3TITA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg81
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARS coronavirus main protease
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3titA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA02
1TPPA 2VH0A 1DY9A 3RXPA 1Z6EA 4GAWA 1Y3YA 4DURA 2O8MA 5A0BA 4X1QU 5AFYH 4BAMB 3TGIE 4KTSA 5T6FA 1DXPA 3GY8A 2QY0B 4WVPE 1TLDA 3M7QA 4YO9A 1O5CB 2A32A 3ZZBA 4IN2A 4KP0A 4LZ4B 3CP7A 1A3BH 3BEIB 3M7TA 3UFAA 1CGJE 1O35A 4FUJA 2BLVA 3SUEA 1P01A 3LIWA 1NU9A 1CU1A 1VGCB 2XC5A 1SGQE 1A3EH 1P2MA 1P3EA 1YCPH 2F9VA 1C5SA 5EXMA 3P8OA 3BTGE 3SV6A 1UTQA 4LXBH 3GCTG 1O3PB 2XCNA 4DCDA 1AKSB 1V2NT 4GSOA 1ACBE 1C4Y2 2W3IA 3SJKA 2ZG0H 1F7ZA 5C5NA 1GI9B 2Y7ZA 4IN1A 1IHTH 1O3FA 3RXRA 5E0HA 1WU1A 4Y8YA 4FU8A 1GMHF 4FUHA 2FIRH 1Z6JH 1IQGA 3RC4A 1QRZA 1AZ8A 3AAUA 1VJ9U 4OS6A 1TONA 3EBNA 2TIOA 1VITG 3SUGA 1TBZH 1Y5UT 3P95A 2D8WA 4GVUA 4I7YH 4NWLA 1G32B 1RJXB 2J38A 2LPRA 2GGVB 1FV9A 1Y3UA 3BTFE 1PPEE 1EB1H 1TNLA 2F9BH 3GICB 3A86A 3DHKH 1AMHA 1SFQB 1GMHG 3U1JB 1RTLA 4Q7YA 4CH8B 1KLJH 1A5HA 4ABEA 2DE9A 3RU4D 1MH0A 2SGAA 2ZGXH 1IQHA 2ZO3H 4MPXA 2BOHB 1EJNA 4MNWA 3BTKE 1V2PT 2ZFQH 4YM9A 1MQ5A 1YF4A 1LHEH 1PPZA 2TGDA 5AFZH 1DM4B 2D26C 1DVAH 8GCHF 1KXDA 1SLUB 3MH4A 4K60A 1H4WA 3EA8A 5FX6A 1C1TA 5I46H 4RKJB 1XUHA 1XUIA 3KHVA 3MFJA 1HUTH 2QGRA 3NKKA 3PMAB 1QR3E 2TRMA 2TGTA 1O3AA 2Q6DA 2GDDA 3SNAA 1O2JA 2WPHS 2XC4A 3R3GB 2Q6FA 1QRXA 4DY7B 3ZYEA 2VGCB 4FUDA 1VCWA 3C1KA 3SO3A 1T31A 3Q77A 1DLEA 1FPCH 4YOGA 2ANWA 1GGDC 4BAOB 5EXNA 1TNKA 1O2ZA 4WXVA 1NO9H 4Y8XA 2FOMB 2RG3A 2XBYA 3GDUA 1OP2A 1P2QA 1AN1E 3MU4A 1V2ST 4JYVH 2ZGJA 5K0HA 4NCYA 2VVCA 1WQVH 3DUXH 2BXUH 5DG6A 2CF8H 1RGQA 3VGCC 1TPSA 4ZKOU 2BX3A 2ZDAH 2XNIA 3RP2A 4MPWA 2EI6A 2J34A 2FTLE 2NU0E 4INLA 5JDUB 2HWLB 1Z1IA 1N6XA 1W7GH 2Y81A 3KGPA 1IQJA 4ISHH 2OBOA 2ZI2H 2QXJA 3SUDA 1QJ6B 5A0AE 1FMGA 2CMYA 4X6PA 1OX1A 1G3BA 5JBBS 1A5GH 3CS7A 4HTCH 4MG3A 1BTWA 3BV9B 1O3GA 1RTFB 3BF6H 2Y5FA 2VWLA 4AX9H 1NU7B 3VEQB 1TAWA 4OS2A 4NIXA 2PV9B 4U01A 1DY8A 3ITIA 2Z9JA 1RIWB 2ZU5A 2P16A 4AG2A 3T62A 1D4PB 1MU8B 1F5LA 3HPTB 1THSH 1C9PA 1HAYB 3HK6B 2JH5D 1BRBE 1GDUA 4AGJA 2QXIA 4CRAA 3LPRA 3RXUA 5C2ZA 1W3CA 3EE0B 4DOQA 1N8OC 1EQ9A 4CRDA 3MI4A 4AFUA 4VGCC 2W5EA 1E34B 1ZLRA 3RXHA 1LO6A 1C5ZB 4WMDA 3B23B 2PWXA 1BRUP 1O3BA 4CRGA 6GCHG 1O38A 1W0ZU 4CHAC 3F9EA 3TVJB 1CGHA 4AB8A 2VNTA 1ETRH 2FDAA 1MBQA 1GCTC 3M5MA 1P8VC 2A4RA 3ZVFA 1ESBA 1YCPK 3TGJE 1YPHC 1ORFA 1VCQA 4I31A 1YPKH 3SN8A 3LH1A 3D62A 1S6HA 4A5TS 4X2VA 2Z94A 4A1XA 3KQCA 3SNEA 4K1SA 1MKWH 2A2XH 5HXFA 3VB7A 2ZDKA 3PO1B 1KYNA 3HGNA 1UJ1A 5A0CA 1EASA 4IMQA 1ZJDA 3SOSA 2A4OA 3H7OA 3UOUA 1C2KA 4MPVA 7ESTE 4DJZB 5ETXA 1K28D 1SI5H 2XBXA 4JK5A 3SJ8A 3W94A 1GMDF 1EUFA 2BYAX 1HAZB 2Y5HA 4K2YA 1MU6B 1UCYH 3MNXA 2YNAA 3TJNA 2Q6GA 2D1JA 3MMGA 2XRCA 1C9TA 4UFEH 1S0QA 2OINA 3RXFA 1A0JA 3TNSA 4DVAU 4K8BA 1RFNA 4D9QA 7GCHG 4YOIA 2Y6TA 4Y6DA 2FWWA 4DIIH 1O39A 4INHA 3ATMA 2AS9A 1K1IA 1MAXA 3L6PA 3GCHB 4YLUA 2ODYB 1GMDG 2B0FA 1EZQA 1UHBB 2P94A 1D3TB 2PKAB 2QF3A 3GOVB 2CJIA 5B6OA 1ZPCA 3TH2H 1CT0E 5GPIB 3SU5A 3QLPH 2G00A 2FODA 3RU4E 1Y59T 1E37B 4AYYB 2FS8A 1SHYA 4PROA 1TPAE 1WCZA 2ZCLP 1AWFH 4UFDH 1NROH 1O2UA 2OC7A 4ESTE 2V6NA 2ZU2A 3FZZA 3NZIA 4XE4A 4F4OC 2Z9GA 4OS4A 2AMPA 3RXMA 3BN9A 1GG6B 1CT2E 3UTUH 2G51A 3GY4A 1C5MD 5BPEA 1AB9B 1OSSA 1MQ6A 2GZ7A 5CHAC 1D9IA 5L2ZH 3RXSA 2VIVA 3E0NB 1C5YB 3B9FH 2ZFFH 5FPSA 3A8CA 1XUGA 2BDCA 3MNCA 4AN7A 4A6LA 4GHQA 1F2SE 1AVXA 1V2RT 4HZHA 2XWAA 2C3SA 4JZFH 4D9RA 1FN6A 1GBIA 3VB4A 1PYTD 3MH6A 1V6DA 1QL7A 4OGYA 1SGNE 1NTPA 1C5OH 2OUAA 2R0KA 3AVZA 2GP9B 5JB9S 2C8ZB 1DWBH 1W12U 2OC8A 2BDAA 3S9AA 1L0ZA 1EATA 5AF9H 3KQBA 3UWJH 2HNTE 2A7HA 1C1WH 1LHCH 1O2WA 5JYIA 1GBBA 1MCVA 1S83A 1C5PA 2H2ZA 1L1NA 1V2KT 1S84A 1H9LB 2P3FH 2Z3CA 3KCGH 1Z8JB 1V2UT 1TE0A 1YPMH 3UREA 2BD7A 3KF2A 1TNGA 3LGTA 2ZFRH 4UE7H 2FMJA 3A7TA 2BD5A 1D3QB 3GYMA 2FESH 5TCAA 1GI2A 1VZQH 4WF8A 4I8GA 1NY22 3URDA 1FJSA 1LQEA 3SU0A 3ZYDA 1FIZA 1ZPZA 1BRCE 2VWMA 4KELA 4AG1A 1YPLH 2H9TH 5EW1H 1T4VH 1AFQB 3RLWH 3A84A 2NU4E 3T27A 1GBHA 1UCYE 1C5QA 2ZDVH 1O2QA 3P17H 3MOCA 1TA2A 3BTME 3OSYA 5AVDA 2BTCE 1GI7B 1ZGIA 3ZZAA 2R2WU 3HKJB 4MNVA 2PLXA 5FCKA 1MKWK 1C2LA 3ZVCA 1SC8U 4ABHA 3RXDA 4U30A 1XVOA 1C2IA 9LPRA 1W14U 5ESBA 1WOFA 1V2JT 2OD3B 3A82A 6CHAC 1O31A 3R0FA 2FYRA 2AYWA 1N1LA 5A8ZA 1Y3XA 2H9HA 4R0IA 3MNBA 1EJAA 1O2YA 1PPGE 3BTDE 1ZYOA 4GPGA 4YLQH 2ALPA 2ZPSA 2ZC9H 3PWCA 3D49H 3G01A 2SGPE 1UCYK 5JPMH 5DP4A 4SGAE 4Q7XA 3F68H 3MO6A 1AWHB 2UUKB 3NCLA 2V3OH 1UK2A 4B76A 2BY5X 1HLTH 3DA9B 3FVFB 2ZHQH 3SZNA 1INCA 3SGAE 4BAKB 1O2VA 1BIOA 2BOKA 3RXOA 3TU7H 4WWYA 1ZMNA 2FO9A 3ZVDA 4JZEH 4WMFA 4DG4A 1QFKH 1J17T 1SGTA 1TGNA 1HNEE 1EAUA 1IQNA 3FAOA 5JBTA 1EZUC 2F9NA 4LK4A 5A09A 1UVOA 1MKXH 4B74A 3OY6U 5L30H 1C4U2 1C4V2 2OXSA 4D76A 1P2KA 3PMJA 1J14A 4AFZA 1QURH 3SQEE 1O34A 3ODDA 3U69H 3K2UA 3RUOA 3M7UA 1TBRH 1O5DH 3QGNB 3UQVA 1QA7A 4MDSA 4TPYA 1A7SA 1L4ZA 1Z8RA 3Q00A 3ZVEA 2OP9A 1TABE 3EGKH 3KQEA 3W95A 5SGAE 3RC6A 4E7NA 1V2WT 3SGQE 3VB3A 1BHXF 