3TITA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg81
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SARS coronavirus main protease
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
source organism Sars coronavirus
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3titA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA02
2JH6D 3T5FH 3NXPA 1TNJA 4IMQA 1BDAA 1SGIB 1NZQH 1HJ9A 1LHGH 1YLDA 1G30B 2A5KA 4F49A 1SGFG 4OS6A 2BDBA 1VCQA 4IC5A 1DOJA 5DPAA 5F8TA 4A1TA 1P06A 1RJXB 1ZMNA 1HB0B 2ZKSA 2NWNA 3RXLA 3EBNA 3AVZA 2PKAB 3KNXA 3O8DA 4GVUA 3DD2H 2D8WA 1F5KU 5A0AE 1YPKH 1GG6B 3TNTA 2AGEX 1ANCA 1BTZA 3A8BA 3KCGH 1SC8U 3VB4A 1OS8A 1SGTA 3FP6E 2Z3CA 1SG8B 1MTUA 3LOXA 1OWDA 3TU7H 1Y3VA 4DJZB 2O9QA 1P9UA 1UVUH 1BZXE 4Y6DA 1RTKA 1EOJA 1SFQB 5GPIB 4XE4A 1GHBG 1ID5H 1NY22 1F7ZA 1LCYA 1G9IE 5AFYH 3TPIZ 5ESBA 1MUEB 1MTNC 1GJBB 2A4GA 3GYLB 3L6PA 4NIWA 1C5YB 4CRCA 5LPFA 1P05A 1GVZA 5F03A 2AMDA 4E7RG 1H8DH 3M61U 1KDQA 1QJ7B 4FXGH 1SLVB 4FUDA 1P3EA 2NU4E 5A0BA 4YT7H 2YNAA 1UTOA 2P95A 4K60A 4K2YA 1BTXA 1C1NA 1O5AB 3SBKA 4DY7B 3RXRA 3A7ZA 3M5LA 1HLTH 1MMJN 1K21H 4BXSA 1TOCB 1Z8GA 1DSTA 2F9VA 3SJKA 1C1WH 3QGNB 1SHYA 2H9HA 1L0ZA 2ZFSA 5EPNA 1BJUA 1TMTH 2EA3A 3RC4A 1QFKH 1YGCH 3TJNA 1XUJA 3SNBA 2PSYA 3ATKA 3GY5A 1VITH 4JZ1A 2FI3E 3U1IB 3QK1A 4ABBA 4FUBA 2AFQB 1WYKA 1THPB 2G4UA 4ISOA 4IGDA 1HGTH 1XUFA 3ATIA 2FYQA 3SI3H 2W5EA 1SR5C 1GHZA 2ZEBA 3GCHB 2EI6A 1C1OA 2AEIH 5AF9H 1V2PT 2G8TA 1C5MD 3KQEA 1QGFA 1AIXH 5C2ZA 3BTTE 2P59A 3PM3A 1G2MA 1RGQA 3UFAA 2BTCE 1O2TA 3W94A 3QO6A 3M7UA 2O8LA 3SV6A 1K1IA 1L1NA 1XUHA 1ZZZA 1P9SA 2R0KA 3VXFH 1RS0A 3GY4A 4K1TA 5I46H 3PYHA 1CA0C 4TWWA 1Y5UT 3M37A 4DIHH 3RLYH 3NKKA 1TQ0B 2ZU1A 3P8GA 1QL9A 2XBYA 1OXGA 3FP8E 2CXVA 2OUAA 3GCTF 5T3HA 1QJ1B 5A8ZA 2Z7FE 2ALVA 3MU4A 2OP9A 4GAWA 2F91A 5EG4A 5T6FA 1NFYA 4I8HA 4MVNA 3GY2A 5AFZH 1Q31A 4F4OC 4XBDA 5E2OA 2Y7ZA 1C2FA 1DWEH 1AB9C 1O3PB 1D9IA 1AUJA 1YCPH 5FBEA 1V2WT 1C2JA 3PMBB 2J92A 3VB7A 2VIDA 2VWLA 1IQFA 3OTJE 1A0JA 2ODPA 1GGDC 3P8OA 4H42U 4BAKB 2OC0A 1C5NH 1LQEA 1W7GH 5GXPA 3SNCA 2H5CA 2ALPA 1DICA 2PSXA 4ZKSU 1CHOG 1S85A 5HMAA 2P3TB 1GHWH 2TRMA 3RXOA 4R0IA 2CHAB 4Y8ZA 1P11E 4INLA 4CRFA 1CU1A 3URCA 3HATH 3ITIA 2ANKH 2K7XA 3TGJE 4ZMAH 4FUGA 3MU0A 5FX5A 3K6ZA 1IQGA 1S6HA 4Q7YA 1F5LA 1NRPH 6ESTA 1P2OA 2FOCA 1WOFA 3STJA 2P8OC 1CSOE 2R2MB 3SUFA 5G4BA 1A5IA 4X2WA 3NK8A 4A6LA 1UJ1A 1GBHA 1TNLA 1UK3A 1D3PB 4YLUA 2AIPA 4HI3A 1MQ6A 1LPGB 1QURH 2GMTB 4X8SH 5GDSH 1SLXB 3HPTB 1NC6A 1AMHA 3WY8A 1MU8B 3DHKH 5TJXA 3F6UH 2A45B 1AGJA 1GJ6A 1C4V2 1VJ9U 5I25A 4AYVB 1MBQA 1A0LA 3ENSB 1ZJDA 4I7YH 2O8WA 1TNGA 3RC5A 1UCYH 1DUAA 1GI3A 1K22H 4OS1A 1AKSA 3I29A 4AGKA 1SI5H 1Y5AT 3SU1A 1O3DA 1AI8H 4LOYH 2SNWA 4WJG2 1OWIA 3M7QA 1MD8A 3ZVAA 1GWAA 2EI7A 2XC4A 1Y5BT 4ZAEA 1C2DA 2J9NA 1GJ9B 1KYNA 1QA7A 2ZU2A 3OSYA 1LDTT 3A7YA 1GJDB 2OC7A 2ZDKA 3VEQB 3W95A 1WCZA 1OPHB 1Z71A 3MFJA 2GDEH 2ZDAH 3ODFA 1P12E 1TBRH 2W3KA 4FU9A 3GOVB 1TWXB 1QHRB 3KF2A 2TGAA 1LO6A 3AAUA 1ZPBA 3MNXA 2FZZA 4ZUHA 2A32A 1OWJA 3E6PH 3RXSA 2FOEA 2FTLE 2I6SA 2C3SA 3VXEH 3SU6A 5E0JA 1C5QA 4AB8A 1V2LT 2F9UA 3O8BA 4BTTB 1SGCA 4X1QU 2GCHF 1LKBA 1O3CA 1D4PB 3PWCA 1DWBH 4JYVH 2EEKA 3C1KA 5L2ZH 2Y5HA 1RTFB 2GP9B 1YP9A 5A09A 1TGCA 1HAXB 1OYTH 1V2TT 1KSNA 3BTKE 3LJJA 2D1JA 2XWBI 1AE8H 1C2MA 2V3HH 4JYTA 2DE9A 4OGYA 1K1JA 2H9TH 6LPRA 1AN1E 3P8FA 1BRAA 1Z8RA 1K2I1 3PWBA 4YOIA 4UD9H 3S9CA 5H4IB 2BD7A 3BG4C 4NWLA 1GBJA 2QF0A 3MH4A 5GJ4B 1P8VC 3FFGA 1O2LA 3FZDA 3TH4H 1EAIA 5K7RA 1P2MA 1XKBC 2FO9A 1HAVB 2ZHQH 3SV7A 1UTQA 1UHBA 3A81A 2ZDLA 4YLQH 2C4FH 4CRAA 4WXIA 1EB1H 1K28D 2ZGHA 1A3EH 4AN7A 3TNSA 1QL7A 2QA9E 3MNBA 4M7GA 4X1PU 5HM2A 1CGJE 5PTPA 1MZDA 1N1LA 1FPCH 1FQ3A 3I78A 1ZSJA 4NA9H 5DP7A 3TGKE 1TFXA 2G5NA 2ZC9H 2ZFPH 3ZZ8A 3Q3YA 3BTME 3K9XB 1GJ8B 5TCCA 1T8LA 5LH8A 1Q3XA 2ZCLP 1C5TA 4XFQA 2Y80A 1SGNE 3E90B 1TMBH 1YM0A 1DSUA 1MCVA 4Y11E 3PLBA 2UWPA 1O34A 1LTOA 1QRZA 5JBCS 1BRBE 4ABDA 2RDLA 1W8BH 2FM2A 3MHWU 4YOJA 3RXHA 3RXKA 3RXFA 3GISB 4X2YA 1TPOA 2VINA 1GBAA 1VJAU 3NUMA 2OBQA 2ANWA 2ZF0H 3TJUA 2QC2A 1GJAB 1DANH 3ZZAA 1EAWA 2VB0A 2VVUA 1O2GH 1N6YA 1SFIA 4X1SU 1CA0B 3PLKA 2D26C 5CMXH 3SV2H 3QTOH 4IN2A 2XBWA 5FPYA 1PQ5A 2FEQH 4AFQA 4UFFH 4JCNA 2WPMS 2AGGX 3SNEA 4BANB 4JMYA 2ZNKH 1VCPA 3MI4A 2ZGCA 2Y6TA 1RIWC 3B8JA 1GI4A 3M3VA 3BTWE 1W13U 4LXBH 2H2ZA 3MU1A 2XTTB 1Z8IB 1LHFH 2OLGA 2VH0A 4TPYA 1C5VA 1GMHG 2GT8A 1OOKB 3A8AA 3U8TH 4GSOA 4AG2A 4AFUA 1GBMA 3M36A 1V2KT 2ZG0H 2A7HA 4UONA 2B8OH 3MH5A 3BF6H 1HIAA 3G01A 2ZDNA 3RC6A 4KELA 1AB9B 2HLCA 2GZ9A 1EQ9A 2Q6DA 2BVSH 2G52A 3OY6U 1AFQC 1K1LA 5DP9A 3HK6B 4MDSA 4RN6A 5ETXA 1QJ6B 1C2GA 1GGDB 3ZZ3A 5SGAE 2ODQA 3JZ2B 1O5GH 1ZMLA 2ANMH 1BRUP 2J34A 3M5MA 2QN5T 2TBSA 2F9BH 5DP8A 1TAWA 3H7OA 1P2QA 3A80A 5EW1H 1C1PA 4TPIZ 3KQDA 2PUQH 3ATMA 3IITA 3PO1B 4A1VA 3GDSA 4OGXA 1H1BA 3UR6A 1TYNA 3RMOH 5CE1A 3TK9A 3QX5H 2BDCA 4FVBA 2ZZUH 3SV8A 2WPIS 2H6MA 1O30A 1FMGA 1S6FA 1O2KA 1O2HA 1SPJA 1H9HE 2O8MA 1EP5A 8KME2 5DO4H 2FI4E 1O2UA 2BQ7B 4DIIH 5EOKA 1MU6B 1WTHD 2FESH 4X1RU 4D7FA 2BXUH 1RTLA 1C5OH 