3O8CA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/rna
molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8cA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8cA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8cA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA03
2ZRFA 1V2VT 3MCAA 3OTPA 2Q6GA 4IDQA 8KME2 4CEJA 3EZ2A 1NG1A 5HGGA 2IS1A 3AASA 2DY1A 1MTUA 2OCVB 4JZIA 3UWKA 4TYYA 2BDTA 1L4ZA 1RRPA 1C1SA 1EAUA 4I1UA 2O8DB 2V6IA 4V0ME 4DUGA 1GVZA 3P8GA 3W6OA 1G16A 3RS5A 4BRUA 1ZBDA 4G01B 5DE3A 3SW2B 4DIEA 3B23B 5JPMH 3ASYA 2MSCB 1T32A 1QHIA 2Z3CA 1TF2A 3I3SR 4US0R 1N8OB 2STBE 2ZS8A 5HZKA 3T15A 1WE2A 1GMHG 4AYWA 2Z9JA 5EZ6B 4E5UA 4Q4HB 1ELOA 1UEJA 3RVBA 2D74A 2G52A 3V3MA 2OBMA 1U2RA 1JR3D 3TH4H 3RDZA 4B73A 3UUZA 4KITB 4ZKEA 4HI3A 1VCOA 1G4AE 4D7FA 1J99A 5C4MA 3DFLA 1DG1G 3M3TA 4OQXA 3GCNA 3EWAA 2AERH 4DLUA 3OHMA 1Z1IA 3WY8A 3UR6A 1H9HE 2BX3A 3RC3A 1XMVA 1AQYA 3GY7A 2NU2E 1BMMH 1O3EA 1X1RA 2CHAC 4ILEA 5FTKA 2ZGBH 1AIPA 1MRSA 3Q3XA 1O5AB 3OF5A 4QHYA 1W7AA 1Y3VA 3KQUA 3THOA 2UZ3A 2RGNC 3B1XA 3ZGXA 1ZRHA 1UVUH 4A0GA 3NEYA 2UUJB 5F3WB 3IEVA 4C2UA 3ZDQA 4J1YA 2WYGA 4AKEA 8ESTE 2V1UA 2FODA 1ZLRA 2QBYA 1EPTC 1H8ED 4E7NA 5AFYH 2NO1A 1KI1A 1TBQH 3X1YA 3GCHC 2B9LA 3RMNH 3THYB 2HLDD 1OHHA 3TMKA 1NRRH 1W2KH 3IEUA 1G7CA 2I6SA 3AEZA 2QF3A 1OE0A 2QZ4A 2YNAA 3IDQA 2J7PD 2YYZA 1KGDA 2ZJYA 3BB1A 2QI9C 1N25A 2H2ZA 2BBWA 1KTTB 2F6RA 1IQNA 3U8RH 4B75A 6Q21A 4DGJA 3A85A 3B78A 3WMEA 4JLAA 3UMSA 2GMTB 2BD4A 4NDZA 1DSUA 2ZFTA 4GZLA 1SHHB 3W6NA 1EAXA 1HUTH 3LW7A 5FL7D 2SGEE 2OZEA 2O8LA 2RG3A 1NL3A 4KYIB 5JBAS 2FZLA 5A09A 3MWLA 4X2VA 1OYQA 1EZUC 4OK6A 1SLWB 3RXFA 3I78A 3ICEA 1TIOA 2G81E 1QTFA 2A4GA 1Q2WA 4JZEH 3SUGA 4LDJA 1LB1B 4WMFA 3IWMA 2R6GA 4NHOA 3LFUA 2XCNA 4EKDA 2QN5T 2NO6A 4FCWA 1P9SA 5CJPA 4DT1B 1MKWH 4IVRA 4LJ9A 2VU8E 3BH7A 3SQHE 3H4MA 2QCYA 4ABHA 4URZR 2ZU1A 4PXAA 5J4QA 2J59A 2XB4A 3M5LA 3V00A 2IXFA 4ESTE 5E7JA 2ZFPH 4BQSA 1BJVA 2EYQA 1GVLA 1Y8TA 5L30H 5E2PA 2A5YB 1SI5H 1GPZA 1SOTA 4IOMA 4X8UH 3M7TA 2ZI5A 4Y0ZE 4ZI2A 2F7SA 4NSYA 1TU4A 3HPQA 2HWLB 3OIWA 2DE9A 2GTPA 4AG5A 2NTYC 1A46H 2ZZUH 4NTZA 1E35B 4Q4LA 3EPKA 2ECKA 4TLBA 1T5IA 3NKVA 2J5XA 4CW7A 4BZQA 3T5DA 2O8FA 2C99A 1LHGH 1TA2A 3U8TH 4QNMA 2XYAA 4OQFA 2D7CA 2XZPA 3AF0A 2NO7A 3TK1A 3PVSA 4B3GA 1AD8H 1OH6A 4LJAA 2Y6TA 5HE8A 1GHYH 1KMHB 3RXKA 1LKAA 1NFXA 2ZEBA 3IKJA 1T3LA 2Z9GA 1F5RA 6LPRA 1ZMLA 2IS4A 2VH5R 3CF2A 4NA9H 4MGKR 3V0XA 2GILA 4PO8A 1Y63A 2SFAA 1UVOA 4B2LA 2Z43A 1P09A 3V4RA 4C4PA 1KJYA 1MUEB 2AGIX 3A1VA 5FCRA 1BOFA 4MYTA 2QXIA 1W4CA 1DM4B 2JLVA 1NN0A 2YV5A 2PSYA 4GSYA 4BASA 2JJ8A 1S8FA 1YYY1 2ZUCA 5J4YA 2O8FB 4YOGA 3MLEA 4FXPA 1Z08A 3FKSD 1D8TA 5SGAE 1YR6A 1IJEA 2BTCE 3GJ5A 4ZHMU 4P33A 1W5SA 3U98H 4LPKA 4RD6A 4BLQA 4LWZA 5EP3A 1GCTB 4DVAU 1JECA 1K21H 3I29A 1DBSA 3EC1A 3U7HB 1P2OA 2QY0B 2UUFB 3IIKA 1XEXA 4HAWA 4NE2A 1U0JA 2KI5A 1MABB 2OC7A 4LYAA 1TX6A 2HYIC 2QT0A 1E38B 4YOIA 5G3ZA 2BZ6H 4O25A 4PR0A 4KV9A 1E2FA 2HVXA 5E0JA 4FUHA 4TPIZ 3AVTA 3REGA 5CHAC 4ISNA 1CGHA 3ESTA 3K0FB 4SGAE 2ZYWX 4UXIA 4JVSB 4OS6A 1SKYE 4NFEA 3K0CA 2FG5A 4QGGA 2DPXA 2GK6A 2YOGA 4IVQA 3NWUA 4GOXA 2CLCX 3T12A 1XCMA 1R10A 3DD2H 1OV4A 2ZEJA 1C9TA 3A1UA 5C1XA 2HNTF 3AB3A 7GCHF 2PX0A 4WF8A 3FANA 2ZDMA 1G2MA 2NU0E 4US2R 1II8B 4I8HA 3PEUA 1XEXB 4A9AA 4YM9A 2BM0A 4E03A 1HAOH 3MOCA 3E0PB 5CLLA 4WMEA 4KJZA 1BCUH 1O2OA 1MO6A 1GKYA 1LNZA 1C5XB 3EGKH 1OH5A 2Y7ZA 3P92A 2VTKA 1XXHB 2ZE6A 1GI2A 1J2JA 3RSLA 1BMFD 2VIDA 2A5JA 3C41J 3ADBA 3OTJE 4IEIA 1HAGE 2UWOA 4A6XA 4TSFD 1D9XA 4KI0A 3ZIAA 1J70A 4F4CA 2GT7A 3VU9B 2R2WU 4JKYA 4RY2A 1XJQA 2A5DA 5G53C 3BTQE 1C2LA 4ZUHA 3GJXC 1HDTH 1CA8B 2DUCA 4QM7A 4Q4JB 5GJCA 1KSNA 1FL9A 2IL1A 1W10U 2NGRA 1HNEE 1GILA 3KHVA 2WWXA 4CT4B 2PLFA 1VHTA 4NCJA 1T4GA 1ZPCA 4XDEA 3SU0A 4JSYA 5DN6A 5LD2C 1V6DA 2RB4A 2WV4A 2CMYA 1NF3A 1F2UA 2QUZA 1NJFA 4X6NA 1DT2A 2Q9AA 3L0SA 3H5CB 1SKQA 2ZJBA 1SHKA 1KOFA 1N6IA 3EZ9A 1WXRA 1H1BA 3U7FB 2QP3A 3QBVA 4LJYA 2YOFA 3OAAA 1GMCF 4Q7XA 2FEQH 4LK2A 5KPDA 2GEUA 3STJA 1U94A 1ZSKA 5JWRA 3GCTF 3GLIA 3F1SB 1S96A 2ZRNA 1G8YA 1KSHA 1VCWA 4RKJB 1Z71A 3PB1E 1V2WT 3JZAA 4IXNA 1O2KA 2W7SA 5IF9A 3Q76A 4MPVA 2Q6DA 1H8IH 1SMFE 2J38A 2ZI6A 1G3BA 3ZVAA 1JAIA 5JJKA 1GBTA 5F98A 4HYYA 1HV7A 1TGCA 3KXKA 3KKMA 3UIRA 1G17A 5FOUA 1EWRA 3DZDA 1E32A 2OV2A 5FOWA 1RTFB 1E34B 2Y81A 2HCJB 4PPNA 1C5TA 1NSFA 4OS5A 3JZMA 2QMHA 1ESNA 4GFDA 4TYDA 1OXTA 4CBNA 1QB9A 1GL1A 3LOXA 2N46A 2FOLA 1YGCH 2OQ5A 2QGZA 4B6FA 3E70C 4NZYA 2WKQA 3O8CA 1OSNA 3M4YA 1GMDF 4IDNA 1HLTH 2ZNKH 3Q3YA 4X8TH 2ZRAA 1G7SA 1NKSA 1ZNYA 2GF9A 2OFWA 2FESH 3OY5U 2F1HA 2NQ2C 4RFVA 1GI8B 5DG6A 2ZDLA 1VECA 2H5CA 4X1NU 3VGCB 2O0JA 2CNWD 1HIAB 2HCBA 2C8XB 3ZZCA 1ESMA 3KFXA 2ZRGA 2VH0A 2A78A 3M0EA 1JJ7A 3KN2A 3SYNA 2BJVA 4QFMA 1ZPZA 5C46F 3OESA 4PO1A 3K9NA 3ZVDA 3A58B 2IXEA 5DP8A 1O35A 1SGFA 1H9LB 3SNHA 2YWFA 2HXYA 3KTAA 2ZPTX 2OAP1 2GCNA 2W58A 4D26A 2H1UA 1WTHD 5K0HA 3L33A 1NS3A 3BD9A 2JLSA 1MD8A 1T91A 2BHGA 2QRZA 2V3CC 3LGVA 4AFSA 3E16B 2H1LA 3BF6H 2ZU3A 5FPYA 1AE8H 1JB1A 1P5ZB 2EFEB 