3O8CA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
total genus 209
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8cA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8cA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8cA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8cA03
5K0HA 1VG9B 3PXGA 3HPQA 3CS0A 2GJ8A 4LHWA 3CONA 1EWQA 2ZROA 3KTAB 1PV4A 1J90A 3THWB 4JZKA 2J0VA 2XJ9A 2HRVA 4VGCB 3PO1B 1UBFA 1T9HA 4ZIRA 1PPFE 1UVOA 1EP6A 5L8VA 3EZ7A 1SLWB 4AX9H 2KB0A 2XNDD 4M9XA 1AFQC 5A5GA 3BEIB 4B6EA 3GY5A 3ZZ3A 2UWPA 3V7TA 4ZKRU 1W0ZU 1MABA 3P4YA 4Q03A 3CF0A 4IXMA 2AHOA 1CF4A 2F9VA 2ZFQH 1GI5A 1RGQA 3BN9A 1Q2WA 2PKAB 1P9SA 4G5RA 4IS5A 3EIEA 4NCJA 2GVFA 1JXMA 4K5ZA 1XM1A 4V0OA 5DNYB 1AB9B 1W5SA 2CXVA 4NP6A 3EA7A 1SOTA 2HCBA 3BWDD 3VR5A 4OGXA 1VCNA 5FXLA 1BT7A 1S96A 4PO8A 3TLXA 2A7JA 1TQ6A 1YR9A 4UNRA 4G1UC 2VSXA 3PLPA 1SXJC 2A5KA 1E9DA 2BDAA 2WJJA 5LBIA 4XWOA 2NG1A 3EC1A 4Y0ZE 2QORA 2EYQA 1YCPM 3W5IA 5HE8A 3STJA 5G4BA 1BIFA 2C04A 3W94A 1C5RA 2FPZA 3UG6A 4A8JC 1AS3A 1P72A 5JBCS 4M21A 1KK0A 3T28A 4HAUA 2WPHS 3FANA 1F7ZA 2OTVA 2J3EA 2JDIA 2PZEA 1ZRKA 5EG4A 3B7GA 4BWYA 1LDTT 3RXOA 4LBWA 1C1RA 1O31A 2WPDA 2BMDA 5DJ7A 3ZV8A 2PCJA 5M04A 4YMSA 5JB8S 4CHAB 1C5TA 4PAMA 4RVCA 1BYUA 1T3HA 2ODNA 2ZRDA 4TZ6A 4AURA 2OAQ1 4M1KA 3FP6E 4M22A 1HV7A 1QJ6B 2Q6FA 3KQDA 5TV2A 3T2NA 3DHWC 3QXHA 3HJNA 1MTUA 3HK6B 2EEKA 4RI0A 5F98A 4GFDA 4I1OA 4XWKA 4WXIA 1O2VA 2WIBA 1C5WB 3RC6A 2PMDA 3EZ6A 3I72A 2BDIA 3RXQA 2ZRPA 1E36B 2YOGA 5JJLA 2NU2E 3BTFE 4A82A 4OHWA 4TMVA 5JBAS 3SGQE 4NE2A 1QRZA 4B3FX 1MT0A 1NN6A 1R0YA 3BOSA 1KSHA 1QHNA 3SJBA 1YQTA 2ZJAA 5E7MA 1CJMA 2FX4A 3FOZA 3ZZ4A 1C1PA 4LJ5A 1YR7A 3S1AB 3GLIB 1UVPA 2QF3A 2BZ6H 3LGYA 3KQBA 1H1BA 3FMFA 4LJAA 4EPXA 4FMDF 4I1VA 1ZC4A 1EFRD 1EZUC 2JLSA 2RA0A 2D2FA 4KFRA 1NRJB 1VKJA 1DSTA 2CL7X 3CR8A 1XEWY 3UIRA 5P21A 4L9SA 5D3MB 3U44A 3OIUA 2IHYA 5IK2D 1NFWA 5C1BA 3BTDE 3LV8A 1KXDA 4Z51A 2ZVPX 2Z3DA 1ZD9A 1HAYB 1C2GA 1W2KH 4QGGA 2XXAB 5CHAB 4I32A 1XTKA 2GILA 4CH8B 3AAVA 1ZPZA 3PTBA 4SGBE 1UK2A 3SC3A 2JGNA 3ZVAA 3QK1A 5SZKB 2H6MA 4XVRA 2UKDA 3D62A 4KBGA 2PH1A 2BDBA 2R6FA 2JATA 1E35B 4BTIB 4YMTA 4TMTA 1W13U 2ALVA 1K22H 3QLPH 2CNWA 4TL6A 3IG6B 2B92A 1IQHA 2QT1A 4DCNA 2CHGA 3TR5A 2OBNA 5T3HA 1GTVA 4TWYA 2ZU2A 2VHCA 1E69A 3WRXC 5BYKA 2WJIA 1G41A 3UUZA 3BXZA 2FTMA 3BH6A 1OH6A 2BB4A 2H57A 2WPJS 3SGAE 1HJAB 4NIWA 1E9SA 1EUFA 3TJZA 1MRSA 1GVNB 1R5OA 3WRYC 2IEZA 1O3BA 2WWGA 2HXYA 1RVDA 1O39A 2BLQA 2EW1A 1YYY1 1Z2CA 2R0KA 3X1DA 1PQ5A 2AN9A 4OQFA 1HCGA 4O97A 4AFSA 4PHFA 4DRZA 2F83A 1D9XA 1I2DA 3G5UA 1TADA 4ZIRB 4HB2A 4DDTA 4D4JA 1MKYA 3SV2H 4BLPA 2CMKA 1DEKA 4AG5A 2B21A 2VINA 4F93B 3M6AA 3SU6A 5G40A 1DPFA 5IYTA 1E2FA 1KO5A 2MSDB 3RP2A 4YMUA 3JZ2B 1MABB 1VTKA 4DJTA 1PPHE 1IY1A 3A7VA 2GJAA 4PAQA 1ETTH 1AE5A 1CA8B 4U2WA 4DUGA 3ATWA 4JMPA 4D26A 3T5GA 1UDWA 1W47A 1YBWA 2A2XH 1BB0B 1DITH 1LTQA 2JIZD 1AQ7A 2W0SA 1XUJA 4JLDA 1XCGB 1ZPCA 1SVWA 3BH0A 3WYFA 5B2ZA 1Z47A 1TYNA 5E7JA 3RXKA 2NPFA 3QY0A 1MO5A 1CBWB 1U0HC 1O3OA 1FY3A 5DHAA 2FZ4A 2XWBI 1BJVA 4ZCLA 3E6PH 1NY6A 3ZH9B 1VYUA 3OAAA 4BAHB 2EVWX 1VJ9U 2VPPA 3NXSA 2NZ8A 1IQIA 4RFSA 1P11E 2H9TH 2QC2A 1A4RA 2ZGJA 4NZQA 4QHYA 3R0FA 3EA0A 2O8CA 1XUGA 2Z9GA 1U0LA 3QI2A 4NA7A 2Z3EA 3REFA 1O5BB 2XXLA 3RXMA 4PPQA 1T4VH 2RHMA 3HP1A 1A61H 2VYFA 2I1VB 2GP9B 3VAAA 1V2UT 2A0QB 1UJ1A 1D4PB 3TAHA 1O0DH 3SYKA 1TU4A 4ZI2A 1TNDA 2Z43A 1UTKA 1NRQH 1SGFG 1YGCH 3U69H 2FP7B 4GT1A 1FL9A 2F91A 1V2LT 2RG3A 1N6XA 1VITH 4NG9H 1C4U2 1IN7A 5FUYA 1S0QA 3TK1A 1DOAA 2QY0B 2ZEJA 1CRPA 4WF8A 1BKDR 4LI0A 2GV6A 4AYXA 5AJVB 4IC5A 2VVUA 4LJ8A 4Q02A 4LK2A 5ANRB 1DTSA 1ZHMA 1JR6A 1DPOA 1SVKA 1P12E 2AX4A 3P8GA 1GI8B 2GEDA 1M6NA 1OV4A 1NLFA 1XUKA 1VYTA 1W4AA 1AM4D 1GMCF 1E2LA 5K8LA 3R7WA 1BMNH 4YXWA 4H6TA 1TEXA 5HPYB 1KLIH 1N8OB 2XCNA 1EB1H 1C4OA 1CTQA 1QRAA 4TT3A 5GCHG 1G8HA 1ELAA 1TNHA 1CIPA 1E2JA 5ELXA 1RW4A 4JLMA 3AEZA 1A5TA 4YLQH 1P3JA 3HU3A 1II9A 3PV0A 4ISOA 4AI6A 1G3RA 3QEJA 3U1JB 3U44B 1MD8A 4D2IA 4Y8ZA 5A4JA 1GI1A 2X2FA 1QFKH 2RGEA 1ZSLA 1IJFA 4YMWA 3IDQA 4PANA 2DCUA 4QNRA 3G82C 2HT6A 5HXFA 1SHKA 1OP8A 1YC0A 3UWKA 2OUAA 1MH1A 1YRAA 3P95A 1HLTH 2SNWA 2XNIA 4IMQA 1FDPA 1RYHA 5L2YH 3ZVEA 4A0GA 4KTSA 1G6OA 5F6MA 4UNQA 4US0R 3TUIC 4A6XA 3EX7C 1TE0A 2R2AA 1OYWA 4DSOA 1O32A 3D65E 1JWTA 4FU9A 2V9PA 3LNCA 2FH5B 4Z54A 1O3LA 1N5IA 1DE7H 3I29A 3LT3A 