3O8CA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
molecule keywords HCV NS3 protease/helicase
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8cA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8cA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8cA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA03
2QIQA 4LY6A 3I4LA 1GWAA 3ENSB 2C9YA 1J90A 2HCJB 1P72A 1UVOA 3DFJA 3U8RH 1K28D 5L8VA 1TE0A 4N3NA 3RS3A 3A7XA 1UCYH 5A8YA 2ZE8A 1G5TA 5GVSA 1JOUB 1XD8A 5E4FA 4U2WA 1TF7A 4XBCA 4LI0A 1O5DH 1ESNA 2WWHA 2VHCA 4CRDA 5C1UA 3RXPA 1TADA 2ONKA 3KKNA 2VPPA 4PAOA 1S83A 2DE9A 4FUDA 1EJNA 4HB0A 1E34B 3LGUA 2W7SA 1AHTH 1HNEE 3EA5A 1SKYB 1IXRC 4EQ6A 2B21A 4Q5IA 1UTQA 1BMAA 5FI1B 5AFYH 2ZU5A 3ZVNA 1VG1A 5GJCA 3R20A 4ZI3A 1W36D 2FEQH 1QHGA 5FPHA 4XSGA 2JEOA 1VCOA 2OD3B 4DT1B 4B73A 4GPGA 2OM2A 2X8AA 2QMHA 1O32A 2F3CE 2WKPA 2IYTA 3HPQA 1GJ7B 5PTPA 1S0RA 4KFRA 1T91A 3NWJA 4WVFA 1GVLA 1DWBH 1SVOA 4BUJA 3UUZA 5SZJA 3TUIC 2TBSA 3THWB 2H9HA 3ZVMA 2WWWA 3PEVA 1QRZA 2WOJA 1TA2A 5HKKA 2W26A 2WMNB 2YOFA 2FWWA 3TUZC 1NJGA 1XCGB 3U3JA 2FNAA 2VF7A 3L3TA 2XOKD 1LVBA 3AVZA 2ZDVH 2J87A 3SOSA 3VX3A 3IG6B 2BEJA 3WYGA 1Z71A 4MGZR 5GADl 4URWR 1UCYE 2GETA 4DT1A 4LJ8A 1QVAA 3DD2H 2D62A 5DP5A 1G32B 5JJIA 3UTUH 3URDA 5C1BA 1EX7A 5BXQC 4AORA 1S0QA 1VCPA 2W83A 4I99A 2C9CA 1P61B 2AIPA 4BEBA 4JYBA 3B13B 2RGCA 4A7IB 1BJVA 4TL7A 2ZVQX 2ZYVX 4GSOA 4X6NA 4HB4A 2BBSA 3PIRA 2OCPA 4DLYA 1W4BA 5D3MA 3BEUA 2OQ5A 2H18A 5JZVA 1XKBC 4RCYA 4YDSA 4HUQA 4TTQA 3SHFA 4KV9A 4ISIH 3B60A 5GCHF 4IGDA 2FS9A 3LXXA 2XBVA 1OYWA 1BZXE 4AY2A 4LYAA 1GI2A 2OG2A 2Q21A 2BMDA 5DK1A 1FP7A 1KDRA 1TQ6A 2QXGA 3EXAA 4H9GA 1ESAA 1P3CA 2B6HA 3QJYA 5JBQA 4MGIR 4JZDH 1Z0JA 4XSHA 2ZHDA 2RG3A 2GMTB 1E0FD 2WYGA 4JLPA 3W90A 1E38B 4Q19A 1Z6YA 2ZO3H 4PHGA 4I31A 2GX4A 5UKDA 3W3ZB 4A36A 4JLNA 1KTTB 1SVIA 3OX7U 5AHGH 4ZH8A 1Y3WA 1HFDA 1EJMA 4DJZB 4TMKA 4B3XA 3QBTA 3TR5A 1KSHA 1VJ9U 3K0EA 3SFVA 3OFND 3SNHA 3RLFA 4IJMA 1FP6A 4Y71A 2A30A 1Q3XA 1ZBDA 3SI7A 4A92A 3IO5A 1ODFA 1RTKA 2H57A 1NU7B 1BS1A 3SNEA 3NEYA 3SBKA 4A0HA 4PO1A 2Q3MA 1Z8GA 3RP2A 2GZ9A 4Y0VA 5FOTA 1NY22 3K2UA 1E9BA 2O8MA 1CA0C 3K9XB 4MVNA 2HT6A 4LC1A 1N6OA 3LRPA 2ZU6A 1GHWH 4UKDA 4AG2A 1E0KA 2GCNA 1II0A 4WBSA 4D6PA 3MJHA 3VKWA 2C8XB 1BMMH 2WPLS 2BZAA 2QUZA 1AI8H 1G1MA 3VQTA 5HM9A 3VB5A 1XU4A 1TGBA 2OE2A 3T1QA 1NN5A 1N5KA 1C2DA 1F2UB 3VR1A 1W2HA 3O8DA 3A85A 1UO6A 1GG6B 1SLVB 2GBLA 2J0UB 3UG6A 3DZDA 4F7WA 5AUQA 1GHZA 1Y63A 2A5YB 3AF1A 1EK0A 4ZV4A 2STBE 1E3MA 2FTLE 5G53C 4FW9A 3A7ZA 3SHAH 3W5IA 2EWWA 1Q12A 1J70A 3C16C 1ZPZA 2H1LA 5DO4H 2AIQA 1HE8B 3UY9A 1ZJDA 5FCKA 1O2ZA 2ZFPH 2G52A 1GG6C 3OAAD 5FBQB 5EXTA 3AKYA 1Z2CA 4DC9A 3ZVLA 2A5KA 1CVWH 2O5VA 4Q7YA 2FX4A 2V55B 1GI6A 2BWJA 2QPAA 3CF6R 2Q6FA 3GD7A 1V2UT 5LDDC 2AMPA 1G4UR 4M0LA 1E2GA 3WNDA 1MABA 4CH8B 5IT5A 3ZZ9A 4RD3A 1ZVQA 4LOYH 1WTGH 1Z8RA 3DOEA 1XXHE 4OYHA 2BDHA 1V6DA 4KXFB 2CK3A 2QI9C 3QPVA 2QXHA 3BOSA 221PA 1W2GA 4ZAEA 1N25A 3BH0A 4KCGA 1EOLA 1QRWA 4CH2B 4E7RG 5A09A 3LAWA 4XVQA 1TQ0B 3DUXH 4E09A 1AE8H 2BDCA 2H1UA 1V2KT 1EGAA 1JRSA 2GZHA 1E4YA 5GWZA 3HR8A 2HV8A 3A7YA 1FAXA 4PC1A 4Q9HA 5C2JB 3FHCB 1HDTH 1O3EA 3NWUA 1C1QA 3TSOA 1LPKB 4FXPA 3E16B 4US1R 3ZQ6A 4JYVH 4LCBA 5FOSA 3DHKH 4WZ6A 4YOGA 4DDTA 1TUEA 1SHYA 4NA7A 3DM9B 2ONJA 5FL7A 1DBSA 1K1LA 1A1VA 4Y0ZE 1F2TA 5JDUB 1W13U 1ELDE 5E0HA 1DTSA 1Z28A 3TH2H 1TMUH 1KDOA 1TPAE 1TF2A 4X2VA 2NU4E 4P0TA 4Q4HB 4DJTA 2UWPA 1YLDA 3RDPA 3EA9A 3T62A 1SGTA 1FW6A 1OX1A 4ASHA 1MRNA 1KKMA 2FOAA 1CR4A 6CHAB 1OFUX 4B2PA 1GBAA 1NO9H 1HTWA 3EQ0H 4NE2A 1F5KU 3V13A 4FWTA 3GMTA 2DFNA 3HDTA 1GI8B 3KQKA 3RYTC 1TMKA 3U7GA 1KLJH 2F55A 4J1YA 3WBJA 3UWKA 3IO3A 5DIFA 2AR7A 2OQUA 2P3FH 4FXGH 4E06H 1NRJB 2LWIA 2AFQB 1LQEA 2GCTB 3BH7A 1EZQA 3U3KA 3AVPA 2DFKB 1ZUIA 2NU2E 1AFEH 3HWSA 4YMVA 4DCNA 1T3LA 1XJQA 2B8OH 5CLQA 2RDLA 1D2EA 1Y3UA 2OFOA 2I6SA 1NI3A 3RU4E 1F2SE 4L9SA 2FMXA 2SNVA 3RWMB 2OXCA 1Y3YA 3MJRA 4I1SA 3AASA 5GXPA 1MKXK 3MMPA 1GCTB 2EFEB 2GEVA 4WIAA 4DURA 1EPTA 4KI0A 1N0WA 1XUHA 3LLMA 1EAIA 1GBTA 2FPKA 1MUEB 3SJOA 1B0FA 5JB8S 4TWWA 1W1WA 1EFCA 1KAOA 3URCA 2Z94A 4CRAA 4II7A 4TYWA 2AK3A 2R9VA 1P9SA 4CF7A 4XTRA 4K1EA 2G8TA 2Q6GA 2Q1JA 3GYMA 4F49A 4ZKSU 3EC1A 3MNBA 1AFQC 4DSNA 4FMDB 2GESA 8OHMA 5B57C 4YT6H 3CKLA 2BCGY 8GCHF 2QMUA 1TWXB 2A31A 4FU8A 2VU8E 2XGJA 1PQ8A 4Q9LA 1EFRA 3E1XB 2VEDA 4UEHH 4RI0A 3AB3A 2FSFA 1VITH 3NDPA 4MH0R 5F03A 4AB8A 3GEHA 1US8A 2BBWA 2FFAA 4HGCA 1VR1H 3QXCA 3K6ZA 1UVTH 1MBQA 4UDWH 3WY8A 2D06A 3U4QB 1R0ZA 4I4LA 3T5GA 5EZ6B 1A0LA 1A5IA 1ANCA 4QGHA 1TEXA 2C8VA 1U94A 1LS6A 3QDZB 3T29A 1G17A 3KJIA 4TY7A 1FTSA 1QG2A 4D4KA 3OIVA 4DT7B 1Q3HA 3GLGB 4TLAA 4LDJA 3ZZ3A 3OF5A 4NIXA 4DUGD 4K2YA 1CSOE 2CF9H 5FUVA 1E1QD 2NO1A 3QOFA 5L30H 1XMIA 3SDZA 1SLWB 3FE2A 3KHVA 1SLUB 5C67A 1GOTA 3TK1A 5HZHA 4IVRA 2ZDLA 3OSYA 1HRTH 2K1QA 1RVDA 4M22A 1KI8A 3FP6E 2YC4C 1Z0AA 1HAZB 4C4PA 1MBMA 1XFAA 3ZS8A 2ZHWH 3SJ8A 1YR9A 3QG5A 1FY8E 1KKLA 4L5BA 3RXMA 1GP2A 2Y8EA 3MYWA 3L0OA 1A2BA 2QMOA 3QGJA 1SGFA 3A87A 1FMGA 1FNIA 2CE2X 2Z9LA 1KLTA 1P7CA 