3O8CA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8cA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8cA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8cA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA03
3EGKH 1O3PB 3B23B 4YT7H 2EVWX 3TUIC 4LHWA 1SVWA 2OSBA 2Z6BD 2PKAB 4RKOB 1SGCA 1UKVY 1BMNH 2WPHS 1V2MT 2WV9A 3V7TA 3U3OA 2DPXA 2ZGCA 1A5TA 3SQXA 3TIUA 2W0MA 3K0FB 1G21E 1M9UA 2HPPH 1DPOA 3TNSA 3SU1A 8GCHG 2BLVA 4O97A 1TONA 1NROH 1PPHE 1AE5A 2QAGB 4KITB 1OWHA 4PHGA 5IYTA 2SGAA 2VHQA 4HAVA 4A2WA 4AORA 3RC3A 2ZYWX 2QI9C 3K6ZA 2QV1A 3KKQA 3SNBA 3ZZ9A 1TAWA 3SU5A 5PTPA 2MSCB 1W36C 1CR0A 5AVDA 1K21H 2WIAA 2I6SA 1YRAA 1QRZA 3RSLA 4BAQB 2RH5A 1C4U2 3KL4A 4NSVA 2VTKA 4A8JC 2AMPA 4KJZA 3ZVNA 2PKSB 3K09A 3SQHE 2BMJA 2R6FA 3RLFA 1OKKD 1GHAG 1KNQA 3SR0A 2RGEA 1E4YA 2YV5A 5EE9A 2ZPQA 1K1OA 1XEWY 2A3RA 3AKYA 1HH4A 2PJRA 3DM5A 3VAAA 2LKCA 2SGPE 1GBLA 2DCUA 3RS0A 2JGNA 3S69A 2IW3A 4TLBA 2W5EA 3B78A 4BAMB 4LX0A 2J2UA 2FYQA 3A7VA 3D7MA 2AMDA 1J70A 3KNXA 5K8TA 2BHRA 2ZTYA 1BJUA 4EJSA 2IEZA 4HEJA 2ZUCA 1SXJB 2BV3A 2FZ4A 4AURA 2ZWLH 4A0GA 3CPJB 1XFAA 4V0NA 4E7NA 1XJQA 4Y0YE 1HRTH 1A61H 1PYTD 4GNKA 3Q7QA 4FUEA 3ZZCA 2FO9A 3R9IA 4JL6A 4TZ6A 2VWMA 221PA 1KOFA 5EE5B 2R3YA 1FPMA 1JJ7A 1TNDA 1WMSA 1KJYA 4CEIA 3P8GA 3L3TA 2NZJA 4G5QA 3OE7A 3TU7H 1V2UT 2FLBH 4HZIA 2D7DA 2R6GA 3NBYC 5FOXA 2HT1A 3SV7A 1CJVC 3MWIU 1C1OA 1ANCA 2RA0A 3I3SR 1AY6H 4M9SA 1FQ3A 2FZZA 4JZ1A 2R8RA 1GZSA 2VHCA 2H92A 2A2XH 3Q3XA 4K5ZA 3P92A 4PC2A 1O3HA 4C0SA 4URVR 1BTZA 2XZPA 1NKSA 1NVVQ 3P20A 1JAIA 3U1JB 1OPXA 3QVUA 2ZI6A 3SO3A 2PKSC 3O8CA 4Z51A 2GJKA 2OLKA 1A1RA 2JH0D 2ALPA 3I62A 1GRRA 2ZDAH 5L3RA 3B5JA 3MH5A 4PSVA 3SBDA 2B0FA 3GEIA 2W2VA 1D3QB 1W49A 1CBUA 1YPEH 2OXCA 1N8OB 1TX4B 3FVFB 1T5LA 2VA8A 2Y7XA 4Z1MA 2W00A 3WRXC 1N6NA 1TU3A 3Q9LA 3M1IA 1BBRK 2F1RA 1QB6A 1ZZZA 4WWYA 3TVDA 1AZZA 4Q7LA 3VX4A 3RVBA 1HBTH 2YWFA 1C2LA 3DKVA 4RFVA 1JR6A 2OC1A 2ULLA 3OEED 4FMCF 5ETXA 4I99A 4OHWA 4U30A 1SXJC 3BRWD 1E0JA 4FXGH 2HCJB 4IFEA 2FSIA 1FDPA 4NONA 5BPEA 2QXIA 2QQ0A 1FMJA 3A89A 5DK1A 4F93B 3ZH9B 1TTTA 3SC3A 5E95A 2EYQA 3ATLA 2GV6A 5KHOC 5FI1B 1TQ6A 5SZHB 1XDBA 1T31A 2P6UA 3A83A 1FTNA 1NG9A 2PZEA 3UWKA 2AERH 2X8AA 4BFVA 3ZVAA 4C0JA 4ACAA 2BD7A 3EA9A 3RDZA 4D76A 2ZQ5A 3TUJC 3CF2A 2W2XA 4X6NA 1DEKA 1MRSA 1GDUA 4Q7XA 1HV7A 3LH1A 1QB1A 1L7VC 1LNZA 2ZYTX 1SULA 1G20E 5LBIA 1X8JA 2MMCA 2BVSH 2VH5R 1ZLRA 4N0EA 1E9SA 1M7HA 5CB6A 1QVAA 4CEHB 2BYAX 2Y80A 3QN7A 4YMWA 1EB2A 1GMHG 1QGFA 3FMOB 4QNRA 2QBYA 3NG1A 2ZDKA 3FP7E 1Y3YA 1MR3F 1Z6JH 4ZKRU 3TUZC 4DLYA 2J7PD 3RU4D 3UQVA 1FMLA 2AK3A 2QG6A 4R98A 2A0QB 4PC6A 3QEJA 3LBHA 4UDWH 4XWAA 2GEVA 3O47A 2WVJA 3RXAA 1T3LA 2ZDNA 2AIQA 2WWIA 2QY9A 2ZSFA 1YKTA 1ARBA 3GLIB 2B21A 1U9IC 1Z8FA 4HAWA 4HLUA 3B82A 2A5KA 1Z06A 2GCOA 1N8OC 1O35A 1Q57A 1D3TB 4QJ4A 1O3AA 1KSHA 1E37B 4ASHA 5LD2C 1SBWA 1MBMA 5AUNB 1P9NA 2F3TA 2G4TA 1QL8A 2NO7A 4HAXA 3ETLA 3ZV9A 1AK2A 4KV9A 1V6DA 1VJAU 2AIPA 4LJ4A 4ZROA 2XBYA 1TX7A 4AYYB 3QTOH 5KDDA 3SEAA 3KHVA 2ZFSA 1EOLA 2QTHA 2WHXA 2THFB 4D4KA 3PTBA 1OKXA 1IXZA 3W94A 4HI0E 2ZCLP 1C5ZB 1E38B 2PFEA 4X1QU 1RRGA 2BDGA 4NCYA 3DVLA 2H9TH 1LPKB 3TLXA 2SHKA 3BB4A 1ELTA 3AF1A 3MUFA 2FOLA 2WAXA 1IQIA 1GDNA 1Y63A 4HLCA 1T8OA 1YCPH 4JT4A 5KNCA 4AYVB 4CBNA 1DX5M 1KK1A 5KUTA 1O2KA 2HYIC 4MKIA 3SHWA 2ZFTA 2JJ8A 2P8OB 1ZUNB 2FN4A 3IKJA 5FOSA 1NFYA 3HP1A 3U3MA 2ZJAA 3Q85A 4MNXA 4NE2A 3A8TA 3K9HA 4A0HA 1ANBA 1TEXA 2BOKA 3PMAB 2YWGA 3GYMA 2F9NA 4K1EA 3QWCH 2IOTA 5FPKA 3QKSB 1O5DH 5FR2A 3SJZA 3HGPA 1COWA 4RD2A 2BDTA 4IEIA 2EI8A 4C7OA 1TGTA 1YC0A 2FMJA 3UIEA 3ASYA 1J8YF 5TARA 4B73A 4EPWA 3M3VA 1O2HA 4GOJA 1QA0A 1WP9A 2PT5A 3BFKA 3HPRA 3GJ8A 1OF1A 4ARZA 5HTKA 3W8RA 5LPNA 1F2SE 4M1KA 1UVOA 2PZGA 2QM7A 2GP9B 3C15C 4PO1A 1IQLA 2QIQA 3D31A 5CK4A 3R9WA 2J0QA 3D8BA 2BZAA 2OO7A 2J9NA 3BD9A 4AY2A 1P72A 3AGQA 5CLLA 4EFLA 4KBFA 2QTFA 1C1YA 2ZPTX 1WXRA 5DNYB 3GY8A 2OXSA 4K46A 3TK1A 2QSZA 4MUAA 5CYPA 2FPMA 4M1WA 1JQLB 1HAXB 1FL9A 2OCPA 1BZXE 2QA5A 2QTVB 3CS7A 3CPHA 2OUAA 4TTPA 1EOJA 1RS0A 2AXPA 2YC4C 1IM2A 2B6HA 1AE8H 1XBTA 4LI0A 4ZIRB 5JEDA 1XTSA 5ESTE 1HV8A 1BRCE 2V7QD 1M2OB 5FL7D 1G6OA 3E90B 4D4JA 2YNBA 2YOHA 3ZVBA 4CZ2A 1A5GH 3LPRA 2ASUB 5H70A 1F2TA 4KU4A 1II9A 5A8YA 3AUYA 1XCMA 2IT1A 1FXYA 4FMCB 3SJKA 5IDKA 2P8OC 1XMIA 1ESNA 1W7GH 1HT2E 1QDEA 1KI2A 3P32A 2DBYA 1KTVA 2BWJA 3A8DA 1V2PT 4LOAA 5E7MA 1E69A 1G3IA 1RJ9A 4K1TA 5EXXA 1SVLA 1LO6A 4PPQA 2EEKA 2GVDC 1A3EH 4W5WA 1BMFA 1ELOA 2P3TB 2OD3B 1NY5A 1OHHD 2REOA 3QF4B 2ZU4A 3H0KA 2I3BA 1QBVH 421PA 3AVWA 6CHAB 1VHTA 1NRQH 1G8GA 4Y6DA 3BTGE 4MYCA 1OWIA 2RHDA 2P5TB 2Q0HA 5C1XA 2JIZA 1H8HD 3QUSA 1IOEA 1AGPA 1XX6A 2QEQA 1R8SA 2FZLA 1YZGA 2G52A 2FI4E 1LPGB 3SN6A 4FCVA 4RD6A 2HPQH 1Z6XA 3KJEA 1GBDA 2GZAA 1BKDR 1U0HC 2DFTA 1W0JD 3UOUA 2WSSD 1T5IA 1SMFE 8LPRA 3ZVFA 3QEOA 5CDFE 3AEZA 4BFUA 5C2JB 2UZ3A 4O25A 2XC0A 1WTGH 4C30A 6Q21A 2P6RA 3CX8A 3DO6A 1SG8B 2BEJA 1NO9H 3KTAB 2F43A 4DVGA 3M35A 4ZH8A 3HKIB 4BOHA 3U7GA 5C3NA 1Q31A 5JJIA 1G36A 3AW1A 1SGNE 1YZNA 3QDZB 4ABYA 1HAVB 