1OPHB

Non-covalent complex between alpha-1-pi-pittsburgh and s195a trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDAGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-antitrypsin precursor
publication title Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ophB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ophB02
4NG9H 1HAPH 1H4WA 1RTFB 4OS7A 3AASA 1QQUA 1XVMA 2GMTC 5EXLA 5C20A 4A1VA 4R0IA 3TK9A 4ZHLU 2FS9A 1FY5A 2V3OH 4X6NA 4E7RG 1TMUH 4JZIA 1GDQA 1ANBA 1AIXH 3SBKA 2HLCA 1U6QA 1KLTA 2PTNA 3GISB 3RMNH 1Y3XA 3FZZA 2ZIQH 2OCVB 4HFPB 4MNVA 3BIVH 4X2VA 2OBOA 1RGQA 2G5NA 1C5VA 1FXYA 1HLTH 2OC7A 1K2I1 2BD8A 1GHBG 1O38A 4X2XA 1GBTA 2BY6X 4JK5A 4OGYA 1AB9C 1ZPCA 1UVOA 1EQ9A 1K21H 5DP9A 1TOCB 1BZXE 1QJ6B 1XXDA 7GCHF 2ZEBA 2F9BH 1FI8A 1Y3UA 2CHAB 4YOGA 1H8DH 2GDEH 2AFQB 3MWIU 3SNEA 2XWBI 2SGAA 1C5RA 4GCHG 1LHFH 1Y5UT 3S0NA 4IN1A 2VJ1A 2BVSH 1PPHE 1DUEA 4MQAA 3OSYA 4BAKB 4B71A 5IDKA 3MHWU 1UCYH 4X1QU 4BXWA 1KDQA 1O3NA 3UFAA 1O39A 3VEQB 2PFEA 5HXFA 5DKMA 4Q80A 5FPSA 1NU7B 1UTQA 2FYQA 4Y8YA 1BMMH 1GBCA 1LVMA 4ZKRU 1MCTA 4HI3A 2P93A 3KN2A 3UIRA 5DP3A 1O3OA 3UREA 1XX9A 2J9NA 4GVUA 1PPCE 4ISNA 2ZKSA 1MTVA 3F9FA 4UEHH 1ZJKA 3EDXB 1O2YA 1P01A 4FUEA 3D23A 4ZKNU 1ZSLA 2A4QA 5E2OA 2VH6A 4TPIZ 2J38A 1QGFA 5TCCA 2BDYA 4D7FA 1C1QA 3DD2H 3SORA 2ODPA 2A4RA 3V7TA 3LT3A 1S81A 1S83A 3A7TA 3SV6A 2GZ9A 3M35A 1QRWA 5F8XA 1C2JA 1MZAA 1UO6A 4D76A 1BUIA 1DITH 1ELTA 1BT7A 3ZVAA 2CV3A 3F6UH 1QBVH 2SGFE 1AKSB 3ZV9A 1AI8H 3QZRA 3RM0H 3FZDA 2GGVB 4FUHA 1BB0B 3TLOA 2J92A 2UWLA 3LH1A 2AGEX 3E0PB 4XOJA 5EOKA 1AGJA 1C5YB 2QF0A 1TBRH 3K6ZA 3RXEA 2VGCB 1T8MA 3GY8A 2WV4A 3M36A 1HXEH 4B2AA 1P2OA 2K1QA 4INHA 3KIDU 1GI4A 1IHSH 5A8ZA 3P8FA 2TIOA 4AX9H 1Q3XA 5H4IB 1VCPA 2RCEA 4H42U 3RXDA 1G3DA 2AMDA 2AYWA 4TY7A 2H9EH 1TMTH 1AWFH 3K2UA 1ZGVA 5GDSH 2G4TA 1TLDA 1WCZA 1QL8A 4FU7A 1TB6H 1F0SA 1HB0B 1AWHB 3RXGA 2C4FH 4K8YA 1SGEE 2VB0A 4A92A 3TGKE 4O3UA 4OS4A 2ZU1A 2F83A 1P06A 3D65E 1FY8E 2UWPA 4RN6A 2R2MB 1T4VH 1P2JA 3ZVCA 1BTXA 1C1UH 2J34A 1C5UA 1HV7A 5J4SA 1OWJA 1GBIA 4YLQH 1S0RA 2H9HA 3SV8A 2ZPRA 5C5NA 2O8TA 4IBLH 1L0ZA 3VFEA 3QWCH 1GBBA 1O5BB 1OPHB 1XUJA 1AFEH 1SOZA 5E2PA 4A1XA 1MU8B 5E0HA 2PWXA 1MAYA 1NROH 2FI4E 1BHXB 1O31A 2GZ8A 3RXTA 1THPB 1F0RA 1SL3A 1P05A 1V2PT 2BYAX 3SNDA 5AF9H 1BA8B 3BTDE 1GWAA 1DANH 2GT8A 1ZTJA 1FDPA 3ZZ5A 5EW1H 1TONA 1PPEE 2QYIA 1PPGE 2ZZUH 4KTCA 4AZ2B 1O2LA 2KAIA 3BG4B 2PKSB 4IGDA 4THNH 3ITIA 1FY4A 2XWAA 1Z8GA 1EAWA 1KLIH 1F0UA 1T8LA 5DJ7A 1OP8A 2OD3B 1O30A 1TNKA 3SI4H 3RXKA 3NUMA 4RSPA 1O2RA 3FANA 4M7GA 1BCUH 3M5OA 3SW2B 1C2KA 1P2KA 2OC0A 2ZGHA 4LZ1H 1IAUA 3SQEE 1O3GA 1P0SH 1SGYE 2ANWA 1VGCC 1ZLRA 3E16B 3LJJA 2SFAA 4NWLA 3B8JA 1GJ8B 1P3EA 2OLGA 2XC5A 3M7UA 3W94A 2QY0B 1NRSH 1V2LT 1DPOA 4NGAH 1LVOA 2Q6GA 4FUBA 3LJOA 4INLA 1TNIA 1G36A 5DP5A 3MU4A 1P09A 3P6ZB 3PWCA 5B6OA 4D9QA 1HYLA 4HZHA 3DFJA 3URDA 2O9QA 3RUOA 2A5AA 5F8TA 4ZKSU 1L1JA 2WYGA 4Z0KA 2W7UA 2C93B 1IQKA 1TX7A 3F9EA 3A7XA 1VCWA 5BRRE 1BTPA 4ZXXH 1KY9A 3K9XB 1ID5H 4XDEA 2W5EA 2W3IA 4FUGA 1C1NA 1E38B 2AMQA 1GMCF 4OS2A 1UHBA 1HAZB 1GBMA 2OINA 2OP9A 1P8VC 1H9HE 3H5CB 1O35A 2FZZA 4NCYA 4GSOA 1GBAA 2RG3A 1V2NT 3UQOA 2C3SA 2J95A 4ZHAA 1KTTB 2H5DA 4F4OC 3BTEE 1FPCH 5LPFA 1VITG 1AVWA 2BY9X 2VWNA 2YNAA 4K1SA 4ABEA 3SU3A 2R9PA 4Q7YA 1AFQC 1Z71A 2WPLS 4U32A 1SMFE 1ZTLA 5FAHA 1UK2A 3STIA 1GVKB 3FP6E 4OS6A 1BJUA 2C8YB 1SGNE 1HCGA 2FO9A 2BOHB 4Y7AA 3NCLA 1YLDA 1AN1E 1DICA 3GCOA 5A0AE 6ESTA 5JBAS 1KIGH 1C4V2 1QL9A 5G4BA 3RXFA 1GCTB 1GDUA 2B0FA 2XNIA 1Y59T 4ISOA 5JBBS 3RLYH 1LQDB 1K1PA 4I8KA 1GVLA 3SUGA 1M9UA 1A5HA 1T8NA 1NS3A 1MKWH 3EA7A 4RKOB 3S7KB 2F9NA 3UY9A 2F3CE 1EB1H 1MQ5A 1BRCE 2ALVA 4B76A 3LU9B 1FJSA 1T4UH 2VWOA 4I8HA 3RXOA 1HUTH 1S85A 1Z1IA 1WQSA 1UCYE 1WTHD 3GCHC 2GTBA 4DOQA 1F5KU 3IWMA 1GBEA 2XTTB 3QDZB 3ZZ9A 2VVCA 2GCTB 4UFEH 5HGGA 2QGRA 4X2WA 3RXPA 3VB6A 2G5VA 1AVXA 1MD7A 1O2ZA 3KQBA 3QGNB 1P2MA 1W0ZU 3BTHE 1HIAA 2J2UA 2Z3DA 1A3EH 3PTBA 1YKTA 3A7ZA 4Y8XA 1V2UT 2VIPA 3QN7A 1C4Y2 4FUJA 2VIWA 1DLEA 1N6XA 3GY6A 2ILNA 3PMJA 1YCPH 4DGJA 3RU4T 1ZHPA 5JPMH 3QK1A 3MO3A 1IQFA 3HPTB 3AVZA 4KELA 1WTGH 2JKHA 3OU0A 3A7VA 1ANDA 4SGBE 2EC9H 2ZTXA 2O8LA 3TITA 1JBUH 1TGCA 5L2YH 1O2HA 4NFEA 2IOTA 2XBWA 1FQ3A 1ZMLA 1C1TA 3EQ0H 1OXGA 8GCHF 5HM9A 5ESBA 1K1IA 1HAHH 2ZP0H 1EZXC 1W7GH 4GHQA 3TU7H 4H6TA 4Y8ZA 3PWBA 3KEEA 1QA7A 5A8XA 5JDUB 2FOFA 1C5WB 1AZZA 3ATMA 1P02A 2CXVA 3NZIA 5C67A 1GHAG 1UVUH 3PTNA 1CHOG 1LKAA 3HK3B 2J4IA 3SV7A 1WQVH 2CHAC 4YTAA 3RC6A 1DWCH 2RA3A 1BTUA 2ZCLP 1O32A 3T26A 3TIUA 1O2TA 1ZTKA 4GHTA 2VWLA 1LHCH 2SGPE 4Y79A 1ACBE 2ANYA 1GJ5H 1H8IH 1O5EH 3TH4H 5EW2H 1NTPA 2ZNKH 4X8VH 3ZZBA 3V13A 1SLXB 4BAQB 1V2JT 1W3CA 1HFDA 3ZVFA 1V2RT 3S9BA 4IS5A 1AFQB 1GHXH 1X7AC 3CS0A 4ZMAH 2BD3A 3EA8A 4LOYH 1DWDH 2CJIA 2ZO3H 2F9PA 1ESAA 4MNYA 4XSKU 3RM2H 3RXCA 1BMLA 3T27A 1C5NH 3BV9B 7ESTE 3ZZ6A 3MU1A 3Q3XA 3E0NB 5DPAA 4X1RU 1W8BH 3Q3KA 4WH6A 1J14A 1HJ8A 2ZGXH 1AO5A 4ABHA 5A0BA 2EA3A 4XBDA 3SN8A 2AH4X 2P95A 3SZNA 1PPZA 1BHXF 2VWMA 2R2WU 1PYTC 2PKAA 5BPEA 4AFZA 4Y10E 1QJ7B 1S6HA 