1O5DH 1UEIA 2IS1A 3LX8A 4ISLA 1E1QA 2BY6X 3MUFA 2PHBA 2HNTE 3U3KA 1N2CE 3RHFA 1NBMD 2WVJA 5H8WA 4GDFA 2I6SA 5CDFA 1IONA 1CP2A 2R2WU 4DT1A 2ZGXH 4GPGA 4XBCA 2BQ6B 2BD2A 3MH6A 3Q3KA 1XD2A 3GJXC 2FZLA 1SI5H 3L3TA 2CHQA 4NSVA 1E79D 3FFAA 2F9UA 1DO0A 5GJBA 1G9IE 2OESA 1VCMA 3MH5A 3U5ZB 1ELFA 3ZVRA 5KNCA 2JEOA 1LHFH 1UAAA 5FFMA 4K60A 4AKGA 4NFFA 3ITIA 4MKHA 3TVTA 4A1XA 1NFYA 2YHSA 3KZ1E 1BTZA 1NF3A 1RYFA 2V3CC 4OQMA 4KTUA 4BE7B 3RXCA 4X6MA 4DDUA 1DO2A 5DPAA 5EXLA 3TNFA 3LVRE 1OPHB 1GMDF 1P2MA 5E0JA 1C5PA 1O30A 1NMYA 2AK2A 4IJMA 1P2JA 2ZRGA 1EAUA 1ZAKA 1O3NA 1KHTA 1BRUP 1GKIA 1Z63A 4FUIA 1R5NA 1PPGE 1Z6EA 2F55A 3GJ4A 2RDLA 1TAGA 3OZXA 1Y3WA 2ZI7A 1HEIA 2XSZA 3UK6A 2C95A 2WJGA 1HAZB 1C2EA 2WSMA 2QNRA 1O35A 3TK5A 2GRJA 1K1LA 5DYIA 3IIKA 2ZR0A 4Q5IA 1Z06A 4M9QA 1KLJH 1A46H 5BWMA 4BEJA 3H2YA 4O2RA 4Q1CA 2B8OH 1UVSH 1G3BA 2SNVA 2BD4A 1KKLA 2GCTC 4Q7JB 2RGCA 4LJYA 4PO1A 2W3IA 2IXFA 1W4RA 3EZ2A 2YC2C 4RFSB 1RTLA 3W34A 4DLWA 3RYTC 3TNSA 4WAUA 3A83A 3O8BA 5C1YA 2GJSA 1H65A 2ZRCA 1P4SA 1UTJA 4HB0A 2J94A 4JBWA 1PQ8A 4L15A 3NG1A 1GBDA 1NN1A 4BAOB 1UPTA 1W7GH 2IN2A 4JYTA 3PLKA 2FWRA 4K8BA 3ICQB 4F38A 2KBEA 1FV9A 3A8DA 4KI0A 1W1WA 3AF0A 2XZPA 3B23B 4E5UA 5F9HA 3DFJA 2BTCE 5C18A 3F9EA 5GJWC 2EWWA 1NT1A 3ZIAA 1VPLA 1HRTH 1MKWH 3AK5A 1ACBE 1HNEE 2ZCHP 1KSGA 2B8TA 1T8LA 2OC0A 3KUCA 1OP0A 1C9KA 1ZPBA 4BLRA 1SGFA 2GVDC 1TNIA 2OXSA 5DK1A 4PHTA 1OPXA 4ABGA 5TJXA 2BEKA 1U9IC 2JLQA 3PIRA 3ENSB 2GJ9A 3SU3A 3UKDA 1XCPA 1YCPH 1EQ9A 1C4V2 1W36D 1JALA 3DFLA 1Q3XA 1G21E 3R7WB 3TQCA 1AWHB 2DFLA 3VMFA 4LBZA 3ADCA 1TGNA 1XX6A 4Q7YA 5EUMA 2WWYA 4ZUHA 1G6HA 2QGNA 3MGCA 3R9WA 4ZKOU 1S85A 4BASA 2ZEBA 2UWOA 2WPKS 1KAOA 1C1TA 1KXAA 2QPTA 3NKVA 1IN6A 1QF9A 2ASUB 1TMBH 2BYAX 2J0UA 2CMYA 3KL4A 1SFQB 4Q9JA 1E2NA 5TCCA 3RS3A 1RC8A 2ZQ2A 2ZU4A 1G8GA 3GDUA 2PUXB 1EAXA 4Q7XA 2ODQA 4KVGA 1H8IH 3T34A 4UE7H 1P6XA 3SYLA 1DDJA 1HYQA 4PPGA 4ISNA 1S3GA 1F48A 1THSH 3ZZAA 3I8XA 3NC1C 4AD8A 4PTLA 3SZNA 4V03A 3Q76A 1RIWB 1CEEA 2FOFA 1C2MA 3M5NA 4K81B 3GLGE 3C14C 2YV5A 1YPHE 1VGCC 2QE7A 1CKEA 2MSEB 4O0MA 1JMOH 1P2TA 4L4UA 4B75A 5EE1A 4A2QA 3SOSA 4GL2A 3KKOA 2D62A 3ZQ6A 1XD8A 1O2ZA 3SU4A 1NL3A 1OXGA 4DBLC 1H9HE 2O8DA 3PROA 5AUQA 5CE1A 1N6OA 1SQAA 2GWHA 1WTHD 2D2DA 4INHA 4PSAA 1RRFA 2WKPA 3IO5A 1T3SA 1TQDA 4TY7A 3T61A 5EXXA 4RD3A 2ZRKA 3RC4A 3JVVA 1V2QT 1DAMA 1SLVB 3RMNH 4DT1B 4ZDJA 2Z83A 1AO5A 3EARA 2AFHE 1GBCA 1XD2B 1GIAA 1ZMXA 3ZV9A 2A5JA 2YNBA 4RY2A 3IEVA 3KIDU 2KI5A 1BBRH 1GI4A 1S83A 1ESBA 2BBSA 2BY5X 4ABEA 3F6UH 1G8YA 2QU8A 4KVAA 3K0CA 2V7QA 4LXBH 4V0NA 1GI9B 3BC1A 3UNQA 4M9ZA 1R0XA 2VWNA 4AYTA 1K5DA 3AP1A 5DI9A 1FMGA 2FDAA 1XTIA 3AF4A 2PGBB 3QJYA 5F3WB 4X2XA 1N3BA 1GOTA 1KO7A 5DIFA 1O5EH 4OGYA 2VP4A 1NRPH 2IA5A 4EAQA 2CJWA 1X8KA 3MOCA 3GP8A 1SKQA 3LWNA 2UUJB 1RPZA 1PQ7A 4IDQA 2F1JA 3EASA 1HE1C 1GJ7B 4WZBE 1SGDE 3RANA 1AE8H 1G3CA 1VMAA 4U30A 4WZAE 4GPTA 3B1VA 4OI1A 4BFTA 2ZFFH 4EPVA 1YZKA 4NSYA 4C0HA 4DCUA 3OE7A 4L9WA 1YHNA 3CF6R 2VP9A 2VIOA 3U7GA 1GP2A 1KDRA 2XOKD 5EP1A 2GV7A 1V2WT 4CBNA 1XXFA 3PV5A 4FMDB 4CIDA 5H4IB 5EZ6B 3AP3A 1DG3A 1ANCA 1LW7A 4MUBA 2PWXA 4M8NE 3HU2A 2YOLA 3M35A 3NEJA 3VB7A 1K1OA 1ZM4A 2V6NA 3RXBA 3OIWA 5JS7A 4WW0A 4MDFA 4KSCA 4D4MA 4WXPA 3BFKA 3MJHA 3CRQA 4V0LA 2N1BA 1CVWH 1ETRH 3D23A 3BG4B 3LJJA 1OIXA 1HY3A 2SGPE 4NCIA 1SVMA 3SHAH 1C5OH 5FBEA 5H68A 3M3SA 1W5TA 1P10A 1YF4A 3RXRA 2EFHB 4CR5A 2G0TA 4AWXA 3A7WA 3EWAA 1E2EA 3SQHE 1DXWA 1W0JA 4DVAU 5GIBA 4BRWA 4GBMA 1O2SA 4BZXA 2Y81A 5C1UA 4RKEA 1FY1A 2WJHA 1N25A 4C0BA 1CR1A 5JWRA 2GCTB 2OUKA 3GOVB 4IFBA 1DAKA 1NN3A 1T5LA 1XMVA 5FI0B 3HWSA 1FI8A 3UPEA 4CRFA 4RD2A 1QTFA 1AN1E 1IQJA 4CRGA 1DX5M 4ZPXA 1GDDA 2GXUA 2X19A 5EU8A 3DMNA 2TIOA 4B2IA 3FAOA 1FP6A 3PEWA 2VWMA 3L8ZA 1A5HA 4X8VH 1QJ7B 1HAIH 2G00A 1FX0A 3IBGA 1KDOA 1B0EA 5CM8B 4KFUA 3I1FA 1H8DH 2EA3A 3QIAA 3SNEA 2ZS9A 3NIBA 4PC7A 1P04A 5GNDA 1XXHE 3U1IB 1SGEE 3CP7A 3ZJYA 1OSNA 4O3TA 2B7BA 3ZVCA 2ZP0H 1ZJDA 2ZPRA 3VNUA 4FI3C 2W7SA 1PLJA 2QQEA 2ZO3H 5HCIA 1FOEB 2Z6BD 1PPBH 4Q2KA 4WWYA 3PUYA 2FNAA 1BRAA 4QBFA 1KIGH 4D7GA 1MAXA 1GCDA 1UKYA 2J95A 4JBYA 2J0UB 5AWFC 3GD7A 1DADA 2R44A 3V00A 1TQ2A 3BFXA 3IUYA 2D7CA 2FIRH 5JFGA 2OFOA 1A0JA 1C5VA 1WXQA 1P9NA 1FQKA 5DP8A 3TVDA 1SHHB 3MNSA 1YVDA 3BB4A 2ORIA 2D4HA 1ZGVA 4Q48A 4TQAA 1HT1E 3B9PA 5AUOB 2ATVA 2BMJA 3RU4T 3GY4A 2B0FA 4HDCA 2QXGA 4D7FA 4INKA 4BLTA 1E9RA 1Y63A 