1YCPM 4XFQA 5C20A 5LH8A 1VGCC 4BANB 3ZV8A 1A61H 2A0QB 2BLWA 1ZRBA 5C1XA 1NM6A 3TNTA 1TGBA 1GVZA 2XWBI 2JETB 1Z8GA 4NZQA 5EW2H 1MTWA 1SLVB 3LT3A 5EG4A 5FBEA 1TGCA 5EPYA 1MTSA 4IC5A 4D7GA 2ALVA 2XC0A 1QQUA 2OQUA 5DK1A 3LGUA 2XXLA 1DT2A 3ATWA 2RA0A 3RXLA 1S5SA 4ZUHA 1ANDA 3TJOA 3E8LA 3UOPA 1C2MA 5EPNA 2BQWB 2O9QA 1HXEH 2PHBA 1AE5A 1DPOA 3UIRA 3ZZ8A 1P3CA 3LU9B 2GV7A 2G55A 4ABGA 1BUIA 1UVUH 1GJDB 3U8RH 1K1LA 1TNHA 1F5RA 4JYUH 5BRRE 2A7JA 2FI5E 2FLRH 1LQDB 1GHBG 2SGQE 5HM9A 2Y80A 5DP8A 5CMXH 5L2YH 2F3CE 2Z6BD 3MHWU 4NA8A 1FUJA 2A5AA 1P2IA 4MNXA 3QTVH 4B75A 4IGDA 1QTFA 1UVTH 2ZDNA 1KTTB 4ZXXH 2WV4A 1XXDA 1WV7H 5F03A 1MZDA 1VJAU 1T8LA 1UO6A 3K65B 4Z6AH 2STAE 2R9PA 2G5VA 1KDQA 3MTYA 1FI8A 3ZZ3A 4WY3A 2ASUB 3VXEH 1EAWA 3K9XB 1QCPA 2FOEA 1UTKA 1GI4A 5C1YA 4I32A 2H6MA 1ELVA 1LDTT 4LZ1H 1FLEE 1MD8A 1UVSH 1O3OA 1OP0A 1DUEA 3GY5A 1C5RA 4X1PU 7KMEH 2WV5A 4NSVA 2GMTB 4GCHF 2EI8A 3SV8A 2NU1E 2CN0H 1BMNH 2VGCC 4U32A 3HK3B 1JOUB 1O2IA 2O8LA 1PJPA 2ANMH 3RM0H 1AE8H 3TLOA 2GT7A 3UNQA 2VINA 1F0UA 3QO6A 1SQOA 4XBCA 4A1VA 1AVGH 2ZGCA 1XUJA 1ANBA 2FOAA 1WTGH 1BITA 4Y79A 1EPTC 1PPBH 1CGIE 2V0BA 3VB6A 1TMBH 1TQ7B 1KXBA 1SPJA 1TMTH 2AIQA 3GY7A 1IQKA 8ESTE 1FIWA 4FUEA 1YPGH 1RXPA 1XXFA 1PPCE 5FCRA 1BMMH 5GWZA 1GHXH 1YGCH 1ELDE 3KEEA 1Q31A 4O3UA 1TNJA 4GHTA 1TOMH 3FANA 1N6YA 4Y7AA 3K6YA 1GBAA 1K1JA 5EXLA 5HYOA 3QTOH 4H6SB 3S69A 1GI1A 2CV3A 1K1MA 3IWMA 2TPIZ 3U1IB 4A92A 1BMAA 5ESTE 3I78A 8GCHG 4WH6A 1O5GH 3BEFB 1IQMA 1P10A 5DJ7A 3IG6B 3A87A 1HJ8A 2CHAB 1NT1A 1S81A 1RIWC 1GI8B 1C5XB 2ZQ1A 1CA0B 4I8HA 1VITH 2WUCA 2W7SA 2LNCA 1MKXK 2PR3A 2FYQA 3O8RA 4NIYA 4B71A 4INKA 1Z71A 4HFPB 4FXGH 4ABFA 3BTEE 1DFPA 1HJAC 1OWIA 1QA0A 1P04A 3LJOA 1O36A 3T25A 4AFSA 1J9CH 2ZECA 1NRRH 1TFXA 4CRCA 1MBMA 4CR9A 3BEUA 2CXVA 4NGAH 1BRAA 2BM2A 5F8ZA 4FU9A 4THNH 3SU4A 3SORA 1NPMA 2GZ8A 1LHDH 1GJCB 1GBTA 1SOZA 1ELCA 3RXTA 3NPSA 3A7WA 1T8NA 3BG8A 1L1JA 1O2GH 1YPHE 5T6GA 3P8NA 2ZP0H 2KAIA 1P12E 3DD2H 1BT7A 1XX9A 1C1OA 5E2OA 1BCUH 2RCEA 2HALA 2XYAA 1PPFE 1OYQA 1NC6A 1AIXH 4GUXA 1G3EA 3ZVBA 3T29A 1ZOMA 3MYWA 5GIBA 2FOFA 1S6FA 1E38B 4WXIA 2A5KA 1GGDB 1SBWA 3PO1C 1O5BB 4ZMAH 1KLTA 2GZ9A 1EKBB 2H9EH 3UY9A 1QBNA 1TYNA 1YP9A 3M3VA 1QIXB 3A80A 3SV7A 3PV4A 1FXYA 3BSQA 2FX6A 3H5CB 1IQFA 3EAJA 2FP7B 1PQ8A 2J95A 2WPKS 1XUFA 1LPGB 2BMGB 1L2EA 1ZMLA 1B5GH 2I6SA 3ATLA 1S85A 3LOXA 1EAIA 2QN5T 4AOQA 1O3DA 1CO7E 1TRNA 2P59A 3RXBA 9ESTA 5FPYA 4UFFH 2QXHA 3UR6A 4JCNA 3DFLA 1ZSJA 2IN2A 1S82A 3RXIA 2F83A 1XKBC 2ZNKH 1TOCB 3PLBA 3D65E 4JMYA 3F9HA 1H1BA 4TYDA 1TA6A 1BA8B 4MTBA 4Y10E 2JKHA 3GCHC 1IHSH 2BD9A 1NFXA 3SU6A 5FXLA 3MH7A 3MNSA 2QAAA 1GJBB 1BTPA 4X8UH 1ELGA 1HDTH 4Y11E 2GCHF 5A8XA 3I29A 4ABJA 3F9FA 1T8MA 3A83A 1W7XH 1FN8A 2BD4A 2FS9A 4X6OA 4X1RU 4ZH8A 1Y8TA 1O3NA 2GTBA 1O3CA 1D6RA 1C1QA 5GXPA 1N8OB 3C27B 3SNDA 5DP3A 1C1SA 1CT4E 4X2XA 4ZAEA 2VIOA 1FONA 1DSTA 4ZKSU 4FUCA 1A46H 3PTNA 4YT7H 1AB9C 1XMNB 1M9UA 2F9PA 4NA7A 1HGTH 6ESTA 2QF0A 2V35A 3UQOA 1GDNA 2EA3A 1EJMA 1GL0E 5JB8S 1SGFG 1EZXC 1O30A 2GV6A 1ID5H 1DWCH 4RKOB 1KXAA 4JK6A 2FOGA 1T7CA 1WSSH 1O37A 1SB1H 3ZZ5A 1AQ7A 1DSUA 1F5KU 2JH6D 2ZCHP 1SGFA 2G4UA 4K8YA 2RDLA 2PTNA 3H7TA 1TGSZ 3EA9A 4TY6A 1HAOH 1J8AA 3QK1A 1HRTH 2WYJA 1A1RA 3JZ2B 1OWHA 2Y7XA 4X8VH 1ARBA 8LPRA 2A45B 2PGBB 1QBOA 1SGRE 2FI3E 3U9AH 1J16A 1O3MA 1TALA 2ZDMA 1YC0A 2ZWLH 2WPIS 5HGGA 2AGGX 4X8SH 4K1TA 5G4BA 2SGDE 3GY3A 2IJOB 1IQLA 1WAYB 1LCYA 1EOLA 1EAXA 1HJ9A 1DWDH 2VIDA 1GJ8B 1C1MA 1GBEA 4AORA 1C1NA 3LONA 1ZGVA 1JRTA 2ZHEH 1V2LT 1O3LA 1OKXA 3BIVH 2R2MB 4NA9H 3TPIZ 4CBOA 1QQ4A 4J1YA 4ABIA 1OWDA 2JH0D 3KQDA 5C67A 1MTVA 1SGYE 1AD8H 2CF9H 2FPZA 3MU5A 3UR9A 4AGKA 3U8TH 4UDWH 3NXPA 3ESTA 2GX4A 1GWAA 2ZU1A 4OS1A 2AMQA 1YM0A 2FTMA 4ZXYH 3SUFA 2J92A 3T26A 1BQYA 2GVFA 1JIMA 4NSYA 1F92A 1EPTA 1UK4A 1G30B 1DOJA 2ZZUH 1GHAF 1Z8IB 1C1RA 1C1UH 1GBDA 1AU8A 5E2PA 2QC2A 3WY8A 1UTNA 3SJIA 4XSKU 4E06H 1OWEA 1KDQB 2O8WA 3MU0A 1AUJA 5EOKA 1G3CA 1W8BH 1FPHH 1HBTH 1O2SA 3ZZ9A 1O2NA 3S0NA 1QHRB 1NS3A 4FU7A 2GCTB 2NU3E 3MO9A 3RXQA 2HGTH 3TIUA 5C3NA 3KIDU 2Q1JA 2ZFTA 5CHAB 3A8AA 1A0HB 5GJ4B 1C5TA 2FLBH 1QJ7B 2P8OB 5FPTA 4Q7ZA 3TK9A 4DT7B 1SHHB 4X2WA 2P95A 2G8TA 1KXEA 3NK8A 4B73A 3D23A 4D8NA 3EA7A 1OXGA 3SGBE 1ELEE 1NESE 2TGAA 4I8KA 5EODA 4B2AA 2VH6A 2AMDA 1SLWB 5DGJA 2BQ7B 1QL9A 1EX3A 5DP9A 1TRMA 5LPEA 2BY9X 3VPKA 2SGFE 4ISOA 1ANCA 3U98H 4BTTB 1UVPA 4CREA 4E05H 3Q3YA 1YPEH 3RXEA 4XBBA 1TX8A 1ZTJA 4CRBA 1O3JA 2GKVE 2ZHFH 4O3TA 2J4IA 1CHOF 2BX4A 1LPZB 1V2TT 1TIOA 3E6PH 3S7HB 1OPHB 1IQIA 1NN6A 1ELFA 2K7XA 1A5IA 5HM2A 1UK3A 1O2XA 1NRPH 1A0LA 3VFEA 2TGPZ 1QJ1B 1THRH 4AFQA 3V7TA 4IS5A 1NFUA 1GJ6A 4I8LA 4ZHMU 3QDZB 5EQSA 2GDEH 3ELAH 1EB2A 1GHZA 1CHGA 3RLYH 1Y3VA 1DICA 4TY7A 2GT8A 2PUXB 3OU0A 1U6QA 1CSOE 2SGEE 1ZPBA 4TWYA 3BTHE 1G2LA 1EZSC 1PPHE 2M5TA 1MUEB 2VIWA 2ZFPH 1GI0A 1PQAA 2PKSC 3ZZDA 1O33A 1W2KH 1B7XB 3T2NA 5EGMA 1C5VA 1P03A 1G37A 1MZAA 1TX6A 2HPQH 1DANH 4K3JA 1LKAA 1QBVH 4I33A 1ETSH 2VWOA 4FUBA 3TK6A 2P3TB 1O2LA 3IITA 7LPRA 1C5UA 3EQ0H 3I77A 1TQ0B 1UTOA 1DX5M 1K22H 1GJAB 1G36A 5DP7A 