5LH8A 2VH0A 2NU3E 2Q6TA 3KQBA 4NIVA 2ZHFH 2GZ8A 3FP8E 3O47A 4QBHA 1MZDA 2GJ9A 5J4LA 3KFVA 5DP6A 1WRBA 3TH4H 4Q1EA 3T1VA 1O3DA 4I33A 3PITA 3TNSA 1OB5A 3IEUA 3P6ZB 3RXTA 1HIAB 3DEFA 3ADKA 1KDQA 3OTJE 1V2MT 1ELFA 5EOKA 3K9GA 4OI4A 1ZPCA 5GPIB 2GMTC 1UCYK 4KLZA 3C41J 4HFPB 4E03A 1DELA 3WBKA 1T3HA 4RN6A 4MRNA 1N6YA 2PZFA 2ZQ5A 1O5EH 2J45A 4UFEH 3X1WA 1HAPH 5FUYA 1THRH 5F6MA 2VTKA 3NIBA 2PUQH 1IQMA 2KB0A 3WY9A 4ASUD 2P16A 5CHAB 3RXJA 2LKCA 4BZXA 1ZTLA 4PANA 2ORVA 3RXLA 1UBFA 2EFCB 1M9UA 3W3AA 3UANA 4JLAA 1A4RA 5JRZA 1G8GA 2BVNA 1OF1A 2V7QA 3ZZCA 4LOAA 3U3RA 5JEEA 4KITB 1WQSA 6GCHG 1OPHB 2ZJZA 2XNSA 2OFWA 5ETXA 4FCWA 3GY7A 4QHSA 2VWLA 1O39A 4LZ1H 1SGPE 4YMUA 2CBZA 2EA3A 3BF6H 1GI7B 2PFEA 2IXGA 3UOUA 2IT1A 5TCAA 1O3FA 1BIOA 4RKEA 4BFZA 3AVWA 4N0DA 1TPPA 2FF7A 4A1TA 1AQYA 4M9FA 1Z6TA 2VP9A 3RC6A 2GHIA 3RABA 4IHQA 3HJNA 4RFSB 5EPYA 4KAXA 4AOQA 3M3TA 4NCHA 2ZZUH 4YESB 1KZGB 1ELGA 3DOFA 2QBYB 3REFA 5DYGA 4G5OA 5HXFA 2FP7B 1KSGA 4MGKR 2ZFRH 2DPXA 4DGJA 2I1VB 4QG7A 1SGDE 3E0PB 1F0SA 3K8YA 2D26C 1F3OA 3SGAE 1E96A 1VCQA 1U9IC 2R9PA 2Z9IA 2BZ6H 1MU6B 2A1DB 2MSCB 2FSGA 3TK6A 1P2MA 2WAYA 1XM1A 1D3QB 4D82A 5LPEA 1W49A 1J8AA 1PLLA 2CJWB 1FN8A 3VHXA 1ZW6A 3UMFA 3CLVA 1JIMA 2ESTE 4ARZB 5DNYB 3QENA 3V7TA 2FX3A 1NY5A 1V2LT 1T0JB 2A2QH 2RGXA 1SVKA 2CNWD 4ZHLU 4O0MA 1S82A 2ZRMA 1UVPA 1ZPBA 1T8LA 3H09A 1UEJA 2F9NA 1DITH 1ZGIA 2CL6X 4Q1BA 5DE3A 2D7DA 1NRRH 2Z83A 3OIUA 1FLEE 4Q4AA 3UNQA 5L3QB 1WV7H 3BC1A 1EPTC 1KK3A 1PQ7A 4AKGA 5EE0A 4AC9A 2QMEA 3FYHA 1SGRE 3R8FA 1G3RA 4K8YA 5FBWB 1Z0KA 1UEIA 4G5RA 2CV3A 3FWYA 3A1WA 1V5WA 5AJVB 5J47A 1J15A 2AD5A 5H68A 1GDNA 4KKDA 1RD3B 2VSXA 2GP9B 4TWYA 4JYUH 1NC6A 1IHUA 2A78A 3SZEA 3VR4A 2B7CA 1J8MF 3F9FA 2VINA 5E8EH 3RXFA 4DLSA 2FA9A 2VH5R 3LH5A 3E70C 3CZQA 1G3MA 3U1JB 1DDJA 3QNUA 4G5SA 1AB9C 3MUFA 2ZKSA 2SGFE 3LT3A 2A9KA 1FV9A 1N0UA 1UADA 3A4MA 3HKJB 1P2IA 5K8UA 4KJZA 1SG8B 1K9OE 1FPHH 1V2VT 2QSYA 4IOLA 3U3MA 2GCTC 1VJAU 1AZTA 2XTNA 3ZVDA 2QG6A 2P6RA 1P2TA 1CEEA 4LJ6A 1Z29A 2CLCX 2FIRH 3PQCA 1W0YH 1BOQA 4A4DA 1E35B 3M5LA 3GJ7A 3KIDU 1TNIA 4CHAC 4AYTA 3ADCA 1CXZA 4I1VA 4QHYA 1W0ZU 3PJRA 2W3KA 4YDHB 5IK2A 4R71A 1ZYOA 4DEXA 1U8AA 4CT4B 1T32A 3EPJA 2IA5A 4HDCA 1GGDC 1NN3A 3F9EA 4CBNA 1C2GA 2EQBA 4MG3A 1LVGA 4JJKA 3G82C 1XXDA 1BMFD 1Q22A 2CXXA 1W47A 3GLHE 2REXB 4ZDKA 1OXUA 4AFSA 2OILA 3L8YA 1T6NA 4LYHA 1UDXA 3HPRA 1KSJA 4OJQA 2QYIA 5T1VA 1TNLA 3RHFA 1W36B 3FGNA 4DVGA 1BHXB 3VB6A 6GCHF 1GBMA 2QN6A 2FOLA 3I92A 1NFXA 3S7HB 4C2TA 2PEZA 1COWA 3AV0B 2O8CB 1NG9A 1IQIA 1ZMNA 1F6BA 4HAVA 4V0KA 1E99A 3ZH9B 3R8CA 1KXBA 1F48A 1GHBF 2V6JA 2RHMA 1HUTH 2CF8H 1DAFA 3C27B 1CJMA 3CO5A 4BECA 1Z8FA 4BFYA 4RD0A 3N70A 3LH3A 1DVAH 3SYJA 4RD2A 3BG4B 4KTSA 4FUBA 3WYFA 2XC4A 3BEIB 1QHYA 3Q9LA 2QE7D 1TGNA 1Q31A 4U01A 3RRMA 2J92A 5HYOA 4RSGA 2GV6A 3MWYW 3NBZC 4BTIB 3ETLA 4GP7A 3A8CA 1MMJN 3HGNA 1OIWA 3VGCB 4RVCA 3RXOA 4TLDA 3WXMA 4P32A 3H2YA 2ZJ8A 4ASUA 2ODWA 1V43A 2YYZA 1E36B 1JIRA 3SU0A 5GJVC 1GZSA 4VGCC 1VITG 3CPJB 3SGBE 4B75A 1KDQB 4GOKA 2HLDA 4Q4JA 2R65A 3PVSA 4OL0A 3RVBA 2F1HA 2W58A 5JWRA 2XBYA 3FDIA 2GKSA 2QU8A 3MOCA 3ZZAA 2WPDA 1DARA 3LBIA 2GVFA 2J9RA 3QEJA 3B9PA 3VU9B 5KTYA 1ELOA 5E7JA 2J0QA 2ZETA 1P9NA 2BDYA 4ZROA 3DM5A 3IPXA 3BN9A 2AWNA 4GOXA 4EKDA 3U98H 4BQSA 2WIAA 1GCDA 2OCYC 3UPUA 1LNZA 3ONWA 4D4MA 2MSDB 2HVXA 4EAQA 3QXXA 3P32A 1BIFA 3AK5A 2P3SA 1QL8A 1GJ8B 2H17A 1DE7H 2QF0A 1MTNB 1LY1A 4NWKA 1KO4A 2PSXA 3FPAA 4I81A 1BKDR 5TXGA 1TAWA 1ELVA 1CIPA 2O9QA 5L3SA 3RXGA 3QK1A 3E2IA 1G37A 4I8LA 1T5IA 2XB4A 3MSXA 3WHLA 3MH5A 2QCYA 4HLUA 2FOCA 2DFLA 4P4UA 1AS2A 2PZEA 3CENA 1O3MA 1K1IA 1LF5A 3NHAA 4PAMA 3UMSA 1D9XA 2FH5B 4DRZA 5LD2C 1DLKB 2W0SA 4TTRA 1O2IA 2GCPA 1HAGE 2XJ4A 2SHKA 3GY4A 1B0EA 4I7YH 3E91A 2GK7A 3GJ6A 4KYUA 1U2RA 5B30A 1CR1A 3MU8A 3AKEA 3THWA 1ZAKA 4QXAA 1CRQA 4PC2A 4XDEA 1G8PA 4PC3A 5KDLA 5KSYA 1ANDA 1A3BH 2W2XA 4V03A 1R0YA 4A8JC 2A0QB 4IN2A 2A7CA 4X1SU 2Y6TA 2QE7A 1ZP6A 3NDBB 4B34A 3RU4D 1TQ2A 1YQTA 4CW7A 4PC7A 5IHPA 4IDHA 2EFDB 3IBYA 3OE7D 2RGGA 1SPJA 2ZGHA 1KK0A 4DHEA 2STAE 5LPRA 1FZZA 2HYDA 4UE7H 3T25A 1PQ5A 4LGMA 3AVXA 1UKVY 2W0MA 2C95A 2G9NA 4DB2A 2C77A 3ECCA 4DVAU 4AKEA 2PGQB 3MNCA 1NG1A 1GBIA 4E5UA 4X2WA 2SNWA 4JZIA 2HLCA 5JCPA 4HZIA 1SKYE 4IDQA 5JSZA 4DIHH 2J46A 4M1SA 1PPHE 4I8JA 1O2OA 1AUTC 4PAQA 4BAMB 3HYTA 1QHSA 1K5GA 5CIQA 1R5OA 2V9PA 1YR7A 4DUGA 2FGJA 2QGZA 5FPSA 1TONA 1DWDH 1EFUA 3LGTA 1VIYA 1NF3A 4DIEA 1O3BA 4DWJA 3ZZ4A 2X2FA 4NZYA 2FV8A 1MCTA 1DOAA 5HM2A 3SHWA 5FTLA 4US2R 1PFXC 1X6VA 1IN7A 1BMNH 4B6FA 3L6PA 3P17H 3GJ8A 4GP6A 1IQPA 1NBMA 1UTPA 3MG9A 1TX6A 2IX3A 2ZYWX 3F5FA 2ZDAH 4OQMA 4EPTA 2QSZA 3U6BA 4BNRA 2NU0E 2G83A 3PM3A 4JYTA 2FMJA 2BIFA 2VB0A 5J5CA 4CEJA 3X1ZA 2BVXH 2C2HA 4AZ2B 2O0HA 2PT5A 4CZ2A 2QEQA 2AGEX 3ICQB 2I4IA 1YR8A 1EP5A 3VGCC 1O2HA 3KKPA 3KQCA 4CRBA 3W6NA 2QPOA 2L0XA 1ZNXA 4ACAA 2IL1A 3L0PA 1FY1A 1CBWC 4Q1AA 1O36A 2XAUA 3QSYA 3MLEA 4XOIA 1BJUA 4V0MA 3KTAB 1W0JD 4FU7A 1E2EA 4ZUHA 1O2PA 1T4GA 2JLRA 3U8TH 2XX3A 4EPYA 3ATKA 1YR6A 3W5JA 2QN5T 2ZPRA 1Y8TA 1OWKA 2MMCA 4OI1A 2G3YA 