8KME2 1QQUA 1CR4A 2QGZA 4PC3A 3PUVA 1OFIA 4YDSA 3BV9B 1J8AA 1ELEE 3C8UA 1XEXA 4A0FA 3GCOA 1Y5AT 2JJ2A 3MO9A 1QHYA 4NPHA 5C1XA 2BY8X 1MTNC 2ZA5A 3D49H 1SKYE 1ZCAA 4EPTA 2WHXA 4QGAA 3FHOA 4GHTA 2HNTC 2F6RA 3U61B 3CB4A 1L4ZA 2HJGA 3PUWA 3BSQA 1EB2A 1VGCB 4MYUA 1FY4A 1LS1A 5EZ5A 4IC6A 1BTWA 2QMEA 2QA9E 1RZ3A 1Z8IB 5IK2A 2FO9A 3IGFA 2A5FA 1V2MT 1SFIA 4QGFA 4X1RU 3Q5DA 3EPJA 2GZ9A 2AWNA 4ABDA 2FI3E 4NIVA 4QG7A 5DYGA 2R62A 4QRHA 3UOPA 2FF7A 4L5BA 3NXPA 4H1UA 5J5CA 1FPMA 2GCOA 3B1ZA 4FUFA 2HXSA 1BMAA 1GMHF 1NIPA 3T1OA 1P7CA 1CJKC 4AG2A 4ABJA 3K53A 2P93A 2ZUCA 4QL3A 3VU9A 1W14U 4QM6A 5FTJA 1AGPA 4DLYA 2YJTD 2J34A 3VKWA 2HPQH 1LPZB 2CJWB 4F4IA 1R7RA 2BX3A 3LH3A 2EFGA 1JR3E 3BORA 1VITG 4MNVA 4A1VA 3X2SA 3MNXA 3MMGA 3U2QA 1F3OA 1D2NA 1DLEA 3L43A 5LB4A 4YDHB 4QJ4A 2Y5GA 3QKSA 4UEHH 1TTTA 4N1AA 1PYTC 3JZMA 4Y7BA 2PZGA 4MPVA 2Z9JA 3OSYA 1EESA 2XYAA 2FMXA 4Y6DA 4K69A 4UJ5A 5TDHA 4WMFA 5FUXA 1KK1A 1FIWA 4NMMA 3EDXB 1ZU5A 3RXHA 2VSOA 3LGTA 4NCHA 2VIQA 4JLAA 3DKPA 2EFEB 2ZDAH 2ZFRH 2XTMA 1QA0A 5FUWA 4HATA 4Q66C 3LQRA 2P16A 3OEEA 1KTTB 4B73A 3SBKA 1YZUA 1ZM9A 2W83A 4AGKA 2JLZA 1KZ7B 3QGNB 2A7CA 4KCGA 1R0ZA 2EI7A 3R9XA 2GDJA 4TZ0A 4JYBA 2ZSFA 4ITRC 1MKWK 2LPRA 2A9KA 5JEDA 1Q57A 3UXMA 1FTSA 2BD7A 5A8YA 3BS4A 2F9NA 3SUDA 3ZYEA 2VJ1A 3RDPA 1B7XB 3QNUA 5DE3A 2XB4A 1LVBA 1GL9B 4JLKA 4C0KA 1C1OA 5A09A 3PCRB 1EG7A 3TSZA 2GT8A 4FUJA 4I8LA 2QROA 3KQUA 2OCPA 3ZLJA 4R2HA 4UXHA 2TGAA 3LBIA 1YCPK 4MKFA 3FKSD 4IDNA 3AVXA 3SI7A 4TTQA 2P6NA 1NZQH 3VHLB 2G9NA 1JIRA 2FXRA 1HAPH 1J16A 1O3HA 1G9XA 3GLIE 1XXDA 1C5SA 2CCKA 4RN6A 1U98A 2ZRAA 2UZIR 2F1IA 2WM9B 1P2SA 1MQ6A 1AFEH 1HFDA 1YPGH 2A7HA 4MDEA 4C9BA 2GTBA 3RWOA 4D9QA 2YC4C 2BVXH 1CT0E 1BBRE 1XKAC 3TJVA 4Y10E 2WICA 2GNOA 4URZR 1GL6A 3BTME 2BQ7B 5EQRA 2WYGA 3SHCH 1NY22 1LFDB 2GK6A 4B34A 1HIAA 3OF5A 5DP5A 1HYLA 2BDGA 3LRPA 3F9FA 3TR0A 2ZTXA 3K09C 2FWWA 1GHBF 3V3MA 5UKDA 1SGWA 1OSSA 4PPFA 4IEEA 4Q7LA 1LVOA 4XVUA 4X1NU 3I77A 3SJIA 1K9OE 4YESB 2FSIA 4TLEA 1TFXA 4UNNA 5FBLB 2WTUA 1AGRA 2ZDVH 3AUXA 4MYCA 5JDUB 3H0KA 2OBQA 3LDXH 3CRRA 3LGIA 1LQDB 5HYOA 1RRKA 1GZSA 1NI3A 1FUUA 1EFTA 3PMBB 3L0PA 3K09A 2CHAB 3BB3A 3QGJA 3A85A 1K5GA 4LZZA 1YPHC 4MYTA 1AD8H 3PYHA 1FFHA 3LX5A 1MKXH 1H9IE 4DC9A 4ZMAH 2AR7A 1WBBA 3VX3A 1SHYA 4BXWA 2VBCA 2IBMA 2WWXA 2VVVA 2O0KA 2GMTC 4NYIR 3P20A 2HF9A 4QKQA 2H16A 4CF7A 1XEXB 1CSOE 4ZHLU 3F8TA 4WXVA 2G4TA 1CGIE 5LD2B 1G16A 2FEMA 4ASUD 3A87A 2I3BA 1NLZA 1EZXC 2XEXA 3UFAA 3IHWA 3LLUA 3KQHA 4QJ5A 5JCPA 4FUEA 1AI8H 4ZDIA 1BBRK 2J1LA 2PLRA 3GLFA 3RLWH 1GRRA 2HGTH 2H5DA 5L2ZH 1TF5A 1SVOA 3ETLA 4N0EA 1XJ0A 2C8WB 1CJUC 4DIHH 4C4PA 4YC7A 3MSXA 2BOHB 1GILA 1C9TA 1S81A 1UTMA 4Q7MB 1FP7A 1OYYA 2Q3MA 4I1SA 2QAGA 2FI4E 1SVIA 4PC6A 2QT0A 1DICA 2HOBA 5EQSA 2J0SA 6ESTA 1YKSA 2JKHA 1MTNB 4K46A 1D8TA 2PT7A 5EXMA 3KJHA 3ZS8A 1W4CA 4U00A 1HT2E 3C4JA 1BMFD 4D0LB 5HMAA 4BFYA 1DS6A 5FX6A 1BMLA 5DGXA 3MU1A 3QG1A 3KDSE 3SJ9A 2AXPA 2GXAA 2UUKB 3SN8A 2J38A 4OQLA 3CO5A 3VU9B 2C8XB 1GNPA 4LHZA 3FP7E 2VHUA 4Z1MD 1TMUH 3B1YA 2VH5R 3MWIU 2HUPA 4DSNA 5L3QA 3PLBA 2ZKSA 1ANBA 1D5CA 4B43A 5F9FA 1Z0JA 4OHVA 1Q12A 4GVUA 1XRJA 1E9BA 1QBVH 3RXAA 1OKXA 4F91B 1E37B 1TNGA 1NBMA 2X8AA 4C30A 5T6DA 1O36A 2ANWA 1IY2A 1NIJA 2NGRA 2ZAMA 2IC5A 1GHBG 4URUR 2V1XA 1P06A 1YPEH 1WV7H 2G4UA 3B2EA 5IHPA 3SJCA 3BTKE 3M3TA 1ZUHA 1MUEB 1GCTC 2BLWA 1IQEA 3TU7H 1X1RA 3RXSA 1U6QA 1TQ7B 1QHHA 4AG6A 1E1RD 1V5WA 3EQ0H 3QBTA 1G18A 3SN6A 5AR1A 1TWXB 1GL1A 4G3XA 1L1JA 5BN5A 1A5GH 1F2TA 2SGEE 2OBLA 3HK3B 1F5RA 3T12A 1L4DA 4I1UA 2JLYA 3CIOA 4ZHAA 2P8OC 1B5GH 4FD2A 4WH6A 2DWQA 3SUGA 5CIQA 4C3ZA 2JA1A 3FWYA 1R4AA 5AF9H 4IBLH 1IAQA 3T29A 1TU3A 1FXYA 3BIVH 2DFTA 3GCTG 5E95A 2PL3A 2L0XA 3EIQA 1L1NA 4FUHA 4HDOB 3IEUA 1EASA 2DFNA 4AZ2B 1G19A 3OESA 1GG2A 2A78A 4D76A 1EATA 1UKVY 1TX4B 1TF2A 5GVSA 1W7XH 1KI4A 1Y59T 3QE0A 4OHZA 1HGTH 3KQCA 3SFVA 3U4QA 3PV4A 1OS8A 2REOA 3LD9A 1O3EA 4XTRA 4A36A 5CM9C 3HR7A 3DOFA 1LS6A 1SVLA 3U8OH 3SW2B 4C7OA 2R6AA 1U2RA 3AVVA 521PA 2QGRA 1P60A 1C2FA 5K7RA 4P4TA 1HBTH 5K8IA 3VHXA 2JETC 1TPOA 2G8TA 2F9OA 2CJIA 4X8SH 4B3BA 4DLSA 4CYMA 3SGBE 1P2VA 2J7PD 2MMCA 4MGIR 4JLPA 1CT4E 4R9UC 3QKTA 2VGCB 3DVLA 1BOFA 5CYPA 2PJRA 2AH4X 1DBSA 4KXFB 1T8OA 3QX5H 1OXTA 3SBEA 3E3TA 1CR0A 1ZNXA 3IQWA 1G64A 1N6LA 1X6VA 2CK3D 1IOZA 4Z8YA 5EQQA 4ZKDA 1XMSA 1HIAB 3N5CA 3A4LA 4NYMR 3P6ZB 1TNKA 1E0SA 1ELGA 3FZDA 4HTCH 