1FONA 3SNCA 1MBQA 4YESB 1Z1JA 6CHAB 1CT2E 1O3JA 3SU5A 3LGWA 1K28D 3HGPA 1DVAH 2A7HA 1FY1A 4XFQA 3T29A 2PUQH 5HM2A 1GMDF 3O8BA 2XC4A 1QB9A 1XUHA 1ELEE 3QTVH 1O2OA 3BTME 2VH0A 1LQEA 1OSSA 3OTJE 1GHZA 4Y0YE 4FUIA 5IYTA 2H2ZA 4BANB 5DG6A 5JB8S 3T25A 2VGCC 2WPJS 1IQIA 3M61U 2Z3EA 1OWEA 2GV7A 2FOBA 2GCHG 5C1YA 2A4GA 1XKAC 2AS9A 3MYWA 2RA0A 3U98H 1JIRA 1RRKA 1Y3WA 1LTOA 1HAIH 5ABWA 2B9LA 2W26A 1TNGA 1BOQA 2YOLA 1CT0E 2C8ZB 1HAVA 2QXGA 3U9AH 1MKXK 4ABJA 1HJAB 4B2CA 4DT7B 3FP7E 1SHHB 3MOCA 1YBWA 3SJKA 1A1RA 3PM3A 2Z9IA 1MAXA 2NU4E 3ZZDA 2SNWA 4H4FA 2A31A 2OC8A 4X6OA 2QN5T 1BTYA 1AUJA 2Y5GA 3GCTG 4MNWA 3ZV8A 1ZPBA 2WPKS 5DO4H 1QB6A 4OGXA 4LZ4B 1DDJA 4CH8B 5EU8A 2BMGB 1ESBA 5CHAB 2EI7A 4UDWH 3RXBA 4UD9H 1EUFA 1NRRH 4X6PA 1A5IA 4I31A 3KCGH 1MTNB 1S84A 1LO6A 2LPRA 2GT7A 1GDNA 2ZQ1A 4U30A 1JXPA 1FN8A 4YLUA 1D3QB 1K1MA 1NY22 8LPRA 4K2YA 1SSXA 3VGCB 5ETXA 3GDUA 3UUZA 3JZ2B 1SLVB 1L1NA 3P8NA 3BG8A 4MPVA 1C5SA 1BQYA 1MMJN 4ABIA 3AAUA 4Y0ZE 1C5LH 3SNBA 3UR9A 2XYAA 1DT2A 5A8YA 1W12U 4CR5A 5A0CA 4TWWA 2NU2E 1UTJA 2GVFA 2ZTYA 3W95A 1UJ1A 1C5TA 3TNTA 2B8OH 1BRBE 1GL0E 3IG6B 2FODA 1CHGA 1SGQE 3R0FA 3CP7A 4LK4A 1O2GH 2OXSA 2D26C 3IITA 2Q6FA 4FUDA 1T8OA 3BG4C 4AFSA 2CF8H 2PKSC 4BNRA 1GMHG 2VNTA 1A5GH 3VB4A 1QRZA 3M3TA 2VIVA 1FMGA 1NU9A 1CO7E 1BRUP 3MFJA 2F9UA 4U01A 5DP6A 5AVDA 5DK1A 5DP8A 5EXMA 1SC8U 1EPTB 1H9IE 5FX6A 4XBBA 2FP7B 4K5ZA 4FU8A 3RXVA 5L2ZH 1V2MT 1GJ9B 1KXFA 1AVGH 3TK5A 1YPJH 1FPHH 3BF6H 6GCHF 4WH8A 2H9TH 1LKBA 2Y80A 3O8CA 5LH8A 2XXLA 4ZH8A 2ZDNA 1VR1H 3ATKA 3ZVGA 2Z9KA 3TH2H 1C2FA 3BTFE 1O2IA 2BD7A 1J9CH 4FUCA 5C1XA 2ZDKA 3PLPA 4MNXA 2QC2A 3KGPA 1PPFE 1IQMA 1EX3A 1ELFA 3SU0A 1S6FA 1HRTH 4IMQA 1YF4A 1BMAA 1ZZZA 1LHDH 4ZXYH 3T28A 1GG6B 3TPIZ 4CBOA 1AE5A 3GDSA 2ZA5A 2QXJA 1HXFH 2WV5A 2BD4A 4CRDA 3ZYDA 1HJ9A 4A6LA 1P57B 2FX4A 1A7SA 1O2VA 1HGTH 2WYJA 3MU0A 2ZU4A 1NPMA 4WMFA 1KLJH 3Q3YA 1GBDA 1GJDB 1WSSH 2P3FH 2WPMS 3MU5A 2ZCKP 3GY4A 1O5DH 3RP2A 1O3LA 1YPGH 4Z6AH 1D4PB 1ABJH 1QNJA 1C2GA 2ANMH 1S0QA 2Y6TA 3RXAA 4FUFA 1W10U 3T5FH 3E8LA 3OYPA 7LPRA 2AGIX 1TPSA 3STJA 4KTUA 5A2MH 3U1JB 4A7IB 4R8TB 3LC3A 2BX3A 2BHGA 2Z7FE 1FUJA 1XM1A 1PQ8A 4GUXA 1JWTA 3VB3A 2V35A 2HNTF 3EGKH 3GOVB 3PV4A 4DG4A 2G8TA 1NFWA 1ZR0A 1DXPA 1GCTC 1GL1A 2FOEA 4TY6A 1V2KT 1SGCA 2FOAA 4X8SH 3DFLA 1DY8A 2R3UA 1TGNA 1WBGB 5CE1A 3TH3H 2ANKH 1J16A 1UCYK 2HWLB 1TQ7B 1O2JA 3LC5A 1GJ7B 1FNIA 1NT1A 2ZHEH 5LGOA 2ZDLA 2BDCA 1QY6A 3M5MA 2NU0E 5E0GA 1OKXA 2BDIA 1ETSH 2BDBA 2GCTC 1NZQH 4YO9A 2G55A 4BXSA 4B74A 2A45B 1EATA 1OWHA 4AGJA 2V3HH 3MH4A 2A7JA 3P8OA 5T6GA 1W0YH 4WXIA 1BIOA 2ZU5A 2PUXB 4ABFA 4DCDA 1BRAA 2Z9LA 7GCHG 2ESTE 1AUTC 3A84A 1QA0A 1TYNA 2ZC9H 2M5TA 4X1PU 3CS7A 1GI3A 1XXFA 3BEIB 4WXVA 4XBCA 1G3EA 1KXDA 8KME2 1DM4B 3A7YA 2VU8E 4Q7XA 1TABE 2FPZA 1YPEH 1TFXA 1TRYA 1SQAA 1MTSA 2Y7XA 1Y3YA 1Q2WA 3ZZ3A 2C8WB 3SJOA 2FX6A 1DS2E 2PSYA 3GY7A 1HBTH 2ZU2A 1D3PB 3ZVEA 4LXBH 1ETRH 3SU6A 4B2BA 2FOHA 3KQDA 5GCHF 1RS0A 1LDTT 1OS8A 4AB8A 1TIOA 3B9FH 1K1JA 1ZSKA 2GKVE 3C1KA 3RXQA 5T3HA 1XKBC 2G4UA 2QCYA 1GBKA 1S82A 1C1VH 1J8AA 4WWYA 1CA0C 2VVUA 2FIRH 1YC0A 2PR3A 2ZGJA 2A2QH 4BTUB 3MNCA 4H6SB 4X1NU 1EP5A 1GHVH 2ZFSA 4JK6A 1O3EA 3TGJE 1ZMNA 1WU1A 2HNTC 4AGKA 1T32A 4K8BA 3TVJB 1WV7H 1FN6A 3M5LA 2A5KA 1TRNA 3PO1C 1RTKA 2XBYA 3P8GA 4MTBA 3HK6B 2ZHWH 5EQSA 1F5LA 3EA9A 3UR6A 1O3CA 1V2QT 1C5MD 1SOTA 4UFDH 3SJ8A 1Z6JH 4BTTB 3FP8E 4BAHB 3A80A 3MH6A 2ASUB 4Y11E 2BQ6B 1GHYH 3BEUA 2FESH 4J2YB 1T7CA 1O2PA 1IQJA 4MVNA 2STAE 2A5IA 1ZGIA 1W13U 1DXWA 1QQ4A 4CREA 3D49H 2VINA 1P2IA 5C2ZA 1O36A 3SUFA 4FXGH 3M3SA 2NU1E 3M7QA 1BJVA 1ESTA 3B23B 1TOMH 3O8RA 2P59A 1Z6EA 1TPAE 1Y5AT 4BAOB 4NFFA 2SGQE 1Z8IB 4X6MA 3RMOH 2GZ7A 1F2SE 2BX4A 3RXRA 1F92A 2C8XB 4TWYA 1AKSA 1SGIB 1HAYB 4DURA 1SHYA 3LONA 3RXLA 3GYLB 1OWIA 4B73A 2AERH 2R0KA 4BOHA 1P2NA 3E6PH 6CHAC 4SGAE 4ABDA 2IPHA 3RDZA 1SQTA 2FOCA 1SI5H 3MH5A 1GBHA 4Y71A 3U8RH 1MZDA 1N8OB 1BBRH 3A82A 1TA2A 3RMMH 1C1MA 1GHBF 1QHRB 4TPYA 3BTGE 5AFYH 1AD8H 3MI4A 1LPGB 2OQ5A 1TPOA 1G30B 2ALPA 4CHAB 1KDQB 1C9TA 1O3PB 2TGPZ 1C2DA 1A3BH 5DP4A 3ZVDA 1GBLA 1GJBB 2FI5E 3RU4E 3SV2H 4CRCA 3H7OA 1UTPA 4ABAA 3F9GA 4GCHF 4JZ1A 2QXHA 3NK8A 4IN2A 1HJAC 3A88A 1SVPA 2R0LA 2TGTA 5T6FA 3A85A 1XMNB 2D1JA 4KTSA 1YCPM 1B0EA 3U1IB 3RU4D 1FIWA 1YGCH 3QUMP 1DX5M 1O5CB 1NFYA 3GICB 3N7OA 1HNEE 1BDAA 3FFGA 3PMAB 1LHEH 4MPUA 4ISIH 4DVAU 2LNCA 2YNBA 1DOJA 2BM2A 4JCNA 4WMEA 1IOEA 4AYYB 2FLBH 1Y5BT 2FI3E 1KTSB 1YPLH 3OY6U 4CH2B 4MDSA 4AG1A 4YOJA 1NFUA 5CHAC 1CA0B 3TGIE 1OWDA 1EJNA 1ZSJA 9LPRA 2TGDA 3LDXH 1G37A 1QJ1B 3BTTE 3QX5H 2BY7X 2QA9E 4I7YH 5J4QA 1WAYB 2Z9GA 2EI8A 2PGQB 1MTNC 3SJ9A 1NFXA 2BVXH 2P16A 1EB2A 3PO1B 1V6DA 1NRPH 1OX1A 2FTMA 1C1WH 2GD4B 4WMDA 4VGCB 2Y5HA 3VGCC 4D8NA 1GGDB 3BEFB 3O8DA 1EASA 1TPPA 1IQEA 1W14U 2WUBA 2BOKA 4DJZB 3MO9A 1C2IA 4NA8A 4O3TA 3E91A 2A4OA 4NWKA 3T62A 4KKDA 9ESTA 1HAGE 3U8OH 1F7ZA 2FYRA 1MD8A 4IC5A 3ZZAA 4B75A 1EOLA 1B5GH 4NIVA 1AQ7A 3LOXA 1P2QA 4I8GA 2J94A 4GLYA 5DGJA 5I25A 1GJ6A 1TNJA 2B5TB 1SB1H 2Y5FA 2ZGBH 1A4WH 1ZRKA 1C2MA 1ETTH 2GV6A 4D9RA 2BDGA 5FXLA 