1P09A 1P62B 1AFQB 1W46A 1D6JA 3T5FH 3OHMA 3LY5A 3CR8A 1O5GH 2IK8A 3VB7A 4YXWA 1WXQA 3IIJA 1ORFA 1LVOA 3EPHA 3V9PA 4D7FA 2CJIA 3BS4A 2O8EA 2BXUH 3M4YA 5CDFE 4YLGA 1E1QA 4WMDA 3SZRA 4GZMA 3TNTA 2QTFA 1X8JA 1SHHB 2TGPZ 1SGYE 1UK3A 5FBLB 3PLPA 3BIFA 1RS0A 1GVNB 2YVUA 5FR1A 1KGDA 3MWJA 5IDVA 4K3JA 2IN2A 3Q3XA 4PC6A 1QB6A 4GPTA 1GJ4H 4BTUB 1NKSA 4PZLA 5JBBS 1WE2A 3BG8A 2HJVA 2ZI2H 2VA8A 1D9IA 4B2IA 1AJEA 3ATIA 3GLGA 3GQBA 2BLOA 3HP1A 2O8BB 3FP7E 4C0LA 1XPRA 3RMOH 1TEVA 4QJ5A 4R0IA 5DP4A 1P02A 3NG1A 1TYNA 1ZC4A 4HEJA 1DAKA 2ATXA 1BTPA 1L1GA 2PTCE 1XUKA 2FM2A 1CLUA 2ZUBA 4JT4A 3M3VA 4MUBA 2TGAA 2QRZA 3ZZBA 4FUFA 1TQ4A 4Z54A 1RRPA 2EFGA 2KJQA 2VL7A 1FXYA 1WCZA 2WPDD 2WSSD 3BWDD 3I61A 3GFOA 4HATA 4XWOA 3LOXA 2BOVA 4TZ0A 2V1UA 4BAHB 1X8KA 1Z8JB 2EYUA 1ZM9A 2ZRCA 5AWFC 2IOTA 1U8YA 4HUTA 3UMRA 1C5UA 2C9OA 1II9A 1RYFA 1QRAA 1TMBH 1C4V2 1DANH 1P05A 4OS1A 3H7OA 2ZP0H 2FDAA 2NZJA 2WWXA 1UF9A 1XUJA 3KEEA 3SS8A 4HLUC 5FFMA 1OWEA 1ZM4A 1N8OC 1M7GA 1SC8U 3UPEA 1FX0A 1XZQA 3OZXA 2JJ8A 3RMMH 2Z6BD 1NRSH 2JJ2D 1TABE 1S8FA 2R2AA 5A5GA 1JBKA 3TGJE 2JJ1D 521PA 4M53A 5IDKA 5KOYA 1NBMD 2C96A 4X8MA 1O87A 2XITA 1FOEB 2C8YB 1SXJA 1OP8A 4GLYA 1H1BA 2ZFQH 2F43A 3SU2A 1ZNWA 3BTQE 1MCVA 3A81A 4RFVA 1XKAC 1DADA 5C46F 1GNRA 1FL9A 1NLZA 4S35A 1HJ8A 3GLHB 5AUOB 2GTPA 3F8TA 3CX7A 4KBGA 2C8ZB 3PO1B 4LBWA 5K8LA 2B7DH 3PWBA 2BXTH 2Z3EA 1EG7A 4LHYA 1EQ9A 1YCPM 3A1TA 3V0XA 5TARA 5EG4A 4WH6A 3SJAA 1QB9A 2Z9GA 4JLOA 5EW1H 3TQFA 2HPQH 2REOA 2UUFB 3ZZDA 2J7KA 3BFVA 3IGFA 4Y76A 2V8OA 3W9YA 1GRNA 1WF3A 4MNWA 1E9DA 2IW3A 3OY6U 1MQ5A 5F2EA 3R9IA 3CX8A 4B6EA 1GJCB 1N6NA 5BRRE 3THYA 1EJAA 2YWGA 4ESHA 3GLFA 2UWLA 1A0JA 3UG7A 2Q6DA 2JH6D 2GZDA 4QJ3A 3CZPA 4PX9A 1F5LA 1C4U2 1RE0A 1Y3XA 3F1SB 3ZIAD 5CE1A 3G01A 4IVQA 1AWFH 1PPEE 3LWNA 2IYXA 3NH6A 2ZNKH 4RJLA 1XTIA 2VVVA 3GCOA 4C2UA 1KXEA 3TR0A 4GT1A 1KI3A 3WMFA 1I2MA 3IHLA 4Z8XA 3V12A 1K8RA 3B23B 1D3TB 1MKYA 1RW4A 3RC8A 4NCKA 2F9VA 4JIMA 3MMGA 3EZ7A 1AE5A 1C2LA 4C3ZA 3D8BA 5A8ZA 4Z8YA 3RS7A 1AN1E 2WPIS 1OJLA 1HYLA 1G3CA 1JR3A 2ALPA 2CCKA 3SV8A 4Q03A 3M7TA 2AMQA 3BTKE 3T28A 1MO5A 3K65B 1W0KA 4OGXA 2GDJA 3GY3A 2VH6A 4GHTA 5EXXA 2ODBA 1KI2A 1W7XH 2P6UA 2NQ2C 1BTHH 2A5DA 2XTMA 1WQVH 3PROA 1EUFA 1YLCA 2ZRGA 1TALA 1HEIA 3BD9A 1IY0A 2VF8A 3QEOA 3SQWA 5E0JA 2VWOA 5KHOC 1E2FA 2WPKS 1BTWA 2Z7FE 4SGAE 2AD1A 3MD0A 2IEYA 4MRPA 4POAA 5LPFA 5CM9C 5F9HA 3B2EA 3SC3A 4M21A 1EATA 4QM7A 5E7MA 1AN0A 1YPJH 3KQDA 1O34A 1KJZA 3GCHB 1SGEE 3E8LA 5LBIA 2AMDA 3BG4C 2J95A 1VECA 4O3UA 1ZOMA 2GEUA 4XH9B 3VR6A 3VB4A 4QC2A 2MSEB 4AD8A 4EPRA 1HQYE 3O8CA 2IXEA 4EIWA 2P67A 3FB4A 4DLWA 4HAZA 1O2GH 1VKJA 2QTHA 1ZCBA 3FMFA 3BIVH 4FMDF 3ZD7A 3MH7A 2ANYA 1NFWA 5J4YA 1E0SA 1CP2A 2W6JA 1AVXA 1GMHF 3I3SR 1NFUA 4G5QA 1IHTH 3JZ2B 1D6WA 3FANA 2JLVA 4Q1DA 1O3YA 3SR0A 2V54A 4JZFH 5BN3A 2OC1A 4YC7A 3WP1B 3AGPA 2PR3A 2ZE6A 3QZQA 2CGAA 1ZMXA 3JVUA 4EDHA 2GA8A 4CT5A 3TJNA 2ZE7A 1EOJA 3TGIE 1US8B 5C20A 3VXFH 4C30A 4TSFA 2QA9E 3ZJYA 1PV4A 3OEHA 1C9KA 3TVTA 1GM5A 2GDEH 2FEMA 5CYPA 5FOUA 4Y8ZA 1IJEA 2P8OC 2QROA 3QPWA 1E2MA 4PTLA 2PLXA 3S9AA 2FI4E 2GRJA 3L43A 2ZPSA 1OXVA 2QF3A 1CJKC 2ZTXA 2VIVA 3BB4A 3Q7PA 1G2LA 2IJOB 2WIBA 4JLDA 4ABIA 2IC5A 4JL5A 4BLQA 3VB3A 2RA3A 3B8HA 4WXVA 1C1UH 1NVUQ 1C9PA 4C7OA 1O3GA 1BDAA 3H5CB 1JEEA 4MRVA 3E3TA 1MU8B 1Q3TA 4RD6A 1BTYA 4RZXA 1W4CA 3DT0H 1YPLH 2OINA 4D81A 3M6AA 1EZUC 5JB9S 1YF4A 4OHXA 2F1RA 2D3WA 1YZGA 3T2NA 4P4SB 4URUR 5FXLA 4W7SA 3A84A 4YT7H 1SLXB 2PJZA 3ATLA 5G40A 1W10U 1LS1A 1GCTC 1P2SA 4AKHA 4PROA 2WZQA 1LMWB 4DLVA 4NWLA 4TQAA 2ZI6A 5FCRA 2OLJA 1RC8A 3EX7C 1AKSA 2ZHQH 1TGTA 4RCZA 2W00A 2VP5A 1W11U 3M1IA 4ILEA 2FWRA 4CR5A 4P3YA 3NPSA 2BD3A 3QF7A 4WZBE 3TJUA 1KK1A 2V4ZA 5J4HA 1LV7A 1ELCA 1BTZA 3OAAA 2XXAA 1P6XA 2OTVA 2IWRA 2ZECA 5B2ZA 2ODPA 1YGCH 1Z6GA 4DOQA 7GCHG 3X1YA 4EJSA 2XNDD 2ZEJA 3P8GA 5CIWA 1F7ZA 4WA7A 2GZ7A 4FIDA 4X1QU 5ANRB 1TB6H 5G3YA 3SBDA 5FAHA 3LJJA 2QAAA 2GF9A 2VO1A 2CN0H 4M2LA 1K5DA 2F9OA 2ZCLP 3NXSA 2AFIE 2ODYB 1K21H 1A0HB 2R0KA 3QXSA 4A1FA 3ASYA 4FCTA 5IRCD 2KAIB 1FMJA 5D3QA 2EYQA 1UTMA 5E7IA 3PLKA 1GHAF 1R7RA 2QQEA 4B2AA 2SGDE 3F6UH 2QPTA 1KI1A 3L0IB 4KVGA 3ATWA 4MNVA 3DHWC 1PYTC 4DCVA 1MTNC 4CEJB 1W3CA 2K5UA 2D2DA 4YZUA 2V6IA 1ZSKA 1KY9A 3WNBA 2AGIX 3QUMP 2OBNA 5BYJA 4IS5A 1YRBA 1JJVA 1LF0A 4OQXA 1QFKH 1IN5A 3SJKA 3QQ5A 4Y0YE 3VFDA 1EPTB 3CF0A 4MYUA 1OWHA 1AD8H 1RTFB 3U60B 5C5NA 4X6OA 4AFQA 2QXJA 1NROH 1IN6A 1MO4A 2XTZA 3SUFA 3B78A 1P10A 1GL9B 4TN1A 5AUPB 4KFSA 1ZHMA 2AHOA 2A7JA 1T5LA 1QZXA 3GLIE 2OXRA 3U5ZB 2ZU0C 1RJ9B 1BBRH 3VNVA 3T34A 4UONA 3MTYA 4XBDA 3F9GA 1G7RA 1Y59T 2ZGCA 1OFIA 4HDQB 2XC5A 5C1YA 5F8ZA 3DPUA 5AJYA 3F0TA 2QP9X 1G3IA 1O2TA 3C4JA 1SGCA 1V2NT 5KSZA 1Z22A 2R3UA 4TTPA 5FOVA 2CHVA 3Q77A 4KVAA 1YPHC 1U9IA 2ORWA 9ESTA 4AI6A 4XD7D 2E87A 4Y8YA 3D62A 4U5XA 2F9PA 2F6RA 4AG5A 4AYYB 3M35A 4BAOB 1GILA 3B9FH 2AH4X 5FPYA 1OFTA 2QENA 3GDVA 4M7GA 1D2MA 4KELA 4AFUA 4O97A 1OLOA 1IAQA 4ISNA 5JI3E 2ZFTA 1QDEA 2GNOA 1JNYA 1G9XA 1N6PA 1ZIPA 4BZQA 4TYNA 2VGCB 1CKEA 1Q44A 1CGHA 3ZIAA 2QAGC 2JA1A 4NCIA 1VG0B 