4XOJA 3UMFA 4U02A 1WQSA 2G5NA 4C0JA 3C16C 5AUNB 2CLSA 2GF0A 1TPAE 2XZLA 4QJ3A 3LA6A 1FJSA 2CVHA 2IYXA 3WY9A 1UBCA 3NTUA 4D25A 3A37A 1TOMH 3SU5A 2FEQH 2NO0A 3KF2A 4DJZB 3CF2A 4WIAA 3VGCC 4I31A 2H5CA 1T8MA 1MQ5A 1HJ8A 1OWEA 4I81A 1SQ5A 2WJVA 2IJOB 1ETUA 1BIOA 2A5GA 1O33A 4Y76A 5DP6A 3A7TA 5J47A 3QZRA 5TVKA 1SSXA 1JR3D 1U90A 3FFBA 2GCNA 2QMUA 2J92A 1KI7A 2QYIA 4B47A 3TGJE 4DKXA 3MU4A 4R98A 4JK5A 4LUCA 4LWZA 3WP1B 2PEYA 3ZZ7A 3KX2A 3K70B 4GLYA 3LAWA 4X8TH 3V9PA 3QQ5A 3VB4A 4D4KA 1J8YF 2DB3A 2TGPZ 1L4UA 3H4MA 3ICEA 3GLFB 4FXPA 3A81A 2DYKA 2IOTA 4ABYA 2WKRA 5KU1A 1GI2A 1TGSZ 5J4SA 4KAXA 3SHWA 1ZRBA 4CRDA 4MTBA 1IN5A 5JMTA 5KNDA 2ZC9H 1Z8JB 3SU0A 3AKCA 2XTZA 3PO1C 2ZPTX 2FOGA 2QAGB 2OC1A 1GNRA 2ERXA 1MTVA 4EPRA 2W58A 2WMNB 2OP9A 3PG5A 1NLYA 1V2NT 5AJZA 4OI0A 2O5VA 4C0AC 4Q4LA 4TSFA 5KDOA 3TBKA 3GQBA 2NU1E 1KI1A 5CJ2A 3CRMA 3LBHA 3FZZA 1LHDH 4UQOA 2NOAA 1RXPA 2DPXA 1NJFA 4ZO4A 3PB1E 4Y0AA 4NYIQ 4X1QU 1SG8B 5HM2A 2GZAA 5KTYA 3THWA 1BCUH 1QY6A 3SU2A 1GHWH 3P70B 1J2JA 1PQAA 4WJG2 1AB9C 3AH8A 1TB6H 4TLDA 4QNMA 1UCYE 1KDPA 2XX3A 4AN7A 3RLYH 4BFXA 5L3QB 2RCNA 4BZPA 3AP2A 3DZ8A 2QL6A 3P32A 4OI4A 1V43A 3SU8A 2ULLA 3JZ1B 5BPEA 1TONA 2VWOA 4FU7A 2WWWA 4MRNA 5K8TA 2D26C 3HPRA 4YTAA 4ON9A 3DUXH 4ABFA 1KIMA 1S6FA 2ZSAA 1FNNA 1ARBA 3OFND 2AK3A 3RS7A 5FBVB 2O8MA 4WH8A 1KDTA 5EE0A 1AVWA 1L0ZA 1DLKB 3C1KA 1Q1QA 5JCZA 1QIXB 4MPUA 1QHXA 1Y3XA 3WY8A 1QHHB 3HDTA 4X8HA 2I6QA 4KYIB 3ATMA 1WCV1 5TY0A 4RFVA 3KXIA 3C41J 1EPTC 4DVGA 1FQ3A 4I8KA 1K8RA 1F2TB 2TGTA 3BB1A 1TMTH 4KODA 5FOUA 2ASEA 2B8WA 4AB9A 3MMPA 1INCA 2P6RA 3HKJB 3B13B 2ERYA 2GDEH 1AS0A 2Q9CA 4NKRA 1JPJA 1KJYA 2VVCA 2J46A 3H1TA 4NIYA 1IY0A 1E2PA 3ZZ9A 1I2MA 1O3YA 2ZUDA 1JQLB 1Q22A 4GNKA 1M7HA 5HZKA 1GCTB 3BG8A 1OE0A 2R0LA 4LY6A 3RSOA 4YOJA 2ZTYA 1E9CA 1NVXQ 5EW1H 3K6YA 5H1YA 3QKUA 2BOVA 2RAPA 5LPRA 4QXAA 2O8UA 1EPTA 3U4QB 2ZRNA 4BEBA 4NA8A 3VB6A 4MRPA 1FY8E 4RZ3A 4C7OB 2EI6A 2C8YB 2BVSH 5EXTA 2ZZUH 1S9HA 4PQRA 2GJKA 2QMOA 2CF8H 1XTSA 1QL8A 1ZJKA 2A31A 5FOTA 2FSFA 2BJVA 1LKBA 2Y5HA 2W00A 3PITA 1IQGA 3OIVA 5EXSA 1AZTA 3P8OA 4KO8A 1P9WA 4X8MA 2RGGA 3W90A 1T5IA 4Q1DA 2AFQB 2GCHF 3W3ZB 4P33A 4FMCF 1O87A 1A7SA 1DARA 2CDNA 4NWKA 5J4LA 1IXZA 4OKSA 1LHCH 4JYUH 4Q01A 4TMXA 2FLRH 1GUAA 2C3SA 2QPAA 2ZF0H 2QRNA 1KLTA 1K1PA 1XU4A 2ZU6A 2F43A 5B6OA 3B8JA 2ZDNA 2JETB 4JL6A 1SPJA 2YINC 1N6KA 1TEVA 4FUCA 3QENA 4JL5A 2CE7A 1O2HA 4HUTA 4M1TA 3A8BA 6CHAB 2CGAA 1MKXK 1I4DD 1VG1A 3U6BA 2VNTA 2YOHA 2Z9KA 3GCNA 4XSHA 4BFZA 2H9EH 2ZDMA 5PTPA 3RS5A 4QBGB 1UHBB 3ZVBA 1Q3TA 2O8EA 4YOIA 4D82A 2WUCA 2GZ8A 2BMEA 1O2GH 3SNHA 2V35A 1OH7A 2Q1JA 1F0RA 3CNNA 5JI3E 4XOIA 4CEHA 3GJ5A 2GDDA 1U99A 1HA3A 2WWHA 2X77A 3O8DA 2VL7A 2WYJA 1OWHA 4JJKA 1GBLA 3VXFH 1NNEA 2AKYA 4ZH8A 1X86B 2GZHA 4WZ6A 2PSXA 1QB6A 1Y3YA 1W36B 2E87A 4AFZA 2JAQA 3UR6A 1L4YA 1O2LA 2STAE 4Q19A 3FPAA 1Y3VA 1DG1G 4IVQA 3SUEA 2DBYA 1E34B 2W6JA 1W0KA 4BAMB 1PUJA 5LPEA 1SB1H 1CU1A 2XZOA 4QHTA 1NVVR 4A1TA 4RZXA 4PZYA 2WPDD 4XSKU 3CPEA 1AUJA 2RGBA 4A7IB 1OLOA 4LHVA 4POAA 3PEYA 2ZE6A 2K5UA 1MRNA 1E99A 4ZXYH 3WYAA 2OBOA 1WE2A 2C4FH 2XGJA 2ONKA 5DP4A 1Z3IX 1US8A 2W5EA 2IYSA 3TH3H 1T4UH 2VF7A 2HLCA 1YZQA 3H86A 4HLUC 4MNXA 1OWDA 5A8ZA 1P61B 3SJZA 5DG6A 3Q3XA 2BY7X 4UNSA 5G53C 2IS4A 1OFHA 3TK6A 1LNZA 3KHVA 2ZI9A 1YPMH 1YR6A 3MI4A 2E9SA 3SO3A 4AOQA 1DFPA 2JLUA 5E0GA 1LKAA 1A2CH 4O03A 1JI0A 1SVSA 1O2QA 3OX7U 1G7TA 1N6IA 4IDHA 4RD4A 4XBDA 1DWBH 5J40A 2O8WA 3PENA 1GJBB 1E6CA 1BOQA 1S5SA 3K2UA 5A8XA 3DOEA 1AA9A 1CBWC 3PMHB 3T15A 2ZNKH 3Q5EA 1JB1A 4HLUA 2ZS8A 2G83A 1GVZA 2OINA 1AHTH 3SZRA 5KSOA 4RZ2A 5JJIA 5FPHA 1FNMA 3N2IA 1YPJH 2AXNA 1D9IA 3EA8A 2XBYA 2PSYA 5E3HA 1A3EH 4PROA 4FINA 2XC4A 1BJUA 4LPSA 3RNLA 4A92A 1FPHH 4RKJB 3RVBA 1GBHA 4LJ7A 1QA7A 2XBWA 3S9AA 3OU0A 2ANKH 1KYNA 2JJ1A 4GI7A 1NVUQ 4G5GA 4N3NA 4GUXA 1TLDA 5J4HA 4CR9A 3RXIA 3SV9A 1F6BA 4KU4A 1O3IA 1AU8A 2QM8A 3UREA 4RKOB 2FOHA 1P2KA 2LKDA 1S8FA 3NH6A 4TL7A 4URVR 3TH2H 2OZEA 4BGDA 1OHHA 4WA7A 3ECCA 3ZVDA 3GJ8A 2P3TB 4HUQB 3SI4H 4KLNA 4GZLA 4KITB 2E1RA 3CRVA 5TARA 2H9HA 3GCHC 1CHOF 1DY8A 2R3UA 1GWNA 3I92A 1TBZH 2HDNB 4ZROA 1GJ8B 4TYQA 1NG1A 3WMGA 4G01B 1SLXB 4TN1A 5HKKA 3BFVA 1EPTB 3SJAA 4NHOA 2OCYC 1N5JA 1P73A 1IJEA 4CVNA 1AJEA 1QGFA 1SGQE 4ZAEA 1E98A 2CNWD 4US1R 3M61U 5AJWA 1MTWA 3K65B 5GJ4B 1XVOA 3EXAA 3ZVNA 4F49A 5EXPA 1N6YA 2ZYUX 3S9CA 4MRRA 3A6PC 1DUAA 3T35A 