1O2MA 3EQ0H 4CBOA 2ZFQH 3TJVA 3ELAH 5BRRE 1QR3E 4U32A 5E2PA 2QY0B 1YBWA 4Y71A 1ANEA 5JBBS 4NFEA 1NFXA 4ZHMU 3SO3A 3SQHE 1E38B 4GHTA 1ZTLA 2V0BA 1V3XA 1C2EA 3SJIA 2NU0E 3UTUH 1MAXA 1ETSH 1S83A 1BTYA 1ELVA 1ELGA 1S0QA 1TRYA 2B5TB 8GCHG 4AFSA 1KTSB 4NZQA 4WMEA 3GDUA 3VFEA 1IHSH 3A8DA 1DVAH 5HM9A 3GCNA 1ACBE 1BTPA 2A0QB 2WPJS 3RXIA 1EPTA 4ZHLU 2BD4A 2BY9X 1MAYA 1AWFH 2ZGJA 3A7XA 1AY6H 1O3BA 3BIUH 1T8OA 1HIAB 1A2CH 2XCFA 4CHAC 1SB1H 1BCUH 1YPGH 1BOQA 1OKXA 1O2YA 2FOMB 1CBWC 3JZ1B 2ZQ2A 1TX6A 1UTLM 1ZHPA 4U01A 4Y79A 5C67A 1AVXA 2F9PA 1EXFA 3P70B 1TA6A 3NWUA 3LGIA 1J17T 1A5GH 4INHA 2F9OA 4KTSA 3L3TA 2ZHEH 4X8VH 5J4SA 1G3CA 1FNIA 3SV9A 4UFDH 3OX7U 3LGVA 4ZKRU 1YCPM 3AW0A 1O37A 7GCHG 1LKAA 3KEEA 1K1NA 2R3UA 3LPRA 4MTBA 4WF8A 2B0FA 1YPHC 2ZTZA 3UR9A 4MNWA 1MTWA 2QAAA 5FX6A 3TGIE 3VB3A 4Y10E 1K1PA 2AERH 1D3QB 2Z9JA 2JH0D 1DXWA 1BMMH 2GVFA 1O0DH 2G4TA 1OX1A 5C5NA 1H9IE 1TONA 2UWLA 1Q2WA 1J8AA 3SGQE 1FIZA 3T62A 4GPGA 1TA2A 2BQ6B 1WU1A 3A83A 4WXVA 3BN9A 1D6RA 2KAIA 2BMGB 4ISIH 4Z6AH 2STBE 1G3EA 2BY7X 2V35A 1IQMA 2BOKA 4Y76A 1T8MA 1ORFA 2P16A 1DY9A 3BTEE 2G5VA 3BG4B 5FXLA 1O3EA 1Y3WA 3ZZCA 1JRSA 1TMUH 4MLFB 3EGKH 1V2NT 2GDDA 1QIXB 2BZ6H 1O2RA 2A4RA 3TITA 2PHBA 2CN0H 1O3GA 1S82A 1TNIA 2ZCHP 1ELAA 4WY3A 1O2SA 2V3OH 2IPHA 1P3CA 4IW4E 2BY8X 3ATLA 2A4QA 2OTVA 3SJ9A 3BIVH 4IN1A 3V13A 4X8UH 1B0FA 1FAKH 1P2IA 2NU2E 4K69A 1V2VT 1AZ8A 4HGCA 4OS4A 4X6MA 3VGCB 1TE0A 1BMNH 1LVOA 3T28A 3A7WA 4RSPA 1WQVH 1DWDH 4X6PA 4KP0A 5GWZA 1C5XB 3MU5A 1CHGA 4UFEH 3PTBA 4FU8A 1E34B 2LIZA 1BTUA 1GHVH 2PKSB 4NGAH 3KHVA 3IG6B 4TYDA 4O9VA 1QB6A 1QRXA 2Z94A 3ATWA 1A0HB 1EUFA 1DLEA 3SW2B 3UNSA 2W7UA 4MPVA 4AORA 4IMZA 2AH4X 5AVDA 3U9AH 5DG6A 1QB1A 5DP4A 1MBMA 2A7JA 3QN7A 1SLWB 4J2YB 3LKWA 4H4FA 3B9FH 2QXIA 4OS7A 1KXBA 3M35A 2FOGA 3HKJB 1L4ZA 3ZYDA 4PROA 1VGCB 2RA3A 5EXNA 1MZAA 1RIWB 2KAIB 2STAE 4NCYA 4FUFA 1PPCE 1CVWH 3Q3XA 3EDXB 3RXBA 1UK4A 2Z9KA 4OS2A 2VGCC 3LU9B 4DW2U 3UUZA 3UREA 3BSQA 2BLOA 1O3AA 3E91A 2BQWB 4TY7A 2ASUB 2VNTA 1FXYA 4LK4A 2IJOB 1XVMA 5C3NA 4B2BA 1ZOMA 1P09A 1N6XA 1P04A 1O2OA 1KDQB 4I31A 1QRWA 2QGRA 2RG3A 4D9QA 1AFQB 4TWYA 2HWLB 1N8OC 3RDZA 3ZVDA 1JMOH 2SGAA 1HAOH 3TIUA 9ESTA 1EX3A 8LPRA 1FZZA 1CE5A 2GV6A 1BHXF 5HGGA 2C90B 4BAHB 3SNDA 3EA7A 2P94A 4A1XA 5L30H 3S7HB 1WQSA 3LJOA 3RXJA 1NROH 1C5WB 4VGCC 1ARBA 3F9HA 2W7SA 1BTHH 2GV7A 7LPRA 4MNYA 1A7SA 4B73A 1AD8H 3BEFB 3GCTG 4BOHA 1QBNA 1ZPZA 4KTUA 3F1SB 1Z1IA 2TGPZ 2AS9A 1D3DB 5EODA 1WSSH 1ELCA 1SL3A 3SU5A 2VJ1A 1UK2A 2R0LA 1O2ZA 1ZRBA 1H9LB 2PGQB 5C5OA 3T29A 1XUIA 1TBZH 1XUKA 3ESTA 1BUIA 2A7CA 4Q7XA 2CJIA 2R3YA 1NRRH 1MQ5A 2J4IA 1PPEE 1BITA 3SU3A 1C1QA 1SMFE 1BIOA 3RXPA 4ISNA 1O3IA 2BDYA 1JWTA 1FI8A 4XOJA 2OQUA 3PROA 5C1XA 4TY6A 1VITF 1G3BA 4O3UA 1THRH 2ESTE 2GX4A 2XXLA 3FAOA 3SOSA 3ZZ6A 4I33A 3FVFB 4R8TB 1V2QT 2B9LA 2B7DH 3D23A 3SU4A 8ESTE 1SGEE 1ELEE 4XSKU 4CRDA 2XC0A 1TNKA 1CT0E 1OWHA 2SFAA 1E37B 2PW8H 4O97A 2WPHS 2Y7XA 2BD9A 1YYY1 1K1MA 2FP7B 2ZDMA 3SNAA 1C5UA 3QUMP 3ZZ4A 4E06H 1JXPA 1JIRA 2ZU5A 1ESAA 4DGJA 4I8LA 1S0RA 1SOTA 3HK3B 2WV5A 1C5LH 1KXEA 2TGDA 1MCTA 4YO9A 1XXFA 9LPRA 1A3BH 2I6QA 1ESBA 3QZQA 2SGEE 5DKMA 6GCHF 1CGIE 2J94A 1KXAA 2FMJA 1BB0B 2UUYA 1TNHA 3MO9A 1ELFA 1ZSLA 1KXCA 1UTPA 3D65E 2FDAA 1LHDH 5EQRA 5EXLA 1VCWA 1JRTA 1XMNB 2DE8A 1ZPCA 2VH6A 2ZHFH 1PQ8A 5FPSA 2GZ7A 5FCKA 4E7NA 5AHGH 1UVPA 3SJ8A 3ODDA 4U30A 1GJ7B 1HAIH 2RCEA 1ZHMA 1LPKB 1FUJA 1XXDA 4H6TA 5B6OA 4NZLA 3SUGA 2CF9H 1QA0A 1HUTH 1GVKB 5CHAC 2Z9LA 1G36A 1ETRH 1LMWB 1RXPA 1SGDE 4JZDH 3N7OA 5A8XA 3U98H 4CH8B 4RKJB 4K1SA 3A7TA 1MTNB 1QBVH 2BB4A 5EU8A 1H8IH 3RXAA 1ZR0A 1NU9A 1W11U 1HYLA 2ZTYA 2J2UA 3K65B 4WWYA 1SGQE 3KGPA 1SHHB 2NU3E 2FYRA 1GHYH 4OS5A 4WVPE 4FUCA 3AAVA 2GCHG 2FI5E 1DLKB 1HAPH 4O03A 2H9EH 3T2NA 1P01A 1HV7A 2BDIA 4Q7ZA 4B76A 4RKOB 3KL6A 1INCA 1EZXC 1PYTC 4B2CA 4DURA 1AKSB 1QB9A 1ZRKA 1GG6C 5HXFA 2QV1A 3TH2H 2HALA 4ABAA 2Y81A 1EPTC 2PTCE 3RXEA 3HKIB 4IC6A 1JIMA 1GL0E 3A86A 3PV4A 4JYUH 1FIWA 3L33A 2ZECA 1FAXA 3GYMA 5LPEA 1KY9A 4HZHA 1GBBA 1C2KA 1GI5A 5C1UA 1EKBB 1SOZA 5GCHF 1T4VH 1THSH 1TGNA 3AASA 1OP8A 3E8LA 4GCHF 1A5HA 2BD5A 1F0RA 1GI0A 1CT4E 1TGSZ 1O2QA 1P57B 1ZHRA 6CHAC 4NIYA 2AGIX 1J14A 1FN8A 1F0UA 1FLEE 1GMDF 1O3KA 3SU2A 2HVXA 1TPPA 1MTSA 1ZJKA 2FODA 3GY7A 1E0FD 1HRTH 3KIDU 4ZROA 1QTFA 1IQIA 1WBGB 3VB5A 3ZVGA 1Y59T 5EXMA 2VGCB 4CR9A 1QBOA 3R3GB 4XDEA 1SLUB 1BQYA 4U2WA 2ZCKP 1ELTA 3RLWH 5JYIA 1S5SA 1C9PA 3LC3A 3ZZDA 3RXVA 2ZHDA 1H4WA 1PPGE 3RXDA 2R9PA 1BTWA 1E35B 3I77A 1GI2A 1N8OB 1O3HA 3ZV9A 1GBIA 1FN6A 3BEUA 1TGTA 3Q00A 1SGYE 2BD8A 4UDWH 3V0XA 2TPIZ 3QZRA 4B74A 3BG8A 1GMCF 1SGPE 3RMMH 3RMLH 1O3FA 2GZ8A 1LHEH 2HNTC 3E0PB 4Y0ZE 1J9CH 2VVVA 4UFGH 1O2JA 1UHBB 1Y3UA 2SNVA 2C8XB 2ANYA 1HFDA 1YCPK 2VIOA 1Y3YA 1G32B 2CGAA 1YPHE 1LVYA 2FOHA 3FP7E 1EJNA 3E0NB 1Z7KA 2Z3DA 3M5OA 2XBVA 1GMCG 1TB6H 4ZKOU 5A2MH 1K1OA 2ODYB 1C5SA 2EI8A 2PFEA 4BAOB 1HAHH 1O5DH 1SQAA 1XVOA 2ZGBH 1W10U 3E3TA 5JBTA 3BTHE 3TLOA 3D49H 3RXMA 5L2YH 4SGAE 2W26A 2DUCA 2AMPA 2ZFTA 4ABHA 1X7AC 1J15A 1MKXK 4LZ4B 1DXPA 3BTGE 4K1EA 1KXDA 3EA9A 4E05H 