1TX6A 5GCHG 3F9HA 1MTWA 4ZKOU 1C5ZB 2C90B 2SNVA 4BTIB 1TE0A 2JH6D 3RXSA 2BLOA 1GMCG 1RJXB 5HMAA 1EPTC 3MMGA 3UNSA 4K1TA 4NA7A 1P11E 4NIYA 3M5NA 1O37A 1TBQH 3ATLA 3KQCA 3Q00A 1V2TT 3D62A 1UTOA 3SUDA 5L30H 3NKKA 4WVPE 2BQ7B 2VIQA 1D9IA 3NXPA 3V12A 4KGAA 1EKBB 3NWUA 2I6SA 1L4ZA 5FPYA 4OS1A 3SHAH 3RXIA 3ENSB 3PLBA 3K65B 2PW8H 1Y3VA 4AFQA 2BDHA 4J1YA 1DWBH 2ZFPH 3SHCH 1K1OA 4UFGH 1A61H 1FV9A 4WY3A 1ELVA 3RLWH 1RXPA 2ZI2H 2ZCHP 5LPEA 1Z8RA 1T31A 2O8UA 1GG6C 1D3DB 1D6RA 1YCPK 2FS8A 4ZHMU 1PYTD 2BY5X 3UWJH 2NU3E 2Y7ZA 4NZQA 3F68H 4DW2U 2A7CA 3LH3A 2ODQA 2OQUA 4I32A 3TJVA 2V6NA 3FVFB 3RXJA 1GI9B 3MU8A 1O2QA 1UVPA 2KAIB 3G01A 3KQEA 5FX5A 2Q6DA 4OS5A 2VIOA 1C2LA 1F0TA 1CGHA 2Y82A 5E8EH 5FPTA 2HOBA 3MTYA 4DIIH 1ELGA 4CRBA 2ZECA 4QT8C 4X1SU 1K1NA 3MNSA 1SQOA 1WYKA 1KXCA 2H6MA 1QL7A 1O2MA 1SR5C 2ZPSA 4NSVA 1TBZH 2R3YA 2V0BA 3P92A 1AMHA 1NESE 1W11U 2P8OB 3LPRA 2PV9B 1P12E 4JYVH 3E1XB 1VJAU 3I29A 1OWKA 3L33A 3RC5A 3SV9A 1ZMJA 2ZDAH 2OC1A 2NWNA 1MH0A 3SNAA 2CGAA 3MNXA 4I8LA 1C5XB 1UK4A 5EPNA 3SU4A 4X2YA 2ULLA 3GYMA 1OYQA 2HRVA 3E90B 1E37B 3MH7A 4X8TH 2PLXA 2B7DH 3ESTA 3JZ1B 3ATWA 4O9VA 3BTQE 1GI6A 2TRMA 4AG2A 1UHBB 3VXFH 1WUNH 3UOUA 3KF2A 1DSTA 1OOKB 1YPHC 1DE7H 1UVSH 8GCHG 2UUJB 3M3VA 1C5PA 3SU2A 4AOQA 1ZRBA 4E05H 3A8AA 2F9VA 4B1TA 2EI6A 1TNHA 1UTLM 3SGQE 1ELCA 1TGSZ 1GPZA 2BZAA 1FIZA 1GBFA 1SFIA 1N6YA 1XUGA 1QB1A 2A1DB 2ZDVH 4X0WU 1BTZA 1H9LB 1TNLA 1QRXA 5GIBA 2Q1JA 2F9OA 1CGJE 2G81E 3QTOH 2XBXA 1BTHH 3OX7U 5E0JA 1O3HA 1A46H 5C3NA 1GI7B 3LGYA 2BDAA 1C4U2 2JETB 5TJXA 1EJAA 1YPHE 1NO9H 1GI0A 1NRQH 2ZWLH 1QFKH 3QO6A 3ODDA 1DSUA 3RC4A 1ZOMA 1C1OA 1CBWB 3E3TA 5C1UA 1QBNA 3ELAH 1E35B 1VITF 4HTCH 1V2OT 2XW9A 5GPIB 1L2EA 1O0DH 4AN7A 1SGFG 1EZUC 3U8TH 4U2WA 2BD2A 2Y81A 1CU1A 3DHKH 1QIXB 1P9SA 2WPIS 5JBTA 4I33A 1ABIH 3VXEH 1EJMA 4ABGA 3DT0H 1BBRE 4TYDA 5EGMA 2W7SA 3RXMA 3KNXA 1BMNH 1H1BA 3HKIB 2BXTH 4YOIA 4JMYA 2BZ6H 1CA8B 1K1LA 4AB9A 1RTLA 1C5OH 1IHTH 2O8MA 4I8JA 2ZFRH 2ZQ2A 1G32B 1S5SA 4FVBA 2ZPQA 4AYVB 1L4DA 5FCRA 2XRCA 2PGBB 1FLEE 1JMOH 3LGUA 4INKA 4MG3A 1MTUA 3V0XA 1GJAB 3GCNA 3LGIA 1P9UA 2GMTB 1JOUB 4NA9H 1HIAB 3BIUH 1QCPA 2A0QB 5ESTE 3TJUA 1EAXA 1K22H 1XVOA 4JZFH 2Z9JA 5AHGH 2BD5A 4FVDA 3L3TA 5F03A 1GMDG 2THFB 3MNBA 1LPZB 2QV1A 4UONA 1DUAA 1G9IE 3ZZ4A 1P04A 1P3CA 3EYDA 3SOSA 1ARBA 1QBOA 2XCNA 7KMEH 1AB9B 3LIWA 2IN2A 2P3TB 1IQGA 3T2NA 1TGBA 4MPWA 3I77A 2BD9A 3L6PA 1XUKA 4DY7B 3QZQA 2QAAA 2P3UB 2ZG0H 3M7TA 2UUYA 3CENA 1AZ8A 3UNQA 1W2KH 3PMHB 2HVXA 3TNSA 1KSNA 1SFQB 1V2VT 3TJNA 2H5CA 1O2UA 3BTWE 1O2SA 1O3KA 2BY8X 2BLWA 2TGAA 1O2WA 4ZROA 2AEIH 3PLKA 1UTMA 5EPYA 2XBVA 3BTKE 1N8OC 1G3CA 1GJ4H 1PJPA 2OTVA 1PFXC 4ISLA 5K0HA 2AIQA 1J15A 1IQLA 5A09A 5F6MA 2ZFTA 1GHAF 2FOGA 4CHAC 1NN6A 3LGVA 1CHOF 2XCFA 1LHGH 1PPBH 1F5RA 1KXAA 1ZJDA 4JYUH 2QF3A 3SUEA 2BQWB 3GY5A 3GY3A 2ZHDA 3PROA 2GX4A 4K1EA 3RXHA 3HGNA 5I46H 2G00A 1FAXA 3Q77A 1SLUB 4MLFB 5GXPA 1GVZA 2QIQA 2FEQH 3WY8A 1THSH 2FMJA 1A0HB 1D6WA 4UE7H 1TRMA 3FAOA 3ZYEA 1ZYOA 3Q76A 2OBQA 3NPSA 1Y8TA 1UMAH 1YPMH 4CRAA 3VB7A 1CQQA 5AFZH 1PQ7A 5JYIA 1GI1A 2EEKA 2W3KA 2BTCE 4E7NA 1K9OE 1OP0A 1OYTH 1DLKB 1Z7KA 1AY6H 2ZFQH 1HPGA 3VPKA 1SPJA 3AW0A 2PKAB 1CGIE 1V2WT 2D2DA 3I78A 1IQHA 4O03A 1UK3A 1UTNA 1ELAA 1ZHMA 1TMBH 2ZFFH 4CRGA 1C2HA 3ATIA 2A2XH 1Z8JB 4IMZA 1EZQA 1ORFA 2UUFB 1WOFA 2IJOB 1SGRE 4WF8A 2SGDE 1B7XB 2ZF0H 1CSOE 4PROA 4YT7H 4VGCC 1GGDC 5EQQA 1FY3A 1O3AA 2DE9A 4E06H 2CN0H 2GDDA 3A89A 2ZGCA 1MQ6A 1G2LA 2A32A 3SJIA 2STBE 4A5TS 3ZZCA 6GCHG 1LVBA 3V3MA 1JRTA 1C1RA 2ZHFH 1N1LA 1ZPZA 1MU6B 1HDTH 3S69A 1YPKH 6LPRA 1DY9A 2HNTE 1O2KA 1SLWB 1GCDA 5CMXH 1HAVB 3ZVBA 4ISHH 1EPTA 4NIWA 3F1SB 3P95A 3UTUH 3DA9B 3S9AA 3KHVA 4HGCA 1KYNA 4NZLA 3EE0B 2BB4A 3MO6A 3QGJA 2GP9B 3P70B 2JH0D 2GCHF 1D3TB 2FM2A 4Y7BA 3PMBB 1PQ5A 2JH5D 1LVYA 5FHTA 3S7HB 2BLVA 3SGBE 2WINI 1RIWC 5LPRA 3RMLH 4CRFA 1CT4E 2VIDA 1RFNA 4K69A 5L6NH 5DP7A 4UFFH 3KL6A 3SU1A 1EOJA 2WUCA 4ASHA 3A81A 1HAOH 1DFPA 1E36B 3PYHA 2CMYA 1GHWH 3DUXH 4YM9A 2TBSA 1O34A 1VZQH 2FWWA 3A8CA 4GPGA 4CR9A 2PHBA 3GCTF 1P03A 1HAXB 4ABBA 3UOPA 4ZUHA 3BN9A 1C1PA 1O33A 2BXUH 4RKJB 3UQVA 1TALA 1C5QA 4IW4E 2ODYB 1XUFA 4ESTE 4IC6A 1KXBA 2DUCA 1O3MA 1YLCA 5FBEA 1O2NA 3ODFA 4WJG2 1SG8B 1O5AB 1TGTA 3PB1E 5C5OA 1TQ0B 3A87A 3U69H 5T6DA 2P94A 2VVVA 4K60A 2TPIZ 1W7XH 1QR3E 4F49A 1SGFA 1G3BA 1C2EA 2CF9H 1SGDE 4X8UH 1UVTH 1SGPE 3URCA 1BITA 1P10A 2FLRH 2ZHQH 1PQAA 1UTKA 1MKXH 1VGCB 1O3BA 4AORA 1EP6A 2BVRH 3A86A 2O8WA 5JBCS 1LCYA 1J17T 1NM6A 4YZUA 3GY2A 2HALA 4AFUA 1YM0A 3M37A 1QURH 5EG4A 1GI2A 1SGTA 3SO3A 2RDLA 1L1GA 4CBNA 2FXRA 1GMHF 2G51A 1MUEB 1YP9A 1GI5A 1SBWA 3ZZ7A 2P8OC 4Q7ZA 2Z94A 3VB5A 1C9PA 1ZHRA 3H7TA 1ANCA 2DE8A 4JZEH 4YT6H 3K6YA 2G52A 1B0FA 5GJ4B 1FZZA 2F91A 3SI3H 2FDAA 3A8DA 3UWIA 4A1TA 2HPPH 1JRSA 3P17H 1A0LA 4K3JA 2Z3CA 1ELDE 1O3DA 1GI8B 2UWOA 5FCKA 2QXIA 4GAWA 4Q2KA 1YYY1 1NRNH 1DWEH 3AW1A 1E34B 2UUKB 2ZU3A 5F8ZA 3LKWA 1TA6A 1MBMA 3HATH 1CVWH 3UPEA 1OP2A 1ANEA 1GBJA 1NC6A 1JIMA 5FBIA 2OUAA 3GDVA 2ZTZA 1MCVA 4O97A 2AIPA 2HPQH 3RXUA 1V3XA 1VJ9U 1IQNA 3S9CA 3A8BA 1O5FH 1QTFA 3SQHE 1CE5A 5TCAA 3UNRA 1AE8H 1EAUA 2AGGX 1THRH 4ZAEA 4JZDH 4DIHH 4FU9A 1G2MA 1TAWA 5EQRA 4NIXA 3QLPH 1FAKH 1RIWB 2XC0A 4MPXA 3AAVA 1VITH 1MKWK 2JETC 1TX8A 3LGTA 4JYTA 5K7RA 1O5GH 4Y76A 2ZDMA 1EAIA 1ELBA 5GWZA 4KP0A 5EXNA 1C1SA 1A2CH 1O3IA 1CBWC 1EZSC 4D7GA 3TK6A 1AU8A 2SGEE 2WPHS 8ESTE 1AHTH 4NSYA 4BAMB 1BTWA 3R3GB 1VCQA 3EAJA 4Y6DA 2HGTH 1V2ST 1BBRK 1KXEA 1TWXB 3A7WA 3GCHB 2H1UA 5SGAE 4XE4A 3ZZ8A 1O2XA 2FOMB 1Q31A 5EODA 3HKJB 3SGAE 1EXFA 2FTLE 2Z6BD 1ARCA 3BSQA 2BLQA 5JB9S 1GJCB 1LMWB 3C27B 1A0JA 2PSXA 1O3FA 3A83A 5PTPA 1E0FD 2AMPA 1RD3B 3TJOA 2I6QA 1INCA 5HYOA 1XUIA 3OY5U 2D8WA 2PTCE 1LPKB
