3TITA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester sg81
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARS coronavirus main protease
publication title Crystal structures of SARS-Cov main protease complexed with a series of unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3titA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3titA02
1PQ7A 1GMCG 2SNWA 1VGCB 1NPMA 3UUZA 4AOQA 1LKAA 2VIVA 2NU1E 2BY5X 3MH7A 2ZWLH 5T6GA 1C4V2 1BMNH 3EA9A 3KHVA 2VINA 2Y80A 1O2KA 1ZHRA 4Y8ZA 1JMOH 2Z3CA 2BY8X 3PLBA 5L6NH 2GDEH 4GHTA 1UK2A 1QB9A 9ESTA 2WV4A 1MTNC 3RLWH 3RDZA 4CBOA 1YBWA 3O8RA 3ZZ6A 2BY9X 3ZYDA 1CGIE 2QA9E 1TRMA 1F2SE 1ELVA 3ZZ9A 3DT0H 2FX4A 4X0WU 1GJ5H 1DY9A 1NFUA 1YKTA 5HYOA 1ARBA 1KXAA 5J4QA 1LMWB 1ZHPA 1PPCE 2O9QA 4HZHA 4WXIA 3BSQA 5C5OA 1O34A 5EQSA 3V0XA 1K1JA 3UWIA 1NU9A 3MTYA 2OBQA 1DDJA 1AB9B 4IW4E 2G00A 1Z1JA 2FXRA 3T25A 1NROH 1C1PA 1C5TA 3GCNA 1BA8B 5DJ7A 4Z0KA 3GY6A 3PLKA 3T2NA 1TPPA 1CA0C 3ATIA 1YPHE 4GUXA 3I77A 1W2KH 4A92A 5A2MH 4JZFH 4Y8YA 3SUFA 1PJPA 1EJNA 2Z9GA 1ELTA 2PWXA 3SO3A 1HAHH 3D65E 2PTNA 2P95A 3O8CA 1ELFA 1PPFE 3SI3H 1TGCA 2XWBI 1QQ4A 2O8TA 1IQHA 3EAJA 1ABIH 1MKWH 4ZMAH 4ISIH 1O5GH 1QFKH 3K2UA 1BBRK 1MBMA 3AAUA 1GVLA 1W11U 1Y3WA 1C5VA 2QYIA 4Y71A 4ZKRU 2BLOA 1ZTKA 4K5ZA 4GPGA 2VWLA 1AN1E 4XE4A 3Q3XA 1BHXF 4MNXA 1HAVB 4NG9H 3BTQE 1UMAH 2BD9A 2J2UA 3GYLB 2V3OH 2R2MB 3KNXA 4HFPB 3P8OA 1V2RT 1P03A 1RGQA 1YPGH 2TIOA 3KGPA 2HLCA 2BB4A 3A88A 5AF9H 1O3DA 4CH8B 2TGTA 1V2TT 2TRMA 3A7YA 3BTFE 1SOZA 4FUBA 4DG4A 1DM4B 1BUIA 2BD7A 4BTIB 2C8YB 5EQQA 3GY7A 1PFXC 2Z6BD 3NPSA 3ELAH 2ZDMA 4ZH8A 1XUIA 1GHBG 1GMHF 1KTTB 1TMBH 4ZKOU 3SI4H 1T4VH 1C2MA 2V35A 1VJAU 4SGAE 3OYPA 1QJ6B 4UDWH 3T28A 4D76A 1EAWA 4WF8A 1AMHA 4Y7AA 4KGAA 1N6XA 3D49H 8KME2 1E34B 3MFJA 1THPB 1GI2A 2BD3A 3TGKE 4R8TB 4AGJA 1PYTD 2AFQB 3BEFB 1Z1IA 1LVYA 1K2I1 2RCEA 1RJXB 2AGGX 1HJAB 1OWEA 5L2YH 1BJVA 2HGTH 4MG3A 3W94A 1WQVH 1BTUA 1SGEE 1SHHB 4I8HA 3OU0A 4VGCB 2GZ9A 1MTVA 1GWAA 1TX7A 2JH5D 2FI3E 5A0AE 3QDZB 1CVWH 1GG6C 2ZDKA 2ZFFH 4GHQA 4K1TA 1OS8A 2FYRA 5A0CA 1O3NA 2HPQH 3O8DA 2V3HH 3DFJA 1BTZA 2A31A 1DS2E 1AE8H 1QNJA 2ZQ1A 3MU8A 5FPYA 4GLYA 2HVXA 3BN9A 5A0BA 1O3AA 1GMDG 1SLXB 2O8WA 2FEQH 1BBRH 5A8XA 2BLWA 1OWJA 3TGIE 2BD5A 1LHCH 1GJBB 4MNWA 2ILNA 1KDQA 1TIOA 1V2VT 3TLOA 2QF0A 3OTJE 4E7RG 1YLDA 1H8IH 3D23A 1PPGE 1AIXH 2F9BH 3K9XB 3SQHE 2BLVA 4CHAB 2ZTZA 1BCUH 1C5WB 3TJVA 1RXPA 1AWFH 1S84A 1EKBB 5CMXH 3PO1C 3M7QA 2H9HA 4ISLA 1LCYA 1GI9B 1F5RA 1XUJA 2Z7FE 3EGKH 3ZZ5A 1O39A 1FN6A 2BZ6H 1UVPA 2RG3A 5F03A 2OUAA 1TOMH 2G5NA 1KLJH 1LQDB 1GCTC 2CHAB 3G01A 3PWCA 4WH8A 4MLFB 2SFAA 1UTOA 3UTUH 4DW2U 1DWEH 5B6OA 1C1MA 1F0UA 1O35A 1P0SH 1ANDA 2UUJB 2JH6D 2UWOA 1EPTB 1HLTH 4K69A 4U2WA 2JH0D 1G36A 3BF6H 3BTGE 3RXVA 5JBTA 1GHZA 2O8MA 1GMCF 4O03A 1TMUH 1ZJDA 1QL8A 3NK8A 1GJ7B 4HGCA 1SFIA 1DLEA 1DWCH 2XW9A 4TWWA 5AHGH 2F9VA 1TBQH 3S9BA 1JRSA 1FY1A 2P3FH 5SGAE 5JB9S 3E1XB 4H4FA 4IGDA 1CQQA 2WPHS 1YLCA 1GPZA 1MU6B 1HJ9A 1O3EA 2ZU4A 3JZ2B 4ZROA 4NSYA 3Q77A 3MU5A 1OSSA 3ATKA 2ZU5A 2P59A 3ESTA 4ABIA 4CRFA 1GDNA 1CBWB 1IQKA 4A1TA 3T29A 1NN6A 3OSYA 1GBTA 1YCPM 3FP8E 2GMTC 2H5CA 4K1SA 1H8DH 1UTLM 3TITA 1TOCB 5I46H 4ABBA 1ZRKA 4YT6H 3MMGA 5C5NA 4INKA 3SV9A 1DVAH 1Y5AT 1EP6A 4JCNA 4TY6A 5K0HA 3H7OA 4I31A 1SL3A 5FAHA 3EE0B 1HAVA 2A7JA 1O2IA 3PLPA 5E0HA 2SGQE 1O5CB 2ESTE 4E7NA 3RMOH 1C5XB 1DANH 1BTPA 3TK5A 2V6NA 3U8TH 2BDAA 2QXIA 1EB2A 4B73A 1CO7E 2ZDNA 2ZIQH 5HXFA 1EUFA 2ALPA 1UO6A 2CMYA 1RRKA 1G9IE 1QHRB 1T7CA 4MTBA 3TPIZ 2HWLB 2IPHA 1PYTC 3HK6B 2XNIA 1ETTH 4IMZA 3M37A 3B9FH 2FI4E 3L6PA 3RUOA 4FUIA 4DT7B 1C5NH 1MTWA 3LKWA 1C9PA 1FY5A 1Z6EA 1YPHC 3I29A 2A5KA 1F7ZA 4BAHB 2GVFA 1H1BA 2DE8A 3LPRA 2Y81A 2GT7A 2CXVA 4OGYA 1J16A 3BTKE 2ZHDA 4ISOA 4X1RU 1ZMLA 1G3EA 3P17H 3RXDA 1CHOG 3UWJH 3CP7A 1ANBA 2D2DA 1GHBF 2FOFA 1GL0E 3TH3H 3F9EA 4CR9A 1G3CA 4UEHH 2FOHA 5DGJA 1ZHMA 1Z6JH 1LO6A 2P94A 4NSVA 3LJOA 2AEIH 4UD9H 1C9TA 2ODYB 3SU2A 3PMAB 1TX6A 2SGPE 3TNTA 1JRTA 1P2NA 3QZQA 2ZP0H 1ID5H 3GY5A 5DP9A 4AFQA 4D7GA 4NZQA 2GCHG 1WTGH 1SBWA 2G81E 1ZPBA 5JPMH 5BPEA 1GJ9B 3HKIB 1NFXA 1SGYE 5LH8A 1S82A 2ZECA 4HI3A 2H9TH 1GHAG 2GKVE 2Y5HA 1LPKB 2VGCC 5EU8A 1G30B 2PLXA 3ZZ4A 1A1RA 1DY8A 1NRRH 2M5TA 1ZGVA 3GICB 5DP8A 4DOQA 5L2ZH 2A32A 2FO9A 2F9OA 3O8BA 2B0FA 4LZ1H 1ZSLA 4X2WA 4WH6A 1A0JA 1SQAA 4LZ4B 1MAYA 4YOJA 4YOIA 1UVOA 3CS0A 3NCLA 1MTSA 1HAIH 3V7TA 2VVVA 1H4WA 1LHFH 2NU2E 4MPWA 5T3HA 2ZEBA 2JETC 1GBDA 2ZZUH 3PTBA 4Y6DA 1BOQA 4JZIA 1PPBH 1A7SA 3RXSA 5K7RA 3ZZ8A 3GCHB 4Y79A 3RMNH 3MNBA 1J17T 4AFUA 1UTPA 3SZNA 1O5AB 3A8AA 2ZFQH 3E3TA 3RU4T 1GMDF 1G3BA 1JIMA 1T4UH 1T8NA 3DHKH 2XBYA 2SGAA 4RN6A 2H6MA 1AE5A 1GJ4H 1O0DH 1Z8JB 1KXEA 3IWMA 3BTWE 2FTLE 1O5DH 1P01A 4FUHA 2WUBA 3QX5H 1EPTA 1YYY1 1GGDC 3HGNA 1FI8A 1ZSKA 1KXFA 1VJ9U 1HJ8A 3ENSB 1ZGIA 4FVBA 1LPZB 2TGDA 2RDLA 5JYIA 3P95A 1J9CH 3SBKA 1JWTA 5EG4A 1N1LA 4CREA 1AVGH 3MHWU 2J92A 1A0LA 2VH0A 1PPHE 1EZSC 2G51A 1HAOH 1HB0B 1TLDA 2CF9H 2ZGBH 1FY8E 2QIQA 3TIUA 1OP0A 2PW8H 3M5LA 1S0QA 3TH4H 4BAMB 3ZZAA 5ETXA 1NC6A 1Q31A 4A7IB 1S85A 