1L1JA 3RM2H 2BLVA 2GCTC 3S9AA 1OSSA 1VR1H 2P8OB 1QCPA 2QF3A 1PPZA 1GHAF 4ABEA 3SI4H 3GICB 3MOCA 5E8EH 3ZVEA 4AB9A 4DT7B 2PTNA 3P92A 3UWJH 3TK6A 3PB1E 2XCNA 3GY6A 2ZPQA 1EZUC 1GJCB 2BDAA 1O3LA 1YPJH 2FOAA 1D3TB 2OC1A 1P2NA 7ESTE 3MMGA 1DWCH 2OC8A 1DE7H 3SGAE 1L2EA 2BDHA 4KTCA 2Y82A 1G2LA 4QT8C 4ABIA 3RMNH 1DPOA 2G55A 4X2XA 2UUJB 2G51A 4I8JA 5E0HA 1ANBA 2VVCA 4A92A 3K2UA 1C5PA 2XWAA 3UNQA 3QGJA 1TLDA 1LVBA 4BNRA 2ZFFH 1DY8A 3LGWA 1ZSKA 4INKA 1C2IA 3LIWA 2FX6A 1T7CA 4Y8XA 3P95A 3O8CA 4WH8A 2LPRA 2XC5A 1HDTH 1W0ZU 4I8GA 5F6MA 2UUKB 1O5EH 1V2RT 2GMTC 3PMAB 3ZVFA 1P2JA 3ZYEA 1CT2E 4YTAA 2K1QA 4FUHA 2HGTH 3GY3A 3UY9A 3TVJB 1FY8E 2JETC 1NO9H 1SGRE 2WINI 3C27B 5EQSA 2ZDVH 3A82A 1GI6A 1PQ7A 1BHXB 1FY1A 3BEIB 4Q2KA 5JDUB 1IHTH 1O2VA 1E36B 3B23B 2VIWA 5A0CA 2XRCA 2VIPA 3HGNA 1UTMA 3SHAH 3SUDA 4DG4A 4NIVA 4B71A 1S81A 4MPWA 1PPHE 4CREA 2BD2A 4MPUA 2Y5GA 1C1TA 4YT6H 5FBIA 1O2NA 5DGJA 3S9BA 3OY5U 1Z6JH 1KLJH 2BLQA 4LZ1H 1QL8A 1GHBF 2FPZA 5K0HA 1YPEH 4X6OA 2PUXB 3ZV8A 3DFLA 4AYYB 3T25A 1V2MT 1AVWA 4AZ2B 2SGPE 2A1DB 3RU4T 2BD3A 1GBLA 2VU8E 1EPTB 2BHGA 2VIVA 4YOGA 1F0SA 1PPFE 1TABE 1GBTA 1B7XB 3MO3A 4GUXA 3IWMA 5T6GA 3PTNA 2BX3A 2QCYA 2XBXA 1O31A 3GDVA 3Q3KA 4NA8A 1NN6A 3FZZA 1KLIH 3KQCA 4ZH8A 4I32A 1PQAA 1NRNH 4KGAA 3M3TA 3QWCH 2QXGA 3LH1A 1ZLRA 2OXSA 1G3DA 1GDNA 1UVTH 6CHAB 1W7XH 3V12A 4BAQB 1PPBH 3ZZ7A 4Y7AA 3TJOA 1DT2A 1ABJH 2BVXH 4XBBA 4YZUA 3P8NA 1SBWA 1T4UH 1WAYB 3MO6A 1NS3A 2IOTA 4X6NA 1BBRE 2JKHA 1C1MA 2R2WU 3LGYA 1NFUA 3MNSA 3O8RA 2AYWA 2ZHWH 4HFPB 1D6WA 1IOEA 5LGOA 1C1VH 1O33A 4JZEH 1HCGA 2GGVB 5JB8S 1LPZB 1V2OT 4ESTE 4A7IB 1NRQH 3UOPA 2F83A 3KQBA 3SQEE 2Q6FA 1QQUA 1ARCA 4NSYA 4SGBE 3SORA 5T6DA 1UTNA 1IAUA 2GT7A 3TK5A 4THNH 3V7TA 2NU1E 1HXEH 1UO6A 3MTYA 4Y0YE 1AE5A 1W0YH 1GBKA 1FJSA 1ANDA 1MH0A 1UTJA 1O32A 1C9TA 2C8ZB 2P3FH 1MKWK 1M9UA 1C5ZB 1AZZA 1O5FH 5A8YA 1FY3A 3SN8A 4J1YA 5C1YA 4BTUB 1YC0A 5FCRA 1CA8B 1Z8JB 4NSVA 2QXHA 5E0GA 5IDKA 4MNVA 5BPEA 2BVRH 2Q1JA 3SJOA 3SUEA 3VB6A 3U69H 2OBOA 4D76A 2GCTB 1NPMA 3RXGA 4ISLA 1FV9A 4AFZA 4XBCA 2FTMA 2ZP0H 4Y8YA 1ZGVA 2G00A 1W14U 3LC5A 3MYWA 4AG1A 1CHOF 1DFPA 1FY4A 1IQKA 1LVMA 1TQ7B 4ISHH 4ABGA 3F68H 1AWHB 1A4WH 2V6NA 3A87A 2WPKS 1GVLA 2TGTA 1CGHA 4Q80A 3ZZ9A 1HXFH 5DP3A 1KIGH 2C93B 3EYDA 1YPLH 2A5IA 1KTTB 2QYIA 1Y3XA 3QLPH 3PO1C 2WYJA 1YF4A 2WPLS 1MKXH 2J95A 1BBRK 3DFJA 1EB2A 1AVGH 4MNXA 1RFNA 3PLPA 4X1NU 4WMDA 4HTCH 4FVDA 1O3OA 5L6NH 4ZXXH 1ABIH 1O3NA 1AFEH 2O8UA 3RU4E 1HJAC 4UE7H 1OP0A 1GCTC 4B2AA 3BV9B 1O2PA 5DP5A 5DP6A 4CHAB 1BA8B 1UTKA 1EOLA 2HPQH 2XNIA 3U8RH 3U1JB 1CBWB 1VITG 1ZMJA 5F8ZA 1GCDA 3RXQA 1NTPA 4JK5A 2FS8A 1OYQA 4D7GA 2GD4B 1V2JT 1NFWA 2CV3A 2WUCA 2EC9H 1P03A 4WMFA 3BTDE 1GHXH 2VIQA 2Y5FA 1FDPA 4Y7BA 1NU7B 1GI9B 1ELDE 1ZGIA 3K6YA 3URDA 1IQJA 1LHCH 1ESTA 2BZAA 3PMHB 5EGMA 1B0EA 1BRCE 4KKDA 2LNCA 2JETB 1DX5M 3QDZB 1O2XA 2ZI2H 3DUXH 4X0WU 1EAUA 1EASA 1HAVA 3LGUA 5FPTA 6GCHG 3CP7A 3BTQE 1V6DA 2OD3B 3S69A 1XX9A 2FX4A 2PLXA 1FPHH 2A2QH 1QY6A 1O36A 1SVPA 2TIOA 4DOQA 2HNTF 1MTVA 4H6SB 5LPRA 2H1UA 1V2ST 2A5AA 3A88A 3LONA 1O2WA 1C4U2 2ZA5A 5FHTA 1C4Y2 4NIXA 1HAZB 2ULLA 3RM0H 4K8YA 1ELBA 1UMAH 3NPSA 2UWOA 4ZXYH 1P10A 2XW9A 3P17H 1AO5A 1EATA 2HPPH 1NRSH 4AGJA 1LQDB 5EPYA 2O8TA 3UPEA 2HNTE 1T31A 1J16A 2THFB 2FOFA 4ZKNU 3LT3A 1TX8A 1XM1A 3S0NA 2WV4A 2BY5X 2SGDE 2WUBA 3CENA 1O35A 1TPAE 2FLRH 1SGFA 1V2UT 1AHTH 2Z6BD 3H7TA 5ABWA 3HGPA 3SHCH 3E16B 1WV7H 4D9RA 5GIBA 1C1SA 2BX4A 4GLYA 2GKVE 2J38A 4B1TA 3TH3H 4Z0KA 1IQLA 2YNBA 4MQAA 5TCAA 3A84A 4MG3A 2A4OA 1VZQH 1W12U 4ZHAA 5C20A 1O3JA 3M5NA 1GBCA 1WTGH 2F9NA 3NZIA 1WUNH 3M7TA 3H5CB 2ZU4A 1HAYB 4FU7A 1OWKA 2OQ5A 2BYAX 1G37A 2ZO3H 1GJ5H 1HJ8A 2HOBA 3U8OH 1Y8TA 1C1UH 1SQOA 1FONA 4MPXA 3F9FA 1TPSA 1T8NA 1C1RA 2M5TA 3UWIA 4BXWA 3RUOA 1A46H 1F2SE 1AU8A 1Z1JA 3MH7A 3E1XB 3MWIU 1CQQA 1PYTD 1SSXA 7KMEH 3SGBE 3VGCC 2IN2A 2QXJA 4D8NA 2UUFB 2FOBA 2ZPSA 4WH6A 5GCHG 1CO7E 2ZGXH 2SGFE 2YOLA 3RU4D 4JZIA 2PGBB 2G81E 1OP2A 4NFFA 1JOUB 2OCVB 2FS9A 4GCHG 3UIRA 1QNJA 1U6QA 1QQ4A 4AOQA 1HAGE 1BT7A 3FANA 4K3JA 1EJAA 1UCYE 2PKSC 1W2KH 3A89A 4IS5A 1GMDG 1GJ4H 1OWEA 2ILNA 2PR3A 5EW2H 1O39A 3UNRA 3S7KB 2ZWLH 1UVSH 1TGBA 2BXTH 2GTBA 3GCHC 3OYPA 2XYAA 3F9GA 1YPMH 2P93A 2WYGA 1EP6A 2JH5D 1GMHF 1GI1A 1Z6EA 2AMQA 3SZNA 3ZZBA 4I8KA 1EZSC 2VWMA 1XUGA 1L1GA 2BDGA 3OU0A 1VGCC 3DA9B 2ZTXA 4VGCB 1F5RA 4B75A 1JBUH 1AQ7A 3UQVA 3Q76A 4CR5A 3ZZ5A 1B5GH 2PV9B 4IBLH 2BLWA 3NCLA 2W3IA 2ZIQH 4A5TS 1GL1A 1DS2E 4K5ZA 3EE0B 1AUTC 1BMAA 3T26A 1BJVA 1A1RA 2CF8H 1GPZA 1F92A 1MD7A 2HRVA 4ASHA 3QTVH 2BY6X 1HPGA 3Q77A 1TRMA 4CBNA 3RXCA 1BMLA 3LGTA 3A8CA 3A85A 2ZFRH 4YESB 2VWNA 1O38A 3VPKA 1MKWH 3PMJA 4BAMB 2ZU3A 4JZFH 2F3CE 2Q6GA 4UEHH 4NWKA 5HYOA 5J4QA 1P2KA 1C5RA 1HNEE 2ZQ1A 4BTIB 1O2IA 4FUJA 1TBQH 4FUEA 3ZVBA 4NG9H 3V3MA 1NM6A 2QIQA 2A31A 3RP2A 4CH2B 1O3MA 5JB9S 1S84A 1SQTA 3MU8A 1P02A 2BOHB 1HJAB 1GCTB 2CMYA 2Z9IA 1TX7A 3BTFE 2FLBH 1O5BB 1GI7B 1TALA 1TRNA 4ABJA 1KLTA 2PWXA 3RXUA 2PKAA 1L4DA 1GHAG 8GCHF 3GY8A 1NT1A 2AIQA 1GBDA 1EAXA 3EA8A 1C2LA 1NESE 2FXRA 1UCYK 3GCOA 4JK6A 2CHAC 3M3SA 1W3CA 2A2XH 1IQEA 1XKAC 1RRKA 2C8YB 4X2VA 3UOUA 1GDUA 1FY5A 1DUEA 1F0TA 1GI8B 3UQOA 4CRGA 1KXFA 3T27A 4DCDA 3RXTA 5ESTE 2Z9GA 1ETTH 3CS0A 4ABFA 3ZVCA 1A61H 1DITH 2SGQE 1GBFA 1BBRH 2C8WB 4GHQA 4NA7A 3SU0A 2Z3EA 1TIOA 1EJMA 3LDXH 5DK1A 3DT0H 5EQQA 2ZPRA 1YKTA 4YM9A 1RD3B 2FIRH 4FUIA 4DVAU 3D62A 1TOMH 2FWWA 3MH6A 2VWOA 1HBTH 1DDJA 5IYTA 1UVOA 3KN2A 3A7VA 1C2HA 4O3TA 1GBEA 3F9EA 3R0FA 4K8BA 1GDQA 1YLCA 3MNCA 7GCHF 4AX9H 2BM2A 3EAJA 5FAHA 1DM4B 3AW1A 3CS7A 1P0SH 2H5DA 5JPMH 3LH3A 5CHAB 1ZTJA 1T32A 1ZYOA 3P6ZB 5F8XA 2D2DA 1PJPA 1EZQA 1PFXC 2RA0A 1ZTKA 2OINA 2P3UB 4CRBA 1K9OE 1IQHA 1IQNA 4X8TH 5DJ7A 5JBAS 1O5CB 3STIA
