1OPHB

Non-covalent complex between alpha-1-pi-pittsburgh and s195a trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDAGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-1-antitrypsin precursor
publication title Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ophB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ophB02
1BIOA 2JETB 4KP0A 2BQ6B 1P04A 5FPTA 1K22H 1HB0B 2GKVE 2XBYA 3TPIZ 1O2TA 1DDJA 2VH0A 1A1RA 5LPRA 1K1IA 2F83A 4ZHAA 1TOMH 2G81E 1C5ZB 2H5CA 1MTUA 5ESBA 1S5SA 5E0HA 2JETC 2FM2A 2BMGB 3LC5A 4R8TB 3GY2A 2PGQB 1NC6A 5T6GA 2ZU1A 5ETXA 2NU2E 1MCVA 1QJ7B 4D8NA 3UWIA 4PROA 1A0LA 1UTQA 1O34A 4BXWA 4E7NA 5JB8S 3S7KB 1OWKA 1E35B 1D9IA 1TBQH 2ZFQH 4H4FA 3FP8E 3LIWA 2CXVA 1MKWK 1JMOH 1FY4A 4WXIA 3LT3A 7GCHF 2GVFA 4CRDA 1ZTLA 3DUXH 6ESTA 1J15A 3P8NA 4M7GA 3ZVDA 3B8JA 3CS7A 1P2NA 2BB4A 1FPHH 1S83A 1P02A 2FPZA 3A81A 3PMHB 1C4Y2 1C5QA 4Y11E 1ABJH 3BTWE 1H9HE 4BAHB 4X2VA 1TX8A 1Y8TA 4ZAEA 3MU5A 3GY4A 1NRRH 1EZXC 3BTTE 1AUTC 3EYDA 1TQ7B 2J94A 1OXGA 4ABGA 1FDPA 3SQEE 3MI4A 1C2IA 3ZZ6A 1N6XA 4Y71A 4OS7A 1ACBE 1RTLA 3F6UH 3SU4A 4HGCA 3IITA 1CHGA 2OQUA 1DICA 4AN7A 1GI5A 1MTSA 1O2MA 1K1JA 4ZHMU 1BMLA 3LGIA 4NCYA 2BDHA 5BRRE 3KQEA 3TK6A 1CBWB 3A83A 1A7SA 2P16A 3A89A 2BOKA 2C8WB 2OQ5A 1SGEE 1G37A 1HYLA 5DKMA 3TU7H 1HAOH 1TNHA 3UOPA 1ETTH 3ZZDA 3BIVH 1GJBB 1BHXB 1GVZA 2ZQ1A 4F49A 1CBWC 1DWCH 1LQDB 4AX9H 2RCEA 1NFXA 4MPXA 4TPYA 2Y7ZA 1SLUB 3T27A 4R0IA 3CP7A 1AIXH 4CHAB 4CRBA 3LC3A 3TH2H 2ZTZA 1VGCB 2KAIA 4X1SU 1BJUA 1SGCA 8KME2 4ZHLU 2TGTA 2AGIX 3SU5A 4ABEA 2QAAA 2STAE 1EJNA 4B2BA 1AWFH 2Y80A 4CHAC 2G8TA 1ANEA 1ELEE 1VGCC 1QJ6B 3D23A 4Y0YE 1C9PA 3STJA 5A2MH 1TLDA 1JIRA 4A92A 4MQAA 1EB2A 1XVMA 1GI9B 2STBE 1HNEE 2HNTF 4KTCA 4XBDA 1L4DA 1A61H 1UHBA 3VGCB 4NZQA 2Z9KA 2A4OA 2ZHEH 2ZDLA 4IGDA 6GCHF 2W3IA 4I8HA 1BTPA 4NA9H 3A8BA 4FUHA 3URDA 3S7HB 4Y10E 4IC5A 3VGCC 1ID5H 1HAGE 4ZKSU 4E06H 1FIZA 1AKSA 1GBAA 3Q3XA 1F5RA 2FXRA 3SV6A 4CRAA 1ZHMA 4NSYA 1EOLA 1GG6B 5EXLA 4Y6DA 3B9FH 3W95A 4RSPA 1BHXF 2AMQA 3PROA 1C5UA 1LKAA 2XBWA 5AF9H 2AMDA 3GDUA 5EXMA 3SV7A 1GG6C 2OINA 1RS0A 1AO5A 2ANMH 2M5TA 2OCVB 2ZU4A 1NRNH 2AFQB 3RC5A 2WUBA 3R0FA 4F4OC 1SBWA 2VIPA 1HAXB 1HCGA 1H9LB 2C90B 2SFAA 3RXBA 3SHAH 2ZZUH 1GMDG 1BUIA 1BQYA 1A5HA 1GVKB 3GYLB 2AYWA 4DCDA 1MKXK 1FJSA 4LZ4B 3RXMA 1GL0E 5K0HA 4BAOB 5GWZA 2BY6X 5GDSH 2GV6A 5F8XA 2ZGBH 1ZYOA 4AFQA 1O5CB 4U30A 3K9XB 5LH8A 1CA0B 1C5RA 1ZLRA 3P8GA 3PWCA 2EA3A 1D4PB 3RC4A 1O3AA 4WH8A 2FS9A 2SNVA 1ESTA 3M35A 3GDVA 2CHAB 4RKJB 2ZIQH 1LHCH 2FX4A 1O5DH 1D3DB 2F9BH 1CA0C 2R2WU 3RM0H 5JDUB 3RXCA 2Q1JA 1QQ4A 4Z0KA 2XBVA 1J9CH 3M5LA 4A1VA 2EI6A 4DOQA 2BX4A 4YLUA 3NZIA 3ZZ7A 2Y82A 1QR3E 3T5FH 2CHAC 1WYKA 3BEFB 1AU8A 1P3EA 2NU3E 3T29A 1GJDB 1MZDA 3O8BA 2V35A 4JZEH 1JXPA 4ZKOU 3SJ8A 1DS2E 1ZJKA 2C3SA 4WMFA 1PYTC 2WUCA 2SGPE 2ODPA 3HKIB 3PTBA 2KAIB 1KLIH 3LGWA 2JKHA 2FWWA 3KF2A 1GJ9B 1O2UA 3A7TA 3FAOA 4KTUA 1N8OB 5HGGA 3FFGA 2UUKB 1MBQA 3MMGA 1YPHE 4WH6A 4Q2KA 1DITH 1HAIH 1N8OC 2CMYA 3V12A 4ZROA 2G4TA 1O0DH 4JK5A 4ABFA 2GZ8A 5CMXH 1UHBB 1C2LA 1GCDA 2QYIA 2BY7X 2XC4A 1GJ6A 2UUFB 3TJVA 1FN6A 4ABAA 1WAYB 4YOJA 2H9EH 1XUHA 1H8IH 2Z3CA 1DUAA 1HPGA 2JH0D 2ZCKP 4DJZB 1BA8B 3BG8A 1GI6A 3SORA 7KMEH 2Z9JA 2EEKA 3NCLA 4OS1A 1SC8U 3VFEA 2ODQA 1AZZA 2XXLA 3GICB 1ZMLA 2B8OH 2FYRA 3T28A 2NWNA 2C8XB 3S9AA 2ZFPH 3GCTG 1NROH 4Y79A 2QXHA 1TE0A 2IOTA 3D49H 1HBTH 5GJ4B 1NZQH 1VITF 1QBVH 2ZDAH 3ATIA 4O3TA 4D7GA 3RXEA 1T4VH 2Q6FA 2VVUA 1P8VC 1O2QA 5C2ZA 4FUCA 3GDSA 3E0PB 3SUFA 1AVXA 3FVFB 2VWNA 1CA8B 3UNRA 2J4IA 1BCUH 3SV8A 1O39A 1QRWA 3M37A 5E2PA 2W26A 1N1LA 5A0BA 4K5ZA 3RXVA 2C8ZB 3U8OH 6LPRA 3EDXB 3FP6E 4UFEH 2VH6A 1V6DA 4CRFA 2BD7A 1C2HA 4CRCA 1BMAA 3F68H 3RXGA 2B5TB 1P03A 1BMMH 1NT1A 1C1SA 1FV9A 1KIGH 1O3OA 3M5OA 2ZF0H 4E05H 3ZZBA 5ESTE 3Q76A 1C5SA 1EAXA 1CU1A 1MU6B 1O3EA 4B75A 1EPTA 1ZHPA 1FAXA 4SGBE 1TNJA 2SGQE 3ZZAA 2GDEH 3A7VA 3JZ1B 1YLDA 1AVWA 1BRAA 1LO6A 3BTGE 1TPSA 4BANB 5IYTA 1UTJA 2Y5HA 4GPGA 4THNH 4YZUA 3SUDA 2ZGCA 3SHCH 3H7TA 1L2EA 3QZQA 1XMNB 2UWOA 3SNAA 3O8RA 4MPUA 1V2MT 4B2AA 3K2UA 1QL7A 1GHZA 1BBRE 2ESTE 2I6SA 3DA9B 4CR9A 1GHAF 3VB5A 1BTHH 1HIAA 5EW2H 2DE9A 1C1PA 1C2MA 1XX9A 2XNIA 9LPRA 1AWHB 1DY8A 2W7SA 4A5TS 1CE5A 4KKDA 2R2MB 2I6QA 1W12U 1KDQA 1TAWA 1SB1H 5DP4A 3RXJA 1RGQA 3FZZA 1Y5AT 1BJVA 2VIVA 2C4FH 3ATKA 4HZHA 1UVSH 1PQAA 1AGJA 2OTVA 1HXEH 2B9LA 1P2JA 1O3HA 1OS8A 1G30B 3SJOA 4Y7AA 1JWTA 1JRSA 5A0CA 3ZZCA 1AY6H 2QXGA 1A4WH 3E1XB 1T32A 1ESBA 5CE1A 2HALA 2BYAX 5DP3A 5E8EH 3PB1E 1BTWA 1EASA 1CO7E 3GY3A 1YCPK 2QXIA 2F9NA 2BZ6H 4BAKB 3SUEA 2K1QA 1DE7H 4MPWA 3T26A 1PPEE 2BXUH 2AIQA 1RJXB 3M5NA 1NFUA 1ZMJA 3A84A 4NSVA 2SGDE 1PPCE 1C5XB 1TNKA 1XVOA 5SGAE 2FS8A 3U1IB 4NWLA 1QJ1B 3V3MA 3KGPA 1V2LT 1ZR0A 2ZFTA 4AG1A 2F91A 1LPGB 2QC2A 1U6QA 2DE8A 1C1RA 4TWYA 1GHWH 3BN9A 1ORFA 1V2KT 2UWLA 3I78A 4INHA 2FOMB 5EQSA 3URCA 1SHYA 4IN2A 1DPOA 2FODA 1AE5A 4K69A 1CSOE 4A1XA 4JYUH 3QWCH 1TMBH 1O3CA 2GDDA 1C2GA 1Y3WA 1WU1A 2FI5E 2HOBA 2J34A 2ZC9H 4K8YA 2ZGJA 1F92A 1KLTA 1SGNE 2HGTH 1MCTA 3ESTA 1GBTA 1EATA 3MO6A 1IQHA 