2JKHA 2J9NA 3TPIZ 2AIPA 2UZIR 4Q01A 4JIMA 2CEAA 2Z4SA 6ESTA 1F5NA 2FTLE 1E9SA 1A2KC 4Q4AA 1AA9A 3SGQE 4LBZA 1KXFA 4Y76A 1N6PA 1GBAA 4O9VA 1XNJA 1M9UA 1D3PB 4WAUA 2WV5A 1GDQA 1KJZA 3AH8A 4ZCMA 2JAQA 2G00A 3A8DA 1D3QB 1AO5A 2WWHA 1A0LA 1OWKA 2P5SA 2Q21A 3SJ9A 1D5CA 4DCSA 2ODYB 2ODEA 3L0OA 1QY6A 2OCAA 3SYKA 2GCOA 4UFGH 2JLWA 3RXVA 1G2LA 3SV6A 1FONA 3QO6A 1GBHA 3SYJA 4D4LA 4EJSC 3MU1A 1SLUB 2PHBA 1E2IA 5C2ZA 2ZECA 5B6LA 3FB4A 4QXAA 1K22H 2HDNB 5F6MA 4ISLA 4US1R 1YHNA 4A2PA 1FMLA 1JIRA 2AFIE 2QQ0A 2WPHS 1RE0A 2O5VA 2WPDA 2VIQA 1AZTA 1O30A 3OYPA 3UK6A 3BEIB 1ZIPA 4NYIQ 4ITRC 5KU1A 1IY0A 2OLKA 1GHBG 3TLXA 3TVDA 4ARZA 2KBFA 3RMOH 1AZSC 2OE2A 3LC3A 3IUYA 1C1OA 121PA 4A36A 4A0HA 3PEWA 5G4BA 3R3GB 3VHLB 1W46A 2W3IA 4K1TA 2XSZA 1SVIA 3R9IA 2YZ2A 4ABEA 2TGDA 3ODFA 3QUSA 1ZM4A 5EODA 4AYTA 1MRNA 1NRNH 3A87A 3RRNA 1DDJA 1OP0A 1P62B 1SQAA 1OB2A 2Z3DA 5FTJA 1GGDC 5C2JB 5EPYA 3SV9A 3KIDU 2KJQA 3MYWA 2VINA 4JJKA 4AI6A 3MWKA 2VGCC 1XXDA 1IHUA 3T5FH 3SE0A 1U6QA 4O2LA 1O5DH 2REBA 4I31A 1GJCB 2FN4A 4LC0A 1QJ7B 3M5MA 4CRWB 4DLXA 2F83A 1OXVA 3BBPA 5DP6A 5E95A 3FGNA 4FW9A 2ZUBA 2ONJA 5D3MB 2SGQE 1PPHE 3VR1A 3MTYA 4U5XA 3P8NA 1JPNA 4D25A 3QXCA 4NONA 2EYUA 3P6ZB 1IN6A 1ZAKA 4G5OA 2OAQ1 1ZHPA 3U69H 1W0ZU 3VR2A 5EU8A 1Z06A 3ETLA 3T35A 4WBSA 1FX0A 4LI0A 2PLRA 4JYCA 3GY6A 4LZ4B 3F9FA 3QIAA 3SZRA 1CLUA 1Q3HA 1W4AA 2B21A 2ZO3H 2QXJA 4OYHA 1XEFA 3TUZC 4KVAA 3RWMB 4O0MA 5SZKB 5L3VA 5L3RA 1BBRK 3M3VA 1DPOA 2A0QB 1YR9A 1EOJA 2G51A 1KSGA 4QGAA 3M36A 4X1SU 4B34A 3DT0H 4KTSA 2Q1JA 4PSKA 4EFLA 1A4WH 1NESE 3WNDA 2ZI4A 4G0NA 1GRNA 2JJ2D 1CJVC 2ODQA 2NZJA 5L3SA 2EEKA 1SGQE 4UONA 2F1IA 1NLYA 1IQJA 1UVPA 2AX4A 2C9YA 2KSQA 4U00A 4Q9KA 4B76A 1QR3E 4TN1A 4Q5IA 1VCQA 2Z83A 2ZANA 5FTLA 5ETXA 3URDA 1HBTH 3WYFA 1C5QA 1PLKA 4DDUA 3CO5A 1CT0E 4CYMA 4F93B 1UCYE 1ORFA 2H18A 2HLCA 3DMNA 1G8FA 2CK3A 1C2IA 3CX8A 2MMCA 1ESBA 4GVUA 2DR3A 2J46A 4FCVA 4IVPA 4BAMB 1NIPA 1TE0A 1J14A 4JLVA 1KK1A 1DUAA 4PHHA 2A3RA 3B2EA 5DHAA 3UWOA 1V2KT 1Q44A 2Y82A 3VEQB 1W0JA 3PV5A 1IXZA 1JR3A 1SVWA 4O3MA 2ZDVH 1U0HC 1ZGIA 2WYJA 3WXMA 4QJ5A 2CVHA 1A7SA 2CF8H 1F5LA 4M1KA 4OGYA 2AFQB 4WVFA 2HRVA 1PJRA 1OXXK 2OINA 3MFJA 3KDSE 3GLFA 4TL8A 9LPRA 2PJZA 2H8KA 1K1LA 1AGRA 2BDAA 4R9UC 3ZZ6A 2D8WA 5D3QA 2ERYA 1SXJA 4TZ6A 2BLOA 1GBLA 2GMTC 3SZEA 2EU8A 3E0NB 4DCNA 4XD7A 1B23P 1RRCA 1H8EA 3PMBB 3B82A 3EPLA 5JBTA 1DADA 3GJ0A 1NY22 2R3UA 3TUIC 4M1OA 1X86B 1G41A 2Z6VA 3ITIA 1ZCBA 1O0DH 4G3XA 4DEXA 1MAXA 3A6PC 4WY3A 5LPEA 4B6EA 2RHMA 4DKXA 5EE5B 3LGYA 3R7WA 2GXQA 2PL3A 5E2OA 1AB9B 2BMJA 4BOHA 3A1WA 4ZCIA 3GLGA 1FQJA 1P2MA 3GLFB 4V0MA 2BIFA 4WZAE 1JAHA 4AKIA 1XDBA 2JLQA 4X8HA 4A1TA 2ZHDA 3SU2A 1DOJA 2OEPA 5FL7A 3BOSA 4ZAEA 1MCVA 4WXPA 3KQNA 1FXYA 1FY5A 4HB3A 1KI2A 5GPIB 2QV1A 4GMXA 1CBUA 4Y6DA 2R2MB 3KB2A 8GCHF 1P73A 3K0AB 3GJ8A 4GNKA 2B7DH 4ZDKA 3LH5A 1GTVA 3W34A 1MTSA 5DH9A 3P4YA 3F9HA 2KAIB 1IOZA 3AGPA 3KKNA 4HTCH 1G9IE 3TQFA 3KKPA 2F9LA 4RCZA 1G3DA 4I4LA 1C4U2 3CB4A 3ZZ5A 1ZHMA 3A8BA 3R7WB 2LKCA 3ZV9A 2H9EH 2THFB 3SQWA 3EZ7A 2I6QA 3CX6A 3U2QA 1CEEA 3GJ4A 3Q3JB 1C5UA 2B6HA 5FHTA 3RC6A 3A37A 3FDIA 4IKEA 3K8YA 2KWIA 4JVNA 1TPSA 1QJ1B 2XTZA 4X8LA 2ZTSA 4F4OC 2XBXA 1E79D 1X6VA 1XD2A 3NXPA 5KTYA 2FIRH 1T8LA 3ATMA 2GCHG 3MO9A 4J0QA 1MZDA 4JT4A 3AVPA 1XP8A 2O9QA 3ATKA 2VP0A 1Z6JH 1U90A 1S0QA 2OLJA 1ELAA 3TE6A 2RGAA 3CRVA 3OFND 1DAIA 2FPMA 1J8AA 1UKEA 3ZZTA 3RXAA 4ABBA 3S1AB 1GJ5H 3SI4H 4JYBA 5AJVB 5ESTE 1PPGE 4HZUA 4TQUS 1DS2E 2EI8A 4BFWA 1C5YB 4PHFA 3VFEA 2R6FA 4A2QA 4UFFH 2ZKSA 4M9XA 5BYJA 1GZSA 2FZ4A 3EAJA 5J4HA 2AWNA 3GCOA 1T0HB 1D2EA 3PCRB 1TGNA 1YCPM 1KYIA 5GCHG 1HAXB 1DY8A 3SNBA 4ZKOU 1GCTC 2ZTYA 1VMAA 4DJZB 1U81A 1O3AA 1XMIA 4PC7A 1RD3B 4YLGA 2VQSA 2R2AA 3MRSA 3LWNA 1XD2B 5FR1A 1CIPA 5KNBA 5A0AE 1FUUA 3FFGA 1DLEA 4DCUA 3SBDA 221PA 3SORA 4B44A 2GGVB 3FVFB 3NBFA 4A0RA 3EX7C 2FFHA 4D0NA 3VB6A 1YPLH 4M1TA 3KEEA 1ESAA 5FL3A 4HFPB 4OKSA 1EXFA 3WYAA 1WF3A 5AUOB 4A1VA 5IHPA 4TTQA 3WMGA 1QA0A 2CL0X 4P4SB 1LS6A 3SU6A 3FKSA 1K2I1 4XOJA 1BH2A 4NIWA 3A84A 1EAIA 2UKDA 5LPNA 5ESBA 3KXLA 1OS8A 1NU7B 3SJOA 2IWHA 3KKQA 5PTPA 2RGBA 2VP9A 2JLYA 4K1SA 3SNCA 2F9VA 1IONA 4HZUB 2IUUA 4EPXA 3HU1A 2W2VA 3H86A 1X8LA 4ZKRU 2VA8A 1LS1A 4PQRA 2R3YA 3KL6A 3CNOA 5HKKD 3PM3A 1AWFH 3PR1A 3GY2A 2O8CA 1ELGA 4GSOA 1O2LA 5JYIA 1EFUA 4A0FA 4CRAA 1AS0A 1TONA 1CVWH 1CJTC 4M7GA 3OEEA 2OQUA 1P2VA 1GM5A 1EB2A 1T8OA 3DZ8A 1Q22A 2QT1A 3MWYW 1S6HA 4HB2A 1Y3XA 1NM6A 1UTLM 4D4KA 1SGPE 1D4PB 5B2ZA 1P2IA 1E9CA 3FHOA 5JHGB 2J3EA 1XD9A 2A2QH 1A0HB 1CHOG 4PQFA 1ZHRA 4AX9H 3GFPA 1VG0B 1W5TA 2MSEB 4Q66C 1M7HA 2V1XA 2ZXUA 1C1PA 3K0CC 3THXA 1BRBE 1O2QA 3IITA 1QHXA 3AGQA 4QBHA 1V2QT 1UEIA 1V2JT 4H1UA 2IX3A 4B3XA 2YC4C 3SUEA 1BMLA 3M5NA 3SU8A 3U60B 3LONA 4YLQH 4MGZR 1W0KD 2QTHA 4M9SA 3SOPA 4Z1MD 3PUWA 1GI0A 4THNH 2BMDA 1GSIA 1Z6GA 3NTUA 4MKIA 4I7YH 4WA7A 3M7UA 2G0NA 1QBNA 2UWLA 2G5VA 5DP9A 1KHTA 2FNAA 4P4TA 1LPKB 1JQJC 4KCGA 1KMQA 1BMFA 3CONA 3QKSA 4YQFA 4DW2U 5FTMA 3A7WA 3BE4A 2ODBA 3VB7A 2EI7A 1BTWA 1T31A 2W83A 3UNQA 1P05A 2XZOA 4GPTA 1J17T 3AF3A 