chains in the Genus database with same CATH superfamily
4NG9H 1HAPH 1H4WA 1RTFB 4OS7A 3AASA 1QQUA 1XVMA 2GMTC 5EXLA 5C20A 4A1VA 4R0IA 3TK9A 4ZHLU 2FS9A 1FY5A 2V3OH 4X6NA 4E7RG 1TMUH 4JZIA 1GDQA 1ANBA 1AIXH 3SBKA 2HLCA 2IPQX 1U6QA 1KLTA 2PTNA 3GISB 3RMNH 1Y3XA 3FZZA 2ZIQH 2OCVB 4HFPB 2CK3D 4MNVA 3BIVH 4X2VA 2OBOA 1RGQA 2G5NA 1C5VA 1FXYA 1HLTH 2OC7A 1K2I1 2BD8A 1GHBG 1O38A 4X2XA 3KYFA 1GBTA 2BY6X 4JK5A 4OGYA 1AB9C 1ZPCA 1UVOA 1EQ9A 1K21H 5DP9A 1TOCB 1BZXE 1QJ6B 1XXDA 7GCHF 2ZEBA 2EQNA 2F9BH 1FI8A 1Y3UA 2CHAB 4YOGA 4F48B 1H8DH 2GDEH 2AFQB 3MWIU 3SNEA 2XWBI 2SGAA 1C5RA 4GCHG 1COWD 1WXRA 1LHFH 1Y5UT 5C0UA 3S0NA 4IN1A 2VJ1A 2BVSH 1PPHE 1DUEA 4MQAA 3OSYA 4BAKB 4B71A 5IDKA 3MHWU 1UCYH 4X1QU 4BXWA 1KDQA 1O3NA 3UFAA 1O39A 3VEQB 2PFEA 5HXFA 5DKMA 4Q80A 5FPSA 1NU7B 1UTQA 1VKYA 2FYQA 4Y8YA 1BMMH 1GBCA 1LVMA 4ZKRU 2KZ4A 1MCTA 4HI3A 2P93A 3KN2A 3UIRA 5DP3A 1O3OA 3UREA 1XX9A 2J9NA 4GVUA 1PPCE 4ISNA 2ZKSA 1MTVA 3F9FA 4UEHH 1ZJKA 3EDXB 1O2YA 1P01A 4FUEA 3D23A 4ZKNU 1ZSLA 2A4QA 5E2OA 2VH6A 4TPIZ 2J38A 1QGFA 5TCCA 2BDYA 4D7FA 1C1QA 3DD2H 3SORA 2ODPA 2A4RA 3V7TA 3LT3A 1S81A 1S83A 3A7TA 3SV6A 2GZ9A 3M35A 3VG8A 1QRWA 4P00A 5F8XA 1C2JA 1MZAA 1UO6A 4D76A 1BUIA 1DITH 1ELTA 1BT7A 3ZVAA 2CV3A 3F6UH 1QBVH 2SGFE 1AKSB 3ZV9A 1AI8H 3QZRA 3RM0H 3FZDA 2GGVB 4FUHA 1BB0B 3TLOA 3WW7A 2J92A 2UWLA 3LH1A 2AGEX 3E0PB 4XOJA 5EOKA 1AGJA 1C5YB 2QF0A 1TBRH 3K6ZA 3RXEA 2VGCB 1T8MA 3GY8A 2WV4A 3M36A 1HXEH 4B2AA 1P2OA 2K1QA 4INHA 3KIDU 1GI4A 1IHSH 5A8ZA 3P8FA 2TIOA 4AX9H 3OAAD 1Q3XA 5H4IB 1VCPA 2RCEA 4H42U 3F3BA 3RXDA 1G3DA 2AMDA 2AYWA 4TY7A 2H9EH 1TMTH 2AHME 1AWFH 3K2UA 1ZGVA 5GDSH 2G4TA 1TLDA 1WCZA 1QL8A 4FU7A 1TB6H 1F0SA 1HB0B 4ACBA 1AWHB 3RXGA 2C4FH 4K8YA 1SGEE 2VB0A 4A92A 3TGKE 4O3UA 4OS4A 5GNDA 2ZU1A 2F83A 4YXWD 1P06A 3D65E 1FY8E 2UWPA 4RN6A 2R2MB 1T4VH 1P2JA 3ZVCA 1BTXA 1C1UH 2J34A 1C5UA 1HV7A 5J4SA 1OWJA 1GBIA 4YLQH 1S0RA 2H9HA 3SV8A 2ZPRA 5C5NA 2O8TA 4IBLH 1L0ZA 3VFEA 3QWCH 1GBBA 1O5BB 1OPHB 1XUJA 1AFEH 1SOZA 5E2PA 4A1XA 3F0PA 1MU8B 5E0HA 2PWXA 1MAYA 1NROH 2FI4E 1BHXB 1O31A 2GZ8A 3RXTA 1THPB 1F0RA 1SL3A 1P05A 1V2PT 2BYAX 3SNDA 5AF9H 3PV5A 1BA8B 3BTDE 1GWAA 1DANH 2GT8A 1ZTJA 1FDPA 3ZZ5A 5EW1H 5HKKD 1TONA 1PPEE 2QYIA 1PPGE 2ZZUH 4KTCA 4AZ2B 1O2LA 2KAIA 3BG4B 2PKSB 4IGDA 4THNH 1EFRD 3ITIA 1FY4A 2XWAA 1Z8GA 1OHHD 3F2GA 1EAWA 1KLIH 1F0UA 1QZ8A 1T8LA 5DJ7A 1OP8A 2OD3B 1O30A 1TNKA 3SI4H 3RXKA 2YMSC 3NUMA 4RSPA 1O2RA 3FANA 4M7GA 1BCUH 3M5OA 3SW2B 1C2KA 1P2KA 2OC0A 2ZGHA 1E1QD 1IAUA 3SQEE 4LZ1H 1O3GA 1P0SH 2QE7D 1SGYE 2ANWA 1VGCC 1ZLRA 3E16B 3LJJA 2SFAA 4NWLA 3B8JA 1GJ8B 1P3EA 2OLGA 2XC5A 3M7UA 3W94A 1KMHB 2QY0B 1NRSH 1V2LT 1DPOA 4NGAH 1LVOA 2Q6GA 4FUBA 3LJOA 4INLA 1TNIA 1G36A 5DP5A 3MU4A 1P09A 3P6ZB 3PWCA 5B6OA 4D9QA 1HYLA 4HZHA 3DFJA 3URDA 2O9QA 3RUOA 2A5AA 5F8TA 4ZKSU 1L1JA 2WYGA 4Z0KA 2W7UA 2C93B 5FL7D 1IQKA 1TX7A 3F9EA 3A7XA 1VCWA 5BRRE 1BTPA 4ZXXH 1KY9A 3K9XB 1ID5H 4XDEA 2W5EA 2W3IA 4FUGA 1C1NA 1E38B 2AMQA 1GMCF 4OS2A 1UHBA 1HAZB 1GBMA 2OINA 3DSGA 2OP9A 1P8VC 1H9HE 3H5CB 1O35A 2FZZA 4NCYA 4GSOA 1GBAA 2RG3A 1V2NT 3UQOA 2C3SA 2J95A 4ZHAA 1KTTB 2H5DA 4F4OC 3BTEE 1FPCH 5LPFA 4B6EA 1VITG 1AVWA 2BY9X 2VWNA 2YNAA 4K1SA 4ABEA 3SU3A 2R9PA 2HLDD 4Q7YA 1AFQC 1Z71A 2WPLS 4U32A 1SMFE 1ZTLA 5FAHA 3GS9A 1UK2A 3STIA 1GVKB 3FP6E 4OS6A 1BJUA 2C8YB 1SGNE 1HCGA 2FO9A 2BOHB 4Y7AA 3NCLA 1YLDA 1AN1E 1DICA 3GCOA 5A0AE 6ESTA 5JBAS 1KIGH 1C4V2 1QL9A 5G4BA 3RXFA 1GCTB 1GDUA 2B0FA 2XNIA 1Y59T 4ISOA 5JBBS 3RLYH 1LQDB 1K1PA 4ACAA 4I8KA 1GVLA 3SUGA 1M9UA 1A5HA 1T8NA 1NS3A 1MKWH 3EA7A 4RKOB 3S7KB 2F9NA 3UY9A 2F3CE 1EB1H 1MQ5A 1BRCE 2ALVA 4B76A 3LU9B 1FJSA 1T4UH 2VWOA 4I8HA 3RXOA 1HUTH 1S85A 1Z1IA 5B6LA 1WQSA 1UCYE 1WTHD 3GCHC 2GTBA 4DOQA 1F5KU 3IWMA 1GBEA 2XTTB 3QDZB 3ZZ9A 2VVCA 2GCTB 4UFEH 5HGGA 1H8HD 2QGRA 4X2WA 3RXPA 3VB6A 2G5VA 5DN6D 1AVXA 1MD7A 1O2ZA 5EJ1A 3N7DA 2F4LA 3KQBA 3QGNB 1P2MA 1W0ZU 3BTHE 1HIAA 2J2UA 2Z3DA 1A3EH 3PTBA 1YKTA 3A7ZA 4Y8XA 1V2UT 2VIPA 3QN7A 1C4Y2 4FUJA 2VIWA 1DLEA 1N6XA 3GY6A 2ILNA 3PMJA 2PP6A 1YCPH 4DGJA 3RU4T 1ZHPA 5JPMH 3QK1A 3MO3A 1IQFA 3HPTB 3AVZA 2V3MA 4KELA 1WTGH 2JKHA 3OU0A 3A7VA 1ANDA 4SGBE 2EC9H 2ZTXA 2O8LA 3TITA 1JBUH 1TGCA 5L2YH 1O2HA 4NFEA 2IOTA 2XBWA 1FQ3A 1ZMLA 1C1TA 3EQ0H 1OXGA 8GCHF 5HM9A 5ESBA 1K1IA 1HAHH 2ZP0H 1EZXC 1W7GH 4GHQA 2J98B 3TU7H 4H6TA 4Y8ZA 3WWBA 3PWBA 3KEEA 1QA7A 5A8XA 5JDUB 2FOFA 1C5WB 2KCYA 1AZZA 3ATMA 1P02A 2CXVA 3NZIA 5C67A 