3OU0A 1TPSA 1Q1BA 1SQOA 2BQWB 1GBLA 1L2EA 1EKBB 4MKHA 1TU3A 2O8DB 1V2TT 4X8UH 1P06A 4A15A 1EFRD 1G21E 2D7CA 1Q1ZA 4NA9H 2OC0A 3RSLA 2ZUDA 3ZD6A 1U99A 2FI5E 3OE7A 3D23A 5JI2E 2XWAA 3AF2A 1E2DA 3RXDA 1OSSA 2UUJB 1KNQA 1P03A 1XEWX 4PPQA 1XRJA 1GIAA 1LTQA 1IXSB 2RCEA 3WRXC 4D0LB 1G19A 1H9IE 2QY9A 2W2VA 2J0UA 3K0FB 2BD9A 3PTNA 1GMCF 2DBYA 4OI0A 4WXRA 4R9UC 4YLUA 1N5IA 2Z4SA 1SXJD 2RH5A 4ZKDA 2EFHB 3RS5A 3AM1A 1HXFH 3LX5A 1AM4D 1EFTA 2FLBH 3PB1E 4GDFA 4MPUA 1YKTA 3BB3A 1RGQA 3CNLA 1U0JA 2GAAA 2JJ2A 1J14A 1S2MA 4EPXA 1YZNA 1UFQA 2H9EH 1QF9A 3PMBB 1P4SA 1O3KA 1FUUA 4ZHMU 4Q4HA 2HALA 1A7JA 3G0HA 2Y80A 1BTUA 2DY1A 4F92B 2KBFA 5AK0A 2BYAX 2WM9B 4K5ZA 2KI5A 5TMPA 2AXPA 2OBQA 4HZUA 4JK5A 1JPJA 1KMQA 3B85A 2VHJA 1E9SA 1TAGA 2A5AA 4HAXA 1O2KA 5DJ7A 4TT3D 2DYKA 4BFVA 3CRW1 1S84A 2R62A 5EODA 4XWKA 1JQLB 5AFZH 2I3BA 2GD4B 4C0SA 1ZUHA 4BRUA 4GSYA 3UKDA 5EXSA 3HU1A 2VBCA 4DIDA 1Z7KA 2IS1A 4LWZA 2BY8X 3PMAB 2IS2A 1Z83A 4PQRA 4DW2U 3ZYDA 3OIWA 5B6OA 4Y6DA 1FNMA 3DO6A 3A7VA 2QV1A 1ABIH 2IYLD 3B1ZA 1KO8A 2J0VA 4KODA 2GVDC 3SU3A 1E37B 4BOHA 1W0JA 4W5HA 6LPRA 3RXQA 3W95A 4B76A 1J2JA 1KO5A 3P1JA 4E22A 2ZTSA 2X19A 2ZROA 3EIEA 3UK6A 3A4NA 2ZRLA 1QURH 4CDGA 3SV6A 1N3BA 1GHBG 2FFHA 3EWSA 3VNUA 3UATA 2O8CA 5DKMA 2HXSA 1YP9A 3IIMA 1Z6JH 4IDPA 1C5NH 2F3TA 2DR3A 3HYRA 2BMGB 2VYFA 3THYB 1TUIA 4HSEA 5JCZA 3D31A 3TW4A 4NMMA 2A5IA 1PPFE 3AKDA 2J7PD 1N6XA 4TMZA 2PLRA 4PZZA 1G16A 4GI7A 2ZI3A 3BXZA 2CL0X 2OUKA 1CBWB 3MO3A 2IHBA 4D4JA 4ON9A 1THPB 2CJWA 4W5WA 1U98A 5L3RA 1IQGA 3SU6A 4QHTA 1OV4A 2NGRA 4M1WA 2BY5X 4MKFA 2ZJ5A 4Q48A 1QHNA 1ZRBA 2FOMB 3AGQA 3GY5A 4X1RU 3EASA 5KSPA 2XW9A 4ZMAH 1JPNA 2FU5C 4INKA 4BLTA 4OM9A 2J5XA 1O38A 2J1LA 1SVLA 621PA 1C1RA 4HLDA 5IYTA 3SUDA 1KXAA 4Q01A 1DO0A 1QCPA 2R6FA 2P59A 1MKWK 1E79D 1DT2A 2CNWA 1HIAA 1HAXB 1XD9A 1F5RA 2ZVPX 5J4SA 3ZYCA 3K1JA 2YNBA 5A0AE 2BJVA 1O5BB 4CRGA 4FMCB 4TPYA 3EDXB 2P8OB 1D3DB 2JDID 4AN7A 3L2OB 1M74A 1O35A 2GT8A 3MU1A 4UNRA 4CVNA 3GJ4A 1UKZA 3SU1A 4KSBA 2ZRHA 2R8RA 3ZZ5A 1MAXA 1O5FH 1CT2E 4H42U 4BTTB 2ZJBA 1NFYA 2C99A 5T6GA 4H6TA 2IYZA 4Y7BA 3RXKA 3D49H 5JPMH 3KKMA 2GVZC 2W6IA 3K0FA 1GJ6A 2F7SA 3U44A 5CHAC 2TGTA 5TY0A 3U3OA 3KJEA 2R6CA 3KDSE 2W5EA 1E79A 2WOOA 2CCJA 3X2SA 1ELEE 4U30A 2Q9AA 4IBLH 5HTKA 1ZUNB 5K7RA 5FL7D 4OHWA 2Y7ZA 1ZHRA 2DWQA 1WUNH 2SGQE 2VIDA 1Q20A 1UTOA 1SI5H 3GLGE 3PG5A 2BDAA 1FI8A 4TT3A 3FFBA 2FO9A 3AAVA 5FBIA 2G6BA 2P93A 1XCMA 4ZIRA 3A80A 1UPTA 3KJHA 2OAP1 4NYIQ 1C5YB 1X1RA 3P8FA 2BY7X 1VYVA 3ZYEA 1R6BX 3L8ZA 2AYWA 1UTLM 1SVSA 1Y5UT 4NZLA 2MMGA 3OY5U 3S9BA 2QGRA 4ZKRU 2VGCC 1BRCE 5FUWA 2BDBA 2G4TA 2QY0B 2PX3A 1AVGH 4I8KA 4MTBA 4FUJA 3SOPA 1KTVA 2WWYA 4NIWA 4A6PA 1AMHA 3DMDA 3KB1A 1J9CH 1BT7A 1Y5AT 1S3GA 1UBEA 2JCSA 1IONA 2BKEA 5DGXA 1ANEA 3Q3YA 2YKGA 1A82A 1OSNA 2DFTA 1Z0DA 2VP0A 1E6CA 2FOGA 2QA5A 2UKDA 3LA6A 1AQUA 5E2OA 3EWAA 2WSSA 2FOHA 2QM8A 3SNBA 4H6SB 4IXMA 1QBNA 2XB2A 3EZ6A 4TY6A 4X2YA 1IQNA 2OC8A 3A37A 4TQ9A 4OS4A 2HNTE 2BBOA 5KUTA 3LX8A 5LGOA 2BX3A 3S69A 3LW7A 3SYLA 2WTUA 4ZCIA 3UXMA 4NSVA 3CWQA 3PWCA 2VHTA 5L2YH 2G88A 2XCNA 2BY6X 2YWHA 4BLSA 4B2BA 2R6AA 5JWHA 3IKJA 1NN0A 5EP1A 2WINI 1P2NA 1E69A 5LB4A 2N1BA 3UR6A 4DLXA 1XEWY 1OH5A 1BYIA 1TX4B 2A32A 3K53A 2ZRFA 3TRFA 1UTJA 2P5SA 1GBCA 3ZLJA 4JLKA 1D8TA 4B3BA 1JMOH 2IWHA 5AJZA 3ZZ6A 2V3OH 1VG8A 1PPBH 2HNTF 2QC2A 4JBWA 2GK6A 2PWXA 3U6KA 1SB1H 4DLRA 3SJBA 1N6HA 2ZYTX 2B8WA 4A5TS 1KK2A 1OFHA 2BLVA 5E95A 4ABAA 4SGBE 2X2EA 2B7BA 2ZJ2A 1TL7C 4X2XA 4D76A 2VVUA 2G00A 2O8UA 2C4FH 2HCBA 5BPEA 3LGWA 3ZZ8A 4WZAE 2J41A 5EXLA 1HT1E 1XJCA 4ZDJA 2BOKA 3S9CA 1CT4E 3MNSA 1ZD9A 2O8TA 1U0HC 5AJXA 2WUBA 2F43B 5C4GB 1WQ1R 2HYIC 1OIVA 1YPEH 1QHHA 1S1MA 3QX5H 3I8SA 5FL3A 3D3QA 3SQEE 4DG4A 4D8NA 2BD8A 4Q7KA 1NRPH 1WBGB 5HMAA 2RA0A 3GCGA 2G51A 1O5CB 5F9FA 1XP8A 4NCYA 3LXRA 1TRYA 2BY9X 1V2WT 4OKSA 1FQJA 1SGNE 3AP1A 3A7TA 5L3VA 3UQVA 3MHWU 1ZR0A 4HI3A 2F3RA 3KXLA 2BHGA 2BB4A 3TBKA 1T8NA 3CR7A 4F91B 1II8B 2ZRKA 1SULA 3ZQJA 1R4AA 4K46A 3MCAA 2ORIA 1O3JA 3OEHD 2OV2A 5A8XA 1YCPK 3QBVA 2CHGA 4XFQA 2BTCE 4EFMA 1NTPA 5H70A 3M7UA 3FKSD 4IW4E 4W9MC 1GVZA 2Q0HA 2GJKA 4CEHB 3CP7A 4K81B 4IVPA 1WMSA 3LBHA 1IN8A 3UWIA 4IFBA 2FJUA 3MFJA 3BTDE 2C78A 1C4OA 1C2KA 4DEYA 1YJ5A 3CIOA 3GOVB 1E98A 2BV3A 4ZHAA 1ANKA 4L16A 4DLUA 1NJFA 3SE0A 2OBMA 4OBEA 6Q21A 1S5SA 2VIQA 3P27A 3OFNA 2NZ8A 1OYQA 5T3HA 4ESVA 1GKIA 5F8TA 1A61H 4TLCA 2JATA 5FOXA 3VR2A 5EU8A 3RANA 1XMNB 1BITA 4XD7A 1SVPA 2OK5A 1PVOA 3EE0B 3AKCA 1GSIA 2O8LA 4AKIA 2GZAA 4GBMA 4TQUS 2Z9JA 1TRMA 2IHYA 1BMFA 3QLPH 1IBRA 3K09C 1P60A 1DUEA 4TPIZ 4MQAA 3B1YA 2WKRA 3BGWA 4TYDA 2UZ3A 5DGJA 3RXUA 4ABEA 1XD2B 2XOKA 1AA9A 4TL6A 4GFDA 2PJRA 1DG3A 3N2EA 2BD4A 1VG9B 4DSUA 1MD7A 5M04A 3FTQA 3QKRB 3HU2A 4GHQA 1Y5BT 4NSYA 1HUQA 4M1MA 2ZSDA 2XYAA 1F60A 4Z1MD 2IS4A 1R10A 1DG1G 4JZKA 3PFIA 4OQNA 4TLEA 4ZXXH 4IN1A 1S6FA 2PKAB 1HA3A 1W44A 1E9FA 3PV0A 5SGAE 4QRHA 3IEVA 1HB0B 3GCTF 4LJAA 3THXB 1DX5M 1T7CA 3CPEA 2XC0A 3DFLA 3TGPA 4QJ4A 3SN6A 1GHXH 1P2OA 1LB1B 4NONA 3W8RA 2FYQA 4OS6A 3O8RA 4FI3C 4HZUB 3B8JA 2H5EA 5JMTA 