1BTXA 1GCTB 1DOJA 4ISIH 3L3TA 3ZVEA 4MNWA 1TGNA 3VB6A 1MD7A 1SPJA 1GCTC 5EG4A 5FHTA 3TVJB 3TGIE 1KLJH 1SGTA 2TGAA 3E6PH 5EQQA 1D3QB 2G5VA 8ESTE 5GCHG 1DXPA 1ANDA 1CQQA 1Z71A 1CHOF 2CF8H 1PPZA 4AFZA 2VINA 4A1TA 5F8TA 1QFKH 1SGPE 3MNCA 4ISHH 4AZ2B 4Z6AH 1BT7A 1V2TT 2LPRA 3QGJA 1V2NT 4HFPB 5T3HA 1EP5A 1HIAB 1S0RA 2G55A 4GCHF 2VB0A 3UWJH 1EKBB 1VJAU 5GXPA 1PFXC 3BSQA 3RU4E 1J17T 1HFDA 2A32A 2R0KA 4K8BA 1ELCA 3FZDA 1KDQB 4VGCB 4DW2U 1L1GA 2H2ZA 1V2UT 3S69A 2XBXA 3VPKA 1W7XH 4NIXA 5TJXA 2RDLA 3RMNH 3F9FA 3Q77A 2A4RA 3ODFA 3MU4A 1TPAE 1MZAA 3RC6A 1DT2A 3UQVA 4VGCC 2XTTB 5C5OA 1IQJA 1C2KA 1O2RA 1W13U 2IJOB 1EJAA 5FCRA 3GCNA 2JH6D 3U9AH 4AB8A 1F0UA 1UJ1A 1UTMA 3SU2A 1L1NA 2PGBB 4Y8ZA 2TRMA 1Z7KA 2RA0A 2CJIA 4HTCH 3TITA 1TGBA 4YO9A 5C67A 2SNWA 5B6OA 2VWLA 4AOQA 4FU8A 3RP2A 5L2ZH 1F0SA 1SGIB 4SGAE 1UO6A 2QV1A 5AFZH 1K2I1 2PSYA 3SBKA 2P3UB 3SNBA 4TY6A 1SLXB 1TQ0B 3MH6A 5FXLA 1MKWH 4O97A 1GGDB 3M36A 1FAKH 4WY3A 3KNXA 3HK6B 2UWPA 2TIOA 1KXEA 1KXFA 2H6MA 1MH0A 1O2XA 1MAXA 1O3FA 3MH5A 2GT7A 3BEUA 4D7FA 1P12E 2DUCA 4MNXA 1EZUC 1ZMNA 1GGDC 1Y3YA 1FI8A 1UTKA 3RM2H 1GJCB 2A31A 2PV9B 3MU0A 1BITA 4B76A 1AN1E 1H8DH 4MNVA 1P9SA 3DFJA 3V0XA 3LONA 1UCYK 4NG9H 5DG6A 1YLCA 2ZKSA 2P94A 2B0FA 3TJUA 2QF3A 4K1SA 2G4UA 2O8LA 3ZZ8A 4UD9H 5DP8A 1WCZA 3SNEA 2AGEX 1C1UH 1W2KH 3BV9B 2AEIH 4TYDA 4FVDA 4B2CA 4LZ1H 1NFYA 4E7RG 2RG3A 1UVTH 3ENSB 1QB6A 4LXBH 5L2YH 2BDIA 3SZNA 1WUNH 5TCCA 4XBCA 2A1DB 1C4V2 1HAHH 1V2JT 3UUZA 2NU4E 1D3TB 1GBIA 1NS3A 3S9CA 3WY8A 1AUJA 3U69H 2BD3A 2ALPA 1E38B 2R3YA 1ARBA 1A5GH 2QXJA 2GTBA 2Q6DA 2GCHG 4XOJA 4NZLA 2BY9X 1A2CH 2J92A 5HYOA 1O3KA 1SOTA 2GGVB 2ZPQA 1BB0B 2XWBI 3UFAA 1C2EA 4OGXA 1OWHA 4B1TA 2P59A 3F9HA 2CF9H 1VITH 3T25A 2ZGHA 2VNTA 2ALVA 3DHKH 1C5TA 1KTTB 1QHRB 1S0QA 1TRYA 2HPPH 3LDXH 3LOXA 3PMAB 1IHTH 1O3IA 2WPHS 4U32A 1ZSJA 5FX5A 3QLPH 1B7XB 2BVRH 4YM9A 1GBMA 1GI2A 3KQDA 3HPTB 1SFIA 4Y0ZE 4JYVH 2EI7A 1O33A 1GWAA 4JCNA 2ZHDA 1ANCA 1SOZA 4H42U 3OY6U 2D26C 1DUEA 4NFEA 1BTZA 4GHTA 1O5EH 4I8JA 1GHBG 1KXCA 1EZSC 1TX7A 4UFGH 3ZVGA 1HAVA 1ZPZA 2H1UA 1NRPH 1EAWA 1QTFA 2PFEA 5EQRA 1MAYA 1CT2E 4J1YA 1NU7B 1SHHB 1SGFA 1TMUH 1IQNA 1TABE 1UTOA 3O8DA 1GHXH 3KQCA 3RXQA 1THPB 2GP9B 2OBQA 1C5OH 3MU1A 1P09A 4WF8A 1V2WT 1W14U 3MNBA 1BDAA 3BEIB 3DT0H 4JZIA 1GI1A 3ELAH 1MKXH 3OX7U 1TMTH 4KGAA 1ELTA 4A7IB 4TPIZ 1P57B 1DANH 1OPHB 4UDWH 3STIA 2TGDA 4DURA 1XKAC 3ZZ5A 5FPSA 1VCQA 1LVYA 1VR1H 1V2ST 5A8ZA 2VU8E 1TPOA 4BTIB 8LPRA 2A5KA 1VCWA 3PV4A 3RLYH 1O32A 3P8FA 1CT4E 2ZEBA 2BVXH 3SJ9A 5C5NA 1IQKA 1GMDF 1OWEA 2NU0E 1FMGA 4WJG2 1P0SH 3P70B 1W0YH 1V2QT 1GJ5H 3F1SB 1DVAH 1G36A 1NM6A 1GBLA 3UR6A 5L6NH 2F9VA 3SO3A 4X8SH 1JIMA 3F9GA 4XSKU 1YF4A 3RXTA 5J4QA 3BG4B 1IQGA 1EB1H 1OP0A 5IDKA 1OOKB 3SGQE 3NKKA 3T2NA 1YKTA 1O30A 1MMJN 2Z9IA 4WMEA 2W5EA 4OS4A 1XM1A 3KL6A 5DPAA 2VVVA 1YCPM 2BTCE 3BG4C 1W8BH 3UNSA 1O3GA 1EZQA 1AFQB 5EXNA 5JBAS 3E3TA 4UFFH 4CBOA 1G2MA 2FOFA 1P3CA 4IMQA 2SGEE 4A6LA 2V3HH 2Y81A 4FXGH 5BPEA 4YLQH 1UK4A 3A7YA 3P8OA 3TNSA 1C1NA 3A7WA 2P8OB 4YT7H 2ZO3H 3LJJA 1AFQC 1VITG 1Z1JA 3FP7E 1WQVH 5C1XA 5FAHA 3MWIU 1RXPA 1Q3XA 1AMHA 5CHAB 1AKSB 3S9BA 5F8ZA 3EAJA 3PLPA 2P8OC 3EA9A 1W11U 2FI3E 2BLVA 1G32B 1P2QA 2O9QA 3NUMA 4D76A 1K21H 3HKJB 3BTQE 1GI4A 4ZKRU 5CHAC 5EGMA 1J16A 3UTUH 5JYIA 2VWMA 4Y7BA 1GDUA 2SGFE 5AVDA 1MTNB 1V2OT 2ILNA 1AB9B 1ABIH 1IQLA 1YP9A 3GCHB 1GPZA 3TJOA 2VIQA 2EC9H 1OWDA 2A0QB 1TX6A 1O2SA 1NRSH 3TGKE 1DSTA 3DFLA 1E0FD 1MTNC 1YPJH 3KCGH 2F9OA 1XUFA 1C5LH 1L0ZA 2THFB 1AB9C 1GI0A 2JH5D 2ZPRA 3GCHC 5A8YA 3G01A 3V13A 1DLEA 1N6YA 2ASUB 3LH3A 3GYMA 1RD3B 1C5MD 3GCTF 2F3CE 4CBNA 1F0TA 3OTJE 1TGSZ 2XWAA 3H5CB 1K9OE 3KEEA 1FY8E 4FUGA 1LHEH 1C5VA 3ZZ4A 4BTUB 1RFNA 1SGFG 1SG8B 2D1JA 3Q3KA 2BLQA 5T6FA 2FX6A 2VVCA 1QB9A 1F5KU 2J9NA 1GBJA 2P3FH 4FU9A 1QQUA 2CGAA 1Y59T 4X6PA 5EOKA 1T8MA 4D9RA 1LKBA 5LGOA 5HXFA 3RXAA 2ANKH 1ZTKA 2C93B 2QF0A 2ZDMA 1TGTA 1IAUA 3M7UA 1MQ6A 1TYNA 1AHTH 1D6WA 3PO1B 4CH2B 1ELAA 1PPBH 3RU4T 2XCNA 1DXWA 2PKAA 1FQ3A 4DVAU 1C4U2 2BX3A 4DIIH 2QGRA 5JBTA 4K1TA 1CGHA 3LU9B 1UVUH 1BBRK 3SJIA 1ZPCA 3LGTA 3O8CA 4X6OA 5PTPA 2BDYA 3PO1C 2OC0A 3AW1A 1O36A 1YM0A 2ZWLH 1H4WA 4DGJA 1J14A 5I25A 2PHBA 2B7DH 1MD8A 1TALA 2XCFA 3RDZA 3GCOA 2OBOA 1TNLA 1T8OA 1K1OA 3PMJA 4I8GA 4Q7YA 1YPHC 1DY9A 3KN2A 1CGJE 3P92A 1O38A 1O5AB 5JBCS 1ELGA 1GJ8B 3EQ0H 3M61U 4MTBA 2FOCA 2ZCHP 1Y3VA 2A7CA 4ABHA 2GCTB 4ABIA 1AFEH 3LJOA 5ABWA 1O2ZA 1A5IA 1HXFH 4CH8B 2Z3EA 1YCPH 3C1KA 2GCTC 3E8LA 1NRQH 1VJ9U 2CN0H 2PTCE 3HGPA 3I77A 4B73A 1NO9H 2O8TA 4XE4A 4Y76A 1AQ7A 1T31A 3L6PA 1JRTA 1H1BA 2A5IA 2ZCLP 2FDAA 3EA8A 4BOHA 1IQIA 3UY9A 2RA3A 3BF6H 2YNBA 1GMCG 1YC0A 5AFYH 1S81A 1ETSH 2F9PA 3QX5H 1GDQA 2C8YB 1YPKH 2Z6BD 1G3CA 4JK6A 2O8UA 1IQEA 1LDTT 1KYNA 1C2JA 1OYQA 2ZDKA 3RUOA 1ZSLA 8GCHG 1E34B 4DIHH 1L4ZA 4LK4A 3W94A 9ESTA 5H4IB 1YBWA 1CGIE 1TNIA 1NPMA 1O2PA 3UREA 1ZRKA 1EAUA 4B74A 4MG3A 1ZGVA 5EPNA 2BY8X 1HUTH 2BY5X 1THSH 3RLWH 3RXDA 4WWYA 1O2KA 1OP2A 5FBIA 3F9EA 2BVSH 1CHOG 1BZXE 2QY0B 2ZECA 3NK8A 3S0NA 1DWDH 1EPTB 1K1NA 1NU9A 3GY5A 4INLA 2V0BA 3RXKA 