chains in the Genus database with same CATH superfamily
2JH6D 3T5FH 3NXPA 1TNJA 4IMQA 1BDAA 1SGIB 1NZQH 1HJ9A 1LHGH 1YLDA 1G30B 2A5KA 4F49A 1SGFG 4OS6A 2BDBA 2XOKD 1VCQA 4IC5A 1DOJA 5DPAA 5F8TA 4A1TA 1P06A 1RJXB 3MQKC 1ZMNA 1HB0B 2ZKSA 2NWNA 3RXLA 3EBNA 3AVZA 2PKAB 3KNXA 3O8DA 4GVUA 3DD2H 2D8WA 1F5KU 5A0AE 1YPKH 1GG6B 3TNTA 2AGEX 1ANCA 1BTZA 3A8BA 3KCGH 1SC8U 3VB4A 1OS8A 1SGTA 2WV9A 3FP6E 2Z3CA 1SG8B 1MTUA 3LOXA 1OWDA 3TU7H 1Y3VA 4DJZB 2O9QA 1P9UA 2K8IA 1UVUH 1BZXE 4Y6DA 1RTKA 1EOJA 1SFQB 5GPIB 4XE4A 1GHBG 1ID5H 1NY22 1F7ZA 1LCYA 1G9IE 5AFYH 3TPIZ 5ESBA 1MUEB 1MTNC 1GJBB 2A4GA 3GYLB 3L6PA 4NIWA 1C5YB 4CRCA 5LPFA 1P05A 1GVZA 4I86A 2AMDA 5F03A 4E7RG 1H8DH 3M61U 1KDQA 1QJ7B 4FXGH 1SLVB 4FUDA 1P3EA 2NU4E 5A0BA 4YT7H 2YNAA 1UTOA 2P95A 4K60A 4K2YA 1BTXA 1C1NA 1O5AB 3SBKA 4AC9A 4DY7B 3RXRA 2KCPA 3A7ZA 3M5LA 1HLTH 1MMJN 1K21H 4BXSA 4XD7D 1TOCB 1Z8GA 1DSTA 2F9VA 3SJKA 1C1WH 3QGNB 1SHYA 2H9HA 1L0ZA 2ZFSA 5EPNA 1BJUA 1TMTH 2EA3A 3RC4A 1QFKH 1YGCH 3TJNA 1XUJA 3SNBA 2PSYA 3ATKA 3GY5A 1VITH 4JZ1A 2FI3E 3U1IB 3QK1A 2WHXA 4ABBA 4FUBA 2AFQB 1WYKA 1THPB 2G4UA 4ISOA 4IGDA 1HGTH 4HG6A 1XUFA 3ATIA 2FYQA 3SI3H 2W5EA 1SR5C 3UB0A 1GHZA 2ZEBA 3GCHB 2EI6A 1C1OA 2AEIH 5AF9H 1V2PT 2G8TA 2YMSD 1C5MD 3KQEA 1QGFA 1AIXH 5C2ZA 3BTTE 2P59A 3PM3A 1G2MA 1RGQA 3UFAA 2BTCE 1O2TA 3W94A 5GNDA 3QO6A 3M7UA 2O8LA 2V7QD 1UW7A 3SV6A 1K1IA 1L1NA 1XUHA 1ZZZA 1P9SA 2R0KA 3VXFH 3U28C 1RS0A 3GY4A 4K1TA 5I46H 3PYHA 1CA0C 4TWWA 1Y5UT 3M37A 4DIHH 3RLYH 3NKKA 1E1QD 1TQ0B 2ZU1A 3P8GA 1QL9A 2XBYA 1OXGA 3FP8E 2CXVA 5B6LA 3ZIAD 2OUAA 3GCTF 5T3HA 1QJ1B 5A8ZA 5IK2D 1WXRA 2Z7FE 2ALVA 3MU4A 2OP9A 2IJD1 2F91A 4GAWA 5EG4A 5T6FA 1NFYA 4I8HA 4MVNA 3GY2A 5AFZH 1Q31A 4F4OC 4XBDA 5E2OA 2Y7ZA 1C2FA 1DWEH 1AB9C 1O3PB 1D9IA 1AUJA 1YCPH 5FBEA 1V2WT 1C2JA 3PMBB 2J92A 3VB7A 2VIDA 2VWLA 1IQFA 3OTJE 1A0JA 2ODPA 1GGDC 3P8OA 4H42U 4BAKB 2OC0A 1C5NH 1LQEA 1W7GH 5GXPA 3SNCA 2H5CA 2ALPA 1DICA 2PSXA 4ZKSU 1CHOG 1S85A 5HMAA 1W0JD 2P3TB 1GHWH 2TRMA 3RXOA 4R0IA 2CHAB 4Y8ZA 1P11E 4INLA 4CRFA 1CU1A 3URCA 3HATH 3ITIA 2ANKH 2K7XA 3TGJE 4ZMAH 4FUGA 3MU0A 5FX5A 3K6ZA 1IQGA 1S6HA 4Q7YA 1F5LA 1NRPH 6ESTA 1P2OA 2FOCA 1WOFA 3STJA 2P8OC 1CSOE 2R2MB 3SUFA 5G4BA 1QZ8A 1A5IA 4X2WA 3NK8A 4A6LA 1UJ1A 1GBHA 1TNLA 1UK3A 1D3PB 4YLUA 2AIPA 4HI3A 1MQ6A 1LPGB 1QURH 2GMTB 4X8SH 5GDSH 1SLXB 3HPTB 1NC6A 1AMHA 3WY8A 4TSFD 1MU8B 3DHKH 5TJXA 3F6UH 2A45B 1AGJA 1GJ6A 1C4V2 1VJ9U 5I25A 4AYVB 1MBQA 1A0LA 3ENSB 1ZJDA 4I7YH 2O8WA 2J5UA 1TNGA 3RC5A 1UCYH 1DUAA 3FOAA 1GI3A 1K22H 4OS1A 1AKSA 3I29A 4AGKA 1SI5H 1Y5AT 3SU1A 1O3DA 1AI8H 3DSGA 4LOYH 2SNWA 4WJG2 1OWIA 3M7QA 1MD8A 3ZVAA 1GWAA 2EI7A 2XC4A 1Y5BT 4ZAEA 1C2DA 2J9NA 1GJ9B 1KYNA 1QA7A 2ZU2A 3OSYA 1LDTT 3A7YA 1GJDB 2OC7A 2ZDKA 3VEQB 3W95A 1WCZA 1OPHB 1Z71A 3MFJA 2GDEH 2ZDAH 3ODFA 1P12E 1TBRH 2W3KA 4FU9A 3GOVB 1TWXB 1QHRB 2KZ4A 3KF2A 2TGAA 1LO6A 3AAUA 1ZPBA 3MNXA 2FZZA 4ZUHA 2A32A 1OWJA 3E6PH 3RXSA 2FOEA 2FTLE 5KECA 2I6SA 2C3SA 3F0OA 3VXEH 3SU6A 5E0JA 1C5QA 4AB8A 1V2LT 2F9UA 3O8BA 4BTTB 1SGCA 4X1QU 2GCHF 1LKBA 1O3CA 1D4PB 3PWCA 1DWBH 4JYVH 2EEKA 3C1KA 5L2ZH 2Y5HA 1RTFB 2GP9B 1YP9A 2QF4A 3F2GA 5A09A 1TGCA 1HAXB 1OYTH 1V2TT 1KSNA 3BTKE 3LJJA 2D1JA 2XWBI 1AE8H 1C2MA 2V3HH 4JYTA 2DE9A 4OGYA 2V3MA 1K1JA 2H9TH 6LPRA 1AN1E 3P8FA 1BRAA 1Z8RA 1K2I1 3PWBA 4YOIA 4UD9H 3S9CA 5H4IB 2BD7A 3BG4C 4NWLA 1GBJA 2QF0A 3MH4A 5GJ4B 1P8VC 3FFGA 1O2LA 3FZDA 3TH4H 1EAIA 5K7RA 1P2MA 1XKBC 2FO9A 1HAVB 2ZHQH 3SV7A 1UTQA 1UHBA 3A81A 2ZDLA 4YLQH 2C4FH 2QE7D 4RI0A 4WXIA 4CRAA 1EB1H 1K28D 2ZGHA 1A3EH 4AN7A 3TNSA 3KQ5A 1QL7A 2QA9E 3MNBA 4M7GA 4X1PU 5HM2A 1CGJE 5PTPA 1MZDA 1N1LA 1FPCH 1FQ3A 3I78A 1ZSJA 3N99A 4NA9H 3CNRA 5DP7A 3TGKE 1TFXA 2G5NA 2ZC9H 2ZFPH 5HKKD 3ZZ8A 3Q3YA 3BTME 3K9XB 1GJ8B 5TCCA 1T8LA 5LH8A 1Q3XA 2ZCLP 1C5TA 4XFQA 2Y80A 1SGNE 3E90B 1TMBH 1YM0A 1DSUA 1MCVA 4Y11E 3PLBA 2UWPA 1O34A 1LTOA 1QRZA 5JBCS 1BRBE 4ABDA 2RDLA 4FOUC 1W8BH 2FM2A 3MHWU 4YOJA 3RXHA 3RXKA 3RXFA 3GISB 4X2YA 1TPOA 2VINA 1GBAA 1VJAU 3NUMA 2OBQA 3WWBA 2ANWA 2ZF0H 3TJUA 2QC2A 1GJAB 1DANH 3ZZAA 1EAWA 2VB0A 2VVUA 1O2GH 1N6YA 1SFIA 3PRBA 4X1SU 1CA0B 3PLKA 2D26C 5CMXH 3SV2H 3QTOH 4IN2A 2XBWA 5FPYA 1PQ5A 2FEQH 4AFQA 4UFFH 4JCNA 2WPMS 2AGGX 3SNEA 4BANB 4JMYA 2ZNKH 1VCPA 3MI4A 2ZGCA 2Y6TA 1RIWC 3B8JA 1GI4A 3M3VA 3BTWE 3F3BA 1W13U 4LXBH 2H2ZA 3MU1A 2XTTB 1Z8IB 1LHFH 1H8ED 2OLGA 2VH0A 4TPYA 1C5VA 1GMHG 2GT8A 1OOKB 3A8AA 3U8TH 