3UA 2J4IA 1SGDE 5L30H 1O3JA 3VB5A 4ASUD 4Q7ZA 3ZZ4A 2F4LA 2BD4A 3EA9A 1E0FD 2O8UA 4CR9A 3MU1A 1P11E 2Y5HA 1C1SA 2A4RA 5CHAC 1V2VT 2W6ID 1MQ6A 1BB0B 2BDAA 3LJJA 1PFXC 4ABHA 3FFGA 5A8XA 1TB6H 4K8BA 1THRH 2GX4A 2C8YB 2ZCKP 4FUCA 1H8ED 1UTOA 1O38A 5DP8A 4H6SB 2GZ8A 2V3MA 2BHGA 1O2RA 5F8XA 4ABJA 1GI7B 1OXGA 1O5DH 1GJBB 1G37A 1MAYA 3BSQA 1Z8GA 1SSXA 1F2SE 1YCPK 2B8OH 2CGAA 2QC2A 1EP5A 2J95A 3ZVAA 1YPMH 2QXGA 1LHCH 1G3EA 5EPYA 2VIQA 2G5VA 2ZTYA 3FP7E 2HNTE 2GCTB 3NCLA 3QZRA 2ZWLH 4I7YH 4AGJA 4CBNA 1TGNA 1GBDA 3FN8A 5DP9A 2GZ9A 4NFFA 3ESTA 1N6XA 3GCHB 3KHVA 2Y7ZA 3A88A 1LPZB 1IQJA 1SGFG 4K3JA 1BOQA 3M3SA 3MWIU 1K9OE 2J9NA 5LPFA 1IOEA 4IN1A 1ABJH 2C4FH 5E0GA 4INHA 1BCUH 1NFWA 1Y3XA 2XWBI 3BTFE 3MFJA 1ELEE 3F3BA 2NU4E 3PMBB 3FOAA 4RT0A 1G30B 1FV9A 1H9HE 3UIRA 1BTXA 2H9TH 3P17H 2EEKA 2ZPSA 3QLPH 2XNDD 3UNQA 3LONA 2ZHEH 3JZ1B 1Z1IA 1MD7A 5EJ1A 1LKBA 1C5RA 3SU0A 3MU5A 2I6QA 1QJ6B 4HG6A 4P00A 1SGFA 3TH2H 4ISHH 5T1VA 1XXFA 3MQKC 1NPMA 5C1XA 2OP9A 3SNCA 3RM2H 3TJOA 3U1IB 2P3TB 3V7TA 1DS2E 1W2KH 3GCTG 1WU1A 2A5IA 1V2TT 1BQYA 2AGEX 1ZZZA 1GCDA 1F5KU 1GBCA 3URDA 1LHEH 3AVZA 3SU2A 3QZQA 1O2GH 1TMTH 2J5UA 4CH8B 1YYY1 2TPIZ 4DURA 4D7GA 1TX8A 1JWTA 2BD5A 2FYRA 1QBOA 4ABAA 2GTBA 1P10A 3OEHD 4QT8C 1VJAU 3TJVA 1TONA 5CHAB 2HRVA 1UCYH 3BF6H 1A46H 1VITF 2EY4C 2Y5FA 1YCPM 1NFYA 1Z8IB 3RXGA 1OP8A 4CRFA 4INLA 1K1NA 1PJPA 2H5CA 4WXIA 3EE0B 4FXGH 1QRXA 1OWIA 1HXFH 5DJ7A 2OBQA 1J9CH 3M37A 3WWBA 1P2KA 2ZKSA 2G51A 2A1DB 2YMSC 1PPEE 1UK2A 4Z1MD 2SGDE 1Y5AT 4DIHH 4ZUHA 1S81A 3F9EA 1W13U 2CF8H 1OS8A 1O2QA 1YPHE 1KIGH 2KFWA 1TNHA 1NC6A 1V2KT 1WDIA 1AVGH 1C5YB 1YKTA 1DUAA 4ZHMU 5EQQA 1O34A 2FM2A 2DUCA 1EP6A 1CBWB 3M7TA 3A7VA 1N6YA 5C0TA 2VWNA 4JZEH 4KP0A 2XXLA 3UQOA 3LJOA 4M9FA 4RI0A 2J97A 3A8AA 3CENA 1A2CH 2VIDA 3GY5A 1C9TA 1N8OC 2OC8A 3QGJA 4OS1A 1L2EA 1MTSA 1QURH 1ZGVA 4XBCA 2Q6FA 1ZLRA 2FWWA 3LH1A 1S0QA 1TRYA 4ISNA 4X2XA 5A0BA 5C1UA 3QTOH 2XOKD 1P09A 3U8OH 4X8TH 2Z9LA 3N99A 3IITA 3ZZ8A 1ZTKA 4Y71A 3FZDA 5IYTA 4FOUC 3BTEE 1HJAB 3MU8A 1EOLA 1FN8A 1O3BA 1GHAF 2C8WB 3ZVEA 2CV3A 1HNEE 2WHXA 2PUQH 3DA9B 4FUHA 1W12U 3RXEA 1OOKB 1XVOA 1DWEH 1O5BB 3RXPA 1EAWA 1NBME 1WBGB 1LDTT 3GY3A 4UDWH 4OM9A 5FAHA 2ANMH 5EW1H 1GDQA 1JMOH 1C2EA 1AD8H 4UFFH 3MH5A 1KXFA 1ORFA 2FPZA 4HI3A 1ETSH 2ANWA 4JK6A 1YF4A 1BHXF 5A8YA 5K0HA 5AFYH 1EZSC 4NCYA 1ARBA 2F91A 2QA9E 2FLRH 2BVSH 2ZHQH 1C1OA 4Y8XA 1O36A 1TX6A 4AFQA 1KXAA 4R0IA 1O3CA 1GHYH 1TOMH 2Y81A 3A7WA 1K1MA 4DY7B 1EUFA 2PHBA 2BOHB 1AUTC 5GIBA 2F9NA 3RXUA 3TK6A 1T8NA 1DX5M 4BTTB 4O3TA 2ZFPH 1C5NH 1BMNH 1QA7A 2HALA 1LVOA 1JIRA 4TPIZ 4BAQB 5KEDA 1W7GH 3T28A 4CH2B 4UONA 1L4DA 2BY6X 4WF8A 6ESTA 1SGTA 4WMDA 1ELAA 1J14A 1TGCA 1SLWB 2AIPA 4VGCC 3SJOA 1NU7B 3ZZAA 2O8MA 2BLOA 3MO9A 2J34A 1AWHB 2QYIA 4A1VA 3MO3A 5TCCA 3MNCA 2I6SA 2AMPA 2C8ZB 1A5HA 1QB1A 4ABEA 2VVCA 2V6NA 1AU8A 1OHHD 3H5CB 1PPGE 3TGJE 