1GHAG 1UVUH 3PTNA 1CHOG 1LKAA 3HK3B 2J4IA 3SV7A 1WQVH 2CHAC 4YTAA 3RC6A 1DWCH 3W1EA 2RA3A 1BTUA 2ZCLP 1O32A 3T26A 3TIUA 5C0TA 1O2TA 1ZTKA 1MABB 4GHTA 2VWLA 1LHCH 2SGPE 4Y79A 5HIZA 1ACBE 2ANYA 1GJ5H 1H8IH 1O5EH 3TH4H 5KECA 5EW2H 1NTPA 2ZNKH 4X8VH 3ZZBA 3V13A 1SLXB 4BAQB 1V2JT 1W3CA 1HFDA 3ZVFA 1V2RT 3S9BA 4IS5A 1AFQB 1GHXH 1X7AC 3CS0A 4ZMAH 2BD3A 3EA8A 4LOYH 1DWDH 2CJIA 2ZO3H 2F9PA 1ESAA 4MNYA 4XSKU 3RM2H 3RXCA 1BMLA 3T27A 1C5NH 3BV9B 7ESTE 3ZZ6A 3MU1A 2JJ1D 3Q3XA 3E0NB 5DPAA 4X1RU 1W8BH 3Q3KA 4WH6A 1J14A 1HJ8A 2ZGXH 2KCOA 1AO5A 4ABHA 5A0BA 4M9FA 2EA3A 4XBDA 3SN8A 2AH4X 2P95A 3SZNA 1PPZA 1BHXF 2VWMA 2R2WU 1PYTC 2PKAA 5BPEA 4AFZA 4Y10E 1QJ7B 1S6HA 1FONA 3SNCA 1MBQA 4YESB 1Z1JA 3FKSD 6CHAB 1CT2E 1O3JA 3SU5A 3LGWA 3UB0A 1K28D 3HGPA 1DVAH 2A7HA 1FY1A 4XFQA 3T29A 2PUQH 5HM2A 1GMDF 3O8BA 2XC4A 1QB9A 1XUHA 1ELEE 3QTVH 1O2OA 3BTME 2VH0A 1LQEA 1OSSA 3OTJE 1GHZA 4Y0YE 4FUIA 5IYTA 2H2ZA 4BANB 5DG6A 5JB8S 3T25A 2VGCC 2WPJS 1IQIA 3M61U 2Z3EA 1OWEA 2GV7A 2FOBA 2GCHG 5C1YA 2A4GA 1XKAC 2AS9A 3MYWA 2RA0A 3U98H 1JIRA 1RRKA 1Y3WA 1LTOA 1HAIH 5ABWA 2B9LA 2W26A 1TNGA 1BOQA 2YOLA 1CT0E 2C8ZB 1HAVA 2QXGA 3U9AH 3PV2A 1MKXK 4ABJA 1HJAB 4B2CA 4DT7B 3FP7E 1SHHB 3MOCA 1YBWA 3SJKA 1A1RA 3PM3A 2Z9IA 1MAXA 2NU4E 3ZZDA 2SNWA 4H4FA 2A31A 2OC8A 3H09A 2QN5T 4X6OA 1BTYA 1AUJA 2Y5GA 3GCTG 4MNWA 3ZV8A 1ZPBA 2WPKS 5DO4H 1QB6A 4OGXA 3CNRA 4LZ4B 1DDJA 4CH8B 2JJ2D 5EU8A 2BMGB 1ESBA 5CHAB 1S6LA 2JIZD 2EI7A 4UDWH 2XOKD 3RXBA 4UD9H 1EUFA 1NRRH 4X6PA 1A5IA 4I31A 3KCGH 1MTNB 3OTPA 1S84A 1LO6A 2LPRA 2GT7A 4ASUD 1GDNA 2ZQ1A 4U30A 1JXPA 1FN8A 3PRDA 4YLUA 1D3QB 1K1MA 1NY22 8LPRA 2JDID 4K2YA 1SSXA 3VGCB 5ETXA 3GDUA 3UUZA 3JZ2B 1SLVB 1L1NA 3P8NA 3BG8A 4MPVA 1C5SA 1BQYA 1MMJN 4ABIA 3AAUA 3DSPA 1C5LH 4Y0ZE 3SNBA 3UR9A 2XYAA 1DT2A 5A8YA 1W12U 4CR5A 5A0CA 4TWWA 2NU2E 1UTJA 2GVFA 2ZTYA 3W95A 1UJ1A 1C5TA 3TNTA 2B8OH 1BRBE 1GL0E 3IG6B 2FODA 1CHGA 1SGQE 3R0FA 1E79D 3CP7A 4LK4A 1O2GH 2OXSA 2D26C 3IITA 2Q6FA 4FUDA 1T8OA 3BG4C 4AFSA 2CF8H 2PKSC 4BNRA 5C17A 1GMHG 2VNTA 1A5GH 3VB4A 1QRZA 3M3TA 2VIVA 1FMGA 1NU9A 3OFND 1CO7E 1BRUP 3MFJA 2F9UA 4U01A 5DP6A 5AVDA 5DK1A 5DP8A 5EXMA 1SC8U 1EPTB 1H9IE 5FX6A 4XBBA 2FP7B 4K5ZA 4FU8A 3RXVA 5L2ZH 1V2MT 1GJ9B 1KXFA 1AVGH 3TK5A 2LELA 1YPJH 1FPHH 3F0OA 3BF6H 6GCHF 4WH8A 2H9TH 1LKBA 2Y80A 3O8CA 5LH8A 2XXLA 4ZH8A 2ZDNA 1VR1H 3ATKA 3ZVGA 2Z9KA 3TH2H 1C2FA 3BTFE 1O2IA 2BD7A 1J9CH 4FUCA 5C1XA 2ZDKA 3PLPA 4MNXA 2QC2A 3KGPA 1PPFE 1IQMA 1EX3A 1ELFA 3SU0A 1S6FA 1HRTH 4IMQA 1YF4A 1BMAA 1ZZZA 1LHDH 4ZXYH 3T28A 1GG6B 2F43B 3TPIZ 4CBOA 1AE5A 3GDSA 3OEHD 2LP6A 2QXJA 2ZA5A 1HXFH 2WV5A 2BD4A 4CRDA 3ZYDA 1HJ9A 4A6LA 1P57B 2FX4A 1A7SA 1O2VA 1HGTH 2WYJA 3MU0A 2ZU4A 1NPMA 2GJGA 4WMFA 1KLJH 3Q3YA 1GBDA 1GJDB 1WSSH 2P3FH 2WPMS 3MU5A 2ZCKP 3GY4A 1O5DH 3RP2A 1O3LA 1YPGH 4Z6AH 1D4PB 1ABJH 1QNJA 1C2GA 2ANMH 1S0QA 2Y6TA 3RXAA 4FUFA 1W10U 3T5FH 3E8LA 3OYPA 7LPRA 2AGIX 1TPSA 3STJA 4KTUA 5A2MH 3U1JB 4A7IB 4R8TB 3LC3A 3AK5A 2BX3A 2BHGA 5T1VA 2Z7FE 1SQRA 2KX4A 1FUJA 1XM1A 1PQ8A 4GUXA 1JWTA 3VB3A 2V35A 2HNTF 3EGKH 2J5UA 3GOVB 3PV4A 4DG4A 2G8TA 1NFWA 1ZR0A 1DXPA 1GCTC 1GL1A 2FOEA 4TY6A 1V2KT 1SGCA 2FOAA 4X8SH 3DFLA 1DY8A 2R3UA 3MQKC 1TGNA 1WBGB 5CE1A 3TH3H 2KCAA 2ANKH 1J16A 1UCYK 2HWLB 1TQ7B 1O2JA 3LC5A 1GJ7B 1FNIA 1NT1A 2ZHEH 5LGOA 2ZDLA 2BDCA 1QY6A 3M5MA 2NU0E 5E0GA 1OKXA 2BDIA 1ETSH 2BDBA 2GCTC 1NZQH 4RI0A 4YO9A 2G55A 4BXSA 4B74A 2A45B 1EATA 1OWHA 4AGJA 2V3HH 3MH4A 3DSOA 2A7JA 3P8OA 5T6GA 1W0YH 4WXIA 3N7EA 1BIOA 2ZU5A 2PUXB 4ABFA 4DCDA 1BRAA 2Z9LA 7GCHG 2ESTE 1AUTC 3A84A 1QA0A 1TYNA 2ZC9H 2M5TA 4X1PU 3CS7A 1GI3A 1XXFA 3BEIB 4WXVA 4XBCA 1G3EA 1KXDA 8KME2 4Q63A 1DM4B 3A7YA 2VU8E 4Q7XA 4F55A 1TABE 2FPZA 1YPEH 1TFXA 1TRYA 1SQAA 1MTSA 2Y7XA 1Y3YA 1Q2WA 4TT3D 3ZZ3A 2C8WB 3SJOA 2FX6A 1DS2E 2PSYA 2WPDD 3GY7A 1HBTH 2ZU2A 1D3PB 3ZVEA 4LXBH 1ETRH 3SU6A 4B2BA 2FOHA 3KQDA 5GCHF 1RS0A 1LDTT 1OS8A 4AB8A 1TIOA 3B9FH 1K1JA 2YMSD 1ZSKA 2GKVE 3C1KA 4XD7D 3RXQA 5T3HA 1XKBC 2G4UA 2QCYA 1GBKA 1S82A 1C1VH 1J8AA 4WWYA 1CA0C 2VVUA 2FIRH 1YC0A 2PR3A 2ZGJA 2A2QH 4BTUB 3MNCA 4H6SB 4X1NU 1EP5A 1GHVH 2ZFSA 4JK6A 1O3EA 3TGJE 1ZMNA 1WU1A 2HNTC 4AGKA 1T32A 4K8BA 3TVJB 1WV7H 1FN6A 1FX0B 3M5LA 2A5KA 1TRNA 3PO1C 1RTKA 2XBYA 3P8GA 4MTBA 3HK6B 2ZHWH 5EQSA 1F5LA 2W6ID 3EA9A 3UR6A 1O3CA 1V2QT 1C5MD 1SOTA 4UFDH 3SJ8A 1Z6JH 4BTTB 3FP8E 4BAHB 3A80A 3MH6A 2ASUB 4Y11E 2BQ6B 1GHYH 3BEUA 2FESH 4J2YB 1T7CA 1O2PA 1IQJA 4MVNA 2STAE 2A5IA 1ZGIA 1W13U 1DXWA 1QQ4A 4CREA 3D49H 2VINA 1P2IA 5C2ZA 1O36A 3SUFA 4FXGH 3M3SA 2NU1E 3M7QA 1BJVA 1ESTA 3B23B 1TOMH 2W6JD 3O8RA 2P59A 1Z6EA 3FOAA 1TPAE 1Y5AT 2IJD1 4BAOB 4NFFA 2SGQE 1Z8IB 4X6MA 3RMOH 2J97A 2GZ7A 1F2SE 5F53A 2BX4A 3RXRA 1F92A 2C8XB 4TWYA 1AKSA 1SGIB 1HAYB 2XNDD 4DURA 1SHYA 3LONA 3RXLA 3GYLB 1OWIA 4B73A 2AERH 2R0KA 4BOHA 1P2NA 3E6PH 6CHAC 4SGAE 4ABDA 2IPHA 3RDZA 1SQTA 2FOCA 4RT0A 2WV9A 1SI5H 3MH5A 1GBHA 4Y71A 3U8RH 1MZDA 1N8OB 1BBRH 3A82A 1TA2A 3RMMH 1C1MA 1GHBF 1QHRB 2WZQA 4TPYA 3BTGE 5AFYH 1AD8H 3MI4A 1LPGB 2OQ5A 1TPOA 1G30B 2ALPA 4CHAB 1KDQB 1C9TA 1O3PB 2TGPZ 1C2DA 