2G5VA 5GDSH 1AFQB 1LQEA 1O3LA 2QXJA 3SV8A 2VH6A 2LNCA 2CGAA 1J8AA 1P9SA 3H5CB 1W12U 2C3SA 2AS9A 2H2ZA 1GI6A 1GBAA 2FIRH 1ESBA 1BTHH 3A83A 2FS9A 4WXVA 1C1RA 1V2LT 4WMDA 1O2ZA 1SGIB 1FY4A 1TABE 4H42U 2WYGA 4IBLH 2VVCA 4NA8A 1P2OA 4MDSA 1C2DA 1O38A 1HJAC 5JBBS 1P2QA 2FPZA 4OS7A 1TALA 2I6SA 1AO5A 4Q2KA 1A61H 3KN2A 1GJ8B 3LC3A 1SI5H 1TE0A 3E0NB 1GBKA 1YGCH 1FZZA 1Y3XA 1WOFA 5A8YA 2VB0A 1FNIA 1XM1A 1FQ3A 3BV9B 4ABFA 4ZUHA 5GJ4B 5F8XA 3BEUA 3SN8A 1O2GH 4WMEA 1L2EA 2ANYA 2YNAA 1QRWA 4AX9H 2AERH 1UTQA 4AB8A 1OWHA 5JB8S 1N6YA 1Y5BT 3V3MA 4K60A 1TNGA 1GBHA 1O3PB 1O3JA 1LVMA 2RA0A 3QZRA 2FESH 4IC6A 3URCA 1ELDE 3LGWA 3GDSA 3TVJB 1TGSZ 2J95A 3LGVA 4ABJA 4O9VA 5GWZA 4FU9A 1ARCA 1F0TA 1S81A 2Z9KA 5A8ZA 2AMPA 3HGPA 3S9AA 2XBVA 4OS1A 1BRUP 4YLUA 3OY6U 3BG8A 1O2RA 2W3KA 1KXCA 1K1OA 3RXLA 3FFGA 3GCOA 3HKJB 3ZVDA 4ISHH 2FMJA 1BQYA 1AKSB 1AZZA 1DSUA 1MD7A 1WUNH 3HATH 3B8JA 3KQEA 3PV4A 4WJG2 4Z6AH 1L1GA 5G4BA 3ZZCA 2H5DA 4X1PU 1O2QA 4JZDH 1ABJH 1LHGH 4ZKNU 3TJOA 3T62A 2Y5FA 3QWCH 4TYDA 1SLVB 1YM0A 1C1UH 3NWUA 2BXTH 1EPTC 1QCPA 1DWDH 1ESTA 1XX9A 3SUEA 2GD4B 3AASA 1L1NA 3ZVGA 4IN1A 4BXWA 2ZGCA 1W7XH 3OX7U 1C2EA 3ZZDA 2C93B 3BTEE 3LDXH 2J4IA 5JDUB 1IQMA 1W13U 2PGBB 2QXGA 5E8EH 4NIYA 4B76A 1HUTH 3E0PB 3R3GB 1NRSH 2VIPA 5TCCA 1ETSH 3MH5A 3AVZA 4Y76A 3SQEE 3UPEA 2ZHQH 4Q7YA 2FOGA 2P8OC 1UVSH 2ZDVH 1ZPZA 4CH2B 1EXFA 1SMFE 1OP8A 1MAXA 3GDUA 3SHAH 1DXWA 4X8UH 4UFFH 2UUFB 1C5YB 1W14U 4GCHG 4ZXYH 2A45B 1MD8A 1ZTLA 3MO3A 1GJCB 1KTSB 3RXTA 1LHDH 4CRCA 1AI8H 5H4IB 1L1JA 2J9NA 3GYMA 3M3TA 4KKDA 1EQ9A 1VITG 2OCVB 2ZDAH 1O3MA 3HPTB 3VB4A 3ZV8A 2D1JA 3PYHA 1D9IA 3P92A 4AG2A 4B1TA 3EA8A 3P70B 1EOLA 1MZDA 4CR5A 3P6ZB 2B9LA 2GCHF 1D6RA 3C1KA 1QA0A 2OP9A 2ODQA 3PB1E 1C5LH 1AFEH 1KLIH 1O3CA 3MNXA 3A7TA 4JZEH 3LIWA 2Z9JA 1A2CH 3VB3A 5I25A 2SGEE 1HDTH 1CGJE 1OYTH 1K22H 1GBLA 2AMQA 1FIZA 6CHAB 4YZUA 5GPIB 1O3KA 4UFDH 1C2FA 4BTTB 3F1SB 2PTCE 2Z3EA 3PWBA 3UOPA 1XVOA 1QL9A 1Y3UA 1SLWB 3ZZ3A 3SW2B 2R2WU 3MOCA 4YT7H 1ANCA 3RXKA 2BDGA 5C67A 2BVSH 2VWNA 1DUAA 1RFNA 3B23B 3UQVA 1AY6H 3BG4B 1HAPH 3MH4A 1O5BB 1GVZA 3EQ0H 1RIWC 5EOKA 2ZU1A 1SPJA 2PKSB 3M5MA 1NFYA 2WUCA 1KXBA 3LH3A 1TA2A 1N8OB 4O97A 3GY8A 3SU4A 2GDDA 1C5SA 5EQRA 3SJIA 3UFAA 1JXPA 3UNRA 2HALA 3E8LA 1BRCE 3DUXH 1E35B 1DLKB 5ABWA 1JIRA 2ZPRA 2VU8E 4DCDA 1TWXB 2OC8A 4UONA 4THNH 4A1XA 1DSTA 1LKBA 2ZGJA 2G4TA 4CRAA 4DVAU 3UNSA 1ETRH 4MPUA 4B71A 1NZQH 2IOTA 1T8OA 1W10U 5CHAB 2ANMH 2YNBA 1TA6A 1BDAA 1GI4A 4Y11E 2XYAA 2XXLA 3T5FH 3VXEH 1YC0A 2VNTA 4FUCA 3CENA 1NRNH 1T32A 1P09A 3P8GA 1UJ1A 3EDXB 2PUQH 2C8XB 3T27A 2Z94A 1O2NA 1SGCA 2EEKA 1ELCA 1IQFA 1H9LB 3RC5A 2ZGHA 2ZQ2A 2DE9A 1XVMA 1O5FH 2XCFA 3VGCC 2GV6A 4B2AA 2VJ1A 1MTNB 5EGMA 3GDVA 1C1TA 1GHYH 4Q7XA 1THRH 1O5EH 2A0QB 2BM2A 4BTUB 4JMYA 5C20A 3BTHE 2P3TB 3SJ9A 2WPMS 1TX8A 2ANWA 1MH0A 2OTVA 2Q6DA 1C5QA 5T6FA 3UR9A 2ZI2H 2EI8A 5E2PA 1QA7A 1S0RA 1DFPA 3SU0A 4PROA 1OXGA 5FCRA 1H9HE 1A3EH 3SGBE 2K1QA 2ZU2A 1QJ1B 3ZVAA 5DG6A 1AQ7A 1TQ7B 1CT0E 3LC5A 1GBIA 2CF8H 1FY3A 1AKSA 3RXBA 2EI7A 2STBE 2WPIS 3SUGA 5F6MA 1GCDA 1Y59T 3SU3A 1BIOA 2F83A 3SHCH 1HNEE 2OQ5A 2PKAB 5LGOA 4Y0ZE 1C5UA 1NS3A 2ZTXA 1CE5A 1F0RA 1KYNA 2AYWA 2F9PA 2B8OH 5L30H 1MCVA 2PSXA 2TPIZ 2VIOA 1P12E 2JKHA 3SV2H 2GZ7A 3IITA 1SGRE 3UY9A 5EW1H 2NU3E 2BXUH 1YPKH 2QF3A 3LGIA 2ZNKH 2G4UA 4MVNA 4SGBE 2ZCKP 3M36A 1LDTT 1QTFA 6LPRA 2FLRH 1FXYA 4ABDA 1P9UA 3Q3YA 4J1YA 4O3TA 3RXFA 1G3DA 1AVXA 1H9IE 4OS6A 1UTJA 3TNSA 2HPPH 2GCTC 3RC6A 1GHWH 1O33A 1Y3YA 5DP7A 3Q3KA 2Q6FA 1CT4E 2PR3A 1XUFA 5TCAA 2FM2A 1UK4A 3M3VA 3UOUA 2W3IA 2QXHA 3ZVCA 3NZIA 5TJXA 1C5OH 3Q76A 2GZ8A 1FONA 2BX4A 3RMMH 1KXDA 2R0LA 1BTXA 4BAOB 5EODA 3UREA 1TNLA 4U32A 1K28D 3F68H 1BZXE 2PUXB 4X8SH 5JBAS 1C2IA 1HIAB 1TNIA 3S9CA 3KQDA 3A80A 1S6HA 3V13A 1DOJA 3K6ZA 1G2MA 2P3UB 1ZOMA 1WSSH 3UR6A 1TNKA 3SNBA 1P04A 2XBXA 4GCHF 1W7GH 2ULLA 3KQCA 4ISNA 1V2ST 1C5MD 1VGCC 2OQUA 4KP0A 1K1IA 1UVTH 2ZFPH 2OINA 1B0FA 1SG8B 3QK1A 8ESTE 5FPSA 1MZAA 1QB6A 4ASHA 2A1DB 3SNCA 2H9EH 1FLEE 1QY6A 1O2XA 1VITF 1EOJA 3MU1A 3BTME 1FPCH 4D9QA 1OYQA 1C5ZB 3MU0A 4Y8XA 2XC5A 1FDPA 1B5GH 3L33A 2O8LA 1MTUA 5F8TA 2WYJA 1XMNB 2BVRH 2GGVB 1LPGB 2ZPSA 1IQGA 2F3CE 3AW1A 1K1LA 4BNRA 1AUJA 1V2PT 1C1VH 2FODA 1GG6B 1D3TB 1OKXA 1E36B 4TY7A 3PMBB 3A8CA 5FPTA 3TH2H 3U98H 3QTVH 1YCPK 4AFSA 3A7VA 6ESTA 3RXQA 1DXPA 3QGNB 4OS2A 1SGDE 1P2KA 1OX1A 2GTBA 1V2OT 1EP5A 2WPLS 3LT3A 1J15A 4NWLA 1AB9C 2V0BA 5DP6A 1WYKA 3ZVFA 3SGQE 2FX6A 1QJ7B 4Q80A 1SLUB 1P2MA 1QR3E 2BD2A 5FXLA 4AZ2B 2ZTYA 1AGJA 4MNVA 1CT2E 2ASUB 3LU9B 4IC5A 1TBZH 1SGFA 1UCYE 1HAYB 3M7TA 4RKOB 1O37A 4XDEA 5CE1A 1OWKA 4JZ1A 2BY7X 3PO1B 4I32A 1O2YA 2XWAA 7GCHG 1RTFB 2QV1A 2C8ZB 1EASA 5ESBA 2FLBH 4NA7A 5DPAA 3PMHB 1GCTB 2GP9B 1ELGA 3KF2A 4CRGA 2PFEA 3MNCA 2A2XH 2UWLA 3SNDA 2GV7A 3JZ1B 4CBNA 1HPGA 1TAWA 5C3NA 3VXFH 4YOGA 1QIXB 2BDHA 1OWDA 1IQLA 3LOXA 2A7HA 1K1NA 3MO9A 4X8TH 2Y5GA 1DPOA 3KQBA 3AW0A 1GBJA 4MPXA 1TMTH 3PMJA 2FI5E 1QBOA 9LPRA 1YPLH 2ZG0H 1TBRH 3RC4A 3UQOA 1XKBC 2OLGA 3U8RH 2BQWB 5C1XA 1NY22 2BQ6B 1HAGE 1SC8U 2VIDA 2PSYA 1AD8H 4ZKSU 2PV9B 