1OWKA 2CN0H 5EODA 5FXLA 2VBCA 3GDSA 1XX9A 3N7EA 5BPEA 4HFPB 3UUZA 1D3DB 1GWAA 1HIAB 1A0HB 1O3AA 4X1SU 3F6UH 2AEIH 2G00A 1PPZA 4K60A 4TWWA 1GJ9B 2HVXA 2FOBA 3UREA 4U30A 1GGDC 1VR1H 1C2LA 1ZMLA 3MMGA 2QCYA 5T6FA 1C2DA 1TALA 1PPCE 1ANDA 1YBWA 3ZZ3A 2QXHA 2FODA 4Q7YA 5IK2D 3WY8A 4BNRA 3BN9A 2J98A 2ZFQH 3SNDA 5HM9A 5FX6A 3P8OA 4X6OA 1HAOH 1ZGIA 1BUIA 1O3PB 4UEHH 1O5AB 4NIVA 3MI4A 2B0FA 4HZHA 4YXWD 3UR6A 2WYJA 3IWMA 1CE5A 2QGRA 5EIYA 2VU8E 1QBVH 2PKSC 4F48B 3MU0A 5GNDA 8KME2 3EA7A 2KCOA 3RXVA 1BTUA 2ZECA 3F2GA 2FMJA 3M36A 1XM1A 3GCNA 3PLPA 4ISLA 3M3VA 1C1TA 2LPRA 1CHOF 1SLXB 2PLXA 4ABFA 2FXRA 4NGAH 1G36A 1O3DA 1UTKA 1UVOA 2R9PA 3D62A 3GY7A 5DP7A 3BIUH 3SV2H 2AS9A 5FX5A 3V12A 1E34B 3DT0H 1AFQC 3R3GB 5LPRA 1RJXB 2BLQA 1HAZB 2O9QA 4B75A 1O3EA 1D3TB 1GI4A 1QHRB 1TBRH 2OQ5A 1YC0A 2BMGB 1HYLA 1PQ5A 1ELGA 1GI5A 4FU7A 1O2XA 3URCA 3M5NA 1V2UT 4E7NA 4YESB 4XRNA 3S9CA 5E0JA 3BTGE 2WPMS 3RU4D 5KGOA 4CRDA 2PGQB 3PLKA 3MHWU 4MNVA 1WV7H 1TAWA 3DHKH 1FY8E 4YTAA 1LVYA 2AGIX 3V0XA 2ANYA 2Y5GA 1Y5BT 4MPWA 3A82A 3DSGA 1JRTA 1GJAB 1GI3A 1RXPA 3SQHE 4JYVH 1WOFA 3SU5A 3RMNH 3S9AA 1WCZA 1GBBA 2XBXA 2ZEBA 3SORA 1GBFA 1F92A 4XD7D 1WQSA 4TY7A 2EC9H 2TGTA 1QQ4A 1IQGA 1MTNB 1ZHMA 1VCQA 1ID5H 3MYWA 1O2VA 4U2WA 2AIQA 1F0UA 2ASUB 2ZDAH 4K2YA 2GP9B 5EXMA 4K5ZA 1O2LA 3C1KA 1HGTH 2XWAA 2EI6A 4IBLH 1FY4A 2LP6A 4YM9A 3VB4A 1IAUA 3LIWA 4RKOB 2P93A 3A89A 3L3TA 3BG8A 4AOQA 5DGJA 3GDVA 1LHDH 3NUMA 1O3FA 1C5OH 1AIXH 3SHAH 2HOBA 1YM0A 1C1UH 4K1EA 1LQDB 4CHAB 2H5DA 2ZCHP 4K1TA 1O5CB 4MNYA 1CT0E 3A84A 1FPHH 1S6HA 2BDCA 1NFUA 4AORA 1O2WA 5ETXA 1D4PB 1K21H 5DN6D 1C2JA 1Q2WA 1E79D 2QF3A 1S85A 4K1SA 1FLEE 3ZV9A 1P3CA 1P9SA 1COWD 1LKAA 1TFXA 5F8TA 3AW0A 1O3LA 3K65B 3O8BA 3V3MA 2LIZA 5AFZH 1A0JA 3F0PA 5ESTE 3TU7H 2FO9A 1OP2A 1V2OT 3I77A 1B0EA 4NIYA 5ABWA 1PYTC 3M61U 3PTNA 2PGBB 4YO9A 3DCLA 2D26C 2ZFSA 3SN8A 1SR5C 3STIA 2NWNA 1HAVB 1VITG 1O2NA 4NZLA 1MUEB 3RXJA 3VG8A 4CBOA 5EJLA 1D9IA 1KSNA 1LPKB 1NY22 2DE9A 4I31A 2LNCA 1MBMA 1QZ8A 1MQ5A 2AH4X 2ZDVH 5FPSA 2ULLA 3BEFB 1AE8H 4MLFB 2R2MB 4ACBA 4DIIH 3ZZDA 4FETA 4U01A 2FP7B 2XCNA 2P3UB 3OTPA 5G4BA 1BITA 4MDSA 2BQ7B 3UR9A 1C1PA 2BD8A 1KXCA 4DG4A 3ZZCA 1B5GH 4JYUH 3RXLA 3PRDA 1W3CA 1FN6A 3LDXH 1T8MA 4THNH 3BTWE 1BMMH 3UQVA 1SGCA 1ZSLA 2EI8A 3S7HB 1WYKA 4TY6A 1QB6A 3LC3A 1IQIA 5JBAS 1W11U 2EI7A 1C1RA 2F83A 4AFUA 1P03A 1ZOMA 3RXFA 1L4ZA 4BAMB 1GI0A 3RXQA 2QF4A 2VWOA 2M2AA 3K2UA 1AKSB 5F8ZA 1HAGE 2W3IA 1O2MA 1RS0A 3FO8D 2FYQA 1P06A 1ZJKA 3VB6A 2KCAA 3RXCA 3AAVA 1TNJA 1BTWA 5A0CA 3GCOA 2VH0A 2L6OA 4KGAA 3RM0H 3RC5A 1BMAA 3RXHA 2RDEA 1P2QA 2Z9IA 1O2IA 4YT7H 3E0PB 3ZVBA 4B2AA 3UY9A 1UTPA 1HJ8A 1RD3B 1AWFH 4ZHAA 2R2WU 2UWOA 5EG4A 4YLUA 1K1OA 4NZQA 1GJ8B 1D3QB 1EXFA 1PPFE 1V2RT 4AG2A 1YLDA 1BJUA 1UMAH 3QTVH 4IGDA 1LO6A 4LOYH 3A86A 1P2OA 2FI4E 3ATMA 2QN5T 5CMXH 1C5PA 2Z9KA 1HBTH 1ESAA 2ZGJA 3PMHB 