1HAVB 3KXKA 4XE4A 3RS0A 2BJWA 3VU9A 3QWCH 1L7VC 4F93B 1VGCC 2PHBA 4CIDA 1G7TA 1FFHA 2J2UA 4C7OB 2A7QA 1C5QA 3FMIA 2RAPA 2WV9A 2ZFFH 3EW9A 2EI8A 1EX3A 4D4LA 4OK3A 2Z9KA 4F4OC 1SMFE 3RMLH 5KPDA 4YTAA 1JAIA 2TIOA 1NT1A 1BQYA 4DB4A 1G41A 2EEKA 1NIPA 1GDUA 1XB2A 3M3SA 4MA4A 1P0SH 4KP0A 1DFPA 3SGQE 5BQ5A 3D7MA 1RRGA 3AVYA 1GBDA 1M1YE 4PHHA 1CS4C 1V2ST 1THSH 1HJAB 4AYVB 1P57B 1GL0E 1DWCH 3RXSA 3LVQE 4GMXA 2HF9A 2CVFA 3KGPA 1O2MA 3CX6A 2ANWA 1CHGA 2ANBA 3RDZA 4UQOA 4M9SA 1PJPA 3F3YA 1RRKA 1GMHG 3C7KA 3PTBA 3SORA 1ZU5A 4RD4A 2GXQA 1V2JT 5FUXA 4TYQA 1BHXF 1QBKC 1YM0A 1IQEA 3SYKA 1SGIB 2ZJOA 1KJWA 1CRPA 3WYAA 1HYQA 3I8XA 2FZLA 4IC6A 2Y5FA 1FPCH 1AKEA 2CMKA 5EPNA 3QPUA 4UXIA 3K9HA 3KZ1E 1GJ5H 1CJVC 1F0TA 4QM6A 1MTVA 4URXR 2D2EA 3HATH 2AERH 4B3GA 2F83A 3TVJB 2Y81A 1E4VA 3LO5A 3TU7H 1BRUP 3P20A 4Q00A 3LBNA 2ZI9A 1DO2A 4Q4JB 1H4WA 1UTNA 2ZRDA 4DLTA 1RIWC 3NEJA 1FUKA 1L1NA 1BB0B 4WY3A 2WWFA 1B23P 3W34A 2ZIAA 4F38A 5L3QA 1F0UA 1J99A 1KY2A 3RLWH 5BW8A 3AVQA 4KFUA 1OP0A 2FTMA 5JJLA 1JR3E 1GITA 5DN6D 3GICB 2FPMA 1SKQA 1OOKB 2PKSB 3MU0A 1N0VC 4TLBA 4FUIA 3SI4H 2B0FA 4ABHA 2IF0A 3PYHA 1XTRA 2P0EA 1OKXA 2FOFA 3BTME 2QAGA 2GDDA 4JVNA 3S7KB 1YZKA 1HY3A 5CITA 4U00A 2LPRA 4NPHA 2VIWA 1CU1A 1IOEA 1XXHA 2HEIA 4HAUA 2G0NA 1N5JA 1DPOA 3PR1A 3AUXA 4U02A 3TAUA 1CT0E 4NCNA 1COWD 1K22H 1W7AA 3SJ9A 2KBEA 1GL7A 3B82A 1GL6A 1W5SA 2LCFA 5EXNA 2ULLA 2FFBA 3P8NA 1LHDH 1SQAA 4HZHA 1P9UA 3T61A 3HKIB 5CK5A 3TSZA 3TLXA 4W5JA 1BA8B 1BO6A 3KQEA 2SGPE 3K9NA 4BZPA 3LQRA 1QHIA 1Z08A 1TQDA 1K1OA 5G3ZA 4O2RA 1KIMA 3U44B 4BFSA 4FUHA 1WAYB 1P2QA 3WNCA 1HH4A 1M8PA 3RRZA 1DLEA 2ZGBH 4EFNA 2PEYA 1OIXA 2FG5A 1G3BA 3RXBA 5EUMA 2GKVE 4C0AC 3E1SA 2NPFA 1GJ9B 4F4IA 3QF4B 4QFMA 1BH2A 4JKIA 4WMEA 1YE8A 3FZDA 2A2ZA 1W48A 2FGKA 1X8LA 3ZVAA 5JWOA 1FIZA 2QORA 4A0GA 2O52A 4BASA 2ZIQH 3EG5A 3WHKA 1GFIA 1K6MA 2F4LA 2DB3A 4KTCA 2AN9A 1BUIA 1ESMA 4C0BA 1Z06A 1XD2A 1P2UA 1Q21A 1LPZB 3GJ5A 4OGYA 2H16A 1O2LA 1QG4A 3EGKH 1KMHA 2FYRA 4Q7XA 1VIAA 5BN5A 4ZIRB 1UAAA 3AVUA 8LPRA 3LD9A 4XOJA 3F68H 1ZC3A 1GL1A 2FZZA 3L82B 3VTKA 5SZHB 4JL8A 3FKQA 1C1SA 3PXGA 4ABBA 4HYYA 3A4LA 5JEDA 2C3SA 3TIUA 4RKFA 2CCGA 3CW2A 4K8BA 1YRAA 4LPKA 1W4AA 2ZM5A 5CDFA 1E2HA 5I25A 5C2ZA 2GF0A 3LDXH 1XUGA 3T5DA 1O5AB 2ZSAA 3T35A 5JHGB 4AX9H 2NO7A 1GI5A 1O0DH 4FUEA 1GPZA 1TOCB 1C2EA 1DS6A 2ZQ1A 2OEPA 1CO7E 4G3XA 1TGSZ 1PJRA 1TNKA 3NXPA 2NO6A 5EP4A 4JMPA 4B32A 1TFXA 5G4BA 2PKAA 4QGFA 2PMKA 2GCHG 3Q3KA 2OFXA 4X1NU 3KKOA 1A5TA 3A8BA 1G36A 3QKSA 2XZOA 3GEEA 2RGAA 1MOZA 1QVRA 2IYWA 4UNPA 1KTSB 2GBLC 2PH1A 4PSKA 1G3QA 4Q4LA 2O0KA 2J0SA 3R3GB 1JXPA 2ZU3A 3TNFA 2BVSH 2BEKA 1RIWB 2CHAB 2PGBB 1VPLA 4ZXYH 1O30A 1XPUA 1HCGA 4KGAA 1YZTA 1Z0IA 4ERNA 3JZ1B 3TQCA 1EP6A 4M9QA 3TJZA 1C5WB 3PV4A 3BTFE 4DCTA 1ZMLA 3AF0A 5DP3A 4Q18A 1EXMA 3P70B 3IQWA 5E2PA 3ICEA 1N6KA 1SZPA 2PZGA 4R98A 4MRSA 5F8XA 5KDDA 3GLFB 5DI3A 1B7XB 4FVDA 3BJIC 1OH6A 3JZMA 3TMKA 1ESBA 3B6EA 1ZD1A 3QKSB 1TX7A 4A0RA 1Z8IB 1N8OB 4AURA 4BWYA 4OI2A 4V0ME 2IUTA 2F9BH 2D74A 1JALA 4U7DA 1I4TD 4INHA 3A88A 1C5VA 1UJ1A 2FDCA 1O3IA 1WOFA 4DKXA 1UKYA 4Q4AB 3Q8XB 3ZGXA 2C93B 3ND9A 4D80A 2P95A 1MABB 3PMHB 3LFUA 3EARA 4X1PU 3AVOA 2ZGXH 2BCJQ 1Q1QA 4X8OA 3PEYA 4AG6A 2C04A 2SFAA 1GJAB 3FHOA 3TH3H 2PKSC 4MYTA 1PPGE 4P4TA 4GOJA 1GI9B 2ZU1A 3J81k 4A9AA 5KNBA 2WV4A 1WA5A 3RC3A 3RWOA 1GHAG 2IF2A 1JXMA 4QNMA 1EAXA 1GI1A 3OEEA 1MKWH 1QRXA 3SZNA 4QL3A 1GAJA 4RZ3A 2J7PA 3KQUA 1LKBA 4LXBH 3RXVA 1OT3A 2JLUA 3UREA 5LPNA 1XBTA 3IWMA 4BXSA 1WXRA 1AGJA 2ZYUX 4X0WU 4RZ2A 1TQ7B 2BKUA 2H5DA 3LPRA 4XBBA 2ODQA 1KI7A 5DLQC 1VYTA 4FUGA 4CRFA 1GKYA 1ACBE 1MTWA 2H2ZA 1GMDG 4F4JA 3BRWD 3BH6A 3DZ8A 1DPFA 5EE5B 4B33A 1GRRA 2YC2C 2HGTH 1JB1A 2O8EB 1KYNA 1IQHA 1DSTA 3U7HB 3ZS9A 1WBDA 3H1TA 1OB2A 1WU1A 4BFXA 4OK5A 3M36A 1RXPA 4J2YB 2CHAC 2IS6A 4Q7JB 1VYUA 4JVLA 5CB8A 2ZCHP 4ACBA 1ARBA 2PTNA 2P5TB 1V2RT 1FZQA 5EP2A 3I77A 2A5GA 1VCWA 1UHBB 2IYYA 3CS0A 4WH8A 3RU4T 1O3AA 5FBRB 5DP7A 1NMYA 1QBVH 2WJHA 1IY2A 4JKYA 1UDWA 1FNNA 4B43A 4WXIA 2W2TA 4HB3A 1NP6A 2A2XH 1HV8A 3OESA 1UM8A 3QKTA 1B0UA 1YPGH 1O2JA 3V00A 1UK2A 4A2WA 4OQLA 3K6YA 1PLKA 1S9DA 1XCPA 4OS2A 4THNH 1XUIA 2XZPA 1Z63A 3ODDA 1P8VC 2XJ9A 2QAJA 1MKXH 1SQTA 1VITF 1TBQH 2WYJA 4V02A 4Y11E 2ZCKP 1XDBA 4LK2A 2D1JA 2ZGJA 2ZS8A 2WHXA 1H8ED 3EZFA 3PEWA 1ZIOA 6ESTA 4TMVA 1YPKH 4M9XA 1TBZH 1GNPA 1ETSH 4Q21A 4HTCH 3RXRA 2LKDA 4HLQB 4RFSA 3B1WA 4TMTA 2GCOA 3IITA 2H5CA 2GTBA 1TOMH 2OESA 1C1PA 3EA7A 4PQFA 2OHFA 1FX0B 5ESBA 2G5VA 5D3MB 2J59A 1TNDA 2O8WA 2BHRA 1JAHA 2JLWA 2C8WB 2IYSA 1FY5A 2Y5HA 3GISB 3RAPR 4D26A 2BMEA 1GJDB 3GDUA 2Q9CA 3BE4A 1EESA 3LQQA 1DWEH 2ANKH 2AGGX 4Q1CA 1C2JA 3K0AB 5HPYB 4YMWA 2PT7A 3A82A 4X6MA 1OXTA 4LHVA 3DL0A 5EQTA 1EWQA 3ZZUA 3T06B 3PUWA 4IRUB 4PPFA 3ZV8A 1E2IA 1NMXA 2ZA5A 3RC4A 1LO6A 5KNDA 1NRNH 1KDTA 1XTQA 4MPXA 3NVAA 2JETC 2Z3DA 1T8UA 1XF9A 5DI9A 1IQLA 5DYIA 1DY9A 4NBSA 1V2QT 4EPWA 4PFSA 4PXAA 1M7HA 5SZIA 2G81E 1KO1A 3CNNA 3I32A 2R44A 5EZ5A 3IPYA 1ZU4A 1EXFA 4BPBA 4JZEH 3GCTG 1NZQH 2BM0A 1GBFA 5EW2H 2FI3E 1HLTH 2A5FA 1E1RA 3RXEA 1CULC 