1A3BH 5DP4A 3ZVDA 1GBLA 1GJBB 2FI5E 3RU4E 3SV2H 4CRCA 3H7OA 1UTPA 4ABAA 3F9GA 4GCHF 4JZ1A 2QXHA 3NK8A 4IN2A 1HJAC 3A88A 1SVPA 2R0LA 2TGTA 5T6FA 3A85A 1XMNB 2D1JA 4KTSA 1YCPM 1B0EA 3U1IB 3RU4D 1FIWA 1YGCH 3QUMP 1DX5M 1O5CB 1NFYA 3GICB 3N7OA 1HNEE 1BDAA 3FFGA 3PMAB 1LHEH 4MPUA 4ISIH 4DVAU 2LNCA 2YNBA 1DOJA 2BM2A 4JCNA 4WMEA 1IOEA 4AYYB 2FLBH 1Y5BT 2FI3E 1KTSB 1YPLH 3OY6U 4CH2B 4MDSA 4AC9A 4AG1A 4YOJA 3NRLA 1NFUA 5CHAC 1CA0B 3TGIE 1OWDA 1EJNA 1ZSJA 9LPRA 2TGDA 3LDXH 1G37A 1QJ1B 3BTTE 3QX5H 2BY7X 2QA9E 4I7YH 5J4QA 1WAYB 2Z9GA 2EI8A 2PGQB 1MTNC 3KYGA 5EJZA 3SJ9A 1K0HA 1NFXA 2BVXH 2P16A 1EB2A 5C94A 3PO1B 1V6DA 1NRPH 1OX1A 2FTMA 1C1WH 2GD4B 4WMDA 4VGCB 2Y5HA 3VGCC 4D8NA 1GGDB 3BEFB 3O8DA 1EASA 1TPPA 4TSFD 1IQEA 1W14U 2WUBA 2BOKA 4DJZB 3MO9A 1C2IA 4NA8A 4O3TA 3E91A 2A4OA 4NWKA 3T62A 2EY4C 4KKDA 9ESTA 1HAGE 3U8OH 1F7ZA 2FYRA 1MD8A 4IC5A 3ZZAA 4B75A 1EOLA 1B5GH 1BMFD 1AQ7A 3LOXA 4NIVA 1P2QA 4I8GA 2J94A 4GLYA 5DGJA 3U28C 5I25A 1GJ6A 1TNJA 2B5TB 1SB1H 2Y5FA 2ZGBH 1A4WH 1ZRKA 1C2MA 4I86A 1ETTH 2GV6A 4D9RA 2BDGA 5FXLA 1TX6A 5GCHG 3F9HA 1MTWA 4ZKOU 1C5ZB 2C90B 2SNVA 4BTIB 1TE0A 2JH6D 3RXSA 2BLOA 1GMCG 1RJXB 5HMAA 1EPTC 3MMGA 3UNSA 4K1TA 4NA7A 1P11E 4NIYA 3M5NA 1O37A 1TBQH 3ATLA 3KQCA 3Q00A 1V2TT 3D62A 1UTOA 3SUDA 5L30H 3NKKA 4WVPE 2BQ7B 2VIQA 1D9IA 2WHXA 3NXPA 3V12A 4KGAA 1EKBB 3NWUA 2I6SA 1L4ZA 5FPYA 4OS1A 3SHAH 3RXIA 3ENSB 3PLBA 2WSSD 3K65B 2PW8H 1Y3VA 4AFQA 2BDHA 4J1YA 1DWBH 2ZFPH 3SHCH 1K1OA 4UFGH 1A61H 1FV9A 4WY3A 1ELVA 3RLWH 1RXPA 2ZI2H 2ZCHP 5LPEA 1Z8RA 1T31A 2O8UA 1GG6C 1D3DB 1D6RA 1YCPK 2FS8A 4ZHMU 1PYTD 2BY5X 3UWJH 2NU3E 2Y7ZA 4NZQA 3F68H 4DW2U 2A7CA 3LH3A 2ODQA 2OQUA 4I32A 3TJVA 2V6NA 3FVFB 3RXJA 1H8ED 1GI9B 3FN8A 3MU8A 1O2QA 1UVPA 2KAIB 3G01A 3KQEA 5FX5A 2Q6DA 4OS5A 2RDEA 2VIOA 1C2LA 1F0TA 1CGHA 2Y82A 5E8EH 5DSFA 5FPTA 2HOBA 3MTYA 4DIIH 1ELGA 4CRBA 5KEDA 2ZECA 4QT8C 4X1SU 1K1NA 3MNSA 1SQOA 1WYKA 1KXCA 1W0JD 2H6MA 1QL7A 1O2MA 1SR5C 2ZPSA 4NSVA 1TBZH 2R3YA 2V0BA 3P92A 1AMHA 1NESE 1W11U 2P8OB 3LPRA 2PV9B 3DCLA 1P12E 4JYVH 3E1XB 1VJAU 3I29A 1OWKA 3L33A 3RC5A 3SV9A 1ZMJA 3WWFA 2ZDAH 2OC1A 2NWNA 1MH0A 3SNAA 2CGAA 3MNXA 4I8LA 1C5XB 1UK4A 5EPNA 3SU4A 4X2YA 3OEED 2ULLA 3GYMA 1OYQA 2HRVA 3E90B 1E37B 3MH7A 4X8TH 2PLXA 2B7DH 3ESTA 3JZ1B 3ATWA 4O9VA 3BTQE 1GI6A 2TRMA 4AG2A 1UHBB 3VXFH 1WUNH 3UOUA 3KF2A 1DSTA 1OOKB 1YPHC 1DE7H 1UVSH 3UAIC 8GCHG 2UUJB 3M3VA 1C5PA 3SU2A 4AOQA 1ZRBA 4E05H 3A8AA 2F9VA 2OK5A 4B1TA 2EI6A 1TNHA 1UTLM 3KQ5A 1ELCA 3SGQE 1TGSZ 1GPZA 2BZAA 1FIZA 1GBFA 1SFIA 1N6YA 1XUGA 5CHBA 1QB1A 2A1DB 2ZDVH 4X0WU 1BTZA 1H9LB 1TNLA 1QRXA 5GIBA 2Q1JA 2F9OA 1CGJE 2G81E 2L74A 3QTOH 2XBXA 1BTHH 3OX7U 5E0JA 1O3HA 1A46H 5C3NA 1GI7B 3LGYA 2BDAA 1C4U2 2JETB 5TJXA 1EJAA 1YPHE 1NO9H 1GI0A 5IK2D 1NRQH 2ZWLH 2J98A 1QFKH 2QF4A 3QO6A 3ODDA 1DSUA 3RC4A 1ZOMA 1C1OA 1CBWB 3E3TA 5C1UA 1QBNA 3ELAH 1E35B 1VITF 4HTCH 1V2OT 2XW9A 5GPIB 1L2EA 1O0DH 4AN7A 1SGFG 1EZUC 3U8TH 2QF5A 4U2WA 2BD2A 2Y81A 1CU1A 3DHKH 1QIXB 1P9SA 2WPIS 5JBTA 4I33A 1ABIH 3VXEH 1EJMA 4ABGA 3DT0H 1BBRE 4TYDA 5EGMA 2W7SA 3RXMA 3KNXA 1BMNH 1H1BA 3HKIB 2BXTH 4YOIA 4JMYA 2BZ6H 1CA8B 1K1LA 4AB9A 1RTLA 1C5OH 1IHTH 2O8MA 4I8JA 2ZFRH 2ZQ2A 1G32B 1S5SA 4FVBA 2ZPQA 4AYVB 1L4DA 5FCRA 2XRCA 2PGBB 1FLEE 1JMOH 3LGUA 4INKA 4MG3A 1MTUA 3V0XA 1GJAB 3GCNA 3LGIA 1P9UA 2GMTB 1JOUB 4NA9H 1HIAB 3BIUH 1QCPA 2A0QB 5ESTE 3TJUA 1EAXA 1K22H 1XVOA 4ZCNA 4JZFH 2Z9JA 5AHGH 2BD5A 4FVDA 3L3TA 5F03A 1GMDG 2THFB 3MNBA 1LPZB 2QV1A 2K0QA 4UONA 1DUAA 1G9IE 3ZZ4A 1P04A 1P3CA 3EYDA 3SOSA 1ARBA 1QBOA 2XCNA 7KMEH 1AB9B 3FO8D 3LIWA 2IN2A 2P3TB 1IQGA 3T2NA 1TGBA 4MPWA 3I77A 2BD9A 3L6PA 1XUKA 4DY7B 3QZQA 2QAAA 2P3UB 2ZG0H 3M7TA 2UUYA 3CENA 1AZ8A 3UNQA 1W2KH 3PMHB 2HVXA 3TNSA 1KSNA 1SFQB 1V2VT 3TJNA 2H5CA 1O2UA 3BTWE 1O2SA 1O3KA 2M2AA 2BY8X 2BLWA 2TGAA 1O2WA 4ZROA 2AEIH 3PLKA 1UTMA 5EPYA 2XBVA 3BTKE 1N8OC 1G3CA 1GJ4H 1PJPA 2OTVA 3F2FA 1PFXC 4ISLA 5K0HA 2AIQA 1J15A 1IQLA 5A09A 5F6MA 2ZFTA 1GHAF 2FOGA 4CHAC 1NN6A 3LGVA 1CHOF 2XCFA 1LHGH 1PPBH 3ZIAD 1F5RA 1KXAA 1ZJDA 4JYUH 2QF3A 3SUEA 2BQWB 3GY5A 3GY3A 2ZHDA 3PROA 2GX4A 4K1EA 3RXHA 3HGNA 5I46H 2G00A 1FAXA 3Q77A 1SLUB 4MLFB 5GXPA 1GVZA 2QIQA 2FEQH 3WY8A 1THSH 2FMJA 1A0HB 1D6WA 4UE7H 1TRMA 3FAOA 3ZYEA 1ZYOA 3Q76A 2OBQA 3NPSA 1Y8TA 1UMAH 1YPMH 4CRAA 3VB7A 1CQQA 5AFZH 1PQ7A 5JYIA 1GI1A 2EEKA 2W3KA 2BTCE 4E7NA 1K9OE 1OP0A 1OYTH 1DLKB 1Z7KA 1AY6H 2ZFQH 5EIYA 1HPGA 3VPKA 1SPJA 3AW0A 2PKAB 1CGIE 4Q4LA 1V2WT 2D2DA 3I78A 1IQHA 4O03A 1UK3A 1UTNA 1ELAA 1ZHMA 1TMBH 2ZFFH 4CRGA 1C2HA 3ATIA 2L6OA 2A2XH 1Z8JB 4IMZA 1EZQA 1ORFA 2UUFB 1WOFA 2IJOB 1SGRE 4WF8A 2SGDE 1B7XB 2ZF0H 1CSOE 4PROA 4YT7H 4VGCC 1GGDC 5EQQA 1FY3A 1O3AA 2DE9A 4E06H 2CN0H 2GDDA 3A89A 1YWUA 2ZGCA 1MQ6A 1G2LA 2A32A 3SJIA 2STBE 4A5TS 3ZZCA 6GCHG 1LVBA 3V3MA 1JRTA 1C1RA 2ZHFH 1N1LA 1ZPZA 1MU6B 2HVYB 1HDTH 3S69A 1YPKH 6LPRA 3OE7D 1DY9A 2HNTE 1O2KA 1SLWB 1GCDA 5CMXH 1HAVB 3ZVBA 4ISHH 1EPTA 4NIWA 3F1SB 3P95A 3UTUH 3DA9B 1YLNA 3S9AA 3KHVA 4HGCA 1KYNA 4NZLA 4XRNA 3EE0B 2BB4A 3MO6A 3QGJA 2GP9B 4OM9A 3P70B 2JH0D 2GCHF 1D3TB 