1K28D 3ITIA 3CENA 3RXIA 1FUJA 1ESAA 3A80A 3ZVCA 1Z1IA 2W7UA 2V6NA 4IC6A 4J2YB 5JB9S 1HRTH 2O8MA 1ZZZA 3A85A 4X6MA 2H5DA 1P01A 1EPTC 2HNTE 1GMHG 2AMPA 4IN1A 3A86A 1T7CA 3MH4A 4NGAH 1O3NA 1Q31A 3RXFA 1QGFA 2FOAA 5C3NA 3TNTA 1QA0A 4JZDH 2VIDA 1O3BA 5EODA 1Z8JB 3GY7A 2PKAB 4RN6A 1WV7H 3PYHA 1T8LA 1D6RA 1GBBA 4ABBA 2FOGA 2TBSA 1O2GH 3QDZB 4TWWA 1KTSB 2G51A 1EAIA 1SQTA 2QCYA 1INCA 1FXYA 1BOQA 5FCKA 2J38A 3NXPA 5E0JA 2Q6GA 5GCHF 2ZTXA 2QIQA 3SU0A 1A46H 1S6HA 3K6YA 4TY7A 7LPRA 4XDEA 3A8DA 2WPJS 1OP8A 2WINI 4ZUHA 3EGKH 2EI8A 1DSUA 2A4GA 2F9UA 4OS2A 3U8RH 1Z6JH 3E90B 2A4QA 3SGAE 1P11E 2Y5FA 1EJMA 1GJAB 2GZ7A 7GCHG 3TH4H 2OP9A 1C1TA 4ZMAH 2ANYA 1ELDE 4GLYA 2BM2A 4HI3A 5T6DA 2ZHWH 3A7XA 4GUXA 3SNCA 3K6ZA 1YYY1 1QB1A 1V2RT 4AFUA 1H9IE 3OYPA 2Y5GA 3K65B 5DP6A 1Y3XA 3SV2H 1EOJA 2FZZA 1LPZB 1B5GH 1TPPA 3RXHA 3GOVB 1O3JA 3MTYA 1TB6H 1FNIA 1F5LA 4X1PU 4X1RU 3SJKA 1SQAA 1F2SE 1HLTH 1O37A 3MH7A 2FOEA 1F7ZA 2FLBH 3M7QA 3QN7A 3SU6A 1UVOA 7ESTE 1PYTD 4JZFH 1SFQB 1SVPA 1IOEA 2ZFFH 1YPEH 3P95A 1C2FA 4ZXYH 3TIUA 2Z9LA 4FUJA 1UCYH 3GY8A 2VIOA 2G5NA 2H9HA 4DT7B 2ODYB 1UCYE 1S84A 2SGAA 3Q00A 1PPFE 3ZYDA 2BDAA 1QBOA 4XFQA 3EE0B 2FTLE 4WVPE 1YPMH 2WYJA 1QURH 1MUEB 3SGBE 3RXRA 1Y5UT 2YOLA 4FUDA 1FN8A 4ASHA 1LVOA 1TNGA 4ESTE 4NWKA 2GV7A 3BIUH 4YOIA 4O9VA 1IQMA 1THRH 1VZQH 3SUGA 1L1JA 2A7JA 1X7AC 4XBBA 3SI3H 4AG2A 1Z6EA 2Y6TA 2BDCA 2V3OH 3M3SA 2HNTC 1IHSH 4YOGA 3ATWA 4JYTA 3U8TH 2FTMA 5FX6A 3A8CA 1MBMA 1UTLM 1NTPA 1P2KA 1QIXB 3SW2B 2FYQA 5AHGH 1GI7B 1FY3A 4NIVA 5L30H 1C1WH 1KY9A 4FUBA 3UQOA 4CR5A 3RMMH 2UUJB 3HATH 5EW1H 4ISOA 1PJPA 3VB4A 6GCHG 1W10U 1O2NA 1ZOMA 1EUFA 2A2QH 2ZDVH 3MO9A 5G4BA 4Y8XA 5HM9A 2PUQH 1AI8H 1SGQE 3SV9A 1NESE 1HAPH 3SOSA 5C1YA 2TGPZ 5GPIB 3MNSA 1ETRH 1BRUP 1QRZA 1GJ7B 1QBNA 3IWMA 1LMWB 1TA6A 4I31A 1O2JA 1WOFA 3JZ2B 1HJ8A 1C9TA 2WYGA 2Z7FE 4B71A 2GCHF 3OSYA 1SGYE 1FPCH 4ZH8A 3MFJA 1C1VH 3ZZ9A 2ZHQH 4Q7ZA 4NFFA 1AZ8A 3E91A 1RRKA 3LGVA 2R3UA 4MDSA 1P06A 1Y3UA 1LVBA 1LTOA 4FVBA 1DX5M 1MQ5A 1K1MA 4ABDA 5DP9A 2BLWA 2XRCA 1HJAB 1OWJA 4UONA 4I32A 2FO9A 1O3LA 1YGCH 2AH4X 1E36B 3MO3A 1HDTH 2VJ1A 5HMAA 4JMYA 2PUXB 2PR3A 1HAYB 1DWBH 2TPIZ 5DGJA 1HJAC 1TBZH 1W3CA 3PLKA 4K1EA 1XUJA 2P95A 2ZP0H 1ARCA 2BDGA 1ZJDA 2FOBA 1WSSH 3VXFH 5LPEA 2ZDNA 2XC0A 5FBEA 3OU0A 5E2OA 3V7TA 2FIRH 2LNCA 1LQEA 2P93A 4NA8A 2Z94A 3BTFE 1OX1A 4GSOA 3QK1A 2WV4A 1GHBF 1PQ7A 1SI5H 1TGCA 4DY7B 3RMOH 4MPVA 3LGUA 1O2HA 4KTSA 3R3GB 3CS0A 4Q7XA 1O2IA 1KXDA 1OSSA 4YESB 5JBBS 1ZPBA 1A3EH 1PQ8A 5EPYA 2GT8A 2XC5A 3M3VA 3E0NB 1BTUA 1GHYH 2BQWB 3ODDA 3ZVFA 4BAQB 5F03A 1TONA 1QA7A 1WTGH 3BTDE 5A0AE 3OY5U 2UUYA 2CV3A 3ZV8A 1RTFB 1TOCB 3AAUA 3TJNA 4AORA 3BTHE 1NFWA 4DG4A 1W7GH 3A87A 4NIYA 1C1MA 2R9PA 2ZQ2A 1TA2A 3SI4H 2Z9GA 2HWLB 2ZI2H 4ZKNU 2H9TH 2BD4A 1V2PT 4K3JA 1SGRE 2Z3DA 3PLBA 2HPQH 4QT8C 1QL9A 2HLCA 3NPSA 3D62A 1Y5BT 1G2LA 1SSXA 2GD4B 3P17H 1ELBA 1S85A 3PWBA 4CREA 1FZZA 1O31A 4I7YH 4H6SB 4IS5A 1GBKA 3I29A 2BD5A 1GI8B 1QL8A 2R0LA 4GVUA 4GAWA 1SGDE 4FUIA 2J95A 3QTOH 2GZ9A 4X6NA 1K1PA 3LGYA 5DO4H 2O8WA 1LVMA 3VXEH 2ZU3A 5GIBA 1PPGE 2XYAA 3ATLA 4OGYA 3ZV9A 4OS5A 4X2WA 1AE8H 4JZ1A 2BZAA 5I46H 3ZZ3A 4WXVA 1XXFA 2ZPSA 1O5FH 1VCPA 3T62A 3LH1A 1SLWB 2ZU2A 2AIPA 1IQFA 3SNDA 1TIOA 1KXAA 1TRMA 3SQHE 1WQSA 1O3DA 4I33A 4RKOB 1V2VT 1HAZB 3UIRA 5A8XA 1UTPA 4X8VH 1A0JA 3QZRA 1DM4B 4X2YA 3N7OA 4H6TA 1HAVB 1XKBC 2A7HA 2NU1E 1SQOA 1ZHRA 1C5PA 2ZNKH 3QO6A 2ZFRH 4D9QA 1OKXA 1SMFE 4NIWA 1F0RA 4FUEA 1HGTH 1G3BA 1T4UH 5EU8A 3VEQB 4AFSA 3BTME 4ISLA 1ANBA 1EXFA 1AVGH 1P2OA 1O2YA 4ABJA 5C1UA 2XW9A 1GBDA 3Q3YA 3AW0A 4FU7A 2D8WA 3MU8A 4AYYB 2WPMS 3PM3A 6CHAB 5LPFA 1P2IA 5F6MA 1FONA 2A5AA 1C1QA 3UNQA 4LOYH 4U01A 2ZG0H 3C27B 1MTVA 2BLOA 1HJ9A 1GHVH 3KHVA 4AGKA 4IMZA 3QGNB 6CHAC 1SR5C 2PKSB 2AS9A 1EX3A 2BD8A 3AAVA 1GHAG 1UVPA 2FOHA 1LHFH 2BDBA 2WPLS 4X1NU 1O3PB 1GJ4H 4NA7A 1O5BB 2QN5T 3U98H 1GI3A 1JBUH 4AGJA 3IG6B 4FUFA 2A2XH 2PKSC 3A7ZA 2BD2A 1WTHD 3H7OA 4INKA 1J8AA 4X0WU 3TK5A 4BTTB 1B0EA 4CRGA 2VIWA 5A09A 2OD3B 3SU1A 1FLEE 2OXSA 3TH3H 3GY6A 3VB3A 3MYWA 3ZYEA 3HGNA 1G9IE 1ZTJA 3PTNA 2PSXA 5FPYA 2QA9E 4YT6H 3PMBB 1A3BH 2PWXA 1UK3A 1YPLH 1Q2WA 3UR9A 3ZVBA 1BBRH 1BMNH 1C1OA 1P2MA 2AGGX 2BHGA 3M5MA 4BXSA 1QCPA 4ISNA 1UK2A 1RTKA 1LPKB 1TFXA 3LPRA 2ZU5A 1CT0E 2BQ7B 2PLXA 2IPHA 1DWEH 1B0FA 3RXSA 3VB7A 1WBGB 1SLVB 1P9UA 3ZVAA 2W3KA 4WMDA 1BRBE 1QRXA 1ZRBA 2FP7B 1A0HB 1V3XA 2ZFSA 2ZTYA 1TBRH 2OC7A 3GISB 4KELA 4BNRA 1E37B 4IBLH 1S82A 1O2WA 1G3DA 5DJ7A 3A88A 2ZA5A 1C5YB 5DP5A 1NY22 1FY1A 3RXLA 3KIDU 3UOUA 1AD8H 1QY6A 3FANA 3TLOA 1XXDA 4GHQA 2FESH 1PQ5A 2FLRH 2Y7XA 4YTAA 5HM2A 3LKWA 1O35A 2HRVA 3L33A 3DD2H 2ANWA 1ELFA 3D65E 1PPHE 1GBCA 1O2OA 2IN2A 1UMAH 4MNYA 1K1LA 1RIWB 4X8UH 1Z8RA 1QNJA 1ZGIA 2ZGXH 2A45B 5J4SA 4K60A 1GBEA 1ELVA 3B23B 4UEHH 4I8KA 1W0ZU 3QTVH 3SN8A 3RXPA 1RIWC 1XUKA 2OC1A 1O3MA 3MHWU 5TCAA 3EA7A 1BRCE 3QUMP 2G00A 1O2LA 1LHGH 1DFPA 1LCYA 2HVXA 4K2YA 2GMTB 4MLFB 1O2VA 1C2DA 1YPGH 1TRNA 4OS6A 2D2DA 3RU4D 1OWIA 4X2XA 2WPKS 3A82A 1Z8GA 1XUIA 3AVZA 2G52A 4X1QU 3P6ZB 4BAMB 1UTNA 1GMCF 3KQBA 1P10A 3M3TA 1NN6A 2GMTC 1DLKB 4O03A 1GDNA 3ATMA 3MOCA 2WV5A 5DK1A 3RXUA 2AERH 3HK3B 2ZHFH 8GCHF 4UFDH 1MTWA 3A8AA 2VWOA 4U2WA 4IW4E 1FY5A 3AASA 2PTNA 4GCHG 1D3PB 2WPIS 1ZSKA 3MNXA 1GL1A 2P3TB 1OYTH 1S6FA 1LHDH 3RMLH 1KXBA 2BOHB 1M9UA 5DP7A 1XUGA 4AYVB 3NWUA 2J2UA 1C5NH 4Y8YA 3TK9A 1KSNA 2BXTH 1GVLA 1P05A 3UPEA 4AB9A 1CVWH 1TWXB 1MU8B 1BTYA 1Z8IB 3SU3A 1EP6A 2OUAA 3M7TA 1FIWA 1EQ9A 3E16B 4ZXXH 5K7RA 1C5WB 1SL3A 2GX4A 3RXOA 2VGCB 2FEQH 2FMJA 5E0GA 1GMHF 1G3EA 2OLGA 3U1JB 2BD9A 2ULLA 2OC8A 5C20A 4MVNA 2FI4E 1GBHA 3BTKE 2YNAA 1O5GH 1GBFA 3BTEE 3TGJE 1JOUB 2VGCC 4UE7H 2PW8H 5JPMH 4I8LA 4Q80A 1HV7A 1T8NA 4O3UA 4X8TH