4DDWA 3CPHA 7GCHF 1M8PA 1JBKA 1N8OC 2GX4A 3B82A 1THRH 3RXUA 2ORWA 4GRAA 1KNXA 3GY7A 2M5TA 3IO3A 2GK7A 3PEVA 3RABA 2G1JA 2V6IA 2IS2A 4BAKB 4HB4A 4GCHF 2CCJA 3SBDA 4TLCA 4V02A 1SL3A 3KJEA 2JH5D 1UTPA 1M34E 2QCYA 4TY6A 3SR0A 3TITA 2ZHWH 2AWOA 2GVZC 1KI2A 3WP0A 1O5GH 5FBWB 1ZLRA 2F43B 2X1VA 5EJEA 3SQXA 1GKUB 1KI9A 4EFNA 1AMHA 3M3VA 2OG2A 5DHFA 1CGJE 4LYJA 4B48A 1XB2A 4DUGD 1P3CA 5HZHA 3E90B 2Y6TA 1UF9A 4JLOA 3DD2H 1TBRH 2D1JA 1O2UA 1SLUB 1XBTA 2VEDA 2O8EB 4LYAA 3V13A 4TQ9A 3CRW1 2J45A 1J14A 4U5XA 4MRVA 1QB1A 4CEHB 4NZYA 4OHYA 5LPNA 2F9MA 2W2VA 1VYVA 1ANEA 1SMFE 3TW8B 4RCYA 3WHKA 2UWLA 1FAKH 3B8HA 4MQAA 3X1WA 1S3SA 3MFJA 2QM7A 1GJDB 1KI8A 3QF7A 1TNJA 2YWGA 3Q85A 4XD7A 1QBNA 3KFVA 1GHVH 3OAAD 3KKMA 1O3PB 1H8HD 2FSHA 3DHKH 5GJVC 2WOOA 1WRBA 1T8NA 2GZDA 1T91A 1IOEA 2H17A 4KFTA 2C98A 4X8LA 1VJAU 3ZZ0A 2RGNC 3K0AA 4L8GA 5HTKA 3NBFA 3SQEE 1HURA 1SBWA 1KI3A 2AMQA 4BRUA 8ESTE 1C2LA 2EC9H 2AIQA 1XTQA 1OKKA 2RHDA 5C4GB 1MO6A 1ABIH 1US8B 2VA8A 2X2EA 2FSGA 1ZIOA 3A8AA 3R20A 1T8UA 4TYYA 2IT1A 2NQ2C 1SGTA 1DT2A 4Y0VA 2XC5A 1YLDA 4TYPA 4E09A 2ZU0C 9ESTA 1HQCA 2VLIA 5L30H 1YE8A 2QAAA 2GEUA 4PQFA 3UATA 2PFEA 5DN6A 2RGNA 2HLDA 1MD7A 2ECKA 1Z8FA 2ZSDA 3UG7A 5L3VA 3SU1A 1WYKA 2C2HA 2FE4A 4K3JA 1TX7A 4KV9A 2J0QA 3RM0H 2QZ4A 4ASUA 5HE9A 4O9VA 1UTOA 3PMAB 5B30A 1OXVA 3F0TA 2BD9A 3CH4B 5JS8A 2A5AA 4YXWD 4AKHA 4JT4A 1S9DA 1C2HA 4RD6A 1QHRB 2KAIA 1NVVQ 4OBEA 4B2CA 2FOLA 1YU9A 1GHAF 3A8CA 2ZS7A 4TT3D 4KBFA 3G0HA 1DS2E 4ESVA 3A4MA 1PPZA 1EZSC 3MCAA 5KHOC 1Q1EA 3GLHA 5A2MH 4DCVA 1TX8A 3GY2A 4PSVA 3PWCA 3TK9A 4MGYR 1OXSC 1PPCE 3KJIA 3A1WA 4MNWA 3NHBA 721PA 2IF0A 1P5ZB 1ZP6A 5BQ5A 3GJ0A 1CULC 5FPYA 1N0VC 4H42U 4BUJA 3UANA 4THNH 1KGDA 3H7TA 3FMOB 4G0NA 2PJZA 4ABBA 4UFDH 2W2XA 2HALA 5E4FA 3B1XA 3FMIA 3BIUH 3EG5A 3HKIB 3U7HB 3RWMB 2VIIA 1TOCB 2QA5A 3E2IA 4Z1MA 2IXGA 4CRAA 1H8EA 1Z28A 5EQTA 3UPUA 2WPLS 2V3HH 3BEUA 1QHIA 3MAAC 5FCRA 3GYLB 3BEFB 1O3CA 4W7SA 1E1QD 2Z9LA 2H5EA 1ZM7A 2XWAA 3OTJE 4WMEA 1P09A 5IRCD 2PTCE 2WIAA 1EAWA 1H4WA 3R9IA 4YQFA 1S1CA 4MQBA 4JJZA 1G36A 3U8TH 1A0HB 2O8FA 2KWIA 1ODFA 2FX6A 3GCHB 2FEOA 2SHKA 4UKDA 4X1SU 4LV6A 4UXJA 6GCHF 2HF8A 5CB8A 1A0LA 1GVLA 2FFQA 4UONA 4B3CA 3RXGA 5C2JB 1EFCA 1ZCBA 4RSGA 3PR1A 2BDTA 2H18A 5J4KA 5FPKA 2RH5A 2OFXA 5EW2H 1Q31A 4HAXA 1IN4A 4GSYA 3Q8XB 1KSNA 3DPUA 1IQKA 1EAIA 3SDZA 3RRYA 4HAVA 1ESNA 3RLFA 2ZRLA 1W0YH 1EX6A 4LJ6A 3VR3A 1C1WH 4JYVH 2B6HA 1Z6XA 1OJLA 4FIDA 1NS3A 4OQXA 1FW6A 1IQFA 3UIEA 4URXR 4PHGA 2OLKA 1UTNA 1KMQA 1JIMA 1AY6H 4DXAA 3UWIA 1ZUNB 3I8SA 4Y8XA 221PA 1RIWC 1XJCA 1YP9A 4D81A 2PLXA 3RMMH 1N0UA 2VTKA 1M2OB 1O2XA 1QL7A 2HVXA 3ZZ8A 3LIWA 4D6PA 1GFIA 1Y5BT 3EAJA 2W6IA 1GBIA 2XSZD 5EOKA 4LX0A 4HAWA 5B6LA 1D6JA 1GDUA 1XMJA 1Z6GA 1NSFA 3A7XA 2BWJA 1C1YA 2V3OH 1A7JA 3EYDA 1G2MA 1AGJA 2ZECA 1GJ6A 5JWHA 2FMJA 4K1TA 2A30A 4DIEA 4UNPA 4Q9KA 2VIDA 3EGKH 4NYJR 1QBOA 2B7CA 2ZR7A 3AF3A 3AVTA 3B78A 1J17T 4MGKR 5CIWA 1AZ8A 4B71A 3LC3A 3SI3H 5GVRA 3K0AB 2TMKA 2EFCB 1DAHA 1ZW6A 4B74A 2IPHA 1V2TT 1XJQA 3NPSA 3HGNA 4JZEH 2VIWA 4OS7A 4CH2B 3GCGA 4PO9A 5H70A 5LGOA 3WHLA 3NKKA 1DY9A 1HUTH 1E2QA 4JSTA 4KKDA 3AVUA 3T5DA 1J8MF 4ZDKA 3AB3A 5LH8A 1TGTA 4NWLA 3KGPA 1MO3A 2IWHA 3GJ6A 3QBVA 4HEJA 4BNRA 4IOMA 3ZIAD 2ZWLH 2OK5A 4HB3A 2ZI4A 3A86A 1V2ST 2EYUA 2OBMA 1Q21A 3FHCB 1CXZA 3RMOH 3GFOA 1E32A 1TNLA 2XB2A 2ALPA 1WDTA 5T1VA 4EUNA 6GCHG 2VSFA 4UFGH 2OQUA 2AGEX 2H92A 3LW8A 4TPYA 4B33A 4LZ4B 2HWLB 3Q7PA 4P31A 2B9LA 1O3FA 3WBKA 3AVWA 1CO7E 4HZHA 1IQNA 2VB0A 1NC6A 4AKIA 3R8FA 5BXQC 3THXA 2AEIH 1VG8A 2KAIB 3BJIC 1HQYE 4FMCB 2TGDA 4JLVA 3ONWA 1OFUX 2FZZA 2BBOA 1GMCG 3GLHB 1YKTA 4ABHA 3E5HA 1G5PA 2O0HA 3PEUA 3B85A 4Q47A 3PFIA 4WVFA 4TPIZ 4E05H 1X1SA 2ZG0H 1CHGA 4DLXA 3BG4C 1R6BX 1CJTC 5KO2A 5DP9A 4IVRA 1SOZA 1P62B 3A1SA 5TMPA 2YWFA 8OHMA 1OIWA 2RGAA 4FWIB 3RXJA 1FN8A 1RE0A 4IEIA 3Q00A 2DWPA 4LYFA 4Q18A 3SV7A 4MRSA 5FOVA 2ZE7A 1HPGA 2P0EA 2FFHA 6Q21A 1P03A 3W6OA 3L33A 1ZNZA 2BV3A 4DIDA 4B44A 2GTPA 5E0HA 2QE7D 4ZDWA 1ID5H 4LCBA 4YO9A 1W44A 4NA9H 4EPWA 1P9UA 1JNYA 5DP7A 2ZITA 1AVGH 1TQ4A 4PX9A 1DE0A 2ZTSA 4HYYA 3V0XA 1OWKA 5DISB 2CL6X 2ZJYA 1COWA 3UR9A 5EE5B 2ODEA 8GCHF 3BTGE 5AJXA 2NWNA 1XX9A 2C8ZB 3TSOA 1XTRA 2YOFA 4M1YA 1NU7B 4B2PA 5FUVA 3MO3A 1D3TB 4HAYA 5HM9A 2NO6A 2Y80A 3HATH 3H5CB 4KP0A 1S4QA 3UQVA 4N0DA 2O8FB 1LY1A 2AERH 1FPCH 2G1KA 4A0HA 3TJNA 1LCYA 2OT3B 4JSYA 5ESTE 