1OIWA 4IOLA 1N6OA 2GBLC 3ZVEA 2BY5X 4DT1A 1P73A 3SJAA 2Z4RA 1AHTH 5EQSA 5C2ZA 2VF7A 2OBLA 1C9TA 5L3SB 1O3BA 1RYFA 1W3CA 4MNYA 4D0NA 1Z83A 1Q22A 2QN6A 1EX3A 3BTQE 2JLRA 4OJQA 1QHYA 1ELGA 4GP6A 2ZE6A 4D8NA 1GL1A 2ANMH 4A2PA 2CVHA 4BXWA 4FUGA 1NRJB 1UTQA 5EZ5A 1ELEE 3PWCA 3EC1A 3IPYA 5L3QA 3ZVLA 1GI2A 3ZGXA 4A1FA 3SHCH 1IXRC 4FMDF 5A2MH 4X2YA 2J0SA 4C2TA 4H1UA 4R7ZA 1GJDB 1Y3WA 6CHAC 4LBZA 1A0HB 4PHTA 4NL4H 3M4YA 1H8ED 1MAXA 1O37A 3T34A 3K0AA 3IG6B 2BCJQ 3D23A 1CBWC 4WXVA 2UUJB 1N5KA 2N1BA 2HJGA 1GBTA 4P4SA 3P26A 3G01A 4NIYA 4OGXA 2I4IA 2ZRHA 3MU0A 4LPSA 1KSFX 2GTPA 3IEUA 4DDUA 1D5CA 1S0QA 1ARCA 4DCDA 1EUFA 2LWIA 1O3IA 1MRNA 1BIOA 4QFMA 3A4MA 2P3UB 1E98A 2JLWA 5J4YA 1EB1H 2BM0A 5BRRE 4L8GA 3F5FA 4LCBA 4I8JA 4JJKA 4LJ5A 1OB2A 2XSZA 1D2MA 3SGBE 5EPNA 2OBQA 1XVOA 3JVUA 2JLVA 1RJXB 1X86B 4B74A 2BX3A 2IYXA 3FPAA 3PB1E 4MGYR 1HXFH 3PQCA 4RFSA 1GL9B 3KFXA 1U81A 2PWXA 3S7KB 4QHTA 2KAIB 2G1KA 2REBA 1NBME 4A6LA 3GJ7A 4MDSA 1YVDA 1AZSC 4XE4A 2XWBI 1P62B 1MQ6A 4KBGA 2R0KA 3OF5A 2DB3A 2AGGX 1CHGA 2BXUH 1GHYH 1AZ8A 3V4FA 1VITF 5CYOA 4ZKDA 1L1JA 4D9RA 4NA9H 1NRRH 1NLFA 2ORIA 1NMYA 1SB1H 1KO4A 4TY6A 2Y5GA 2ZO3H 3GLHA 4XTCS 1UFQA 3W5JA 3RMNH 1KXDA 4J2YB 3KQBA 2PLXA 2FOCA 1OJLA 3RS4A 3LH3A 5CITA 2QT0A 3RXIA 4QM7A 1LQDB 1MKXK 3TE6A 1H65A 2ODQA 1P9SA 4UQOA 2VGCB 3FKSA 2ERYA 3WNCA 2QY0B 2WWYA 3PUWA 7ESTE 3ZQ6A 1C4Y2 3BH7A 2ZRIA 4KHZA 3U3KA 4RZ3A 2XB2A 4OQNA 5DYIA 3Q3YA 1A5IA 1E1QA 2HVXA 3SI3H 4TLDA 1HA3A 1IQJA 4Q1DA 1O2GH 5HKKD 3C5CA 3KN2A 4ZDWA 4HUQA 8GCHF 1QG4A 1EQ9A 3D3QA 4IDPA 2Z9IA 1XD2B 2YWEA 1P03A 4U00A 1SFIA 3AAVA 4OQFA 4EPTA 2JATA 1EAIA 4BANB 1K22H 2XEXA 1E9FA 2C78A 3BTWE 2C8ZB 5FUVA 1ZTKA 4ABJA 1S96A 2RGBA 1ZM2A 1O3LA 3VHXA 2JH6D 3A88A 4JLBA 4KTSA 1Z6YA 2ZR7A 3LT3A 2BOVA 4Q19A 1C1QA 1GHAF 2EQBA 1PUJA 2ZU5A 5B6LA 3T25A 1G5PA 3R7WB 3T5FH 1BMLA 2ERXA 1G8FA 1Y3XA 3C27B 2E9SA 1AFEH 4CEJB 3SUDA 2XJ9A 5A4JA 3S9AA 1JQJC 2PX0A 2ZFRH 1S3SA 2JDID 4KTCA 1AI8H 1O38A 1PLLA 1EZXC 1R0ZA 2ZRFA 4D80A 1OWKA 2VIDA 4D7FA 1RIFA 2QM8A 3EZ2A 1MABB 1QRXA 1MO3A 5JZVA 3IQXA 2MSDB 2VGCC 5F98A 3IDQA 3U9AH 1NRSH 1J16A 1ELCA 2EW1A 1O31A 2CDNA 2PTNA 3L0OA 3U6BA 1V43A 5K0HA 1R7RA 4FINA 3GLGA 4LY6A 1JPNA 4XTRA 4BQSA 1MO6A 2CK3D 2GKSA 3FWYA 3BIFA 2WWXA 4RJLA 1MKWK 1CEEA 1QHXA 3KKNA 4JZEH 4JSYA 4YO9A 1XXDA 1G7CA 1R5BA 1SLVB 1Z08A 2GZ7A 3TR5A 2JLUA 3OTPA 4HB3A 1EATA 3QQ5A 1HAIH 1EFTA 1KDPA 5DP5A 4GP7A 1LTOA 1RTLA 1Z47A 1AMHA 1L4UA 5FPHA 4ZHMU 2JEOA 5JEEA 2GV7A 4PZLA 4B2AA 3V4RA 4PFSA 4KFUA 4AG1A 2PLRA 2HWLB 4K8OA 2D8WA 4ITRC 3PJRA 3FFBA 1TX6A 3T5GA 1C9KA 4B3XA 5KTYA 3VB4A 4IDOA 5EW1H 1W46A 5ESBA 1XPOA 3H1TA 2FGJA 1E0SA 4UFDH 3PVSA 1HAZB 2STAE 3MO9A 1ZM9A 4KGAA 2ZXUA 1FNNA 1P2UA 1SKYE 2CHAB 4B75A 1TF7A 3PENA 4NP6A 2GETA 1O0DH 3SU8A 1M8PA 1ESAA 1XKAC 3B85A 3IILA 1AKYA 1DWEH 4KSCA 1O2NA 1GBCA 2HV8A 2RA3A 1ZGIA 3PEUA 3T2NA 4O3UA 2QF0A 3MLEA 3RXPA 3V13A 2IN2A 1Q21A 3SJ9A 2JJ2D 4JMYA 2PKAA 2FFHA 2FOGA 4I8HA 5B58C 3F6UH 2W6JA 2Z43A 3CBQA 1BTWA 1WAYB 3AW0A 1K8RA 3K0FA 4NPHA 4KYUA 1FPHH 4G01B 1SVOA 1IAUA 3RWMB 1IY1A 2QAGA 3RP2A 4TPIZ 2H16A 1CA0B 1YP9A 4A0RA 4U2WA 5G41A 2UKDA 3TJUA 1GMCG 4CT5A 2GCPA 2XXLA 2J94A 2VJ1A 3KQDA 2ZPSA 1G9XA 3AKEA 4I1OA 1QHRB 1J14A 3RXRA 4QC2A 3EPKA 3NVAA 3RXCA 4GT1A 2ZQ1A 2ZNKH 3ZD6A 3FTQA 1N6XA 3VFEA 4K1SA 4NWKA 2NO6A 2ZRNA 3JZAA 5GVSA 1UVUH 3AF4A 1GJ8B 1SI5H 2UVQA 1IBRA 4DKXA 1KXFA 4KFRA 1MD8A 2WYJA 4DC9A 4AKEA 5GWZA 1K1JA 4TMKA 1HGTH 4RZ2A 2WINI 1XB2A 3T1OA 2FPZA 1UKYA 1OS8A 1U0JA 3FHTA 3OIWA 5DHFA 1YPJH 2FU5C 1JWTA 4URYR 1S5SA 2ZM5A 1ESTA 1Q20A 1YZQA 2NOAA 2PT7A 4MPVA 1O5EH 5L2YH 5F2EA 4Y0VA 1S4QA 1ZM7A 1KDRA 1PPFE 4K81B 1QNJA 3M3SA 2QE7D 4EPRA 2GCHG 5LPEA 1ETRH 1L4ZA 4MKFA 3PUXA 3UIRA 1P01A 2OP9A 1XD8A 1ZU4A 2OCAA 5EUQB 3A7ZA 3ONWA 4B3DA 5BYKA 1MTVA 2ZP0H 1P6XA 1NPMA 5EQQA 3A1WA 3GY4A 2UZIR 4X6PA 2CHAC 4IDNA 2ZRBA 1O2PA 1S0UA 1L2TA 3OZXA 4CR9A 1HAYB 2F9OA 2FSGA 3GQBA 4NIXA 4D2IA 4WBSA 1EZQA 2F1JA 2IS1A 3IO3A 2IL1A 1ANEA 5JLJA 4B33A 1I2MA 3STIA 1D6JA 3M61U 2WPKS 4MUBA 2PCLA 1L2EA 4AWXA 3IQWA 4RD3A 2FI3E 3W6OA 3SNEA 2BHGA 8ESTE 2ZIAA 4Z6AH 1CA0C 2O8WA 3EQ0H 3SI4H 3CB4A 2J45A 4TMWA 2R6DA 3LX8A 1J90A 2CV3A 4MYUA 4LHXA 4ZHAA 4XDEA 4UXHA 4IKEA 3L82B 1D6RA 4UONA 2V55B 2H9HA 4LC0A 1C1WH 5FHTA 4BAOB 5C18A 1TPPA 4D81A 4V0OA 3SZNA 5A0CA 1HUTH 2Q6TA 1QBOA 1OP2A 3ECCA 3LXXA 1J7KA 4KKDA 3AV0B 3U8RH 4S2EA 3MNXA 3BB3A 3TR0A 2QMUA 1G8HA 2GNOA 4PHHA 2OLGA 1J99A 4W9MC 3ZVDA 2ZU0C 2GF9A 1U9IA 2IF2A 2W0SA 1C5LH 2GZDA 1G7RA 3HK3B 3E16B 3JZ2B 1S9HA 2GILA 1YR7A 4JBWA 2ODNA 2BIFA 3T35A 5JBAS 3V0XA 3RS7A 1KMQA 5DE3A 1SHZA 5J40A 3WBKA 3PEYA 3QF7A 3MO3A 2IXEA 1LW7A 1CS4C 4MPUA 4LV8B 4EPYA 5TCAA 1ZPBA 2OT3B 5HPYB 5DJ7A 1RFLA 3NBZC 2OXRA 4OS4A 2HUPA 1TPZA 1DSTA 1DXWA 1HE8B 3SJ8A 4B2CA 3I61A 2BBTA 4XVQA 1C5MD 5M04A 1Y3VA 2ORWA 1E79D 5C5OA 1C1NA 1KTSB 3A8AA 1W4CA 4QJ3A 2ZEBA 3SOPA 5JHGB 1GPZA 1SPJA 3FAOA 1KLTA 1D8TA 1C1RA 2Y6TA 2BM1A 1UO6A 1E36B 4OS5A 2DE8A 1WSSH 3H7OA 1P2NA 1NKTA 1ZIPA 4B2IA 3OIUA 5T6FA 1ZD9A 2ANCA 4CEHA 2CXXA 1AIPA 4L9WA 4Z54A 