4EIWA 3ADDA 1OWHA 3SZNA 5HCNA 1NSTA 1FNIA 1AKSA 5CIWA 4DSUA 1T8UA 3SUDA 3U7GA 5FBVB 2CDNA 4LV6A 3GY8A 1V2RT 1MT0A 1JI0A 2FPZA 3B1WA 1UO6A 5L3QA 3JZ2B 3EA7A 2WJJA 1CULC 1R0WA 4DIHH 2FFAA 2IN2A 3X2SA 3ZD7A 2WPLS 2ASUB 2VO1A 1AVXA 1ELBA 4P3YA 1C2HA 3VKHA 4IDOA 2ZRCA 2QA9E 4CEIB 2ZRJA 3ZZUA 3LGWA 3WYGA 1SB1H 2ANCA 4MNXA 1RTKA 1NLZA 2XRCA 1D6WA 2G4UA 1KK0A 2ZI3A 2D4HA 4KBFA 4FUIA 4W9MC 1UHBA 2BWJA 1DSTA 2ZDNA 2BDYA 1OYTH 4HGCA 2ZHWH 1JR6A 4GMDA 3GISB 3ADCA 1Z0DA 1WB9A 1RJXB 4QT8C 4B2CA 1P2QA 5TB5A 1WTGH 1KO8A 1FPCH 1O3LA 4R71A 2BD9A 1O33A 1AKSB 1DICA 5TY0A 4TQ9A 4DCVA 1O38A 3TNSA 1XEWX 1OLOA 3LIWA 2QMOA 1O2SA 1OPXA 3BS4A 1YCPK 3SUFA 2A4QA 3I8XA 1E0KA 3U9AH 1G8PA 2NU4E 3VGCC 1LY1A 2EVWX 2B8OH 3HYTA 4JS0A 2ZM5A 4ZXYH 1NFUA 3W6PA 4GAWA 3RXBA 4JZKA 1CRQA 1SGRE 1RS0A 1G4UR 3UNRA 1ELTA 2GVDC 2BLVA 3NK8A 3LH3A 2V0BA 1SKYB 3ND8A 3NBYC 5JSZA 4NYMR 4BNRA 3UG7A 4D8NA 2DWOA 3E1XB 2WPKS 5GDSH 4OQMA 1FAKH 1JXPA 1NG9A 2FYQA 1E69A 1MTWA 4PPFA 3D62A 2CLDX 3ZZ9A 2FOGA 3VNUA 3TR5A 3WBJA 4A1FA 4W5JA 2B5TB 1IBRA 1IN4A 1BTHH 3I77A 4PANA 1KDTA 3D7MA 1E2MA 4A5TS 3UPEA 3BTEE 4FMBB 4V03A 3Q85A 1GJBB 2D2EA 2NZ8A 1ZP6A 1GHXH 1ETRH 3DMDA 2XC4A 2QGRA 4ZDIA 3DL0A 1WV7H 1GG6B 4IW3B 1GJ8B 2F3RA 2C77A 1GVKB 2FE4A 1GHZA 3B85A 1BOQA 1H9IE 1K1OA 4XBCA 1HY3A 1BTXA 4IEEA 1K1JA 3O8DA 1S1CA 3BIFA 1KI6B 8LPRA 1QA7A 2WIAA 5JSZB 3LNCA 3QTVH 4LJ7A 2OK5A 1P12E 2P0EA 4XTCS 3T5GA 3CLVA 2RDLA 2BD2A 3QKUA 2GZ8A 3L3TA 4QRHA 3CRQA 1ZTKA 3MNBA 2RGGA 3BN9A 4QC2A 3QZQA 1VTKA 3X1DA 2CGAA 2C4FH 1AZ8A 2ONKA 2IF0A 1DWDH 4DLWA 3ZVCA 2BM1A 3T62A 3TK6A 4Y71A 3AQ4A 5CLQA 1X1SA 4D76A 5JEEA 4B3DA 1R5BA 1WAYB 3A8CA 3W8RA 3QI2A 3TIUA 1P9UA 3EARA 5JCZA 1Z0AA 3FP7E 2ZJZA 4CGZA 3T1QA 1K9OE 3K09A 1P3CA 3ZVFA 3KQHA 1O3GA 1XTQA 4NYMQ 2Z9IA 2ZAMA 4QJ4A 1KSJA 2PBRA 5ANRB 1CA0C 5TXGA 1GCDA 2FOBA 1NN5A 4MYUA 1Y3WA 2WM9B 2FO9A 2JIZA 3GDUA 4OK3A 1LDTT 3QPWA 1E1QD 3RANA 3ZS9A 2IT1A 5A8ZA 1WQVH 1QURH 5JRZA 1Q31A 3REFA 4N1AA 2ZHFH 4CDGA 4GOJA 1GAJA 1ZU5A 2J34A 4NZLA 2BVSH 3T27A 5TMPA 4XVRA 4MITA 3TAHA 1GI7B 1NFWA 4HEJA 1D3TB 4DDVA 1DAFA 3EZFA 4AFUA 1XPUA 1EASA 4R8TB 2JETB 2IEYA 2YWHA 4UJ3A 3TJUA 4O3TA 3RM2H 4OQLA 2GJKA 1EJMA 4A1XA 2ZF0H 5BQ5A 1H8HD 4TL7A 4TYNA 1T7CA 4CBOA 1CJUC 4WH8A 2WV9A 2OILA 1C4OA 4WH6A 4UEHH 1WUNH 1Z63A 3LT3A 2Z9KA 4KXFB 3IBYA 5F8XA 1AM4D 2QM8A 3GQBA 1RFLA 2GVZC 1NN3A 3C4JA 1B0UA 3VKGA 2XJ9A 4Q1BA 4ACAA 2ZDKA 1ZC4A 3RLFA 3UKDA 1XX9A 4I8JA 1MQ5A 2QAGA 2FOFA 1G7RA 1KDPA 2WUBA 1KDQB 4DSNA 3K53A 5HR5A 1CTQA 1XJCA 5AJXA 3W8NA 1O5FH 3AVZA 1ZU4A 4G5QA 2GVFA 2VHUA 3TH3H 2QMUA 4TY7A 3F9GA 2V9PA 4KYUA 3FHTA 1TNKA 3RLYH 1GOTA 1GWAA 2J41A 2ZJ5A 4I1SA 2QQEA 3LJJA 2BOHB 1YPHC 4AWXA 1U8ZA 4AN7A 2FGKA 3TLOA 4XFQA 2BBOA 2L0XA 1L7VC 4Q7YA 4Z8YA 1P01A 4ZROA 3UPUA 3VFDA 5LB4A 4LRWA 3NXSA 1UTMA 2JJ2A 4M22A 1NLFA 2J1LA 1XRJA 5FX5A 3UFAA 4ZDWA 1AMHA 3SJAA 5K8TA 2N1BA 5B57C 5JBQA 2HF9A 2FSHA 3ENSB 5DO4H 2YINC 1QBOA 4AG2A 4AGJA 2PJRA 4KHZA 2ZQ2A 1SLVB 3D23A 3P8OA 1K1NA 1G3IA 4EQ6A 3FMFA 1SVSA 4YMUA 4QM6A 3A8AA 1FDPA 2F43A 1TPOA 1O34A 1W7GH 4UKDA 3FFBA 1RIWB 1Q1EA 4RFSA 2HEIA 2H5DA 1N6HA 4HUQB 3LO5A 4BAHB 3GJ3A 3P20A 3LBNA 3KQDA 2BCJQ 4RD1A 1N1LA 1QRWA 1H4WA 4LHVA 2PKSB 4XWAA 3V13A 2WPMS 4YDSA 1M7BA 1FFHA 3VHXA 3N5CA 5A2MH 2XITA 1V2ST 2IYSA 4O03A 2ZG0H 3V12A 2ZP0H 2HF8A 1E1RD 4WXRA 5EXSA 4C0HA 1DO0A 5GNDA 4F49A 3W90A 1A1VA 1DWBH 2ILNA 5LPFA 4E07A 2JJ1A 3SBEA 1SG8B 4U02A 2DWQA 4JVMA 5JHHB 3B8HA 2IF2A 3P1JA 4M1MA 4Q7JB 1IJFA 5DI9A 3B6EA 3QG5A 1N6YA 3WRYC 4DLTA 4B33A 4K8BA 4XIGS 4BECA 3MGCA 5CITA 3A86A 5BN3A 2OC1A 1AB9C 2ZPSA 5EQSA 1RJ9A 4LBVA 2CN0H 1VJAU 4M21A 1I4LD 1AUJA 3VR6A 4Z54A 1JEDA 2GJ9A 4GHQA 1QHGA 3LXXA 3T34A 2BVRH 4K69A 2ZREA 1D9IA 3RXSA 5A0CA 4MG3A 1CT2E 1L4YA 3CIOA 3EA0A 1SXJC 3GD7A 3NH9A 4K3JA 1A4RA 1E9AA 1OKKA 2ZR7A 4URUR 2QF0A 4TY6A 3A81A 2WWGA 4O2RA 2C8ZB 3FZZA 4V0KA 1GRRA 5JS7A 1KAOA 2BDGA 1GMHF 1MKWK 3DPUA 1ELFA 2H9HA 3O8RA 4FVDA 7KMEH 3GFOA 4FU9A 3NKKA 3HGPA 2E1RA 2ZAOA 4Q1EA 3TGPA 2PKAA 1KK2A 1ELVA 1FY4A 4Q7MB 2A4RA 4QBFA 3F8TA 2O8TA 1QQ4A 4A8JB 4ZMAH 3U3KA 3EE0B 3SI7A 4BZXA 1RJ9B 4DDTA 1S3GA 2FS8A 2DWPA 4MYCA 1ZMNA 2IYXA 4L9SA 5FUXA 3SQXA 1WSSH 1FQKA 2FMJA 2AD5A 3VR3A 1MO3A 1C1VH 1WOFA 1F6BA 2ZRHA 1YC0A 1Z1JA 1E9DA 2PEZA 4AY2A 3RXDA 2QORA 2YWGA 5CB6A 2SNWA 1CBWC 4TMXA 1ZYOA 4TLAA 4BAOB 3QGNB 5C67A 3PTBA 4ZXXH 5EXNA 3RU4E 1QZXA 3TH5A 3RXIA 3CH4B 1YBWA 3D65E 1GRQA 5DSZA 1UTPA 4BEBA 4C0QC 2CXVA 2FPLA 4LPSA 2QM7A 3BXZA 3UWIA 1N6XA 3ZVRA 3GY5A 2AIQA 3B5JA 1O5CB 1P0SH 4MDFA 3UATA 1DE0A 3I72A 3VTKA 1FI8A 3S9CA 1Q12A 1KY2A 3K9GA 1KO7A 2H92A 3LJOA 5FTNA 4CRGA 4ZIRA 2ODPA 1G30B 3QKRB 2AYWA 4QL3A 1YRBA 4AB8A 2R62A 2Y80A 5AF9H 1W8BH 4K46A 1E79A 1LQDB 4LYFA 2TRMA 3EA8A 3VB4A 1GG2A 5DI3A 5JB9S 1N5IA 1XKAC 1ID5H 1Z22A 5KSOA 3PLBA 1L2TA 1QHRB 1COWD 3CX7A 2A9KA 2ESTE 2GEDA 4X8VH 1QDEA 3KJIA 4NCIA 4UQOA 1TABE 1U8AA 3LAWA 4GCHG 2J0QA 4NCKA 1L4UA 4Y7AA 1Z2CA 1MH0A 4EJSA 4DIIH 3RWOA 1FUKA 4LBYA 3EPJA 3ZLJA 3RRYA 3UY9A 2A7JA 3U1JB 4LOYH 1BIOA 4ABDA 2FWWA 1VITG 1FLEE 1KLIH 3WP0A 3RXCA 