5JBBS 2RA3A 3L82B 5G41A 4GHQA 2N42A 1FONA 1AUTC 2IXEA 4DB2A 1OT3A 4Q1EA 3BF6H 4M0LA 4B1TA 1OB2A 4CDGA 3IPYA 3HPTB 1KY9A 5SGAE 4GOKA 4DLRA 1XUFA 3EE0B 3FVFB 4PC2A 1SGPE 2BM2A 3F3YA 2ODPA 3TGKE 1ZOMA 3A4NA 2V7QD 1QDEA 4AYVB 4NH0A 1Z5ZA 3KQLA 4EKDA 4F92B 2WMOB 1ZU4A 1G7SA 1U8ZA 1YJ5A 1WB9A 2CF9H 1AQYA 4ZKSU 1QZXA 1RTFB 3ZZ6A 1W4BA 2ZQ1A 1FLEE 4MUAA 3AF1A 4PHHA 3FKQA 1EJAA 4MPXA 3I61A 3K1JA 2OO7A 2Y82A 3PWBA 3E8LA 2P95A 1KY2A 4NL4H 1XUHA 2IYZA 2VH0A 1GMDG 1BTPA 4ABAA 3VTKA 5BN3A 1EJMA 3X1YA 5C46F 4FU8A 2IYRA 1C4Y2 3QUMP 2QF0A 2BDHA 3N70A 3MO6A 2J2UA 3OE7D 3M0EA 1TL7C 1HXFH 1G7RA 4LC1A 3MWJA 1DAGA 3QXCA 3CWQA 2QQ0A 2OFWA 3M36A 4LPKA 1XD9A 1ELVA 2H1LA 3HYTA 3MYWA 3KJGA 4ARZA 3GLFE 2ZU5A 4BPBA 1L2TA 2AGIX 1S2MA 4OI2A 2C9YA 4JLNA 3AAUA 4OJQA 3QPVA 2ZYWX 1ZRHA 4A4DA 3W8NA 3GY6A 2G6BA 3D31A 1Z0DA 1S6HA 2QUZA 4CW7A 5DKMA 3RC5A 1KSJA 4OK6A 5KUTA 2Z94A 4GMDA 1O2TA 5JRJA 4JVNA 3KCGH 121PA 3MHWU 1ZD8A 3OHMA 2XTTB 4YOGA 2BZAA 2RGXA 3K0CC 5G3YA 3ADKA 3RS4A 1G5TA 2ZCKP 4MVNA 1W0JD 3H09A 2WSSA 2Y8EA 1BHXF 1AQUA 1AS2A 3NBZC 3PUXA 1WQ1R 5FL7A 2XJ4A 4JVLA 4KTCA 2W26A 1VIAA 8GCHG 2BEJA 2H1UA 1IAUA 1ESAA 2C9OA 1K21H 1C5MD 3BTWE 1W11U 3AVPA 4B35A 1UEJA 1TALA 4URYR 5J4YA 1O5CB 5C2ZA 3GICB 3O8RA 2R8RA 3LGWA 3NVAA 2C9CA 3A7YA 2BCJQ 4YT7H 2IYYA 2NZJA 3WNCA 3SHFA 3Q3YA 4OJKA 1PJPA 1Z6TA 1NBME 4BLQA 1M74A 4YMVA 3ODFA 1XWIA 4NYJQ 4R71A 3C5CA 3IIJA 4ACAA 2IW3A 4V0MA 1Z0FA 2ANCA 3DKVA 1OYTH 2G77B 2IK8A 3F1SB 1OF1A 3THXB 4KHZA 2BHGA 2DR3A 3O8CA 3LVQE 3OEHA 2YZ2A 1YZTA 1WBDA 5EP4A 1WOFA 1E2GA 3FDIA 3LH1A 4NFEA 1CR2A 3GJ3A 3D3QA 2A4RA 1QB9A 1HAHH 3SJKA 1SXJA 3BBPA 1F92A 3K9NA 4WBSA 1G20E 1S0UA 1IQMA 3ELAH 4WOPA 3W9YA 3CLVA 3ATLA 3KKPA 4A8JA 4DHEA 4FCTA 3M37A 1K2I1 2AS9A 3OTPA 2A2QH 2D06A 1FUJA 3CW2A 3A1UA 4KELA 1J9CH 1O5AB 1FUKA 2QENA 5JHGB 4X8OA 1E0JA 2BCGY 3V12A 1HAOH 1UKZA 1NY5A 4Q4HA 4P3YA 4OS2A 2F7SA 1N5KA 3AVZA 1ZC3A 1W8BH 5EPNA 1RIFA 2XW9A 1WA5A 3TH5A 1NP6A 4JMYA 2XNDA 1KXEA 1NTPA 2FPKA 2D8WA 2GKVE 2F9PA 4HI0E 2JJ2D 1A1RA 3IPXA 1QRWA 2Q9BA 3BTEE 1O37A 1WF3A 1Z08A 1XZQA 1LTOA 2CHVA 2Y7ZA 1GNQA 3FVQA 5C20A 5JWOA 4FUGA 2CL0X 2ZI2H 3RXLA 5FAHA 3CX6A 2O0JA 3RM2H 5C4MA 4A5TS 3M5LA 5LB2A 1QRXA 4BTTB 4EJSB 1NESE 1GJ9B 2NU4E 1MBMA 2JLVA 1WCZA 1NRSH 1MO4A 3L0OA 2ZGCA 1GITA 5ETXA 2P3SA 1RS0A 2KBFA 2A45B 3A36A 3ADBA 1K1IA 4FUBA 1Y3AA 4NU0A 1YLCA 4HGCA 1E2MA 4M7GA 1MZDA 1EKBB 3GEIA 2OHFA 3CZPA 3CZQA 5I25A 4I33A 3SS8A 3VR4A 4ESTE 3U8RH 2ZPSA 1PLKA 2PEZA 4RD0A 4QHSA 3QOFA 1KY3A 2ODWA 1GDNA 4XIGS 4JYCA 3CS7A 3LBNA 1U94A 3DMDA 3PV2A 1OXXK 1LVYA 2VIPA 7KMEH 3AM1A 4NBSA 1F0SA 3NWJA 2CHAC 1LO6A 1HAGE 1YRBA 3SORA 3K9XB 2WV4A 2IUTA 5JSZA 4ZCMA 2QP4A 2A5IA 4GSOA 2KSQA 1MCTA 3RXDA 1DANH 1U81A 1GBBA 4AK9A 3CPJB 1WUNH 2MMGA 3PJRA 4HSEA 1KDQA 2P67A 1BH2A 4BFUA 2FOAA 5LD2C 3DDCA 4TLAA 1Y5UT 2ZQ5A 3TNTA 1LMWB 4M1OA 1OFTA 2ZU1A 4CT4B 4CT5A 4E07A 4Q1BA 4ARZB 1Y8TA 3BIFA 1THPB 1HB0B 4TMZA 1N5LA 2BMGB 5JBQA 1K1NA 3VPKA 3TIUA 3QZQA 4JS0A 4BAQB 1ZR0A 4B2AA 2J5XA 4GP7A 3OEED 5GCHF 3P1JA 1G3MA 5EPYA 1T3LA 3AVQA 1UK4A 2ZRBA 5FOSA 1PYTD 3BE4A 2DY1A 4DDVA 4ZHMU 2BIFA 1D9ZA 1KK2A 4RD1A 4X0WU 4IDPA 2OILA 2YKGA 1S0RA 4F7WA 4B2LA 1GRNA 2YNMA 3E1SA 2CEAA 1BMMH 2QAJA 4ESHA 3QVVA 1JBUH 3ND8A 3RDZA 5CITA 1JAHA 4DG4A 2VQSA 1EFRA 4LV8B 3MLEA 3FHTA 3LONA 4JCNA 2VHJA 1KXCA 3ZYCA 1G3UA 1WU1A 4DEYA 3A7ZA 5AUPB 3QPWA 1RJ9A 3GFTA 1C5QA 5JECA 4HZUA 4MPWA 1NU9A 4US2R 2VH6A 3L6PA 1AFQB 2ZYVX 4JLBA 2Z0MA 1C9PA 4IOLA 1K1JA 2HT1A 1BQYA 2BBTA 2D2EA 5KYKA 1VG0B 2SFAA 3RU4E 1FZZA 4BLOA 3IILA 2QTVB 2OAP1 1ZGIA 2HCJB 5KSYA 2QP9X 4KYUA 1K6MA 1H8HA 1MTSA 1U8AA 4BECA 4ZI3A 4OS1A 1C5XB 3AQ4A 3VKHA 1Q3HA 2EU8A 3LW7A 1AN0A 3CENA 1TAWA 1D6WA 1ELCA 4DY7B 2DUCA 3AW1A 5FTKA 1P0SH 2IWRA 3VNVA 4BQSA 4DCSA 3ASZA 1SXJB 3URDA 4FCVA 4LSGA 4PPNA 4FN5A 2VO1A 8LPRA 2C99A 4DLUA 2RGDA 1HUQA 3LFUA 3BTHE 1QL9A 4A8JB 2A4OA 1JXPA 4R0IA 3PVSA 2QSYA 5CYOA 2P94A 3DEFA 1P2IA 3RXPA 3NDPA 4MH0R 2J41A 2QXIA 4Z8XA 3K9GA 2IYQA 4M1MA 4X2WA 2CN0H 1XFAA 4Q4HB 1ABJH 1XF9A 2G55A 3H84A 1Z22A 2GAAA 3DM5A 2GETA 4AORA 1AZSC 2DE8A 821PA 3K70D 4A2PA 1ETSH 2BD3A 2ZRFA 3IWMA 2P2LA 4URWR 5AFYH 2GAOA 1Q44A 1S1MA 3C7KA 5FI1B 1G17A 2ZIQH 2VGCC 3E70C 3QPUA 3VQTA 5C3NA 3TPIZ 1LF5A 2GXSA 3QTVH 4Q21A 1GJAB 4D9RA 3VR6A 3CH5A 2A5YB 2JIZA 2V1UA 3IIMA 4C0LA 1QCPA 1NN5A 1G30B 4LV5B 4RKFA 3SUFA 2RMKA 4BXSA 3M7UA 2C8VA 1JJ7A 