1FX0B 2G9NA 1RRCA 1P2MA 1CR4A 4WF8A 1TQ4A 3T1TA 4KLZA 1C1TA 1OXVA 1Z29A 1QQUA 1F0TA 1HJ8A 3KIDU 2ZVQX 5J4SA 2SGDE 1AA9A 3B9QA 5FPYA 3OEHA 1HYLA 1V2VT 1SGPE 3RXKA 2BDBA 2HXSA 1S1CA 4LJAA 3K6YA 3DPUA 3GDVA 1P4SA 3QOFA 3GICB 1TGBA 3DA9B 1TRNA 2QYIA 1LFDB 2ZUBA 1MZDA 2YC2C 3BIUH 1TGCA 1NESE 4II7A 4UNPA 4AOQA 4MVNA 2Q1JA 1CU1A 4B3FX 3GY3A 3WMFA 4QJ5A 2IHBA 3ZIAA 1C2IA 3ODFA 1SGEE 3TJZA 5E8EH 1BRBE 1MO5A 3CF0A 1UPTA 4XVRA 1BBRH 3S1AB 1BB0B 4BEBA 2KBFA 1V2ST 3ZZBA 2GDEH 1DANH 2TIOA 2AH4X 1XPUA 4GHQA 1GI4A 3RXFA 2BKEA 4EFNA 2GMTB 1ELAA 4A6XA 5HZKA 4PANA 1N0UA 1ZR0A 4AFUA 3CH5A 2I6QA 3SNDA 1Q1EA 2V1UA 2V0BA 3EE0B 4Z0KA 2A5YB 4HYYA 2GCTB 1DO0A 2Z0MA 5BN4A 3I5XA 1P2KA 1SVSA 2PUQH 3BFVA 1N6LA 4B2LA 3HKJB 1JOUB 1AUJA 1G9IE 3M6AA 3A6PC 3GJ0A 3FFGA 1UVPA 1ONBA 4BFTA 2OCYC 5H8WA 1RKBA 1DVAH 1UTMA 1E2GA 3PEVA 4OHZA 3EIEA 3LQRA 4M22A 1AD8H 1NVVR 5JRJA 1O34A 1ZPCA 1DAEA 1ZRHA 1AWFH 1QBKC 2V9PA 2C8YB 3QGNB 3X1XA 5E0GA 3A84A 1SGWA 3TJNA 4CRCA 1CLUA 4DCUA 2FGKA 3CS0A 4DWJA 1Q3HA 3DL0A 1L1GA 1TRYA 4BASA 2RGNA 3QKSA 3TMKA 3FB4A 4U01A 2J4IA 2SNVA 4X0WU 1HCGA 1XNJA 1BA8B 5CM8B 1E9BA 2REXB 1ZTJA 3SJOA 4JBXA 1E94E 4H1VA 1E2DA 3M7QA 1NFWA 3GCGA 1UTLM 1KI1A 2GD4B 2WKPA 1GFIA 5CJ2A 3MWJA 4Q9IA 2VHTA 2XNIA 1EG7A 1ZTLA 4E5UA 1QL7A 1IHSH 4TQ9A 2HF9A 2GTBA 2Q9BA 2ONJA 1F60A 2WSMA 4PROA 2WUCA 2QCYA 4OS7A 4M4SA 1TBRH 1RC8A 1V2NT 4CRFA 1W0KA 2G51A 2NIPA 2O8UA 5ANRB 2ODWA 5JJLA 2ZHFH 4Q9KA 4HAUA 4Q00A 2D26C 1R5NA 2GMTC 1HAHH 1E0FD 1BTPA 3THWA 3TNTA 1J8AA 1N5JA 4XBBA 1OP0A 4ZXXH 5FH9A 1KNXA 3QXHA 1UJ2A 1THPB 2GCTC 1YZUA 1EFRD 4TYQA 3THOA 1OYTH 2EFHB 3NKVA 4BEJA 3UWIA 2OLJA 1E2IA 4A1XA 1O3OA 2GXAA 2GBLA 1Z1IA 2H9EH 2UWPA 1I4TD 1FUKA 1E2JA 3EW9A 1MBQA 4NIWA 1K28D 1LVOA 1R0WA 2Z6VA 3RRNA 4OKSA 2VIPA 2BC9A 2C4FH 1GI6A 2EFCB 1E2FA 3GLFE 2XW9A 2DR3A 1HJAB 1W14U 5KNDA 3BEFB 4JLAA 5J4HA 4WXIA 1EJAA 3F9FA 4MNVA 2BMGB 2WPMS 1Q1QA 2B9LA 4BTUB 1MO4A 4OK3A 4ZKSU 4CGZA 1W4RA 4FUBA 2IUSA 5GADl 1L0ZA 1N2CE 1IN5A 3TSWA 1KI9A 1NMXA 3KXLA 4Y71A 4URWR 5JBQA 1B0FA 1O5CB 3E1XB 4X8LA 5FUXA 1S0RA 1NS3A 4NCJA 1G7SA 2HYDA 1DSUA 1EX7A 4QGHA 3OSYA 3KKPA 2YOLA 2IHYA 3QF4A 3B1YA 3RHFA 4IOMA 3P17H 3VXEH 3M36A 2QP4A 3KZ1E 3RXGA 4SGAE 1NN0A 1G3BA 3HU1A 1BUIA 1P8VC 1Q44A 3F3YA 1KDTA 1W12U 2WJHA 1HTWA 4BRWA 2VLIA 3DD2H 1G41A 3EPLA 3E8LA 1MV5A 3BTTE 2ZRGA 3SOSA 3FGNA 5AFYH 1E34B 3PMBB 2PL3A 2ZE8A 4PPNA 1KSGA 2HXYA 3FDIA 1GVZA 3SGQE 1JEDA 1FZZA 1P2JA 4CH8B 2ZAOA 4B76A 4WOPA 4BE7B 2BCGY 1ETUA 3AH8A 2ZSBA 4L16A 1FY3A 3KTAA 2AHOA 1LS6A 4MKGA 4MA4A 1ZMNA 5A8XA 3W3ZB 2BVNA 4IW3B 1JI0A 1HAVA 4TWZA 5FOVA 1ELFA 6ESTA 1N5IA 3SYLA 3EA0A 2J34A 3VB7A 1A7SA 3EIHA 2BY7X 3A1TA 1KY9A 2G5NA 1P04A 2ZS7A 5DI3B 5L3SA 3SU0A 3CWQA 1HYQA 4PO9A 4LPKA 2JJ1A 2ZTXA 1NMZA 2PGQB 4C0BA 1CR1A 1FP7A 4D9QA 4LSGA 1A0LA 3TNFA 1HJAC 5FBLB 4IMZA 4FI3C 2P67A 3VR4A 3SGAE 2C77A 1DT2A 1Z8IB 3RXTA 4XD7A 3W5IA 3LAWA 4RY2A 3F68H 3TGPA 1WUNH 4IOKA 1M7BA 1ANKA 1E9DA 1EASA 1JALA 1II8A 4AKHA 4GUXA 2QL6A 4DLXA 1Z0FA 4MLFB 2VH0A 5JI2E 1AM4D 3SN8A 3TQCA 1E9CA 1SXJE 3C16C 1J2JA 3L0SA 621PA 1JR3E 2EI7A 4LJ8A 2X1VA 1QFKH 2VNTA 1DELA 1VDZA 3I77A 1W4BA 2OFWA 2KJQA 1SZPA 1AQ7A 3VU9A 3K0EA 3ADCA 3EXAA 1AO5A 1OXTA 4KI0A 1O2UA 1W2GA 3SBKA 5AR1A 3C1KA 1A1VA 5FTMA 5DP4A 2XJ4A 5DO9A 2VVCA 4XBDA 1OXUA 1EWRA 3D62A 2IYQA 4AG6A 3V9PA 1ZOMA 3EYDA 1IJEA 2A7HA 2ZFFH 3RXQA 2PSYA 1BT7A 2XBVA 2A78A 2PX3A 2DHRA 3RM0H 4MGZR 4GLYA 4FUHA 4NH0A 4E06H 4X6OA 2ZUDA 4PXAA 1CT0E 1N0WA 1P02A 4P4UA 2RGGA 3ZS9A 2VINA 4JYVH 1KKLA 1AVWA 3BTHE 1KHTA 3VTKA 3T61A 3M5LA 3L0PA 4CRWB 1YR8A 2VSOA 2JLYA 4Q2KA 3OE7D 1SQOA 4NSYA 1M34E 4BNRA 2CMYA 2V35A 1TLDA 2PGBB 2ZYUX 1GNPA 1ESMA 3SZEA 2QAJA 4KELA 1EZSC 3RUOA 1OXXK 4X6MA 3UATA 3ICQB 3PFIA 1T8MA 3BH6A 4K69A 4PHFA 3LBIA 4BZQA 2FPKA 2ZRJA 4FUCA 3OIVA 1JXMA 3SV2H 4FVBA 2PV9B 4PC1A 4YMTA 1GBHA 3SNCA 2C8WB 3F9HA 3K9LA 4P3YA 1KZ7B 4QHYA 4URUR 3B8JA 2GAOA 2GA8A 2FSHA 4A36A 1G4UR 4KFSA 4XSHA 1NG1A 3TW4A 3ITIA 3LH5A 2ZJ8A 4Q4JB 4NYMR 5HMAA 1EWQA 5C1YA 4PC7A 2BLWA 8OHMA 4LZ1H 5CIQA 1P12E 3X1DA 1V2OT 1OYWA 2ZROA 4M1OA 2W3KA 4NFFA 4Z1MD 1G64A 3PV5A 3T27A 2IS6A 1KMHB 3H09A 2WPDA 2VP9A 3EASA 2Y8EA 4DCSA 1PVOA 1CQQA 2HGTH 3PYHA 4KTUA 2ODBA 1ZSLA 1CRPA 1FONA 4WXRA 4TMXA 3BF6H 1JRSA 1TF2A 5GJWC 1C2JA 2ZSDA 1XTQA 5JPMH 3SJCA 4C4PA 4INKA 2GZHA 2ZRAA 2HF8A 3P1JA 1TNLA 2D7CA 2O0KA 1XD2A 1BHXF 1PQAA 4PTLA 5HXFA 4B48A 5E0JA 1VITH 1BJVA 3KQUA 2E87A 3VB6A 2D2DA 3MH7A 1IN4A 3CRVA 2H8KA 5KSOA 3UK6A 1GBBA 1NF3A 2J87A 4GSOA 3PIRA 4PSKA 1XTJA 1RFNA 1D3PB 2J5XA 5BN5A 2QMHA 1GVNB 4M1YA 2HNTF 4DCTA 3K65B 3VMFA 4DZZA 3RLYH 3OTJE 1QRWA 4OHVA 1NI3A 2RB4A 2VYFA 4YQFA 1KJZA 4Q1EA 3F9GA 1T3HA 2VWLA 3T06B 2IUTA 1IY2A 1DY8A 3U98H 3GLIE 3MU1A 4GPTA 1TNKA 5JB9S 1ZNWA 2EFEB 3BEUA 1OXGA 1OT3A 1P0SH 2GHIA 4CEJA 4U02A 1LKBA 2ZRMA 1GG6B 1GJ9B 2PMDA 2QGNA 1G37A 3CRRA 2WZQA 2BDHA 2NGRA 3A1UA 3QY0A 1F0UA 5FAHA 1PZNA 3GDSA 3KXIA 1H8IH 3NXPA 1RIWB 1MABA 1FW6A 1AQYA 3K9GA 3RXBA 4EIWA 5FBVB 4ABEA 4JT2A 3HU2A 3CF6R 2VHUA 3V00A 3FOZA 2FJUA 4PR0A 1T8LA 4AYXA 4LXBH 