4GSOA 3WW7A 4AG2A 4AFUA 1GBMA 3M36A 1V2KT 2ZG0H 2A7HA 4UONA 2B8OH 3MH5A 3BF6H 1HIAA 3G01A 2ZDNA 3RC6A 4KELA 1AB9B 4OM9A 2HLCA 2GZ9A 1EQ9A 2Q6DA 2BVSH 2G52A 3OY6U 1AFQC 1K1LA 5DP9A 3HK6B 4MDSA 4RN6A 5ETXA 1QJ6B 1C2GA 1GGDB 3ZZ3A 5SGAE 2ODQA 3JZ2B 1O5GH 1ZMLA 2ANMH 1BRUP 2J34A 3M5MA 2QN5T 2TBSA 2F9BH 5DP8A 1TAWA 3H7OA 1P2QA 3A80A 5EW1H 1C1PA 4TPIZ 3KQDA 2PUQH 3ATMA 3IITA 3PO1B 4A1VA 3GDSA 4OGXA 1H1BA 3UR6A 1TYNA 3RMOH 5CE1A 3TK9A 3QX5H 2BDCA 4FVBA 2ZZUH 3SV8A 2WPIS 2H6MA 1O30A 1FMGA 1S6FA 1O2KA 1O2HA 1SPJA 1H9HE 2O8MA 1EP5A 8KME2 5DO4H 2FI4E 5FL7D 1O2UA 2BQ7B 4DIIH 5EOKA 1MU6B 1WTHD 1H8HD 2FESH 4X1RU 4D7FA 2BXUH 2WPDD 1RTLA 1C5OH 1O2MA 3EQ0H 2F4LA 4CBOA 2ZFQH 3TJVA 3ELAH 5BRRE 5KGOA 1QR3E 4U32A 5E2PA 2QY0B 1YBWA 4Y71A 1ANEA 5JBBS 4NFEA 2JJ2D 1NFXA 4ZHMU 3SO3A 3SQHE 1E38B 4GHTA 1ZTLA 2V0BA 1V3XA 1C2EA 3SJIA 2NU0E 3UTUH 1MAXA 1ETSH 1S83A 1BTYA 1ELVA 1ELGA 1S0QA 1TRYA 2B5TB 8GCHG 4AFSA 1KTSB 4NZQA 4WMEA 3GDUA 3VFEA 1IHSH 3A8DA 1DVAH 5HM9A 3GCNA 1ACBE 1BTPA 2A0QB 2WPJS 3RXIA 1EPTA 4ZHLU 2BD4A 2BY9X 1MAYA 1AWFH 2ZGJA 3A7XA 1AY6H 1O3BA 1BMFD 3BIUH 1T8OA 1HIAB 1A2CH 2XCFA 4CHAC 1SB1H 1BCUH 1YPGH 1BOQA 1OKXA 1O2YA 2FOMB 1CBWC 3FN8A 3JZ1B 2ZQ2A 1TX6A 1UTLM 1ZHPA 4U01A 4Y79A 5C67A 4P02A 1AVXA 2F9PA 1EXFA 3P70B 1TA6A 3NWUA 3LGIA 1J17T 2J98A 1A5GH 4INHA 2F9OA 4KTSA 2F43B 2KCOA 3L3TA 2IPQX 2ZHEH 3FO8D 4X8VH 5J4SA 5DSFA 1G3CA 1FNIA 3SV9A 4UFDH 3OX7U 3LGVA 4ZKRU 1YCPM 3AW0A 1O37A 7GCHG 1LKAA 3KEEA 1COWD 1K1NA 1MABB 2R3UA 2W6JD 3OAAD 3LPRA 4MTBA 4WF8A 2B0FA 1YPHC 4RT0A 2ZTZA 3UR9A 4MNWA 1MTWA 2QAAA 5FX6A 4ACBA 3TGIE 3VB3A 4Y10E 1K1PA 2AERH 1D3QB 2Z9JA 2JH0D 1DXWA 1BMMH 2GVFA 1O0DH 2G4TA 1OX1A 5C5NA 1H9IE 1TONA 2UWLA 1Q2WA 1J8AA 3SGQE 1FIZA 3T62A 4GPGA 1TA2A 2BQ6B 4RT1A 1WU1A 3A83A 3H09A 4WXVA 1SKYE 3BN9A 1D6RA 2KAIA 2BMGB 4ISIH 4Z6AH 2STBE 1G3EA 2BY7X 2V35A 1IQMA 2BOKA 4Y76A 1T8MA 1ORFA 2P16A 1DY9A 3BTEE 2G5VA 3BG4B 5FXLA 1O3EA 1Y3WA 3ZZCA 1JRSA 1TMUH 4MLFB 3EGKH 1V2NT 2GDDA 1QIXB 2BZ6H 1O2RA 2A4RA 3TITA 2PHBA 3OFND 2CN0H 1O3GA 1S82A 1TNIA 2ZCHP 1ELAA 4WY3A 1O2SA 2V3OH 2IPHA 1P3CA 4IW4E 2BY8X 3ATLA 2A4QA 2OTVA 3SJ9A 3BIVH 2LP6A 4IN1A 3V13A 4X8UH 1B0FA 1FAKH 1P2IA 2NU2E 3FKSD 4K69A 1V2VT 1AZ8A 4HGCA 2HLDD 4OS4A 4X6MA 3VGCB 1TE0A 1BMNH 1LVOA 3T28A 3A7WA 4RSPA 1WQVH 1DWDH 4X6PA 4KP0A 5GWZA 1C5XB 3MU5A 1CHGA 4UFEH 3PTBA 3W1EA 4FU8A 1E34B 2LIZA 1BTUA 1GHVH 2PKSB 4NGAH 3KHVA 3IG6B 4TYDA 4O9VA 1QB6A 1QRXA 2Z94A 3ATWA 1A0HB 1EUFA 1DLEA 4B6EA 3SW2B 3UNSA 2W7UA 4MPVA 2OK5A 4IMZA 4AORA 2AH4X 5AVDA 3U9AH 5DG6A 1QB1A 5DP4A 1MBMA 2A7JA 3QN7A 1SLWB 4J2YB 3LKWA 4H4FA 3B9FH 2QXIA 4OS7A 1KXBA 3M35A 2FOGA 3HKJB 1L4ZA 3ZYDA 4PROA 1VGCB 2RA3A 5EXNA 1MZAA 1RIWB 2KAIB 2STAE 4NCYA 4FUFA 1PPCE 1CVWH 3Q3XA 3EDXB 3RXBA 1UK4A 2Z9KA 3KYGA 4OS2A 2VGCC 3LU9B 4DW2U 3UUZA 2AHME 3BSQA 2BLOA 1O3AA 3E91A 3UREA 2BQWB 4TY7A 2ASUB 2VNTA 1FXYA 1E79D 4LK4A 2IJOB 1XVMA 5C3NA 4B2BA 1ZOMA 1P09A 1N6XA 1P04A 1O2OA 1KDQB 4I31A 1QRWA 2QGRA 2RG3A 4D9QA 1AFQB 4TWYA 2HWLB 1N8OC 3RDZA 3ZVDA 1JMOH 2SGAA 1HAOH 3TIUA 9ESTA 1EX3A 8LPRA 3F2FA 1FZZA 1CE5A 2GV6A 1BHXF 5HGGA 2C90B 4BAHB 3SNDA 1NBME 3EA7A 2P94A 4A1XA 5L30H 3S7HB 1WQSA 3LJOA 3RXJA 1NROH 4TT3D 1C5WB 4VGCC 1ARBA 3F9HA 2W7SA 1BTHH 2GV7A 7LPRA 4MNYA 1A7SA 4B73A 1AD8H 3BEFB 3GCTG 4BOHA 1QBNA 1ZPZA 4KTUA 3F1SB 1Z1IA 3EE7A 2TGPZ 2AS9A 1D3DB 5EODA 1WSSH 1ELCA 1SL3A 3SU5A 2VJ1A 1UK2A 2R0LA 1O2ZA 1ZRBA 1H9LB 2PGQB 5C5OA 3T29A 1XUIA 1TBZH 1XUKA 3ESTA 2L6OA 1BUIA 2A7CA 4Q7XA 2CJIA 2R3YA 1NRRH 1MQ5A 2J4IA 1PPEE 1BITA 3SU3A 1C1QA 1SMFE 1BIOA 3RXPA 4ISNA 1O3IA 2BDYA 1JWTA 2KM0A 1FI8A 4XOJA 2OQUA 3PROA 5C1XA 1YY3A 1VITF 4TY6A 1G3BA 4O3UA 1THRH 2ESTE 2GX4A 2XXLA 3FAOA 3SOSA 3ZZ6A 4I33A 3FVFB 4R8TB 1V2QT 2L74A 2B9LA 2B7DH 3D23A 3SU4A 8ESTE 1SGEE 1ELEE 4XSKU 4CRDA 2XC0A 1TNKA 1CT0E 1OWHA 2SFAA 1E37B 2PW8H 4O97A 2WPHS 2Y7XA 2BD9A 1YYY1 1K1MA 2FP7B 2ZDMA 3SNAA 1C5UA 3QUMP 3ZZ4A 4E06H 1JXPA 1JIRA 5F53A 2ZU5A 1ESAA 4DGJA 4I8LA 1S0RA 1SOTA 3HK3B 2WV5A 1C5LH 1KXEA 2TGDA 1MCTA 4YO9A 1XXFA 9LPRA 1A3BH 2I6QA 1ESBA 3QZQA 2SGEE 5DKMA 6GCHF 1CGIE 2J94A 1KXAA 2FMJA 1BB0B 2UUYA 1TNHA 3MO9A 1ELFA 1ZSLA 5EJZA 1KXCA 1UTPA 3D65E 2FDAA 1LHDH 5EQRA 5EXLA 1VCWA 1JRTA 1XMNB 2DE8A 1ZPCA 2VH6A 2ZHFH 1PQ8A 5FPSA 3F2HA 2GZ7A 5FCKA 4E7NA 5AHGH 1UVPA 3SJ8A 3ODDA 3DSOA 4U30A 1GJ7B 2VBCA 1HAIH 2RCEA 1ZHMA 1LPKB 1FUJA 1XXDA 4H6TA 5B6OA 4NZLA 3SUGA 2CF9H 1QA0A 1HUTH 1GVKB 5CHAC 2Z9LA 1G36A 1ETRH 1LMWB 1RXPA 1SGDE 4JZDH 3N7OA 5A8XA 3U98H 4CH8B 4RKJB 4K1SA 3A7TA 1MTNB 1QBVH 2BB4A 5EU8A 1H8IH 3RXAA 1ZR0A 1NU9A 1W11U 1HYLA 2ZTYA 2J2UA 3K65B 4WWYA 1SGQE 3KGPA 1SHHB 2NU3E 2FYRA 1GHYH 4OS5A 4WVPE 4FUCA 3AAVA 2GCHG 2FI5E 1DLKB 1NBMD 1HAPH 4O03A 2H9EH 3T2NA 1P01A 1HV7A 2BDIA 4Q7ZA 4B76A 4RKOB 3KL6A 1INCA 1EZXC 1PYTC 4B2CA 4DURA 4F48B 1AKSB 1QB9A 1ZRKA 1GG6C 2EQNA 5HXFA 2QV1A 3TH2H 2HALA 4ABAA 2Y81A 1EPTC 2PTCE 3RXEA 3HKIB 5CHBA 4IC6A 1JIMA 1GL0E 3A86A 3PV4A 4JYUH 1FIWA 3L33A 2ZECA 3NRLA 1FAXA 3GYMA 5LPEA 1KY9A 4HZHA 1GBBA 1C2KA 1GI5A 5C1UA 1EKBB 1SOZA 5GCHF 1T4VH 1THSH 1E1RD 1TGNA 