3SOPA 3LOXA 2GBLC 3MWYW 3UWOA 1CS4C 1VCOA 1OB5A 1R8QA 4DB4A 4GOJA 1T4GA 5FX5A 2OEPA 3ZGXA 3RSLA 4TLBA 3LU9B 2OCAA 2UUFB 4LRWA 2QI9C 3C27B 1P2UA 3B9FH 4IW3B 5EODA 3Q72A 2PUQH 4TQUS 5DLQC 5EXNA 1TBQH 2ZIAA 4M2LA 1W2GA 2JJ8A 3GISB 2WJYA 3MRSA 4KFSA 1C1VH 2ZRIA 1EFHA 1EK0A 1GJ5H 1ZM2A 3QO6A 3Q77A 1P2OA 2ATXA 1UM8A 2C78A 1GBTA 2GBLA 1SGIB 2ANMH 1KMHA 2ZDKA 1BS1A 4O2LA 3ZVGA 3S69A 1GMHG 1IHUA 2GKSA 4C0SA 2VRWA 5AJYA 1NJGA 1OH5A 5JSZB 4UJ3A 3SNCA 4NCYA 2QG6A 1O2RA 3E91A 4G5QA 2PT5A 1W46A 4A9AA 3K70C 1KDQB 3P8FA 2IYWA 1D3QB 2ZJZA 3C15C 3RMLH 1SR5C 4M1SA 3PMJA 2ZCLP 4F4JA 2FDCA 3Q3JB 1E9EA 1FZQA 2K1QA 1S84A 4Y79A 4TMWA 1EFUA 4X6OA 2P65A 2P5TB 4D0GA 5LPFA 1E2HA 4INLA 2C96A 2JLXA 1GBAA 1PZNA 1F2UA 4DIIH 2FA9A 2BBWA 2ZGHA 1ZTJA 2PW8H 3W5JA 2ZM5A 1IQLA 1EGAA 2QAGC 2F9BH 3RXVA 2BD5A 1E0FD 5FBQB 3EPLA 3UTUH 3KQEA 3WBJA 4A2WA 4MKGA 2LKCA 2YYZA 3SZEA 5IF9A 2PCLA 2TBSA 2A3RA 4OS4A 3T06B 3I73A 5CMXH 3WNBA 3K9HA 3L0IB 3V4RA 2OLJA 1XTJA 4DLTA 2DHRA 4AIIA 2WOJA 3KB2A 1JRTA 1O2JA 4Q4JA 1W12U 4TYNA 3LY5A 3SNDA 3QF4A 2NMVA 4NZLA 3RUOA 2Q0HA 4S2EA 3Q9LA 4G5SA 1RJ9B 1IHSH 3STIA 3FE2A 4HZUB 5A0AE 2P5SA 1Z1JA 2XBVA 3VFDA 1DSUA 2PLFA 2SGQE 4L16A 3NWUA 1E2IA 2UVQA 1GG6C 3GPLA 1O5FH 1MOZA 1PUIA 1KSFX 4TMKA 4OM9A 2A4GA 1ZD1A 1HE8B 2R9PA 3CM0A 1Q1ZA 1ZMLA 2QN5T 1QBKC 1T0JB 3L0SA 3VFEA 4DZZA 3SNAA 2YWEA 1IN8A 1OW3B 1X8LA 2ZSEA 2DWOA 3ATIA 3L8YA 3P92A 1KOFA 4LBVA 3ND9A 1XNJA 1F60A 1YPLH 3AKYA 4YONB 2O8CB 2RCEA 1XCMA 1QQ4A 1F5KU 1TUEA 2FS8A 1W48A 4IRUB 4XSGA 1J7KA 4JVMA 3IQXA 3IITA 1BTYA 1TPSA 1Q1BA 1E2KA 1U0JA 2HNTF 5BN4A 4CRWB 2BM1A 5A0CA 2OLGA 1XMIA 1UJ2A 3U60B 2CVFA 1E79A 1MMJN 3U7FB 1NM6A 2GZ7A 4D80A 5JHHB 3K8YA 2IS6A 1P2QA 5BRRE 1UBEA 3DM9B 3LKWA 4P4SA 2ZPQA 2GGVB 4AYWA 7LPRA 3T1QA 3QXXA 7ESTE 3BERA 2PV9B 1TRYA 2AMPA 2G52A 1GL7A 4QC2A 2B5TB 5KPJA 2FN4A 2FM2A 5JYIA 1O3GA 4J1YA 4M4SA 2QIQA 3BH7A 2Q21A 4TWZA 2FYQA 3AF2A 4X6PA 3R8CA 3BTQE 3EPKA 2EFDB 3LXXA 4I8HA 1J99A 4J2YB 1TABE 1Z2AA 2NO1A 4W5HA 5FTNA 2VHTA 3UNSA 4LJ4A 1QHSA 1O2YA 3S9BA 4JIMA 4BOHA 2H2ZA 3B60A 3RXEA 2H8KA 1TRMA 4PR0A 4JZFH 3D7MA 1UFQA 2BOKA 1U9IA 1E9FA 5B64A 1EWRA 1EZQA 1D2EA 5CK4A 3M5OA 3SEAA 2G3YA 5JLJA 1ZMNA 2FGJA 4O3UA 1B0UA 1E96A 2EI8A 5TB5A 3A88A 3GYMA 4W5WA 1D2MA 4DCTA 3NC0C 3JZAA 4TSFD 1L8QA 4DSUA 4A6PA 1HAXB 1A1VA 3QDZB 1JAIA 1CA0C 4U01A 1XDBA 1GM5A 2OXRA 1DELA 1BHXB 2RKOA 6CHAC 5SZIA 2ZHQH 3VXEH 4YLGA 1OP2A 2ZAOA 3HYRA 3UY9A 1FMLA 2PMKA 4A15A 5FPSA 3LDAA 1GJCB 4GZMA 1ANDA 2DFKB 3WMFA 1P8VC 4LHYA 4MITA 2QPOA 4PXAA 2ZJBA 4XH9B 1IHTH 1ZNYA 1XPRA 4KGAA 4Y71A 2BVRH 1KMHB 2Q3HA 2O52A 4EFMA 1ZYOA 1X3SA 2O8LA 1GHZA 1V3XA 4GP6A 4E7NA 4CEIA 3NEYA 3RU4D 3F9HA 2Q6DA 3U3RA 1T31A 1FIZA 2XRCA 1AWFH 3THOA 1GBEA 2NO9A 3PTNA 1M7GA 1BUIA 1SGYE 1W36C 4E06H 1EJNA 2BC9A 5FH9A 1UHBA 2F1RA 3P26A 1VZQH 3RC3A 3AW0A 2WBLC 4PZLA 1OH8A 4O25A 3RRZA 1F2UB 1ZYUA 1ZHPA 5AK0A 2ZE5A 2AIPA 2Q6TA 5J4VA 4EIWA 1ZIPA 1HV8A 5L6NH 1O38A 1V2PT 3N7OA 3I5YA 1P02A 4DEXA 1P3EA 5FL3A 3W6NA 1JOUB 5EE3A 4OS5A 1Z1IA 3I5XA 3KN2A 4QFMA 2IEYA 1N6PA 2BVNA 4ILEA 1G2LA 1TMKA 621PA 1MCVA 3URCA 1JXOA 2JCSA 4AB8A 4PFSA 3U6KA 4ACBA 1TX6A 1OXUA 4KJZA 3M5MA 2FOBA 3QKRA 1WTGH 4II7A 3NBXX 5HR5A 2THFB 3ZD7A 4Q4JB 1AZZA 2QV1A 3QF4B 3MWKA 2BJWA 1TGBA 5EUQB 3TIFA 2ZHDA 2OV2A 1V2RT 1IM2A 4YT6H 3MU5A 2BDYA 3A8TA 3CNOA 3UNRA 4CRBA 4IXNA 1RKBA 4CBOA 2J9RA 1YZLA 4LJ9A 1SVPA 3MNCA 4H9GA 1ARCA 5BW8A 1E2DA 4B32A 1O3JA 2CCGA 1KNQA 4EFLA 3QUSA 4LBYA 3LO5A 3RS0A 1AKSA 3SFZA 2BQWB 3GLHE 2QN6A 2AKAB 1PLLA 3G01A 4Q4AA 5AFZH 3Q7QA 2TPIZ 2NIPA 1HTWA 3TUJC 2ONJA 5AHGH 1GAJA 2G51A 2EWVA 2D3WA 5CJPA 2BKUA 4HLQB 1X7AC 3KQNA 4MG3A 3S0NA 2F3TA 3LPRA 1JJVA 4JL8A 1GG6B 4MGZR 3TUZC 4UFFH 3WMEA 3A1TA 2HEIA 4F4CA 4JKYA 1N6HA 4G5OA 1V2JT 3J81k 2Z3CA 4IKEA 2GESA 1MV5A 2QXJA 2GD4B 1EX7A 4Q80A 4KLZA 1Y3UA 3BRWD 3QWCH 1RFLA 2OCVB 3SNBA 4A6LA 1DOJA 1CJVC 2Z4SA 4OS6A 3AVOA 1BITA 2V54A 3LLMA 4X6NA 4JKIA 1G1MA 1LHGH 2OQ5A 1UKEA 2I1QA 4Y11E 3B6EA 1E3MA 1GKYA 2GCPA 1P9RA 5FOXA 4DLVA 3W6PA 1GWAA 2QY9A 5TXGA 4P4SB 3ZYDA 4LHXA 1LVGA 2IX3A 5IDVA 1IXSB 5E8EH 2QP3A 1QJ1B 2P3UB 4FWTA 4V0KA 4HUQA 4A0RA 1VCWA 3TE6A 3OIYA 1VITF 2ESTE 5FOWA 2ZFTA 1XPUA 1O2KA 4DSTA 2UUYA 1YZGA 3TGIE 1P75A 5DSZA 4FW9A 4SGAE 1JEDA 4Q1FA 4QGHA 4RSPA 2Q9AA 4Q7ZA 4TL8A 4FVDA 4F4OC 2W6JD 4XBBA 1W0KD 1E4YA 1DVRA 1B23P 2WWIA 2V0BA 4M1WA 5L3SA 2F3CE 5DGJA 1HJ9A 