3PROA 1D3PB 4TT3D 2JKHA 3VPKA 1C2HA 4JZIA 4XSKU 1UTNA 1NBMD 3MU4A 3U98H 2ZDMA 3S0NA 1P2MA 5J4SA 1KXEA 3GY4A 2GT8A 4OGXA 4E05H 4FUDA 4YLQH 1GMHG 1P02A 1SBWA 2IPQX 1SGQE 4FVBA 1BBRE 1BIOA 1PPBH 2VGCC 1ETRH 1TLDA 1SFIA 3KQDA 3UTUH 2CF9H 4MG3A 4KTUA 1W8BH 1TWXB 3NK8A 6GCHG 4A6LA 1Q3XA 4Y7AA 2ZIQH 1MU8B 3FAOA 1SGPE 1TGBA 2ZQ2A 3CNRA 3S7KB 1ZSKA 1GJ7B 1T7CA 1ZSJA 2AMQA 3ODDA 1TABE 4LZ1H 1G3BA 3P8FA 1J17T 3KQ5A 5A09A 1UVUH 4NWKA 1MH0A 3LOXA 1GBEA 4AX9H 5C5NA 1GBKA 5FHTA 6GCHF 4LK4A 3F1SB 1GI2A 3LGVA 3OX7U 1FNIA 3EGKH 4B2CA 4Z6AH 2ZFRH 4ISOA 2AYWA 3NPSA 4D7FA 1MKXH 2BD7A 1O2PA 2PTCE 2V0BA 2C93B 4Y0ZE 5C0UA 1GCTB 4Q80A 5EXNA 1ABIH 2A0QB 4WH6A 3ZZ5A 3WWFA 3KQBA 3SUFA 3LGIA 3TIUA 1GI9B 1T4UH 1D6RA 1DPOA 1P2IA 3RC6A 5FCRA 2TGAA 2KCPA 1G32B 5AVDA 1O5GH 1YCPH 2JETB 3LGUA 2HGTH 5E0HA 3PRBA 5E2PA 4BAHB 5DO4H 4NIWA 1TRMA 3ZZ6A 2YNAA 4X0WU 3SGAE 1F0SA 1EB2A 3PTBA 4BXSA 1C2MA 3T5FH 1AI8H 3K9XB 1O3OA 1DITH 3SV9A 1A0LA 4Y79A 2G81E 3B23B 1QJ1B 2BD9A 4WJG2 1C5XB 4IW4E 5HGGA 1ESTA 1GBTA 3A85A 1WSSH 3MH4A 2R0KA 1ZPCA 2ODPA 2EQNA 2GD4B 1BRCE 1E1RD 4DOQA 4YOJA 2VWMA 1SQAA 3NRLA 3E1XB 3RLWH 3P8GA 2K7XA 1J15A 3P95A 3HK6B 1DY8A 3VGCB 4FUFA 1HAIH 5HIYA 1GBLA 3W1EA 4X8UH 7KMEH 3AK5A 3RXMA 4H4FA 1NFXA 2FOMB 1OKXA 1VZQH 1TA6A 2D8WA 3O8DA 4RN6A 2QF5A 3NZIA 1JXPA 1EZQA 2AFQB 2THFB 3ZVFA 3QX5H 2A2XH 1AHTH 3GISB 1EPTA 5FPTA 1C1VH 1KY9A 3VGCC 8ESTE 1HAPH 1TPSA 4AC9A 4TPYA 2WPDD 1CGIE 1UCYK 4HTCH 1MMJN 3HATH 4UD9H 1C1MA 4MNWA 3VXEH 1HCGA 2GV7A 7LPRA 3Q3KA 1YPKH 2VVVA 3LT3A 3TLOA 1QJ7B 2G4TA 4CRAA 4A1TA 2FOEA 2Z7FE 2ZHDA 2STAE 5FPYA 2F9UA 2M5TA 1L1NA 1ANCA 5AF9H 4JCNA 1DANH 3GICB 4YOGA 1K1LA 2XC4A 2OQUA 3PM3A 1O39A 1F0RA 1DSTA 1QY6A 4DT4A 3ATKA 4A5TS 3PV2A 3U8RH 1GHVH 2AGGX 1BJVA 4ZCNA 1NRSH 1EATA 4O9VA 3BEUA 1O2TA 2HLDD 1Q31A 3DFLA 1W0JD 1UTLM 2KM0A 1MKWK 1K1PA 1E36B 1UTJA 3BIVH 1DM4B 1A7SA 2DE8A 2WUCA 2JH0D 3U69H 1GDNA 1G9IE 4SGBE 4O3UA 2BD3A 1THPB 4ABDA 2RA3A 1Y3YA 1PQAA 3G01A 1O0DH 4NSVA 1IQKA 2ZQ1A 1BMFD 1N1LA 1AB9C 5T3HA 2HLCA 1YLCA 4WVPE 1O2KA 2WV4A 2SNVA 2H1UA 1A3EH 1TX7A 1EKBB 1UVPA 1XMNB 2R0LA 4GUXA 1DDJA 3RXRA 1HRTH 1T8OA 1VCWA 3PYHA 4HGCA 3ODFA 1CVWH 1Y8TA 2P8OB 1C2FA 1MABB 1QRZA 1RTKA 2KCYA 2WUBA 4SGAE 3RDZA 5GDSH 2NU3E 4I8LA 1C2GA 2OINA 4LZ4B 3A7YA 4FUGA 3UWIA 4B76A 1FJSA 4MTBA 3PWBA 4X8SH 4X2WA 1GJCB 1C4V2 3VB7A 2A4QA 1GL0E 1VGCB 1RFNA 3W94A 1C5QA 1AQ7A 5JB9S 3UB0A 1OPHB 1FIWA 1SVPA 1UVSH 3ITIA 3TH4H 4E7RG 1S83A 2HPQH 1ELTA 1IHTH 4IC5A 3SU4A 3A7ZA 2VIOA 3PV4A 1QCPA 3A8CA 2GVFA 2VJ1A 1O3KA 1H9IE 3UOPA 1FZZA 2ODQA 1O33A 2WV5A 1AFEH 1L0ZA 1WXRA 4F49A 4RT1A 3SZNA 5JYIA 1YP9A 1GG6B 1ZPBA 3SJIA 1FAKH 3SV7A 3PMAB 1C5WB 3GYLB 4ZAEA 3SUGA 4NIXA 5EU8A 4TYDA 2NU2E 1CSOE 4WH8A 4X1QU 3D23A 1MTVA 2ALPA 2W7UA 1EQ9A 1FQ3A 1TMBH 3OAAD 2VIWA 1LTOA 3LC5A 2PW8H 1TYNA 1DWBH 2JJ1D 1ELVA 4JZFH 4I8GA 1CT4E 2ZF0H 1P2JA 1RRKA 