3GISB 2KAIB 1HYLA 2XBWA 1EATA 2HOBA 2ZFTA 5EPYA 3S69A 3K6YA 1W3CA 2C8WB 3BIVH 5HGGA 4AYVB 4LOYH 3MH6A 4DY7B 3LJJA 4AB9A 2PKAA 3F6UH 3U8OH 1A0HB 1GI8B 2BD8A 3E90B 2ZC9H 3SU5A 3KL6A 4FVDA 1C4U2 3LGYA 4FUFA 1QBNA 2F91A 1YCPH 1QBVH 5DP4A 4X1SU 1L4DA 3M61U 5A09A 1UTNA 1EAIA 3FP6E 3K65B 3GCTG 1GBCA 3M3SA 3Q00A 4KTUA 1K21H 1PPEE 1GBBA 1VCQA 1AVWA 2QN5T 3A7ZA 1DX5M 3T26A 1IHSH 1V2NT 4ZXXH 1TRYA 5ESTE 4TPYA 3A81A 4IS5A 2AIQA 4QT8C 1QRXA 2SNVA 1MCTA 1HAZB 3LONA 3S7KB 1DITH 2IN2A 1EAUA 4XSKU 4UFEH 1GDQA 4VGCC 2ZFRH 3L3TA 1AZ8A 5HM2A 3RM0H 1ZRBA 5E0GA 2W7SA 1TNHA 2QAAA 1NRQH 1LVBA 3P8NA 1BHXB 1NU7B 1OPHB 3EA7A 1F0SA 1LTOA 2A4GA 4JYTA 4CRBA 4XBCA 2BMGB 1IQEA 3QO6A 5T6DA 1D3QB 4I8LA 3RXGA 2WPJS 2VWMA 2O8UA 1V2MT 4A6LA 2G52A 4X2YA 2J94A 2BTCE 3MI4A 1HIAA 5AVDA 4KTCA 5HM9A 3EYDA 4JYUH 5AFZH 1K1MA 1IQIA 1W8BH 4DGJA 5LPEA 1MQ6A 3RXCA 3SV7A 3SU6A 1TONA 1MBQA 4CHAC 1TPSA 1HV7A 1NT1A 1BMMH 3U1JB 2CJIA 1E37B 5FX6A 1BTYA 1Q2WA 1MKXK 1CU1A 2ZHFH 2CHAC 1GL1A 1SQOA 5E2OA 2ZCLP 1GI1A 1P3CA 1FIWA 2FOAA 2QCYA 1O2HA 1TGBA 1NFWA 2SGFE 1ZR0A 2XC0A 4NGAH 1GI5A 1VITH 2G55A 3FP7E 5F8ZA 1WCZA 1G32B 2I6QA 2W7UA 4M7GA 3ZVEA 1LVOA 1FUJA 1EX3A 1TB6H 3ZZ7A 1Z8RA 1A5IA 1AHTH 1V3XA 1O2UA 3RXPA 3FANA 4X6MA 4DURA 2BHGA 1P2IA 1SGFG 1RS0A 4OS4A 4YM9A 1UCYK 2B7DH 1FPHH 2BDYA 1Y3VA 4XBBA 2BDCA 3RXMA 3U9AH 2TGAA 2UWPA 4CRDA 2R3UA 1XUKA 2VGCB 1YPMH 1LHEH 1UTMA 3RU4D 1WBGB 1TNJA 1O2OA 1HXEH 4ESTE 2HNTE 3SJOA 3TJNA 4KTSA 3SOSA 2EA3A 4X6NA 1CHOF 1M9UA 3LH1A 1SGPE 3DFLA 1C2HA 1CBWC 1NM6A 2D26C 2JETB 5FHTA 2D8WA 8GCHG 2R0KA 3IG6B 1THSH 2QY0B 4GVUA 1EB1H 1A4WH 3MWIU 1ORFA 1KY9A 1O2VA 3ATLA 3SU1A 2FDAA 3FZDA 1Z8GA 1BITA 2CN0H 1GI7B 2ZGXH 1IQNA 1O3OA 4XOJA 2Z9IA 1GHAF 1O3GA 1VZQH 1AUTC 1UHBB 2A4OA 1GGDB 2C4FH 3GY2A 1O3HA 4AYYB 1YPEH 2J34A 3EBNA 1NTPA 3M7UA 3AAVA 1O2PA 2LPRA 3RXOA 7GCHF 1MKXH 4F4OC 3I78A 1WTHD 2P93A 4YTAA 4WMFA 4MNYA 3F9HA 2KAIA 2B5TB 2A4RA 2HNTF 1IOEA 2FOMB 4DIIH 3TGJE 3UNQA 1W0YH 2BOKA 1P10A 3UIRA 3BIUH 1XUGA 5GXPA 2QC2A 1JOUB 5FBEA 2H1UA 5C1YA 4X1NU 1NO9H 2ZPQA 4ZAEA 3QN7A 4U01A 3DA9B 2ZO3H 1K1PA 2TGPZ 1O31A 4X2VA 3DD2H 1C1NA 3MNSA 3PM3A 1UCYH 4I33A 6GCHG 1GI3A 5J4SA 3VB5A 2FOCA 1KIGH 3A8BA 4AFZA 3V12A 2PHBA 1BMLA 4FU7A 1ZPCA 5DP5A 5EPNA 1D3DB 3FAOA 1C2GA 1GBEA 3U69H 3QLPH 3A87A 1ZMNA 2A5IA 3SJ8A 1D6WA 2C90B 1W0ZU 1E0FD 1SR5C 2A4QA 1QB1A 1HXFH 4ZHMU 1FAKH 1XXDA 3M35A 2BDBA 4INHA 5FX5A 1GHXH 3SORA 3GY4A 4YESB 4IMQA 2BQ7B 1FAXA 3BTDE 3GCTF 4H6TA 4OGXA 3RP2A 2Q6GA 3ATWA 3A89A 1FMGA 3SGAE 1TPOA 1WU1A 1BT7A 3FZZA 4ABGA 1GBMA 4LXBH 3RXIA 3KIDU 2OXSA 2A7CA 2XC4A 4NFEA 1T31A 4Y10E 8LPRA 4NCYA 1C2LA 2SGDE 2EC9H 1EJAA 2BZAA 4Y0YE 2ZU3A 2W26A 1SQTA 4K2YA 1A3BH 4TPIZ 1GJAB 4GAWA 1P3EA 4HTCH 1CHGA 1NESE 4E05H 1RTLA 2A2QH 2FOBA 3HK3B 1MU8B 3GCHC 1P11E 4Q7ZA 3RMLH 1D3PB 1PQ5A 1ZSJA 1GHVH 5E0JA 4I8GA 4OS5A 1O2LA 1GJ6A 2OC7A 2F9NA 1IHTH 1CA0B 2RA3A 5GCHG 3ODDA 1O3FA 2EI6A 3VEQB 1A46H 2ANKH 1KLTA 1QQUA 1ZZZA 1SHYA 3NXPA 2QGRA 1IQJA 1B0EA 1P2JA 2AMDA 5HMAA 3A8DA 1GVKB 4FUEA 3M5NA 3ODFA 4BOHA 4RSPA 4NIWA 2ODPA 5BRRE 3SV6A 4IN2A 4JK6A 4JK5A 2BLQA 1S83A 3E6PH 3BEIB 2P8OB 4B2CA 4K8BA 3RXJA 1V2KT 2NWNA 1A5HA 3RXEA 1BJUA 3QUMP 3PROA 2GT8A 4E06H 4K8YA 1VCPA 2XCNA 4X8VH 1INCA 1IAUA 1AFQC 3NKKA 3SUDA 4D8NA 2CV3A 1MMJN 4AORA 3VB6A 5DK1A 1CSOE 4FUJA 2ZDLA 3A7XA 1O3BA 1V2JT 1V2UT 4X6OA 2ZHWH 2VWOA 1RTKA 3GY3A 3A85A 4NIXA 3R0FA 1UTKA 1F92A 1E38B 2WV5A 3SNEA 3C27B 4NIVA 3RM2H 2BDIA 1L0ZA 2FOEA 4X6PA 1C1QA 1P02A 1T8MA 3PTNA 1SB1H 3M5OA 5DKMA 2PGQB 3CS7A 4BAQB 1G2LA 3A86A 1SOTA 2XTTB 1ESAA 1XKAC 2ZHEH 4GSOA 1ZTJA 1Z71A 2Y6TA 3SJKA 1UHBA 2STAE 1BB0B 3MU4A 1P05A 3ATMA 4FXGH 3LGTA 1Y8TA 1ZJKA 4ABAA 1X7AC 1C2JA 2A5AA 3S7HB 1RIWB 8GCHF 1VR1H 1JBUH 2J38A 4WVPE 4MPVA 4TWYA 1GJDB 4INLA 5IDKA 4FUDA 3OY5U 4NA9H 1C2KA 4YLQH 4ZHAA 1VCWA 1O30A 1HAXB 1MUEB 1SFQB 1HRTH 1YF4A 2FYQA 2NU0E 5LPRA 3URDA 1QURH 3RLYH 4FU8A 1TQ0B 1Q3XA 1Y5UT 2FZZA 4UE7H 3W95A 1D4PB 1UVUH 2OBOA 2ALVA 2HNTC 3MYWA 1GI0A 4K1EA 1EZQA 3ZVBA 7LPRA 4WY3A 5FBIA 2R9PA 2K7XA 4FUGA 5GIBA 2UUKB 3S0NA 3RXHA 3GOVB 4BAKB 1UK3A 4UFGH 3H7TA 3LGUA 4A1VA 2UUYA 4KELA 4H6SB 4LK4A 1PQ8A 3BTTE 2TBSA 4AGKA 4ABEA 1EZXC 3STIA 3F9GA 2ZCHP 5FCKA 4I7YH 4NFFA 1V6DA 4R0IA 2YOLA 1Z8IB 2AIPA 1OP2A 3TJUA 4XFQA 2DUCA 3RXAA 1ELEE 2OC1A 5JBCS 3A7WA 3NUMA 1BTWA 2XRCA 1DT2A 2Z3DA 3ZZBA 1TFXA 1QGFA 2G8TA 4F49A 3STJA 3RXRA 4B74A 2LIZA 3P8FA 1FV9A 1HGTH 1P8VC 1BMAA 3VGCB 6GCHF 1S5SA 2IJOB 5C2ZA 3ZV9A 2Q1JA 1F5LA 1ANEA 2HRVA 1O32A 1SGNE 4O3UA 3VFEA 3E16B 5EW2H 2Y82A 1ELBA 1GMHG 2GX4A 2AGIX 1BRBE 3U1IB 2Z9LA 1V2WT 5AFYH 4X2XA 4DIHH 4AN7A 1HCGA 2R3YA 4BANB 1P06A 1SGTA 2FP7B 1OWIA 1ZLRA 3A82A 1EJMA 2ZF0H 1CGHA 2VVUA 1BBRE 1L4ZA 3MO6A 1EZUC 5EXNA 2W5EA 4JYVH 1FN8A 3ITIA 5PTPA 2BOHB 2ZFSA 1PPZA 1XXFA 1DE7H 1EAXA 1OOKB 2BD4A 5DO4H 2OD3B 1DUEA 3FVFB 1WQSA 4J2YB 3WY8A 3VB7A 4MQAA 1S6FA 3E91A 2NU4E 1ACBE 1DWBH 4Y7BA 4X1QU 3KCGH 4ABHA 1DICA 1QRZA 3SNAA 1YPJH 1GDUA 1O2MA 4U30A 4A5TS 1ELAA 6CHAC 1QL7A 4K3JA 1RD3B 2OC0A 5IYTA 1MQ5A 2BY6X 1NRPH 3RXUA 4DJZB 2F9UA 4I8KA 3A84A 1O3IA 2WINI 7KMEH 1SVPA 2Y7ZA 4D9RA 4WWYA 1O2SA 4YO9A 1O2JA 1HBTH 1B7XB 2VIWA 3BG4C 1GBFA 1TGNA 2GMTB 2BX3A 1ZYOA 4I8JA 4NZLA 1O2WA 3QTOH 4B75A 2GCTB 2BYAX 2AH4X 2BVXH 1TRNA 3RU4E 1C1WH 2PKSC 3KEEA 1N8OC 7ESTE 3QGJA 1C4Y2 2FS8A 3D62A 1AU8A 1ZMJA 4RKJB 4XBDA 3TK6A 1J14A 5C1UA 1PQAA 3F9FA 1U6QA 2P16A 1T8LA 4B2BA 4D7FA 4NWKA 1TPAE 1Z7KA 1KSNA 2ZKSA 1BRAA 2THFB 1XUHA 1SSXA 5LPFA 5GCHF 1O36A 5EXLA 1CA8B 1K9OE 1TYNA 4BXSA 1C1OA 1C1SA 5EXMA 2ZA5A 3N7OA 1TGTA 2AGEX 3TK9A 1FJSA 3VPKA 4ZHLU 4AG1A 1P57B 2Y7XA 1SGQE 1AWHB 1WAYB 1C5RA 2WPKS 1G37A 1KDQB 1MKWK 1WV7H 2FWWA 1O2TA 5CHAC 5DP3A 2FTMA 1F5KU 1A5GH 1V2QT 3TU7H 1YP9A 1C5PA 3ZYEA 2VIQA 1HFDA