2FM2A 4Y7BA 3PMBB 1PQ5A 2JH5D 1LVYA 5FHTA 3S7HB 2BLVA 2K8IA 1NBME 3SGBE 2WINI 1RIWC 5LPRA 3RMLH 4CRFA 2V7QD 1CT4E 4FOUC 2VIDA 1RFNA 4K69A 5L6NH 5DP7A 4UFFH 3KL6A 1YY3A 3SU1A 1EOJA 2WUCA 4ASHA 3A81A 1HAOH 1DFPA 1NBMD 1E36B 3PYHA 2CMYA 1GHWH 3DUXH 4YM9A 2TBSA 1O34A 1VZQH 2FWWA 3A8CA 4GPGA 4CR9A 2PHBA 3GCTF 1P03A 1HAXB 4ABBA 3PRBA 3UOPA 4ZUHA 3BN9A 2VBCA 1C1PA 1O33A 2BXUH 5KGOA 4RKJB 3UQVA 1TALA 1C5QA 4IW4E 5EJLA 2ODYB 1XUFA 3F2HA 4ESTE 4IC6A 1KXBA 2DUCA 1O3MA 1YLCA 5FBEA 1O2NA 3ODFA 4WJG2 1SG8B 1SKYE 1O5AB 1TGTA 4P02A 3PB1E 5C5OA 1TQ0B 3A87A 3U69H 5T6DA 2P94A 2VVVA 4K60A 3SYJA 2TPIZ 2YMSB 1W7XH 1QR3E 4F49A 1SGFA 1G3BA 1C2EA 2KM0A 2CF9H 1SGDE 4X8UH 1UVTH 1SGPE 3URCA 1BITA 1P10A 2FLRH 2ZHQH 1PQAA 1UTKA 1MKXH 1VGCB 1O3BA 4AORA 1EP6A 2BVRH 3A86A 2O8WA 5JBCS 1LCYA 1J17T 1NM6A 4YZUA 3GY2A 2HALA 4AFUA 1YM0A 3M37A 1QURH 5EG4A 4FETA 1GI2A 1SGTA 3SO3A 2RDLA 1L1GA 4CBNA 2FXRA 1GMHF 2G51A 1MUEB 1YP9A 1GI5A 1SBWA 3ZZ7A 2P8OC 4Q7ZA 2Z94A 3VB5A 1ZHRA 1C9PA 3H7TA 1ANCA 2DE8A 4JZEH 4YT6H 3K6YA 2G52A 1B0FA 5GJ4B 1FZZA 2F91A 3SI3H 2FDAA 3A8DA 3UWIA 4A1TA 2HPPH 1W0KD 1JRSA 3P17H 1A0LA 4K3JA 2Z3CA 1ELDE 1O3DA 1GI8B 2UWOA 2KR7A 5FCKA 2QXIA 4B6FA 4GAWA 4Q2KA 1YYY1 1NRNH 1DWEH 3AW1A 1E34B 2UUKB 2ZU3A 5F8ZA 3LKWA 1TA6A 1MBMA 3HATH 1CVWH 3UPEA 1OP2A 1ANEA 1GBJA 1NC6A 1JIMA 5FBIA 2RFKC 2OUAA 3GDVA 2ZTZA 1MCVA 4O97A 2AIPA 2HPQH 3RXUA 1V3XA 1VJ9U 1IQNA 3S9CA 3A8BA 4RT1A 1O5FH 1QTFA 3SQHE 1CE5A 5TCAA 3UNRA 1AE8H 1EAUA 2AGGX 1THRH 4ZAEA 4JZDH 4DIHH 4FU9A 1G2MA 1TAWA 5EQRA 4NIXA 3QLPH 1FAKH 1RIWB 2XC0A 1WDIA 4MPXA 3AAVA 1VITH 1MKWK 2JETC 1TX8A 3LGTA 4JYTA 5K7RA 4DT4A 1O5GH 3SZEA 4Y76A 2ZDMA 1EAIA 1ELBA 5GWZA 4KP0A 5EXNA 1C1SA 1A2CH 5HIYA 1O3IA 1CBWC 1EZSC 4D7GA 3TK6A 1AU8A 2SGEE 2WPHS 8ESTE 1AHTH 4NSYA 4BAMB 1BTWA 3R3GB 1VCQA 3EAJA 4Y6DA 2HGTH 1V2ST 1BBRK 1UW7A 1KXEA 1TWXB 3A7WA 4Z1MD 3GCHB 2H1UA 5SGAE 4XE4A 3ZZ8A 1O2XA 2FOMB 5CDFE 3N99A 1Q31A 1E1RD 2KFWA 3HKJB 5EODA 1EXFA 3SGAE 2FTLE 2Z6BD 1ARCA 3BSQA 2BLQA 5JB9S 1GJCB 1LMWB 3C27B 1A0JA 2PSXA 1O3FA 3A83A 5PTPA 1E0FD 2AMPA 1RD3B 2KCPA 2I6QA 3TJOA 1INCA 5HYOA 1XUIA 3OY5U 2D8WA 3EE7A 2PTCE 1LPKB 4HG6A
chains in the Genus database with same CATH topology
4NG9H 1HAPH 1H4WA 1RTFB 4OS7A 3AASA 1QQUA 1XVMA 2GMTC 5EXLA 5C20A 4A1VA 4R0IA 3TK9A 4ZHLU 2FS9A 1FY5A 2V3OH 4X6NA 4E7RG 1TMUH 4JZIA 1GDQA 1ANBA 1AIXH 3SBKA 2HLCA 1U6QA 1KLTA 2PTNA 3GISB 3RMNH 1Y3XA 3FZZA 2ZIQH 2OCVB 4HFPB 4MNVA 3BIVH 4X2VA 2OBOA 1RGQA 2G5NA 1C5VA 1FXYA 1HLTH 2OC7A 1K2I1 2BD8A 1GHBG 1O38A 4X2XA 1GBTA 2BY6X 4JK5A 4OGYA 1AB9C 1ZPCA 1UVOA 1EQ9A 1K21H 5DP9A 1TOCB 1BZXE 1QJ6B 1XXDA 7GCHF 2ZEBA 2F9BH 1FI8A 1Y3UA 2CHAB 4YOGA 1H8DH 2GDEH 2AFQB 3MWIU 3SNEA 2XWBI 2SGAA 1C5RA 4GCHG 1LHFH 1Y5UT 3S0NA 4IN1A 2VJ1A 2BVSH 1PPHE 1DUEA 4MQAA 3OSYA 4BAKB 4B71A 5IDKA 3MHWU 1UCYH 4X1QU 4BXWA 1KDQA 1O3NA 3UFAA 1O39A 3VEQB 2PFEA 5HXFA 5DKMA 4Q80A 5FPSA 1NU7B 1UTQA 2FYQA 4Y8YA 1BMMH 1GBCA 1LVMA 4ZKRU 1MCTA 4HI3A 2P93A 3KN2A 3UIRA 5DP3A 1O3OA 3UREA 1XX9A 2J9NA 4GVUA 1PPCE 4ISNA 2ZKSA 1MTVA 3F9FA 4UEHH 1ZJKA 3EDXB 1O2YA 1P01A 4FUEA 3D23A 4ZKNU 1ZSLA 2A4QA 5E2OA 2VH6A 4TPIZ 2J38A 1QGFA 5TCCA 2BDYA 4D7FA 1C1QA 3DD2H 3SORA 2ODPA 2A4RA 3V7TA 3LT3A 1S81A 1S83A 3A7TA 3SV6A 2GZ9A 3M35A 1QRWA 5F8XA 1C2JA 1MZAA 1UO6A 4D76A 1BUIA 1DITH 1ELTA 1BT7A 3ZVAA 2CV3A 3F6UH 1QBVH 2SGFE 1AKSB 3ZV9A 1AI8H 3QZRA 3RM0H 3FZDA 2GGVB 4FUHA 1BB0B 3TLOA 2J92A 2UWLA 3LH1A 2AGEX 3E0PB 4XOJA 5EOKA 1AGJA 1C5YB 2QF0A 1TBRH 3K6ZA 3RXEA 2VGCB 1T8MA 3GY8A 2WV4A 3M36A 1HXEH 4B2AA 1P2OA 2K1QA 4INHA 3KIDU 1GI4A 1IHSH 5A8ZA 3P8FA 2TIOA 4AX9H 1Q3XA 5H4IB 1VCPA 2RCEA 4H42U 3RXDA 1G3DA 2AMDA 2AYWA 4TY7A 2H9EH 1TMTH 1AWFH 3K2UA 1ZGVA 5GDSH 2G4TA 1TLDA 1WCZA 1QL8A 4FU7A 1TB6H 1F0SA 1HB0B 1AWHB 3RXGA 2C4FH 4K8YA 1SGEE 2VB0A 4A92A 3TGKE 4O3UA 4OS4A 2ZU1A 2F83A 1P06A 3D65E 1FY8E 2UWPA 4RN6A 2R2MB 1T4VH 1P2JA 3ZVCA 1BTXA 1C1UH 2J34A 1C5UA 1HV7A 5J4SA 1OWJA 1GBIA 4YLQH 1S0RA 2H9HA 3SV8A 2ZPRA 5C5NA 2O8TA 4IBLH 1L0ZA 3VFEA 3QWCH 1GBBA 1O5BB 1OPHB 1XUJA 1AFEH 1SOZA 5E2PA 4A1XA 1MU8B 5E0HA 2PWXA 1MAYA 1NROH 2FI4E 1BHXB 1O31A 2GZ8A 3RXTA 1THPB 1F0RA 1SL3A 1P05A 1V2PT 2BYAX 3SNDA 5AF9H 1BA8B 3BTDE 1GWAA 1DANH 2GT8A 1ZTJA 1FDPA 3ZZ5A 5EW1H 1TONA 1PPEE 2QYIA 1PPGE 2ZZUH 4KTCA 4AZ2B 1O2LA 2KAIA 3BG4B 2PKSB 4IGDA 4THNH 3ITIA 1FY4A 2XWAA 1Z8GA 1EAWA 1KLIH 1F0UA 1T8LA 5DJ7A 1OP8A 2OD3B 1O30A 1TNKA 3SI4H 3RXKA 3NUMA 4RSPA 1O2RA 3FANA 4M7GA 1BCUH 3M5OA 3SW2B 1C2KA 1P2KA 2OC0A 2ZGHA 4LZ1H 1IAUA 3SQEE 1O3GA 1P0SH 1SGYE 2ANWA 1VGCC 1ZLRA 3E16B 3LJJA 2SFAA 4NWLA 3B8JA 1GJ8B 1P3EA 2OLGA 2XC5A 3M7UA 3W94A 2QY0B 1NRSH 1V2LT 1DPOA 4NGAH 1LVOA 2Q6GA 4FUBA 3LJOA 4INLA 1TNIA 1G36A 5DP5A 3MU4A 1P09A 3P6ZB 3PWCA 5B6OA 4D9QA 1HYLA 4HZHA 3DFJA 3URDA 2O9QA 3RUOA 2A5AA 5F8TA 4ZKSU 1L1JA 2WYGA 4Z0KA 2W7UA 2C93B 1IQKA 1TX7A 3F9EA 3A7XA 1VCWA 5BRRE 1BTPA 4ZXXH 1KY9A 3K9XB 1ID5H 4XDEA 2W5EA 2W3IA 4FUGA 1C1NA 1E38B 2AMQA 1GMCF 4OS2A 1UHBA 1HAZB 1GBMA 2OINA 2OP9A 1P8VC 1H9HE 3H5CB 1O35A 2FZZA 4NCYA 4GSOA 1GBAA 2RG3A 1V2NT 3UQOA 2C3SA 2J95A 