1F5RA 2Z3DA 1TE0A 3FP6E 2OLGA 2P95A 3F9HA 3T25A 1SMFE 1BMLA 4ZROA 1ZYOA 1SG8B 5LPEA 3TVJB 5EW2H 2AHME 1SPJA 2P16A 4GLYA 5DG6A 1AGJA 2Y82A 3W95A 1L1GA 1F7ZA 2QE7D 4FU8A 1XUJA 1P12E 4ZHLU 3QDZB 2J94A 1MAXA 5HKKD 2GDEH 1HFDA 2D2DA 2JIZD 2HPPH 1QIXB 4ZKRU 2SGPE 2CHAB 1CA0B 3BG4B 1DICA 4WWYA 5GPIB 2BDIA 1EOJA 1XUIA 1QTFA 1SGNE 4Q4LA 1PQ7A 5DKMA 2PSXA 3DUXH 3ZVDA 6CHAB 4B2BA 1SQRA 1LHFH 2ZA5A 1PYTD 1SC8U 4GPGA 2QXIA 3SQEE 4Y10E 2FOHA 1RGQA 1Z6EA 6CHAC 3N7OA 1RTLA 1MBQA 2OC0A 2CK3D 1LPGB 3QN7A 3BG4C 3UAIC 4D76A 1CA0C 2CHAC 3KNXA 3LPRA 4AB9A 1GHBF 2W26A 2YMSD 4B73A 2KAIB 3AASA 3OYPA 3SV8A 3TNSA 3FVFB 4UE7H 1V2ST 4B6FA 2PR3A 1EZUC 2HWLB 1A5GH 1EB1H 1KTTB 4ZXXH 3SNAA 1O31A 3RXAA 1HB0B 1EX3A 2B9LA 1G3CA 1MTUA 2XBVA 3QWCH 1FXYA 5FBEA 2FDAA 2BDHA 2OUAA 3OEED 3RP2A 1P57B 2Y6TA 2BQWB 1Z8JB 5GXPA 1QBNA 2SGQE 4PROA 3CP7A 1K28D 1Y5UT 2PV9B 1ZJDA 1DE7H 2PP6A 1NRNH 1KDQB 2ZU3A 3A7TA 1GJ5H 2ZU1A 3MNSA 2K1QA 2H9EH 2XBYA 1OSSA 2VNTA 5EOKA 5BRRE 2B7DH 1BRAA 1THSH 1BZXE 1Y3WA 1O37A 1GG6C 1GJ6A 2UUYA 4K8YA 4I8HA 2JH6D 3SJKA 2H9HA 1MCTA 1V2PT 3GOVB 1BTHH 4AYYB 4Y6DA 1B7XB 1YY3A 1A1RA 2PFEA 2ANKH 4CHAC 1DXWA 5C2ZA 1MTWA 2GT7A 3LGWA 1IQEA 1KMHB 7GCHF 1Z1JA 1QL9A 1SLUB 3KCGH 1LMWB 3EQ0H 3TJNA 2PWXA 1VGCC 1TBQH 1TOCB 2FZZA 1FDPA 1VJ9U 4Z0KA 3WW7A 3T27A 1HUTH 1EZXC 3TK5A 3SV6A 5E2OA 3SNBA 3HGPA 2GCHG 2P8OC 2STBE 1V2QT 1SI5H 1Y3VA 3EE7A 1DFPA 2Z6BD 1HAYB 4XBDA 1NRRH 3EDXB 1H8HD 2J2UA 3S9BA 1HIAA 4WXVA 5L6NH 2ZU5A 3RXKA 4D9QA 1BTZA 1F0TA 2BDGA 1UCYE 3RXIA 2WPLS 4WY3A 1YPEH 5B6OA 2W5EA 1AB9B 2A45B 4NSYA 3VB3A 2P3FH 1XUGA 3L33A 2IJOB 2ZGBH 2F9OA 3M7UA 4DVAU 3EAJA 1BTYA 3TK9A 4E06H 1VCPA 1O2JA 3U1JB 1V6DA 4GHQA 4R8TB 1TNKA 1H8IH 3E90B 1OYTH 3JZ2B 4NWLA 3RLYH 3Q00A 2PTNA 1IQNA 4I8KA 1J16A 3ATWA 1KTSB 1XUFA 2PSYA 1TNIA 2Y80A 3ATIA 5PTPA 4J2YB 3K6ZA 2BYAX 1TGTA 5FCKA 1E35B 2SGEE 3PMJA 2A31A 1LVMA 2Z3EA 3HKIB 3MO6A 3A81A 2HVYB 4BAOB 3OY6U 5GWZA 1TPAE 1QL8A 1X7AC 3UWJH 4B1TA 1XVMA 1NROH 2HNTC 1S6LA 1UHBA 3NWUA 2XTTB 1GBJA 1K1JA 1H4WA 5HXFA 3KIDU 2A2QH 2KR7A 3BTQE 2CXVA 4NA9H 4KTSA 9LPRA 5HIZA 2FOAA 3F68H 3O8CA 1M9UA 5C3NA 1HAXB 2NU0E 1OX1A 2XCFA 2QAAA 2ZDLA 4Y76A 1GVLA 1Z71A 3OTJE 2FEQH 1ZTLA 5AHGH 1KXDA 2L74A 5C5OA 1SFQB 2PUXB 1QQUA 1QFKH 2VINA 1KDQA 1NN6A 1HXEH 1DVAH 3T29A 4AFZA 3E0NB 3KYGA 1GBAA 2V3OH 4KTCA 1MKWH 1AE5A 1GGDB 1YPGH 4KKDA 3SI4H 2ESTE 4YT6H 4BTUB 3U28C 1GPZA 5LH8A 1WTGH 4GSOA 5LGOA 3FANA 5FBIA 8GCHG 3ZYDA 1DOJA 3SZEA 2QV1A 1GMDG 1K1IA 2ZU2A 2CMYA 2ILNA 4M7GA 3QUMP 1SGEE 2BXUH 4F4OC 4ZXYH 4JK5A 1S5SA 3TNTA 1P3EA 3SU3A 4F55A 2D1JA 3O8RA 1V2NT 1O30A 3AW1A 3UNSA 2B5TB 1ZMNA 1FI8A 2RDLA 2HNTF 2VIVA 1C4Y2 2P94A 1QRWA 3F2HA 1LQEA 3PWCA 5C94A 1QR3E 3BV9B 4VGCB 5T6GA 4D9RA 1XXDA 1G2MA 3LGTA 5TCAA 3UNRA 4AN7A 2ZTXA 4AYVB 3GY8A 4ZH8A 1GVKB 2XNIA 5H4IB 4CR5A 2JETC 4IN2A 3EA8A 3ELAH 1HV7A 1G2LA 2ZDKA 1CQQA 1DLEA 