chains in the Genus database with same CATH superfamily
3DSGA 1PQ7A 1GMCG 2SNWA 1VGCB 1NPMA 3UUZA 4AOQA 1LKAA 2VIVA 2NU1E 2BY5X 3MH7A 2ZWLH 5T6GA 1C4V2 1BMNH 3EA9A 3KHVA 2VINA 2Y80A 1O2KA 1ZHRA 4Y8ZA 1JMOH 2Z3CA 2BY8X 3PLBA 5L6NH 2GDEH 3N99A 4GHTA 1UK2A 1QB9A 9ESTA 2WV4A 1MTNC 3RLWH 3RDZA 4CBOA 1YBWA 3O8RA 3ZZ6A 2BY9X 3ZYDA 1CGIE 2QA9E 1TRMA 1F2SE 2QF4A 1ELVA 3ZZ9A 3DT0H 2FX4A 4X0WU 1GJ5H 5CHBA 1DY9A 1NFUA 1YKTA 5HYOA 1ARBA 1KXAA 5J4QA 1LMWB 1ZHPA 1PPCE 2O9QA 4HZHA 4WXIA 3BSQA 5C5OA 1O34A 5EQSA 3V0XA 1K1JA 3UWIA 1W0JD 1NU9A 3MTYA 2OBQA 1DDJA 1AB9B 4IW4E 2G00A 1Z1JA 2FXRA 3T25A 1E79D 1NROH 1C1PA 1C5TA 3GCNA 1BA8B 5DJ7A 4Z0KA 3GY6A 3PLKA 3T2NA 1TPPA 1CA0C 3ATIA 1YPHE 4GUXA 3I77A 1W2KH 4A92A 5A2MH 4JZFH 4Y8YA 3SUFA 1PJPA 1EJNA 2Z9GA 1ELTA 2PWXA 2YMSB 3SO3A 1HAHH 3D65E 2PTNA 2P95A 3O8CA 1ELFA 1PPFE 3SI3H 1TGCA 2XWBI 1QQ4A 2O8TA 1IQHA 3EAJA 1ABIH 1MKWH 4ZMAH 4ISIH 1O5GH 1QFKH 3K2UA 1BBRK 2V3MA 1MBMA 3AAUA 1GVLA 1W11U 3EE7A 1Y3WA 1C5VA 2QYIA 3FKSD 4Y71A 4ZKRU 2BLOA 1ZTKA 1VKYA 4K5ZA 4GPGA 2VWLA 1AN1E 4XE4A 3Q3XA 1BHXF 4MNXA 1HAVB 4NG9H 3F0PA 3BTQE 1UMAH 2BD9A 2J2UA 3GYLB 2V3OH 2R2MB 3KNXA 4HFPB 3P8OA 1V2RT 1P03A 1RGQA 1YPGH 2TIOA 3KGPA 2HLCA 2BB4A 3A88A 5AF9H 1O3DA 4CH8B 2TGTA 1V2TT 2TRMA 3A7YA 3BTFE 1SOZA 4FUBA 4DG4A 1DM4B 1BUIA 2BD7A 4BTIB 2C8YB 5EQQA 3GY7A 1PFXC 2Z6BD 3NPSA 3ELAH 2ZDMA 4ZH8A 1XUIA 1GHBG 1GMHF 1KTTB 1TMBH 4ZKOU 3SI4H 1T4VH 1C2MA 2V35A 1VJAU 4SGAE 3OYPA 1QJ6B 4UDWH 3T28A 4D76A 1EAWA 4WF8A 1AMHA 4Y7AA 4KGAA 1N6XA 3N7DA 3D49H 8KME2 1E34B 3MFJA 1THPB 1YLNA 1GI2A 2BD3A 3TGKE 4R8TB 4AGJA 1PYTD 2AFQB 3BEFB 1Z1IA 1LVYA 1K2I1 2RCEA 3KQ5A 1RJXB 2AGGX 1HJAB 1OWEA 5L2YH 1BJVA 2HGTH 4MG3A 3W94A 1SQRA 1WQVH 1BTUA 1SGEE 1SHHB 4I8HA 3OU0A 4VGCB 2GZ9A 1MTVA 1GWAA 1TX7A 2JH5D 2FI3E 5A0AE 3QDZB 1CVWH 1GG6C 2ZDKA 2ZFFH 4GHQA 1UW7A 5HIZA 4K1TA 1OS8A 2FYRA 5A0CA 1O3NA 2HPQH 3O8DA 2V3HH 3DFJA 1BTZA 2A31A 1DS2E 1AE8H 1QNJA 2ZQ1A 3MU8A 5FPYA 4GLYA 2HVXA 3H09A 3BN9A 5A0BA 1O3AA 1GMDG 1SLXB 2O8WA 2FEQH 1BBRH 5A8XA 2BLWA 1OWJA 3TGIE 2BD5A 1LHCH 1GJBB 4MNWA 2ILNA 1KDQA 1TIOA 1V2VT 3TLOA 2QF0A 3OTJE 4E7RG 1YLDA 1H8IH 1QZ8A 3D23A 1PPGE 1AIXH 2F9BH 3K9XB 3SQHE 2BLVA 4CHAB 2ZTZA 1BCUH 1C5WB 3TJVA 1RXPA 1AWFH 1S84A 1EKBB 4ZCNA 5CMXH 3PO1C 3M7QA 2H9HA 4ISLA 1LCYA 1GI9B 1F5RA 1XUJA 2Z7FE 3EGKH 3ZZ5A 1O39A 1FN6A 2BZ6H 1UVPA 2RG3A 5F03A 2OUAA 1TOMH 2G5NA 1KLJH 1LQDB 1GCTC 2CHAB 3G01A 3PWCA 4WH8A 4MLFB 2SFAA 1UTOA 3UTUH 4DW2U 1NBME 1DWEH 5B6OA 1C1MA 1F0UA 1O35A 1P0SH 1ANDA 2UUJB 2JH6D 2UWOA 1EPTB 1HLTH 4K69A 4U2WA 2JH0D 1G36A 3BF6H 3BTGE 3RXVA 5JBTA 1GHZA 2YMSD 2O8MA 1GMCF 4O03A 1TMUH 1ZJDA 1QL8A 3NK8A 3PRDA 1GJ7B 4HGCA 1SFIA 1DLEA 1DWCH 2XW9A 1W0KD 4TWWA 5AHGH 2F9VA 1SKYE 1TBQH 3S9BA 1JRSA 1FY1A 2JIZD 2P3FH 5SGAE 5JB9S 3E1XB 4H4FA 5CDFE 4IGDA 1CQQA 3MQKC 2WPHS 1YLCA 1GPZA 1MU6B 1HJ9A 1O3EA 2ZU4A 4FETA 3JZ2B 4ZROA 4NSYA 3Q77A 3MU5A 1OSSA 3ATKA 2ZU5A 2P59A 3ESTA 4ABIA 4CRFA 1GDNA 1CBWB 1IQKA 4A1TA 3T29A 1NN6A 5EJLA 3OSYA 1GBTA 1YCPM 3FP8E 4P00A 3VG8A 2GMTC 2H5CA 4K1SA 1H8DH 1UTLM 3TITA 1TOCB 5I46H 4ABBA 1ZRKA 4YT6H 3MMGA 5C5NA 4INKA 3SV9A 1DVAH 1Y5AT 1EP6A 4JCNA 4TY6A 5K0HA 3H7OA 4I31A 1SL3A 5FAHA 3EE0B 1HAVA 2A7JA 1O2IA 3PLPA 5E0HA 2K0QA 2SGQE 1FX0B 5FL7D 1O5CB 2ESTE 4E7NA 3RMOH 1C5XB 1DANH 1BTPA 3TK5A 3OAAD 2V6NA 3U8TH 2BDAA 2QXIA 1EB2A 4B73A 1CO7E 2ZDNA 2ZIQH 5HXFA 1EUFA 2ALPA 1UO6A 2CMYA 1RRKA 1G9IE 1QHRB 1T7CA 4MTBA 5KGOA 3TPIZ 1OHHD 2HWLB 2IPHA 1PYTC 3HK6B 2XNIA 1ETTH 4TSFD 4IMZA 3M37A 3B9FH 2FI4E 3L6PA 1NBMD 3RUOA 2JDID 4FUIA 4DT7B 1C5NH 1MTWA 3LKWA 1C9PA 1FY5A 1Z6EA 1YPHC 3I29A 2A5KA 1F7ZA 5C0TA 4BAHB 2GVFA 1H1BA 2DE8A 3LPRA 2Y81A 2GT7A 2CXVA 4OGYA 1J16A 3BTKE 3CNRA 2ZHDA 4ISOA 4X1RU 3GS9A 1ZMLA 1G3EA 3P17H 3PV5A 3RXDA 1CHOG 2OK5A 3UWJH 3CP7A 1ANBA 2D2DA 1GHBF 2FOFA 1GL0E 3TH3H 3F9EA 1KMHB 4CR9A 1G3CA 4UEHH 2FOHA 5DGJA 2HVYB 1ZHMA 2J98B 1Z6JH 1LO6A 2P94A 4NSVA 3LJOA 2AEIH 4UD9H 1C9TA 2ODYB 3SU2A 3PMAB 1TX6A 2SGPE 2JJ1D 3TNTA 1JRTA 1P2NA 3QZQA 2ZP0H 1ID5H 3GY5A 5DP9A 4AFQA 4D7GA 4NZQA 2GCHG 1WTGH 1SBWA 2G81E 1ZPBA 5JPMH 5BPEA 1GJ9B 3HKIB 1NFXA 1SGYE 5LH8A 1S82A 2ZECA 4HI3A 2H9TH 1GHAG 2GKVE 2Y5HA 1LPKB 2VGCC 5EU8A 1G30B 2PLXA 3ZZ4A 1A1RA 1DY8A 1NRRH 2M5TA 1ZGVA 3GICB 5DP8A 4DOQA 5L2ZH 2A32A 2FO9A 2F9OA 3O8BA 2B0FA 4LZ1H 1ZSLA 4X2WA 4WH6A 1A0JA 1SQAA 4LZ4B 1MAYA 4YOJA 4YOIA 1UVOA 3CS0A 3NCLA 1MTSA 1MABB 3FO8D 