1V2MT 4YTAA 1ZTLA 1AZZA 1CVWH 1O5AB 4ABAA 1DWEH 1DDJA 2ZHDA 1J15A 2UWOA 1WBGB 2D2DA 2R3UA 1BJVA 2KAIB 1F0TA 4YZUA 3SV9A 3FP6E 2BXTH 4A7IB 3GY2A 1MTNB 1MCTA 1C2HA 1LVBA 2BD3A 2Z3EA 2PSXA 1ZJKA 1CBWB 1HAGE 3V13A 4IC6A 2FEQH 2VIQA 1UMAH 1QB1A 2WYGA 2WPLS 3RMMH 1E0FD 1SGDE 4AB9A 4BAHB 2BLOA 4WH8A 5IDKA 3S9CA 5E8EH 1P2JA 4NFEA 1VR1H 1TWXB 1L1GA 1C5NH 1LKBA 1K1PA 3PWBA 4ABBA 3LDXH 2EEKA 1HCGA 5DPAA 1GBJA 1ELTA 5T6DA 2FI4E 1TPOA 4NIWA 3RXKA 1D3DB 1JMOH 3RXGA 3RMLH 1HYLA 2ZU3A 4JZIA 4DGJA 2FOHA 1IAUA 1G9IE 3LGVA 4Z0KA 3MU1A 5ABWA 2LIZA 4Y76A 4ASHA 1HB0B 1MAYA 1TX7A 2A2QH 2OQ5A 2GMTC 2Z9KA 1EP5A 3GCTF 1Z7KA 1SGIB 3SNCA 4AYVB 1Q2WA 4BXWA 4CRFA 4QT8C 2QCYA 1O2TA 3AW0A 4YOJA 4UFGH 2VIPA 4K1EA 2BB4A 1NRNH 1KTSB 1YPJH 3T28A 3MO3A 1G2MA 4OS7A 1T8OA 1ZRKA 3BG4B 2SFAA 2QIQA 3HATH 1SR5C 2ZHWH 3ZVGA 1WTHD 2HRVA 3RXVA 1VITF 1QGFA 1O2RA 2A5IA 2BDYA 1MMJN 3M35A 3ZVAA 4HGCA 1GI5A 4X1SU 4X8TH 5A8YA 1P2NA 4FUGA 3L3TA 1C2FA 2UWPA 1FY1A 1B0EA 1QB6A 3Q76A 3RXAA 3ZV9A 1BJUA 2A7CA 4K69A 2FOBA 1NFYA 4Y7BA 4KTUA 2ESTE 4X6MA 1GPZA 4RSPA 3SNBA 1DITH 1ESTA 2ZPQA 1WYKA 3BTQE 2B8OH 3PMHB 2ZDLA 4H6TA 2ZQ2A 2ZTZA 1FQ3A 2BDHA 2F91A 3SI3H 4UEHH 1C5LH 1GJ9B 1TB6H 1V2VT 2H5CA 3GDSA 3PROA 4ZKNU 1Y3WA 3PYHA 3SU3A 1O2OA 2CHAC 1TMUH 1V2OT 1LVMA 4O03A 2O8TA 4Y0ZE 1CA0C 1PYTC 5H4IB 4BTIB 3QN7A 1Z1JA 5FBIA 1BMLA 3P70B 4GCHG 3STJA 2W7UA 2ZA5A 3A7XA 3ATKA 3VB5A 1L4DA 2DE8A 1RRKA 1SL3A 2C8WB 1ELBA 1O2KA 5EQRA 2R0LA 1GCDA 1FNIA 1C2GA 1WUNH 3GY6A 4F49A 2PUQH 2C4FH 1XM1A 5FX5A 3ZZ4A 2K1QA 1SG8B 1BBRE 1QL8A 4ZHAA 2Y5GA 2J94A 2WUBA 2ZGBH 1AHTH 3K6ZA 2FX4A 4TPIZ 3F9GA 4FVDA 1OS8A 4E7RG 4TWWA 3A85A 1GMCF 1ZHPA 5DP5A 1BTXA 5A2MH 1CQQA 1K9OE 2HNTF 3T5FH 1ABJH 1JWTA 2VJ1A 2B5TB 1GBLA 1FY5A 3Q3XA 1GJ7B 3E91A 4Y0YE 1ZTKA 1P02A 3AASA 1O32A 2UUYA 3P92A 2HVXA 1TGTA 3SI4H 1BTHH 3ATIA 1O0DH 1LHFH 4IBLH 3M61U 3GISB 1AGJA 2WPJS 1OYTH 3SHAH 4O9VA 1FAXA 2BQ6B 1GMCG 1ELAA 1MTUA 2XBWA 1KIGH 1HV7A 1Y5AT 1EPTB 3UUZA 1BBRK 2ULLA 2ZU4A 3PMBB 5C5OA 2FZZA 2B7DH 5J4SA 3UPEA 1JRSA 1A2CH 1C5WB 1O5EH 4GLYA 2BVXH 4R8TB 1GBKA 3TITA 2P3UB 3LKWA 4NZLA 1O2PA 3S9BA 2YNBA 1P2OA 3TH4H 5K7RA 2UUJB 1DUAA 4UD9H 4ZKRU 2ZEBA 3ZZ7A 3STIA 1P06A 4YESB 1CA8B 3CS0A 2A4QA 2H1UA 3MWIU 3A81A 1DLKB 3M37A 4LOYH 1PQ7A 1RD3B 5I25A 2QV1A 3SQHE 2R3YA 1O3HA 4BNRA 6GCHF 4H4FA 2C90B 1HAVA 4BXSA 2BDBA 2Z9IA 4XBDA 2XBVA 3RXCA 4H42U 3A7VA 1HIAA 1PQ5A 3PTBA 1SLXB 4HI3A 1E36B 3GCOA 3F1SB 3FZDA 3VGCB 4DW2U 1E35B 1HJAB 4X0WU 3AW1A 2J2UA 2BD2A 1VCPA 4YT6H 2V3HH 1B0FA 2Z3DA 3V3MA 1FAKH 1ZHRA 3PLKA 4DIHH 3BTWE 2AGIX 3AAVA 4KGAA 4Y71A 4D7FA 1YLCA 3QUMP 2VWNA 1YYY1 5FAHA 3B8JA 1TBQH 1HAHH 1SGCA 2G5NA 2BLQA 2BZAA 2STBE 4ISLA 2C8YB 4B2BA 1XUKA 2ZKSA 3HGPA 5E0GA 4X1NU 4NG9H 2HPPH 2VB0A 3ODFA 5FHTA 2XTTB 1KY9A 3RMNH 2ZTXA 2J9NA 1EP6A 1OWJA 3F6UH 4OGXA 1HAXB 1GVLA 3E0PB 2NU2E 1SVPA 3O8BA 2BVSH 1BOQA 2ODQA 3EYDA 4FUFA 3RC5A 4ZROA 3A8BA 2SNVA 3BIUH 4ZHLU 4WJG2 4VGCB 1AKSA 1LHGH 2QXGA 3Q3KA 2BDIA 4Y8ZA 3QZQA 4MVNA 2AGEX 7GCHF 4BAQB 4CHAB 1GG6C 2BDGA 2QA9E 1K1NA 5F8XA 2GCHG 4BOHA 3GDVA 2PGQB 3M36A 4WMEA 1EOJA 1GCTB 3LC3A 3QGJA 2OCVB 1ARCA 2XCFA 5L6NH 2ZFSA 2AH4X 3OY5U 1KXCA 1O3EA 1AVWA 1KSNA 2O8UA 1UTPA 1GVKB 2XW9A 4CBNA 4J2YB 2W26A 1ZSLA 1GI6A 1QY6A 3OYPA 1P11E 4BTUB 2HOBA 2AEIH 5LPFA 1LVOA 1OP8A 3UNSA 2BD8A 1NRSH 2WPMS 1GBMA 3GYLB 3SJ9A 2VVVA 2EI7A 3V0XA 2I6QA 1X7AC 1H8DH 1AO5A 1O2HA 1FY8E 3ENSB 4ABDA 1BTYA 2BY6X 1BB0B 3MU8A 3GCNA 1ZSKA 3U8OH 5DP6A 5JBAS 2OBQA 1OOKB 3O8DA 4FUIA 2NWNA 1P09A 2HLCA 2FXRA 2THFB 4Q2KA 3SU1A 5C1UA 1NFWA 3A89A 1KXFA 1GBFA 4KTCA 3RU4T 2DUCA 5HMAA 1QRWA 1FY4A 3FP8E 3LH3A 2GCTC 1QB9A 4AZ2B 1HAIH 1ZZZA 1BHXB 1BZXE 1GHWH 2A4GA 1H9IE 3E1XB 1YBWA 2P8OC 1DE7H 1YLDA 1HAPH 3PM3A 1NZQH 1C2EA 4NWKA 4SGBE 1GBCA 4NFFA 3P8GA 1TRYA 2VVUA 2IOTA 1AFQC 4NIVA 2BVRH 2AIPA 2ZPRA 3LC5A 2ZGHA 2PTCE 1GHVH 3DT0H 1OWKA 2FOCA 1NRQH 1C1VH 3CENA 3V12A 1HFDA 1HXFH 3P6ZB 1AFEH 1IOEA 2EC9H 1GL1A 1Y5BT 1O3KA 2G81E 5LPRA 3SU2A 2ZF0H 2Y82A 4RN6A 3RXJA 1ZMJA 1DXWA 4JZ1A 1RS0A 3A7ZA 1T32A 3FFGA 3URCA 1AY6H 1TNIA 1SQTA 4XDEA 2ZIQH 2G52A 1SQAA 1FY3A 3UWIA 3RDZA 2GD4B 2UUFB 6LPRA 1D3PB 2B9LA 5E0JA 4B1TA 2IPHA 1GHAG 1V2QT 2A1DB 4MNYA 1JIRA 2OC1A 1Q3XA 3M3SA 4IW4E 1ABIH 4Q80A 5EQQA 3ZZCA 3A88A 2SNWA 5T3HA 4MLFB 3LGYA 3NUMA 5DO4H 2ILNA 1A4WH 3E16B 1W11U 2Z7FE 2Z9LA 2OC0A 2ODPA 1W13U 2RA3A 4ISNA 5AHGH 1WQSA 3M3TA 2G4TA 1JXPA 1CE5A 1P9SA 4FVBA 4O97A 3SBKA 1ESAA 1BTUA 5IYTA 3OX7U 1PFXC 5GDSH 2P93A 1C2JA 2C93B 3LGWA 2HNTC 1ZR0A 4I8JA 2C8XB 3NWUA 1C2DA 3KN2A 3TJUA 3MH5A 1H9HE 1W0YH 5TJXA 3TK5A 3P8FA 1K1OA 4M7GA 3O8CA 2PFEA 4CR5A 1ZHMA 3LJJA 1O3IA 4JZDH 5LGOA 2F9OA 2VU8E 4JYTA 2BHGA 5F8TA 3M5LA 1SOTA 1ANEA 5GCHF 2F9UA 1SGEE 1AUTC 2FM2A 1LMWB 2BY8X 5TCCA 1CHOG 3BTTE 1AI8H 2ANKH 1DS2E 1P05A 1MTNC 1C1PA 4B2CA 1D6WA 2W3KA 2UWLA 1EXFA 3E90B 1CBWC 1F0RA 1SFIA 2PSYA 3TH3H 3M5NA 2ZTYA 1XVMA 2JETC 3QX5H 1YKTA 3A8DA 3TGKE 2BY7X 1H8IH 4MQAA 1V3XA 1BTZA 5GCHG 5J4QA 3PLPA 5CE1A 1G3DA 1LPKB 3L33A 5PTPA 1P0SH 3SJOA 4U2WA 3HKIB 3SV2H 1SMFE 4IMZA 2H5DA 1IQEA 3RM2H 3ZZ6A 1W10U 4XOJA 1FDPA 4UONA 1MD7A 2TBSA 8KME2 3DFJA 3TJVA 4ISIH 3JZ1B 1O2MA 3E3TA 6CHAB 5JBCS 1LTOA 4CH2B 3RMOH 1BBRH 1RTKA 2CGAA 4MPUA 2ZCKP 2OLGA 3EDXB 5DKMA 3KNXA 3N7OA 3FP7E 4A1TA 2WINI 1UHBA 2PKAA 3LGIA 3M5OA 1FZZA 1JBUH 1THPB 5F6MA 3QWCH 4K5ZA 1GJ5H 4X2YA 1T4UH 4X6NA 1P9UA 2AERH 4OS5A 1GHYH 1QNJA 3QZRA 2A31A 1ETTH 1XKAC 3PB1E 1HAVB 1SGPE 1S0RA 1KLIH 1UTJA 3SW2B 1BDAA 1UTMA 2PW8H 1UTLM 2PKSB 1P57B 1F0SA 1HIAB 2ANYA 2QYIA 3BG4C 3KL6A 1O5FH 1GDQA 1GI3A 1GJ4H 3OTJE 2BZ6H 2OTVA 1LVYA 3A7YA 1K2I1 3UNRA 2YOLA 5EU8A 1K21H 4KKDA 1GHBF 1HPGA 1SSXA 3S7KB 3VXFH 2AFQB 3SHCH