3KL6A 1XKAC 3E6PH 4ESTE 1BT7A 1HAHH 1T4VH 5GCHG 1A5IA 2OBOA 3TJUA 2FOGA 4OS5A 1ELDE 4JZDH 4X2VA 3GS9A 2TRMA 3GCTF 3KQCA 4Y11E 1GCTC 1QL7A 1A4WH 1O3NA 2JJ2D 3NKKA 1SHYA 1ZMJA 1NM6A 1A3BH 2FOCA 5SGAE 1XUKA 1SOTA 4Q7XA 2FIRH 2SFAA 2A4GA 4FU9A 4ASHA 2WZQA 1P0SH 1TMUH 1W7XH 1ZHPA 1CT2E 3M5LA 1IHSH 2BZAA 1ZR0A 3VXFH 2BQ6B 5K7RA 1A61H 3RU4E 1AMHA 5HMAA 1V2MT 1C9PA 3ZZ7A 2K0QA 1TNGA 1GI8B 2C8XB 4U32A 3A80A 1IQLA 1D6WA 1FUJA 3NXPA 4X1PU 1GHWH 2BY7X 1DXPA 1GMCG 2TGDA 2A4OA 5EQSA 4X1NU 5DP5A 2TGPZ 1UK4A 1GBHA 3SW2B 1QNJA 1Y59T 2A5AA 1E1QD 5JBCS 1O2YA 2VGCB 2ALVA 2ZG0H 3HPTB 1ZHRA 1SB1H 2XYAA 4Y8YA 4DT7B 4MVNA 4Q63A 3OFND 3QK1A 2VVUA 4NG9H 1BDAA 3KEEA 1W0KD 2J98B 4GVUA 1ZRKA 1WQVH 3DD2H 2C90B 1FY3A 2QF0A 1O32A 3F0OA 1UTMA 2O8WA 4AGKA 5A2MH 1JBUH 1QA0A 1BTPA 4X6MA 2WPKS 1T32A 1KYNA 2ZI2H 3GY2A 2OCVB 1S82A 2W3KA 3SOSA 3BTME 3E16B 2OTVA 1ANEA 1NU9A 5T6DA 3ZZBA 4BXWA 3FZZA 5F53A 5JBBS 2UWLA 1RTFB 4BTIB 5EPNA 1N8OB 3ZVCA 3T26A 2H2ZA 1QB9A 4ZKNU 2BVRH 1ARCA 4MQAA 2BXTH 3Q76A 2TBSA 4B71A 2IN2A 2J92A 4CREA 1GHAG 3SJ8A 3SUDA 1UK3A 1JIMA 3RMMH 3SGQE 2OXSA 2GZ7A 2CJIA 2WINI 1EAXA 3UOUA 1XKBC 1ELCA 5F6MA 1NTPA 2IOTA 4B6EA 4MPUA 3K6YA 5FL7D 1YLNA 1W0ZU 1C4U2 5GCHF 4UFDH 4DJZB 4OS7A 1FONA 3SHCH 3QGNB 4JZ1A 2WPJS 3EBNA 4X8VH 1L1JA 4J1YA 3SU1A 3P6ZB 4ACAA 2BDBA 4JMYA 2F9BH 4ISIH 4X1RU 1DSUA 3F9GA 5E8EH 2ZGXH 1C5SA 2UUFB 2GV6A 4IMQA 1V2WT 1TGSZ 2BM2A 2FS8A 3GY6A 4UFGH 5JB8S 3D65E 2BB4A 4AG1A 1OWEA 2R3UA 1U6QA 1FY1A 4IS5A 2FOFA 3V13A 2W7SA 2KZ4A 1C1NA 3EYDA 2IJD1 1YWUA 4FUIA 2JDID 1EJMA 1KLIH 4O03A 1S6FA 4XDEA 5DPAA 1NZQH 1UJ1A 5DSFA 5J4QA 3M7QA 4FUBA 5C17A 5IDKA 4Q2KA 1JOUB 2WYGA 2BOKA 3CS7A 4LXBH 4MPVA 1P8VC 2XBWA 3RU4T 1H9LB 2BX3A 5KECA 4ABGA 2QXJA 6LPRA 4ZMAH 5TJXA 3TITA 2VH6A 1YPLH 2GKVE 1UTQA 1GI1A 2ZGCA 3PV5A 1O5FH 1C1WH 3SJ9A 1LHGH 3STJA 2GJGA 4KELA 1GBMA 3ZV8A 1NRPH 2C3SA 1MD8A 5C1YA 3RMLH 3BTKE 1HAVA 1KLJH 1MZAA 1VKYA 3M5MA 2F9VA 3M5OA 1B0FA 3LU9B 3RXDA 2KX4A 4FUEA 3VEQB 3KN2A 3L6PA 2Z3CA 1C5ZB 2OK5A 3A8BA 3KYFA 4AFSA 4H6TA 3BTTE 3QO6A 2OC7A 2ZCLP 3LKWA 3BTDE 7GCHG 2OD3B 1TQ0B 2FI3E 5L2ZH 3MH7A 3ZIAD 4RSPA 2BLWA 2FX4A 3SYJA 1V2LT 5CE1A 1OP0A 3Q77A 3ATLA 3T62A 4GHTA 1GBIA 2XC5A 1C1QA 3GCHC 1GMHF 5EJZA 1MTNC 2ZGHA 2R3YA 2YOLA 2ZO3H 5EGMA 1AZ8A 3E91A 4B74A 2GCTC 2ZNKH 4IC6A 4OS2A 1NESE 1QGFA 3P70B 3CS0A 3MOCA 4I33A 1H1BA 5ESBA 1GJDB 4WMEA 4X6NA 2ZP0H 1KXBA 2VWLA 4NA8A 3OY5U 4IMZA 1P04A 5DP3A 3N7DA 3TPIZ 1BHXB 2O8LA 3BTHE 1WUNH 1CU1A 4A92A 4DCDA 1O3HA 4JYTA 2FLBH 1SQTA 1AUJA 2RCEA 1Z6JH 1E38B 5L2YH 2AMDA 3F9FA 1AVWA 1IQFA 1C5UA 1SKYE 2XW9A 1GL1A 4CRBA 2RFKC 1BA8B 4ZKOU 2ZPRA 2BLVA 3RXBA 1YPJH 3FKSD 1MZDA 1AN1E 1EASA 3BEIB 3ZYEA 2V7QD 5A0AE 2ZFTA 5CDFE 1DLKB 3ENSB 3C27B 2O8TA 1V2JT 4AB8A 1SOZA 9ESTA 1XUHA 1K2I1 1O35A 3RMOH 2BY5X 3B9FH 1ACBE 4RKJB 1O3IA 1INCA 2G8TA 4I86A 3TGKE 3H7TA 2ZZUH 3KF2A 2JH5D 1H8DH 