4GVUA 1OH8A 4BTTB 4XWOA 2HCBA 2YKGA 5C67A 1BCUH 1MKXH 4ZCLA 4XVUA 1VG9B 1VPLA 1XJ0A 4MTBA 2FOEA 5JSZB 2AFHE 1S84A 1ZIOA 3W8NA 4QKQA 3GY2A 1IY0A 4F91B 4XBCA 1SVMA 2O8DB 1YPMH 1OW3B 4XSGA 5H4IB 2VPPA 4Y76A 2OC8A 1Q12A 1T91A 2ZDVH 4KODA 1GHVH 2BBOA 3BTFE 1N25A 1P9RA 4DVAU 3A81A 1VR1H 4U5XA 2D3WA 5L30H 1O2RA 5CLQA 1GI5A 1NU7B 4ESVA 1YE8A 1RYHA 1CGHA 1O3KA 4HAYA 4BECA 1N6YA 1NIJA 4JL5A 1CP2A 3E70C 5SZIA 2A5FA 2QMEA 5DP9A 1US8B 1NNEA 3SDZA 3VR6A 4PZYA 4JK5A 1CJMA 1OXSC 4WVPE 3SORA 2C9CA 3BFXA 1NJGA 2YNMA 2PJZA 721PA 1ZVQA 2ZEJA 3IHWA 3UMRA 4CEIB 2J95A 4A8JB 3ZZDA 1GI8B 3VXFH 4I31A 2C03A 1JBKA 3SUFA 2NO0A 3EIQA 3UQOA 3CZPA 4Y8XA 3GLFB 2F9BH 2ZRCA 2VWOA 4M9ZA 1KJWA 2F3RA 2QRNA 5EXSA 4JK6A 1U99A 2BKUA 2FTMA 1BQYA 1UK2A 2QPOA 2HALA 1MKYA 4M9FA 2XC4A 2FDCA 3MU4A 2ZI2H 1Y5BT 1GG6C 1COWD 3CNLA 3U7EB 1NTPA 3RRYA 4DIDA 3LDXH 1LHEH 3QKUA 4DLSA 1DLKB 5EG4A 3T1QA 1RGQA 3URDA 1XCPA 2FEQH 1RIWC 5TCCA 3AKDA 4ESTE 3K09C 4WA7A 1K1IA 2O8LA 3BSQA 1Z6GA 4Q48A 4JLPA 1CRQA 4KLNA 2TPIZ 5P21A 4TT3A 4YXWA 1BYIA 1KDQA 2TGAA 2R6CA 4HB0A 1F7ZA 3K9XB 1CXZA 2BEKA 4TSFA 3A36A 3E3TA 4C0QC 4K2YA 2QRZA 3U5ZB 1BIFA 3DFLA 5AUQA 4QBHA 1X6VA 1OH7A 2GJSA 3CM0A 1P5ZB 1IQMA 5CDFA 3Q8XB 1A2CH 4EJSC 4D4MA 1T0JB 1GRQA 3ASZA 2ZDLA 4OJKA 1MKWH 4G3XA 2FM2A 3B1VA 4RZUA 4Q7JB 3X1WA 3B13B 1DY9A 2IJOB 1OFHA 4Q4HB 1NVXQ 3NDPA 1PJRA 4P33A 4F7WA 3RXLA 2GZ9A 1FNMA 4K3JA 2W7SA 2V6JA 1SGTA 2C93B 1ZD1A 4G0NA 2V1XA 4OK5A 2ZG0H 2D2FA 5HE9A 3UKDA 5CHAC 5E4FA 3RU4E 1QA7A 4OK6A 2D2EA 4PZZA 4UNRA 4SGBE 4B47A 5LGOA 1S85A 1NSFA 2ZGJA 4FU9A 2F6RA 5DHAA 5F8XA 1N5LA 4NCKA 2M5TA 3R0FA 3MJHA 3GEEA 4B3BA 5J4VA 3CH4B 1VIAA 1BBRE 4HLDA 4WY3A 1X8KA 1OB5A 2Z3CA 3L43A 3U8TH 2C95A 1GVLA 4E07A 4R71A 3M0EA 1GL6A 5SZKB 1JPJA 2IYSA 3M5MA 1BMFD 1DADA 2TGTA 1DICA 2CCJA 4ZHLU 4PPFA 4AKIA 3MNSA 3SW2B 1O2IA 1Y5AT 2O5VA 4DW2U 3BS4A 2FI5E 1UCYK 1MTWA 1CE5A 5CK5A 4WZAE 1S8FA 4FW9A 9LPRA 2JIZD 1GWAA 1DAKA 2OZEA 3MWLA 2F9LA 1QHHB 3RXJA 3T28A 5AUPB 3KKMA 1LS1A 3T26A 2B8TA 2V8OA 3QBTA 3PLPA 2GF0A 1WBDA 3ZD7A 1C5PA 1XVMA 3UREA 2QA9E 4AZ2B 3DEFA 1FFHA 2WJGA 1LDTT 1HQYE 4NMMA 2VIIA 1GHXH 4YLUA 1T4UH 1W48A 1IHUA 2C2HA 2Y7ZA 3WP1B 1CGIE 4HFPB 2ZR0A 4MH0R 4HAZA 4NBSA 2BXTH 3STJA 2F9MA 3GFTA 2CJWB 1WYKA 4GCHF 3A1SA 1BOFA 4JLJA 2NU3E 1GRNA 3EARA 4M53A 4Q9JA 1VECA 4R8TB 1XMNB 3HYRA 2ATXA 2FEMA 3LV8A 5KU1A 4LK2A 4GZMA 2W7UA 2QROA 3PV0A 1GDQA 1G3DA 1DG3A 4W7SA 2OK5A 2G4UA 2WAYA 3E0PB 4LGMA 3PROA 1T7CA 2OBOA 1UKZA 1LVBA 2VQSA 1T3SA 3SZRA 2FWRA 1HY3A 1CA8B 3MI4A 2OILA 3BC1A 1AS2A 2JKHA 3NHAA 1NBMA 4X1PU 1QURH 4HSEA 2TMKA 3K70B 3R3GB 1WRBA 3M7TA 1N1LA 2BD4A 1TU4A 1ZC3A 3GD7A 4ERNA 1VCPA 1O87A 3FMFA 4IVQA 4V0LA 2C98A 2WBLC 1ZMXA 2LCFA 1F5LA 2VWNA 2AK2A 1XZQA 3CRQA 3TJOA 4HUTA 3BG4B 5EQRA 3NBXX 4WIAA 5LD2B 3HPQA 5G4BA 3UR9A 2BY8X 2V3OH 3OFNA 4P4TA 4QBGB 1D9ZA 5E7IA 1SKQA 4JVMA 1WE2A 4YDSA 2CF8H 2D06A 2HNTC 3FZZA 4GI7A 1NN3A 3SNAA 4OHYA 1H9LB 5FCRA 2QT1A 1UTJA 2ODEA 4NU0A 2G1JA 2IYVA 1IN7A 3NK8A 4TZ0A 1U8YA 3CX7A 5DGXA 1FX0A 4HLUC 2YWHA 2B7DH 2GT7A 2DUCA 2VHJA 5TDHA 1G3CA 4IOJA 3T29A 1TL7C 4HZUB 1ZRBA 1NVWQ 1ZNYA 2OM2A 2A30A 4R0IA 4UXJA 1AGJA 1KKMA 4AI6A 1YRBA 5EJEA 4NYIQ 3UNQA 4X1RU 3A7XA 3BJIC 1MCTA 2YYZA 3U4QB 1O3NA 5J4LA 1ZYOA 1PQ7A 2V3HH 1TQDA 3ZZAA 1R6BX 3R9XA 5JBBS 2JA1A 4HI3A 1IQGA 1ZAKA 3CNOA 3B1XA 3B9FH 3AP1A 3EA5A 4HB2A 5L6NH 1HFDA 1Z3IX 5AHGH 2QENA 3TBKA 3RXMA 3NWUA 4MRSA 3AQ4A 1C5TA 2XSZD 1UBGA 5FBQB 1RD3B 3I8SA 3P8NA 1VCWA 2Q3FA 2CMKA 2GVFA 2GVZC 2NTYC 2PLFA 2ZGBH 1XJCA 3SFZA 3LDAA 3QPUA 1R4AA 4F92B 4U32A 4O0MA 4CRGA 3S1AA 4YOGA 2OBNA 4ZI3A 1K1PA 3K70C 2FWWA 2WJYA 4DSOA 1DBSA 2W83A 1VKJA 4LHVA 1FZQA 3KJHA 1G3RA 4UEHH 3SFVA 3MYWA 3BG4C 4X8SH 2J9RA 1GBJA 3RMLH 1C2MA 1NL3A 2O8CA 1FPCH 3A4NA 1VIYA 2KWIA 4C3ZA 1W10U 3QJYA 4S35A 1NC6A 2EYUA 2QC2A 3I32A 3CP7A 3E91A 5K8LA 3A37A 1EKBB 1DAMA 4WMFA 2C99A 2BX4A 1Y59T 1NLYA 4Y10E 3FKSD 3EA7A 2ZVPX 2ONKA 3GY5A 1LMWB 2FH5B 2P95A 4M9XA 2IJD1 1OIXA 4DCVA 1BO6A 1KSNA 2NPIA 1SC8U 3VB3A 1Z2AA 5EP1A 2G8TA 4A5TS 3SUEA 3B60A 1KI8A 3UANA 3LGVA 2FP7B 3N2IA 1AVXA 4RCZA 3ELAH 3E1SA 4BLRA 2UUKB 2XNDA 1P57B 2YNAA 4A7IB 3QXXA 4OI2A 4AGJA 2MMGA 2IK8A 2Y5FA 1F5NA 1BTUA 1V2QT 3TQFA 2A7QA 1PV4A 4ISHH 1YPGH 3HPTB 1C5UA 1T9HA 4JVLA 4ZDKA 3NKKA 3W3AA 2PH1A 3MMPA 4DT7B 2OESA 1NIPA 4X8MA 2ANBA 4Q4AB 3WY9A 4TMVA 2AMQA 1Z0IA 3B8HA 1SHKA 1YQTA 4KSBA 3MNBA 5FUYA 1P2IA 2N42A 4IDHA 3THYA 1DFPA 1KO7A 1SGIB 3BE4A 4CRDA 4QOSA 3RMOH 1EFCA 3AF2A 2D62A 4EPVA 2K1QA 3EWSA 2VVUA 1CVWH 2QNRA 5SZJA 4F49A 3S0NA 1C1UH 1ETSH 4AFZA 4GPGA 2XWAA 4H9GA 1HAPH 3L6PA 1QQ4A 3U44A 4IFBA 5IF9A 1QJ1B 4V0ME 3OU0A 4ZV4A 3WHKA 2RG3A 4ZI2A 1SLUB 4O3MA 2O8FB 1XRJA 3RU4T 2VB0A 3GCHB 1V2WT 5G3YA 3I4LA 1ZHMA 3H86A 2WICA 4YDHB 4X8UH 1Z5ZA 2FESH 1KYNA 5IK2A 2VF8A 2A4OA 5L3QB 5CIWA 5F8TA 5E2PA 1PJPA 1OWJA 4EQ6B 3RC8A 4RSPA 1S6FA 5B30A 1KK3A 3S9CA 1XEFA 4K8BA 2ZA5A 3R20A 4L15A 3BORA 1YM0A 4N3NA 2ILNA 4DG4A 3K0AB 4X2XA 2ZITA 2VIQA 1G2LA 4M1MA 5AJXA 5JBTA 4LJ6A 4RCYA 3S9BA 6LPRA 4YC7A 1NFXA 1HXEH 1MAYA 1PYTC 4JZIA 