chains in the Genus database with same CATH superfamily
1TPPA 2VH0A 1DY9A 3RXPA 1Z6EA 5DN6D 4GAWA 1Y3YA 4DURA 2O8MA 5A0BA 4X1QU 5AFYH 4BAMB 3TGIE 4KTSA 5T6FA 1DXPA 3GY8A 2QY0B 4WVPE 1TLDA 3M7QA 4YO9A 1O5CB 2A32A 3ZZBA 2KCOA 4IN2A 4KP0A 4LZ4B 3CP7A 1A3BH 3BEIB 3M7TA 3UFAA 1CGJE 1O35A 4FOUC 4FUJA 2BLVA 5HIYA 3SUEA 1P01A 3LIWA 1NU9A 1CU1A 1VGCB 2XC5A 1SGQE 1A3EH 1P2MA 1P3EA 1YCPH 2F9VA 1C5SA 5EXMA 3P8OA 3BTGE 3SV6A 1UTQA 4LXBH 3GCTG 1O3PB 2XCNA 4DCDA 1AKSB 1V2NT 4GSOA 1ACBE 1C4Y2 2W3IA 3SJKA 2ZG0H 5HKKD 1F7ZA 5C5NA 1GI9B 2Y7ZA 4IN1A 1IHTH 1O3FA 3RXRA 5E0HA 1WU1A 4Y8YA 4FU8A 1GMHF 4FUHA 2FIRH 1Z6JH 1IQGA 3WWBA 3RC4A 1QRZA 1AZ8A 3AAUA 1VJ9U 4OS6A 1TONA 3EBNA 2TIOA 1VITG 3SUGA 1TBZH 1Y5UT 3P95A 2D8WA 2K0QA 3OTPA 4GVUA 4I7YH 5C17A 4NWLA 1G32B 1RJXB 2J38A 3FKSD 2LPRA 2GGVB 1FV9A 1Y3UA 3BTFE 1PPEE 1EB1H 1TNLA 2F9BH 3GICB 3WW7A 3A86A 3DHKH 1AMHA 1SFQB 1GMHG 3U1JB 1RTLA 4Q7YA 4CH8B 1KLJH 1A5HA 4ABEA 2DE9A 3RU4D 1MH0A 2GJGA 2SGAA 2ZGXH 1IQHA 5CHBA 2ZO3H 4MPXA 2BOHB 1EJNA 4MNWA 3BTKE 1V2PT 4TSFD 2ZFQH 4YM9A 1MQ5A 1YF4A 1LHEH 1PPZA 2TGDA 5AFZH 1DM4B 1NBME 1DVAH 2D26C 8GCHF 1KXDA 1SLUB 3MH4A 4K60A 1H4WA 3EA8A 5FX6A 1BMFD 1C1TA 5I46H 4RKJB 1XUHA 1XUIA 3KHVA 3MFJA 1HUTH 2QGRA 3NKKA 3PMAB 1QR3E 2TRMA 2TGTA 1O3AA 2Q6DA 2GDDA 3SNAA 1O2JA 2WPHS 2XC4A 3R3GB 2Q6FA 1QRXA 4DY7B 2LP6A 3ZYEA 2VGCB 4FUDA 1VCWA 3C1KA 3SO3A 1T31A 3Q77A 1DLEA 1FPCH 4YOGA 2ANWA 1GGDC 3FN8A 4BAOB 5EXNA 1TNKA 1O2ZA 4WXVA 1NO9H 4Y8XA 2FOMB 2RG3A 2XBYA 3GDUA 1OP2A 1P2QA 1AN1E 3MU4A 1V2ST 4JYVH 2ZGJA 5K0HA 4NCYA 2VVCA 1WQVH 3DUXH 2BXUH 5DG6A 2CF8H 1RGQA 3VGCC 1TPSA 4ZKOU 2BX3A 2ZDAH 2XNIA 3RP2A 4MPWA 2EI6A 2J34A 2FTLE 2NU0E 4INLA 5JDUB 2HWLB 3UAIC 1Z1IA 1N6XA 1W7GH 2Y81A 3KGPA 1IQJA 4ISHH 2OBOA 2ZI2H 2QXJA 3SUDA 1QJ6B 5A0AE 1FMGA 2CMYA 4X6PA 1OX1A 5KGOA 1G3BA 1MABB 5JBBS 1A5GH 3CS7A 4HTCH 4MG3A 1BTWA 3BV9B 1O3GA 1RTFB 3BF6H 2Y5FA 2VWLA 4AX9H 1NU7B 3VEQB 1TAWA 4OS2A 4NIXA 2PV9B 4U01A 1DY8A 3ITIA 2Z9JA 1RIWB 2ZU5A 2P16A 4AG2A 3T62A 1D4PB 1MU8B 1F5LA 3HPTB 1THSH 1C9PA 1HAYB 3HK6B 2JH5D 1BRBE 1GDUA 4AGJA 2QXIA 3OFND 4CRAA 3LPRA 3RXUA 5C2ZA 1W3CA 3EE0B 1H8ED 4DOQA 1N8OC 1EQ9A 4CRDA 3MI4A 4AFUA 4VGCC 2W5EA 1E34B 1ZLRA 3RXHA 1LO6A 1C5ZB 4WMDA 3B23B 2PWXA 1BRUP 1O3BA 4CRGA 6GCHG 1O38A 1W0ZU 4CHAC 3F9EA 3TVJB 1CGHA 4AB8A 2VNTA 1ETRH 2FDAA 1MBQA 1GCTC 3M5MA 1P8VC 2A4RA 3ZVFA 1ESBA 1YCPK 3TGJE 1YPHC 1ORFA 1VCQA 4I31A 1YPKH 3SN8A 2JJ1D 3LH1A 3D62A 1QZ8A 1S6HA 4A5TS 4X2VA 2Z94A 4A1XA 3KQCA 3SNEA 4K1SA 1MKWH 4YXWD 2A2XH 5HXFA 3VB7A 2ZDKA 3PO1B 2EY4C 1KYNA 3HGNA 1UJ1A 5A0CA 1EASA 4IMQA 1ZJDA 3SOSA 2A4OA 3H7OA 3UOUA 1C2KA 4MPVA 7ESTE 4DJZB 2JIZD 5ETXA 2AHME 3F2GA 1K28D 1SI5H 2XBXA 4JK5A 3SJ8A 3W94A 1GMDF 1EUFA 2BYAX 1HAZB 2Y5HA 4K2YA 1MU6B 1UCYH 3MNXA 1OHHD 2YNAA 3TJNA 2Q6GA 2D1JA 3MMGA 2XRCA 1C9TA 4UFEH 1S0QA 2OINA 3OEED 3RXFA 1A0JA 3TNSA 4DVAU 4K8BA 1RFNA 4D9QA 7GCHG 4YOIA 2Y6TA 4Y6DA 2FWWA 4DIIH 1O39A 4INHA 3ATMA 2AS9A 1K1IA 1MAXA 3L6PA 3GCHB 4RI0A 4YLUA 2ODYB 1GMDG 2B0FA 1EZQA 1UHBB 2P94A 1D3TB 2PKAB 2QF3A 3GOVB 2CJIA 5B6OA 1ZPCA 3TH2H 4HG6A 1CT0E 5GPIB 3SU5A 3QLPH 2G00A 2FODA 3RU4E 1Y59T 1E37B 4AYYB 2FS8A 1SHYA 4PROA 1TPAE 1WCZA 2ZCLP 1AWFH 2YMSC 4UFDH 1NROH 1O2UA 2OC7A 4ESTE 2V6NA 2ZU2A 3FZZA 3NZIA 4XE4A 4F4OC 4DT4A 1K0HA 2Z9GA 4OS4A 2AMPA 1E79D 3RXMA 3BN9A 1GG6B 1CT2E 3UTUH 2G51A 3GY4A 1C5MD 5BPEA 1AB9B 1KMHB 1OSSA 1MQ6A 2GZ7A 5CHAC 1D9IA 5L2ZH 3RXSA 2VIVA 3E0NB 1C5YB 3B9FH 4ZCNA 2ZFFH 3F0OA 5FPSA 3A8CA 1XUGA 2BDCA 3MNCA 4AN7A 4A6LA 1WDIA 1F2SE 1AVXA 4GHQA 1V2RT 4HZHA 2XWAA 2C3SA 4JZFH 5HIZA 4D9RA 1FN6A 1GBIA 3VB4A 1PYTD 3MH6A 1V6DA 1QL7A 4OGYA 1SGNE 1NTPA 1C5OH 2OUAA 2R0KA 3AVZA 2GP9B 5JB9S 1UW7A 3DSGA 2C8ZB 1DWBH 1W12U 2OC8A 2BDAA 3S9AA 1L0ZA 1EATA 5AF9H 3KQBA 3UWJH 2HNTE 2A7HA 1C1WH 1LHCH 1O2WA 5JYIA 1GBBA 1MCVA 1S83A 1C5PA 2H2ZA 1L1NA 1V2KT 1S84A 1H9LB 2P3FH 2Z3CA 3KCGH 1SQRA 1Z8JB 1V2UT 2WPDD 1TE0A 1YPMH 3UREA 2BD7A 3KF2A 1TNGA 3LGTA 2ZFRH 4UE7H 2FMJA 3A7TA 2BD5A 1D3QB 3GYMA 2FESH 5TCAA 1GI2A 1VZQH 4WF8A 4I8GA 1NY22 3URDA 1FJSA 1LQEA 3SU0A 3ZYDA 1FIZA 1ZPZA 2KZ4A 1BRCE 2VWMA 4KELA 4AG1A 1YPLH 2H9TH 5EW1H 1T4VH 1AFQB 3RLWH 3A84A 2NU4E 3T27A 1VKYA 1GBHA 1UCYE 4Q63A 1C5QA 2ZDVH 1O2QA 3P17H 3MOCA 1TA2A 3BTME 3OSYA 5AVDA 5CDFE 2BTCE 3SYJA 1GI7B 1ZGIA 3ZZAA 2R2WU 3HKJB 4MNVA 2PLXA 5FCKA 1MKWK 1C2LA 3ZVCA 1SC8U 4ABHA 3RXDA 4U30A 1XVOA 1C2IA 9LPRA 1W14U 2WSSD 1WOFA 5ESBA 1V2JT 2OD3B 3A82A 6CHAC 1O31A 