4MNXA 1AFQB 8LPRA 3SI3H 2ZTZA 2Z9GA 4UFEH 1FAXA 2RG3A 1W10U 1NT1A 2TIOA 3FP8E 5A8ZA 1HLTH 2BY9X 2GGVB 1O2SA 2Y7XA 4K69A 4ZKSU 1O2UA 1HJ9A 5HYOA 4GAWA 1O2OA 2KAIA 3LH3A 3DFJA 5EXLA 1ZTJA 1TPOA 1W14U 4A1XA 3S69A 4CRGA 1P2NA 1CGHA 3E8LA 3Q3YA 2V3HH 3A7XA 1SLVB 2PKSB 1DWCH 1GHZA 3TGIE 3E3TA 1DT2A 3A83A 4H42U 1GMCF 3SO3A 3TH3H 3R0FA 4ABIA 3HGNA 2G4UA 1GI6A 1G3DA 2Z94A 2XC0A 1C2KA 2UUJB 2ZDNA 5GJ4B 1OYQA 1TRNA 2BY8X 2YNBA 4FVDA 2ZC9H 1P01A 1TNLA 3UFAA 3AAUA 2BX4A 2WSSD 2ZU4A 2H6MA 3GYMA 2WPIS 3OSYA 4Y0YE 5HM2A 1T8LA 2PKAB 4ABBA 1GMDF 1SHHB 2FESH 4X2YA 1AY6H 3A8DA 2XRCA 1EAUA 1ANBA 3T2NA 2P59A 1CO7E 2IPHA 2UWPA 4XBBA 5JDUB 2FS9A 1MCVA 2Q6GA 1V3XA 1OWHA
chains in the Genus database with same CATH topology
2G52A 1SGIB 2A32A 2RA0A 1HDTH 1CHGA 1BBRH 4INKA 1YGCH 1SQOA 2ZHFH 1Z7KA 3MNBA 1GDUA 3MH6A 2ODYB 2A7JA 5C20A 3D49H 3SU6A 4BAKB 1ZPZA 1F5LA 4GCHF 5DP6A 1SL3A 1IQHA 5I25A 1EPTB 1O3MA 1MU6B 2A7HA 2BZ6H 3MTYA 1NO9H 1NS3A 1RIWC 2GMTB 1JRSA 2V35A 1S84A 4A7IB 1ETTH 4YOIA 1NRQH 1TIOA 3U9AH 1TQ7B 2VB0A 2UUKB 1O3GA 2GCHF 1C5VA 1C5MD 4XOJA 1BRBE 4FUJA 1O2HA 1AO5A 1EJAA 3PO1C 1ELBA 2FX6A 2J38A 4I8JA 4DW2U 1WTHD 1GJ4H 1AZZA 4O97A 2VIPA 1PPHE 2ZPQA 3RXTA 1E37B 3U8TH 4XFQA 5DP4A 4XE4A 3PO1B 3M35A 1EJNA 4CRCA 3RXSA 3SGBE 1C5LH 3B8JA 7ESTE 1GHBG 4BOHA 5I46H 3RC4A 3KQEA 3ZVGA 1LVBA 2Z9JA 3ZZ9A 2F3CE 4D8NA 1RIWB 2GMTC 4I32A 3UPEA 1SGYE 2WPHS 2G5NA 1EPTC 1EAIA 1FIZA 2Q1JA 3I78A 4OGYA 1J8AA 3RXOA 4BANB 1LCYA 1UVTH 3P8NA 1OWJA 1HJAC 3SNEA 1SGRE 2BDYA 4OS4A 4MPXA 2A5KA 2FTLE 1DY9A 5DK1A 1ESBA 1GVZA 1FPCH 2SGFE 5EQRA 1Z8RA 3A87A 3KGPA 1AVXA 5JPMH 2FTMA 3MNXA 1FMGA 1C2IA 1WAYB 1TBZH 1DUEA 3IG6B 2QY0B 1P05A 5C67A 1ZRBA 4YZUA 1CHOG 2BTCE 4GCHG 2A7CA 2GDDA 1VITH 8GCHF 2SGAA 2FI5E 3SUEA 2OC1A 2BD2A 1IQMA 4WMFA 2NU1E 4Y8ZA 2ZHWH 1UHBB 3PLBA 1CA8B 1P9UA 1CBWC 3I29A 1MKXK 3HKJB 1O2ZA 3VFEA 2G55A 4DGJA 3M3TA 1CGJE 3H7OA 4Y7BA 1DWDH 1HPGA 1OWDA 2EA3A 1T31A 2PKAA 3RUOA 4AZ2B 3PB1E 3SBKA 2AERH 1TA2A 3OU0A 1PQ8A 4OS6A 2BVXH 2SNWA 2ZFFH 3LGYA 3GDUA 1W0YH 4NFEA 1AKSA 3HK3B 1YPHC 1BBRK 4TWYA 1C5TA 1K22H 1BRUP 4NA7A 1FY5A 5F03A 3Q3XA 5JBTA 2F9PA 1TPPA 4X6PA 1S0RA 3P92A 1GHXH 1UO6A 2QIQA 1O5EH 1ELFA 1KLTA 2Q6DA 1Y3UA 2J4IA 1SGDE 5L30H 1O3JA 3VB5A 4Q7ZA 3ZZ4A 2BD4A 3EA9A 1E0FD 2O8UA 4CR9A 3MU1A 1P11E 2Y5HA 1C1SA 2A4RA 5CHAC 1V2VT 1MQ6A 1BB0B 2BDAA 3LJJA 1PFXC 4ABHA 3FFGA 5A8XA 1TB6H 4K8BA 1THRH 2GX4A 2C8YB 2ZCKP 4FUCA 1UTOA 1O38A 5DP8A 4H6SB 2GZ8A 2BHGA 1O2RA 5F8XA 4ABJA 1GI7B 1OXGA 1O5DH 1GJBB 1G37A 1MAYA 3BSQA 1Z8GA 1SSXA 1F2SE 1YCPK 2B8OH 2CGAA 2QC2A 1EP5A 2J95A 3ZVAA 1YPMH 2QXGA 1LHCH 1G3EA 5EPYA 2VIQA 2G5VA 2ZTYA 3FP7E 2HNTE 2GCTB 3NCLA 3QZRA 2ZWLH 4I7YH 4AGJA 4CBNA 1TGNA 1GBDA 5DP9A 2GZ9A 4NFFA 3ESTA 1N6XA 3GCHB 3KHVA 2Y7ZA 3A88A 1LPZB 1IQJA 1SGFG 4K3JA 1BOQA 3M3SA 3MWIU 1K9OE 2J9NA 5LPFA 1IOEA 4IN1A 1ABJH 2C4FH 5E0GA 