1RFNA 2ZSBA 3TSOA 1DTSA 1O2ZA 2ZVPX 3E3TA 1NZQH 1K8RA 4ZIRB 1Z8IB 1LW7A 2FX4A 5G41A 2QROA 4ABFA 4X8OA 4RJLA 1GUAA 2W6ID 5H4IB 2BEJA 2BOVA 3QXHA 5CK5A 3KL4A 4GI7A 1Q1QA 1ANBA 4JBWA 1JXOA 1UMAH 1E99A 5EQQA 1UBEA 1MOZA 4I8KA 1T3HA 3EAQA 1RW4A 2BOKA 1NY6A 2VSOA 1DVRA 2R6AA 4MPWA 5FH9A 2C3SA 4NCNA 5EZ5A 1V43A 1F2TA 1S3SA 1C1UH 3AK5A 1SGIB 1Z83A 4PAQA 2F9BH 3CENA 1YZNA 3JVVA 4FUCA 2Y5FA 1ANEA 4IDHA 3LDAA 1YE8A 1BTPA 1K5DA 5HKKA 2IOTA 4JL8A 3N70A 4R98A 1Q1BA 1UADA 2WMOB 1UAAA 1F3OA 4KO8A 4PHTA 3UWJH 5K7RA 2JA1A 4B2IA 4CRCA 2BJWA 1IHSH 1KSFX 4JL6A 3SJBA 3B8JA 4MLFB 1W36B 2IYWA 2ZE5A 1VGCB 3K6YA 3RC4A 3IIMA 5DYGA 1GBMA 4PZLA 5JWOA 4D4MA 2AGGX 2CJWA 1YZKA 1SVKA 2STAE 1IQHA 1ELCA 1NKTA 5GJBA 2J0SA 1N3BA 3BIUH 1WBBA 3K70C 3Q7PA 4IN1A 1OB5A 2O8DA 5A8YA 3BEFB 2FOCA 3STIA 2J0VA 4L16A 2EFCB 3ZZ7A 3AP3A 2TGPZ 2PSXA 3RXEA 3RXHA 5HE9A 4KODA 1N2CE 1MZAA 2WBLC 4NKRA 2RA0A 4BUJA 1UTNA 3WHLA 1GJ4H 1E9BA 2Y5GA 1O2XA 1XUKA 2XB2A 5EP2A 3HDTA 5LBIA 4X6OA 1EOLA 4TZ0A 1MO4A 1T0JB 4A6LA 3PENA 4MRVA 1HRTH 4TT3D 1TNJA 4Z1MA 1Y59T 4I33A 4RI0A 2HGTH 1XZPA 3S9BA 4MVNA 3QXSA 1ZCAA 4HAXA 5CK4A 4XE4A 2EWWA 5EJEA 1R4AA 3PWCA 2CJWB 3HK3B 3SHFA 4IMQA 1UFQA 4ZPXA 5F03A 4S35A 1TNIA 1AGJA 4DUGD 3PO1C 1UVSH 3AF4A 1ELDE 3W94A 2O8BB 1CT4E 4DWJA 1DOAA 1A2BA 3SI3H 3JZ1B 4AB9A 1U8YA 3IGFA 2J92A 3G0HA 1CF4A 1C5VA 3ZZAA 1SVOA 5L8VA 4JLNA 5EXPA 1GHAG 2V55B 4ZHAA 3F5FA 5P21A 9ESTA 1ZM2A 3CH5A 1TQ4A 3E8LA 2C98A 4HATA 2BVNA 2ORVA 2ZS7A 1LF0A 1J16A 4B47A 3B9FH 3EZ6A 4CIDA 3OY6U 3LRPA 3THYA 1AI8H 3PMAB 1FTSA 2MMGA 2RGDA 1G5PA 3H0KA 1G64A 4QNRA 4TTRA 3SO3A 1FZQA 3TVTA 1C5NH 1G8HA 2J7KA 4INKA 3HP1A 3Q3KA 3DM9B 2RKOA 3B9QA 1XUGA 1G3EA 1BRCE 1UF9A 2AMQA 2XXLA 5F9FA 4C7OB 5HM9A 3QX5H 3DDCA 2F3CE 4E05H 2D26C 2FZZA 1MAYA 4AFQA 5DGJA 1E2JA 1MO5A 3X1XA 5JI2E 5GWZA 3QF4B 4NWLA 1L8QA 3AKEA 3AUYA 2VLIA 2C9CA 3G82C 1TRNA 1ZGVA 2WJIA 1KAGA 4Y8XA 1HAIH 4IN2A 1DUEA 2ZFRH 4HLUA 4PSVA 2UVQA 1M7GA 2IUTA 4ASUD 1Q1ZA 4MDSA 4URVR 2J94A 1HE1C 2HXSA 4JMPA 2GK7A 1BS1A 1SGDE 2A7HA 3GICB 1OSSA 4WJG2 1PUIA 3CWQA 1A5GH 1P57B 1GL6A 5GJWC 1JRSA 3I92A 5KNDA 4TLCA 4KFUA 1TNGA 3LD9A 4DT1A 3AVUA 4OS7A 4HDQB 3QXJA 2JEOA 2PT5A 4DC9A 3LW8A 3KNXA 4PHGA 1D9ZA 3Q8XB 2CVFA 4BLTA 1TFXA 3SBKA 4PAOA 2HV8A 1QBVH 2QGNA 4YMTA 1C2DA 2W2XA 1ZNZA 1YQTA 1HAVB 3GCHB 5EE0A 1UPTA 3PEYA 3MO6A 1IXRC 3SJZA 1XWIA 2ZI7A 2QTFA 4X8SH 2OSBA 2HT1A 1GDUA 3GYMA 1Z8JB 2FYRA 3SDZA 4K81B 1QJ6B 1PUJA 3WY9A 1MKYA 2WSMA 1ZIOA 2PUXB 5B30A 5DK1A 3PMJA 4GHTA 3NIBA 5FPSA 2WZQA 2YWEA 2R0LA 3QGJA 2JLXA 4BFXA 4J2YB 1BJUA 3GY4A 3ZZ4A 3CS7A 4FMDF 1GL0E 3GDVA 2OXCA 3G01A 1EKBB 3OSYA 3RC8A 1RRFA 1KMHA 4A4DA 1ZTJA 3PTNA 3TJVA 3QOFA 1V5WA 1Z07A 4FUEA 4PROA 4ISHH 1TALA 2J9RA 1CGJE 1ZW6A 2W0SA 5GIBA 5CDFA 1LPGB 4OK5A 3K2UA 2TBSA 2X1VA 5E8EH 5DP5A 4URWR 5FUWA 1JIMA 1A2CH 2P67A 1WQ1R 2C78A 1O3IA 2GKVE 1XF9A 3QEJA 2TMKA 1KI3A 2ZTXA 4U01A 2BQ6B 3BFKA 2ZJAA 3FYHA 4Y10E 1S9DA 5J40A 1TGTA 1PPZA 4D82A 1NROH 1YLCA 1GI6A 6GCHG 5JI3E 2BY9X 3U7EB 4NU0A 2Q3HA 2P16A 1I4DD 2CL6X 1PZNA 4GZMA 1E2PA 2XAUA 821PA 2BCGY 1CU1A 2ODWA 3U8OH 3K09C 3F3YA 4NP6A 4QG7A 1KIMA 4C0KA 3KGPA 4TMZA 2IWRA 1Y5AT 1I4TD 5BPEA 1MABA 4CHAC 1AY6H 5JECA 1NC6A 1NVUQ 1ARBA 2ANYA 2ANMH 5EQRA 2A5FA 5T6DA 3RMMH 1YU9A 4Q80A 3RSOA 4EPYA 4D9RA 4B3FX 4C0BA 4LHWA 4LBWA 3CS0A 3MWIU 4BANB 1FN6A 4YDHB 3EIEA 3K0FA 4JL5A 2XOKA 3RS3A 1OXSC 3URCA 1O3MA 1ZTLA 1EZSC 4LJ6A 3NPSA 1TADA 4FD2A 3ELAH 1OYYA 3HJNA 3OE7D 1OFUX 2PWXA 1FJSA 1O32A 1X7AC 1KI9A 1GJAB 4X6MA 1OT3A 3RXJA 1H8HA 3GMTA 1NBME 3RRZA 1ONBA 1VDZA 2C03A 4KTCA 5SZJA 4DT7B 1II8A 2WOJA 3C16C 3P27A 3BTKE 2P93A 3VX4A 3SHCH 1EFRD 4NWKA 4M4SA 4IS5A 4DDWA 3S7KB 5HMAA 1Q20A 3FMIA 4CZ2A 1E2HA 5C20A 5ABWA 2W2TA 2CBZA 3ICQB 3MWJA 1XXHA 1DVAH 2RGXA 4C0LA 1E9FA 3B7GA 1GHBF 2BBSA 4HAYA 1Y5BT 2QAGC 3VAAA 4JLOA 3E5HA 4V0LA 1QFKH 5ELXA 1YZTA 3GLIE 2SGPE 1OXGA 4RVCA 4AGKA 3MFYA 1U99A 2D06A 1KYNA 3ZVNA 4AYYB 4Q7LA 1NIJA 2AFHE 4NA7A 1C1TA 2WICA 1SQOA 3VU9A 3FFAA 4FUFA 4ISOA 4R2HA 1RIWC 3NZIA 4AORA 3GJ6A 1CHGA 2VVCA 2VL7A 4KAXA 3AVWA 4Q4JA 1N5LA 4FINA 2OCPA 2V8OA 1AFQC 1QL8A 5FBEA 1VIAA 3BH6A 1D2MA 3C7KA 4D9QA 1WDTA 1QHHB 1L1JA 2PKSC 3HKJB 1C1RA 2ZROA 4PC6A 4R7ZA 1W14U 1P02A 2IHYA 4ON9A 2B7BA 4C2TA 3QXXA 2V6JA 4NYJR 4C9BA 1JXMA 1HTWA 4MUBA 1TRYA 2AH4X 4PZZA 3ZD6A 4M8NE 2A1DB 1TF5A 5EXTA 3ZVGA 3ZIAD 1SVMA 1UBFA 2EWVA 3T61A 3WP1B 2BLQA 1KLJH 4TMVA 2OFOA 1NY5A 1R2QA 1NBMD 3K9HA 2SGFE 1GBJA 1INCA 4GLYA 3Q9LA 2IA5A 2GZDA 2BD3A 1P3EA 4LXBH 3RXOA 2GDEH 3T29A 4KTUA 3AVXA 3PYHA 3WHKA 5DN6D 3LX8A 4YMSA 1OPHB 1E98A 1BUIA 1E1RA 3GLHE 2VPPA 4MDEA 1SQTA 2H5EA 1T4VH 1TOCB 1LPZB 1FZZA 4XVQA 4HDCA 1W1WA 2QN6A 4Q00A 5GJVC 1Z0JA 2GHIA 2GDJA 4D7GA 1FMGA 4TLEA 1KI8A 2Z9LA 3TGJE 2BV3A 3QEOA 1ZC3A 1EFTA 4A8JC 4K1EA 4P32A 5UKDA 3P4XA 3M61U 4QGHA 3BTFE 1C1MA 2PGBB 2ZU5A 2F55A 3SJIA 2J0UB 5BYKA 1BITA 5FCKA 3H2YA 4BAQB 4D0GA 1AFEH 1HIAA 3QJYA 1HJ8A 2FLBH 4I8GA 2FSIA 3DVLA 1GHVH 3U5ZB 2BY8X 5FX6A 1NO9H 5GJ4B 4FCTA 4CT5A 3IPYA 1Z0FA 2ZRBA 4EPRA 4Q21A 5FXLA 2ZE7A 4NYJQ 2WJGA 4RD0A 2RGCA 