4LBZA 1RTLA 4XIGS 1L2TA 3EIHA 1S9HA 2XRCA 5JHHB 2SGEE 4R2HA 4DBLC 3QO6A 1XUFA 1HAOH 4A1XA 2GWHA 4RY2A 4CBOA 5GJWC 2P2LA 2JDIA 4LHWA 1S0UA 3SUEA 3R7WA 4ABGA 1HV7A 3REGA 2RMKA 1FUJA 1Z1JA 3VXEH 1LHEH 5EE3A 4HI0E 3FMOB 3QXHA 1Q0UA 3SW2B 3TH5A 1NLFA 2YJTD 4ABYA 2A4GA 1PZNA 4Q7MB 1T3SA 3GLFE 1Y3AA 3A1UA 5F98A 4IOJA 3U7FB 2ZU4A 1T0HB 4KFTA 5DO9A 2ASEA 1C5MD 3D65E 2H7VA 2JLQA 3RS4A 3BTEE 1CE5A 1GBHA 4NKRA 1S6HA 5EXMA 3Q3JB 2FE4A 1KDPA 3LW8A 1P2VA 3M61U 3GY6A 4UFDH 3EPLA 4TWZA 5TV2A 1DAGA 3KQNA 1R5BA 2HXYA 2WPMS 1G7CA 1QHHB 3T15A 3MU5A 3ZVFA 3S0NA 4V0NA 3LC5A 3CRRA 4JSTA 1KSNA 3UNSA 1K1JA 1A2CH 1DAHA 2FZ4A 2AEIH 1AY6H 3TIFA 1GHVH 2DWPA 4V0OA 1C4Y2 3KUCA 3UFAA 4BXWA 1RFLA 1H9LB 4DDVA 1V2PT 3QXJA 3RRNA 2FN4A 2G5NA 1G4AE 3MNXA 2VIOA 5L2ZH 3TSWA 1JI0A 4NDZA 1G7SA 3SV2H 3AH8A 2AXNA 2RCNA 4O3TA 1C2IA 5TB5A 3DMNA 1YPHE 2ZEBA 3GP8A 1OHHD 4E05H 4JLJA 4B3DA 3QZRA 3EPKA 4GVUA 1G2MA 5J4VA 4DDWA 1CTQA 4MDSA 2KE5A 1UTKA 1NNEA 1F0RA 4D7GA 1P12E 2ZRIA 1BYUA 3A6PC 2VP4A 4GCHG 4V0LA 1MV5A 2WJJA 3KCGH 1UKEA 1KIGH 3BV9B 5IF9A 4GZLA 1CA8B 1I4DD 4ZKNU 4D0GA 5HKKD 1F92A 2V3CC 1OKKD 3TJVA 2NU1E 2QL6A 5BN4A 1DXWA 3NBXX 3AF3A 4ISOA 4OS7A 1MT0A 2ASUB 1GTVA 1I2DA 4A82A 3GYLB 1O3CA 3KB2A 1CHOF 3MGCA 3STIA 1E1RD 4BRWA 5SZKB 5FI0B 1G64A 1TNHA 1W7GH 1BRBE 3AP3A 4WOPA 4AWXA 1O2RA 2IJD1 3ITIA 1G20E 3KKQA 3ZVEA 1BBRK 1FAKH 4YQFA 3Q5EA 4DCSA 2HRVA 3PV5A 1LHCH 5FPTA 2J38A 3M7QA 4I32A 4ZCLA 2ZRPA 3RC5A 1KNXA 2EC9H 1PPCE 3AUYA 1X3SA 3W6PA 4Q47A 1AZSC 1GDDA 3FAOA 1LFDB 1ARCA 4ABDA 4PO8A 4TMWA 3PUZA 3U69H 4IDOA 4PHFA 2GV7A 821PA 1OWIA 2BDGA 1UK4A 5CJ2A 3VKHA 5IK2D 2ZC9H 1AKSB 1A46H 4AB9A 2VHQA 2BM1A 4MNYA 1MAYA 1EB1H 1A5GH 5FBEA 2ZI7A 1G5RA 4QGAA 4IEIA 1LKAA 4IC5A 5K8TA 2R6GA 1N6IA 2N46A 2WKQA 4LJ7A 2CXVA 5C4MA 1GDQA 1F2TB 4C0JA 4AG1A 1OYYA 3QG1A 1SOZA 3PMJA 5FTKA 1O37A 3KUDA 1R0WA 1NVVQ 3ADBA 5TDHA 1SFIA 4B35A 4FUCA 1LVMA 1Y3VA 5K0HA 1QQUA 2AS9A 2OCBA 4A6LA 2ZSFA 1E9AA 1VCMA 1DAMA 2ZS7A 3SNAA 4Q02A 4MNXA 2VSOA 1C5RA 1P5ZB 5L6NH 1OXSC 4NTZA 1OW3B 2HPPH 4L4UA 1ZJKA 2ZITA 3AQ4A 3CONA 1HT2E 3P95A 1IQKA 4H4FA 1U0LA 1E2QA 1NY6A 1N2CE 1AWHB 1ETUA 4X8HA 4TSFD 4MKIA 1J7KA 1GMCG 3ESTA 2ZJYA 2CLDX 4DZZA 2SGAA 2QGNA 2ZS9A 3VHLB 2BX4A 1G8HA 4G01B 1C1YA 3QE0A 3HK6B 2VP2A 1ZMJA 4O03A 2ODNA 1Z6EA 5J4KA 5E0GA 4B2LA 1XEFA 3C1KA 1KXCA 2YZ2A 2VRWA 2O8FA 3CUEF 4BEJA 2A3RA 3K0SA 1ELBA 4UFGH 1IQFA 2GEDA 4QOSA 4NP6A 1V2OT 3IUYA 1S4QA 1D6RA 2FPLA 4TL9A 721PA 2XBXA 5GJ4B 2GXAA 2J94A 2O8FB 4C0KA 1ZYUA 2XSZA 4B71A 1QQ4A 1IQJA 5EP3A 5KO2A 5EJEA 2BQ7B 4JS0A 3M0EA 1FJSA 1BBRE 4S2EA 1IOZA 2TGDA 4ESTE 1YU9A 2W3IA 4QBFA 1DXPA 1KYIA 2H92A 3VFEA 4A0FA 2YOLA 2GT7A 1E9CA 1EB2A 1T4VH 2NWNA 4WJG2 2VQSA 2B8TA 3PUYA 4HAWA 4IXNA 4WF8A 2FPZA 3ZZTA 2H8KA 3VR5A 1AIPA 2VWNA 1ZM7A 4UJ5A 4B1TA 1K2I1 1U8ZA 2QBYA 5EUQB 2F91A 2QZ4A 3EZ9A 2M5TA 4BFWA 3EYDA 4EQ6B 2BOHB 4LJYA 4Q7ZA 8ESTE 4KBFA 1E9EA 2ZSBA 4YONB 3RXHA 1P2JA 1AKYA 1S3SA 2C03A 3CRMA 1YKSA 2ATVA 1Z1IA 4DY7B 2ZWLH 4LZ4B 1B5GH 1NVWQ 3HR7A 2OLKA 4GUXA 4HUQB 4QBGB 4JLVA 2PV9B 2QXIA 1NESE 4YM9A 1C1NA 1W12U 1PQAA 1ZSLA 1XTKA 4AFZA 1N1LA 2R2MB 3SBEA 3HK3B 4YXWD 1S81A 1CJUC 4CEIB 3B1VA 4DIIH 2RGBA 2XZLA 2VWMA 1Z6AA 3C8UA 5P21A 3TUJC 3ASZA 2R0LA 1CF4A 1GI0A 2BMFA 3JZAA 3BBPA 3UWJH 1SHKA 2H9TH 1XJ0A 1W0KD 4Z0KA 1R2QA 1Z47A 4Y8XA 2ZR0A 4ISLA 4DCUA 1P2KA 1ANBA 4PR0A 2BLQA 3MH6A 3E0NB 3NHBA 3E5HA 1E32A 1TX8A 1NPMA 4PPGA 1LDTT 3QY0A 3AEZA 3N2IA 3TITA 3L33A 5JRJA 4X8VH 1A3EH 2REBA 2R6DA 2Q9BA 4IOMA 5G41A 4QT8C 1TNJA 2Y7XA 3LGYA 5TVKA 1CJTC 4OQFA 1W36C 3K09A 4OHVA 1CGJE 2FSHA 1G30B 3I29A 1XMVA 4KU4A 1O3LA 3OYPA 1XX6A 1YYY1 4JYCA 4DSTA 1J8YF 4BE7B 1FONA 2D4HA 2EI7A 3KTAA 5CLLA 2WJGA 2O8DA 1NVXQ 2OXSA 1SVMA 1EWRA 3BAFA 2ZG0H 4K1SA 1OS8A 3EAJA 1AUJA 1VCNA 2VP6A 2ZR9A 5C3NA 1GMDF 4XTCS 3KNXA 4RD1A 4X8TH 1P3JA 1RKBA 3A8DA 4K8OA 1C5LH 4C0HA 1D2NA 2NIPA 4H1VA 3TPIZ 2AK2A 1K1NA 1AVWA 2UUYA 1DAEA 1Z2AA 2DUCA 3QF4A 2E1RA 4YMSA 1D9ZA 1KI6A 421PA 1JQJC 3SHCH 1LHGH 1AS0A 3K0AA 2PLFA 4YMTA 4MLFB 1GVKB 3QTOH 2UZIR 1EAWA 1BTXA 5ABWA 9LPRA 4LSGA 4WWYA 2V7QD 1D4PB 4VGCB 3SU8A 3WMGA 4ZCMA 4M8NE 1L4ZA 1CGIE 3H7TA 4BGDA 3KJGA 3T1OA 1IM2A 4MQBA 3GLIA 1N5LA 2VJ1A 1C2HA 1L0ZA 2WWGA 4HB2A 2JKHA 2GGVB 3U8OH 1OH8A 3U1IB 3P4XA 1ZD8A 2CLSA 4FINA 3N5CA 1TBRH 1ZNZA 2YOGA 4GL2A 4FWIB 1ETRH 1IXZA 4M4SA 3S1AB 5AVDA 4Q80A 2JLSA 4Q1FA 2WUCA 1SXJC 1QJ1B 5DP9A 2RHDA 3EIQA 2Y5GA 5AJWA 1FQKA 4PPNA 3A36A 4M1OA 1VZQH 4X6PA 5HCNA 1L4UA 2ANMH 1TGCA 3W6OA 3A89A 1O2SA 1ELTA 1K1PA 3ZVCA 1AQ7A 3FVFB 2WPHS 1XTSA 4NG9H 1UBCA 1GUAA 3VX4A 1ZGVA 2ODEA 2C5LA 2EU8A 3SO3A 1G6OA 3NK8A 1A7SA 2JETB 2BMJA 4EFLA 1LCYA 2OC7A 3LC3A 1DEKA 1Z3IX 1G3EA 5LD2B 2WJIA 3TAHA 5FH9A 4AGJA 3BEFB 2PCJA 2IPHA 2ZSEA 3X1XA 1SXJE 5DPAA 4FVBA 1C5OH 4TMXA 2QM7A 1C9TA 5C1XA 5A2MH 3GLHA 1UJ2A 1T8TA 5A0BA 2D2FA 3FFGA 2F9MA 3BB1A 2GXSA 3Q76A 2AL7A 2OT3B 3N7OA 5JS7A 3EA0A 2Q3HA 1YZQA 3GJ3A 1NSTA 4B3FX 2CVHA 3SQHE 1EAUA 4G1UC 1VDZA 1G18A 3KX2A 1SSXA 4UNNA 4JT2A 1RIFA 1EASA 1PYTD 3CH4B 2JGNA 1R5NA 5BYKA 3QVVA 2QT1A 1LQDB 4LHZA 1DOJA 2GCHF 