chains in the Genus database with same CATH superfamily
1BIOA 2JETB 4KP0A 2BQ6B 1P04A 5FPTA 1K22H 1HB0B 2GKVE 2XBYA 3TPIZ 1O2TA 1DDJA 2VH0A 1A1RA 5LPRA 1K1IA 2F83A 3EE7A 4ZHAA 1TOMH 2G81E 1C5ZB 2H5CA 1MTUA 5ESBA 1S5SA 5E0HA 2JETC 2FM2A 2BMGB 3LC5A 4R8TB 3GY2A 2WPDD 2PGQB 1NC6A 5T6GA 2ZU1A 5ETXA 2NU2E 1MCVA 1QJ7B 4D8NA 3UWIA 4PROA 1H8ED 1A0LA 1UTQA 1O34A 4BXWA 4E7NA 5JB8S 3S7KB 1OWKA 1E35B 1D9IA 1TBQH 2ZFQH 4H4FA 3FP8E 3LIWA 2CXVA 1MKWK 1JMOH 1FY4A 4WXIA 5IK2D 3LT3A 7GCHF 2GVFA 4CRDA 1ZTLA 3DUXH 6ESTA 1J15A 3P8NA 4M7GA 3ZVDA 1W0KD 3B8JA 3CS7A 1P2NA 2BB4A 1FPHH 1S83A 3N99A 1P02A 2FPZA 3A81A 3PMHB 1C4Y2 1C5QA 4Y11E 3MQKC 1ABJH 3BTWE 1H9HE 4BAHB 4X2VA 1TX8A 1Y8TA 4ZAEA 3MU5A 3GY4A 1NRRH 1EZXC 3BTTE 1AUTC 3EYDA 1TQ7B 2J94A 1OXGA 4Q63A 4ABGA 1FDPA 3SQEE 3MI4A 1C2IA 3ZZ6A 1N6XA 4Y71A 4OS7A 1ACBE 1RTLA 3F6UH 3SU4A 4HGCA 3IITA 1CHGA 2OQUA 1DICA 4AN7A 1GI5A 1MTSA 1O2MA 1K1JA 4ZHMU 1BMLA 3LGIA 4NCYA 2BDHA 5BRRE 2KX4A 3KQEA 1CBWB 3A83A 3TK6A 1A7SA 2P16A 3A89A 2BOKA 2C8WB 2OQ5A 1SGEE 1G37A 1HYLA 5DKMA 3TU7H 1HAOH 1TNHA 3UOPA 2F4LA 1ETTH 3ZZDA 3BIVH 1GJBB 1BHXB 1GVZA 2ZQ1A 4F49A 1CBWC 1DWCH 1LQDB 4AX9H 2RCEA 2KCOA 1NFXA 4MPXA 4TPYA 2Y7ZA 1SLUB 3T27A 3SZEA 4R0IA 3CP7A 1AIXH 3ZIAD 4CHAB 4CRBA 3LC3A 3TH2H 2ZTZA 1VGCB 2KAIA 4X1SU 1BJUA 1SGCA 8KME2 2GJGA 4ZHLU 2TGTA 2AGIX 3SU5A 4ABEA 2QAAA 2STAE 1EJNA 4B2BA 1AWFH 2Y80A 4CHAC 2G8TA 1ANEA 1ELEE 1VGCC 1QJ6B 3D23A 4Y0YE 1C9PA 3STJA 5A2MH 1TLDA 1JIRA 4A92A 4MQAA 1EB2A 1XVMA 1GI9B 2STBE 1HNEE 2HNTF 4KTCA 4XBDA 1L4DA 1A61H 1UHBA 3VGCB 4NZQA 2Z9KA 2A4OA 2ZHEH 2ZDLA 4IGDA 6GCHF 2W3IA 4I8HA 1BTPA 4NA9H 3A8BA 4FUHA 3URDA 3S7HB 4Y10E 4IC5A 3VGCC 1ID5H 1HAGE 4ZKSU 4E06H 1FIZA 1AKSA 1GBAA 3Q3XA 3WWBA 1F5RA 2FXRA 3SV6A 2WZQA 4CRAA 1ZHMA 4NSYA 1EOLA 1GG6B 5EXLA 4Y6DA 3B9FH 3U28C 2PP6A 3W95A 4RSPA 1BHXF 2AMQA 3PROA 1C5UA 1LKAA 2XBWA 5AF9H 2AMDA 3GDUA 5EXMA 3SV7A 1GG6C 2OINA 1RS0A 1AO5A 2ANMH 2M5TA 2OCVB 2ZU4A 1NRNH 2AFQB 3RC5A 2WUBA 3R0FA 4F4OC 1SBWA 2VIPA 1HAXB 1HCGA 1H9LB 2C90B 2SFAA 3RXBA 3SHAH 2ZZUH 1GMDG 1BUIA 1BQYA 1A5HA 1GVKB 3GYLB 2AYWA 4DCDA 1MKXK 1FJSA 4LZ4B 3RXMA 1GL0E 5K0HA 4BAOB 5GWZA 2BY6X 5GDSH 2GV6A 5F8XA 2ZGBH 1ZYOA 4AFQA 1O5CB 4U30A 3K9XB 5LH8A 1CA0B 1C5RA 1ZLRA 3P8GA 3PWCA 2EA3A 1D4PB 3RC4A 1O3AA 4WH8A 2FS9A 2SNVA 1ESTA 3M35A 3GDVA 2CHAB 3FO8D 4RKJB 3KYFA 2ZIQH 1LHCH 2FX4A 1O5DH 1D3DB 2F9BH 1CA0C 2R2WU 3RM0H 5JDUB 3RXCA 2Q1JA 1QQ4A 4Z0KA 2XBVA 1J9CH 3M5LA 4A1VA 2EI6A 4DOQA 2BX4A 4YLUA 3NZIA 3ZZ7A 2Y82A 1QR3E 3T5FH 2CHAC 1WYKA 3BEFB 1AU8A 1P3EA 2NU3E 3T29A 1GJDB 1MZDA 3O8BA 2V35A 4JZEH 1JXPA 4ZKOU 3SJ8A 1DS2E 1ZJKA 2C3SA 4WMFA 1PYTC 2WUCA 2SGPE 2ODPA 3HKIB 3PTBA 2KAIB 1KLIH 3LGWA 2JKHA 2FWWA 3KF2A 1GJ9B 1O2UA 2LELA 3A7TA 3FAOA 4KTUA 1N8OB 5HGGA 3FFGA 2UUKB 1MBQA 3MMGA 1YPHE 4WH6A 4Q2KA 1DITH 1HAIH 1N8OC 2CMYA 3V12A 1WXRA 4ZROA 2G4TA 1O0DH 4JK5A 4ABFA 2GZ8A 5CMXH 1UHBB 1C2LA 1GCDA 2QYIA 2BY7X 2XC4A 1GJ6A 2UUFB 3TJVA 1FN6A 4ABAA 1WAYB 4YOJA 2H9EH 1XUHA 1H8IH 2Z3CA 1DUAA 1HPGA 2JH0D 2ZCKP 4DJZB 1BA8B 3BG8A 3PRDA 1GI6A 3SORA 7KMEH 2Z9JA 2EEKA 3NCLA 4OS1A 5CHBA 1SC8U 3VFEA 2ODQA 1AZZA 2XXLA 3GICB 1ZMLA 2B8OH 2FYRA 3T28A 2NWNA 2C8XB 3S9AA 2ZFPH 3GCTG 1NROH 4Y79A 2QXHA 1TE0A 2IOTA 3D49H 1HBTH 5GJ4B 1NZQH 1VITF 1QBVH 2ZDAH 3ATIA 1EFRD 4O3TA 4D7GA 3RXEA 1T4VH 2Q6FA 2VVUA 1P8VC 1O2QA 5C2ZA 4FUCA 3GDSA 3E0PB 3SUFA 1AVXA 4B6EA 3FVFB 1MABB 2VWNA 1CA8B 3UNRA 2J4IA 1BCUH 3SV8A 1O39A 1QRWA 3M37A 5E2PA 2W26A 1N1LA 5A0BA 4K5ZA 3RXVA 2C8ZB 3U8OH 6LPRA 3EDXB 3FP6E 4UFEH 2VH6A 1V6DA 4CRFA 2BD7A 1C2HA 4RT0A 4CRCA 1BMAA 3F68H 3RXGA 2B5TB 1P03A 1BMMH 1NT1A 1C1SA 1FV9A 1KIGH 1O3OA 3M5OA 2ZF0H 4E05H 3ZZBA 5ESTE 3Q76A 1C5SA 1EAXA 1CU1A 1MU6B 1O3EA 4B75A 1EPTA 1ZHPA 1FAXA 4SGBE 1TNJA 2SGQE 3ZZAA 2GDEH 3A7VA 3JZ1B 1YLDA 1AVWA 1BRAA 1LO6A 3BTGE 1TPSA 2JIZD 3DCLA 5IYTA 4BANB 1UTJA 2Y5HA 4GPGA 4THNH 4YZUA 3SUDA 2ZGCA 3SHCH 3H7TA 1L2EA 3QZQA 1NBME 1XMNB 2UWOA 3SNAA 4MPUA 3O8RA 1V2MT 4B2AA 3K2UA 3WWFA 1QL7A 1GHZA 1BBRE 2ESTE 2I6SA 3DA9B 4CR9A 1GHAF 3VB5A 2LP6A 2RFKC 1BTHH 1HIAA 4TT3D 5EW2H 4OM9A 2DE9A 1C1PA 1C2MA 1XX9A 2XNIA 9LPRA 1AWHB 1S6LA 1DY8A 2W7SA 4A5TS 1CE5A 4KKDA 2R2MB 2I6QA 1W12U 1KDQA 1TAWA 1SB1H 5DP4A 3RXJA 1RGQA 3FZZA 1Y5AT 1BJVA 2VIVA 2C4FH 3ATKA 4HZHA 1UVSH 1PQAA 1AGJA 3FN8A 2OTVA 1HXEH 2B9LA 1P2JA 1O3HA 1OS8A 1G30B 3SJOA 4Y7AA 1JWTA 1JRSA 5A0CA 3ZZCA 1AY6H 2QXGA 1A4WH 3E1XB 1T32A 1ESBA 2IJD1 