3AVVA 4NL4H 1O31A 3GEEA 1MD7A 1QRXA 1C5WB 5BN4A 1C1WH 2VP2A 3P26A 1DWEH 3BAFA 3A89A 1EESA 2P2LA 3TVJB 3B1VA 4PSAA 2WPIS 1EX6A 3ZS8A 1PV4A 5JWHA 5K8UA 3QVUA 4YT6H 1NTPA 3MNCA 2CLSA 1OOKB 1FIWA 4RD4A 3A36A 4PAMA 1W48A 5AUPB 1W2HA 1VG1A 4KGAA 2O8MA 2OXSA 1YPEH 1E2LA 4HB0A 1PYTD 4YC7A 2FTMA 4G1UC 2EFGA 3SNDA 1O3DA 3PUYA 3SC3A 3NBZC 5JEDA 1J15A 3P17H 2VWLA 2PFEA 3MU5A 2ZHQH 1KLTA 1AZZA 2RMKA 2IYYA 1BYIA 5TVKA 4JZ1A 3LLUA 2X19A 1ABJH 3T1VA 4IFEA 4BWYA 3KZ1E 2J87A 2DFKB 2AKYA 2ZCHP 1Z6XA 4DLSA 3ZZDA 3RNLA 1A3EH 3RRMA 2QENA 2IW3A 3NBXX 3BTGE 4NMMA 3AAVA 1HT1E 1YZLA 2V54A 5KSZA 1BBRE 3QF7A 5IYTA 2Z4RA 1ZMJA 2Q6TA 1YZGA 4BAKB 2GD4B 4D2IA 3RXQA 1BDAA 3VPKA 4BFSA 1GKUB 1NN1A 2FLRH 5JJLA 5BN5A 1BO6A 2XBVA 4BFUA 3D3QA 1A61H 2A5IA 1VR1H 3AM1A 4LHZA 2V3HH 4YO9A 3LGTA 1AVWA 4IDPA 1COWA 1NVVR 2AR7A 1ANKA 1N6OA 1O2JA 5DO9A 2HPQH 2YNMA 3ASZA 2CHQA 3A88A 2ATXA 2C8YB 2EQBA 1RGQA 4HLCA 2PH1A 4ERNA 4H4FA 3BIVH 4KBGA 3A7ZA 2FS9A 1B0FA 1TPAE 5FI0B 4YONB 5KYKA 2LPRA 1ZRBA 1MV5A 4E09A 3QBTA 5AVDA 1XTSA 4EFMA 3CZQA 4LUCA 1CR0A 2WPDD 1P06A 5LH8A 4LHYA 5LDDC 1IY1A 3U44A 5FAHA 2PMKA 1EUFA 1QHSA 5EG4A 2GXUA 4IMZA 4UXJA 3SU1A 2IYVA 1EWQA 4AZ2B 3L82B 3BB3A 4YT7H 4H1VA 5D3MA 1P03A 3BV9B 2W6IA 2ORWA 1M2OB 4M1YA 2B0FA 2B8TA 3UOUA 2NU3E 2XSZD 3HATH 5EXXA 1F0UA 4UDWH 3WRXC 2C9OA 3SS8A 2GCHF 1R0ZA 3HGNA 2QPTA 4PC2A 1G1MA 2PGQB 4JK6A 2ZR9A 1FTNA 4YXWA 2F1RA 4ABAA 3C15C 4MA4A 2BDBA 1IOEA 2NPIA 4JSTA 6CHAB 2HUPA 4W5WA 4PPQA 4NSVA 1L0ZA 3S0NA 1I2DA 2C5LA 3TQCA 4NBSA 4LV8B 1HAZB 3U44B 2H57A 5FUVA 1NRPH 1V2UT 1JR3E 5DGXA 4GT1A 5BWMA 1G19A 3G5UA 4TQAA 3RXMA 2FP7B 5GCHF 1C4Y2 5HXFA 1NVVQ 1DE7H 1SGTA 5BRRE 4DRZA 3QKTA 1SSXA 4IBLH 1XTIA 1FIZA 2CCKA 4LHXA 1IQPA 2H7VA 4JCNA 2GAAA 5GADl 1ODFA 2YJTD 4TTPA 4XJXA 3U3JA 3QN7A 1J7KA 4K60A 4FMDB 3EA5A 1BB0B 1SXJE 5EE9A 3CPEA 2XBWA 2A4OA 2ZI2H 2PCLA 3TIFA 2W5EA 1JOUB 1AUTC 3KQKA 4KKDA 5EGMA 4LYHA 3RXLA 3R8CA 1IHTH 4U32A 2Q6FA 4ESVA 1Y3UA 1Y3AA 3CNNA 2FXRA 1DARA 3M6AA 1DITH 4IJMA 3BTTE 5T6GA 3K0SA 2QE7D 3GPLA 1UTJA 4K8OA 1H8DH 4TT3A 3BORA 1HAPH 4NCHA 1XPOA 2VYFA 2ZU4A 2WINI 4FIDA 4LZZA 2TGTA 1E4YA 1YPGH 2AKAB 1AQUA 2O52A 1N8OC 3C1KA 5AJYA 4LJ4A 4NGAH 4N3NA 1UDWA 4V0NA 1ZZZA 2UUYA 3GLGE 2ZUDA 3SGAE 2J95A 1TA6A 1Z28A 3RU4T 1R8QA 4WXVA 2CK3D 4O3UA 2ZFSA 4MGIR 3K6ZA 4TYPA 4M0LA 1DANH 1CGIE 2GV7A 4M9FA 3T26A 1WA5A 1FNMA 4BLOA 1QIXB 1Z29A 3U61B 2IJOB 1E4VA 1CHOF 1FY8E 1TMUH 3IHLA 4QKQA 1C4V2 5FPTA 4AD8A 1O2UA 4JVLA 3DHWC 1W0JD 3OU0A 4LGMA 5EPNA 2CV3A 1XFAA 3ATIA 4CEHB 5T3HA 2C90B 2VWMA 4LC1A 2AMPA 4CEJB 2G1JA 2CCGA 3FHCB 5C1YA 3NWJA 3CRMA 1UTOA 5LPRA 4PZYA 2IYLD 2JH0D 1G3QA 4ABJA 1XM1A 2REOA 3AVYA 1ZYUA 1LTQA 4AK9A 1OP2A 3BG8A 3SN8A 2ZJ2A 1GDDA 3E2IA 2XNDD 3W95A 2VVUA 2QMEA 3FP8E 4BTTB 1SXJD 2IYRA 5JCPA 3L0PA 2WTUA 3OEHD 2F4LA 4WMDA 4TLDA 2ZJOA 2P95A 1O3YA 5DP3A 2FEOA 3QNUA 1XUJA 1TMKA 4XD7D 2DYKA 1ANDA 4CR5A 2F9OA 4P31A 4XWOA 3QDZB 4ASUA 2VHCA 2IUSA 3EIHA 1G9XA 1GFIA 1W44A 1B0EA 1XX6A 3K0AA 2GKSA 3QPUA 3TNTA 2AK2A 4TWZA 1PVOA 4HLUC 2KAIA 5F8ZA 5HPYB 1HJAB 3Q00A 2HLDA 2IK8A 1EAWA 1LMWB 4MPXA 3QZRA 2QL6A 3DEFA 2BQ7B 4EFNA 4FN5A 3UG6A 3FE2A 2J7PA 1F0SA 4S2EA 4BPBA 1FY1A 1HJ9A 4Q7KA 1GJ6A 1TNLA 1S1MA 3IO3A 3M3SA 1O3CA 1FOEB 2ZRDA 4DHEA 4I81A 3KUCA 2O8EA 3QENA 1IQFA 2PZFA 2ZE8A 2ZGJA 2TIOA 4YESB 3SGBE 1UKVY 3BK7A 5JMTA 2Z5FA 1G3UA 2QBYB 1CO7E 1VCMA 2P3UB 5EE1A 5E4FA 4Y8YA 2P8OB 2XC0A 2IYQA 4Q1CA 1KIGH 4X8MA 2PT7A 1PLJA 1Y5UT 3SV8A 4WZBE 2TPIZ 2ZPRA 2FI5E 2PZGA 2BB4A 3GEHA 1VIYA 1GI5A 2R9PA 4OHXA 3S1AA 4EPVA 1P2JA 2VRWA 4JLPA 1FAXA 2FEMA 4QOSA 4AKHA 2JLRA 3K9LA 1LQEA 4M1WA 2PTNA 1O39A 5C1UA 1YZQA 1Z2AA 1SQ5A 4E06H 1TQ7B 1R8SA 1E96A 5EW1H 4JYVH 1XZQA 3B1ZA 2O8EB 2BD8A 3FAOA 5H68A 1O3FA 2RCNA 5DHFA 3HR8A 1XCGB 4JZDH 1TNHA 2XX3A 1MBMA 1Y3YA 3R20A 3RS7A 2ZRLA 2NO0A 3I73A 4HLQB 1S4QA 1RXPA 2QIQA 2CMKA 2IBMA 2Q9BA 4OHWA 2GXSA 1C5RA 5GXPA 4P4SA 1G3MA 4LSGA 5FBLB 3LQQA 2MSDB 2KB0A 1S81A 1WQSA 1BKDR 1YZUA 2VHJA 4ASHA 1O5BB 4PFSA 1W3CA 2IJD1 1GBEA 4Y0VA 4H9GA 4IRUB 2J45A 3EYDA 1YLDA 2D1JA 2D62A 1YP9A 5KDLA 1TEVA 2WAXA 4TL6A 1Z6YA 3HPRA 2VSFA 3X1WA 4BFTA 4KLNA 2C8WB 2W26A 5JBCS 2ZU2A 1GI4A 1W36D 3IQWA 3LGIA 3AW0A 2VIPA 2F91A 1PQ8A 3FZDA 5E0HA 5EQTA 3KJHA 3IO5A 1N6KA 1XKBC 2CE2X 1E0SA 1ZD9A 1G37A 4XSHA 5FOTA 4U7DA 1E36B 4UFEH 1XUHA 3NHAA 2R8RA 4PO9A 2ZU6A 4U30A 3ZYDA 1RC8A 3M5OA 3N7OA 1HV8A 2G6BA 3GP8A 3OE7A 3A83A 3TNFA 1UJ2A 2ZYVX 2FDCA 1SHYA 4WXIA 5IDVA 3MHWU 5E7MA 2BD5A 5T6FA 3FVQA 2FPKA 1JJVA 4ZKNU 2P3SA 2FSFA 2Q9CA 2NG1A 1NVWQ 1J9CH 5KO2A 1KXCA 3N2IA 4URYR 2XC5A 1A5HA 4LK4A 2BC9A 1C5PA 2GCTB 3M37A 1GBDA 3OEED 1C1NA 3QPVA 1EFRA 3K70D 2UWPA 1EG7A 1MTNB 4PC3A 1WRBA 2GESA 4TYWA 2QXGA 3R0FA 2O8WA 4BLRA 4NPHA 1BA8B 2GBLA 2FDAA 3M1IA 1YVDA 1UKYA 2EC9H 2QA5A 1Z47A 2W7UA 3TGIE 3FPAA 1A0JA 2R44A 2XWBI 2WWWA 2A2ZA 2ZU0C 1GJ9B 2DBYA 4OQNA 1V2TT 3MU4A 4MTBA 3A8TA 1UK4A 3ZVEA 2GP9B 1T3SA 2BKEA 1PJPA 3KX2A 2HJVA 2BM2A 2FWRA 1GITA 3LPRA 4BXWA 4NFFA 2WWIA 5HCIA 1IQMA 2P6UA 4HLDA 2K1QA 5DP7A 3RM0H 2Q3FA 1IAQA 3N2EA 4FMCF 1AHTH 4AOQA 1Q57A 