1GKUB 4CR5A 3RANA 1QY6A 3PITA 2Y5HA 2W3IA 5GXPA 1XEWX 5FOUA 5FX6A 3EA8A 1UBCA 1UEJA 2NU0E 1O3EA 1Z28A 1AGRA 1Q1ZA 1N6IA 5HCNA 1G3UA 4M9QA 4X2WA 1IN6A 3PCRB 1K9OE 1AWHB 4OI4A 5H1YA 4MRVA 3OX7U 2RCEA 2XTZA 5JWHA 1D4PB 1ZM4A 3SQWA 2WWHA 4AFQA 2CNWA 3UTUH 4H42U 3L2OB 1FQKA 3A7YA 1P09A 2FODA 4IMQA 3QGJA 1GITA 4JYBA 2ZANA 3F8TA 4JLVA 3VEQB 3EAQA 3EDXB 1KXAA 1XD9A 1SVKA 5CM9C 2VP5A 5ELXA 1HB0B 4HDOB 2WKRA 2GESA 5IHPA 1P7CA 3KQEA 3T62A 3S7HB 1UTOA 1X8LA 4B2PA 1CBWB 3QNUA 3E6PH 3OIYA 1TA2A 4Q5IA 3ZZUA 5JJKA 1A3BH 3GCHC 1ZUHA 4E7RG 4X8VH 2XB4A 2X19A 3N70A 4TYNA 2OC7A 1XKBC 3U61B 4ZUHA 3C41J 3GLHB 2W6JD 4CHAB 4UFEH 2ZU1A 4CIDA 4TTQA 4FVDA 1ZJ6A 1UK3A 4V02A 1ZMLA 1HPGA 1P2VA 2DWQA 4TTRA 3R8CA 3BG8A 1QIXB 1TMUH 3A82A 5D3QA 3VR5A 1ZSKA 2WIBA 2JH5D 1ZHRA 2CJIA 1VG0B 3CO5A 1J17T 1IONA 4Y11E 1FY8E 1XWIA 2A32A 4ZDIA 3RYTC 1JJVA 4M21A 4FIDA 4NCHA 1NN5A 1E99A 1EFHA 2Z94A 2FX3A 2Q6GA 1EJNA 2VL7A 3U6KA 3DOEA 4I33A 3THXB 4A2QA 2O0HA 4UFFH 4EKDA 1Z6EA 2D74A 3FMPB 1C2GA 4GBMA 2HLDA 2ZJ5A 3PMJA 7LPRA 1MCVA 1HE1C 1DOAA 4ZCIA 1EXFA 1VYUA 1TBQH 1LKAA 3VNVA 1O2QA 2IX3A 4Q7MB 3VR1A 2BMFA 5GJBA 2DYKA 5DH9A 1ZCAA 3IO5A 2KE5A 2F9PA 4NHOA 2ZR9A 2A4GA 2C96A 1EP5A 4XSKU 1U8AA 4BAKB 3ADKA 2DY1A 2G3YA 1LHGH 1V2JT 5KYKA 1ETTH 1ZUIA 2EU8A 1W1WA 4DGJA 2AX4A 4DIEA 4PPGA 3L0IB 4ASUA 1S2MA 1G16A 1ZBDA 4Y79A 2PMKA 3TKLA 4UXIA 3BH0A 3H2YA 3HU3A 1KK2A 1PPCE 3MCAA 3UMSA 3H84A 1CHOG 1NY22 2PSXA 4FWIB 4BFXA 2HRVA 1SOZA 3EPJA 4MITA 1JIMA 3R8FA 1DTSA 2H1LA 3TK9A 1LHCH 4A15A 2VEDA 1GI1A 4CREA 1GHBG 5TMPA 4CHAC 2SGFE 5KDLA 2JLQA 1E0AA 2F55A 1CULC 4R9UC 3ZV8A 4RSGA 3CR7A 1GAJA 2JLSA 3UUZA 2P93A 2G0TA 2O52A 1I2DA 3ATKA 1XMSA 4E05H 1OWDA 3OY6U 3U1IB 2QXGA 2F83A 1XTRA 3Q72A 1RE0A 2ODYB 3FYHA 2BQ7B 3TGKE 1GIAA 5AJWA 4Q01A 3EG5A 2H7VA 1T8NA 1P61B 4DLTA 4LYFA 4FXPA 4DIHH 3DOFA 4GHTA 4G1UC 1BRUP 1SL3A 2O8BB 4GAWA 2BJVA 2CHGA 2VSXA 4TL6A 5ABWA 1ZNZA 1DUEA 2OV2A 3LNCA 1P2QA 3PUVA 4WZ6A 1OE0A 2KBEA 1ZW6A 2IC5A 4Z8YA 4Q7KA 4MRRA 2AYWA 1CIPA 1R0YA 1R10A 2IXGA 1FNIA 2LKDA 1B0EA 2CCKA 4Q9HA 2CXVA 2ZC9H 4XH9B 4BFWA 1N6HA 3VQTA 1GCDA 2QU8A 4DLWA 3PV4A 1W7XH 5BN3A 1FN8A 3RRMA 1F6BA 1YPKH 3UG7A 1KLJH 2YVUA 6GCHG 4RKJB 1E2EA 1KIGH 1F48A 2AKAB 1EP6A 3WNDA 3BEIB 1Z71A 3GCOA 3K8YA 2ZS9A 2VU8E 1AKEA 2WPLS 4QM6A 2JCSA 1TUIA 2BJWA 1EGAA 3BGWA 2FTLE 4A4DA 1C2FA 2IYRA 4P32A 4DRZA 3G0HA 4CRBA 1AFQB 3WYFA 4GDFA 3P4XA 4IN1A 4AD8A 1WU1A 3K0SA 1ZCBA 3BWDD 4D25A 4FUDA 4QBFA 4LBVA 3RDPA 2XTTB 2RGAA 2O0JA 3TH4H 3SHAH 1ODFA 1B5GH 1GBIA 3FZDA 3TW8B 3PR1A 2ZCHP 1UKEA 3X2SA 2XC5A 4JYUH 1GTVA 3VX3A 2EFDB 2ATVA 2IUUA 4H6TA 1NY6A 2ZETA 3LVQE 5LB4A 1LHDH 5T3HA 3UFAA 5FI0B 1ZNXA 1O2ZA 1HEIA 3KQKA 3KJIA 1O2XA 2CLCX 3MRSA 3OEHD 5DP8A 4Q47A 1SFQB 4YTAA 1VHLA 3X1ZA 4U7DA 2WUBA 1FIWA 2C3SA 1GUAA 4DHEA 1DXPA 1MH0A 3F1SB 5GJ4B 3LY5A 4DUGA 2SFAA 1TUEA 4Q1FA 1LF5A 1KZGB 4YESB 1PFXC 4ZKOU 2IYYA 5G53C 1KXEA 5HM9A 4UJ5A 1ABJH 3CLVA 5KSPA 2OEPA 2O8TA 2QP9X 1C5QA 1Z8RA 3SHFA 3ZIAD 2C90B 4IW4E 2Z3EA 1OYQA 2C8VA 5JSZA 3QG5A 3LFUA 1IQEA 1A7JA 4DLRA 1SGFA 4XOJA 3Q76A 1IJFA 1FOEB 1AKSA 3DM9B 2O8DA 1OX1A 1QG2A 4F4CA 3MO6A 1G8YA 2F9VA 3QZQA 5C20A 5EUMA 5KO2A 1PLKA 1JXPA 2YHSA 2WPJS 2OTVA 3PMHB 1EPTB 1AFQC 1W4AA 3I5YA 1S1MA 1XUGA 2GK7A 1VG1A 3EAJA 2H5EA 4OQXA 1O3JA 3CONA 3GY7A 3ZZ0A 5DN6A 3I72A 1US8A 1KAGA 3V3MA 1JMOH 4NA7A 2IXFA 1DS2E 1EESA 4I1VA 3TH2H 1GHZA 1G18A 1UDWA 2XOKA 1AJEA 3N2EA 1C1MA 1TQ0B 2Q9CA 4DLVA 3BBPA 2ZYVX 4A8JA 3UY9A 4GMXA 2ZHWH 5EXPA 3GMTA 2F3CE 5DP3A 3PUZA 3FE2A 1ZRKA 4FMDB 4EDHA 3ESTA 3U2QA 3GLFA 3GY6A 5JWOA 4XJXA 2PR3A 2ZZUH 1P10A 2NWNA 4BUJA 2QAGC 4THNH 2IA5A 4OS1A 1E9EA 2V6IA 1UTPA 4OI1A 1OH6A 1WCV1 1LVMA 3B6EA 2DFKB 5EXNA 1K5DA 5FUWA 1UVSH 1FIZA 1O39A 3L8ZA 5L2ZH 1A0JA 1TGNA 2CE7A 4YONB 3RXUA 1F3OA 3A87A 4NZLA 1XX9A 2ZKSA 4BXSA 4V03A 3NH6A 2BM2A 5D3MB 3Q5DA 2I1VB 5JBCS 4LBWA 3W6NA 2AEIH 1P75A 4NG9H 4NYJQ 1X1RA 4Q21A 2R62A 1Q3XA 1W0KD 4IRUB 3W95A 3LGYA 4GOXA 3ZQJA 1G291 5HM2A 1O3FA 2H57A 1EPTC 4G5SA 3BIVH 3M3TA 1DAGA 2O8EB 1DWDH 4L5BA 1E2PA 5BYJA 5CE1A 2Y81A 1IQFA 1KO1A 3CR8A 2UWOA 4Q4HA 1GCTB 2V6NA 3NIBA 3RNLA 2B7CA 1SGDE 2C9OA 5C46F 5E0HA 4TYYA 4LUCA 1TE0A 5FCKA 1KLIH 5FBEA 2J0UB 4W5JA 1GBEA 2B92A 4JLMA 1RRKA 3LC5A 2PW8H 2BMEA 5AK0A 4DSUA 3QZRA 2ZU3A 3MNCA 1ZSJA 1A2BA 2A7JA 2P0EA 4A82A 1PPBH 1RZ3A 3UR6A 2FFQA 5EE3A 2BY6X 2ZE5A 5I46H 3C4JA 1VYVA 1TMBH 1RRPA 1GNRA 4I1UA 5SGAE 2OQUA 2IEYA 1E9RA 4FN5A 5FBWB 4BLSA 3L33A 3P95A 2BLOA 3ZS8A 2XZOA 3QUMP 1W5SA 3ZYEA 3T5DA 3AUXA 5G3ZA 4IVPA 4JKYA 4TYDA 3OAAA 3LC3A 1H9IE 2P65A 4Q7YA 1WQ1R 1Q3TA 2R0LA 1SXJA 2EWVA 4QL3A 5KDOA 2W58A 1JR3A 1QHHA 5E3HA 4NFEA 4G5GA 1G32B 1P05A 4KVGA 2HLCA 2NPFA 1QCPA 2B8WA 4TLEA 3ADDA 1JXOA 5J4KA 2X77A 3NHBA 1FY5A 1EAUA 4PO8A 3MWKA 3KKOA 2XBXA 3P27A 2WOJA 4G5RA 5JFGA 4IJMA 1GMDG 1GJ4H 2GAAA 1KXBA 3KL6A 4KP0A 2FFAA 1S9DA 1NZQH 2VIOA 4F4OC 1E2QA 2GWHA 1KI6B 3LOXA 1XXHE 3LX5A 4F4IA 1T8TA 1VYTA 4UNSA 1LTQA 4Z8XA 3QI2A 3REFA 4OQLA 1XUJA 2CJWA 4X8HA 1W44A 2A4RA 1HAOH 3VFDA 4B3GA 3A80A 5DP6A 5FTNA 3CX6A 3SNHA 2GK6A 4LJYA 