4ZHAA 1KTTB 2H5DA 4F4OC 3BTEE 1FPCH 5LPFA 1VITG 1AVWA 2BY9X 2VWNA 2YNAA 4K1SA 4ABEA 3SU3A 2R9PA 4Q7YA 1AFQC 1Z71A 2WPLS 4U32A 1SMFE 1ZTLA 5FAHA 1UK2A 3STIA 1GVKB 3FP6E 4OS6A 1BJUA 2C8YB 1SGNE 1HCGA 2FO9A 2BOHB 4Y7AA 3NCLA 1YLDA 1AN1E 1DICA 3GCOA 5A0AE 6ESTA 5JBAS 1KIGH 1C4V2 1QL9A 5G4BA 3RXFA 1GCTB 1GDUA 2B0FA 2XNIA 1Y59T 4ISOA 5JBBS 3RLYH 1LQDB 1K1PA 4I8KA 1GVLA 3SUGA 1M9UA 1A5HA 1T8NA 1NS3A 1MKWH 3EA7A 4RKOB 3S7KB 2F9NA 3UY9A 2F3CE 1EB1H 1MQ5A 1BRCE 2ALVA 4B76A 3LU9B 1FJSA 1T4UH 2VWOA 4I8HA 3RXOA 1HUTH 1S85A 1Z1IA 1WQSA 1UCYE 1WTHD 3GCHC 2GTBA 4DOQA 1F5KU 3IWMA 1GBEA 2XTTB 3QDZB 3ZZ9A 2VVCA 2GCTB 4UFEH 5HGGA 2QGRA 4X2WA 3RXPA 3VB6A 2G5VA 1AVXA 1MD7A 1O2ZA 3KQBA 3QGNB 1P2MA 1W0ZU 3BTHE 1HIAA 2J2UA 2Z3DA 1A3EH 3PTBA 1YKTA 3A7ZA 4Y8XA 1V2UT 2VIPA 3QN7A 1C4Y2 4FUJA 2VIWA 1DLEA 1N6XA 3GY6A 2ILNA 3PMJA 1YCPH 4DGJA 3RU4T 1ZHPA 5JPMH 3QK1A 3MO3A 1IQFA 3HPTB 3AVZA 4KELA 1WTGH 2JKHA 3OU0A 3A7VA 1ANDA 4SGBE 2EC9H 2ZTXA 2O8LA 3TITA 1JBUH 1TGCA 5L2YH 1O2HA 4NFEA 2IOTA 2XBWA 1FQ3A 1ZMLA 1C1TA 3EQ0H 1OXGA 8GCHF 5HM9A 5ESBA 1K1IA 1HAHH 2ZP0H 1EZXC 1W7GH 4GHQA 3TU7H 4H6TA 4Y8ZA 3PWBA 3KEEA 1QA7A 5A8XA 5JDUB 2FOFA 1C5WB 1AZZA 3ATMA 1P02A 2CXVA 3NZIA 5C67A 1GHAG 1UVUH 3PTNA 1CHOG 1LKAA 3HK3B 2J4IA 3SV7A 1WQVH 2CHAC 4YTAA 3RC6A 1DWCH 2RA3A 1BTUA 2ZCLP 1O32A 3T26A 3TIUA 1O2TA 1ZTKA 4GHTA 2VWLA 1LHCH 2SGPE 4Y79A 1ACBE 2ANYA 1GJ5H 1H8IH 1O5EH 3TH4H 5EW2H 1NTPA 2ZNKH 4X8VH 3ZZBA 3V13A 1SLXB 4BAQB 1V2JT 1W3CA 1HFDA 3ZVFA 1V2RT 3S9BA 4IS5A 1AFQB 1GHXH 1X7AC 3CS0A 4ZMAH 2BD3A 3EA8A 4LOYH 1DWDH 2CJIA 2ZO3H 2F9PA 1ESAA 4MNYA 4XSKU 3RM2H 3RXCA 1BMLA 3T27A 1C5NH 3BV9B 7ESTE 3ZZ6A 3MU1A 3Q3XA 3E0NB 5DPAA 4X1RU 1W8BH 3Q3KA 4WH6A 1J14A 1HJ8A 2ZGXH 1AO5A 4ABHA 5A0BA 2EA3A 4XBDA 3SN8A 2AH4X 2P95A 3SZNA 1PPZA 1BHXF 2VWMA 2R2WU 1PYTC 2PKAA 5BPEA 4AFZA 4Y10E 1QJ7B 1S6HA 1FONA 3SNCA 1MBQA 4YESB 1Z1JA 6CHAB 1CT2E 1O3JA 3SU5A 3LGWA 1K28D 3HGPA 1DVAH 2A7HA 1FY1A 4XFQA 3T29A 2PUQH 5HM2A 1GMDF 3O8BA 2XC4A 1QB9A 1XUHA 1ELEE 3QTVH 1O2OA 3BTME 2VH0A 1LQEA 1OSSA 3OTJE 1GHZA 4Y0YE 4FUIA 5IYTA 2H2ZA 4BANB 5DG6A 5JB8S 3T25A 2VGCC 2WPJS 1IQIA 3M61U 2Z3EA 1OWEA 2GV7A 2FOBA 2GCHG 5C1YA 2A4GA 1XKAC 2AS9A 3MYWA 2RA0A 3U98H 1JIRA 1RRKA 1Y3WA 1LTOA 1HAIH 5ABWA 2B9LA 2W26A 1TNGA 1BOQA 2YOLA 1CT0E 2C8ZB 1HAVA 2QXGA 3U9AH 1MKXK 4ABJA 1HJAB 4B2CA 4DT7B 3FP7E 1SHHB 3MOCA 1YBWA 3SJKA 1A1RA 3PM3A 2Z9IA 1MAXA 2NU4E 3ZZDA 2SNWA 4H4FA 2A31A 2OC8A 4X6OA 2QN5T 1BTYA 1AUJA 2Y5GA 3GCTG 4MNWA 3ZV8A 1ZPBA 2WPKS 5DO4H 1QB6A 4OGXA 4LZ4B 1DDJA 4CH8B 5EU8A 2BMGB 1ESBA 5CHAB 2EI7A 4UDWH 3RXBA 4UD9H 1EUFA 1NRRH 4X6PA 1A5IA 4I31A 3KCGH 1MTNB 1S84A 1LO6A 2LPRA 2GT7A 1GDNA 2ZQ1A 4U30A 1JXPA 1FN8A 4YLUA 1D3QB 1K1MA 1NY22 8LPRA 4K2YA 1SSXA 3VGCB 5ETXA 3GDUA 3UUZA 3JZ2B 1SLVB 1L1NA 3P8NA 3BG8A 4MPVA 1C5SA 1BQYA 1MMJN 4ABIA 3AAUA 4Y0ZE 1C5LH 3SNBA 3UR9A 2XYAA 1DT2A 5A8YA 1W12U 4CR5A 5A0CA 4TWWA 2NU2E 1UTJA 2GVFA 2ZTYA 3W95A 1UJ1A 1C5TA 3TNTA 2B8OH 1BRBE 1GL0E 3IG6B 2FODA 1CHGA 1SGQE 3R0FA 3CP7A 4LK4A 1O2GH 2OXSA 2D26C 3IITA 2Q6FA 4FUDA 1T8OA 3BG4C 4AFSA 2CF8H 2PKSC 4BNRA 1GMHG 2VNTA 1A5GH 3VB4A 1QRZA 3M3TA 2VIVA 1FMGA 1NU9A 1CO7E 1BRUP 3MFJA 2F9UA 4U01A 5DP6A 5AVDA 5DK1A 5DP8A 5EXMA 1SC8U 1EPTB 1H9IE 5FX6A 4XBBA 2FP7B 4K5ZA 4FU8A 3RXVA 5L2ZH 1V2MT 1GJ9B 1KXFA 1AVGH 3TK5A 1YPJH 1FPHH 3BF6H 6GCHF 4WH8A 2H9TH 1LKBA 2Y80A 3O8CA 5LH8A 2XXLA 4ZH8A 2ZDNA 1VR1H 3ATKA 3ZVGA 2Z9KA 3TH2H 1C2FA 3BTFE 1O2IA 2BD7A 1J9CH 4FUCA 5C1XA 2ZDKA 3PLPA 4MNXA 2QC2A 3KGPA 1PPFE 1IQMA 1EX3A 1ELFA 3SU0A 1S6FA 1HRTH 4IMQA 1YF4A 1BMAA 1ZZZA 1LHDH 4ZXYH 3T28A 1GG6B 3TPIZ 4CBOA 1AE5A 3GDSA 2ZA5A 2QXJA 1HXFH 2WV5A 2BD4A 4CRDA 3ZYDA 1HJ9A 4A6LA 1P57B 2FX4A 1A7SA 1O2VA 1HGTH 2WYJA 3MU0A 2ZU4A 1NPMA 4WMFA 1KLJH 3Q3YA 1GBDA 1GJDB 1WSSH 2P3FH 2WPMS 3MU5A 2ZCKP 3GY4A 1O5DH 3RP2A 1O3LA 1YPGH 4Z6AH 1D4PB 1ABJH 1QNJA 1C2GA 2ANMH 1S0QA 2Y6TA 3RXAA 4FUFA 1W10U 3T5FH 3E8LA 3OYPA 7LPRA 2AGIX 1TPSA 3STJA 4KTUA 5A2MH 3U1JB 4A7IB 4R8TB 3LC3A 2BX3A 2BHGA 2Z7FE 1FUJA 1XM1A 1PQ8A 4GUXA 1JWTA 3VB3A 2V35A 2HNTF 3EGKH 3GOVB 3PV4A 4DG4A 2G8TA 1NFWA 1ZR0A 1DXPA 1GCTC 1GL1A 2FOEA 4TY6A 1V2KT 1SGCA 2FOAA 4X8SH 3DFLA 1DY8A 2R3UA 1TGNA 1WBGB 5CE1A 3TH3H 2ANKH 1J16A 1UCYK 2HWLB 1TQ7B 1O2JA 3LC5A 1GJ7B 1FNIA 1NT1A 2ZHEH 5LGOA 2ZDLA 2BDCA 1QY6A 3M5MA 2NU0E 5E0GA 1OKXA 2BDIA 1ETSH 2BDBA 2GCTC 1NZQH 4YO9A 2G55A 4BXSA 4B74A 2A45B 1EATA 1OWHA 4AGJA 2V3HH 3MH4A 2A7JA 3P8OA 5T6GA 1W0YH 4WXIA 1BIOA 2ZU5A 2PUXB 4ABFA 4DCDA 1BRAA 2Z9LA 7GCHG 2ESTE 1AUTC 3A84A 1QA0A 1TYNA 2ZC9H 2M5TA 4X1PU 3CS7A 1GI3A 1XXFA 3BEIB 4WXVA 4XBCA 1G3EA 1KXDA 8KME2 1DM4B 3A7YA 2VU8E 4Q7XA 1TABE 2FPZA 1YPEH 1TFXA 1TRYA 1SQAA 1MTSA 2Y7XA 1Y3YA 1Q2WA 3ZZ3A 2C8WB 3SJOA 2FX6A 1DS2E 2PSYA 3GY7A 1HBTH 2ZU2A 1D3PB 3ZVEA 4LXBH 1ETRH 3SU6A 4B2BA 2FOHA 3KQDA 5GCHF 1RS0A 1LDTT 1OS8A 4AB8A 1TIOA 3B9FH 1K1JA 1ZSKA 2GKVE 3C1KA 3RXQA 5T3HA 1XKBC 2G4UA 2QCYA 1GBKA 1S82A 1C1VH 1J8AA 4WWYA 1CA0C 2VVUA 2FIRH 1YC0A 2PR3A 2ZGJA 2A2QH 4BTUB 3MNCA 4H6SB 4X1NU 1EP5A 1GHVH 2ZFSA 4JK6A 1O3EA 3TGJE 1ZMNA 1WU1A