1U90A 2ZHEH 1W14U 2FS8A 3GFTA 4BLRA 7LPRA 1QBOA 2RGDA 3DA9B 3MH4A 5JECA 4TYYA 2FSIA 4A6XA 4AIIA 1WTHD 3QGNB 1ZLRA 3I72A 3UWOA 1KHTA 4LUCA 4LHXA 5FBVB 4NGAH 4BLPA 5TCCA 4PHTA 1QY6A 2XNIA 5JFGA 2PW8H 1MH1A 1VCIA 2G55A 4LC0A 4O25A 2GXUA 4LK4A 3E90B 4CGZA 2TPIZ 2YNMA 3QKRA 4A8JB 4QKQA 1ELAA 1M34E 1RYHA 1XTJA 3SN8A 1IN4A 4WW0A 2I1QA 1CR0A 2F9LA 4P31A 4NA8A 4E7NA 1KI4A 3NKKA 1TPZA 2FEOA 3H86A 4AK9A 1P3EA 3PO1C 3AW1A 2QP4A 4FMCF 2V0BA 3SEAA 3A83A 1GHYH 1OWDA 1Q1EA 1NRQH 3KQHA 5GCHG 3KL6A 1XWIA 2HT1A 1P11E 4AYWA 1OE0A 2PUXB 3EAQA 1SR5C 1MO3A 1G3DA 2YWFA 3QVUA 1H8HD 3P4YA 4Q9IA 5GJBA 1HURA 4F4CA 2ZPQA 2VVCA 4Q66C 1OHHA 1Q2WA 4Q2KA 1RPZA 3ZVBA 3RSOA 4CEHA 3ZVGA 1TU4A 1Q57A 5ELXA 2R3YA 4WXPA 2RGNA 2WSMA 1JJ7A 2ERXA 2FXRA 1HAYB 3VR3A 5B6LA 2BC9A 1KMHB 1O2QA 2IBMA 4BAQB 3RUOA 7GCHF 4G5GA 1L4DA 2HWLB 2PBRA 3C5HA 5GNDA 1C1VH 1ZM2A 1C5XB 1ZSJA 4PO9A 4OJKA 4TYPA 3TK9A 3I1FA 3PENA 1NLYA 2ZAOA 3ND8A 1SGQE 1IAUA 3R7WB 2O0JA 1TF5A 1W5TA 1AIXH 4FMBB 4OHZA 5TJXA 1XMSA 4U32A 5EXPA 2ZFSA 1KY3A 1G3UA 3R9XA 4RSPA 4BFUA 3LH1A 2X77A 2WBLC 5AUNB 4L9WA 5I46H 2OZEA 3SFZA 4Q9JA 3CM0A 2DE8A 3NKVA 1LTOA 1ZTJA 4K1TA 4JL6A 2G0TA 1TRNA 1BRAA 3IIKA 4NZQA 4XVRA 4JLBA 5CJPA 3R0FA 4Z6AH 3KN2A 1YBWA 1Z6XA 5CM8B 2ZDNA 4NFEA 1HAVA 2A4QA 2KSQA 2B5TB 5FTNA 1C1TA 3LIWA 1QTFA 4M9ZA 2ZI5A 4KLNA 2BLWA 4EJSB 2QT0A 3SV9A 3QTVH 1P01A 3SV7A 3UIRA 1U81A 2ZRAA 1NN1A 2CL7X 1X1SA 1KAGA 1XPOA 4LJ5A 1O31A 1YZUA 3C15C 4PSAA 4Y7AA 3QUSA 2HOBA 2F1IA 2FOBA 1O3NA 3BTGE 1N6LA 1QHXA 1FQ3A 4Y79A 2HJGA 2Y82A 3FHTA 1WCV1 4CRWB 2W6JD 2OBOA 4CHAB 2A4OA 3MO9A 2Z43A 1SOTA 3RRYA 1W2KH 2ZANA 2WV5A 2V6NA 1RZ3A 3GFPA 3AVVA 3LGVA 1NSFA 3CRVA 4QNRA 2CDNA 2RKOA 2HF8A 1FPMA 3PEUA 3WRYC 1G9IE 2HLDD 2EVWX 2NMVA 1KXFA 3NUMA 4O2LA 1HPGA 3U7EB 2C90B 4HLCA 2OCAA 1GI3A 3RMNH 2G77B 3NH9A 2ZI4A 3IQXA 3ZDQA 1YC0A 2FODA 3I78A 2OLGA 4LBVA 1C1MA 4NL4H 2PCLA 2EI6A 1AO5A 3SJCA 5CMXH 2BVRH 4LZZA 4PSVA 3V3MA 1E94E 5ESTE 4P4SA 5A0CA 5B64A 1DM4B 1YHNA 5EGMA 2XTTB 3SUGA 3SJIA 1KO7A 3H4MA 4B47A 1O2VA 2JASA 4YOIA 1H8IH 1O2XA 1UVSH 2XEXA 2OO7A 2THFB 3I62A 1WDTA 1H9HE 2JAQA 2GJSA 3IDQA 5F3WB 2XBWA 3KQLA 3H0KA 4YOJA 5A0FA 1G8FA 4JJZA 4BLOA 1NKTA 1SGWA 3VPKA 3T1TA 4ABJA 3T27A 1NBME 4IW3B 1E2KA 1SGFG 2JLXA 1QB1A 2GILA 2G1JA 3A1VA 5JBAS 4IKEA 1HJ9A 5BWMA 1CA0B 4ZI2A 2WJVA 4FD2A 1ZRHA 4RKJB 3VAAA 3GLIB 2E9SA 4M1YA 4JCNA 2AKYA 5FR2A 1ZHPA 5DISB 3AF4A 3K0CA 2XSZD 1VMAA 1D5CA 4NIYA 2WMOB 3QIAA 4DXAA 1O2WA 3NZIA 3A8AA 5GIBA 4N1AA 5C5OA 4KYIB 4D9RA 1LHFH 2YNAA 3MRSA 3NBFA 1XEXA 3GPLA 4GNKA 4Z51A 1P04A 4FU9A 4ZKEA 5DG6A 3BERA 1R8QA 2P65A 4ZO4A 1AZZA 4L15A 5H4IB 2LNCA 4YO9A 4MITA 1XVMA 5JSZB 2W7UA 3P26A 1II8A 2CK3D 4B48A 3T12A 2PX0A 3NC0C 2JH5D 3ZVRA 4CR9A 3M5OA 3B1XA 4RKOB 4XSKU 1YVDA 3F9HA 2Z0MA 3RM2H 5FOWA 4Y10E 1GBEA 1GI4A 1Z5ZA 1QHRB 1E9RA 4KO8A 1BMLA 2DHRA 3BFKA 2FLRH 1EX6A 1GBKA 4NHOA 4UNSA 5HZKA 1SQ5A 2GJAA 1DAIA 2QRNA 1QJ7B 1MO6A 3UOPA 2VIPA 3GY2A 4MGYR 4IFEA 1C1OA 1R8SA 1SHZA 1C2MA 1ZTKA 4LJ9A 1MRSA 3FOZA 1CQQA 2P94A 1OKKA 4I1UA 3Q00A 3MWLA 5GDSH 5KNCA 3CPHA 1O3OA 1H8EA 3Q85A 3Q7QA 3LNCA 4D2IA 3BIUH 2ZRBA 4R2IA 1CR2A 4NFFA 3SYNA 1E2LA 4TL8A 4UXJA 3ATMA 2WICA 1GNQA 1E2NA 2J3EA 3NBYC 1RRFA 3NC1C 2A5JA 4KSCA 1DUAA 1JWTA 3I73A 3P8OA 2W6ID 5K8IA 4WVPE 2EWVA 3O8BA 1NL3A 3PUXA 1AZ8A 3GJXC 1VTKA 3QI2A 4PQYA 1HXEH 2ZUCA 3Q5DA 1E0JA 3LKWA 2VSFA 2WWIA 5AF9H 1S96A 4B2CA 3B9QA 1T4UH 1G5PA 1PUJA 4JVSB 4B3CA 2BBTA 8GCHG 3JVVA 2ILNA 5EE9A 3U9AH 1XVOA 5KDOA 4JK6A 1P9RA 4CEIA 5A4JA 3MU4A 4MRRA 1MZAA 3GY8A 1KZ7B 5DI3B 5HCIA 2CMYA 3ELAH 2RGEA 1H8HA 1ZCAA 1OXGA 3VEQB 5H8WA 4TZ6A 5HR5A 4NYIR 1G291 1GBBA 3SI3H 5L3SB 4LV8B 3AW0A 1TNGA 1O2NA 3FKSA 3PV2A 3MFYA 5C18A 2G4UA 5EQQA 1S1CA 2F9UA 2WPJS 3AP2A 2XWBI 5KU1A 1TTTA 1O33A 4JMYA 1E2PA 1INCA 4QBIA 1SFQB 2QNRA 1QJ6B 7ESTE 2FOEA 2ZDMA 4IDNA 2FX6A 5EQSA 3SU5A 3U2QA 2IYVA 5JLJA 4C0QC 4LYFA 1X7AC 5LB2A 1QA0A 1P9WA 2ZF0H 1NN6A 4MYCA 1ID5H 5CB6A 4LJ4A 4INLA 4NYJR 1SL3A 5FPKA 2QAGB 2XNDA 2AKAB 3GCNA 3C5CA 5DP8A 1C5ZB 1ONBA 4JVMA 1NIJA 2PL3A 4KTUA 2ZPTX 2ZQ2A 2YV5A 1XX9A 3I5XA 4CREA 1ABJH 2ZTYA 3BFXA 4LV6A 1OPXA 5FTMA 1HBTH 3OTPA 1XNJA 1WB9A 4AGKA 4E07A 2ZDKA 3CBQA 3THOA 1RJXB 1FTNA 2CEAA 2IYQA 1ZRKA 1AK2A 3A1SA 1SXJB 1XZPA 3HPTB 1C5TA 4Z1MA 3TKLA 1HGTH 1O2UA 2OBLA 4G0NA 5H1YA 4FN5A 1M7BA 2BD5A 2ZREA 1VGCB 4I8HA 4CYMA 1R0XA 3RLYH 1KJYA 4LPSA 2XXLA 2V35A 1EFHA 3VKGA 3C14C 2YOHA 1MR3F 1FY4A 2HDNB 1AGPA 2ZR7A 4NH0A 4KHZA 2BDIA 4IOKA 1WSSH 1T31A 1KXDA 2V3HH 4K60A 4MKGA 1UBGA 4URZR 1X86B 1C1WH 2A45B 2ZXUA 3RXCA 4R7ZA 3BTHE 3QN7A 5J4QA 1QL9A 5EQRA 4XJXA 4B44A 3MWKA 4IEEA 4N0EA 2BD2A 2H6MA 4OHYA 3G5UA 2ZRNA 2B9LA 3D6TB 4UXHA 5DH9A 2DCUA 3GDSA 1A2KC 2IUSA 4JLMA 2BDTA 4ZKOU 3GJ0A 1NVVR 3LV8A 4FCVA 2P3TB 3ZZ0A 2B92A 3IILA 3A7WA 3OIYA 5JBCS 1TLDA 3SJZA 1H65A 3TVDA 5J40A 2IXFA 1T8MA 1OH7A 1JR6A 2UUKB 3IBGA 2A7HA 3K9LA 3DDCA 5HGGA 4HDOB 5KPJA 3E6PH 4HAYA 3EC2A 2P3UB 3ZV9A 3RS2A 4UFFH 1NMZA 2QQ0A 2I6QA 1CBUA 1FDPA 2UWOA 3DKPA 4D25A 4EJSC 4ARZA 2JJ1A 2CHQA 1GG2A 2OAQ1 5AR1A 4I1OA 4XVUA 4MPWA 4WAUA 