3AASA 1WDIA 1OP8A 3E8LA 4GCHF 3OEED 1A5HA 2BD5A 3KYFA 1F0RA 1GI0A 1CT4E 1TGSZ 1O2QA 1P57B 1ZHRA 6CHAC 4NIYA 2AGIX 1J14A 1FN8A 1F0UA 1FLEE 1GMDF 1O3KA 3SU2A 2HVXA 1TPPA 1MTSA 1ZJKA 2FODA 3GY7A 1E0FD 1HRTH 3KIDU 4ZROA 1QTFA 1IQIA 1WBGB 3VB5A 3ZVGA 1Y59T 5EXMA 2VGCB 4CR9A 1QBOA 3R3GB 4XDEA 1SLUB 1BQYA 4U2WA 2ZCKP 1ELTA 3RLWH 2M2AA 5JYIA 1S5SA 1C9PA 3LC3A 3ZZDA 3RXVA 2ZHDA 1H4WA 2J97A 1PPGE 3RXDA 2R9PA 1BTWA 1E35B 3I77A 1GI2A 1N8OB 1O3HA 3ZV9A 1GBIA 1FN6A 3BEUA 1TGTA 3Q00A 1SGYE 2BD8A 4UDWH 3V0XA 2TPIZ 3QZRA 4XRNA 4B74A 3BG8A 1GMCF 1SGPE 3RMMH 3RMLH 1O3FA 2GZ8A 1LHEH 2HNTC 3E0PB 4Y0ZE 1J9CH 2VVVA 4UFGH 1O2JA 1UHBB 1Y3UA 2SNVA 5C94A 2C8XB 2ANYA 1HFDA 1YCPK 2VIOA 1Y3YA 1G32B 2CGAA 1YPHE 1LVYA 2FOHA 3FP7E 1EJNA 3E0NB 1Z7KA 2Z3DA 3M5OA 2XBVA 1GMCG 1TB6H 4ZKOU 5A2MH 1K1OA 2ODYB 1C5SA 2EI8A 2PFEA 4BAOB 1HAHH 1O5DH 1SQAA 1XVOA 2ZGBH 1W10U 3E3TA 5JBTA 3BTHE 3TLOA 3D49H 3RXMA 5L2YH 4SGAE 2W26A 2DUCA 2AMPA 2ZFTA 4ABHA 1X7AC 1J15A 1MKXK 4LZ4B 2QF5A 1DXPA 3BTGE 4K1EA 1KXDA 3EA9A 2KCAA 4E05H 1L1JA 3UAIC 3RM2H 2BLVA 2GCTC 3S9AA 1OSSA 4Q4LA 1VR1H 2P8OB 1QCPA 2QF3A 1PPZA 1GHAF 4ABEA 3SI4H 2GJGA 3GICB 3MOCA 5E8EH 3ZVEA 4AB9A 2LELA 4DT7B 2W6ID 2PTNA 3P92A 3UWJH 4DT4A 4F55A 3TK6A 3PB1E 3SYJA 2XCNA 3GY6A 1FX0B 2ZPQA 1EZUC 2BDAA 1GJCB 1O3LA 1YPJH 2FOAA 1D3TB 2OC1A 1P2NA 3OTPA 7ESTE 3MMGA 1DWCH 2OC8A 1DE7H 3SGAE 1L2EA 2BDHA 2JDID 4KTCA 2Y82A 1G2LA 4QT8C 4ABIA 3RMNH 1DPOA 2G55A 4X2XA 2UUJB 2G51A 4I8JA 5E0HA 1ANBA 2VVCA 4A92A 3K2UA 1C5PA 2XWAA 3UNQA 3QGJA 1TLDA 1LVBA 4BNRA 2ZFFH 1DY8A 3LGWA 1ZSKA 2KFWA 4INKA 2KX4A 1C2IA 3LIWA 2FX6A 1T7CA 4B6FA 4Y8XA 3P95A 3O8CA 4WH8A 1YWUA 2LPRA 2XC5A 1HDTH 1W0ZU 4I8GA 5F6MA 2UUKB 1O5EH 5C17A 1V2RT 2GMTC 3PMAB 5KEDA 3ZVFA 1P2JA 3DCLA 3ZYEA 1CT2E 4YTAA 2K1QA 4FUHA 2HGTH 4P00A 3GY3A 3UY9A 3TVJB 1FY8E 5EJ1A 2JETC 3N7DA 1NO9H 1SGRE 4ASUD 2WINI 3C27B 5EQSA 2ZDVH 3A82A 1GI6A 1PQ7A 1BHXB 1FY1A 3BEIB 4Q2KA 5JDUB 1IHTH 1O2VA 1E36B 3B23B 2VIWA 5A0CA 2XRCA 2VIPA 3HGNA 1UTMA 3SHAH 3GS9A 3PRDA 3SUDA 4DG4A 4NIVA 4B71A 1S81A 4MPWA 1PPHE 4CREA 2BD2A 4MPUA 2Y5GA 1C1TA 4YT6H 5FBIA 2K0QA 1O2NA 5DGJA 3S9BA 3OY5U 1Z6JH 1KLJH 2BLQA 4LZ1H 1QL8A 1GHBF 2FPZA 5K0HA 1YPEH 4X6OA 2PUXB 3ZV8A 3DFLA 4AYYB 3T25A 1V2MT 1AVWA 4AZ2B 2SGPE 2A1DB 3RU4T 2BD3A 1GBLA 2VU8E 1EPTB 2BHGA 2VIVA 4YOGA 1F0SA 1PPFE 1TABE 1GBTA 2JJ1D 1B7XB 3MO3A 4GUXA 3IWMA 5T6GA 3PTNA 2BX3A 2QCYA 2XBXA 1O31A 3GDVA 3Q3KA 4NA8A 1NN6A 3FZZA 1KLIH 3KQCA 4ZH8A 4I32A 1PQAA 1NRNH 4KGAA 3M3TA 2J98B 3QWCH 2QXGA 3LH1A 2HVYB 1ZLRA 2OXSA 2YMSC 1G3DA 1GDNA 1UVTH 6CHAB 1W7XH 3F0PA 3V12A 4BAQB 1PPBH 3ZZ7A 4Y7AA 3TJOA 1DT2A 1ABJH 2BVXH 4XBBA 4YZUA 3P8NA 1SBWA 1T4UH 1WAYB 3MO6A 1NS3A 2IOTA 4X6NA 1BBRE 2JKHA 1C1MA 2R2WU 3LGYA 1NFUA 3MNSA 4Z1MD 3O8RA 2PP6A 2AYWA 2ZHWH 4HFPB 1D6WA 1IOEA 5LGOA 1C1VH 1O33A 4JZEH 1HCGA 2GGVB 1W0KD 5JB8S 1LPZB 1V2OT 4ESTE 4A7IB 1NRQH 3UOPA 2F83A 3KQBA 3SQEE 2Q6FA 1QQUA 1ARCA 4NSYA 4SGBE 3SORA 5T6DA 1UTNA 1IAUA 2GT7A 3TK5A 4THNH 3V7TA 2NU1E 1HXEH 1UO6A 3MTYA 4Y0YE 1AE5A 1W0YH 2JIZD 1GBKA 1FJSA 1ANDA 1MH0A 1UTJA 1O32A 1C9TA 2C8ZB 2P3FH 1MKWK 1M9UA 1C5ZB 2CK3D 1AZZA 1O5FH 5A8YA 1FY3A 3SN8A 4J1YA 5C1YA 4BTUB 1YC0A 5FCRA 1CA8B 1Z8JB 4NSVA 2QXHA 5E0GA 5IDKA 4MNVA 3DSPA 5BPEA 2BVRH 2Q1JA 3SJOA 3SUEA 3VB6A 3U69H 2OBOA 4D76A 2GCTB 1NPMA 3RXGA 4ISLA 1FV9A 4AFZA 2RDEA 4XBCA 2FTMA 2ZP0H 4Y8YA 1ZGVA 2G00A 1W14U 3LC5A 3MYWA 4AG1A 1CHOF 1DFPA 1FY4A 1IQKA 1LVMA 1S6LA 3AK5A 1TQ7B 4ISHH 4ABGA 3F68H 4ACAA 3OEHD 1AWHB 1A4WH 2V6NA 3A87A 2WPKS 1GVLA 2TGTA 1CGHA 4Q80A 3ZZ9A 1HXFH 5DP3A 1KIGH 2C93B 3EYDA 1YPLH 2A5IA 1KTTB 2QYIA 1Y3XA 3QLPH 3PO1C 2KCYA 2WYJA 1YF4A 2WPLS 1MKXH 2J95A 1BBRK 3DFJA 1EB2A 1AVGH 4MNXA 1RFNA 3PLPA 4X1NU 4WMDA 4HTCH 4FVDA 1O3OA 5L6NH 4ZXXH 5DN6D 1ABIH 1O3NA 1AFEH 2O8UA 3RU4E 1HJAC 4UE7H 1OP0A 1GCTC 4B2AA 3BV9B 1O2PA 5DP5A 5DP6A 4CHAB 1BA8B 1UTKA 1EOLA 2HPQH 2XNIA 3U8RH 3U1JB 1CBWB 1VITG 1ZMJA 5F8ZA 1GCDA 3RXQA 1NTPA 4JK5A 2FS8A 1OYQA 1OHHD 4D7GA 2GD4B 1V2JT 1NFWA 2CV3A 2WUCA 2EC9H 1P03A 4WMFA 3BTDE 1GHXH 2VIQA 2Y5FA 1FDPA 4Y7BA 1NU7B 1GI9B 1ELDE 1ZGIA 3K6YA 3URDA 1IQJA 1LHCH 1ESTA 2BZAA 3PMHB 5EGMA 1B0EA 1BRCE 4KKDA 2LNCA 2JETB 1DX5M 3QDZB 1O2XA 2ZI2H 3DUXH 4X0WU 1EAUA 1EASA 1HAVA 3LGUA 5FPTA 6GCHG 3CP7A 3BTQE 1V6DA 2OD3B 3S69A 1XX9A 2FX4A 2PLXA 1FPHH 2A2QH 1QY6A 1O36A 1SVPA 2TIOA 4DOQA 3OE7D 2HNTF 1MTVA 4H6SB 5LPRA 2H1UA 1V2ST 4ZCNA 2A5AA 3A88A 5HIZA 3LONA 1O2WA 3N7EA 1C4U2 2ZA5A 5FHTA 3WWFA 1C4Y2 4NIXA 1HAZB 2ULLA 3SZEA 5CDFE 1KMHB 3RM0H 4K8YA 1ELBA 1UMAH 3NPSA 2UWOA 4ZXYH 1P10A 2XW9A 5C0UA 3P17H 1AO5A 1EATA 2HPPH 1NRSH 4AGJA 1LQDB 5EPYA 2O8TA 3UPEA 2HNTE 1T31A 1J16A 2THFB 2FOFA 4ZKNU 3LT3A 1TX8A 1XM1A 3S0NA 2WV4A 2BY5X 2SGDE 2WUBA 3CENA 1O35A 1TPAE 2FLRH 1SGFA 1V2UT 1AHTH 2Z6BD 3H7TA 5ABWA 3HGPA 3SHCH 5C0TA 3E16B 1WV7H 4D9RA 5GIBA 1C1SA 2BX4A 4GLYA 2GKVE 3VG8A 2J38A 4B1TA 3TH3H 4Z0KA 1IQLA 2YNBA 4MQAA 2YMSB 5TCAA 3A84A 4MG3A 2A4OA 1VZQH 1W12U 4ZHAA 5C20A 1O3JA 3M5NA 1GBCA 1WTGH 2F9NA 3NZIA 4Q63A 1WUNH 3M7TA 3H5CB 2ZU4A 1HAYB 4FU7A 1OWKA 2OQ5A 2BYAX 1G37A 