3R0FA 2FYRA 2AYWA 1N1LA 5A8ZA 1Y3XA 2H9HA 4R0IA 3MNBA 1EJAA 1O2YA 1PPGE 3BTDE 1ZYOA 4GPGA 4YLQH 2ALPA 2ZPSA 2ZC9H 3PWCA 3D49H 3G01A 2SGPE 1UCYK 5JPMH 5DP4A 4SGAE 4Q7XA 3F68H 3MO6A 1AWHB 2UUKB 3NCLA 2V3OH 1UK2A 4B76A 2BY5X 1HLTH 3DA9B 3FVFB 2ZHQH 2WV9A 3SZNA 1INCA 3SGAE 4BAKB 1O2VA 1BIOA 2BOKA 3RXOA 3TU7H 4WWYA 1ZMNA 2FO9A 3ZVDA 4JZEH 4WMFA 4DG4A 1QFKH 1J17T 1SGTA 1TGNA 2W6ID 3OE7D 1HNEE 2OK5A 1EAUA 1IQNA 3FAOA 5JBTA 1EZUC 2F9NA 4LK4A 5A09A 1UVOA 1MKXH 4XRNA 4B74A 3OY6U 5L30H 1C4U2 1C4V2 2OXSA 4D76A 1P2KA 3PMJA 1J14A 4AFZA 1QURH 3SQEE 1O34A 3ODDA 3U69H 3K2UA 3RUOA 3M7UA 1TBRH 1O5DH 3QGNB 3UQVA 1QA7A 4MDSA 4TPYA 1A7SA 1L4ZA 1Z8RA 3Q00A 3ZVEA 2OP9A 1TABE 3EGKH 3KQEA 3W95A 5SGAE 3RC6A 4E7NA 1V2WT 3SGQE 3VB3A 1BHXF 1YCPM 4XFQA 5C20A 5LH8A 1VGCC 4BANB 3ZV8A 1A61H 2A0QB 2BLWA 1ZRBA 5C1XA 1NM6A 3TNTA 1TGBA 1GVZA 2XWBI 2JETB 1Z8GA 4NZQA 5EW2H 1MTWA 1SLVB 3LT3A 5EG4A 5FBEA 1TGCA 5EPYA 1MTSA 4IC5A 4D7GA 2ALVA 2XC0A 1QQUA 2OQUA 5DK1A 3LGUA 2XXLA 1DT2A 3ATWA 2RA0A 3RXLA 1S5SA 4ZUHA 1ANDA 3TJOA 3E8LA 3UOPA 5DSFA 1C2MA 5EPNA 2BQWB 2O9QA 1HXEH 2PHBA 1AE5A 1DPOA 3U28C 3UIRA 3ZZ8A 1P3CA 3LU9B 2KCYA 2GV7A 2G55A 4ABGA 1BUIA 1UVUH 1GJDB 3U8RH 5KEDA 1K1LA 1TNHA 2QE7D 1F5RA 4JYUH 5BRRE 2A7JA 2FI5E 2FLRH 1LQDB 1GHBG 2SGQE 4ACBA 5HM9A 2Y80A 5DP8A 5CMXH 5L2YH 2F3CE 2Z6BD 3MHWU 4NA8A 1FUJA 1EFRD 2A5AA 1P2IA 2WZQA 4MNXA 1H8HD 3SZEA 3QTVH 4B75A 4IGDA 1QTFA 1UVTH 2ZDNA 1KTTB 4ZXXH 2WV4A 1XXDA 1WV7H 5F03A 1MZDA 4B6FA 1VJAU 1T8LA 1UO6A 3K65B 4Z6AH 2STAE 2R9PA 2YMSD 2G5VA 1KDQA 3F2HA 3MTYA 1FI8A 3ZZ3A 4WY3A 2ASUB 3VXEH 1EAWA 3K9XB 1QCPA 2FOEA 1UTKA 1GI4A 5C1YA 4I32A 2H6MA 1ELVA 1LDTT 4LZ1H 1FLEE 1MD8A 1UVSH 1O3OA 1OP0A 1DUEA 3GY5A 1C5RA 4X1PU 7KMEH 2WV5A 4NSVA 2GMTB 4GCHF 2EI8A 3SV8A 2NU1E 2CN0H 1BMNH 2VGCC 4U32A 3HK3B 1JOUB 1O2IA 2O8LA 1PJPA 2ANMH 3RM0H 1AE8H 3TLOA 2GT7A 3UNQA 2VINA 1F0UA 3QO6A 1SQOA 4XBCA 4A1VA 1AVGH 2ZGCA 1XUJA 1ANBA 2FOAA 1WTGH 1BITA 4Y79A 1EPTC 1PPBH 1CGIE 2V0BA 3VB6A 1TMBH 1TQ7B 1KXBA 1SPJA 1TMTH 2AIQA 3GY7A 1IQKA 8ESTE 1FIWA 4FUEA 1YPGH 1RXPA 1XXFA 5C0TA 2RFKC 1PPCE 5FCRA 1BMMH 5GWZA 1GHXH 1YGCH 1ELDE 3KEEA 1Q31A 4O3UA 1TNJA 4GHTA 1TOMH 2XOKD 1N6YA 3FANA 2K8IA 4Y7AA 3K6YA 4RT1A 1GBAA 1K1JA 5EXLA 5HYOA 3QTOH 4H6SB 3S69A 1GI1A 2CV3A 1K1MA 3IWMA 2TPIZ 3N99A 3U1IB 3FOAA 4A92A 1BMAA 5ESTE 3I78A 8GCHG 4WH6A 1O5GH 3BEFB 1IQMA 1E1RD 1P10A 5DJ7A 3IG6B 3A87A 1HJ8A 2CHAB 1NT1A 1S81A 1RIWC 1GI8B 1C5XB 2ZQ1A 5KECA 1CA0B 4I8HA 1VITH 2WUCA 2W7SA 2LNCA 1MKXK 2PR3A 2FYQA 3AK5A 3O8RA 4NIYA 4B71A 4INKA 1Z71A 4HFPB 4FXGH 4ABFA 3BTEE 1DFPA 1HJAC 1OWIA 1QA0A 1P04A 3LJOA 1O36A 3T25A 4AFSA 1J9CH 2ZECA 1NRRH 1TFXA 4CRCA 1MBMA 4CR9A 3BEUA 2CXVA 4NGAH 1BRAA 2BM2A 5F8ZA 4FU9A 4THNH 3SU4A 3SORA 1NPMA 2GZ8A 1LHDH 1GJCB 1GBTA 1SOZA 1ELCA 3RXTA 3NPSA 3A7WA 1T8NA 3BG8A 1L1JA 1O2GH 1YPHE 5T6GA 3P8NA 2ZP0H 2KAIA 1P12E 3DD2H 1BT7A 1XX9A 1C1OA 5E2OA 1BCUH 2RCEA 2HALA 2XYAA 1PPFE 1OYQA 1NC6A 1AIXH 4GUXA 1G3EA 3ZVBA 3T29A 1ZOMA 3MYWA 5GIBA 2FOFA 4TT3D 1S6FA 1E38B 4WXIA 2A5KA 1GGDB 1SBWA 3PO1C 1O5BB 4ZMAH 1KLTA 2GZ9A 1EKBB 2H9EH 4ACAA 3UY9A 1QBNA 5IK2D 1TYNA 1YP9A 3M3VA 1QIXB 3A80A 3SV7A 3PV4A 1FXYA 3BSQA 2FX6A 3H5CB 1IQFA 3EAJA 2FP7B 1PQ8A 2J95A 2WPKS 1XUFA 1LPGB 2BMGB 1L2EA 1ZMLA 1B5GH 2I6SA 3ATLA 1S85A 3LOXA 1EAIA 2QN5T 4AOQA 1O3DA 1CO7E 1TRNA 2P59A 3RXBA 9ESTA 5FPYA 4UFFH 2QXHA 3UR6A 4JCNA 3DFLA 1ZSJA 2IN2A 1S82A 3RXIA 2F83A 1XKBC 2ZNKH 1TOCB 3PLBA 3D65E 4JMYA 3F9HA 1H1BA 4TYDA 1TA6A 1BA8B 4MTBA 4Y10E 2JKHA 3GCHC 1IHSH 2BD9A 1NFXA 3SU6A 5FXLA 3MH7A 3MNSA 2QAAA 1GJBB 1BTPA 4X8UH 1ELGA 1HDTH 2HLDD 4Y11E 2KCPA 2GCHF 5A8XA 3I29A 4ABJA 3F9FA 2JDID 3PV5A 1T8MA 3A83A 1W7XH 1FN8A 2BD4A 2FS9A 4X6OA 4X1RU 4ZH8A 1Y8TA 1O3NA 3W1EA 2GTBA 1O3CA 1D6RA 1C1QA 5GXPA 1N8OB 3C27B 3SNDA 5DP3A 2WHXA 1C1SA 1CT4E 4X2XA 4ZAEA 2VIOA 1FONA 1DSTA 4ZKSU 4FUCA 1A46H 3PTNA 4YT7H 1AB9C 1XMNB 2W6JD 3MQKC 1M9UA 2F9PA 4NA7A 1HGTH 6ESTA 4Z1MD 2QF0A 2V35A 3UQOA 1GDNA 2EA3A 1EJMA 1GL0E 5JB8S 1SGFG 1EZXC 1O30A 5GNDA 2GV6A 1ID5H 1DWCH 4RKOB 1KXAA 3KQ5A 4JK6A 2FOGA 1T7CA 1WSSH 1O37A 1SB1H 3ZZ5A 1AQ7A 1DSUA 1F5KU 2JH6D 2ZCHP 1SGFA 2G4UA 4K8YA 2RDLA 2PTNA 3H7TA 4Q4LA 1TGSZ 3EA9A 4TY6A 1HAOH 1J8AA 3QK1A 1W0KD 1HRTH 2WYJA 1A1RA 3JZ2B 1OWHA 2Y7XA 4X8VH 1ARBA 8LPRA 2A45B 2PGBB 1QBOA 1SGRE 2FI3E 3U9AH 1J16A 1O3MA 1TALA 2PP6A 2ZDMA 2KM0A 1YC0A 2ZWLH 2WPIS 5HGGA 2AGGX 2J98A 4K1TA 4X8SH 5G4BA 2SGDE 3GY3A 2IJOB 1IQLA 1WAYB 1LCYA 1EOLA 1EAXA 1HJ9A 1DWDH 2VIDA 1GJ8B 1C1MA 1GBEA 3OAAD 4AORA 1C1NA 2VBCA 3LONA 1ZGVA 1JRTA 2ZHEH 1V2LT 1O3LA 3OEHD 1OKXA 3BIVH 2R2MB 4NA9H 3TPIZ 3KYGA 4CBOA 1QQ4A 4J1YA 4ABIA 1OWDA 2IPQX 2JH0D 3KQDA 5C67A 1MTVA 1SGYE 1AD8H 2CF9H 2FPZA 3MU5A 3UR9A 4AGKA 3U8TH 4UDWH 3NXPA 3ESTA 2GX4A 1GWAA 2ZU1A 4OS1A 2AMQA 1YM0A 2FTMA 4ZXYH 1W0JD 3SUFA 2J92A 5C94A 3T26A 1BQYA 2GVFA 1JIMA 4NSYA 1F92A 1EPTA 1UK4A 1G30B 1DOJA 2ZZUH 2YMSB 1GHAF 1Z8IB 1C1RA 1C1UH 1GBDA 1AU8A 5E2PA 2QC2A 3WY8A 1UTNA 3SJIA 4XSKU 4E06H 1OWEA 1KDQB 2O8WA 3MU0A 1AUJA 5EOKA 1G3CA 1W8BH 1FPHH 1HBTH 1O2SA 3ZZ9A 1O2NA 3S0NA 