3M37A 5A0AE 1GCTC 5L3VA 3RRZA 4J0QA 1AIXH 3G82C 1PLJA 4PQYA 4QGFA 2AFQB 5F6MA 2OG2A 3GP8A 1GJCB 5KPDA 2JJ1D 1UTKA 3HDTA 1TADA 1P60A 1C1SA 1W13U 1WXQA 1XUIA 2ALVA 1UBEA 1ZC4A 1W2KH 2NMVA 2ZJYA 4QRHA 1Z6AA 3SYKA 1MMJN 1O2OA 1MZAA 4FWTA 1JBUH 4XD7D 3BTME 4JVSB 4ZCMA 1BOQA 1SHYA 5EXLA 5A5GA 2W6IA 1RTFB 5H68A 3E5HA 1E1RA 4LYAA 2RKOA 5HGGA 1T4GA 5FBRB 1P3EA 4WMDA 4DEYA 2P16A 4JZKA 1Z0KA 3W9YA 4BFSA 1ZGVA 4JJZA 1XUFA 1H9HE 1YCPM 4O2RA 5AJYA 4F38A 3FHCB 1SGQE 1UCYH 3DMNA 1YZKA 4PC3A 3AF0A 3QPWA 2ORVA 4HZUA 4OS2A 1W2HA 1V2RT 2CCGA 1AQUA 5F3WB 2PHBA 4A1TA 3JZ1B 4FU8A 3U4QA 2GCNA 4OYHA 1DO2A 1D2EA 1FY4A 2ZPRA 1VMAA 1C1VH 4JZFH 2J92A 3OY5U 1UMAH 1FMGA 5TJXA 1SLXB 3CPEA 3GFOA 1GGDB 3MU5A 3LGTA 3THWB 4TL8A 3SI7A 2QMOA 5GCHG 1DE7H 2NQ2C 1MD7A 5B2ZA 2F1IA 4OS6A 1GG2A 3JVVA 3TVTA 5LB2A 3UG6A 2RGDA 1BTYA 5EP2A 4GZLA 2K5UA 3IIMA 5JECA 3LD9A 3SU4A 1G5RA 2IYLD 1C5SA 1GBKA 1TOCB 2ZTSA 1F2UB 2EA3A 3I8XA 1YPHC 2XRCA 4MPWA 4KYIB 2DE9A 4BZXA 1GKIA 5JCPA 1F92A 5GJCA 1XU4A 2OHFA 4GSYA 3GLIA 1O2LA 2SGQE 4AC9A 5LH8A 1G4AE 1OKKA 4YLGA 4TWYA 3AB3A 1AU8A 4QGGA 1DWCH 1O3CA 1UVTH 5G40A 4XIGS 1W7AA 4AG5A 5EU8A 3N7OA 4E22A 3TPIZ 1CJUC 2FSFA 2W26A 4Q4LA 4MNWA 2RGNC 2SGEE 4Y8YA 3WHLA 4OHXA 5C4MA 4MKHA 2ZE7A 4B6FA 4LZ4B 1C5NH 3KQNA 1MH1A 3UXMA 1GHWH 5FBIA 4FUJA 2CLDX 1WA5A 3AF3A 4B71A 2V54A 1KY2A 1VCQA 2WPDD 2IBMA 1MT0A 4LRWA 4I8KA 3TK6A 2Q3HA 2NG1A 3LWNA 5JWRA 4B32A 1JIRA 4BZPA 5E2OA 3PUYA 2FFBA 2J46A 3RXSA 2CN0H 1UJ1A 3PO1B 2BD3A 4NYMQ 2VIVA 2C04A 3EZ9A 1G2MA 2CVFA 1S83A 2F9UA 3A7TA 5A0BA 3E0NB 1EXMA 1ZM3A 2ZI9A 5EOKA 1VCNA 3ZVMA 1K1NA 2XGJA 2GJ8A 2ZI4A 1OLOA 2HEIA 5JI3E 4MYTA 4AIIA 1V2KT 2ZS8A 3AVUA 1GGDC 2Z3DA 3NEYA 3SS8A 1GJ7B 4GCHG 1RVDA 1VJ9U 3KF2A 3KUDA 4US1R 2ZHEH 2WKQA 3ZZ6A 4Q4AA 2YOFA 3GJ3A 2MSEB 4X1NU 3GPLA 1N6PA 4AGKA 2JAQA 2ZGHA 1ZMJA 2ZJOA 2A5JA 4HTCH 2ZHDA 5BW8A 3MGCA 3GDUA 1UDXA 1SGYE 3UNRA 4EPXA 3PTNA 3NWJA 3IEVA 1E2LA 4OL0A 1V2LT 5DISB 3A7WA 3OYPA 1UHBB 2AD1A 4RKFA 1SR5C 1TNHA 4LV5B 3LIWA 4DDTA 3NUMA 5F9FA 2A5GA 1NRNH 5AJVB 2AKYA 3RXHA 1GM5A 3KQHA 3MJRA 1OWEA 3ICEA 1GWNA 1E9AA 1DG1G 1YJ5A 3A4LA 2O8FA 2CL6X 2J38A 3P6ZB 3IBGA 3B1ZA 5A0FA 1TQ7B 3ENSB 1II8B 3KJGA 3IUYA 3VB5A 2QORA 1QBNA 1FAXA 1DARA 3LO5A 4NYIR 1O2WA 4HDCA 5BXQC 3M5NA 4EQ6A 1H1BA 4JVNA 5EXTA 3OEEA 3HATH 1A5HA 2R9VA 4IEEA 4TLAA 1OFUX 1CHOF 3O8RA 4JBYA 1ZHPA 3MSXA 1CGJE 2FX6A 5DLQC 2IYZA 3VU9B 2FF7A 3WRYC 5CMXH 3KXKA 4ZIRA 4LHZA 4URXR 1M6NA 521PA 1GHBF 3PO1C 2B7BA 4DB2A 2ZU6A 1NJFA 3KB2A 1FV9A 2WWGA 5FTLA 2G77B 2AWOA 4ZDJA 2AGEX 1IXSB 3BN9A 2D1JA 3G5UA 1W5TA 1QRAA 1P9WA 3U7HB 4K8YA 3F0TA 1G6HA 1MOZA 2RDLA 4EFMA 1QZXA 1G3QA 1K2I1 1QJ6B 3SYJA 1R5OA 3U3JA 2IYTA 2EC9H 1HAGE 3W6PA 1XUKA 2EWWA 3QPVA 1FP6A 3GYLB 2CL0X 4JIMA 1Z2CA 4KVAA 4YM9A 2QGRA 1LQEA 1TF5A 1THSH 3QE0A 1Z0DA 2NU2E 1IOZA 3LRPA 2J7PA 3D6TB 1HQCA 2R3UA 1GI7B 4AYTA 2G55A 4JZDH 4DY7B 1O36A 1CSOE 5F9HA 2GDJA 2PTCE 1U94A 2P3FH 5DI9A 2BBSA 1FN6A 3I1FA 4EAQA 3RC4A 3I73A 1LF0A 4FUFA 4DJTA 2ZU2A 1XF9A 4TMZA 2G83A 3B7GA 1FY1A 1W11U 4ABIA 2Y82A 2ZRPA 2UWLA 2ZQ2A 4AX9H 1DS6A 1FUJA 6GCHF 3W34A 3PXGA 2UUYA 4RVCA 1L4YA 4ZKEA 4CW7A 1LCYA 1XTIA 3NDBB 3O8BA 1TGSZ 1UBFA 1YZLA 1QR3E 1U98A 1YLDA 4D0LB 2ZJBA 4W5HA 2JASA 4KAXA 3CKLA 3HGNA 3TRFA 4TT3D 2Z9LA 2FOAA 4YXWD 5C1BA 3ATIA 4VGCB 4TSFD 4YOIA 3BTKE 1A82A 4NZQA 1TOMH 3RS3A 2EI6A 1QB9A 1TMTH 4TL7A 4QNMA 2Q21A 1OYYA 3AKCA 4DB4A 2F4LA 1HIAB 3SV6A 1S82A 4IGDA 3HWSA 5DKMA 1YR9A 3O8DA 2BTCE 4NWLA 2XX3A 4Y0ZE 3VKWA 4HLQB 2BDCA 2IYUA 1OOKB 1XXHB 1Z6TA 4WVFA 1A2KC 1XTKA 2XBWA 1IQNA 1GOTA 5EP4A 1KYIA 1INCA 4TYWA 2P5SA 3THXA 5DG6A 3I78A 2QZ4A 1P3CA 3WMEA 1CF4A 4A1VA 2GXUA 3MG9A 5DGJA 2FPLA 3M5OA 4UFGH 1P3JA 3FHOA 3UPEA 1DDJA 1UAAA 1Z07A 2FLRH 5AF9H 1O32A 3EZ7A 1SGFG 2VP4A 1KO8A 1C4OA 1P2SA 3RC6A 3GEHA 2OFXA 4AB9A 2HNTE 1MUEB 1TRMA 2AFIE 3NXSA 1WQVH 3C7KA 1MTSA 1O2MA 4WXPA 3DHKH 1HJ9A 4LZZA 2QGZA 2BVRH 3KQCA 1O3MA 3P8FA 1BITA 4HGCA 4LJ7A 3WNBA 1N0VC 3SV8A 2VBCA 1TFXA 1EZUC 2R9PA 3DFJA 1B23P 2GEUA 1MTNB 4FUIA 1XZPA 3GFPA 3LGIA 2KSQA 1B0UA 2RCNA 2JLZA 4FU7A 1SQAA 3J81k 2QPTA 3WYAA 1C2KA 1W0YH 4D6PA 3IGFA 1DLEA 2XXAB 4PAMA 3N5CA 2JETB 4N0DA 1PQ8A 3OESA 4ZO4A 4WH8A 1Y3AA 4VGCC 3BAFA 2VIWA 1TYNA 2A9KA 3WP0A 4I8GA 1G19A 2P94A 4LJ9A 3BTEE 3D49H 3SJIA 3MHWU 1CT4E 2OCVB 2H5DA 1XEXB 2EFGA 2J59A 2V7QA 4TLCA 5FL7A 2O8BA 2KAIA 1ESBA 4L9SA 1F0SA 4JLDA 1HURA 3CRMA 4B6EA 5JDUB 1O2TA 1HNEE 1JB1A 2DFNA 2V4ZA 1BMMH 3RXDA 3GCTG 1T6NA 1G5TA 1WQSA 4KCGA 2XYAA 4LYJA 2CEAA 5JS7A 4KXFB 1WOFA 1YLCA 1DUAA 4RZXA 3L8YA 1DVRA 1D3DB 3LLUA 3RLWH 1ZPZA 3DDCA 1IQPA 3GJ5A 3RMMH 3TSOA 3SU6A 5KOYA 2QXHA 2WJIA 1NBMD 3FFAA 1N6KA 1YBWA 2WM9B 4DDWA 3MFYA 1Q0UA 4MGIR 3CIOA 1O2VA 2ZHQH 1Y8TA 2OINA 2WV5A 4G5OA 1OHHA 4NCIA 1DM4B 5F8ZA 1CT2E 1TA6A 2NU4E 1THRH 2J0VA 2WMOB 1ANDA 4UNNA 3QK1A 4DLUA 4QXAA 1JNYA 1O5GH 2FS9A 1G3MA 3OFND 4A9AA 2ANWA 3MOCA 4Q9LA 1H8HA 1C5XB 2RAPA 1KSJA 4RKEA 3AASA 1QHSA 1P9UA 2QQEA 2P59A 3MH4A 1MTNC 2VVVA 1JECA 5KNBA 1U2RA 1YU9A 4PQFA 1ID5H 1QJ7B 3HR8A 1QF9A 1SVIA 2STBE 1W0JA 2P2LA 3DHWC 