4INHA 1BCUH 1NFWA 1Y3XA 2XWBI 3BTFE 3MFJA 1ELEE 2NU4E 3PMBB 1G30B 1FV9A 1H9HE 3UIRA 1BTXA 2H9TH 3P17H 2EEKA 2ZPSA 3QLPH 3UNQA 3LONA 2ZHEH 3JZ1B 1Z1IA 1MD7A 1LKBA 1C5RA 3SU0A 3MU5A 2I6QA 1QJ6B 1SGFA 3TH2H 4ISHH 1XXFA 1NPMA 5C1XA 2OP9A 3SNCA 3RM2H 3TJOA 3U1IB 2P3TB 3V7TA 1DS2E 1W2KH 3GCTG 1WU1A 2A5IA 1V2TT 1BQYA 2AGEX 1ZZZA 1GCDA 1F5KU 1GBCA 3URDA 1LHEH 3AVZA 3SU2A 3QZQA 1O2GH 1TMTH 4CH8B 1YYY1 2TPIZ 4DURA 4D7GA 1TX8A 1JWTA 2BD5A 2FYRA 1QBOA 4ABAA 2GTBA 1P10A 4QT8C 1VJAU 3TJVA 1TONA 5CHAB 2HRVA 1UCYH 3BF6H 1A46H 1VITF 2Y5FA 1YCPM 1NFYA 1Z8IB 3RXGA 1OP8A 4CRFA 4INLA 1K1NA 1PJPA 2H5CA 4WXIA 3EE0B 4FXGH 1QRXA 1OWIA 1HXFH 5DJ7A 2OBQA 1J9CH 3M37A 1P2KA 2ZKSA 2G51A 2A1DB 1PPEE 1UK2A 2SGDE 1Y5AT 4DIHH 4ZUHA 1S81A 3F9EA 1W13U 2CF8H 1OS8A 1O2QA 1YPHE 1KIGH 1TNHA 1NC6A 1V2KT 1AVGH 1C5YB 1YKTA 1DUAA 4ZHMU 5EQQA 1O34A 2FM2A 2DUCA 1EP6A 1CBWB 3M7TA 3A7VA 1N6YA 2VWNA 4JZEH 4KP0A 2XXLA 3UQOA 3LJOA 3A8AA 3CENA 1A2CH 2VIDA 3GY5A 1C9TA 1N8OC 2OC8A 3QGJA 4OS1A 1L2EA 1MTSA 1QURH 1ZGVA 4XBCA 2Q6FA 1ZLRA 2FWWA 3LH1A 1S0QA 1TRYA 4ISNA 4X2XA 5A0BA 5C1UA 3QTOH 1P09A 3U8OH 4X8TH 2Z9LA 3IITA 3ZZ8A 1ZTKA 4Y71A 3FZDA 5IYTA 3BTEE 1HJAB 3MU8A 1EOLA 1FN8A 1O3BA 1GHAF 2C8WB 3ZVEA 2CV3A 1HNEE 2PUQH 3DA9B 4FUHA 1W12U 3RXEA 1OOKB 1XVOA 1DWEH 1O5BB 3RXPA 1EAWA 1WBGB 1LDTT 3GY3A 4UDWH 5FAHA 2ANMH 5EW1H 1GDQA 1JMOH 1C2EA 1AD8H 4UFFH 3MH5A 1KXFA 1ORFA 2FPZA 4HI3A 1ETSH 2ANWA 4JK6A 1YF4A 1BHXF 5A8YA 5K0HA 5AFYH 1EZSC 4NCYA 1ARBA 2F91A 2QA9E 2FLRH 2BVSH 2ZHQH 1C1OA 4Y8XA 1O36A 1TX6A 4AFQA 1KXAA 4R0IA 1O3CA 1GHYH 1TOMH 2Y81A 3A7WA 1K1MA 4DY7B 1EUFA 2PHBA 2BOHB 1AUTC 5GIBA 2F9NA 3RXUA 3TK6A 1T8NA 1DX5M 4BTTB 4O3TA 2ZFPH 1C5NH 1BMNH 1QA7A 2HALA 1LVOA 1JIRA 4TPIZ 4BAQB 1W7GH 3T28A 4CH2B 4UONA 1L4DA 2BY6X 4WF8A 6ESTA 1SGTA 4WMDA 1ELAA 1J14A 1TGCA 1SLWB 2AIPA 4VGCC 3SJOA 1NU7B 3ZZAA 2O8MA 2BLOA 3MO9A 2J34A 1AWHB 2QYIA 4A1VA 3MO3A 5TCCA 3MNCA 2I6SA 2AMPA 2C8ZB 1A5HA 1QB1A 4ABEA 2VVCA 2V6NA 1AU8A 3H5CB 1PPGE 3TGJE 1OWKA 2CN0H 5EODA 5FXLA 3GDSA 1XX9A 5BPEA 4HFPB 3UUZA 1D3DB 1GWAA 1HIAB 1A0HB 1O3AA 4X1SU 3F6UH 2AEIH 2G00A 1PPZA 4K60A 4TWWA 1GJ9B 2HVXA 2FOBA 3UREA 4U30A 1GGDC 1VR1H 1C2LA 1ZMLA 3MMGA 2QCYA 5T6FA 1C2DA 1TALA 1PPCE 1ANDA 1YBWA 3ZZ3A 2QXHA 2FODA 4Q7YA 3WY8A 4BNRA 3BN9A 2ZFQH 5HM9A 3SNDA 5FX6A 3P8OA 4X6OA 1HAOH 1ZGIA 1BUIA 1O3PB 4UEHH 1O5AB 4NIVA 3MI4A 2B0FA 4HZHA 3UR6A 2WYJA 3IWMA 1CE5A 2QGRA 2VU8E 1QBVH 2PKSC 3MU0A 8KME2 3EA7A 3RXVA 1BTUA 2ZECA 2FMJA 3M36A 1XM1A 3GCNA 3PLPA 4ISLA 3M3VA 1C1TA 2LPRA 1CHOF 1SLXB 2PLXA 4ABFA 2FXRA 4NGAH 1G36A 1O3DA 1UTKA 1UVOA 2R9PA 3D62A 3GY7A 5DP7A 3BIUH 3SV2H 2AS9A 5FX5A 3V12A 1E34B 3DT0H 1AFQC 3R3GB 5LPRA 1RJXB 2BLQA 1HAZB 2O9QA 4B75A 1O3EA 1D3TB 1GI4A 1QHRB 1TBRH 2OQ5A 1YC0A 2BMGB 1HYLA 1PQ5A 1ELGA 1GI5A 4FU7A 1O2XA 3URCA 3M5NA 1V2UT 4E7NA 4YESB 3S9CA 5E0JA 3BTGE 2WPMS 3RU4D 4CRDA 2PGQB 