5CE1A 2HALA 2BYAX 5DP3A 5CDFE 5E8EH 3PB1E 1BTWA 1EASA 1CO7E 3GY3A 1YCPK 2QXIA 2F9NA 2BZ6H 4BAKB 4HG6A 2K1QA 1DE7H 3KQ5A 3SUEA 4MPWA 3T26A 1PPEE 2BXUH 4Q4LA 4P00A 2AIQA 1RJXB 3M5NA 1NFUA 1ZMJA 3A84A 4NSVA 2SGDE 1PPCE 1C5XB 1TNKA 1XVOA 5FL7D 5SGAE 1OHHD 2FS8A 3U1IB 4NWLA 1QJ1B 3V3MA 3KGPA 1V2LT 1ZR0A 2ZFTA 4AG1A 2F91A 1LPGB 2QC2A 1U6QA 2DE8A 1C1RA 4TWYA 1GHWH 3BN9A 1ORFA 1V2KT 2UWLA 3I78A 4INHA 2FOMB 5EQSA 3URCA 2W6JD 1SHYA 4IN2A 1DPOA 2FODA 1AE5A 2KCAA 4K69A 1CSOE 4A1XA 4JYUH 3QWCH 1TMBH 1O3CA 2GDDA 1C2GA 1Y3WA 1WU1A 2FI5E 2HOBA 2J34A 2ZC9H 4K8YA 2ZGJA 1F92A 1KLTA 1SGNE 2HGTH 1MCTA 3ESTA 1GBTA 1EATA 5C17A 3MO6A 1IQHA 1BTXA 1GCTB 1DOJA 3FKSD 5HKKD 5B6LA 4ISIH 3L3TA 5C0UA 1H8HD 2KFWA 4MNWA 3ZVEA 1TGNA 3VB6A 1MD7A 1SPJA 3N7DA 1GCTC 5EG4A 5FHTA 3TVJB 3TGIE 1KLJH 1SGTA 2TGAA 3E6PH 5EQQA 1D3QB 2G5VA 8ESTE 5GCHG 1DXPA 1ANDA 1CQQA 1BMFD 1Z71A 3N7EA 1CHOF 2CF8H 1PPZA 4AFZA 2VINA 4A1TA 5F8TA 1QFKH 1SGPE 3MNCA 4ISHH 4AZ2B 4Z6AH 1BT7A 1V2TT 2LPRA 3QGJA 1V2NT 4HFPB 5T3HA 1K0HA 1EP5A 1HIAB 1S0RA 2F43B 2G55A 4GCHF 2VB0A 3UWJH 1EKBB 1VJAU 3DSGA 5GXPA 1PFXC 3BSQA 3RU4E 1J17T 1HFDA 2A32A 2R0KA 4K8BA 1ELCA 3FZDA 1KDQB 4VGCB 4DW2U 1L1GA 2H2ZA 1V2UT 3S69A 2XBXA 3VPKA 1W7XH 4NIXA 5TJXA 2RDLA 3RMNH 3F9FA 3Q77A 2A4RA 4DT4A 3ODFA 3MU4A 1TPAE 1MZAA 3RC6A 1DT2A 3UQVA 3VG8A 4VGCC 2XTTB 5C5OA 1IQJA 1C2KA 1O2RA 1W13U 2IJOB 1EJAA 5FCRA 3GCNA 2JH6D 3U9AH 4AB8A 1F0UA 1UJ1A 1UTMA 3SU2A 1L1NA 2K8IA 2PGBB 4Y8ZA 2TRMA 1Z7KA 2RA0A 2CJIA 4HTCH 3TITA 1TGBA 1YY3A 4YO9A 1KMHB 5C67A 2SNWA 2EQNA 3F0PA 2HVYB 5B6OA 2VWLA 4AOQA 4FU8A 3RP2A 5L2ZH 1WDIA 1F0SA 2J97A 1SGIB 4SGAE 1UO6A 2QV1A 5AFZH 1K2I1 2PSYA 3SBKA 2P3UB 3SNBA 4TY6A 1SLXB 1TQ0B 3MH6A 5FXLA 1MKWH 4O97A 1GGDB 3M36A 1FAKH 4FETA 4WY3A 3KNXA 3HK6B 2UWPA 2TIOA 1KXEA 1KXFA 2H6MA 1MH0A 1O2XA 1MAXA 1O3FA 3MH5A 2GT7A 3BEUA 4D7FA 1P12E 2DUCA 3OFND 4MNXA 1EZUC 1ZMNA 1GGDC 1Y3YA 1FI8A 1UTKA 3RM2H 1GJCB 2A31A 2PV9B 3MU0A 2QF4A 1BITA 4B76A 1AN1E 1H8DH 4MNVA 1P9SA 3DFJA 3V0XA 3LONA 1UCYK 4NG9H 5DG6A 1YLCA 2ZKSA 2P94A 2B0FA 3DSOA 3TJUA 2QF3A 4K1SA 2G4UA 2O8LA 3ZZ8A 4UD9H 5DP8A 1WCZA 3SNEA 2AGEX 5KEDA 1C1UH 1W2KH 3BV9B 2AEIH 1E79D 4FVDA 4TYDA 4B2CA 4LZ1H 1NFYA 4E7RG 2RG3A 1UVTH 3ENSB 1QB6A 4LXBH 5L2YH 2BDIA 3SZNA 1WUNH 5TCCA 4XBCA 2A1DB 1C4V2 1HAHH 1V2JT 3UUZA 2M2AA 2NU4E 1D3TB 1GBIA 1NS3A 3S9CA 3WY8A 1AUJA 3U69H 2BD3A 2ALPA 1E38B 2R3YA 1ARBA 1A5GH 2QXJA 2GTBA 2J98B 2Q6DA 2GCHG 4XOJA 4NZLA 2BY9X 1A2CH 2J92A 5HYOA 1O3KA 1SOTA 2GGVB 2ZPQA 1BB0B 2XWBI 3UFAA 2W6ID 4B6FA 1C2EA 4OGXA 1OWHA 4B1TA 2P59A 3F9HA 2CF9H 1VITH 3T25A 2ZGHA 2VNTA 2ALVA 3DHKH 1C5TA 1KTTB 1QHRB 1S0QA 1TRYA 2HPPH 3LDXH 3LOXA 3PMAB 1IHTH 1O3IA 2WPHS 4U32A 1ZSJA 5FX5A 3QLPH 1B7XB 2BVRH 4YM9A 1GBMA 1GI2A 3KQDA 3HPTB 1SFIA 4Y0ZE 4JYVH 3WW7A 2EI7A 1O33A 1GWAA 4JCNA 4ACBA 2ZHDA 1ANCA 2JJ2D 1SOZA 4H42U 3OY6U 2D26C 1DUEA 4NFEA 2JDID 1BTZA 3PV5A 4GHTA 1O5EH 4I8JA 2XNDD 1GHBG 1KXCA 1EZSC 1TX7A 4UFGH 3ZVGA 1HAVA 1ZPZA 2H1UA 1NRPH 1EAWA 1QTFA 2PFEA 5EQRA 1MAYA 1CT2E 4J1YA 1NU7B 1SHHB 1SGFA 1TMUH 1IQNA 1TABE 1UTOA 3O8DA 1GHXH 3KQCA 3RXQA 1THPB 2GP9B 2OBQA 1C5OH 3MU1A 1P09A 4WF8A 1V2WT 1W14U 3MNBA 1BDAA 3F2GA 3BEIB 3DT0H 4JZIA 1GI1A 3ELAH 1MKXH 3OX7U 1TMTH 3GS9A 4KGAA 1ELTA 4A7IB 4TPIZ 1P57B 1DANH 1OPHB 4UDWH 3STIA 2TGDA 4DURA 1XKAC 3ZZ5A 5FPSA 1VCQA 5DSFA 1LVYA 1VR1H 1V2ST 5A8ZA 2VU8E 2VBCA 1TPOA 4BTIB 8LPRA 2A5KA 1VCWA 3PV4A 3RLYH 1O32A 4YXWD 3P8FA 1CT4E 2V7QD 2ZEBA 2BVXH 3SJ9A 5C5NA 1IQKA 2L74A 1GMDF 1OWEA 2NU0E 1FMGA 4WJG2 2WSSD 1P0SH 3P70B 1W0YH 5C0TA 1V2QT 1GJ5H 3F1SB 1DVAH 1G36A 1NM6A 1GBLA 3UR6A 5L6NH 2F9VA 3SO3A 4X8SH 1JIMA 3F9GA 4XSKU 1YF4A 3RXTA 5J4QA 3BG4B 1IQGA 1EB1H 1OP0A 5IDKA 1OOKB 3SGQE 3NKKA 3T2NA 1YKTA 1O30A 1MMJN 2Z9IA 4WMEA 2W5EA 4OS4A 1XM1A 3KL6A 5DPAA 2VVVA 1YCPM 2BTCE 3BG4C 1W8BH 2YMSB 3DSPA 3UNSA 1O3GA 1EZQA 1AFQB 5EXNA 5JBAS 3E3TA 4UFFH 4CBOA 1G2MA 2FOFA 1P3CA 4IMQA 2SGEE 4A6LA 2V3HH 2Y81A 4FXGH 5BPEA 4YLQH 1UK4A 3A7YA 2YMSC 3P8OA 3TNSA 1C1NA 3A7WA 2P8OB 4YT7H 2ZO3H 3LJJA 1AFQC 1VITG 1Z1JA 3FP7E 1WQVH 5C1XA 5FAHA 3MWIU 1RXPA 1Q3XA 1AMHA 5CHAB 1AKSB 3S9BA 5F8ZA 1YWUA 3EAJA 3PLPA 2P8OC 3EA9A 1W11U 2FI3E 2BLVA 1G32B 1P2QA 2O9QA 3NUMA 4D76A 1K21H 3HKJB 3BTQE 1GI4A 4ZKRU 5CHAC 5EGMA 1J16A 3UTUH 5JYIA 2VWMA 4Y7BA 1GDUA 2SGFE 5AVDA 1MTNB 1V2OT 2ILNA 1AB9B 1ABIH 1IQLA 1YP9A 3GCHB 2K0QA 1GPZA 2OK5A 3TJOA 2VIQA 2EC9H 1OWDA 2A0QB 1TX6A 1O2SA 1NRSH 3TGKE 1DSTA 3DFLA 1E0FD 1MTNC 1YPJH 3KCGH 2F9OA 1XUFA 1C5LH 1L0ZA 2THFB 1AB9C 1GI0A 2JH5D 2ZPRA 3GCHC 5A8YA 3G01A 3V13A 1DLEA 3OEED 1N6YA 2ASUB 3LH3A 4RT1A 3GYMA 4RI0A 1RD3B 1C5MD 3GCTF 2F3CE 4CBNA 1F0TA 3OTJE 4XRNA 1TGSZ 2XWAA 3H5CB 1K9OE 2EY4C 3KEEA 1FY8E 4FUGA 1LHEH 1C5VA 3H09A 3ZZ4A 4BTUB 1RFNA 1SGFG 1SG8B 2D1JA 3Q3KA 2BLQA 5T6FA 2FX6A 2VVCA 1QB9A 1F5KU 2J9NA 1GBJA 2P3FH 4FU9A 1QQUA 2CGAA 1Y59T 4X6PA 5EOKA 1T8MA 4D9RA 1LKBA 5LGOA 5HXFA 3RXAA 2ANKH 1ZTKA 5EJLA 2C93B 2QF0A 2ZDMA 1TGTA 1IAUA 3M7UA 1MQ6A 1TYNA 3F2FA 1AHTH 1D6WA 3PO1B 4CH2B 1ELAA 1PPBH 3RU4T 2XCNA 1DXWA 2PKAA 1FQ3A 4DVAU 1C4U2 2BX3A 4DIIH 