1DAFA 4IXNA 3P4YA 3H4MA 2WSSA 4MPXA 1SVPA 1MU8B 5LPFA 4HB4A 3WYGA 4ISLA 4DLZA 3RM2H 2JETC 3TJVA 3K0CC 4AK9A 3VKHA 1ACBE 2A31A 3NCLA 1K5GA 1UEIA 2FOHA 4PAQA 3QKRB 3F9EA 2FE4A 3UNSA 3TH5A 1KDQB 5FXLA 4LC1A 3GCNA 4B35A 1Z1JA 4Y7AA 4QGAA 1M7GA 5FL3A 3I29A 2BBWA 2RMKA 1GL0E 4DURA 5TY0A 3WMGA 2JLXA 2GZ8A 2Q3MA 4YT6H 3QXSA 1BRAA 4E03A 2QN5T 3RS2A 4P0TA 4CH2B 2FMXA 2GRJA 3CUEF 3NBFA 1GMHF 4FCWA 3R7WA 5KSZA 4C0KA 4MGKR 3LXRA 2BD8A 5EXMA 2AXNA 3BV9B 3ZDQA 4BLTA 1OSNA 1Q2WA 1E32A 2BZ6H 4NTZA 1NP6A 4CBOA 1AS0A 2XTNA 3GJXC 5AUOB 2OC0A 3U69H 3K53A 1XUHA 2A2QH 4IXMA 1OIVA 3HK6B 1CJKC 4Q1BA 3VPKA 2P3SA 2CF9H 1D2NA 1IQHA 2CBZA 3BXZA 4R2IA 1TAGA 4MQBA 2IWHA 2PBRA 1EPTA 1MU6B 2OCBA 1DITH 1KAOA 1F5RA 5KPJA 2VH6A 3MFJA 4V0MA 2XITA 3TIFA 4MG3A 3QVVA 2BOHB 1H8EA 1GMDF 4QT8C 1C9PA 1MTUA 4PX9A 1ELBA 4E09A 4TQUS 1GILA 4LOYH 1EJMA 2X2EA 4MRPA 5IRCD 4I81A 1ORFA 4AB8A 4AKGA 3A86A 2Q9AA 5B57C 4US2R 4B44A 1RXPA 4EJSB 1FUUA 3K1JA 2KB0A 3VHLB 4Y7BA 4BLPA 2RGCA 4BRUA 4BFYA 1KXCA 5IDVA 4BWYA 1VG8A 1M74A 2J3EA 1O5FH 1UTNA 4AFSA 1H4WA 3GJ4A 1NVUQ 3SQEE 1YHNA 2XNDD 4JCNA 1N3BA 3FMIA 1X7AC 2R2AA 3RXVA 3AVZA 1CTQA 4BFZA 2GT8A 4D26A 1XP8A 5CHAB 4YLQH 2CHVA 5T6GA 2B8OH 5K7RA 3NH9A 3BOSA 4DIIH 1D9IA 5C4GB 1OSSA 4LHYA 3WY8A 1YGCH 2HT6A 1T32A 2N46A 2CGAA 1LB1B 2VP2A 5D3MA 3CZQA 1J8MF 2B5TB 2YOGA 5LPRA 3PEWA 2XNSA 3EWAA 3GISB 3IIKA 4D7GA 2TRMA 1VCIA 3Q77A 1Z0AA 3MU8A 1UCYE 1A4WH 4IC5A 4GRAA 1HT1E 2XZLA 1XMVA 5AWFC 1Z8JB 4BPBA 3AVOA 7GCHG 4Q1AA 4UNQA 1O5BB 4XFQA 4QG7A 2G0NA 4ABGA 1IQKA 2G5VA 1TX8A 5EODA 1Z8GA 2ZRLA 3LU9B 2OUKA 1VZQH 2O8EA 4A0FA 1GJAB 5FFMA 2FIRH 1NLZA 3TGIE 1ELVA 5KSYA 4ESHA 1RRFA 4INHA 3C5HA 2CL7X 1YKSA 2ZJZA 4POAA 1EAXA 5IK2D 2BD2A 5EGMA 2J0UA 1XPRA 4RI0A 1WTHD 4BGDA 1O2YA 5GDSH 2C9YA 4RN6A 3ZZ8A 4LV6A 2BVXH 3KDSE 2QSYA 3MMGA 2ZECA 1C5YB 1EK0A 3REGA 2PEZA 5B6OA 1GJ6A 5JS8A 3U60B 3RXEA 3T1VA 4L4UA 5BQ5A 3QBVA 5A8ZA 5GCHF 5HKKA 1SGRE 1U0LA 4JLOA 5F03A 3MAAC 4ZMAH 1YCPK 1IAQA 4TMTA 2GJ9A 4C9BA 2ZI3A 2A45B 4DCNA 4TWWA 1HDTH 3GOVB 1EX6A 1RW4A 2FEOA 1TWXB 3VR2A 4H6SB 3NC1C 1TPOA 1CKEA 1O3GA 3QSYA 1TEVA 1KO5A 1D9XA 5TXGA 3VR3A 4NDZA 1NM6A 5LDDC 2O9QA 1TPAE 1UADA 3U8OH 3FANA 1BHXB 2DWOA 2QBYB 2CNWD 1TNJA 1O2JA 4M8NE 2IPHA 3AAUA 4WMEA 5J47A 4UJ3A 5A09A 3GLHE 1G3EA 4YMSA 1KI6A 3EZ6A 1E35B 3PLBA 4JLKA 2JDIA 1LV7A 1PQ5A 2WJVA 1SQTA 4D4LA 4X8OA 1R8QA 1NN6A 4Y0AA 3URCA 2LPRA 2YZ2A 5FOTA 1G8PA 1L4DA 1VGCB 3KFVA 4ABHA 2GCOB 2IYWA 5EW2H 4I4LA 3AGPA 1F5KU 2RHMA 3LVRE 5DP7A 1NRPH 2FX4A 2O8CB 1Y5UT 4MYHA 5L8VA 1FJSA 1V2TT 1E2MA 1G1MA 2GGVB 3NTUA 2QF3A 3RSOA 2BDIA 3CRW1 1PUIA 3KUCA 4F4JA 2CK3A 1ZJKA 4Q80A 3FP8E 2G88A 1QVRA 4DSNA 3PWBA 3QXCA 5TB5A 3ZYDA 1HUQA 5JMTA 3I92A 1R0XA 4Q02A 4I32A 3A8BA 4JS0A 2WTUA 1V3XA 4ISNA 2HJVA 1GJBB 2A7CA 5CB8A 1GI9B 1M1YE 4MRNA 2HDNB 2IS4A 3SJBA 1KY3A 2WYGA 3ZZ5A 4PQRA 1KTTB 3B9PA 4KO8A 1GBAA 4ABDA 4YOJA 2WWWA 3QIAA 1O3DA 4M0LA 2ZF0H 1C4V2 2HLDD 4V0KA 4NYJR 3A85A 2TBSA 1EFUA 3OHMA 4B34A 4CVNA 1DAHA 4A6PA 1BTHH 5JYIA 4FD2A 1GKYA 5JRZA 1AZTA 4LBYA 3TITA 1E2HA 2C8XB 2A5DA 5DO4H 3U7FB 3CNNA 1KGDA 2ANKH 1FQJA 2AN9A 3C8UA 3RABA 2ZGXH 1PPZA 3SV9A 4M1TA 1ELDE 3THYB 9ESTA 4YZUA 1AVGH 3KEEA 4ASUD 4C7OB 5DIFA 3V12A 3KX2A 3DUXH 2JJ2A 2ANYA 1JAHA 2XAUA 4IBLH 1O33A 2ZFPH 3UOPA 4Q7ZA 1VGCC 4TL9A 1FTSA 1S6HA 2A4QA 1SKYB 4ARZB 3U44B 2NZ8A 3ND9A 1C2HA 2VP0A 3CENA 2Z9GA 3LW8A 5JCZA 2ZDMA 3TH3H 3GLGE 2IWRA 1JRTA 1SOTA 1C5OH 4TN1A 3QENA 2X2FA 5DPAA 1O30A 2DWPA 1F2UA 2NO1A 1KI3A 2ZTZA 2ZI7A 2OE2A 2OFOA 3QXJA 3LJOA 1GBMA 3RS5A 2A5AA 2ECKA 5B64A 1W0ZU 3MD0A 1AUTC 1TIOA 4J1YA 5E7JA 4ACBA 4C2UA 1OV4A 1FLEE 5GJVC 4XOIA 3CW2A 3SUGA 3VGCB 5HCIA 2OQ5A 3EX7C 3ZLJA 2ESTE 3SU2A 1TB6H 4ZKNU 1E3MA 5EQTA 1II0A 2ASEA 5FOWA 4TQAA 3UPUA 1GI3A 1LY1A 2FDAA 3LBNA 5FX5A 3AVXA 3AVYA 1GNQA 3ND8A 3SE0A 2VP6A 1OPHB 1F2TB 1Z0JA 3A58B 4LDJA 1O5AB 5FPTA 3KGPA 2QE7A 2L0XA 2PUXB 1C2EA 2QP3A 3AVTA 3BTDE 3NPSA 2FG5A 3WBJA 4RD0A 1W47A 3DZ8A 5EPYA 2R2WU 4OGYA 1K6MA 3UWJH 1E0KA 4N1AA 3ZVCA 4Q66C 3LW7A 4XWKA 3T15A 2NO9A 3P70B 2GXQA 1RJ9B 1QTFA 2Q6DA 4TY7A 4D0GA 2D4HA 3FKQA 1KDOA 4ISOA 5FPSA 2UUFB 3EC2A 2GJAA 4C0AC 1WBBA 2F91A 4UKDA 1S81A 2XCFA 4DEXA 4BLQA 4ZAEA 4CDGA 1K1LA 2LNCA 1CJTC 1Z7KA 4OQMA 1VCMA 2AL7A 1DAIA 1TMKA 3TLOA 2AGIX 5J5CA 4IS5A 1U90A 3A1VA 1O2SA 1E1QD 1SLWB 1G7TA 1QHGA 3A8CA 2H1UA 4GL2A 2Z9JA 4RD4A 1Q1BA 1DPFA 4GMDA 2Q6FA 2FA9A 5CJPA 1J15A 2WWFA 4Q1CA 4CF7A 3M7UA 4JKIA 1AN1E 3AP3A 5C1UA 2ZCKP 4URZR 3FVQA 4LYHA 1UHBA 3AM1A 4MDFA 2TGPZ 4I1SA 1RPZA 5AJZA 5I25A 2F43B 3VGCC 4INLA 1ZINA 4IN2A 1DWBH 3AVVA 4ISIH 1PPEE 1C1PA 4O03A 4PAOA 1GDDA 1LVYA 4ABAA 4DBLC 4DUGD 2GDDA 4DT1B 3W90A 4H4FA 2ZRDA 1L8QA 4P31A 3DT0H 1ZU5A 2GXSA 4NIVA 4R2HA 3K9NA 1T8UA 3QX5H 1IN8A 2P6NA 2FOMB 2FNAA 3UWOA 1LVGA 1TNGA 1EAWA 4O9VA 3SBEA 4AN7A 1GBFA 4GFDA 4HZHA 2FOBA 4M1SA 1AB9B 2GKVE 2G81E 2BQWB 4Q18A 3CWZA 3NC0C 2BB4A 3EPHA 2Z5FA 3U3RA 1BMAA 1E79A 2CLSA 1KIMA 1A46H 1KI4A 5T1VA 1C5VA 2IF0A 4CT4B 2BLQA 3DKPA 3ZYCA 1GSIA 2AWNA 5EE0A 3UMFA 3NEJA 3B2EA 5FTKA 4IHQA 4X1SU 2C5LA 