1HAIH 3V7TA 2VVVA 1H4WA 1LHFH 2NU2E 4MPWA 4RT1A 5T3HA 2ZEBA 3F2FA 2JETC 1GBDA 2ZZUH 3PTBA 4Y6DA 1BOQA 4JZIA 1PPBH 1A7SA 3RXSA 5K7RA 3ZZ8A 3GCHB 4Y79A 3RMNH 3MNBA 1J17T 4AFUA 1UTPA 3SZNA 1O5AB 3A8AA 3UB0A 2ZFQH 3E3TA 3RU4T 1GMDF 1G3BA 1JIMA 1T4UH 1T8NA 3DHKH 2XBYA 2SGAA 4RN6A 2H6MA 1AE5A 1GJ4H 1O0DH 1Z8JB 1KXEA 3IWMA 3BTWE 3OEED 2FTLE 1O5DH 1P01A 4FUHA 2WUBA 3QX5H 4DT4A 1EPTA 1YYY1 1GGDC 3HGNA 1FI8A 1ZSKA 3KYFA 1KXFA 2WSSD 1VJ9U 1HJ8A 3ENSB 1ZGIA 4FVBA 1LPZB 2TGDA 2RDLA 5JYIA 3P95A 4B6EA 1J9CH 3SBKA 1JWTA 5EG4A 1N1LA 4CREA 1AVGH 3MHWU 2J92A 1A0LA 2VH0A 1PPHE 1EZSC 2G51A 1HAOH 1HB0B 1TLDA 2CF9H 2ZGBH 1FY8E 2QIQA 3F3BA 3TIUA 1OP0A 2PW8H 3M5LA 1S0QA 3TH4H 4BAMB 3ZZAA 5ETXA 1NC6A 1Q31A 4A7IB 1S85A 2G5VA 5GDSH 1AFQB 1LQEA 1O3LA 2QXJA 3SV8A 2VH6A 2LNCA 2CGAA 1J8AA 1P9SA 3H5CB 1W12U 2C3SA 2AS9A 2H2ZA 1GI6A 1GBAA 2FIRH 1ESBA 1BTHH 4Z1MD 3A83A 2FS9A 4WXVA 1C1RA 1V2LT 4WMDA 1O2ZA 1SGIB 1FY4A 1TABE 4H42U 2WYGA 4IBLH 2VVCA 3OFND 3OTPA 4NA8A 1P2OA 4MDSA 1C2DA 1O38A 1HJAC 5JBBS 1P2QA 2FPZA 4OS7A 1TALA 2I6SA 1AO5A 4Q2KA 1A61H 3KN2A 1GJ8B 3LC3A 1SI5H 1TE0A 3E0NB 1GBKA 1YGCH 1FZZA 1Y3XA 1WOFA 5A8YA 2VB0A 1FNIA 1XM1A 1FQ3A 3BV9B 4ABFA 4ZUHA 5GJ4B 5F8XA 3BEUA 3SN8A 1O2GH 4WMEA 1L2EA 2ANYA 2YNAA 1QRWA 4AX9H 2AERH 1UTQA 4AB8A 1OWHA 5JB8S 1N6YA 1Y5BT 3V3MA 4K60A 1TNGA 1GBHA 1O3PB 1O3JA 2WHXA 1LVMA 2RA0A 3QZRA 2FESH 4IC6A 3URCA 1ELDE 3LGWA 4FOUC 3GDSA 3TVJB 1TGSZ 2J95A 3LGVA 4ABJA 4O9VA 3AK5A 5GWZA 4FU9A 1ARCA 1F0TA 1S81A 2Z9KA 2KR7A 5A8ZA 2AMPA 3HGPA 3S9AA 2XOKD 2XBVA 4OS1A 1BRUP 4YLUA 3OY6U 3BG8A 1O2RA 2W3KA 1KXCA 1K1OA 3RXLA 3FFGA 3GCOA 3HKJB 3ZVDA 4ISHH 2FMJA 1BQYA 1AKSB 1AZZA 1DSUA 1MD7A 1WUNH 3HATH 3B8JA 3KQEA 3PV4A 4WJG2 4Z6AH 1L1GA 5G4BA 3ZZCA 2H5DA 4X1PU 1O2QA 4JZDH 1ABJH 1LHGH 4ZKNU 3TJOA 3T62A 2Y5FA 3QWCH 4TYDA 1SLVB 1YM0A 1C1UH 3NWUA 2BXTH 1EPTC 1QCPA 1DWDH 5EJZA 1ESTA 1XX9A 3SUEA 2GD4B 3AASA 1L1NA 3ZVGA 4IN1A 4BXWA 2ZGCA 1W7XH 3OX7U 2KCPA 1C2EA 3ZZDA 2C93B 3BTEE 1COWD 3LDXH 2J4IA 5JDUB 2J98A 1IQMA 1W13U 2PGBB 2QXGA 5E8EH 4NIYA 4B76A 2L74A 2W6ID 1HUTH 3E0PB 3R3GB 1NRSH 2VIPA 5TCCA 1ETSH 3MH5A 3AVZA 4Y76A 3SQEE 3UPEA 2ZHQH 4Q7YA 2FOGA 2P8OC 1UVSH 2ZDVH 1ZPZA 4CH2B 1EXFA 1SMFE 1OP8A 1MAXA 3GDUA 3SHAH 1DXWA 4X8UH 4UFFH 2UUFB 1C5YB 1W14U 4GCHG 4ZXYH 2A45B 1MD8A 1ZTLA 3MO3A 1GJCB 1KTSB 3RXTA 1LHDH 4CRCA 1AI8H 5H4IB 4F55A 1L1JA 2J9NA 3GYMA 4TT3D 3M3TA 4KKDA 1EQ9A 1VITG 2OCVB 2ZDAH 4I86A 1O3MA 3HPTB 3VB4A 3ZV8A 2D1JA 3PYHA 1D9IA 3P92A 4AG2A 4B1TA 3EA8A 3P70B 1EOLA 1MZDA 4CR5A 3P6ZB 2B9LA 2GCHF 1D6RA 3C1KA 1QA0A 2OP9A 2ODQA 3PB1E 1C5LH 1AFEH 1KLIH 1O3CA 3MNXA 3A7TA 4JZEH 3LIWA 2Z9JA 1A2CH 3VB3A 5I25A 2SGEE 1HDTH 1CGJE 1OYTH 1K22H 1GBLA 2AMQA 1FIZA 6CHAB 3NRLA 4YZUA 5GPIB 1O3KA 4UFDH 1C2FA 5GNDA 3F1SB 3ZIAD 4BTTB 2PTCE 2Z3EA 3PWBA 3UOPA 1XVOA 1QL9A 1Y3UA 1SLWB 3ZZ3A 3SW2B 2R2WU 3MOCA 4YT7H 1ANCA 3RXKA 2BDGA 5EIYA 3N7EA 5C67A 2BVSH 2VWNA 1DUAA 1RFNA 3B23B 3UQVA 1AY6H 3BG4B 1HAPH 3MH4A 1O5BB 1GVZA 3EQ0H 1RIWC 5EOKA 2ZU1A 1SPJA 2PKSB 3M5MA 1NFYA 2WUCA 1KXBA 3LH3A 1TA2A 1N8OB 4O97A 3GY8A 3SU4A 2GDDA 1C5SA 5EQRA 3SJIA 3UFAA 1JXPA 3UNRA 1WDIA 2LP6A 2HALA 3E8LA 3WWFA 5EJ1A 1BRCE 3SYJA 3DUXH 1E35B 1DLKB 2XNDD 1JIRA 2ZPRA 5ABWA 2VU8E 4DCDA 1TWXB 2OC8A 4UONA 4THNH 4A1XA 1DSTA 1LKBA 2ZGJA 2G4TA 4CRAA 4DVAU 3UNSA 1ETRH 4MPUA 4B71A 1H8HD 1NZQH 2IOTA 1T8OA 1W10U 5CHAB 2ANMH 2YNBA 1TA6A 2AHME 1BDAA 1GI4A 4Y11E 2XYAA 2XXLA 3T5FH 3VXEH 2F43B 1YC0A 2VNTA 4FUCA 3CENA 5KECA 1NRNH 1T32A 1P09A 3P8GA 1UJ1A 3EDXB 2PUQH 2C8XB 3T27A 2Z94A 1O2NA 1SGCA 2EEKA 1ELCA 1IQFA 1H9LB 3RC5A 2ZGHA 2ZQ2A 2DE9A 1XVMA 1O5FH 2XCFA 3VGCC 2GV6A 4B2AA 2VJ1A 1MTNB 5EGMA 3GDVA 1C1TA 1GHYH 4Q7XA 1THRH 1O5EH 2A0QB 2BM2A 4BTUB 4JMYA 5C20A 3BTHE 2P3TB 3SJ9A 2WPMS 1TX8A 2ANWA 5C0UA 1MH0A 2OTVA 2Q6DA 1C5QA 5T6FA 3UR9A 2ZI2H 2EI8A 5E2PA 1QA7A 1S0RA 1DFPA 3SU0A 4PROA 1OXGA 5FCRA 1H9HE 1A3EH 3SGBE 2K1QA 2ZU2A 2V7QD 1QJ1B 3ZVAA 5DG6A 1AQ7A 1TQ7B 1CT0E 3LC5A 1GBIA 2CF8H 1FY3A 1AKSA 1BMFD 3RXBA 2EI7A 2STBE 2WPIS 3SUGA 5F6MA 1GCDA 1Y59T 3SU3A 5HIYA 1BIOA 2F83A 3SHCH 1HNEE 2OQ5A 2PKAB 5LGOA 4Q4LA 1C5UA 1NS3A 4Y0ZE 2ZTXA 1CE5A 1F0RA 1KYNA 2AYWA 2F9PA 2B8OH 5L30H 1MCVA 2PSXA 5IK2D 2TPIZ 2VIOA 1P12E 2JKHA 3SV2H 2GZ7A 3U28C 3IITA 1SGRE 3UY9A 5EW1H 2NU3E 2BXUH 2RFKC 1YPKH 3KYGA 2QF3A 3LGIA 2ZNKH 2G4UA 4MVNA 4SGBE 2ZCKP 3M36A 1LDTT 1QTFA 6LPRA 2FLRH 1FXYA 4ABDA 1P9UA 3Q3YA 4J1YA 4O3TA 3RXFA 1G3DA 1AVXA 1H9IE 4OS6A 1UTJA 3TNSA 2HPPH 2GCTC 5DSFA 3RC6A 1GHWH 1O33A 1Y3YA 5DP7A 3Q3KA 2Q6FA 1CT4E 1E1RD 2PR3A 1XUFA 5TCAA 2FM2A 1UK4A 3M3VA 3UOUA 2W3IA 2QXHA 3ZVCA 3NZIA 5TJXA 1C5OH 3Q76A 2GZ8A 1FONA 2BX4A 3RMMH 1KXDA 2R0LA 1BTXA 4BAOB 5EODA 3UREA 1TNLA 4U32A 1K28D 3F68H 1BZXE 2PUXB 4X8SH 5JBAS 1C2IA 1HIAB 1TNIA 3S9CA 3KQDA 3A80A 1S6HA 2KCOA 1DOJA 3V13A 3K6ZA 1G2MA 2P3UB 1ZOMA 1WSSH 3UR6A 1TNKA 3SNBA 1P04A 2XBXA 4GCHF 1W7GH 2ULLA 3KQCA 4ISNA 1V2ST 1C5MD 1VGCC 2OQUA 4KP0A 1K1IA 2L6OA 1UVTH 2ZFPH 2OINA 1B0FA 1SG8B 3QK1A 8ESTE 5FPSA 1MZAA 1QB6A 4ASHA 2A1DB 3SNCA 2H9EH 1FLEE 1QY6A 1O2XA 1VITF 1EOJA 3MU1A 3BTME 