2QGRA 5JBTA 4K1TA 1CGHA 3LU9B 1UVUH 1BBRK 3SJIA 1ZPCA 3LGTA 3O8CA 4X6OA 5PTPA 2BDYA 3PO1C 2OC0A 3AW1A 1O36A 1YM0A 2ZWLH 1H4WA 4DGJA 1J14A 5I25A 2PHBA 2B7DH 5KECA 1MD8A 1TALA 2XCFA 3RDZA 3GCOA 2OBOA 1TNLA 1T8OA 1K1OA 3PMJA 4I8GA 4Q7YA 1YPHC 1DY9A 3KN2A 1CGJE 3P92A 1O38A 1O5AB 5JBCS 1ELGA 1GJ8B 3EQ0H 3M61U 4MTBA 2FOCA 2ZCHP 1QZ8A 1Y3VA 2A7CA 4ABHA 2GCTB 4ABIA 1AFEH 3LJOA 5ABWA 3UB0A 1O2ZA 1A5IA 1HXFH 4CH8B 1SKYE 2Z3EA 1YCPH 3C1KA 2GCTC 3E8LA 1NRQH 1VJ9U 2CN0H 2PTCE 3HGPA 3I77A 4TSFD 4B73A 1NO9H 2O8TA 4XE4A 4Y76A 1AQ7A 1T31A 3L6PA 1JRTA 1H1BA 2A5IA 2ZCLP 2FDAA 3EA8A 4BOHA 1IQIA 3UY9A 1YLNA 2RA3A 3BF6H 2YNBA 1GMCG 1YC0A 5AFYH 1S81A 1ETSH 2F9PA 3QX5H 1GDQA 2C8YB 1YPKH 2Z6BD 1G3CA 4JK6A 2O8UA 1IQEA 1LDTT 1KYNA 1C2JA 1OYQA 2ZDKA 3RUOA 1ZSLA 8GCHG 1E34B 4DIHH 2QF5A 1L4ZA 4LK4A 3W94A 9ESTA 2KM0A 3F3BA 5H4IB 1YBWA 1CGIE 1TNIA 1NPMA 1O2PA 3UREA 1ZRKA 1EAUA 4B74A 4MG3A 1ZGVA 5EPNA 2BY8X 1HUTH 2BY5X 1THSH 3RLWH 3RXDA 4WWYA 1O2KA 1OP2A 5FBIA 3F9EA 2BVSH 1CHOG 1BZXE 2QY0B 2ZECA 3NK8A 5EJ1A 3S0NA 1DWDH 1EPTB 5KGOA 1K1NA 1NU9A 3OAAD 1FX0B 3GY5A 4INLA 2V0BA 3RXKA 1K28D 3ITIA 3CENA 3RXIA 1FUJA 1ESAA 3A80A 3ZVCA 1Z1IA 2W7UA 2V6NA 4IC6A 4J2YB 5JB9S 1HRTH 2O8MA 1ZZZA 3A85A 4X6MA 2L6OA 2H5DA 1P01A 1EPTC 2HNTE 1GMHG 2AMPA 4IN1A 3A86A 1T7CA 3MH4A 4NGAH 1O3NA 1Q31A 2RDEA 1QGFA 2FOAA 3RXFA 5C3NA 3TNTA 1QA0A 4JZDH 2VIDA 1O3BA 5EODA 1Z8JB 3GY7A 2PKAB 3OE7D 4RN6A 1WV7H 3PYHA 1T8LA 2CK3D 1D6RA 1GBBA 4ABBA 2FOGA 2TBSA 1O2GH 3QDZB 4TWWA 1KTSB 2G51A 1EAIA 1SQTA 2QCYA 1E1RD 1INCA 1FXYA 1BOQA 5FCKA 2J38A 3NXPA 5HIZA 5E0JA 2Q6GA 5GCHF 2KZ4A 2ZTXA 2QIQA 4ZCNA 3SU0A 1A46H 1S6HA 3K6YA 4TY7A 7LPRA 4XDEA 3A8DA 2WPJS 1OP8A 2WINI 4ZUHA 3EGKH 2EI8A 1DSUA 2A4GA 2F9UA 4OS2A 3U8RH 1Z6JH 3CNRA 2A4QA 3E90B 3SGAE 1P11E 2Y5FA 1EJMA 1GJAB 2GZ7A 7GCHG 3TH4H 2OP9A 1C1TA 4ZMAH 2ANYA 1ELDE 4F55A 4GLYA 4ACAA 2BM2A 4HI3A 5T6DA 2ZHWH 3A7XA 4GUXA 3SNCA 3K6ZA 1YYY1 1QB1A 1V2RT 4AFUA 1H9IE 3OYPA 2Y5GA 3K65B 5DP6A 1Y3XA 3SV2H 1EOJA 2FZZA 1LPZB 1B5GH 1TPPA 3RXHA 3GOVB 1O3JA 3MTYA 1TB6H 1FNIA 1F5LA 4X1PU 4X1RU 3SJKA 1SQAA 1F2SE 1HLTH 1O37A 3MH7A 2FOEA 1F7ZA 2FLBH 3M7QA 3QN7A 1E1QD 3SU6A 1UVOA 4F48B 7ESTE 5HIYA 1PYTD 4JZFH 1SFQB 1SVPA 1IOEA 2ZFFH 1YPEH 5C94A 3P95A 1C2FA 4ZXYH 3TIUA 2Z9LA 4FUJA 1UCYH 3GY8A 2VIOA 2G5NA 2H9HA 4DT7B 2ODYB 1UCYE 1S84A 2SGAA 3Q00A 1PPFE 3ZYDA 2BDAA 1QBOA 2WHXA 4XFQA 3EE0B 2FTLE 4WVPE 1YPMH 2WYJA 1QURH 1MUEB 3SGBE 3RXRA 1Y5UT 2YOLA 4FUDA 1FN8A 4ASHA 1LVOA 1TNGA 4ESTE 4NWKA 5F53A 2GV7A 3BIUH 2YMSD 4YOIA 4O9VA 1IQMA 1THRH 1VZQH 3SUGA 1L1JA 2A7JA 1X7AC 3OTPA 4XBBA 3SI3H 4AG2A 1Z6EA 2Y6TA 2BDCA 2V3OH 3M3SA 2HNTC 1IHSH 4YOGA 3ATWA 4JYTA 3U8TH 2FTMA 5FX6A 3A8CA 1MBMA 1UTLM 1NTPA 1P2KA 1QIXB 3SW2B 2FYQA 5AHGH 1GI7B 1FY3A 4NIVA 5L30H 1C1WH 1KY9A 4FUBA 3UQOA 4CR5A 3RMMH 2UUJB 3HATH 5EW1H 4ISOA 1PJPA 3VB4A 6GCHG 1W10U 1O2NA 1ZOMA 1EUFA 2A2QH 2ZDVH 3MO9A 5G4BA 4Y8XA 5HM9A 2PUQH 1AI8H 1SGQE 3SV9A 1NESE 1HAPH 3FOAA 3SOSA 5C1YA 2TGPZ 5GPIB 4Z1MD 3MNSA 1ETRH 1BRUP 1QRZA 1GJ7B 3AK5A 1QBNA 3IWMA 1LMWB 1TA6A 4I31A 1O2JA 1WOFA 3JZ2B 1HJ8A 1C9TA 2WYGA 2Z7FE 4B71A 2GCHF 3OSYA 5EIYA 1SGYE 1FPCH 4ZH8A 3MFJA 1C1VH 3ZZ9A 2ZHQH 5DN6D 4Q7ZA 4NFFA 1AZ8A 3E91A 1RRKA 3LGVA 2R3UA 4MDSA 1P06A 1Y3UA 1LVBA 2V3MA 1LTOA 4FVBA 1DX5M 1MQ5A 1K1MA 4ABDA 5DP9A 3OEHD 2BLWA 2IPQX 2XRCA 1HJAB 1OWJA 4UONA 4I32A 2FO9A 2QE7D 1O3LA 1YGCH 5T1VA 2AH4X 1E36B 3MO3A 1HDTH 2VJ1A 5HMAA 4JMYA 2PUXB 2PR3A 1HAYB 1DWBH 2TPIZ 5DGJA 1HJAC 1TBZH 1W3CA 3PLKA 4K1EA 1XUJA 2P95A 2ZP0H 1ARCA 2BDGA 3F0OA 1ZJDA 2FOBA 1WSSH 3NRLA 3VXFH 5LPEA 2ZDNA 2XC0A 5FBEA 3OU0A 5E2OA 3V7TA 2FIRH 2LNCA 1LQEA 2P93A 4NA8A 2Z94A 3BTFE 1OX1A 4GSOA 5GNDA 3QK1A 2WV4A 1GHBF 1PQ7A 1SI5H 1TGCA 4DY7B 3RMOH 4MPVA 3LGUA 1O2HA 4KTSA 3R3GB 3CS0A 4Q7XA 1O2IA 1KXDA 1OSSA 4YESB 5JBBS 1ZPBA 1A3EH 1PQ8A 5EPYA 2GT8A 2XC5A 3M3VA 3E0NB 1BTUA 1GHYH 2BQWB 3ODDA 1UW7A 3ZVFA 4BAQB 5F03A 1TONA 1QA7A 1WTGH 3BTDE 5A0AE 4FOUC 3OY5U 2UUYA 2CV3A 3ZV8A 1RTFB 3UAIC 1TOCB 3AAUA 4P02A 3TJNA 4AORA 3BTHE 1NFWA 4DG4A 1W7GH 3A87A 4NIYA 1C1MA 2R9PA 2ZQ2A 1TA2A 3SI4H 2Z9GA 2HWLB 4ASUD 2ZI2H 4ZKNU 2H9TH 2BD4A 1V2PT 4K3JA 1SGRE 2Z3DA 3PLBA 2HPQH 4QT8C 1QL9A 2HLCA 3NPSA 3D62A 1Y5BT 1G2LA 1SSXA 2GD4B 3P17H 1ELBA 1S85A 3PWBA 4CREA 1FZZA 1O31A 4I7YH 4H6SB 4IS5A 2HLDD 1GBKA 3I29A 2BD5A 1GI8B 1QL8A 2R0LA 4GVUA 4GAWA 1SGDE 2XOKD 4FUIA 2J95A 3QTOH 2GZ9A 4X6NA 1K1PA 3LGYA 5DO4H 3KYGA 2O8WA 3PV2A 1LVMA 3VXEH 2ZU3A 5GIBA 1PPGE 2XYAA 3ATLA 4OGYA 3ZV9A 4OS5A 4X2WA 1AE8H 4JZ1A 2BZAA 5I46H 3ZZ3A 4WXVA 1XXFA 2ZPSA 1O5FH 1VCPA 3T62A 3LH1A 1SLWB 2ZU2A 2AIPA 1IQFA 3SNDA 1TIOA 1KXAA 1TRMA 3SQHE 2KCYA 1WQSA 1O3DA 4I33A 4RKOB 1V2VT 1HAZB 3UIRA 5A8XA 1UTPA 4X8VH 1A0JA 3QZRA 5EJZA 3W1EA 1DM4B 4X2YA 3N7OA 4H6TA 1HAVB 1XKBC 2A7HA 2NU1E 1SQOA 1NBMD 1ZHRA 1C5PA 2ZNKH 3QO6A 2ZFRH 4D9QA 1OKXA 1SMFE 4NIWA 1F0RA 4FUEA 1HGTH 1G3BA 1T4UH 5EU8A 3VEQB 4AFSA 3BTME 4ISLA 1ANBA 1EXFA 1AVGH 1P2OA 1O2YA 4ABJA 5C1UA 2JJ1D 2XW9A 1GBDA 3Q3YA 3AW0A 4FU7A 3PRBA 2D8WA 3MU8A 3SYJA 4AYYB 2WPMS 3PM3A 6CHAB 5LPFA 1P2IA 