2ZO3H 1GJ5H 1HJ8A 2HOBA 3U8OH 1Y8TA 1C1UH 1SQOA 1FONA 4MPXA 3F9FA 1YLNA 1TPSA 1T8NA 1C1RA 2KR7A 2M5TA 3UWIA 4BXWA 3RUOA 1A46H 1F2SE 1AU8A 1Z1JA 3MH7A 3E1XB 3MWIU 1CQQA 1PYTD 1SSXA 7KMEH 3SGBE 3VGCC 2IN2A 2QXJA 4D8NA 2UUFB 2FOBA 2ZPSA 4WH6A 5GCHG 1CO7E 2ZGXH 2SGFE 2YOLA 3RU4D 4JZIA 2PGBB 2G81E 1OP2A 4NFFA 1JOUB 2OCVB 2FS9A 4GCHG 3UIRA 1QNJA 1U6QA 1QQ4A 4AOQA 1HAGE 1BT7A 3FANA 4K3JA 1EJAA 1UCYE 2PKSC 1W2KH 3A89A 4IS5A 1GMDG 1GJ4H 1OWEA 2ILNA 2PR3A 5EW2H 1O39A 3UNRA 3S7KB 2ZWLH 1UVSH 1TGBA 2BXTH 2GTBA 3GCHC 3OYPA 2XYAA 1EFRD 3F9GA 1YPMH 2P93A 4FETA 2WYGA 1EP6A 2JH5D 1GMHF 1GI1A 4YXWD 1Z6EA 2AMQA 3SZNA 3ZZBA 2XNDD 4I8KA 1EZSC 2VWMA 1XUGA 1L1GA 2BDGA 3OU0A 1VGCC 3DA9B 2ZTXA 4VGCB 1F5RA 4B75A 1JBUH 1AQ7A 3UQVA 3Q76A 4CR5A 3ZZ5A 1B5GH 2PV9B 4IBLH 2BLWA 3NCLA 2W3IA 2ZIQH 4A5TS 1GL1A 1DS2E 4K5ZA 3EE0B 1AUTC 1BMAA 3T26A 1BJVA 1A1RA 2CF8H 1GPZA 1F92A 1MD7A 5EJLA 2HRVA 4ASHA 3QTVH 2BY6X 1HPGA 5EIYA 5T1VA 3Q77A 1TRMA 4CBNA 3RXCA 1BMLA 3LGTA 3A8CA 3A85A 2ZFRH 4YESB 2VWNA 1O38A 3VPKA 1MKWH 3PMJA 4BAMB 2ZU3A 5HIYA 4JZFH 2F3CE 2Q6GA 4UEHH 4NWKA 5HYOA 5J4QA 1P2KA 2WZQA 1C5RA 1HNEE 2ZQ1A 4BTIB 1O2IA 4FUJA 1TBQH 4FUEA 3ZVBA 4NG9H 3V3MA 1NM6A 2QIQA 2A31A 3RP2A 4CH2B 1O3MA 5JB9S 1S84A 1SQTA 3MU8A 1P02A 2BOHB 1HJAB 1GCTB 2CMYA 2Z9IA 1TX7A 3BTFE 2FLBH 1O5BB 1GI7B 1TALA 1TRNA 2WSSD 4ABJA 1KLTA 2PWXA 3RXUA 2PKAA 1L4DA 1GHAG 8GCHF 3GY8A 1K0HA 1NT1A 2AIQA 1GBDA 1EAXA 3EA8A 1C2LA 1NESE 2FXRA 1UCYK 3GCOA 4JK6A 2CHAC 2EY4C 3M3SA 1W3CA 2A2XH 1IQEA 2RFKC 1VKYA 1XKAC 1RRKA 2C8YB 4X2VA 3UOUA 1GDUA 1FY5A 1DUEA 1F0TA 1GI8B 3UQOA 4CRGA 1KXFA 3T27A 4DCDA 3RXTA 5ESTE 2Z9GA 1ETTH 3CS0A 4M9FA 4ABFA 3ZVCA 1A61H 1DITH 2SGQE 1GBFA 1BBRH 2C8WB 4GHQA 4NA7A 3SU0A 2Z3EA 1TIOA 1EJMA 3LDXH 5DK1A 3DT0H 5EQQA 2ZPRA 1YKTA 1SQRA 4YM9A 1RD3B 2FIRH 4FUIA 4DVAU 3D62A 1TOMH 2FWWA 3MH6A 2VWOA 1HBTH 1DDJA 3PV2A 5IYTA 1UVOA 3KN2A 3A7VA 1C2HA 4O3TA 1GBEA 3F9EA 3R0FA 4K8BA 1GDQA 1YLCA 3MNCA 7GCHF 4AX9H 2BM2A 3EAJA 5FAHA 1DM4B 3PV5A 3AW1A 3CS7A 1P0SH 2H5DA 5JPMH 3LH3A 5CHAB 1ZTJA 1T32A 1ZYOA 3P6ZB 5F8XA 2D2DA 1PJPA 1EZQA 1PFXC 2RA0A 1ZTKA 2OINA 2P3UB 4CRBA 1K9OE 1IQHA 1IQNA 4X8TH 5DJ7A 5JBAS 1O5CB 3STIA
chains in the Genus database with same CATH topology
2JH6D 3T5FH 3NXPA 1TNJA 4IMQA 1BDAA 1SGIB 1NZQH 1HJ9A 1LHGH 1YLDA 1G30B 2A5KA 4F49A 1SGFG 4OS6A 2BDBA 1VCQA 4IC5A 1DOJA 5DPAA 5F8TA 4A1TA 1P06A 1RJXB 1ZMNA 1HB0B 2ZKSA 2NWNA 3RXLA 3EBNA 3AVZA 2PKAB 3KNXA 3O8DA 4GVUA 3DD2H 2D8WA 1F5KU 5A0AE 1YPKH 1GG6B 3TNTA 2AGEX 1ANCA 1BTZA 3A8BA 3KCGH 1SC8U 3VB4A 1OS8A 1SGTA 3FP6E 2Z3CA 1SG8B 1MTUA 3LOXA 1OWDA 3TU7H 1Y3VA 4DJZB 2O9QA 1P9UA 1UVUH 1BZXE 4Y6DA 1RTKA 1EOJA 1SFQB 5GPIB 4XE4A 1GHBG 1ID5H 1NY22 1F7ZA 1LCYA 1G9IE 5AFYH 3TPIZ 5ESBA 1MUEB 1MTNC 1GJBB 2A4GA 3GYLB 3L6PA 4NIWA 1C5YB 4CRCA 5LPFA 1P05A 1GVZA 5F03A 2AMDA 4E7RG 1H8DH 3M61U 1KDQA 1QJ7B 4FXGH 1SLVB 4FUDA 1P3EA 2NU4E 5A0BA 4YT7H 2YNAA 1UTOA 2P95A 4K60A 4K2YA 1BTXA 1C1NA 1O5AB 3SBKA 4DY7B 3RXRA 3A7ZA 3M5LA 1HLTH 1MMJN 1K21H 4BXSA 1TOCB 1Z8GA 1DSTA 2F9VA 3SJKA 1C1WH 3QGNB 1SHYA 2H9HA 1L0ZA 2ZFSA 5EPNA 1BJUA 1TMTH 2EA3A 3RC4A 1QFKH 1YGCH 3TJNA 1XUJA 3SNBA 2PSYA 3ATKA 3GY5A 1VITH 4JZ1A 2FI3E 3U1IB 3QK1A 4ABBA 4FUBA 2AFQB 1WYKA 1THPB 2G4UA 4ISOA 4IGDA 1HGTH 1XUFA 3ATIA 2FYQA 3SI3H 2W5EA 1SR5C 1GHZA 2ZEBA 3GCHB 2EI6A 1C1OA 2AEIH 5AF9H 1V2PT 2G8TA 1C5MD 3KQEA 1QGFA 1AIXH 5C2ZA 3BTTE 2P59A 3PM3A 1G2MA 1RGQA 3UFAA 2BTCE 1O2TA 3W94A 3QO6A 3M7UA 2O8LA 3SV6A 1K1IA 1L1NA 1XUHA 1ZZZA 1P9SA 2R0KA 3VXFH 1RS0A 3GY4A 4K1TA 5I46H 3PYHA 1CA0C 4TWWA 1Y5UT 3M37A 4DIHH 3RLYH 3NKKA 1TQ0B 2ZU1A 3P8GA 1QL9A 2XBYA 1OXGA 3FP8E 2CXVA 2OUAA 3GCTF 5T3HA 1QJ1B 5A8ZA 2Z7FE 2ALVA 3MU4A 2OP9A 4GAWA 2F91A 5EG4A 5T6FA 1NFYA 4I8HA 4MVNA 3GY2A 5AFZH 1Q31A 4F4OC 4XBDA 5E2OA 2Y7ZA 1C2FA 1DWEH 1AB9C 1O3PB 1D9IA 1AUJA 1YCPH 5FBEA 1V2WT 1C2JA 3PMBB 2J92A 3VB7A 2VIDA 2VWLA 1IQFA 3OTJE 1A0JA 2ODPA 1GGDC 3P8OA 4H42U 4BAKB 2OC0A 1C5NH 1LQEA 1W7GH 5GXPA 3SNCA 2H5CA 2ALPA 1DICA 2PSXA 4ZKSU 1CHOG 1S85A 5HMAA 2P3TB 1GHWH 2TRMA 3RXOA 4R0IA 2CHAB 4Y8ZA 1P11E 4INLA 4CRFA 1CU1A 3URCA 3HATH 3ITIA 2ANKH 2K7XA 3TGJE 4ZMAH 4FUGA 3MU0A 5FX5A 3K6ZA 1IQGA 1S6HA 4Q7YA 1F5LA 1NRPH 6ESTA 1P2OA 2FOCA 1WOFA 3STJA 2P8OC 1CSOE 2R2MB 3SUFA 5G4BA 1A5IA 4X2WA 3NK8A 4A6LA 1UJ1A 1GBHA 1TNLA 1UK3A 1D3PB 4YLUA 2AIPA 4HI3A 1MQ6A 1LPGB 1QURH 2GMTB 4X8SH 5GDSH 1SLXB 3HPTB 1NC6A 1AMHA 3WY8A 1MU8B 3DHKH 5TJXA 3F6UH 2A45B 1AGJA 1GJ6A 1C4V2 1VJ9U 5I25A 4AYVB 1MBQA 1A0LA 3ENSB 1ZJDA 4I7YH 2O8WA 1TNGA 3RC5A 1UCYH 1DUAA 1GI3A 1K22H 4OS1A 1AKSA 3I29A 4AGKA 1SI5H 1Y5AT 3SU1A 1O3DA 1AI8H 4LOYH 2SNWA 4WJG2 1OWIA 3M7QA 1MD8A 3ZVAA 1GWAA 2EI7A 2XC4A 1Y5BT 4ZAEA 1C2DA 2J9NA 1GJ9B 1KYNA 1QA7A 2ZU2A 3OSYA 1LDTT 3A7YA 1GJDB 2OC7A 2ZDKA 3VEQB 3W95A 1WCZA 1OPHB 1Z71A 3MFJA 2GDEH 2ZDAH 3ODFA 1P12E 1TBRH 2W3KA 4FU9A 3GOVB 1TWXB 1QHRB 3KF2A 2TGAA 1LO6A 3AAUA 1ZPBA 3MNXA 2FZZA 4ZUHA 2A32A 1OWJA 3E6PH 3RXSA 2FOEA 2FTLE 2I6SA 2C3SA 3VXEH 3SU6A 5E0JA 1C5QA 4AB8A 1V2LT 2F9UA 3O8BA 4BTTB 1SGCA 4X1QU 2GCHF 1LKBA 1O3CA 1D4PB 3PWCA 