1FPCH 4D9QA 1OYQA 1C5ZB 3MU0A 4Y8XA 2GJGA 2XC5A 1FDPA 2JJ2D 1B5GH 3L33A 2IPQX 2O8LA 1MTUA 5F8TA 2WYJA 1XMNB 2BVRH 2GGVB 1LPGB 2ZPSA 1IQGA 2F3CE 3AW1A 1K1LA 4BNRA 1AUJA 1V2PT 1C1VH 2FODA 1GG6B 3WWBA 1D3TB 1OKXA 1E36B 4TY7A 3PMBB 3A8CA 5FPTA 3TH2H 3U98H 3QTVH 1YCPK 4AFSA 3A7VA 6ESTA 3RXQA 1DXPA 3QGNB 4OS2A 1SGDE 1P2KA 1OX1A 2GTBA 1V2OT 1EP5A 2WPLS 3LT3A 1J15A 4NWLA 1AB9C 2V0BA 5DP6A 1WYKA 5B6LA 3ZVFA 3SGQE 2FX6A 1QJ7B 4Q80A 1SLUB 1P2MA 1QR3E 2BD2A 5FXLA 4AZ2B 2ZTYA 1AGJA 4MNVA 1CT2E 2ASUB 3LU9B 4IC5A 1TBZH 1SGFA 1UCYE 1HAYB 3FN8A 3M7TA 4RKOB 1O37A 4XDEA 5CE1A 1OWKA 4JZ1A 2BY7X 3WW7A 3PO1B 4I32A 1O2YA 2XWAA 7GCHG 1RTFB 2QV1A 2C8ZB 2YMSC 1EASA 3F0OA 5ESBA 2FLBH 4NA7A 5DPAA 3PMHB 1GCTB 2GP9B 1ELGA 3KF2A 4CRGA 2PFEA 3MNCA 2A2XH 2UWLA 3SNDA 2GV7A 3JZ1B 4CBNA 1HPGA 1TAWA 5C3NA 3VXFH 4YOGA 1QIXB 2BDHA 1OWDA 1IQLA 3LOXA 2A7HA 2KX4A 1K1NA 3MO9A 4X8TH 2Y5GA 1DPOA 3KQBA 3AW0A 1GBJA 4MPXA 1TMTH 3PMJA 2FI5E 1QBOA 9LPRA 1YPLH 2KM0A 2ZG0H 4B6FA 1TBRH 3RC4A 3UQOA 1XKBC 2OLGA 3U8RH 2BQWB 5C1XA 1NY22 2BQ6B 1HAGE 1SC8U 2VIDA 2PSYA 1AD8H 4ZKSU 2PV9B 3GISB 2KAIB 1HYLA 2XBWA 1EATA 2HOBA 2ZFTA 5EPYA 3S69A 3K6YA 1W3CA 2C8WB 3BIVH 5HGGA 5DN6D 4AYVB 4LOYH 3MH6A 4DY7B 3LJJA 4AB9A 2PKAA 3F6UH 3U8OH 1A0HB 1GI8B 2BD8A 3E90B 2ZC9H 3SU5A 3KL6A 4FVDA 1C4U2 3LGYA 4FUFA 1QBNA 2F91A 1YCPH 1QBVH 5DP4A 4X1SU 1L4DA 3M61U 2W6JD 5A09A 1UTNA 1EAIA 3FP6E 3K65B 3GCTG 1GBCA 3M3SA 3Q00A 4KTUA 1K21H 1PPEE 1GBBA 1VCQA 2K8IA 4XD7D 1AVWA 2QN5T 3A7ZA 1DX5M 3T26A 1IHSH 1V2NT 4ZXXH 1TRYA 5ESTE 4TPYA 3OEHD 3A81A 4IS5A 2AIQA 4QT8C 1QRXA 2SNVA 1MCTA 4ACBA 1HAZB 3LONA 3S7KB 1DITH 2IN2A 1EAUA 4XSKU 4UFEH 1GDQA 4VGCC 2ZFRH 1S6LA 3L3TA 1AZ8A 5HM2A 3RM0H 1ZRBA 5E0GA 2W7SA 1TNHA 2QAAA 1NRQH 1LVBA 3P8NA 1BHXB 1K0HA 1NU7B 1OPHB 3EA7A 1F0SA 1LTOA 2A4GA 4JYTA 4CRBA 4XBCA 2BMGB 1IQEA 3QO6A 5T6DA 1D3QB 4I8LA 3RXGA 2WPJS 2VWMA 2O8UA 4ASUD 1V2MT 4A6LA 2G52A 4X2YA 2J94A 2BTCE 3MI4A 1HIAA 5AVDA 4KTCA 5HM9A 3EYDA 4JYUH 5AFZH 1K1MA 1IQIA 1W8BH 4DGJA 5LPEA 1MQ6A 3RXCA 3SV7A 3SU6A 1TONA 1MBQA 4CHAC 1TPSA 1HV7A 1NT1A 1BMMH 3U1JB 2CJIA 1E37B 5FX6A 1BTYA 1Q2WA 1MKXK 1CU1A 2ZHFH 2CHAC 1GL1A 1SQOA 5E2OA 2ZCLP 1GI1A 1P3CA 1FIWA 2FOAA 2QCYA 2LELA 1O2HA 1TGBA 1NFWA 2SGFE 1ZR0A 2XC0A 4NGAH 1GI5A 1VITH 2G55A 3FP7E 5F8ZA 1WCZA 1G32B 2I6QA 2W7UA 4M7GA 3ZVEA 1LVOA 1FUJA 1EX3A 1TB6H 3ZZ7A 1Z8RA 1A5IA 1AHTH 5T1VA 1V3XA 1O2UA 3RXPA 3FANA 4X6MA 4DURA 2BHGA 1P2IA 1SGFG 1RS0A 4OS4A 4YM9A 1UCYK 2B7DH 1FPHH 2BDYA 1Y3VA 4XBBA 2BDCA 3RXMA 3U9AH 2TGAA 2UWPA 4CRDA 2R3UA 1XUKA 2VGCB 1YPMH 1LHEH 1UTMA 2EY4C 1WBGB 3RU4D 1TNJA 1O2OA 1HXEH 3F2GA 4ESTE 2HNTE 3SJOA 1EFRD 3TJNA 4KTSA 3SOSA 2EA3A 4X6NA 1CHOF 1M9UA 3LH1A 1SGPE 3DFLA 1C2HA 3PRBA 1CBWC 1NM6A 2D26C 2JETB 5FHTA 2D8WA 8GCHG 2R0KA 3IG6B 1THSH 2QY0B 4GVUA 1EB1H 1A4WH 3MWIU 1ORFA 1KY9A 1O2VA 3ATLA 3SU1A 2FDAA 3FZDA 1Z8GA 1BITA 2CN0H 1GI7B 2ZGXH 1IQNA 1O3OA 4XOJA 2Z9IA 1GHAF 1O3GA 1VZQH 1AUTC 1UHBB 2A4OA 1GGDB 2C4FH 3GY2A 1O3HA 4AYYB 1YPEH 2J34A 3EBNA 1NTPA 3M7UA 3AAVA 1O2PA 2LPRA 3RXOA 7GCHF 1MKXH 4F4OC 3I78A 1WTHD 2P93A 4YTAA 4WMFA 3W1EA 4MNYA 3F9HA 4RI0A 2KAIA 2B5TB 2A4RA 2HNTF 2EQNA 1IOEA 2FOMB 4DIIH 3TGJE 3UNQA 1W0YH 2BOKA 1P10A 3UIRA 3BIUH 1XUGA 5GXPA 2QC2A 1JOUB 4RT0A 5FBEA 2H1UA 5C1YA 4X1NU 3PV2A 1NO9H 2QF5A 2ZPQA 4ZAEA 3QN7A 4U01A 3DA9B 2ZO3H 1K1PA 2TGPZ 1O31A 4X2VA 3DD2H 1C1NA 3MNSA 3PM3A 1UCYH 4I33A 6GCHG 2HLDD 1GI3A 5J4SA 3VB5A 2FOCA 1KIGH 3A8BA 4AFZA 3V12A 2PHBA 1BMLA 2J97A 4FU7A 1ZPCA 5DP5A 5EPNA 3F2HA 1D3DB 3FAOA 1C2GA 1GBEA 3U69H 3QLPH 3A87A 1ZMNA 2A5IA 3SJ8A 1D6WA 2C90B 1W0ZU 1E0FD 1SR5C 2A4QA 1QB1A 1HXFH 4ZHMU 1FAKH 1XXDA 3M35A 1WXRA 2BDBA 4INHA 4AC9A 5FX5A 1GHXH 3SORA 1YY3A 3GY4A 4YESB 4IMQA 2BQ7B 1FAXA 3BTDE 3GCTF 4H6TA 4OGXA 3RP2A 2RDEA 2Q6GA 3ATWA 3A89A 1FMGA 3SGAE 1TPOA 1WU1A 1BT7A 3FZZA 4ABGA 1GBMA 4LXBH 3RXIA 3KIDU 2OXSA 2A7CA 2XC4A 4NFEA 1T31A 4Y10E 8LPRA 4NCYA 1C2LA 2SGDE 2EC9H 1EJAA 2BZAA 4Y0YE 2ZU3A 2W26A 1YWUA 1SQTA 4K2YA 1A3BH 4TPIZ 1GJAB 4GAWA 1P3EA 3DCLA 4HTCH 1CHGA 1NESE 3UAIC 1RTLA 2A2QH 2FOBA 3HK3B 1MU8B 3GCHC 4E05H 1P11E 4Q7ZA 3RMLH 1D3PB 1PQ5A 1ZSJA 1GHVH 3FOAA 5E0JA 4I8GA 4OS5A 1O2LA 1GJ6A 2OC7A 2F9NA 1IHTH 1CA0B 2RA3A 5GCHG 3ODDA 1O3FA 2EI6A 3VEQB 1A46H 2ANKH 1KLTA 1QQUA 1ZZZA 1SHYA 3NXPA 2QGRA 1IQJA 1B0EA 1P2JA 2AMDA 5HMAA 3A8DA 1GVKB 4FUEA 3M5NA 3ODFA 4BOHA 4RSPA 4NIWA 2ODPA 5BRRE 3SV6A 3DSOA 4IN2A 4JK6A 2VBCA 4JK5A 2BLQA 1S83A 3E6PH 3BEIB 2P8OB 4M9FA 4B2CA 4K8BA 3RXJA 1V2KT 2NWNA 2PP6A 1A5HA 3RXEA 1BJUA 3QUMP 3SZEA 2WPDD 3PROA 2GT8A 4E06H 4K8YA 1VCPA 2XCNA 4X8VH 1INCA 1IAUA 1AFQC 3NKKA 3SUDA 4D8NA 2CV3A 2QE7D 1MMJN 4AORA 3VB6A 5DK1A 1CSOE 4FUJA 2ZDLA 3A7XA 1O3BA 1V2JT 1V2UT 4X6OA 2ZHWH 2VWOA 1RTKA 3GY3A 3A85A 4NIXA 3R0FA 1UTKA 1F92A 1E38B 2WV5A 3SNEA 3C27B 4NIVA 3RM2H 2BDIA 1L0ZA 2FOEA 4X6PA 1C1QA 1P02A 1T8MA 3PTNA 1SB1H 3M5OA 5DKMA 2PGQB 3CS7A 4BAQB 1G2LA 3A86A 1SOTA 2XTTB 1ESAA 1XKAC 2ZHEH 4GSOA 1ZTJA 1Z71A 2Y6TA 3SJKA 1UHBA 2STAE 1BB0B 3DSPA 3MU4A 1P05A 3ATMA 4FXGH 3LGTA 1Y8TA 1ZJKA 4ABAA 1X7AC 1C2JA 2A5AA 3S7HB 1RIWB 