5F6MA 1FONA 2A5AA 1C1QA 3UNQA 4LOYH 4U01A 2ZG0H 3C27B 1MTVA 2BLOA 1HJ9A 1GHVH 3KHVA 4AGKA 4IMZA 3QGNB 6CHAC 1SR5C 2PKSB 2AS9A 1EX3A 2BD8A 3AAVA 1GHAG 1UVPA 2FOHA 1LHFH 2BDBA 2WPLS 4X1NU 1O3PB 1GJ4H 4NA7A 1O5BB 2QN5T 3U98H 1GI3A 1JBUH 4AGJA 3IG6B 4FUFA 2A2XH 2PKSC 3A7ZA 2BD2A 1WTHD 3H7OA 4INKA 1J8AA 4X0WU 3TK5A 4BTTB 1B0EA 4CRGA 2VIWA 5A09A 2OD3B 3SU1A 1FLEE 2OXSA 3TH3H 3GY6A 3VB3A 3MYWA 3ZYEA 3HGNA 1G9IE 1ZTJA 3PTNA 2PSXA 5FPYA 2QA9E 4YT6H 3PMBB 1A3BH 2PWXA 1UK3A 1YPLH 1Q2WA 3UR9A 3ZVBA 1BBRH 1BMNH 1C1OA 1P2MA 2AGGX 2BHGA 3M5MA 4BXSA 1QCPA 4ISNA 1UK2A 1RTKA 2AHME 1LPKB 1TFXA 3LPRA 2ZU5A 1CT0E 2BQ7B 2PLXA 2IPHA 1DWEH 1B0FA 3RXSA 3VB7A 1WBGB 1SLVB 1P9UA 1SQRA 3ZVAA 2W3KA 4WMDA 1BRBE 1QRXA 1ZRBA 2FP7B 1A0HB 1V3XA 2ZFSA 2ZTYA 1TBRH 2OC7A 3GISB 4KELA 4BNRA 1E37B 4IBLH 1S82A 1O2WA 1G3DA 5DJ7A 3A88A 2ZA5A 1C5YB 5DP5A 1NY22 1FY1A 3RXLA 3KIDU 3UOUA 1AD8H 1QY6A 3FANA 3TLOA 1XXDA 4GHQA 2FESH 1PQ5A 2FLRH 2Y7XA 4YTAA 5HM2A 3LKWA 1O35A 2HRVA 3L33A 3DD2H 1COWD 2ANWA 1ELFA 3D65E 1PPHE 1GBCA 1O2OA 2IN2A 1UMAH 4MNYA 1K1LA 1RIWB 4X8UH 1Z8RA 1QNJA 1ZGIA 2ZGXH 2A45B 5J4SA 4K60A 1GBEA 1ELVA 3B23B 4UEHH 1W0JD 4I8KA 1W0ZU 3QTVH 3SN8A 3RXPA 1RIWC 4AC9A 1XUKA 2OC1A 2J5UA 1O3MA 3MHWU 5TCAA 3EA7A 1BRCE 3QUMP 2G00A 1O2LA 1LHGH 1DFPA 1LCYA 2HVXA 4K2YA 2GMTB 4MLFB 1O2VA 1C2DA 1YPGH 1TRNA 4OS6A 2D2DA 3RU4D 1OWIA 4X2XA 2WPKS 3A82A 1Z8GA 1XUIA 3AVZA 2G52A 4X1QU 3P6ZB 4BAMB 1UTNA 1GMCF 3KQBA 1P10A 3M3TA 1NN6A 2GMTC 1DLKB 4O03A 3F2HA 1GDNA 3ATMA 3MOCA 2WV5A 2KCPA 5DK1A 3RXUA 2AERH 3HK3B 2ZHFH 8GCHF 4UFDH 1MTWA 3A8AA 2VWOA 4U2WA 4IW4E 1FY5A 3AASA 2PTNA 4GCHG 1D3PB 2WPIS 1ZSKA 3MNXA 4XD7D 1GL1A 2P3TB 1OYTH 1S6FA 2KR7A 1LHDH 2WV9A 3RMLH 1KXBA 2BOHB 1M9UA 5DP7A 1XUGA 4AYVB 3NWUA 2J2UA 1C5NH 4Y8YA 3TK9A 1KSNA 2BXTH 1GVLA 1P05A 3UPEA 4AB9A 1CVWH 1TWXB 1MU8B 1BTYA 1Z8IB 3SU3A 1EP6A 2OUAA 3M7TA 1FIWA 1EQ9A 3E16B 4ZXXH 2J98A 5K7RA 1C5WB 1SL3A 2GX4A 3RXOA 2VGCB 1VKYA 2FEQH 2FMJA 5E0GA 1GMHF 1G3EA 2OLGA 4M9FA 3U1JB 2BD9A 2ULLA 2OC8A 5C20A 4MVNA 2FI4E 1GBHA 3BTKE 2YNAA 1O5GH 1GBFA 3BTEE 3TGJE 1JOUB 2VGCC 4UE7H 2PW8H 5JPMH 4I8LA 4Q80A 1HV7A 1T8NA 4O3UA 4X8TH 4I86A
chains in the Genus database with same CATH topology
1BIOA 2JETB 4KP0A 2BQ6B 1P04A 5FPTA 1K22H 1HB0B 2GKVE 2XBYA 3TPIZ 1O2TA 1DDJA 2VH0A 1A1RA 5LPRA 1K1IA 2F83A 4ZHAA 1TOMH 2G81E 1C5ZB 2H5CA 1MTUA 5ESBA 1S5SA 5E0HA 2JETC 2FM2A 2BMGB 3LC5A 4R8TB 3GY2A 2PGQB 1NC6A 5T6GA 2ZU1A 5ETXA 2NU2E 1MCVA 1QJ7B 4D8NA 3UWIA 4PROA 1A0LA 1UTQA 1O34A 4BXWA 4E7NA 5JB8S 3S7KB 1OWKA 1E35B 1D9IA 1TBQH 2ZFQH 4H4FA 3FP8E 3LIWA 2CXVA 1MKWK 1JMOH 1FY4A 4WXIA 3LT3A 7GCHF 2GVFA 4CRDA 1ZTLA 3DUXH 6ESTA 1J15A 3P8NA 4M7GA 3ZVDA 3B8JA 3CS7A 1P2NA 2BB4A 1FPHH 1S83A 1P02A 2FPZA 3A81A 3PMHB 1C4Y2 1C5QA 4Y11E 1ABJH 3BTWE 1H9HE 4BAHB 4X2VA 1TX8A 1Y8TA 4ZAEA 3MU5A 3GY4A 1NRRH 1EZXC 3BTTE 1AUTC 3EYDA 1TQ7B 2J94A 1OXGA 4ABGA 1FDPA 3SQEE 3MI4A 1C2IA 3ZZ6A 1N6XA 4Y71A 4OS7A 1ACBE 1RTLA 3F6UH 3SU4A 4HGCA 3IITA 1CHGA 2OQUA 1DICA 4AN7A 1GI5A 1MTSA 1O2MA 1K1JA 4ZHMU 1BMLA 3LGIA 4NCYA 2BDHA 5BRRE 3KQEA 3TK6A 1CBWB 3A83A 1A7SA 2P16A 3A89A 2BOKA 2C8WB 2OQ5A 1SGEE 1G37A 1HYLA 5DKMA 3TU7H 1HAOH 1TNHA 3UOPA 1ETTH 3ZZDA 3BIVH 1GJBB 1BHXB 1GVZA 2ZQ1A 4F49A 1CBWC 1DWCH 1LQDB 4AX9H 2RCEA 1NFXA 4MPXA 4TPYA 2Y7ZA 1SLUB 3T27A 4R0IA 3CP7A 1AIXH 4CHAB 4CRBA 3LC3A 3TH2H 2ZTZA 1VGCB 2KAIA 4X1SU 1BJUA 1SGCA 8KME2 4ZHLU 2TGTA 2AGIX 3SU5A 4ABEA 2QAAA 2STAE 1EJNA 4B2BA 1AWFH 2Y80A 4CHAC 2G8TA 1ANEA 1ELEE 1VGCC 1QJ6B 3D23A 4Y0YE 1C9PA 3STJA 5A2MH 1TLDA 1JIRA 4A92A 4MQAA 1EB2A 1XVMA 1GI9B 2STBE 1HNEE 2HNTF 4KTCA 4XBDA 1L4DA 1A61H 1UHBA 3VGCB 4NZQA 2Z9KA 2A4OA 2ZHEH 2ZDLA 4IGDA 6GCHF 2W3IA 4I8HA 1BTPA 4NA9H 3A8BA 4FUHA 3URDA 3S7HB 4Y10E 4IC5A 3VGCC 1ID5H 1HAGE 4ZKSU 4E06H 1FIZA 1AKSA 1GBAA 3Q3XA 1F5RA 2FXRA 3SV6A 4CRAA 1ZHMA 4NSYA 1EOLA 1GG6B 5EXLA 4Y6DA 3B9FH 3W95A 4RSPA 1BHXF 2AMQA 3PROA 1C5UA 1LKAA 2XBWA 5AF9H 2AMDA 3GDUA 5EXMA 3SV7A 1GG6C 2OINA 1RS0A 1AO5A 2ANMH 2M5TA 2OCVB 2ZU4A 1NRNH 2AFQB 3RC5A 2WUBA 3R0FA 4F4OC 1SBWA 2VIPA 1HAXB 1HCGA 1H9LB 2C90B 2SFAA 3RXBA 3SHAH 2ZZUH 1GMDG 1BUIA 1BQYA 1A5HA 1GVKB 3GYLB 2AYWA 4DCDA 1MKXK 1FJSA 4LZ4B 3RXMA 1GL0E 5K0HA 4BAOB 5GWZA 2BY6X 5GDSH 2GV6A 5F8XA 2ZGBH 1ZYOA 4AFQA 1O5CB 4U30A 3K9XB 5LH8A 1CA0B 1C5RA 1ZLRA 3P8GA 3PWCA 2EA3A 1D4PB 3RC4A 1O3AA 4WH8A 2FS9A 2SNVA 1ESTA 3M35A 3GDVA 2CHAB 4RKJB 2ZIQH 1LHCH 2FX4A 1O5DH 1D3DB 2F9BH 1CA0C 2R2WU 3RM0H 5JDUB 3RXCA 2Q1JA 1QQ4A 4Z0KA 2XBVA 1J9CH 3M5LA 4A1VA 2EI6A 4DOQA 2BX4A 4YLUA 3NZIA 3ZZ7A 2Y82A 1QR3E 3T5FH 2CHAC 1WYKA 3BEFB 1AU8A 1P3EA 2NU3E 3T29A 1GJDB 1MZDA 3O8BA 2V35A 4JZEH 1JXPA 4ZKOU 3SJ8A 1DS2E 1ZJKA 2C3SA 4WMFA 1PYTC 2WUCA 2SGPE 2ODPA 3HKIB 3PTBA 2KAIB 1KLIH 3LGWA 2JKHA 2FWWA 3KF2A 1GJ9B 1O2UA 3A7TA 3FAOA 4KTUA 1N8OB 5HGGA 3FFGA 2UUKB 1MBQA 3MMGA 1YPHE 4WH6A 4Q2KA 1DITH 1HAIH 1N8OC 2CMYA 3V12A 4ZROA 2G4TA 1O0DH 4JK5A 4ABFA 2GZ8A 5CMXH 1UHBB 1C2LA 1GCDA 2QYIA 2BY7X 2XC4A 1GJ6A 2UUFB 3TJVA 1FN6A 4ABAA 1WAYB 4YOJA 2H9EH 1XUHA 1H8IH 2Z3CA 1DUAA 1HPGA 2JH0D 2ZCKP 4DJZB 1BA8B 