1QHRB 1NS3A 4FU7A 2GCTB 2NU3E 3MO9A 3RXQA 2HGTH 3TIUA 5C3NA 3KIDU 2Q1JA 2ZFTA 5CHAB 3A8AA 1A0HB 5GJ4B 1C5TA 2FLBH 1QJ7B 2P8OB 5FPTA 4Q7ZA 3TK9A 4DT7B 1SHHB 4X2WA 2P95A 2G8TA 1KXEA 3NK8A 4B73A 3D23A 4D8NA 3EA7A 1OXGA 3SGBE 1ELEE 1NESE 2TGAA 4I8KA 5EODA 4B2AA 4I86A 2VH6A 2AMDA 1SLWB 5DGJA 2BQ7B 3F2FA 1QL9A 1EX3A 5DP9A 1TRMA 5LPEA 2BY9X 3VPKA 5EJ1A 2SGFE 3N7DA 4ISOA 1ANCA 3U98H 4BTTB 1UVPA 4CREA 4E05H 3Q3YA 1YPEH 3RXEA 4XBBA 1TX8A 1ZTJA 4CRBA 1O3JA 2GKVE 2ZHFH 4O3TA 2J4IA 1CHOF 2L6OA 2BX4A 1LPZB 1V2TT 1TIOA 3E6PH 3S7HB 1OPHB 1IQIA 1NN6A 1ELFA 2K7XA 1A5IA 5HM2A 1UK3A 1O2XA 1NRPH 1A0LA 3VFEA 2TGPZ 1QJ1B 1THRH 4AFQA 3V7TA 4IS5A 1NFUA 1GJ6A 4I8LA 4ZHMU 3QDZB 5EQSA 2GDEH 3ELAH 1EB2A 1GHZA 1CHGA 3RLYH 1Y3VA 1DICA 4TY7A 2GT8A 2PUXB 3OU0A 1U6QA 1CSOE 2SGEE 1ZPBA 4TWYA 3BTHE 1G2LA 1EZSC 1PPHE 2M5TA 1MUEB 2VIWA 2ZFPH 1GI0A 1PQAA 2PKSC 3ZZDA 2KR7A 1O33A 1W2KH 1B7XB 3T2NA 5EGMA 1C5VA 1P03A 1WXRA 1G37A 1MZAA 1TX6A 3PRBA 2HPQH 3CNRA 1DANH 4K3JA 1LKAA 1QBVH 4I33A 1ETSH 2VWOA 4FUBA 3TK6A 2P3TB 1O2LA 3IITA 7LPRA 1C5UA 3EQ0H 2M2AA 3I77A 1TQ0B 1UTOA 1DX5M 2V7QD 1K22H 1GJAB 1G36A 5DP7A 1V2MT 4YTAA 1ZTLA 1AZZA 1CVWH 1COWD 1O5AB 4ABAA 1DWEH 1DDJA 2ZHDA 1J15A 2UWOA 1WBGB 2D2DA 2R3UA 1BJVA 2KAIB 1F0TA 2EQNA 4YZUA 3SV9A 3FP6E 2BXTH 2J5UA 4A7IB 3GY2A 1MTNB 1MCTA 1C2HA 1LVBA 2BD3A 2Z3EA 2PSXA 1ZJKA 1CBWB 1HAGE 3V13A 4IC6A 2FEQH 2VIQA 1UMAH 3EE7A 1QB1A 2WYGA 2WPLS 3RMMH 1E0FD 1SGDE 4AB9A 4BAHB 2BLOA 4WH8A 5IDKA 3S9CA 5E8EH 1P2JA 4NFEA 1VR1H 1TWXB 1L1GA 1C5NH 1LKBA 1K1PA 3PWBA 4ABBA 3LDXH 2EEKA 1HCGA 5DPAA 1GBJA 1ELTA 5T6DA 2FI4E 1TPOA 4NIWA 3RXKA 1D3DB 1JMOH 3RXGA 3RMLH 1HYLA 2ZU3A 2KFWA 4JZIA 4DGJA 2FOHA 1IAUA 1G9IE 3LGVA 4Z0KA 3MU1A 5ABWA 2LIZA 4Y76A 4ASHA 1HB0B 1MAYA 1TX7A 2A2QH 2OQ5A 2GMTC 2Z9KA 1EP5A 2V3MA 3GCTF 1Z7KA 1SGIB 3SNCA 4AYVB 1Q2WA 4BXWA 4CRFA 4QT8C 4FETA 3PRDA 2QCYA 1O2TA 3AW0A 4YOJA 4UFGH 2VIPA 4K1EA 2BB4A 1NRNH 1KTSB 1YPJH 3T28A 3MO3A 1G2MA 4OS7A 1T8OA 5T1VA 1ZRKA 3BG4B 2SFAA 2QIQA 3HATH 1SR5C 2ZHWH 3ZVGA 1WTHD 2HRVA 3RXVA 1VITF 1QGFA 1O2RA 2A5IA 2BDYA 4B6EA 1MMJN 3M35A 4P02A 3ZVAA 4HGCA 1GI5A 4X1SU 4X8TH 5A8YA 1P2NA 4FUGA 3L3TA 1C2FA 1YY3A 1FY1A 1B0EA 1QB6A 2UWPA 3Q76A 3RXAA 3ZV9A 1BJUA 2A7CA 4K69A 2FOBA 1NFYA 4Y7BA 4KTUA 2ESTE 4X6MA 1GPZA 4RSPA 3SNBA 1DITH 4F48B 1ESTA 2ZPQA 1WYKA 3BTQE 2B8OH 3PMHB 2ZDLA 4H6TA 2ZQ2A 2ZTZA 1FQ3A 2BDHA 2F91A 3SI3H 4UEHH 1C5LH 1GJ9B 1TB6H 1V2VT 5FL7D 2H5CA 3F3BA 3GDSA 3PROA 4ZKNU 2CK3D 1Y3WA 3PYHA 3SU3A 4M9FA 1O2OA 2CHAC 2JJ2D 1TMUH 1V2OT 1LVMA 4O03A 2O8TA 4Y0ZE 1CA0C 1PYTC 5H4IB 4BTIB 4F55A 3QN7A 1Z1JA 5FBIA 1BMLA 3P70B 4GCHG 3STJA 2W7UA 2ZA5A 3A7XA 3ATKA 3VB5A 1L4DA 2DE8A 1RRKA 3FO8D 5EIYA 2QF4A 1SL3A 2C8WB 1ELBA 1O2KA 5EQRA 2R0LA 1GCDA 1FNIA 1C2GA 1WUNH 3GY6A 4F49A 2PUQH 2C4FH 2J98B 1XM1A 5FX5A 3ZZ4A 2K1QA 1SG8B 1BBRE 1QL8A 4ZHAA 2Y5GA 2J94A 2WUBA 2ZGBH 1AHTH 3K6ZA 2FX4A 4TPIZ 3F9GA 4P00A 4FVDA 1OS8A 4E7RG 4TWWA 3A85A 1GMCF 1ZHPA 5DP5A 1BTXA 5A2MH 1CQQA 1K9OE 2HNTF 3T5FH 1ABJH 1JWTA 3WWFA 2VJ1A 2B5TB 1GBLA 1FY5A 3Q3XA 1GJ7B 3E91A 4Y0YE 1ZTKA 1P02A 3AASA 1O32A 2UUYA 3P92A 2HVXA 1TGTA 3SI4H 1BTHH 3ATIA 5F53A 1O0DH 1LHFH 4IBLH 4OM9A 3M61U 3GISB 1AGJA 2WPJS 1OYTH 3SHAH 4O9VA 1FAXA 2BQ6B 1GMCG 1ELAA 1MTUA 2XBWA 1KIGH 1HV7A 1Y5AT 1EPTB 3UUZA 1BBRK 2ULLA 2ZU4A 3PMBB 5C5OA 2FZZA 2B7DH 5J4SA 3UPEA 1JRSA 1A2CH 1C5WB 1O5EH 4GLYA 3N7EA 2BVXH 4R8TB 1GBKA 3TITA 2P3UB 3LKWA 4NZLA 1O2PA 3S9BA 2YNBA 1P2OA 3TH4H 5K7RA 2UUJB 1DUAA 4UD9H 4ZKRU 2ZEBA 3ZZ7A 3STIA 1P06A 4YESB 1CA8B 3CS0A 2A4QA 2H1UA 2L74A 3MWIU 3A81A 1DLKB 3M37A 4LOYH 1PQ7A 3DCLA 1RD3B 5I25A 2QV1A 3SQHE 2R3YA 1O3HA 4BNRA 6GCHF 4H4FA 2C90B 1HAVA 4BXSA 2BDBA 2Z9IA 4XBDA 2XBVA 3RXCA 4H42U 3A7VA 1HIAA 1PQ5A 3PTBA 1SLXB 4HI3A 1E36B 3GCOA 3F1SB 3FZDA 3VGCB 4DW2U 1E35B 1HJAB 4X0WU 3AW1A 2J2UA 2BD2A 1VCPA 4YT6H 2V3HH 5EJLA 1B0FA 2Z3DA 3V3MA 1FAKH 1ZHRA 3PLKA 4DIHH 3BTWE 2AGIX 3AAVA 4KGAA 4Y71A 4D7FA 1YLCA 3QUMP 3F0PA 2VWNA 1FX0B 1YYY1 5FAHA 3B8JA 1TBQH 1HAHH 1SGCA 2G5NA 2BLQA 2BZAA 2STBE 4ISLA 2C8YB 4B2BA 1XUKA 2ZKSA 3HGPA 5E0GA 4X1NU 4NG9H 2HPPH 2VB0A 3ODFA 5FHTA 2XTTB 1KY9A 3RMNH 2ZTXA 2J9NA 1EP6A 1OWJA 3F6UH 3H09A 1HAXB 1GVLA 3E0PB 2NU2E 4OGXA 1SVPA 3O8BA 2BVSH 1BOQA 2ODQA 3EYDA 4FUFA 3RC5A 4ZROA 3A8BA 2SNVA 3BIUH 4ZHLU 4WJG2 4VGCB 1AKSA 1LHGH 2QXGA 3Q3KA 2BDIA 4Y8ZA 3QZQA 4MVNA 2AGEX 7GCHF 4BAQB 4CHAB 1GG6C 2BDGA 2QA9E 1K1NA 5F8XA 2GCHG 4BOHA 2F43B 3GDVA 2PGQB 3M36A 4WMEA 1EOJA 1GCTB 3LC3A 3QGJA 2OCVB 1ARCA 2XCFA 5L6NH 2ZFSA 2AH4X 1S6LA 3OY5U 1KXCA 1O3EA 1AVWA 1KSNA 2O8UA 1UTPA 1GVKB 2XW9A 4CBNA 4J2YB 5B6LA 2W26A 1ZSLA 1GI6A 1QY6A 3OYPA 1P11E 4BTUB 2HOBA 2AEIH 5LPFA 1LVOA 1OP8A 3UNSA 2BD8A 1NRSH 2WPMS 1GBMA 3GYLB 2J97A 3SJ9A 2VVVA 2EI7A 3V0XA 2I6QA 1X7AC 1H8DH 1AO5A 1O2HA 1FY8E 3ENSB 4ABDA 1BTYA 2BY6X 1BB0B 3MU8A 3GCNA 1ZSKA 3U8OH 5DP6A 5JBAS 2OBQA 1OOKB 3DSOA 3O8DA 4FUIA 2NWNA 5C0UA 1P09A 2HLCA 2FXRA 2THFB 4Q2KA 3SU1A 5C1UA 1NFWA 3A89A 2KX4A 1KXFA 1GBFA 4KTCA 3RU4T 1E1QD 2DUCA 3KYFA 5HMAA 1QRWA 1FY4A 3FP8E 3LH3A 2GCTC 1QB9A 4AZ2B 1HAIH 