8GCHF 1VR1H 1JBUH 2J38A 4WVPE 4MPVA 4TWYA 1GJDB 2M2AA 4INLA 5IDKA 4FUDA 3OY5U 4NA9H 1C2KA 4YLQH 4ACAA 2J5UA 4ZHAA 1VCWA 1O30A 1HAXB 1MUEB 1SFQB 1HRTH 1YF4A 2FYQA 2NU0E 5LPRA 3URDA 1QURH 3RLYH 4FU8A 1TQ0B 1Q3XA 1Y5UT 2FZZA 4UE7H 3W95A 1D4PB 1UVUH 2OBOA 2ALVA 2HNTC 3MYWA 1GI0A 4K1EA 1EZQA 3ZVBA 7LPRA 4WY3A 5FBIA 2R9PA 2K7XA 4FUGA 5GIBA 2UUKB 3S0NA 3RXHA 3GOVB 4BAKB 1UK3A 4UFGH 4YXWD 3H7TA 3LGUA 4A1VA 2UUYA 4HG6A 4KELA 5F53A 4H6SB 4LK4A 1PQ8A 3BTTE 2TBSA 2KCYA 4AGKA 5C17A 4ABEA 1EZXC 3STIA 3F9GA 2ZCHP 5FCKA 4I7YH 2KFWA 4NFFA 1V6DA 4R0IA 2YOLA 1Z8IB 2AIPA 1OP2A 3TJUA 4XFQA 2DUCA 3RXAA 1ELEE 2OC1A 5JBCS 3A7WA 2CK3D 3NUMA 1BTWA 2XRCA 1DT2A 2Z3DA 5KEDA 3ZZBA 1TFXA 1QGFA 4P02A 2G8TA 4F49A 3STJA 3RXRA 4B74A 2LIZA 3P8FA 1FV9A 1HGTH 1P8VC 1BMAA 3VGCB 6GCHF 1S5SA 2IJOB 5C2ZA 3ZV9A 2Q1JA 1F5LA 1ANEA 2HRVA 1O32A 1SGNE 4O3UA 3VFEA 3E16B 5EW2H 2Y82A 1ELBA 1GMHG 2GX4A 2AGIX 1BRBE 3U1IB 2Z9LA 1V2WT 2KCAA 5AFYH 4X2XA 4DIHH 4AN7A 1HCGA 2R3YA 4BANB 1P06A 1SGTA 2FP7B 1OWIA 1ZLRA 3A82A 1EJMA 2ZF0H 1CGHA 2VVUA 1BBRE 1L4ZA 3MO6A 1EZUC 5EXNA 2W5EA 4JYVH 1FN8A 3ITIA 4OM9A 5PTPA 2BOHB 2ZFSA 1PPZA 1XXFA 1DE7H 1EAXA 1OOKB 2BD4A 5DO4H 2OD3B 1DUEA 3FVFB 1WQSA 4J2YB 3WY8A 3VB7A 4MQAA 1S6FA 3E91A 2NU4E 1ACBE 1DWBH 4Y7BA 4X1QU 3KCGH 4ABHA 1DICA 4Q63A 1QRZA 3SNAA 1YPJH 1GDUA 1O2MA 4U30A 4A5TS 1ELAA 6CHAC 1QL7A 4K3JA 1RD3B 2OC0A 5IYTA 1MQ5A 2BY6X 1NRPH 3RXUA 4DJZB 2F9UA 4I8KA 3A84A 1O3IA 5HKKD 2WINI 7KMEH 1SVPA 2Y7ZA 4D9RA 4WWYA 2IJD1 1O2SA 4YO9A 1O2JA 1HBTH 1B7XB 2VIWA 3BG4C 1GBFA 1TGNA 2GMTB 2BX3A 1ZYOA 2WZQA 4I8JA 4NZLA 1O2WA 3QTOH 4B75A 2GCTB 2BYAX 2AH4X 2BVXH 2KZ4A 1TRNA 3RU4E 1C1WH 2PKSC 3KEEA 1N8OC 7ESTE 3QGJA 1C4Y2 2FS8A 3D62A 1AU8A 1ZMJA 4RKJB 4XBDA 3TK6A 1J14A 5C1UA 1H8ED 3F9FA 1PQAA 1U6QA 1T8LA 2P16A 4B2BA 4D7FA 4NWKA 1TPAE 1Z7KA 1KSNA 2ZKSA 1BRAA 2THFB 1XUHA 1SSXA 5LPFA 5GCHF 1O36A 5EXLA 1CA8B 1K9OE 1TYNA 4BXSA 1C1OA 1C1SA 2F4LA 5EXMA 2ZA5A 3N7OA 1TGTA 2AGEX 3TK9A 1FJSA 3VPKA 4ZHLU 4AG1A 2WV9A 1P57B 2Y7XA 1SGQE 1AWHB 1WAYB 1C5RA 2WPKS 3OE7D 1G37A 1KDQB 1MKWK 1WV7H 2FWWA 5C94A 1O2TA 5CHAC 4XRNA 5DP3A 2FTMA 1F5KU 1A5GH 1V2QT 3TU7H 4F48B 1E1QD 1YP9A 1C5PA 3ZYEA 2VIQA 1HFDA
chains in the Genus database with same CATH topology
1PQ7A 1GMCG 2SNWA 1VGCB 1NPMA 3UUZA 4AOQA 1LKAA 2VIVA 2NU1E 2BY5X 3MH7A 2ZWLH 5T6GA 1C4V2 1BMNH 3EA9A 3KHVA 2VINA 2Y80A 1O2KA 1ZHRA 4Y8ZA 1JMOH 2Z3CA 2BY8X 3PLBA 5L6NH 2GDEH 4GHTA 1UK2A 1QB9A 9ESTA 2WV4A 1MTNC 3RLWH 3RDZA 4CBOA 1YBWA 3O8RA 3ZZ6A 2BY9X 3ZYDA 1CGIE 2QA9E 1TRMA 1F2SE 1ELVA 3ZZ9A 3DT0H 2FX4A 4X0WU 1GJ5H 1DY9A 1NFUA 1YKTA 5HYOA 1ARBA 1KXAA 5J4QA 1LMWB 1ZHPA 1PPCE 2O9QA 4HZHA 4WXIA 3BSQA 5C5OA 1O34A 5EQSA 3V0XA 1K1JA 3UWIA 1NU9A 3MTYA 2OBQA 1DDJA 1AB9B 4IW4E 2G00A 1Z1JA 2FXRA 3T25A 1NROH 1C1PA 1C5TA 3GCNA 1BA8B 5DJ7A 4Z0KA 3GY6A 3PLKA 3T2NA 1TPPA 1CA0C 3ATIA 1YPHE 4GUXA 3I77A 1W2KH 4A92A 5A2MH 4JZFH 4Y8YA 3SUFA 1PJPA 1EJNA 2Z9GA 1ELTA 2PWXA 3SO3A 1HAHH 3D65E 2PTNA 2P95A 3O8CA 1ELFA 1PPFE 3SI3H 1TGCA 2XWBI 1QQ4A 2O8TA 1IQHA 3EAJA 1ABIH 1MKWH 4ZMAH 4ISIH 1O5GH 1QFKH 3K2UA 1BBRK 1MBMA 3AAUA 1GVLA 1W11U 1Y3WA 1C5VA 2QYIA 4Y71A 4ZKRU 2BLOA 1ZTKA 4K5ZA 4GPGA 2VWLA 1AN1E 4XE4A 3Q3XA 1BHXF 4MNXA 1HAVB 4NG9H 3BTQE 1UMAH 2BD9A 2J2UA 3GYLB 2V3OH 2R2MB 3KNXA 4HFPB 3P8OA 1V2RT 1P03A 1RGQA 1YPGH 2TIOA 3KGPA 2HLCA 2BB4A 3A88A 5AF9H 1O3DA 4CH8B 2TGTA 1V2TT 2TRMA 3A7YA 3BTFE 1SOZA 4FUBA 4DG4A 1DM4B 1BUIA 2BD7A 4BTIB 2C8YB 5EQQA 3GY7A 1PFXC 2Z6BD 3NPSA 3ELAH 2ZDMA 4ZH8A 1XUIA 1GHBG 1GMHF 1KTTB 1TMBH 4ZKOU 3SI4H 1T4VH 1C2MA 2V35A 1VJAU 4SGAE 3OYPA 1QJ6B 4UDWH 3T28A 4D76A 1EAWA 4WF8A 1AMHA 4Y7AA 4KGAA 1N6XA 3D49H 8KME2 1E34B 3MFJA 1THPB 1GI2A 2BD3A 3TGKE 4R8TB 4AGJA 1PYTD 2AFQB 3BEFB 1Z1IA 1LVYA 1K2I1 2RCEA 1RJXB 2AGGX 1HJAB 1OWEA 5L2YH 1BJVA 2HGTH 4MG3A 3W94A 1WQVH 1BTUA 1SGEE 1SHHB 4I8HA 3OU0A 4VGCB 2GZ9A 1MTVA 1GWAA 1TX7A 2JH5D 2FI3E 5A0AE 3QDZB 1CVWH 1GG6C 2ZDKA 2ZFFH 4GHQA 4K1TA 1OS8A 2FYRA 5A0CA 1O3NA 2HPQH 3O8DA 2V3HH 3DFJA 1BTZA 2A31A 1DS2E 1AE8H 1QNJA 2ZQ1A 3MU8A 5FPYA 4GLYA 2HVXA 3BN9A 5A0BA 1O3AA 1GMDG 1SLXB 2O8WA 2FEQH 1BBRH 5A8XA 2BLWA 1OWJA 3TGIE 2BD5A 1LHCH 1GJBB 4MNWA 2ILNA 1KDQA 1TIOA 1V2VT 3TLOA 2QF0A 3OTJE 4E7RG 1YLDA 1H8IH 3D23A 1PPGE 1AIXH 2F9BH 3K9XB 3SQHE 2BLVA 4CHAB 2ZTZA 1BCUH 1C5WB 3TJVA 1RXPA 1AWFH 1S84A 1EKBB 5CMXH 3PO1C 3M7QA 2H9HA 4ISLA 1LCYA 1GI9B 1F5RA 1XUJA 2Z7FE 3EGKH 3ZZ5A 1O39A 1FN6A 2BZ6H 1UVPA 2RG3A 5F03A 2OUAA 1TOMH 2G5NA 1KLJH 1LQDB 1GCTC 2CHAB 3G01A 3PWCA 4WH8A 4MLFB 2SFAA 1UTOA 3UTUH 4DW2U 1DWEH 5B6OA 1C1MA 1F0UA 1O35A 1P0SH 1ANDA 2UUJB 2JH6D 2UWOA 1EPTB 1HLTH 4K69A 4U2WA 2JH0D 1G36A 3BF6H 3BTGE 3RXVA 5JBTA 1GHZA 2O8MA 1GMCF 4O03A 1TMUH 1ZJDA 1QL8A 3NK8A 1GJ7B 4HGCA 1SFIA 1DLEA 1DWCH 2XW9A 4TWWA 5AHGH 2F9VA 1TBQH 3S9BA 1JRSA 1FY1A 2P3FH 5SGAE 5JB9S 3E1XB 4H4FA 4IGDA 1CQQA 2WPHS 1YLCA 1GPZA 1MU6B 1HJ9A 1O3EA 2ZU4A 3JZ2B 4ZROA 4NSYA 3Q77A 3MU5A 1OSSA 3ATKA 2ZU5A 2P59A 3ESTA 4ABIA 4CRFA 1GDNA 1CBWB 1IQKA 4A1TA 3T29A 1NN6A 3OSYA 1GBTA 1YCPM 3FP8E 2GMTC 2H5CA 4K1SA 1H8DH 1UTLM 3TITA 1TOCB 5I46H 