3BG8A 1GI6A 3SORA 7KMEH 2Z9JA 2EEKA 3NCLA 4OS1A 1SC8U 3VFEA 2ODQA 1AZZA 2XXLA 3GICB 1ZMLA 2B8OH 2FYRA 3T28A 2NWNA 2C8XB 3S9AA 2ZFPH 3GCTG 1NROH 4Y79A 2QXHA 1TE0A 2IOTA 3D49H 1HBTH 5GJ4B 1NZQH 1VITF 1QBVH 2ZDAH 3ATIA 4O3TA 4D7GA 3RXEA 1T4VH 2Q6FA 2VVUA 1P8VC 1O2QA 5C2ZA 4FUCA 3GDSA 3E0PB 3SUFA 1AVXA 3FVFB 2VWNA 1CA8B 3UNRA 2J4IA 1BCUH 3SV8A 1O39A 1QRWA 3M37A 5E2PA 2W26A 1N1LA 5A0BA 4K5ZA 3RXVA 2C8ZB 3U8OH 6LPRA 3EDXB 3FP6E 4UFEH 2VH6A 1V6DA 4CRFA 2BD7A 1C2HA 4CRCA 1BMAA 3F68H 3RXGA 2B5TB 1P03A 1BMMH 1NT1A 1C1SA 1FV9A 1KIGH 1O3OA 3M5OA 2ZF0H 4E05H 3ZZBA 5ESTE 3Q76A 1C5SA 1EAXA 1CU1A 1MU6B 1O3EA 4B75A 1EPTA 1ZHPA 1FAXA 4SGBE 1TNJA 2SGQE 3ZZAA 2GDEH 3A7VA 3JZ1B 1YLDA 1AVWA 1BRAA 1LO6A 3BTGE 1TPSA 4BANB 5IYTA 1UTJA 2Y5HA 4GPGA 4THNH 4YZUA 3SUDA 2ZGCA 3SHCH 3H7TA 1L2EA 3QZQA 1XMNB 2UWOA 3SNAA 3O8RA 4MPUA 1V2MT 4B2AA 3K2UA 1QL7A 1GHZA 1BBRE 2ESTE 2I6SA 3DA9B 4CR9A 1GHAF 3VB5A 1BTHH 1HIAA 5EW2H 2DE9A 1C1PA 1C2MA 1XX9A 2XNIA 9LPRA 1AWHB 1DY8A 2W7SA 4A5TS 1CE5A 4KKDA 2R2MB 2I6QA 1W12U 1KDQA 1TAWA 1SB1H 5DP4A 3RXJA 1RGQA 3FZZA 1Y5AT 1BJVA 2VIVA 2C4FH 3ATKA 4HZHA 1UVSH 1PQAA 1AGJA 2OTVA 1HXEH 2B9LA 1P2JA 1O3HA 1OS8A 1G30B 3SJOA 4Y7AA 1JWTA 1JRSA 5A0CA 3ZZCA 1AY6H 2QXGA 1A4WH 3E1XB 1T32A 1ESBA 5CE1A 2HALA 2BYAX 5DP3A 5E8EH 3PB1E 1BTWA 1EASA 1CO7E 3GY3A 1YCPK 2QXIA 2F9NA 2BZ6H 4BAKB 3SUEA 2K1QA 1DE7H 4MPWA 3T26A 1PPEE 2BXUH 2AIQA 1RJXB 3M5NA 1NFUA 1ZMJA 3A84A 4NSVA 2SGDE 1PPCE 1C5XB 1TNKA 1XVOA 5SGAE 2FS8A 3U1IB 4NWLA 1QJ1B 3V3MA 3KGPA 1V2LT 1ZR0A 2ZFTA 4AG1A 2F91A 1LPGB 2QC2A 1U6QA 2DE8A 1C1RA 4TWYA 1GHWH 3BN9A 1ORFA 1V2KT 2UWLA 3I78A 4INHA 2FOMB 5EQSA 3URCA 1SHYA 4IN2A 1DPOA 2FODA 1AE5A 4K69A 1CSOE 4A1XA 4JYUH 3QWCH 1TMBH 1O3CA 2GDDA 1C2GA 1Y3WA 1WU1A 2FI5E 2HOBA 2J34A 2ZC9H 4K8YA 2ZGJA 1F92A 1KLTA 1SGNE 2HGTH 1MCTA 3ESTA 1GBTA 1EATA 3MO6A 1IQHA 1BTXA 1GCTB 1DOJA 4ISIH 3L3TA 3ZVEA 4MNWA 1TGNA 3VB6A 1MD7A 1SPJA 1GCTC 5EG4A 5FHTA 3TVJB 3TGIE 1KLJH 1SGTA 2TGAA 3E6PH 5EQQA 1D3QB 2G5VA 8ESTE 5GCHG 1DXPA 1ANDA 1CQQA 1Z71A 1CHOF 2CF8H 1PPZA 4AFZA 2VINA 4A1TA 5F8TA 1QFKH 1SGPE 3MNCA 4ISHH 4AZ2B 4Z6AH 1BT7A 1V2TT 2LPRA 3QGJA 1V2NT 4HFPB 5T3HA 1EP5A 1HIAB 1S0RA 2G55A 4GCHF 2VB0A 3UWJH 1EKBB 1VJAU 5GXPA 1PFXC 3BSQA 3RU4E 1J17T 1HFDA 2A32A 2R0KA 4K8BA 1ELCA 3FZDA 1KDQB 4VGCB 4DW2U 1L1GA 2H2ZA 1V2UT 3S69A 2XBXA 3VPKA 1W7XH 4NIXA 5TJXA 2RDLA 3RMNH 3F9FA 3Q77A 2A4RA 3ODFA 3MU4A 1TPAE 1MZAA 3RC6A 1DT2A 3UQVA 4VGCC 2XTTB 5C5OA 1IQJA 1C2KA 1O2RA 1W13U 2IJOB 1EJAA 5FCRA 3GCNA 2JH6D 3U9AH 4AB8A 1F0UA 1UJ1A 1UTMA 3SU2A 1L1NA 2PGBB 4Y8ZA 2TRMA 1Z7KA 2RA0A 2CJIA 4HTCH 3TITA 1TGBA 4YO9A 5C67A 2SNWA 5B6OA 2VWLA 4AOQA 4FU8A 3RP2A 5L2ZH 1F0SA 1SGIB 4SGAE 1UO6A 2QV1A 5AFZH 1K2I1 2PSYA 3SBKA 2P3UB 3SNBA 4TY6A 1SLXB 1TQ0B 3MH6A 5FXLA 1MKWH 4O97A 1GGDB 3M36A 1FAKH 4WY3A 3KNXA 3HK6B 2UWPA 2TIOA 1KXEA 1KXFA 2H6MA 1MH0A 1O2XA 1MAXA 1O3FA 3MH5A 2GT7A 3BEUA 4D7FA 1P12E 2DUCA 4MNXA 1EZUC 1ZMNA 1GGDC 1Y3YA 1FI8A 1UTKA 3RM2H 1GJCB 2A31A 2PV9B 3MU0A 1BITA 4B76A 1AN1E 1H8DH 4MNVA 1P9SA 3DFJA 3V0XA 3LONA 1UCYK 4NG9H 5DG6A 1YLCA 2ZKSA 2P94A 2B0FA 3TJUA 2QF3A 4K1SA 2G4UA 2O8LA 3ZZ8A 4UD9H 5DP8A 1WCZA 3SNEA 2AGEX 1C1UH 1W2KH 3BV9B 2AEIH 4TYDA 4FVDA 4B2CA 4LZ1H 1NFYA 4E7RG 2RG3A 1UVTH 3ENSB 1QB6A 4LXBH 5L2YH 2BDIA 3SZNA 1WUNH 5TCCA 4XBCA 2A1DB 1C4V2 1HAHH 1V2JT 3UUZA 2NU4E 1D3TB 1GBIA 1NS3A 3S9CA 3WY8A 1AUJA 3U69H 2BD3A 2ALPA 1E38B 2R3YA 1ARBA 1A5GH 2QXJA 2GTBA 2Q6DA 2GCHG 4XOJA 4NZLA 2BY9X 1A2CH 2J92A 5HYOA 1O3KA 1SOTA 2GGVB 2ZPQA 1BB0B 2XWBI 3UFAA 1C2EA 4OGXA 1OWHA 4B1TA 2P59A 3F9HA 2CF9H 1VITH 3T25A 2ZGHA 2VNTA 2ALVA 3DHKH 1C5TA 1KTTB 1QHRB 1S0QA 1TRYA 2HPPH 3LDXH 3LOXA 3PMAB 1IHTH 1O3IA 2WPHS 4U32A 1ZSJA 5FX5A 3QLPH 1B7XB 2BVRH 4YM9A 1GBMA 1GI2A 3KQDA 3HPTB 1SFIA 4Y0ZE 4JYVH 2EI7A 1O33A 1GWAA 4JCNA 2ZHDA 1ANCA 1SOZA 4H42U 3OY6U 2D26C 1DUEA 4NFEA 1BTZA 4GHTA 1O5EH 4I8JA 1GHBG 1KXCA 1EZSC 1TX7A 4UFGH 3ZVGA 1HAVA 1ZPZA 2H1UA 1NRPH 1EAWA 1QTFA 2PFEA 5EQRA 1MAYA 1CT2E 4J1YA 1NU7B 1SHHB 1SGFA 1TMUH 1IQNA 1TABE 1UTOA 3O8DA 1GHXH 3KQCA 3RXQA 1THPB 2GP9B 2OBQA 1C5OH 3MU1A 1P09A 4WF8A 1V2WT 1W14U 3MNBA 1BDAA 3BEIB 3DT0H 4JZIA 1GI1A 3ELAH 1MKXH 3OX7U 1TMTH 4KGAA 1ELTA 4A7IB 4TPIZ 1P57B 1DANH 1OPHB 4UDWH 3STIA 2TGDA 4DURA 1XKAC 3ZZ5A 5FPSA 1VCQA 1LVYA 1VR1H 1V2ST 5A8ZA 2VU8E 1TPOA 4BTIB 8LPRA 2A5KA 1VCWA 3PV4A 3RLYH 1O32A 3P8FA 1CT4E 2ZEBA 2BVXH 3SJ9A 5C5NA 1IQKA 1GMDF 1OWEA 2NU0E 1FMGA 4WJG2 1P0SH 3P70B 1W0YH 1V2QT 1GJ5H 3F1SB 1DVAH 1G36A 1NM6A 1GBLA 3UR6A 5L6NH 2F9VA 3SO3A 4X8SH 1JIMA 3F9GA 4XSKU 1YF4A 3RXTA 5J4QA 3BG4B 1IQGA 1EB1H 1OP0A 5IDKA 1OOKB 3SGQE 3NKKA 3T2NA 1YKTA 1O30A 1MMJN 2Z9IA 4WMEA 2W5EA 4OS4A 1XM1A 3KL6A 5DPAA 2VVVA 1YCPM 2BTCE 3BG4C 1W8BH 3UNSA 1O3GA 1EZQA 1AFQB 5EXNA 5JBAS 3E3TA 4UFFH 4CBOA 1G2MA 2FOFA 1P3CA 4IMQA 2SGEE 4A6LA 2V3HH 2Y81A 4FXGH 5BPEA 4YLQH 1UK4A 3A7YA 3P8OA 3TNSA 1C1NA 3A7WA 2P8OB 4YT7H 2ZO3H 3LJJA 1AFQC 1VITG 1Z1JA 3FP7E 1WQVH 5C1XA 5FAHA 3MWIU 1RXPA 1Q3XA 1AMHA 5CHAB 1AKSB 3S9BA 5F8ZA 3EAJA 3PLPA 2P8OC 3EA9A 1W11U 2FI3E 2BLVA 1G32B