3SQEE 2Y5HA 1EJAA 1P60A 3AF2A 3EA9A 3RDPA 3UNSA 2QNRA 5AK0A 1SGFG 4CEIA 4B74A 2BX4A 1HQYE 1RPZA 4INLA 3THWA 1T8MA 1FP6A 3UQOA 4CRBA 4DJTA 2DFLA 1NPMA 4Z51A 1O3PB 5T1VA 3TUJC 3LVQE 3NUMA 2XEXA 1QQUA 2V35A 1ZUNB 4TSFA 3PV2A 5FR2A 1BTZA 4MNVA 4LZ1H 1P2UA 3HKIB 1ZUHA 1V2LT 5B64A 5DJ7A 4XSKU 2IHBA 4CVNA 2AL7A 3S69A 5HZHA 1NBMA 3CRRA 2SNVA 1Z6TA 1E2QA 2CF9H 3LBIA 3AP2A 4B43A 4FUBA 3MAAC 1P61B 4AG1A 2VSXA 2R6CA 1KI4A 1ZINA 1K1MA 4NIYA 1G20E 4MKHA 5EUMA 5JJIA 3BTWE 3T2NA 2C2HA 5IT5A 2ZVQX 3CF0A 1TBRH 4VGCB 1YKSA 4Y8ZA 2A7QA 1OWIA 1FN8A 3U3RA 3CWZA 3C5CA 2JCSA 1F60A 3SJ8A 3EASA 1WP9A 1DS6A 2AHOA 4KVGA 2LKDA 1XTKA 1VG9B 1P2TA 5CIQA 2IS2A 2H9TH 1D6RA 1TMTH 1TPZA 3THWB 3V9PA 3A7YA 2WKRA 2WVJA 1DO2A 1RVDA 2V7QD 3BB4A 5KDOA 1N6RA 3PWBA 2QAJA 1YR8A 1E0AA 4JMYA 4OI2A 4JBYA 2QP4A 3RHFA 1R7RA 5CE1A 3ZQJA 4BRWA 5AUNB 2R0KA 3BH0A 2GZ7A 1V2MT 1OWEA 3GOVB 1FP7A 4DURA 1E0FD 3UXMA 1TX7A 2QU8A 3L43A 1KKMA 3A1SA 1RRGA 1VHLA 5KSYA 2P5TB 1WMSA 2H6MA 4FU8A 3I61A 1SFIA 3K65B 1F2UB 1LVYA 1DFPA 5J4LA 2X2EA 2OCBA 3PJRA 1T8TA 4IOLA 4I1OA 1CJMA 3DUXH 1S0RA 1ZJKA 4NIVA 1LVGA 2ZFQH 1IQEA 3AP1A 2PR3A 3MH4A 2AN9A 2ZITA 3A7VA 1KI6A 1W11U 2GXAA 1UK3A 2Q0HA 3TJNA 2JH5D 1AQ7A 4DLZA 3GLIB 3SU4A 1NRQH 2PLXA 2WUCA 2FM2A 1EX7A 1EQ9A 1W12U 3A7XA 4MNYA 1QF9A 3PG5A 1R5NA 1GP2A 3PIRA 2FOEA 4NYIR 1THSH 3GYLB 2A7CA 4LY6A 2P6RA 1BT7A 4BEJA 1TYNA 2IS6A 1LHCH 3E90B 1T5LA 1RIFA 1ZMXA 1HQCA 4YMVA 2CNWA 5J4VA 3BGWA 4PTLA 3GLHA 4PPGA 1EFCA 1TGSZ 521PA 1KNXA 1U9IC 1XJ0A 5AR1A 3RMLH 3M35A 4GUXA 2JLZA 2NMVA 4BZPA 4FUDA 3V7TA 2XTMA 1MH1A 2BDCA 4NA8A 3H7OA 2VBCA 2OLGA 2VJ1A 4OS4A 4MPUA 1QHNA 4FXGH 3CPJB 1GBFA 2IPHA 1HB0B 4CRDA 1AKYA 2IXGA 3CUEF 2SGAA 3ND9A 4Q19A 3TBKA 3KXIA 1AJEA 1TOMH 1EZQA 3RABA 2W6JD 2D3WA 1ZM3A 4K8YA 4JT2A 4M1SA 4HI0E 1C1YA 3AKDA 1LVMA 2AWOA 1DEKA 1QHYA 3PUZA 5CYOA 5JFGA 5DPAA 1PPCE 1BRUP 2A30A 4NH0A 1D3DB 1D2NA 4FU7A 2GZAA 3MNSA 4ZHLU 3DOEA 4Q1AA 1T6NA 1NNEA 1S6FA 4JLJA 3GLHB 2F9MA 2WKPA 1QRZA 5JBBS 2XGJA 2SGDE 1XPRA 5EE3A 2YNBA 1F92A 2WSSD 1CRPA 3KTAB 3P8FA 1P9WA 3WNBA 4LOAA 1II9A 4GRAA 1XBTA 4ABGA 3ATLA 2BBTA 2G1KA 2IYZA 2JIZD 1O2TA 1V2OT 4MYHA 3SHWA 3T28A 2NWNA 2TGAA 2FI4E 1JNYA 4X1PU 3UMFA 3J81k 2GETA 2RHDA 3VB5A 2QAAA 1FV9A 3EPHA 2BMFA 1AS2A 2WHXA 1OWJA 4Y79A 4D0LB 3DM5A 6CHAC 4X6PA 2C8VA 4Q4AB 5L2YH 2QC2A 3PUXA 4OHYA 1G6HA 1TMBH 1LFDB 3FKQA 1BIFA 2REXB 3PROA 2G9NA 4ZCLA 1W2GA 3WMFA 1OWDA 5J4KA 4RN6A 1KDQA 3RXPA 1F7ZA 2G77B 4F7WA 1CA0B 3PUVA 4KFRA 3SV2H 4TWWA 1GI9B 1TUIA 2GCOB 2XTTB 1S83A 1QNJA 2Z0MA 7GCHG 1ZVQA 2GJAA 3O8BA 1XUFA 3B60A 3UIEA 5JDUB 3VXFH 5HTKA 1O3NA 4DEYA 4GCHF 1ETTH 2QYIA 3ZZ0A 1P8VC 3ZZ8A 2YOHA 3TRFA 1Q21A 3VR4A 1LHFH 4MQBA 2PMDA 3ZVMA 3SV7A 4OI1A 1TPPA 4C30A 3VMFA 3W3ZB 5EUQB 2AXPA 1TQ0B 1ZJDA 3QQ5A 2OBLA 1VITF 3I8SA 1T8NA 1QVRA 4XSGA 4UE7H 1II0A 4JLKA 2GA8A 4EDHA 2OP9A 5BXQC 4Q9HA 4ARZB 4PC1A 4DG4A 2BVXH 3MU8A 4A92A 3IHWA 1FUJA 4X2YA 5CM8B 621PA 3KCGH 1HYQA 4JBXA 1TGBA 4MNWA 2X77A 4X2WA 1G32B 1V3XA 3CKLA 2YVUA 5A5GA 2NIPA 4DB4A 1LCYA 2ZGHA 3KJEA 2IEZA 4P0TA 5J5CA 1GBBA 4BLSA 4HUQA 1QVAA 3D8BA 2IYTA 4I32A 4II7A 1AK2A 3FTQA 4ABIA 1SGCA 4DLRA 2E9SA 4TMTA 1KJWA 3I5XA 1C5MD 3SFVA 2FFBA 3MO3A 4W5HA 5J47A 2HALA 5F9HA 5CYPA 2EI6A 4MRNA 2AEIH 4DCDA 2QE7A 2JH6D 4IC6A 4WIAA 1AU8A 1WCZA 4M9QA 5FPHA 2P65A 4CH2B 2Q3MA 1O5GH 2E87A 1CJKC 1CP2A 2ANWA 3KQEA 1J90A 4GOKA 1RKBA 4GDFA 2GT8A 4UNQA 3KKOA 2QSYA 3QVVA 1GMCG 1FX0B 1C2EA 3ZZBA 2RA3A 4RZXA 3GCTG 4AIIA 1N6LA 1VCPA 2OTVA 4OS1A 1VCIA 3VB3A 1HAHH 3MU0A 1VYVA 5TDHA 3SR0A 2BDIA 4DSOA 2OD3B 1O36A 4C0SA 3BEUA 3EG5A 3MJHA 2WJVA 3F0TA 3DHKH 2BXTH 2P59A 4G5RA 4G5GA 1DELA 2UUKB 3SNAA 3LKWA 4M53A 1W0YH 3TH2H 1NRJB 1YR7A 1P2KA 4POAA 2BY7X 1N0WA 4BTUB 4TYQA 1F0TA 2BYAX 1K1PA 1L1GA 4MQAA 3S7HB 1KKLA 5L3SB 2AD1A 2YHSA 1TEXA 1R6BX 1O2YA 2ZQ1A 3CR7A 4AC9A 2FFQA 1KXBA 2BHRA 2ZS9A 5BW8A 2JJ1D 1SGWA 1C5SA 3EWSA 3HYRA 1C2GA 1SHZA 1HGTH 2BMEA 2AMDA 2BEKA 5FBQB 2ZCKP 3MNXA 1F2SE 1GMDG 4BE7B 2F9PA 1HXEH 1L2EA 1HJAC 1SC8U 3GJ7A 4I8LA 4ZH8A 1C5LH 3RXRA 1HYLA 4A8JA 2XNDA 1OH8A 3IPXA 4B2AA 1Z7KA 1TQ2A 4CR9A 4ZDJA 3OEHA 3PXGA 4XH9B 2VIIA 3C8UA 1JEEA 4X1RU 2NPFA 5JRJA 1O5EH 2G3YA 3OZXA 5KNCA 4RKOB 2ZTZA 5KSPA 2ZGXH 2HNTC 4QHSA 4MKGA 3CZPA 4OHVA 4B3CA 1OKKD 4A7IB 4I99A 2VIWA 3PLPA 3SN6A 3UREA 1GHAF 4RCYA 4AYVB 1C5OH 1TX4B 1E3MA 2QRNA 1O3KA 4OS2A 1UK2A 1WBGB 4C3ZA 4LJ8A 1B7XB 1JALA 1O3HA 2P8OC 1DAMA 3A7TA 2ASEA 2A5KA 4ZV4A 1E2KA 5A8XA 3AV0B 4O97A 1E2EA 4DOQA 1S0UA 1DX5M 4JYUH 1P3JA 2FV8A 3AKYA 2HOBA 4EAQA 3SHAH 1O2HA 4B32A 1CS4C 5FBIA 1WCV1 5FPKA 3RYTC 1SBWA 1SXJB 2GV6A 5AFZH 1P9NA 4Q1DA 3TW8B 1DY9A 1QGFA 4FWTA 3QKRA 5H8WA 1P4SA 1T4UH 2YC2C 2GRJA 1J8MF 2R65A 2ZFFH 3ECCA 1S5SA 4FMCB 3D31A 1L1NA 1M1YE 4DLVA 4TMKA 5G3YA 1WU1A 4N0DA 3BTME 2CJIA 4ZO4A 1G21E 3RUOA 1W49A 3BG4B 1HE8B 1ANCA 1HFDA 2D2FA 5FOVA 1O3JA 3I4LA 5KDDA 3NDBB 1CKEA 1XTRA 3P32A 4DY7B 3GLGB 1XCPA 2A45B 1Z0KA 1RYFA 1EATA 3PITA 1K6MA 1UCYK 1JRTA 2ULLA 1BTUA 1GKIA 4MH0R 4F38A 4PX9A 2ALVA 2EA3A 3KUDA 3TSZA 2ZGCA 4UNRA 5FI1B 1CBWB 1YJ5A 5TCAA 3RS4A 