4ABBA 1ZRKA 4YT6H 3MMGA 5C5NA 4INKA 3SV9A 1DVAH 1Y5AT 1EP6A 4JCNA 4TY6A 5K0HA 3H7OA 4I31A 1SL3A 5FAHA 3EE0B 1HAVA 2A7JA 1O2IA 3PLPA 5E0HA 2SGQE 1O5CB 2ESTE 4E7NA 3RMOH 1C5XB 1DANH 1BTPA 3TK5A 2V6NA 3U8TH 2BDAA 2QXIA 1EB2A 4B73A 1CO7E 2ZDNA 2ZIQH 5HXFA 1EUFA 2ALPA 1UO6A 2CMYA 1RRKA 1G9IE 1QHRB 1T7CA 4MTBA 3TPIZ 2HWLB 2IPHA 1PYTC 3HK6B 2XNIA 1ETTH 4IMZA 3M37A 3B9FH 2FI4E 3L6PA 3RUOA 4FUIA 4DT7B 1C5NH 1MTWA 3LKWA 1C9PA 1FY5A 1Z6EA 1YPHC 3I29A 2A5KA 1F7ZA 4BAHB 2GVFA 1H1BA 2DE8A 3LPRA 2Y81A 2GT7A 2CXVA 4OGYA 1J16A 3BTKE 2ZHDA 4ISOA 4X1RU 1ZMLA 1G3EA 3P17H 3RXDA 1CHOG 3UWJH 3CP7A 1ANBA 2D2DA 1GHBF 2FOFA 1GL0E 3TH3H 3F9EA 4CR9A 1G3CA 4UEHH 2FOHA 5DGJA 1ZHMA 1Z6JH 1LO6A 2P94A 4NSVA 3LJOA 2AEIH 4UD9H 1C9TA 2ODYB 3SU2A 3PMAB 1TX6A 2SGPE 3TNTA 1JRTA 1P2NA 3QZQA 2ZP0H 1ID5H 3GY5A 5DP9A 4AFQA 4D7GA 4NZQA 2GCHG 1WTGH 1SBWA 2G81E 1ZPBA 5JPMH 5BPEA 1GJ9B 3HKIB 1NFXA 1SGYE 5LH8A 1S82A 2ZECA 4HI3A 2H9TH 1GHAG 2GKVE 2Y5HA 1LPKB 2VGCC 5EU8A 1G30B 2PLXA 3ZZ4A 1A1RA 1DY8A 1NRRH 2M5TA 1ZGVA 3GICB 5DP8A 4DOQA 5L2ZH 2A32A 2FO9A 2F9OA 3O8BA 2B0FA 4LZ1H 1ZSLA 4X2WA 4WH6A 1A0JA 1SQAA 4LZ4B 1MAYA 4YOJA 4YOIA 1UVOA 3CS0A 3NCLA 1MTSA 1HAIH 3V7TA 2VVVA 1H4WA 1LHFH 2NU2E 4MPWA 5T3HA 2ZEBA 2JETC 1GBDA 2ZZUH 3PTBA 4Y6DA 1BOQA 4JZIA 1PPBH 1A7SA 3RXSA 5K7RA 3ZZ8A 3GCHB 4Y79A 3RMNH 3MNBA 1J17T 4AFUA 1UTPA 3SZNA 1O5AB 3A8AA 2ZFQH 3E3TA 3RU4T 1GMDF 1G3BA 1JIMA 1T4UH 1T8NA 3DHKH 2XBYA 2SGAA 4RN6A 2H6MA 1AE5A 1GJ4H 1O0DH 1Z8JB 1KXEA 3IWMA 3BTWE 2FTLE 1O5DH 1P01A 4FUHA 2WUBA 3QX5H 1EPTA 1YYY1 1GGDC 3HGNA 1FI8A 1ZSKA 1KXFA 1VJ9U 1HJ8A 3ENSB 1ZGIA 4FVBA 1LPZB 2TGDA 2RDLA 5JYIA 3P95A 1J9CH 3SBKA 1JWTA 5EG4A 1N1LA 4CREA 1AVGH 3MHWU 2J92A 1A0LA 2VH0A 1PPHE 1EZSC 2G51A 1HAOH 1HB0B 1TLDA 2CF9H 2ZGBH 1FY8E 2QIQA 3TIUA 1OP0A 2PW8H 3M5LA 1S0QA 3TH4H 4BAMB 3ZZAA 5ETXA 1NC6A 1Q31A 4A7IB 1S85A 2G5VA 5GDSH 1AFQB 1LQEA 1O3LA 2QXJA 3SV8A 2VH6A 2LNCA 2CGAA 1J8AA 1P9SA 3H5CB 1W12U 2C3SA 2AS9A 2H2ZA 1GI6A 1GBAA 2FIRH 1ESBA 1BTHH 3A83A 2FS9A 4WXVA 1C1RA 1V2LT 4WMDA 1O2ZA 1SGIB 1FY4A 1TABE 4H42U 2WYGA 4IBLH 2VVCA 4NA8A 1P2OA 4MDSA 1C2DA 1O38A 1HJAC 5JBBS 1P2QA 2FPZA 4OS7A 1TALA 2I6SA 1AO5A 4Q2KA 1A61H 3KN2A 1GJ8B 3LC3A 1SI5H 1TE0A 3E0NB 1GBKA 1YGCH 1FZZA 1Y3XA 1WOFA 5A8YA 2VB0A 1FNIA 1XM1A 1FQ3A 3BV9B 4ABFA 4ZUHA 5GJ4B 5F8XA 3BEUA 3SN8A 1O2GH 4WMEA 1L2EA 2ANYA 2YNAA 1QRWA 4AX9H 2AERH 1UTQA 4AB8A 1OWHA 5JB8S 1N6YA 1Y5BT 3V3MA 4K60A 1TNGA 1GBHA 1O3PB 1O3JA 1LVMA 2RA0A 3QZRA 2FESH 4IC6A 3URCA 1ELDE 3LGWA 3GDSA 3TVJB 1TGSZ 2J95A 3LGVA 4ABJA 4O9VA 5GWZA 4FU9A 1ARCA 1F0TA 1S81A 2Z9KA 5A8ZA 2AMPA 3HGPA 3S9AA 2XBVA 4OS1A 1BRUP 4YLUA 3OY6U 3BG8A 1O2RA 2W3KA 1KXCA 1K1OA 3RXLA 3FFGA 3GCOA 3HKJB 3ZVDA 4ISHH 2FMJA 1BQYA 1AKSB 1AZZA 1DSUA 1MD7A 1WUNH 3HATH 3B8JA 3KQEA 3PV4A 4WJG2 4Z6AH 1L1GA 5G4BA 3ZZCA 2H5DA 4X1PU 1O2QA 4JZDH 1ABJH 1LHGH 4ZKNU 3TJOA 3T62A 2Y5FA 3QWCH 4TYDA 1SLVB 1YM0A 1C1UH 3NWUA 2BXTH 1EPTC 1QCPA 1DWDH 1ESTA 1XX9A 3SUEA 2GD4B 3AASA 1L1NA 3ZVGA 4IN1A 4BXWA 2ZGCA 1W7XH 3OX7U 1C2EA 3ZZDA 2C93B 3BTEE 3LDXH 2J4IA 5JDUB 1IQMA 1W13U 2PGBB 2QXGA 5E8EH 4NIYA 4B76A 1HUTH 3E0PB 3R3GB 1NRSH 2VIPA 5TCCA 1ETSH 3MH5A 3AVZA 4Y76A 3SQEE 3UPEA 2ZHQH 4Q7YA 2FOGA 2P8OC 1UVSH 2ZDVH 1ZPZA 4CH2B 1EXFA 1SMFE 1OP8A 1MAXA 3GDUA 3SHAH 1DXWA 4X8UH 4UFFH 2UUFB 1C5YB 1W14U 4GCHG 4ZXYH 2A45B 1MD8A 1ZTLA 3MO3A 1GJCB 1KTSB 3RXTA 1LHDH 4CRCA 1AI8H 5H4IB 1L1JA 2J9NA 3GYMA 3M3TA 4KKDA 1EQ9A 1VITG 2OCVB 2ZDAH 1O3MA 3HPTB 3VB4A 3ZV8A 2D1JA 3PYHA 1D9IA 3P92A 4AG2A 4B1TA 3EA8A 3P70B 1EOLA 1MZDA 4CR5A 3P6ZB 2B9LA 2GCHF 1D6RA 3C1KA 1QA0A 2OP9A 2ODQA 3PB1E 1C5LH 1AFEH 1KLIH 1O3CA 3MNXA 3A7TA 4JZEH 3LIWA 2Z9JA 1A2CH 3VB3A 5I25A 2SGEE 1HDTH 1CGJE 1OYTH 1K22H 1GBLA 2AMQA 1FIZA 6CHAB 4YZUA 5GPIB 1O3KA 4UFDH 1C2FA 4BTTB 3F1SB 2PTCE 2Z3EA 3PWBA 3UOPA 1XVOA 1QL9A 1Y3UA 1SLWB 3ZZ3A 3SW2B 2R2WU 3MOCA 4YT7H 1ANCA 3RXKA 2BDGA 5C67A 2BVSH 2VWNA 1DUAA 1RFNA 3B23B 3UQVA 1AY6H 3BG4B 1HAPH 3MH4A 1O5BB 1GVZA 3EQ0H 1RIWC 5EOKA 2ZU1A 1SPJA 2PKSB 3M5MA 1NFYA 2WUCA 1KXBA 3LH3A 1TA2A 1N8OB 4O97A 3GY8A 3SU4A 2GDDA 1C5SA 5EQRA 3SJIA 3UFAA 1JXPA 3UNRA 2HALA 3E8LA 1BRCE 3DUXH 1E35B 1DLKB 5ABWA 1JIRA 2ZPRA 2VU8E 4DCDA 1TWXB 2OC8A 4UONA 4THNH 4A1XA 1DSTA 1LKBA 2ZGJA 2G4TA 4CRAA 4DVAU 3UNSA 1ETRH 4MPUA 4B71A 1NZQH 2IOTA 1T8OA 1W10U 5CHAB 2ANMH 2YNBA 1TA6A 1BDAA 1GI4A 4Y11E 2XYAA 2XXLA 3T5FH 3VXEH 1YC0A 2VNTA 4FUCA 3CENA 1NRNH 1T32A 1P09A 3P8GA 1UJ1A 3EDXB 2PUQH 2C8XB 3T27A 2Z94A 1O2NA 1SGCA 2EEKA 1ELCA 1IQFA 1H9LB 3RC5A 2ZGHA 2ZQ2A 2DE9A 1XVMA 1O5FH 2XCFA 3VGCC 2GV6A 4B2AA 2VJ1A 1MTNB 5EGMA 3GDVA 1C1TA 1GHYH 4Q7XA 1THRH 1O5EH 2A0QB 2BM2A 4BTUB 4JMYA 5C20A 3BTHE 2P3TB 3SJ9A 2WPMS 1TX8A 2ANWA 1MH0A 2OTVA 2Q6DA 1C5QA 5T6FA 3UR9A 2ZI2H 2EI8A 5E2PA 1QA7A 1S0RA 1DFPA 3SU0A 4PROA 1OXGA 5FCRA 1H9HE 1A3EH 3SGBE 2K1QA 2ZU2A 1QJ1B 3ZVAA 5DG6A 1AQ7A 1TQ7B 1CT0E 3LC5A 1GBIA 2CF8H 1FY3A 1AKSA 3RXBA 2EI7A 2STBE 2WPIS 3SUGA 5F6MA 1GCDA 1Y59T 3SU3A 1BIOA 2F83A 3SHCH 1HNEE 2OQ5A 2PKAB 5LGOA 4Y0ZE 1C5UA 1NS3A 2ZTXA 1CE5A 1F0RA 1KYNA 2AYWA 2F9PA 2B8OH 5L30H