3WMEA 1SBWA 1OXXK 4MUAA 3W8NA 3SNDA 4BAKB 5CK4A 3LJOA 1MTSA 3Q72A 4X8LA 5KYKA 1EZXC 4P33A 1HAIH 3LONA 3OEED 3ODFA 2WAXA 4DLZA 1D3PB 1FY3A 2YINC 1ZINA 4IMZA 4EUNA 5FHTA 1KI9A 1NU9A 1W4RA 3I5YA 3STJA 4A2QA 1WBBA 1QNJA 2GJ8A 3FMPB 3CB4A 4ISHH 3K0CC 3LDAA 2BD7A 2NOAA 2BM2A 3M5NA 4A1VA 2G1KA 1GWNA 1JBUH 2QTVB 3MWIU 1SVWA 4MDEA 1XEXB 1DSUA 3PCRB 1IJFA 2XCFA 1RRCA 4R8TB 3A8TA 3B5JA 3H84A 2ZJAA 3U4QA 3WP0A 2GCOB 1ZNYA 1CHOG 4JBXA 1IHSH 1HJAC 1ZZZA 4IMQA 1HQCA 2ALVA 1QL7A 4ZPXA 2ZRJA 2J34A 1IY1A 1DVRA 4O3MA 3SNCA 2QP3A 4CRCA 4C9BA 3LVRE 2AX4A 2Z6VA 3MI4A 4UJ3A 3BK7A 1GRQA 3L0SA 2OSBA 4UNQA 2OCVB 1ZJ6A 2IUUA 3GEIA 4GCHF 5JS8A 4LV5B 4K69A 1HE1C 3RM0H 2RB4A 1TA6A 1M6NA 3RNLA 3U61B 1XXHB 3DKVA 1XXFA 3CH5A 2VHUA 4BFTA 2D8WA 1DY8A 2YWEA 4D9QA 1MD8A 1W8BH 3CS7A 3BTTE 4O9VA 1J16A 1V3XA 2RGNC 1O3HA 1PPZA 4JBYA 1BOFA 4I8GA 2JIZA 1YCPH 1J17T 1KLIH 1EZSC 2AFHE 1K1MA 2ZE5A 3SQXA 2BQ6B 4US0R 1C2FA 2O8BA 1QA7A 2ERYA 1GBJA 1TIOA 1UHBA 1TMTH 3QKUA 4X8SH 1GKUB 8KME2 1L8QA 2VIIA 2DWOA 3A86A 1M2OB 1G8YA 4QGGA 1ETTH 1PUIA 2IYUA 3A58B 121PA 1RJ9A 1AU8A 1KOFA 4M1TA 3TW8B 2J4IA 4NYJQ 3FVQA 4UD9H 2N42A 5DSZA 4LX0A 1FIWA 2NO0A 1UMAH 1S85A 5KSOA 3NTUA 5DHFA 5EE1A 4A2PA 1VHTA 1A5HA 3ADDA 4WMFA 4YLQH 1DICA 2ECKA 2Q3FA 2OUAA 1O2YA 2C98A 4DDUA 1MTUA 4ZDIA 3BSQA 6CHAC 1QGFA 1TPOA 2NG1A 1WP9A 1A1RA 3KF2A 5GVRA 1G6HA 2NO9A 2KWIA 1AGRA 2GAOA 1OP2A 1Z07A 1C5PA 2ZAMA 4BANB 4GMDA 3X1DA 4GAWA 5FX5A 4D0NA 2R2WU 1NS3A 1GJBB 2ZTZA 4URYR 1JRTA 3K70C 3TJOA 3TE6A 3ZZ7A 3DVLA 3LLUA 3LGIA 1JECA 3UR9A 2VLIA 2KAIA 4ZDWA 3CF2A 1U6QA 3K70B 4J0QA 4OK6A 3AAUA 4XWAA 4MDFA 2P6NA 2Z3CA 3KL4A 3V4RA 1C5SA 1MH0A 3CNOA 1JXOA 3HGPA 4NYMQ 2JLZA 1QIXB 1PLJA 3MAAC 1ZM3A 3P92A 1RFNA 5E3HA 4B74A 3S1AA 3CWZA 1HAHH 2JLYA 1FN6A 2IEZA 1GGDB 1E0AA 5JBTA 2Z5FA 4RZUA 3R9WA 3GCHC 3NCLA 4PZYA 2AWOA 4Q9KA 2XXAB 2UVQA 1H8DH 1T9HA 3RXIA 3PLBA 3THXA 4MPVA 2J9NA 3AVTA 1WYKA 3FZZA 1MQ6A 3RXAA 4LYJA 3LU9B 4H1UA 2PMDA 3EA8A 4NCJA 2HUPA 3KFXA 4NU0A 2ANCA 2TRMA 2ZU2A 1JEDA 5T6DA 1OWJA 4AYXA 3HU3A 1F2UA 1LVYA 5HE9A 1L1JA 4GRAA 3K70D 1YZLA 3SU4A 1QR3E 3TGKE 1A4WH 4ITRC 2EW1A 5DN6A 2WVJA 4DSOA 1FMLA 4JSYA 1AS3A 5CYOA 1E2JA 3VMFA 2F1JA 2JH0D 3W94A 4DCDA 5B58C 1T8OA 2HNTC 4M1KA 1I4LD 1XMJA 1N6RA 1F5NA 1ESTA 2X1VA 2A4RA 4ABFA 1BCUH 7KMEH 2JIZD 5JYIA 4L8GA 1Z0FA 1DE0A 3M5MA 2CE7A 1P73A 1KSFX 4JZ1A 3MO6A 1LPGB 1OYTH 1NM6A 2Z4RA 3UIEA 2FFQA 3IHWA 3UQOA 4URVR 3BTWE 3B7GA 3TK5A 2YHSA 2FESH 5HE8A 5FTJA 4Q7LA 1VHLA 5JJKA 4EPVA 5FX6A 4LBYA 3PUVA 1P75A 4NYMR 4LRWA 4Y0AA 3FFAA 1LW7A 1AB9B 2VNTA 3KXIA 5T6FA 3M37A 2OP9A 3EZ2A 1L4YA 2IYRA 2WJYA 2V1XA 3V4FA 4MYHA 1UVUH 4OS5A 3T26A 2TMKA 1DS2E 3CRQA 2NPIA 1YPMH 1JR3D 3TLOA 2PSYA 1KI6B 3BORA 4A8JA 1O3PB 3UNRA 5DHAA 2NTYC
chains in the Genus database with same CATH superfamily
1UZLA 2QIQA 4LY6A 3I4LA 1GWAA 3ENSB 1HG0A 1REQB 2X0JA 4LECA 5D86A 2C9YA 5FFFA 3OPVA 1I36A 1R0SA 5TPWA 5KQGA 1A9SA 1T0UA 1HTTA 2N3ZA 5EUCA 5ED4A 1J90A 4QT0A 3UF0A 3S1SA 4XCQA 2HCJB 4M9UA 1P72A 3CH7A 4EG0A 5DTMA 3GVHA 3V80A 1PHPA 3NOQA 1UVOA 3M6IA 4XJSA 3DFJA 3U8RH 3E7FA 4AWBA 4BVKA 4CMBA 1K28D 4HEQA 4KO4S 3QPCA 5EMLA 3RFTA 1IZ8A 3WHPA 2NU7A 5L8VA 1TE0A 4D97A 4N3NA 3RS3A 5KTPA 2NV6A 3A7XA 4Y2SA 3T7EA 3H5RA 3M8KA 3VR5H 1R4MB 1BHQ1 4ENPA 3LKDA 1UCYH 3CS3A 3TF5A 1ODTC 3WLRA 5A8YA 4J1TA 2ZE8A 4G36A 1G5TA 3TD9A 1G6Q1 1JOUB 4OBXA 3TLEA 5GVSA 2H0RA 1XD8A 5E4FA 4U2WA 2BP7B 2XNHA 3CCBA 3QLJA 3VPHA 4MWZA 1TF7A 2OV6A 4UUQA 2HPAA 1O9HA 4TWIA 3FUVA 1TYAE 4XR4A 4XBCA 2PQMA 5BN4B 3LQYA 3OOWA 1ODLA 4YGYA 3A9RA 3FDFA 4L5IA 3TSCA 3HSSA 3EFOB 1O5DH 2NUPA 1ESNA 4LI0A 2WWHA 4RGVA 2I2BA 3VHQA 4B9AA 2VHCA 5ABPA 3MGGA 5HF9A 4KXQA 4CRDA 5C1UA 3RXPA 1P1KA 1TADA 3JTEA 1TO6A 4Q3LA 2ONKA 4ATNA 5JFTA 3ZTTA 3MBKA 2BR4A 2YDXA 3VZRA 4G0YA 1T1GA 1FVHA 3KKNA 2VPPA 5AKGA 1JT9A 4PAOA 1CUIA 4AN0A 4TSRA 3TL3A 3GBPA 3R5JA 1JG7A 3O9MA 4CQMA 1FSPA 1S83A 2DE9A 4FUDA 1FNCA 2HLNA 5HEKA 1WWKA 2VRNA 1ZEMA 1EJNA 3QHQA 2PKQP 4YUWA 2IY8A 4XGRA 4JXXA 4HB0A 1E34B 2YCBA 3LGUA 5DH9A 5C52B 4RIGA 3RIXA 2W7SA 3AY7A 1AHTH 1UMCA 2ZJFA 3FXAA 1HNEE 2ESRA 3JPYA 2QLMA 3AR3A 3KU1A 3EA5A 3DHNA 1VMEA 1T4CB 4HAOA 4N7BA 4UARA 4Z4IA 3JQQA 4CN8A 1IWBB 1Y33E 5HTOA 3GT4A 1SKYB 4Y1EA 1IXRC 4EQ6A 2B21A 1DT5A 4Q5IA 1JVBA 2AZ4A 3WGNA 2GNAA 1UTQA 1BMAA 3M33A 5FI1B 4JI1B 5AFYH 3R76A 2ZU5A 4ZQHA 1RP7A 3ZVNA 1VG1A 2EQ5A 5GJCA 5KTOA 2O1SA 3R20A 3RU2A 3HCEA 4ZI3A 5CXUA 2CSUA 4FTWA 1BE1A 2OFPA 3HWRA 4NE7A 3MRVA 5DW0A 1LBIA 3SX2A 1W36D 2XCTB 2FEQH 1QHGA 4I4CA 5FPHA 4OLBA 2BTEA 1IQRA 3U3XA 5HIYA 1KP9A 4XSGA 5K0LA 3QLVC 3P9XA 2FOIA 2R8BA 3A4IA 1H2BA 2JEOA 3PD0A 1VCOA 2OD3B 1JEYB 1UP4A 1O03A 2YQ4A 4DT1B 4B73A 3ESDA 1DXYA 1L5WA 4GPGA 4UBMA 4F9EA 1H4SA 2OM2A 2X0NA 5K0NA 1VE3A 2VPIA 2VDWA 4GOXA 4E1BA 5COQA 2VPQA 2X8AA 2PBLA 3M5WA 2ID9A 2QMHA 4KNVA 5D3ZA 3ZGOA 4ZVPA 1K7YA 5IUKC 4CF4A 4QU5A 1O32A 1UWKA 2C7GA 5CFLA 1PGPA 3CNRA 3GBVA 3DMFA 1ADGA 4A0RA 3UBTA 1AKWA 2P9HA 1NZDA 2F3CE 2QV0A 3MTEA 2WKPA 1CY7A 1J4AA 4XI9A 2IYTA 3HPQA 4AKTA 5I9BA 1GJ7B 5PTPA 2XB8A 5HX7A 1KQGA 4KLRA 5KYYB 1S0RA