1ZZZA 1BHXB 1BZXE 1GHWH 2A4GA 1H9IE 3E1XB 1YBWA 2P8OC 1DE7H 1YLDA 1HAPH 3PM3A 1NZQH 1C2EA 4NWKA 4SGBE 1GBCA 4NFFA 3P8GA 1TRYA 2VVUA 2IOTA 1AFQC 4NIVA 2BVRH 2AIPA 2ZPRA 3LC5A 2ZGHA 2PTCE 1GHVH 3DT0H 1OWKA 2FOCA 1NRQH 1C1VH 3CENA 3V12A 2QF5A 1HFDA 1HXFH 3P6ZB 1AFEH 1IOEA 2EC9H 1GL1A 1Y5BT 1O3KA 2G81E 5LPRA 3SU2A 2ZF0H 2Y82A 4RN6A 3RXJA 3DSPA 1ZMJA 1DXWA 4JZ1A 1RS0A 3A7ZA 1T32A 3FFGA 3URCA 1AY6H 1TNIA 1SQTA 4XDEA 2ZIQH 2G52A 1SQAA 1FY3A 3UWIA 3RDZA 2GD4B 2UUFB 6LPRA 2LELA 1D3PB 2B9LA 5E0JA 4B1TA 2IPHA 1GHAG 1V2QT 2A1DB 4MNYA 1JIRA 2OC1A 1Q3XA 3M3SA 4IW4E 1ABIH 4Q80A 5EQQA 3ZZCA 3A88A 2SNWA 5T3HA 4MLFB 3LGYA 3NUMA 2IJD1 4XD7D 5DO4H 2ILNA 1A4WH 3E16B 1W11U 2Z7FE 2Z9LA 2OC0A 2ODPA 4ASUD 1W13U 2RA3A 4ISNA 5AHGH 1WQSA 3M3TA 2G4TA 1JXPA 2XNDD 1CE5A 3ZIAD 1P9SA 4FVBA 4O97A 3SBKA 1SKYE 1ESAA 1BTUA 5IYTA 3OX7U 1PFXC 5GDSH 2P93A 2F4LA 1C2JA 2C93B 3LGWA 2HNTC 1ZR0A 4I8JA 2C8XB 3NWUA 1C2DA 3KN2A 3TJUA 3MH5A 1H9HE 1W0YH 5EJZA 5TJXA 3TK5A 3P8FA 1K1OA 4M7GA 3O8CA 2PFEA 1NBMD 4CR5A 1ZHMA 3LJJA 1O3IA 4JZDH 5LGOA 3GS9A 2F9OA 3PV2A 2VU8E 2HVYB 4JYTA 2BHGA 5F8TA 3M5LA 1SOTA 1ANEA 5GCHF 2F9UA 1SGEE 1AUTC 2FM2A 1LMWB 2BY8X 5TCCA 1CHOG 3BTTE 1AI8H 2ANKH 2KCAA 1DS2E 1P05A 1MTNC 1C1PA 4B2CA 1D6WA 2W3KA 2UWLA 1EXFA 3E90B 1CBWC 1F0RA 1SFIA 2PSYA 3TH3H 3M5NA 2ZTYA 1XVMA 2JETC 3QX5H 1YKTA 3A8DA 3TGKE 2BY7X 1H8IH 4MQAA 1V3XA 1BTZA 5GCHG 5J4QA 3PLPA 5CE1A 1G3DA 1LPKB 3L33A 5PTPA 1P0SH 3SJOA 4U2WA 3HKIB 3SV2H 1SMFE 4IMZA 2H5DA 1IQEA 3RM2H 3ZZ6A 2RDEA 1W10U 4XOJA 1FDPA 4UONA 1MD7A 2TBSA 8KME2 3DFJA 3UB0A 3TJVA 4ISIH 3JZ1B 1O2MA 3E3TA 6CHAB 4AC9A 5JBCS 1LTOA 4CH2B 3RMOH 1BBRH 1RTKA 2CGAA 4MPUA 3NRLA 2ZCKP 2OLGA 3EDXB 5DKMA 3KNXA 3N7OA 3FP7E 4A1TA 2WINI 1UHBA 2PKAA 3LGIA 3M5OA 1FZZA 1JBUH 1THPB 5F6MA 3QWCH 4K5ZA 1GJ5H 4X2YA 1T4UH 4X6NA 1P9UA 2AERH 4OS5A 1GHYH 1QNJA 3QZRA 2A31A 1ETTH 1XKAC 3PB1E 1HAVB 1YWUA 1SGPE 1S0RA 1KLIH 1UTJA 3SW2B 1BDAA 1UTMA 2PW8H 1UTLM 2PKSB 1P57B 1F0SA 1HIAB 2ANYA 2QYIA 3BG4C 3KL6A 1O5FH 1GDQA 1GI3A 1GJ4H 3OTJE 2BZ6H 2OTVA 1LVYA 3A7YA 1K2I1 3VG8A 3UNRA 2YOLA 5EU8A 1K21H 4KKDA 1GHBF 1HPGA 1SSXA 4RT0A 3S7KB 3VXFH 2AFQB 3SHCH 1YLNA
chains in the Genus database with same CATH topology
1TPPA 2VH0A 1DY9A 3RXPA 1Z6EA 4GAWA 1Y3YA 4DURA 2O8MA 5A0BA 4X1QU 5AFYH 4BAMB 3TGIE 4KTSA 5T6FA 1DXPA 3GY8A 2QY0B 4WVPE 1TLDA 3M7QA 4YO9A 1O5CB 2A32A 3ZZBA 4IN2A 4KP0A 4LZ4B 3CP7A 1A3BH 3BEIB 3M7TA 3UFAA 1CGJE 1O35A 4FUJA 2BLVA 3SUEA 1P01A 3LIWA 1NU9A 1CU1A 1VGCB 2XC5A 1SGQE 1A3EH 1P2MA 1P3EA 1YCPH 2F9VA 1C5SA 5EXMA 3P8OA 3BTGE 3SV6A 1UTQA 4LXBH 3GCTG 1O3PB 2XCNA 4DCDA 1AKSB 1V2NT 4GSOA 1ACBE 1C4Y2 2W3IA 3SJKA 2ZG0H 1F7ZA 5C5NA 1GI9B 2Y7ZA 4IN1A 1IHTH 1O3FA 3RXRA 5E0HA 1WU1A 4Y8YA 4FU8A 1GMHF 4FUHA 2FIRH 1Z6JH 1IQGA 3RC4A 1QRZA 1AZ8A 3AAUA 1VJ9U 4OS6A 1TONA 3EBNA 2TIOA 1VITG 3SUGA 1TBZH 1Y5UT 3P95A 2D8WA 4GVUA 4I7YH 4NWLA 1G32B 1RJXB 2J38A 2LPRA 2GGVB 1FV9A 1Y3UA 3BTFE 1PPEE 1EB1H 1TNLA 2F9BH 3GICB 3A86A 3DHKH 1AMHA 1SFQB 1GMHG 3U1JB 1RTLA 4Q7YA 4CH8B 1KLJH 1A5HA 4ABEA 2DE9A 3RU4D 1MH0A 2SGAA 2ZGXH 1IQHA 2ZO3H 4MPXA 2BOHB 1EJNA 4MNWA 3BTKE 1V2PT 2ZFQH 4YM9A 1MQ5A 1YF4A 1LHEH 1PPZA 2TGDA 5AFZH 1DM4B 2D26C 1DVAH 8GCHF 1KXDA 1SLUB 3MH4A 4K60A 1H4WA 3EA8A 5FX6A 1C1TA 5I46H 4RKJB 1XUHA 1XUIA 3KHVA 3MFJA 1HUTH 2QGRA 3NKKA 3PMAB 1QR3E 2TRMA 2TGTA 1O3AA 2Q6DA 2GDDA 3SNAA 1O2JA 2WPHS 2XC4A 3R3GB 2Q6FA 1QRXA 4DY7B 3ZYEA 2VGCB 4FUDA 1VCWA 3C1KA 3SO3A 1T31A 3Q77A 1DLEA 1FPCH 4YOGA 2ANWA 1GGDC 4BAOB 5EXNA 1TNKA 1O2ZA 4WXVA 1NO9H 4Y8XA 2FOMB 2RG3A 2XBYA 3GDUA 1OP2A 1P2QA 1AN1E 3MU4A 1V2ST 4JYVH 2ZGJA 5K0HA 4NCYA 2VVCA 1WQVH 3DUXH 2BXUH 5DG6A 2CF8H 1RGQA 3VGCC 1TPSA 4ZKOU 2BX3A 2ZDAH 2XNIA 3RP2A 4MPWA 2EI6A 2J34A 2FTLE 2NU0E 4INLA 5JDUB 2HWLB 1Z1IA 1N6XA 1W7GH 2Y81A 3KGPA 1IQJA 4ISHH 2OBOA 2ZI2H 2QXJA 3SUDA 1QJ6B 5A0AE 1FMGA 2CMYA 4X6PA 1OX1A 1G3BA 5JBBS 1A5GH 3CS7A 4HTCH 4MG3A 1BTWA 3BV9B 1O3GA 1RTFB 3BF6H 2Y5FA 2VWLA 4AX9H 1NU7B 3VEQB 1TAWA 4OS2A 4NIXA 2PV9B 4U01A 1DY8A 3ITIA 2Z9JA 1RIWB 2ZU5A 2P16A 4AG2A 3T62A 1D4PB 1MU8B 1F5LA 3HPTB 1THSH 1C9PA 1HAYB 3HK6B 2JH5D 1BRBE 1GDUA 4AGJA 2QXIA 4CRAA 3LPRA 3RXUA 5C2ZA 1W3CA 3EE0B 4DOQA 1N8OC 1EQ9A 4CRDA 3MI4A 4AFUA 4VGCC 2W5EA 1E34B 1ZLRA 3RXHA 1LO6A 1C5ZB 4WMDA 3B23B 2PWXA 1BRUP 1O3BA 4CRGA 6GCHG 1O38A 1W0ZU 4CHAC 3F9EA 3TVJB 1CGHA 4AB8A 2VNTA 1ETRH 2FDAA 1MBQA 1GCTC 3M5MA 1P8VC 2A4RA 3ZVFA 1ESBA 1YCPK 3TGJE 1YPHC 1ORFA 1VCQA 4I31A 1YPKH 3SN8A 3LH1A 3D62A 1S6HA 4A5TS 4X2VA 2Z94A 4A1XA 3KQCA 3SNEA 4K1SA 1MKWH 2A2XH 5HXFA 3VB7A 2ZDKA 3PO1B 1KYNA 3HGNA 1UJ1A 5A0CA 1EASA 4IMQA 1ZJDA 3SOSA 2A4OA 3H7OA 3UOUA 1C2KA 4MPVA 7ESTE 4DJZB 5ETXA 1K28D 1SI5H 2XBXA 4JK5A 3SJ8A 3W94A 1GMDF 1EUFA 2BYAX 1HAZB 2Y5HA 4K2YA 1MU6B 1UCYH 3MNXA 2YNAA 3TJNA 2Q6GA 2D1JA 3MMGA 2XRCA 1C9TA 4UFEH 1S0QA 2OINA 3RXFA 1A0JA 3TNSA 4DVAU 4K8BA 1RFNA 4D9QA 7GCHG 4YOIA 2Y6TA 4Y6DA 2FWWA 4DIIH 1O39A 4INHA 3ATMA 2AS9A 1K1IA 1MAXA 3L6PA 3GCHB 4YLUA 2ODYB 1GMDG 2B0FA 1EZQA 1UHBB 2P94A 1D3TB 2PKAB 2QF3A 3GOVB 2CJIA 5B6OA 1ZPCA 3TH2H 1CT0E 5GPIB 