3PLKA 3MHWU 4MNVA 1WV7H 1TAWA 3DHKH 1FY8E 4YTAA 1LVYA 2AGIX 3V0XA 2ANYA 2Y5GA 1Y5BT 4MPWA 3A82A 1JRTA 1GJAB 1GI3A 1RXPA 3SQHE 4JYVH 1WOFA 3SU5A 3RMNH 3S9AA 1WCZA 1GBBA 2XBXA 2ZEBA 3SORA 1GBFA 1F92A 1WQSA 4TY7A 2EC9H 2TGTA 1QQ4A 1IQGA 1MTNB 1ZHMA 1VCQA 1ID5H 3MYWA 1O2VA 4U2WA 2AIQA 1F0UA 2ASUB 2ZDAH 4K2YA 2GP9B 5EXMA 4K5ZA 1O2LA 3C1KA 1HGTH 2XWAA 2EI6A 4IBLH 1FY4A 4YM9A 3VB4A 1IAUA 3LIWA 4RKOB 2P93A 3A89A 3L3TA 3BG8A 4AOQA 5DGJA 3GDVA 1LHDH 3NUMA 1O3FA 1C5OH 1AIXH 3SHAH 2HOBA 1YM0A 1C1UH 4K1EA 1LQDB 4CHAB 2H5DA 2ZCHP 4K1TA 1O5CB 4MNYA 1CT0E 3A84A 1FPHH 1S6HA 2BDCA 1NFUA 4AORA 1O2WA 5ETXA 1D4PB 1K21H 1C2JA 1Q2WA 2QF3A 1S85A 4K1SA 1FLEE 3ZV9A 1P3CA 1P9SA 1LKAA 1TFXA 5F8TA 3AW0A 1O3LA 3K65B 3O8BA 3V3MA 2LIZA 5AFZH 1A0JA 5ESTE 3TU7H 2FO9A 1OP2A 1V2OT 3I77A 1B0EA 4NIYA 5ABWA 1PYTC 3M61U 3PTNA 2PGBB 4YO9A 2D26C 2ZFSA 3SN8A 1SR5C 3STIA 2NWNA 1HAVB 1VITG 1O2NA 4NZLA 1MUEB 3RXJA 4CBOA 1D9IA 1KSNA 1LPKB 1NY22 2DE9A 4I31A 2LNCA 1MBMA 1MQ5A 2AH4X 2ZDVH 5FPSA 2ULLA 3BEFB 1AE8H 4MLFB 2R2MB 4DIIH 3ZZDA 4U01A 2FP7B 2XCNA 2P3UB 5G4BA 1BITA 4MDSA 2BQ7B 3UR9A 1C1PA 2BD8A 1KXCA 4DG4A 3ZZCA 1B5GH 4JYUH 3RXLA 1W3CA 1FN6A 3LDXH 1T8MA 4THNH 3BTWE 1BMMH 3UQVA 1SGCA 1ZSLA 2EI8A 3S7HB 1WYKA 4TY6A 1QB6A 3LC3A 1IQIA 5JBAS 1W11U 2EI7A 1C1RA 2F83A 4AFUA 1P03A 1ZOMA 3RXFA 1L4ZA 4BAMB 1GI0A 3RXQA 2VWOA 3K2UA 1AKSB 5F8ZA 1HAGE 2W3IA 1O2MA 1RS0A 2FYQA 1P06A 1ZJKA 3VB6A 3RXCA 3AAVA 1TNJA 1BTWA 5A0CA 3GCOA 2VH0A 4KGAA 3RM0H 3RC5A 1BMAA 3RXHA 1P2QA 2Z9IA 1O2IA 4YT7H 3E0PB 3ZVBA 4B2AA 3UY9A 1UTPA 1HJ8A 1RD3B 1AWFH 4ZHAA 2R2WU 2UWOA 5EG4A 4YLUA 1K1OA 4NZQA 1GJ8B 1D3QB 1EXFA 1PPFE 1V2RT 4AG2A 1YLDA 1BJUA 1UMAH 3QTVH 4IGDA 1LO6A 4LOYH 3A86A 1P2OA 2FI4E 3ATMA 2QN5T 5CMXH 1C5PA 2Z9KA 1HBTH 1ESAA 2ZGJA 3PMHB 3PROA 1D3PB 2JKHA 3VPKA 1C2HA 4JZIA 4XSKU 1UTNA 3MU4A 3U98H 2ZDMA 3S0NA 1P2MA 5J4SA 1KXEA 3GY4A 2GT8A 4OGXA 4E05H 4FUDA 4YLQH 1GMHG 1P02A 1SBWA 1SGQE 4FVBA 1BBRE 1BIOA 1PPBH 2VGCC 1ETRH 1TLDA 1SFIA 3KQDA 3UTUH 2CF9H 4MG3A 4KTUA 1W8BH 1TWXB 3NK8A 6GCHG 4A6LA 1Q3XA 4Y7AA 2ZIQH 1MU8B 3FAOA 1SGPE 1TGBA 2ZQ2A 3S7KB 1ZSKA 1GJ7B 1T7CA 1ZSJA 2AMQA 3ODDA 1TABE 4LZ1H 1G3BA 3P8FA 1J17T 5A09A 1UVUH 4NWKA 1MH0A 3LOXA 1GBEA 4AX9H 5C5NA 1GBKA 5FHTA 6GCHF 4LK4A 3F1SB 1GI2A 3LGVA 3OX7U 1FNIA 3EGKH 4B2CA 4Z6AH 2ZFRH 4ISOA 2AYWA 3NPSA 4D7FA 1MKXH 2PTCE 1O2PA 2BD7A 2V0BA 2C93B 4Y0ZE 1GCTB 4Q80A 5EXNA 1ABIH 2A0QB 4WH6A 3ZZ5A 3KQBA 3SUFA 3LGIA 3TIUA 1GI9B 1T4UH 1D6RA 1DPOA 1P2IA 3RC6A 5FCRA 2TGAA 1G32B 5AVDA 1O5GH 1YCPH 2JETB 3LGUA 2HGTH 5E0HA 5E2PA 4BAHB 5DO4H 4NIWA 1TRMA 3ZZ6A 2YNAA 4X0WU 3SGAE 1F0SA 1EB2A 3PTBA 4BXSA 1C2MA 3T5FH 1AI8H 3K9XB 1O3OA 1DITH 3SV9A 1A0LA 4Y79A 2G81E 3B23B 1QJ1B 2BD9A 4WJG2 1C5XB 4IW4E 5HGGA 1ESTA 1GBTA 3A85A 1WSSH 3MH4A 2R0KA 1ZPCA 2ODPA 2GD4B 1BRCE 4DOQA 4YOJA 2VWMA 1SQAA 3E1XB 3RLWH 3P8GA 2K7XA 1J15A 3P95A