4K60A 2J1LA 5JHHB 2O8MA 5C5NA 1WCZA 3RC5A 4ABFA 1AS3A 1P2OA 1WV7H 5DN6D 2H6MA 4MDEA 4WW0A 1QHIA 1H8DH 1W36D 3JZMA 4D82A 2AD5A 2Z4SA 5J4QA 3LGWA 2XOKD 4NCNA 4P4SB 3LQQA 5UKDA 1Z22A 1NFUA 2WPIS 4NA8A 4WAUA 4ZXYH 2QUZA 5EZ6B 3TSZA 2ZRKA 1YYY1 3H5CB 1KK0A 4UD9H 1XMJA 1GL7A 3AVQA 2YJTD 3GCTF 1TBZH 2WMNB 1P11E 1QL9A 5HYOA 4C0LA 2ODPA 1Y3UA 2A1DB 2I1QA 1BDAA 1QHNA 1TABE 3MWYW 4DJZB 3IHLA 2IS2A 4KFTA 1V5WA 1UF9A 3ADBA 1YR6A 1NT1A 2ZFQH 2ZAMA 5HZHA 7KMEH 5GVRA 2TGDA 3QG1A 1WDTA 2ZI5A 4RFSB 4OI0A 1OP8A 1T0HB 3TK5A 3AP2A 1WB9A 2BDAA 4NGAH 1ZJDA 4OM9A 4OBEA 4RD1A 4GOKA 2CE2X 1AB9C 3HJNA 1X1SA 1YPLH 5JB8S 1C2DA 4LK4A 2OAP1 5HR5A 4IC6A 1HIAA 4B2BA 5HE8A 2J7KA 4EUNA 2R44A 4PSAA 1I4LD 1XXHA 2BD5A 5DI3A 3LGUA 2R65A 4ON9A 5T6DA 2QXJA 2W2TA 3Q5EA 3Q00A 1ZD8A 4MQAA 3LKWA 1WF3A 4IVRA 3LA6A 121PA 2WOOA 2VSFA 2G00A 1TQ2A 1OFIA 1JEEA 5TVKA 1ZP6A 2ZSAA 1GMCF 1E4VA 3LJJA 2VO1A 3AVPA 1NU9A 1GJ5H 2F7SA 3DZDA 3ODDA 4TPYA 5DYGA 4M2LA 1K1MA 2FS8A 3E2IA 2G6BA 1C5WB 3ATMA 3PM3A 3C14C 1UM8A 1XCGB 4BTIB 1F0RA 2J41A 5GPIB 4O2LA 1OH5A 3PLKA 3IBYA 4JYTA 4HUQB 2KI5A 2A5IA 3SYNA 1GP2A 4JYCA 1SSXA 3PV2A 4TYPA 2FYRA 5BWMA 3LONA 4LWZA 2FV8A 4FCTA 1KI7A 4X2VA 1GI0A 4QHSA 3BERA 4Q03A 3ZZ4A 3HR7A 3EZFA 1IHTH 3IIJA 1D6WA 2E1RA 1TPSA 1U8ZA 3OAAD 1GVKB 3MTYA 1BS1A 2H17A 2VRWA 4I7YH 2GCHF 1SXJD 3TGJE 1P2TA 4QBIA 3T12A 4IDQA 1YF4A 3RAPR 1JR3D 3Q3KA 5IT5A 2Z7FE 4JSTA 2XTMA 4A92A 4DDVA 2BQ6B 3QLPH 2XXAA 1XM1A 3ZZ3A 3K0CA 2WJJA 2R2MB 3X1YA 3P8OA 4AYWA 1SQ5A 3ZVGA 1B7XB 8KME2 4ZPXA 4FMBB 2SNWA 2H2ZA 1O3YA 3RWOA 3QO6A 4CYMA 2BDYA 1EFRA 4ILEA 4BAHB 3D65E 3HYTA 4I8LA 3KB1A 1PPGE 1AKSB 1DOJA 1HLTH 1XEXA 1I4DD 5K8UA 4WZBE 4CRAA 2WV4A 4HDQB 1YPHE 4JMPA 3ZJYA 3ZZTA 4DXAA 1BTXA 2ZSEA 2HOBA 1MQ5A 1U6QA 3ZZ7A 1A4RA 1YZTA 3QKTA 3H7TA 2R6AA 3ATWA 2FOFA 4O3TA 1C5RA 4DSTA 5K8IA 1NSTA 1SHHB 1G17A 4NKRA 1E2NA 3TAUA 4B43A 1R2QA 3KCGH 1TALA 2GX4A 1N6RA 1NN1A 4B3CA 3NZIA 3SU3A 2XCNA 2ZREA 3GLGB 3TAHA 2ZJ2A 1W36B 5EE1A 3VNUA 3IITA 1RTKA 3K2UA 1CR2A 3LLMA 2OBMA 1BYUA 1WBGB 3K70D 1AN0A 1LPZB 1P06A 1E2KA 3IPXA 4Q4JA 2PEYA 2Z9KA 2H5CA 1VCOA 4NZYA 2PCJA 1ABIH 5DSZA 2FXRA 3FP6E 4WJG2 3QTVH 5AFZH 3B1WA 4B1TA 4M7GA 3BK7A 2W6ID 2BMDA 2H18A 2YINC 3RXOA 2AS9A 2QAAA 1KMHA 4ABBA 1E1RD 1G30B 3Q7PA 4Y8ZA 1VITG 1TNIA 3VKGA 2BY9X 4DOQA 2GEDA 1DE0A 1ZYUA 5TV2A 3DMDA 3Q3JB 4YMVA 1J9CH 3MH6A 2OAQ1 2Z83A 1FAKH 4C0HA 2ZIQH 5GIBA 3GJ6A 7GCHF 1CO7E 5GNDA 1XXFA 3TVJB 2RGXA 5EP3A 1BH2A 2CHQA 3KQLA 1VTKA 4WH6A 4US0R 2AR7A 3ZVRA 5FTJA 1E96A 4AG2A 1FI8A 2QPAA 1L1NA 3IWMA 4YMUA 1Z63A 3BB1A 2V3CC 3WXMA 3QKRA 1OFTA 4X8TH 821PA 1LHFH 2NU1E 1W8BH 2PZFA 3PG5A 4BLOA 3AK5A 1E6CA 1X3SA 2F1HA 2BD9A 5FR1A 4HATA 1UK4A 2DFLA 1T4VH 4UE7H 1S3GA 4JL8A 4JLNA 2A2ZA
chains in the Genus database with same CATH superfamily
1U7PA 1O3PB 3TUIC 3UJ6A 1E3LA 3PRYA 1SGCA 1RP7A 1V2MT 1SC6A 3PVZA 2FWJA 2DPXA 4RIHA 1JBQA 2WUEA 3OZRA 3IJ5A 1M9UA 2HPPH 3NP7A 5E6RB 1B6RA 1X7HA 1TONA 1T25A 2NWQA 1PPHE 3UJ9A 2LCQA 3UAVA 1OWHA 3U4GA 1KR5A 2JGMA 1I2CA 1IEWA 4MO2A 2QI9C 3K6ZA 2QV1A 5A05A 2V7TA 3ZZ9A 4EFKA 1F4VA 2MSCB 1CR0A 2GPJA 3V4LA 4HNUA 3DO8A 2HK7A 4NSVA 3ZPXA 4A8JC 3ZLUA 2AMPA 3H6HA 4KJZA 1EBFA 2PKSB 1X3LA 1IDN1 2R6FA 1OKKD 4ER7A 3SYTA 3IAEA 1KNQA 2XRFA 4MVWA 4NJEB 4O2BF 4DEVA 2V8BA 4D79A 3KE8A 1XEWY 3VDXA 2PJRA 1BWQA 1S01A 4ENQA 1J8FA 5DGIA 3VAAA 1NYLA 2W6MA 5ES3A 2SGPE 1QIDA 2DCUA 2WJZB 4MQ5A 2DH6A 3EGIA 4IIBA 4B5KA 4XFKA 1N1GA 2UUPA 4TLBA 4BAMB 1KMIY 2VTEA 4F5DA 3MC1A 4LMPA 2AMDA 2Z3WA 2QMZA 2ZT8A 4WXMA 3GRYA 4PAWA 4EJSA 1UWCA 2HMWA 2IEZA 3KSZO 6REQB 2FZ4A 3WGJA 4AURA 1BVYF 3BD8A 5C8ZA 4E7NA 2HWXA 4MHSA 4K9PA 1EK6A 4GNKA 2O3JA 3Q7QA 4ZHQA 1Y48E 1KE1A 2YCLA 2FO9A 2BTQA 4NARA 3R9IA 4IIVA 221PA 1Y4DE 1YV9A 4N82A 3VBCA 1KOFA 5EE5B 2R3YA 4Q9DA 1WDKA 5KIAA 4EH1A 3ENWA 1OD6A 4ZVKA 3S2YA 1Z2EA 1FFSA 4IBOA 1DUVG 1FSZA 1CUFA 4E5YA 3QWBA 1PR0A 3EDOA 2FLBH 2NNWB 1Z74A 1CJVC 4Z4HA 4PHCA 1FQ3A 1KDYA 1XKQA 5IBCA 1YQ9A 3TFQA 2R8RA 4X85A 1GZSA 1T2DA 2RAUA 5ERGB 3P92A 4PC2A 1J4AA 4C0SA 5JNVA 4OD0A 2F1OA 3NWPA 1LDMA 2XZPA 4ZCTA 3MS7A 3K0BA 3HJTA 2V7PA 4RGBA 3KZMA 3K5HA 3KC2A 1T5TA 1F6WA 4M8LA 2GJKA 4HBGA 1A1RA 4BVKA 2ALPA 3I62A 3EEYA 2BZ1A 4G0QA 1CBUA 2WF9A 3ZYZA 4F9TA 5KEIA 2YMSD 4BYGA 4IIDA 3R76A 4Z1MA 3P19A 5J9FA 4J1NA 3M1IA 3AR7A 3OQPA 4NBLA 4DQUA 3Q12A 4WWYA 4MIOA 4P2BA 5ALWA 2OCGA 1AZZA 3ZV3A 4KR7A 3WNZA 1HBTH 2HSEA 2HY7A 2JGRA 1A9TA 1C2LA 3DKVA 1JR6A 2IYNA 2OC1A 4FMCF 2PIAA 5ETXA 4I99A 2HPVA 1EB8A 1RLOA 3AUSA 5EI5A 3BRWD 3EQZA 3P2OA 3O26A 2FSIA 4E5MA 1XL0A 3OETA 1KYZA 2QQ0A 3WLFA 5EXEA 2F67A 2XA9A 4JHLA 2EYQA 1UZNA 5EJMA 5IT0A 4HDMB 4W7IA 3A83A 2QIPA 1ODIA 3F3SA 2PZEA 4J29A 4CNBA 3OZCA 2AERH 2OGSA 2WJWA 3EFEA 2X8AA 4GI3A 4ACAA 5JO9A 3D3WB 3RDZA 2ZQ5A 3CF2A 3T0IA 2JI6A 4X6NA 2HEGA 2PX5A 1GDUA 4Q6WA 3LH1A 4IGKA 2R8YA 3DZCA 5LQJA 4F5EA 3BHIA 5CB6A 5E6UA 1QVAA 2BYAX 3AEQA 1EB2A 2FUG1 2X9VA 5HBGA 1SBZA 4IQGA 1UK8A 1Y3YA 1PFYA 1IIRA 5IJ0A 1N2SA 2G76A 5CBKA 3SS9X 3H6GA 3RU4D 4GX5A 3OTWA 4PC6A 3QEJA 5F77A 3S28A 4XWAA 3ASUA 1M76A 2GEVA 4BATA