3B9PA 2FGJA 1DXPA 1FNNA 2FH5B 1AIXH 1SVPA 5L2ZH 5I46H 1IQLA 4HZIA 5FBWB 1N6NA 3BTHE 4LYJA 3I5YA 4X1QU 2RGEA 2H17A 1CSOE 4Q48A 2OC8A 421PA 1AKEA 3C27B 4ESHA 4ZI3A 3I62A 3Q77A 3NC0C 1DAEA 4R0IA 2BLWA 3FWYA 1G5RA 5AUQA 1MU6B 5TCCA 4AFZA 2XCFA 2ZQ5A 2OESA 1NMXA 1TB6H 1A3BH 1M8PA 3OFNA 1KTVA 2PEYA 3AW1A 3QLPH 4Z6AH 3MSXA 3KQLA 2ZETA 1DXWA 1G3CA 2CXXA 4QGFA 3RS0A 3T06B 2ZCLP 1ZJ6A 4JZFH 2ZPQA 1KXDA 1QCPA 1B5GH 3KFVA 1N0UA 1PLLA 5EW2H 4HB4A 3CPHA 1UTKA 2ZSFA 2OCYC 3RXUA 5KHOC 1X8JA 1LHDH 1VG8A 4M2LA 1TAGA 1KO1A 3SEAA 2GEVA 2Z6BD 5EXMA 2VWOA 1KO4A 4NCYA 1BHXF 1TU3A 4P4UA 2YOLA 1ACBE 2GCTC 2DFTA 1NMZA 3LXRA 1Z3IX 1MTNC 1SL3A 1O2NA 1JBUH 1GIAA 1THPB 4DLYA 4MKFA 1XVMA 2JGNA 1P72A 3RU4D 1NP6A 2G55A 1O87A 3QE0A 4UJ5A 1FMJA 4ISIH 3VR5A 2FU5C 2OXRA 3K0EA 1XB2A 1UBCA 4OM9A 4UNNA 5KOYA 4GL2A 3CF6R 4ACBA 3PV4A 2WJHA 4GBMA 1TX8A 2JDID 1T9HA 5IK2D 4CRFA 2W3KA 1S2MA 2CCJA 5AJWA 1LVBA 4FVBA 6GCHF 2ZHEH 3LC5A 4XBBA 3LVRE 1TTTA 4Y7BA 1BZXE 1JQLB 1A5TA 3GEIA 1R5OA 2PUQH 2VH6A 3BFVA 3TSWA 5C4GB 4DVGA 2FF7A 2KE5A 3F68H 3GCGA 5HYOA 1MQ6A 1QG2A 2OBNA 4F4JA 1VJ9U 1LHEH 4BFVA 1FW6A 3LY5A 3UMRA 3K1JA 1O2IA 3C5HA 5EOKA 3U6KA 4D6PA 4FUGA 1VKJA 4R2IA 2O8BA 2C96A 1TRMA 4V0OA 2EFDB 2GBLC 3LX5A 3BC1A 1UKZA 1Z6AA 2G4TA 5CB8A 1NJGA 2ODNA 1HCGA 1Q3TA 3QY0A 1AN0A 1GNQA 2O8CB 1OJLA 1ZPBA 1OYWA 3BSQA 2I1QA 4URXR 2GAOA 2DCUA 2Z94A 1Z8FA 1LVOA 4WVPE 1W0KA 5E3HA 1EGAA 2FSGA 2VP5A 2XBYA 3K70B 1UTQA 1AE5A 3AF1A 2DFNA 1PQAA 3NDPA 3TR0A 3QUMP 2LNCA 3MH7A 3UTUH 4GP6A 4VGCC 3NVAA 3CW2A 3NH6A 1HXFH 2WMNB 2OUKA 3PMHB 4JLDA 1FQ3A 2OHFA 3BJIC 1LO6A 1IN5A 1S85A 1HH4A 4C7OA 1SGEE 4W7SA 5M04A 3WBKA 4MRPA 2QTVB 1IQKA 1XU4A 4RZUA 3THXB 3QF4A 1MKXK 3SYLA 4Q18A 1KTSB 1PPBH 1P2SA 2DB3A 3OIUA 4H42U 3UR9A 2ZRKA 1BBRH 4UFDH 1UM8A 4Q03A 3LU9B 4FUJA 3NEJA 5TJXA 4DCTA 1GL7A 4BFZA 3AUXA 5FUYA 1OP8A 5F8TA 2X2FA 4X0WU 3U1IB 1IQGA 4MRSA 2OBOA 3E1SA 4JYTA 1DPFA 3PO1B 2NOAA 1S84A 4IFBA 5DYIA 1N0VC 5FBRB 5KPJA 2B8WA 4C0JA 4F92B 3QSYA 4Z0KA 5A4JA 1X8KA 3CM0A 1E2GA 2I3BA 1G3RA 2XJ4A 4RD3A 3QKSB 3ZYCA 2BD7A 5C5OA 4F4IA 4KSCA 2JATA 2BDHA 3R9XA 2WWYA 3KF2A 2RGNA 2V7QA 1YF4A 2VP6A 4BGDA 4G5SA 2QP9X 4D81A 5DP4A 3LDXH 2PV9B 4OI4A 3RAPR 1BRAA 4AKGA 1C9PA 3SFZA 1EPTA 3E6PH 5A0FA 3MG9A 2OM2A 2DHRA 8GCHG 1HAVA 5TV2A 5DNYB 3BERA 2WAYA 3HPTB 2X8AA 4D4JA 5CDFE 2EFHB 3RXGA 5L3QB 1Q0UA 1ZNWA 1QL7A 2IC5A 1ZUIA 5DKMA 3RLWH 4UNPA 1SGNE 5C18A 1KK3A 4KFTA 1TQ6A 5CMXH 3MI4A 1QB1A 4TPYA 3SNEA 3VKWA 1OHHD 2CHVA 2R6DA 3ZVBA 2OUAA 2ZJ8A 2FOHA 1W13U 2GTBA 2AXNA 4N0EA 2CHAB 3L0IB 4JLBA 4WOPA 4A2WA 5LGOA 4ABYA 4L8GA 1SOZA 1GG6C 1UHBB 1EJNA 1G36A 2WWFA 1WBDA 2ANBA 1EP5A 3H1TA 2OO7A 1O3BA 4BTIB 3IILA 4Q1FA 3PQCA 4WW0A 1GBCA 1EPTB 2HPPH 2XXAA 1QRAA 4M9ZA 2HYDA 1EX3A 1I2MA 3A4NA 3ZH9B 2PW8H 1DAHA 2V4ZA 2ATVA 3D6TB 4ZKSU 2ZIAA 5I25A 1PQ5A 1TNDA 1O2MA 5AWFC 3W5IA 2H16A 3BTDE 3CBQA 1E0JA 3SJKA 1PYTC 5EXLA 1HA3A 3B13B 2GCPA 4RSGA 2QY9A 2Y8EA 1XMJA 1E6CA 2QSZA 1KI7A 1YPMH 1EP6A 2PX3A 4RZ2A 2ZC9H 5IRCD 1EFHA 2A32A 4JLMA 5JS8A 1GHWH 3EW9A 3A82A 2I1VB 2QXHA 4EPTA 2VIOA 4HSEA 3FP6E 2ZDAH 5C3NA 2FMXA 2G5NA 5GVSA 4Q9IA 2PCJA 2VVVA 3H7TA 2W6JA 3U6BA 4YOJA 3RP2A 5DIFA 3IIJA 2XXAB 1XVOA 1OFIA 4AG6A 4YZUA 4XOIA 3ADKA 3E91A 1IY2A 4TMWA 2FA9A 1Z8RA 1J8YF 4YTAA 4HZHA 1GJ7B 3EQ0H 1M34E 1NMYA 1XXHE 5H70A 3EXAA 2O0KA 2XW9A 4L5BA 4IGDA 3R9WA 1BTYA 2GZ9A 1GI3A 1CR2A 1LF5A 2ERXA 2WSSA 2WPJS 1AGPA 1YPKH 2FOMB 1X3SA 2ZWLH 1OIWA 3Q5EA 5GVRA 1XD8A 2ZIQH 1ARCA 2VHTA 4TWYA 2JETC 3P70B 1IXSB 2AK3A 3U3OA 2FOAA 3UQVA 1TF7A 3OIYA 3WNCA 1UCYH 4B1TA 1E1QA 4RZ3A 1TLDA 1KZ7B 5A0BA 3TK5A 2A5AA 4HAUA 1F48A 2BY5X 3F6UH 3TKLA 5JB8S 1UDXA 1TAWA 1O2WA 2ALPA 3QG1A 1HUQA 2G83A 3CRW1 1P10A 5JZVA 721PA 2F1JA 1G5TA 2VF7A 3W5JA 1SR5C 1ELEE 1Z5ZA 4KFSA 1N5JA 4RSPA 2XOKD 2GNOA 5E0GA 1Z6EA 3DKVA 1NT1A 2ZRMA 2G0TA 3D49H 5FOSA 3ZYEA 4TL9A 1V2PT 1KDOA 4A15A 3I1FA 2I4IA 4MGYR 2OC0A 4K5ZA 1SGYE 3HR7A 1N5KA 2BMGB 7LPRA 4UXHA 1ZM7A 3H09A 4CHAB 4H6SB 2W00A 4Y0YE 1AWHB 3LLMA 3RXTA 1Q3XA 3L8ZA 2AGEX 1TL7C 1O37A 5KUTA 1BMAA 1C2MA 2M5TA 1DLKB 1P7CA 4CF7A 1BQYA 1RTLA 5K8IA 1MTVA 1QB6A 5FFMA 1G6OA 4B48A 1ZOMA 1QHHA 4K2YA 1XMNB 3M7QA 3ATWA 1ZRKA 4Q9LA 1A82A 3DOFA 4OJKA 1H65A 1LV7A 5L6NH 4OL0A 1E37B 2BQWB 1W7XH 2LCFA 4L9WA 2A31A 1CR4A 1ABIH 3AKCA 1P9RA 4DIDA 4XVUA 2F3TA 2VHQA 1G7TA 1XTJA 4LV5B 2A2XH 1AVGH 2PTCE 3AAUA 5AJZA 3HK6B 1VCNA 1C2JA 3OIVA 2XTNA 4OI0A 3PFIA 4U2WA 1EK0A 5IDKA 4MUAA 5CHAB 4DSTA 2RAPA 5EP4A 3KQCA 2OFXA 5C5NA 2QG6A 1YRAA 1TUEA 2ZR0A 1IN7A 1MU8B 4A6PA 2QAGB 4Z8XA 3PLKA 4B71A 2XZLA 1UJ1A 4KSBA 2BXUH 4KLZA 1DAKA 3IQXA 1KXEA 3A1TA 4HAVA 1HEIA 3LH1A 5FOXA 2A5GA 4WWYA 1E9RA 4QBGB 4HDOB 1JWTA 5AHGH 1QL9A 1NVXQ 3W9YA 1A5IA 4EUNA 4Q47A 1AFQB 4NG9H 1XUIA 1C5ZB 3OX7U 3ZQ6A 7ESTE 2YKGA 4EPWA 1RYHA 1LTOA 2VB0A 3KQBA 2J0UA 4OBEA 2NO9A 4YLUA 3KJGA 1THRH 1ZNXA 1G291 3BWDD 1LKBA 1RRKA 2GWHA 1BHXB 1AN1E 4QHTA 1HAYB 4L4UA 3VX3A 1IAUA 1EB1H 1BMNH 1NFYA 1FPMA 2ZI9A 3Q72A 1MBQA 1V2NT 4L15A 3TJOA 2F9UA 1K5GA 1US8A 5E7IA 4DBLC 4EQ6B 1S82A 1E2DA 1SZPA 1OKXA 2F43B 2VF8A 1YPJH 