1DWBH 4JYVH 2EEKA 3C1KA 5L2ZH 2Y5HA 1RTFB 2GP9B 1YP9A 5A09A 1TGCA 1HAXB 1OYTH 1V2TT 1KSNA 3BTKE 3LJJA 2D1JA 2XWBI 1AE8H 1C2MA 2V3HH 4JYTA 2DE9A 4OGYA 1K1JA 2H9TH 6LPRA 1AN1E 3P8FA 1BRAA 1Z8RA 1K2I1 3PWBA 4YOIA 4UD9H 3S9CA 5H4IB 2BD7A 3BG4C 4NWLA 1GBJA 2QF0A 3MH4A 5GJ4B 1P8VC 3FFGA 1O2LA 3FZDA 3TH4H 1EAIA 5K7RA 1P2MA 1XKBC 2FO9A 1HAVB 2ZHQH 3SV7A 1UTQA 1UHBA 3A81A 2ZDLA 4YLQH 2C4FH 4CRAA 4WXIA 1EB1H 1K28D 2ZGHA 1A3EH 4AN7A 3TNSA 1QL7A 2QA9E 3MNBA 4M7GA 4X1PU 5HM2A 1CGJE 5PTPA 1MZDA 1N1LA 1FPCH 1FQ3A 3I78A 1ZSJA 4NA9H 5DP7A 3TGKE 1TFXA 2G5NA 2ZC9H 2ZFPH 3ZZ8A 3Q3YA 3BTME 3K9XB 1GJ8B 5TCCA 1T8LA 5LH8A 1Q3XA 2ZCLP 1C5TA 4XFQA 2Y80A 1SGNE 3E90B 1TMBH 1YM0A 1DSUA 1MCVA 4Y11E 3PLBA 2UWPA 1O34A 1LTOA 1QRZA 5JBCS 1BRBE 4ABDA 2RDLA 1W8BH 2FM2A 3MHWU 4YOJA 3RXHA 3RXKA 3RXFA 3GISB 4X2YA 1TPOA 2VINA 1GBAA 1VJAU 3NUMA 2OBQA 2ANWA 2ZF0H 3TJUA 2QC2A 1GJAB 1DANH 3ZZAA 1EAWA 2VB0A 2VVUA 1O2GH 1N6YA 1SFIA 4X1SU 1CA0B 3PLKA 2D26C 5CMXH 3SV2H 3QTOH 4IN2A 2XBWA 5FPYA 1PQ5A 2FEQH 4AFQA 4UFFH 4JCNA 2WPMS 2AGGX 3SNEA 4BANB 4JMYA 2ZNKH 1VCPA 3MI4A 2ZGCA 2Y6TA 1RIWC 3B8JA 1GI4A 3M3VA 3BTWE 1W13U 4LXBH 2H2ZA 3MU1A 2XTTB 1Z8IB 1LHFH 2OLGA 2VH0A 4TPYA 1C5VA 1GMHG 2GT8A 1OOKB 3A8AA 3U8TH 4GSOA 4AG2A 4AFUA 1GBMA 3M36A 1V2KT 2ZG0H 2A7HA 4UONA 2B8OH 3MH5A 3BF6H 1HIAA 3G01A 2ZDNA 3RC6A 4KELA 1AB9B 2HLCA 2GZ9A 1EQ9A 2Q6DA 2BVSH 2G52A 3OY6U 1AFQC 1K1LA 5DP9A 3HK6B 4MDSA 4RN6A 5ETXA 1QJ6B 1C2GA 1GGDB 3ZZ3A 5SGAE 2ODQA 3JZ2B 1O5GH 1ZMLA 2ANMH 1BRUP 2J34A 3M5MA 2QN5T 2TBSA 2F9BH 5DP8A 1TAWA 3H7OA 1P2QA 3A80A 5EW1H 1C1PA 4TPIZ 3KQDA 2PUQH 3ATMA 3IITA 3PO1B 4A1VA 3GDSA 4OGXA 1H1BA 3UR6A 1TYNA 3RMOH 5CE1A 3TK9A 3QX5H 2BDCA 4FVBA 2ZZUH 3SV8A 2WPIS 2H6MA 1O30A 1FMGA 1S6FA 1O2KA 1O2HA 1SPJA 1H9HE 2O8MA 1EP5A 8KME2 5DO4H 2FI4E 1O2UA 2BQ7B 4DIIH 5EOKA 1MU6B 1WTHD 2FESH 4X1RU 4D7FA 2BXUH 1RTLA 1C5OH 1O2MA 3EQ0H 4CBOA 2ZFQH 3TJVA 3ELAH 5BRRE 1QR3E 4U32A 5E2PA 2QY0B 1YBWA 4Y71A 1ANEA 5JBBS 4NFEA 1NFXA 4ZHMU 3SO3A 3SQHE 1E38B 4GHTA 1ZTLA 2V0BA 1V3XA 1C2EA 3SJIA 2NU0E 3UTUH 1MAXA 1ETSH 1S83A 1BTYA 1ELVA 1ELGA 1S0QA 1TRYA 2B5TB 8GCHG 4AFSA 1KTSB 4NZQA 4WMEA 3GDUA 3VFEA 1IHSH 3A8DA 1DVAH 5HM9A 3GCNA 1ACBE 1BTPA 2A0QB 2WPJS 3RXIA 1EPTA 4ZHLU 2BD4A 2BY9X 1MAYA 1AWFH 2ZGJA 3A7XA 1AY6H 1O3BA 3BIUH 1T8OA 1HIAB 1A2CH 2XCFA 4CHAC 1SB1H 1BCUH 1YPGH 1BOQA 1OKXA 1O2YA 2FOMB 1CBWC 3JZ1B 2ZQ2A 1TX6A 1UTLM 1ZHPA 4U01A 4Y79A 5C67A 1AVXA 2F9PA 1EXFA 3P70B 1TA6A 3NWUA 3LGIA 1J17T 1A5GH 4INHA 2F9OA 4KTSA 3L3TA 2ZHEH 4X8VH 5J4SA 1G3CA 1FNIA 3SV9A 4UFDH 3OX7U 3LGVA 4ZKRU 1YCPM 3AW0A 1O37A 7GCHG 1LKAA 3KEEA 1K1NA 2R3UA 3LPRA 4MTBA 4WF8A 2B0FA 1YPHC 2ZTZA 3UR9A 4MNWA 1MTWA 2QAAA 5FX6A 3TGIE 3VB3A 4Y10E 1K1PA 2AERH 1D3QB 2Z9JA 2JH0D 1DXWA 1BMMH 2GVFA 1O0DH 2G4TA 1OX1A 5C5NA 1H9IE 1TONA 2UWLA 1Q2WA 1J8AA 3SGQE 1FIZA 3T62A 4GPGA 1TA2A 2BQ6B 1WU1A 3A83A 4WXVA 3BN9A 1D6RA 2KAIA 2BMGB 4ISIH 4Z6AH 2STBE 1G3EA 2BY7X 2V35A 1IQMA 2BOKA 4Y76A 1T8MA 1ORFA 2P16A 1DY9A 3BTEE 2G5VA 3BG4B 5FXLA 1O3EA 1Y3WA 3ZZCA 1JRSA 1TMUH 4MLFB 3EGKH 1V2NT 2GDDA 1QIXB 2BZ6H 1O2RA 2A4RA 3TITA 2PHBA 2CN0H 1O3GA 1S82A 1TNIA 2ZCHP 1ELAA 4WY3A 1O2SA 2V3OH 2IPHA 1P3CA 4IW4E 2BY8X 3ATLA 2A4QA 2OTVA 3SJ9A 3BIVH 4IN1A 3V13A 4X8UH 1B0FA 1FAKH 1P2IA 2NU2E 4K69A 1V2VT 1AZ8A 4HGCA 4OS4A 4X6MA 3VGCB 1TE0A 1BMNH 1LVOA 3T28A 3A7WA 4RSPA 1WQVH 1DWDH 4X6PA 4KP0A 5GWZA 1C5XB 3MU5A 1CHGA 4UFEH 3PTBA 4FU8A 1E34B 2LIZA 1BTUA 1GHVH 2PKSB 4NGAH 3KHVA 3IG6B 4TYDA 4O9VA 1QB6A 1QRXA 2Z94A 3ATWA 1A0HB 1EUFA 1DLEA 3SW2B 3UNSA 2W7UA 4MPVA 4AORA 4IMZA 2AH4X 5AVDA 3U9AH 5DG6A 1QB1A 5DP4A 1MBMA 2A7JA 3QN7A 1SLWB 4J2YB 3LKWA 4H4FA 3B9FH 2QXIA 4OS7A 1KXBA 3M35A 2FOGA 3HKJB 1L4ZA 3ZYDA 4PROA 1VGCB 2RA3A 5EXNA 1MZAA 1RIWB 2KAIB 2STAE 4NCYA 4FUFA 1PPCE 1CVWH 3Q3XA 3EDXB 3RXBA 1UK4A 2Z9KA 4OS2A 2VGCC 3LU9B 4DW2U 3UUZA 3UREA 3BSQA 2BLOA 1O3AA 3E91A 2BQWB 4TY7A 2ASUB 2VNTA 1FXYA 4LK4A 2IJOB 1XVMA 5C3NA 4B2BA 1ZOMA 1P09A 1N6XA 1P04A 1O2OA 1KDQB 4I31A 1QRWA 2QGRA 2RG3A 4D9QA 1AFQB 4TWYA 2HWLB 1N8OC 3RDZA 3ZVDA 1JMOH 2SGAA 1HAOH 3TIUA 9ESTA 1EX3A 8LPRA 1FZZA 1CE5A 2GV6A 1BHXF 5HGGA 2C90B 4BAHB 3SNDA 3EA7A 2P94A 4A1XA 5L30H 3S7HB 1WQSA 3LJOA 3RXJA 1NROH 1C5WB 4VGCC 1ARBA 3F9HA 2W7SA 1BTHH 2GV7A 7LPRA 4MNYA 1A7SA 4B73A 1AD8H 3BEFB 3GCTG 4BOHA 1QBNA 1ZPZA 4KTUA 3F1SB 1Z1IA 2TGPZ 2AS9A 1D3DB 5EODA 1WSSH 1ELCA 1SL3A 3SU5A 2VJ1A 1UK2A 2R0LA 1O2ZA 1ZRBA 1H9LB 2PGQB 5C5OA 3T29A 1XUIA 1TBZH 1XUKA 3ESTA 1BUIA 2A7CA 4Q7XA 2CJIA 2R3YA 1NRRH 1MQ5A 2J4IA 1PPEE 1BITA 3SU3A 1C1QA 1SMFE 1BIOA 3RXPA 4ISNA 1O3IA 2BDYA 1JWTA 1FI8A 4XOJA 2OQUA 3PROA 5C1XA 4TY6A 1VITF 1G3BA 4O3UA 1THRH 2ESTE 2GX4A 2XXLA 3FAOA 3SOSA 3ZZ6A 4I33A 3FVFB 4R8TB 1V2QT 2B9LA 2B7DH 3D23A 3SU4A 8ESTE 1SGEE 1ELEE 4XSKU 4CRDA 2XC0A 1TNKA 1CT0E 1OWHA 2SFAA 1E37B 2PW8H 4O97A 2WPHS 2Y7XA 2BD9A 1YYY1 1K1MA 2FP7B 2ZDMA 3SNAA 1C5UA 3QUMP 3ZZ4A 4E06H 1JXPA 1JIRA 2ZU5A 1ESAA 4DGJA 4I8LA 1S0RA 1SOTA 3HK3B 2WV5A 1C5LH 1KXEA 2TGDA 1MCTA 4YO9A 1XXFA 9LPRA 1A3BH 2I6QA 1ESBA 3QZQA 2SGEE 5DKMA 6GCHF 1CGIE 2J94A 1KXAA 2FMJA