3SU5A 3QLPH 2G00A 2FODA 3RU4E 1Y59T 1E37B 4AYYB 2FS8A 1SHYA 4PROA 1TPAE 1WCZA 2ZCLP 1AWFH 4UFDH 1NROH 1O2UA 2OC7A 4ESTE 2V6NA 2ZU2A 3FZZA 3NZIA 4XE4A 4F4OC 2Z9GA 4OS4A 2AMPA 3RXMA 3BN9A 1GG6B 1CT2E 3UTUH 2G51A 3GY4A 1C5MD 5BPEA 1AB9B 1OSSA 1MQ6A 2GZ7A 5CHAC 1D9IA 5L2ZH 3RXSA 2VIVA 3E0NB 1C5YB 3B9FH 2ZFFH 5FPSA 3A8CA 1XUGA 2BDCA 3MNCA 4AN7A 4A6LA 4GHQA 1F2SE 1AVXA 1V2RT 4HZHA 2XWAA 2C3SA 4JZFH 4D9RA 1FN6A 1GBIA 3VB4A 1PYTD 3MH6A 1V6DA 1QL7A 4OGYA 1SGNE 1NTPA 1C5OH 2OUAA 2R0KA 3AVZA 2GP9B 5JB9S 2C8ZB 1DWBH 1W12U 2OC8A 2BDAA 3S9AA 1L0ZA 1EATA 5AF9H 3KQBA 3UWJH 2HNTE 2A7HA 1C1WH 1LHCH 1O2WA 5JYIA 1GBBA 1MCVA 1S83A 1C5PA 2H2ZA 1L1NA 1V2KT 1S84A 1H9LB 2P3FH 2Z3CA 3KCGH 1Z8JB 1V2UT 1TE0A 1YPMH 3UREA 2BD7A 3KF2A 1TNGA 3LGTA 2ZFRH 4UE7H 2FMJA 3A7TA 2BD5A 1D3QB 3GYMA 2FESH 5TCAA 1GI2A 1VZQH 4WF8A 4I8GA 1NY22 3URDA 1FJSA 1LQEA 3SU0A 3ZYDA 1FIZA 1ZPZA 1BRCE 2VWMA 4KELA 4AG1A 1YPLH 2H9TH 5EW1H 1T4VH 1AFQB 3RLWH 3A84A 2NU4E 3T27A 1GBHA 1UCYE 1C5QA 2ZDVH 1O2QA 3P17H 3MOCA 1TA2A 3BTME 3OSYA 5AVDA 2BTCE 1GI7B 1ZGIA 3ZZAA 2R2WU 3HKJB 4MNVA 2PLXA 5FCKA 1MKWK 1C2LA 3ZVCA 1SC8U 4ABHA 3RXDA 4U30A 1XVOA 1C2IA 9LPRA 1W14U 5ESBA 1WOFA 1V2JT 2OD3B 3A82A 6CHAC 1O31A 3R0FA 2FYRA 2AYWA 1N1LA 5A8ZA 1Y3XA 2H9HA 4R0IA 3MNBA 1EJAA 1O2YA 1PPGE 3BTDE 1ZYOA 4GPGA 4YLQH 2ALPA 2ZPSA 2ZC9H 3PWCA 3D49H 3G01A 2SGPE 1UCYK 5JPMH 5DP4A 4SGAE 4Q7XA 3F68H 3MO6A 1AWHB 2UUKB 3NCLA 2V3OH 1UK2A 4B76A 2BY5X 1HLTH 3DA9B 3FVFB 2ZHQH 3SZNA 1INCA 3SGAE 4BAKB 1O2VA 1BIOA 2BOKA 3RXOA 3TU7H 4WWYA 1ZMNA 2FO9A 3ZVDA 4JZEH 4WMFA 4DG4A 1QFKH 1J17T 1SGTA 1TGNA 1HNEE 1EAUA 1IQNA 3FAOA 5JBTA 1EZUC 2F9NA 4LK4A 5A09A 1UVOA 1MKXH 4B74A 3OY6U 5L30H 1C4U2 1C4V2 2OXSA 4D76A 1P2KA 3PMJA 1J14A 4AFZA 1QURH 3SQEE 1O34A 3ODDA 3U69H 3K2UA 3RUOA 3M7UA 1TBRH 1O5DH 3QGNB 3UQVA 1QA7A 4MDSA 4TPYA 1A7SA 1L4ZA 1Z8RA 3Q00A 3ZVEA 2OP9A 1TABE 3EGKH 3KQEA 3W95A 5SGAE 3RC6A 4E7NA 1V2WT 3SGQE 3VB3A 1BHXF 1YCPM 4XFQA 5C20A 5LH8A 1VGCC 4BANB 3ZV8A 1A61H 2A0QB 2BLWA 1ZRBA 5C1XA 1NM6A 3TNTA 1TGBA 1GVZA 2XWBI 2JETB 1Z8GA 4NZQA 5EW2H 1MTWA 1SLVB 3LT3A 5EG4A 5FBEA 1TGCA 5EPYA 1MTSA 4IC5A 4D7GA 2ALVA 2XC0A 1QQUA 2OQUA 5DK1A 3LGUA 2XXLA 1DT2A 3ATWA 2RA0A 3RXLA 1S5SA 4ZUHA 1ANDA 3TJOA 3E8LA 3UOPA 1C2MA 5EPNA 2BQWB 2O9QA 1HXEH 2PHBA 1AE5A 1DPOA 3UIRA 3ZZ8A 1P3CA 3LU9B 2GV7A 2G55A 4ABGA 1BUIA 1UVUH 1GJDB 3U8RH 1K1LA 1TNHA 1F5RA 4JYUH 5BRRE 2A7JA 2FI5E 2FLRH 1LQDB 1GHBG 2SGQE 5HM9A 2Y80A 5DP8A 5CMXH 5L2YH 2F3CE 2Z6BD 3MHWU 4NA8A 1FUJA 2A5AA 1P2IA 4MNXA 3QTVH 4B75A 4IGDA 1QTFA 1UVTH 2ZDNA 1KTTB 4ZXXH 2WV4A 1XXDA 1WV7H 5F03A 1MZDA 1VJAU 1T8LA 1UO6A 3K65B 4Z6AH 2STAE 2R9PA 2G5VA 1KDQA 3MTYA 1FI8A 3ZZ3A 4WY3A 2ASUB 3VXEH 1EAWA 3K9XB 1QCPA 2FOEA 1UTKA 1GI4A 5C1YA 4I32A 2H6MA 1ELVA 1LDTT 4LZ1H 1FLEE 1MD8A 1UVSH 1O3OA 1OP0A 1DUEA 3GY5A 1C5RA 4X1PU 7KMEH 2WV5A 4NSVA 2GMTB 4GCHF 2EI8A 3SV8A 2NU1E 2CN0H 1BMNH 2VGCC 4U32A 3HK3B 1JOUB 1O2IA 2O8LA 1PJPA 2ANMH 3RM0H 1AE8H 3TLOA 2GT7A 3UNQA 2VINA 1F0UA 3QO6A 1SQOA 4XBCA 4A1VA 1AVGH 2ZGCA 1XUJA 1ANBA 2FOAA 1WTGH 1BITA 4Y79A 1EPTC 1PPBH 1CGIE 2V0BA 3VB6A 1TMBH 1TQ7B 1KXBA 1SPJA 1TMTH 2AIQA 3GY7A 1IQKA 8ESTE 1FIWA 4FUEA 1YPGH 1RXPA 1XXFA 1PPCE 5FCRA 1BMMH 5GWZA 1GHXH 1YGCH 1ELDE 3KEEA 1Q31A 4O3UA 1TNJA 4GHTA 1TOMH 3FANA 1N6YA 4Y7AA 3K6YA 1GBAA 1K1JA 5EXLA 5HYOA 3QTOH 4H6SB 3S69A 1GI1A 2CV3A 1K1MA 3IWMA 2TPIZ 3U1IB 4A92A 1BMAA 5ESTE 3I78A 8GCHG 4WH6A 1O5GH 3BEFB 1IQMA 1P10A 5DJ7A 3IG6B 3A87A 1HJ8A 2CHAB 1NT1A 1S81A 1RIWC 1GI8B 1C5XB 2ZQ1A 1CA0B 4I8HA 1VITH 2WUCA 2W7SA 2LNCA 1MKXK 2PR3A 2FYQA 3O8RA 4NIYA 4B71A 4INKA 1Z71A 4HFPB 4FXGH 4ABFA 3BTEE 1DFPA 1HJAC 1OWIA 1QA0A 1P04A 3LJOA 1O36A 3T25A 4AFSA 1J9CH 2ZECA 1NRRH 1TFXA 4CRCA 1MBMA 4CR9A 3BEUA 2CXVA 4NGAH 1BRAA 2BM2A 5F8ZA 4FU9A 4THNH 3SU4A 3SORA 1NPMA 2GZ8A 1LHDH 1GJCB 1GBTA 1SOZA 1ELCA 3RXTA 3NPSA 3A7WA 1T8NA 3BG8A 1L1JA 1O2GH 1YPHE 5T6GA 3P8NA 2ZP0H 2KAIA 1P12E 3DD2H 1BT7A 1XX9A 1C1OA 5E2OA 1BCUH 2RCEA 2HALA 2XYAA 1PPFE 1OYQA 1NC6A 1AIXH 4GUXA 1G3EA 3ZVBA 3T29A 1ZOMA 3MYWA 5GIBA 2FOFA 1S6FA 1E38B 4WXIA 2A5KA 1GGDB 1SBWA 3PO1C 1O5BB 4ZMAH 1KLTA 2GZ9A 1EKBB 2H9EH 3UY9A 1QBNA 1TYNA 1YP9A 3M3VA 1QIXB 3A80A 3SV7A 3PV4A 1FXYA 3BSQA 2FX6A 3H5CB 1IQFA 3EAJA 2FP7B 1PQ8A 2J95A 2WPKS 1XUFA 1LPGB 2BMGB 1L2EA 1ZMLA 1B5GH 2I6SA 3ATLA 1S85A 3LOXA 1EAIA 2QN5T 4AOQA 1O3DA 1CO7E 1TRNA 2P59A 3RXBA 9ESTA 5FPYA 4UFFH 2QXHA 3UR6A 4JCNA 3DFLA 1ZSJA 2IN2A 1S82A 3RXIA 2F83A 1XKBC 2ZNKH 1TOCB 3PLBA 3D65E 4JMYA 3F9HA 1H1BA 4TYDA 1TA6A 1BA8B 4MTBA 4Y10E 2JKHA 3GCHC 1IHSH 2BD9A 1NFXA 3SU6A 5FXLA 3MH7A 3MNSA 2QAAA 1GJBB 1BTPA 4X8UH 1ELGA 1HDTH 4Y11E 2GCHF 5A8XA 3I29A 4ABJA 3F9FA 1T8MA 3A83A 1W7XH 1FN8A 2BD4A 2FS9A 4X6OA 4X1RU 4ZH8A 1Y8TA 1O3NA 2GTBA 1O3CA 1D6RA 1C1QA 5GXPA 1N8OB 3C27B 3SNDA 5DP3A 1C1SA 1CT4E 4X2XA 4ZAEA 2VIOA 1FONA 1DSTA 4ZKSU 4FUCA 1A46H 3PTNA 4YT7H 1AB9C 1XMNB 1M9UA 2F9PA 4NA7A 1HGTH 6ESTA 2QF0A 2V35A 3UQOA 1GDNA 2EA3A 1EJMA 1GL0E 5JB8S 1SGFG 1EZXC 1O30A 2GV6A 1ID5H 1DWCH 4RKOB 1KXAA 4JK6A 2FOGA 1T7CA 1WSSH 1O37A 1SB1H 3ZZ5A