3ODDA 4X2XA 5EP1A 4GPGA 2GJSA 3W3AA 1FPHH 2VNTA 3OAAD 4RFSB 4NZQA 2C93B 2SHKA 1TWXB 3VXEH 1ESTA 2G8TA 2FJUA 3EDXB 2WJYA 3L6PA 1QG4A 3DA9B 1O2GH 2O8UA 1R0XA 3H84A 2VP4A 1K28D 4B35A 3HU3A 4JJZA 3T1TA 3GY3A 1HT2E 4Q02A 1G18A 1RZ3A 2P3TB 1A7JA 1G8GA 2XWAA 3MD0A 2W0MA 1MKXH 5LD2B 1O3OA 3DO6A 1C2KA 5B58C 3MMPA 2WOOA 4IOKA 2J4IA 2VIVA 4FWIB 1W47A 1U0LA 3X1ZA 1NI3A 1CE5A 1TBZH 1PFXC 1E9EA 1OX1A 5CJ2A 4Y11E 2V6NA 2IYUA 1E94E 4JKIA 5TARA 4RKFA 1OIVA 1US8B 3SJCA 1C1QA 3LV8A 3MMGA 1L4DA 1NRSH 3SU5A 3MUFA 2P6NA 4KP0A 3BG4C 3SOSA 2ORIA 1GBIA 1E2NA 1O2VA 4DZZA 5HM2A 2VEDA 4YMWA 4FI3C 3O47A 2AS9A 1YKTA 4HAZA 1CR1A 1DAGA 2J2UA 3FOZA 1SFQB 3VNVA 1ZD8A 4Q7ZA 3L2OB 1NN6A 1GWNA 1U98A 1VYUA 1W4RA 1XMSA 3TW4A 1VITH 1OH7A 1IN8A 3LGUA 3AVOA 2Z7FE 2D7DA 1O2RA 1QBKC 2JASA 1GVNB 1M6NA 2DE8A 1WYKA 4BXSA 1U9IA 4QJ3A 2Y7XA 4BFYA 1OFTA 1DG3A 1P2NA 2OG2A 2HT6A 3ONWA 2FX6A 4WZ6A 3UOPA 1HURA 3T1OA 1YCPH 3U3MA 2ZYTX 2QPOA 3TJZA 4OJQA 3A80A 1AS3A 2PKAB 2ZYUX 3SU3A 4D80A 3TITA 3QWCH 3B1YA 3V4FA 4A82A 1PPFE 4QBIA 3P95A 3R8FA 1C9KA 1ZSLA 3ZVLA 2BKUA 2RCEA 1ETUA 2K5UA 1XEWY 2N42A 1CQQA 1KZGB 3LQRA 1PQ7A 1GNRA 4IHQA 1GL9B 2OBQA 2C95A 1F5KU 3PV0A 2ZSDA 1P04A 2CE7A 3CP7A 3CR8A 4BLPA 4SGBE 5F2EA 3LBHA 3KB1A 1BYUA 3S9AA 1O2PA 3JVUA 1FY3A 4UD9H 3PEVA 4E7RG 2VWNA 1P75A 1UBGA 1NU9A 4F91B 4IC5A 3Q5DA 1GBKA 2BY6X 3LA6A 2P3FH 5C1BA 4INHA 4ZKDA 3MJRA 3VQTA 4RD2A 2HJGA 4XTRA 5DISB 4NIXA 4AYXA 2FI3E 2OT3B 2ZSAA 3EC2A 4HUTA 1MCTA 2GJ8A 4Y0AA 1KDRA 4CH8B 1OW3B 5H1YA 2XNIA 1YPHE 4V02A 3GDSA 3TK9A 4LX0A 3TGKE 2GZHA 4B3BA 5JLJA 3A4MA 3TAUA 3UANA 1MR3F 2ZSEA 3FMOB 3ZZ3A 1R0YA 2P94A 2CHGA 2JLUA 1JMOH 4UNSA 2C04A 4C0AC 8OHMA 3QTOH 1JPJA 2QPAA 4XWKA 3Q7QA 2R9VA 2WIBA 1KO5A 4Q2KA 3I32A 5K8LA 2ANKH 5DI3B 1VPLA 2RH5A 3RS2A 1SULA 2FX3A 4DXAA 1KY3A 4PQYA 2F9NA 1A1RA 1JBKA 2D2DA 2LWIA 1F0RA 2KBEA 5DLQC 3U4QA 4JK5A 4B2PA 4EJSB 4IW4E 2GF0A 3HU2A 3F9EA 1W36C 4YXWD 1VYTA 1VGCC 4OGXA 5SZIA 2ZA5A 3IG6B 1KXAA 3NCLA 3TU7H 4LJ5A 1KY9A 3A4LA 2QEQA 1CXZA 1YM0A 3BFXA 1OXUA 1P6XA 3GFTA 2JDIA 1Z8GA 3MH5A 3ZJYA 2GX4A 1OIXA 2Z3EA 1ZSJA 2EW1A 3EIQA 3FMPB 1ZD1A 5IK2A 4GP7A 1VZQH 1DWCH 1S9HA 5CM9C 3K9XB 2ZRIA 2BZAA 1W4BA 1TQDA 1KNQA 2CL7X 2GDDA 5SZHB 2NU1E 1GI1A 3T25A 4B2BA 1UVTH 1IQIA 5G40A 1ZR0A 1IM2A 1P11E 3DKPA 3NC1C 1OF1A 1EXMA 4Q9JA 3IBGA 1HPGA 4E22A 4DB2A 2B92A 4CREA 2XNSA 2O0HA 1SVLA 1XXFA 2ZRPA 1ETSH 5J4SA 1M74A 3BRWD 4RKEA 4XBDA 3U4QB 3GLFE 1GGDB 1D6JA 4I1VA 3RC5A 1OFHA 3L8YA 1K1IA 3HWSA 1F2TB 4KU4A 2HNTE 3NG1A 4MRRA 2VGCB 1GDNA 3DFJA 4KELA 3QK1A 3CNLA 3NHBA 1SLXB 4IXMA 4OHZA 2B7CA 5LB2A 2G88A 1GJDB 1ZM9A 1PPEE 1Z0IA 1WXQA 3AVQA 1GNPA 1SPJA 3C14C 5B6OA 4Q4HA 1EZXC 4AURA 4IOJA 3MH6A 1C2FA 2PZEA 4H6TA 2V3OH 3ZV8A 1MMJN 4CEHA 4LCBA
chains in the Genus database with same CATH superfamily
3OTPA 2Q6GA 4IDQA 4CEJA 3CB2A 3UBMA 1MTUA 2OCVB 4L2IA 2QTGA 4JZIA 4R0MA 3UWKA 2HOQA 1Z4MA 1Y6GA 1QE5A 1RRPA 1B14A 2CXPA 4E4TA 1PGNA 2O8DB 1TVKA 2XRFA 3IAS6 2V6IA 4V0ME 4DUGA 4UD2A 1GPAA 3RYIA 3W6OA 2ZTVA 4CMEA 3NHRA 1TM1E 3K0HA 4LRXA 4HRYA 1RJEA 4GWGA 3KT6A 1XRSB 4P81A 5AIAA 4BO8A 1T32A 3QKIA 4XCXA 4I08A 1XVIA 2Z9JA 5EZ6B 1DAOA 5B7GA 2NVBA 2Y1CA 4PPYA 1U2RA 3RGGA 3AJAA 3RDZA 2ST1A 4ZKEA 5JOQA 2GRAA 4JUBA 2PGLA 1J99A 3UGJA 3D1LA 3T3IA 4P2GA 4HDKA 2AERH 4DLUA 4DMFA 2O2EA 4B4UA 5EQFA 1NZJA 1OFGA 3Q11A 3TQIA 1O3EA 1X1RA 4J75A 4Z49A 2ZGBH 1SD1A 5B36A 3E9NA 1O5AB 2C57A 3L8DA 2UZ3A 3VTAA 2RGNC 3ZGXA 5AVTA 1UVUH 4NEQA 2Y77A 3T4XA 4RHYA 2HCFA 3L4EA 3EDQA 2WYGA 2V1UA 8ESTE 2RHLA 1CUVA 1EPTC 4E7NA 2NO1A 3X1YA 3G13A 2YHIB 4JP1A 4IAOA 1JQEA 4DM7A 2L74A 1W2KH 3VVBA 5BY2A 4U0JA 4Y9UA 3FCUB 4BLUA 2J7PD 3PLRA 4WFKA 3BB1A 1PZFA 3OFVA 1WOYA 2AQKA 2XLCA 4FWBA 1IQNA 1W88B 6Q21A 4CLRB 4YJ3F 2JCXA 4KWTA 1FJ2A 5HF5A 3UMSA 2P91A 1JWAB 5JXIA 3BK2A 1DSUA 4GR4A 2I29A 3BA1A 3HU5A 5LKAA 2I8CA 5FL7D 4NH4A 5AHRA 1I10A 3G89A 2OZEA 1NL3A 3BJRA 2DUMA 2WYVA 4GUDA 5A09A 1UDAA 4I55F 5EUCA 1GPH1 1FRNA 1T5BA 1BROA 1SLWB 2G81E 1HKUA 1Q2WA 4JZEH 5I9IA 4WMFA 3PRKE 3SZ3A 4NHOA 1TAQA 1TJYA 2XCNA 1DEAA 4I4CA 4EKDA 1TIBA 1ZUD1 2NO6A 2R86A 3FPKA 4FOOA 2KR7A 1QF6A 4PRZA 1MKWH 1C1XA 1WHSA 4GECA 3BH7A 5KQLA 1KYQA 1EVEA 3H4MA 2QCYA 3JVIA 4DY6A 3N1UA 3TW6A 3DLBA 2Q1UA 2BM8A 4INPA 3COSA 5J4QA 3GA5A 4ESTE 4GBGA 1HYBA 1AK9A 3INNA 1EMDA 5TJ9A 1SI5H 5TQ2A 1DKNA 4QATA 5DPMA 5LP6F 5H83A 2ERCA 3PI6A 1K3TA 4Q37A 4ZI2A 1AQIA 4H7FA 2O5EA 3EAGA 1SC6A 2QD1A 2WJPA 2GTPA 1H69A 4NTZA 4DQLA 5B37A 3EPKA 2FRXA 4MV4A 3U0VA 3KOYA 3CUSA 3MPUA 2OHVA 3VKVA 4W1QA 2JFYA 4Y6SA 4BZQA 4BWGA 3T5DA 2EGUA 4I9FA 1UT6A 2C99A 3G8CA 1VJGA 4QNMA 3HBLA 2HA2A 1TZBA 1M6VA 5HKBA 1FVFA 2PAFA 2XZPA 4R9VA 5GM2A 3TK1A 5DOZA 3MXOA 1AD8H 3DO5A 2MDTA 2Y6TA 2XAAA 4O2AA 6REQA 2QLBA 1KMHB 4NE7A 5F3DA 1X1DA 3RXKA 4RK4A 3EYAA 4NFHA 1VFPA 1X94A 1WWKA 2MHCA 3Q3CA 4OHOA 4P34A 3RVPA 1CJSA 2O2ZA 3CF2A 4I1YA 3V0XA 1Y63A 2D1TA 1Z3CA 2X3UA 4B2LA 1FZTA 4NQZA 4C4PA 1KJYA 2VHVA 5FCRA 5LCXA 1BOFA 3KQOA 4ZVLA 1WP4A 1Z4IA 2H4FA 4HWPA 4BASA 3E9CA 4ZRNA 1PTJA 1XTZA 3BHIA 2JJ8A 4HNVA 5FT9A 4BQNA 1QVWA 1JVSA 3RBXA