2VU8E 1GI3A 2ZJOA 1XZPA 1P57B 1Z0IA 4PAOA 3QTOH 3MG9A 1WMSA 3GEHA 3D8BA 5EGMA 2ZXUA 1II8A 2VP0A 5T6GA 1BRCE 2XOKA 3RS2A 3P4XA 3SQWA 1SGNE 3MJRA 1T32A 3QVUA 4AYYB 1FAXA 3RRNA 1HDTH 4NDZA 4M9FA 1DWEH 3P17H 4XDEA 2JLWA 2IHBA 3VEQB 3W8RA 4D8NA 4OYHA 2BKEA 1I4LD 1XEWX 3HU1A 1RJXB 2HYDA 3NZIA 4IOKA 4IHQA 2STBE 2NU0E 1UVTH 2HV8A 5A0FA 1NG9A 1NPMA 4I99A 1G291 3MH7A 1QR3E 2O8DB 3EA5A 1DAIA 3RXTA 2GA8A 4CEIB 1C2DA 3E16B 1CA0B 2ODYB 2BDCA 4IFEA 1ZTKA 1GBKA 4ZKNU 1ZUIA 2D7DA 5E2PA 1VHLA 1RTKA 1C1UH 3E0PB 4I7YH 2YNAA 4AFQA 2VWLA 2ZGBH 1NRRH 5J4QA 1C5YB 1O3KA 1TRNA 1BA8B 1ZJ6A 2AFIE 1P05A 1DWCH 2BY9X 3VB3A 3TLOA 3T27A 4CGZA 2JJ1D 3IKJA 4BFVA 2IYTA 2TRMA 2F3RA 2IJD1 5SZJA 1W3CA 2W3KA 3CBQA 3NBYC 2ODBA 2FX3A 1XKBC 1LV7A 4OL0A 4P32A 1KO4A 4XE4A 1OHHD 2WV9A 3W3AA 1BZXE 4IN1A 3CUEF 1GI7B 2A1DB 4NYMQ 2R6GA 3U9AH 1QVAA 3RAPR 4K1EA 5GWZA 1CT2E 1GHXH 2FI5E 2ZRMA 1UK3A 5C5NA 1DAFA 3T1VA 1G4UR 2Z5FA 2JDID 1KI6A 3QKRB 1FQJA 4TTRA 4HFPB 1ELBA 5HKKD 5KNBA 2ZTZA 3EW9A 2J4IA 4I8GA 2CE2X 5CB6A 2R3YA 1GVKB 4LK4A 1FNIA 3MU0A 4OK3A 2WZQA 2IL1A 1B0FA 1LPGB 2C5LA 3GDVA 4AGJA 3GFPA 4WXRA 4IGDA 4ISIH 4K8YA 2OC8A 1PFXC 3A80A 1VR1H 2XAUA 2Y7XA 3P27A 3JVUA 4GMXA 3CWZA 1ZTLA 4RJLA 5F2EA 3K0SA 2NO7A 5I46H 2R6DA 1UO6A 3TQFA 4PC1A 4JT2A 2WAYA 2I4IA 4W5JA 2A7QA 3BK7A 1G8PA 3DZDA 5T6FA 1AKSB 3F9GA 5TCAA 1KJWA 2XC0A 2PTNA 3R3GB 2LWIA 3HR8A 4Q4AB 2ZYTX 5D3QA 3LC5A 3AV0B 3B5JA 4CEJA 2GCHG 1OIVA 2ZETA 4NCKA 2SGAA 1UADA 3F5FA 1GBJA 4LOAA 1CRQA 1AK2A 1GSIA 1EOJA 2FFBA 2REBA 4R2IA 1Z07A 3IHLA 5E7IA 4H4FA 3LXRA 4NONA 4XFQA 3U3OA 4EDHA 3A84A 2ILNA 1O3MA 1KXBA 1BYIA 2VP6A 2FODA 2VF8A 3CNLA 3K9LA 1O3AA 2BLOA 4YZUA 4B6FA 3UQOA 1F2SE 4AFUA 3MD0A 2SGDE 4JZ1A 1VECA 1Z0AA 4HAZA 2QTHA 3TJOA 2LNCA 2Z6VA 1Q20A 1LHEH 2O8BA 2VP2A 4LDJA 4MLFB 3M7TA 1O3DA 5L3RA 3PUZA 1G8FA 1G4AE 1UCYH 2R9VA 2SGFE 5JB9S 1FX0B 2GEVA 4P4UA 1P2NA 5FHTA 4MYHA 2CLCX 3ZZDA 1C1SA 3O47A 4Z6AH 4FXGH 4XD7D 3AKDA 2PZFA 3QSYA 2A32A 1RRPA 5EP3A 1ZINA 4B3DA 4CREA 4R7ZA 4DURA 4IMZA 2QMHA 3LQQA 2F4LA 1LPKB 1V2OT 1BO6A 3TMKA 1NFUA 4JVSB 1G32B 1CLUA 4E22A 3AUYA 2R2MB 4B2BA 1XP8A 5L3SB 3ZZTA 1TF7A 1IQPA 2ZVQX 2ZI3A 2PX0A 2WPMS 2W7UA 5E2OA 1N6RA 1OKKD 2ANBA 3EIHA 5F8ZA 3KEEA 2C93B 3X1ZA 4D4LA 1II8B 3EAQA 1T6NA 3KXLA 1GI6A 1Z71A 3THYA 1FMJA 1KTSB 2OC7A 1ELOA 3WYGA 2YVUA 2AD5A 4Q1AA 3KNXA 5CLLA 1C1NA 1JQJC 2F1HA 1GHYH 5CK5A 5EE9A 3CX7A 1ESTA 4JZDH 3I32A 5DN6D 2HLDD 3GCTF 3K6ZA 1A82A 1NVWQ 2G88A 1ONBA 1R10A 4IOJA 1ESMA 4TWWA 1Z6AA 1HAVA 1KKMA 1QG4A 1L7VC 2ZI6A 1E94E 1A3BH 5C67A 3AASA 5FCKA 2IF2A 3ODDA 1MBQA 5HGGA 3AGQA 4ZXXH 2IYUA 2GHIA 4AKEA 1W7AA 2HPPH 3DL0A 3RRMA 4AC9A 1PVOA 3U7EB 1R2QA 2ZUBA 4X8UH 2ZFSA 1G7CA 1OOKB 3GLGA 3T26A 1KO1A 3ZDQA 2CLDX 1SZPA 1EOLA 4Q9LA 4H1VA 1V2KT 1I4TD 4DWJA 4B3XA 2FOMB 3FKSA 4UDWH 3FGNA 4QM7A 2BMFA 1O2IA 3EZFA 3I4LA 2DE9A 3GY8A 1HXEH 1ANKA 1TIOA 1GRQA 1LVMA 1XVMA 5JRZA 2PGQB 2Q3FA 4Y0YE 4U7DA 1YZNA 4J0QA 2O9QA 4MKIA 3DO6A 4E03A 3D6TB 2XCFA 2QRZA 2GCOB 5GXPA 3SV8A 1Q0UA 5KSZA 1XUIA 1QHGA 3FP8E 1L2EA 4C2TA 3E0NB 4JLJA 5F8XA 4XTCS 1BTXA 4DT7B 3TW4A 3ESTA 4HLCA 4FCWA 3P8NA 2WKQA 1W2HA 2CXXA 1L1GA 1NFXA 2W2TA 1N0WA 3CX8A 4OQNA 2N46A 1H8ED 1KI6B 3W95A 1A2KC 1JECA 5BYJA 2JH0D 1FN6A 2REXB 4OK5A 3U3JA 3PM3A 1C1QA 3K0FA 1NRNH 4I8JA 1CHOG 1K1MA 1E0AA 2GT7A 1ZMJA 3OYPA 3QKSB 3QXJA 2F9LA 4WMDA 1C5LH 2OD3B 1Z7KA 1KYIA 1VCPA 5DO9A 2FPMA 1TQ0B 4EQ6A 1D3PB 3HGPA 1UTQA 2V4ZA 1GGDC 3M4YA 3REGA 4ZCIA 2ZSBA 1XMNB 3ZZCA 3BGWA 4V0ME 1AVXA 3TH4H 2GF9A 5FTLA 3A89A 4NGAH 2ZHFH 5KSPA 1M9UA 1F5LA 2O8TA 1C5ZB 4EPYA 3TJUA 1TUIA 1UVUH 7GCHG 4C2UA 1ZVQA 5KDLA 2BD8A 1SXJE 5DP3A 1OX1A 2NTYC 5F8TA 2AGGX 2ZANA 2R6CA 2PR3A 4CEJB 2R65A 1SGCA 5KDDA 3NCLA 3S7HB 3VKGA 1F0UA 4GCHG 1PPEE 1KZGB 2J7KA 1YR8A 4JBXA 1CQQA 2FG5A 4YM9A 1OWIA 5F03A 4BLSA 2FOEA 1CGHA 2ZE8A 1ZM3A 2OM2A 3AVYA 4PQYA 5ESBA 2AD1A 1NKSA 4LYHA 1O2PA 2IYVA 1UMAH 3ZS9A 4NTZA 2QEQA 4XJXA 2RB4A 1GL0E 4CZ2A 4TYDA 1D3DB 2V55B 2ZI5A 5JZVA 1DUEA 1C1MA 1N1LA 1EXMA 1TA2A 1AIPA 3EC2A 2ZFPH 2W6ID 2Z7FE 2J59A 1N6NA 1IBRA 2O8BB 3BD9A 2IUUA 5B57C 1BDAA 2Q6GA 3U3MA 1G3IA 1BMFA 1XEFA 4BFWA 3IBYA 3MFYA 1O2MA 1BTHH 3M7QA 4IN2A 3ZVFA 4PZZA 2WV5A 2WPIS 5JPMH 4RZUA 2FESH 1A5IA 3RXFA 4H6SB 4DW2U 2P3FH 5GADl 3T1TA 2HJVA 3A58B 2MSCB 4LGMA 1F5NA 2ZHEH 2PKSC 1MAYA 1SC8U 5DO4H 5SZHB 1CE5A 1ZSJA 4JK6A 1M7BA 1O2WA 1W10U 3FFGA 1Z0KA 5A0BA 5IDKA 1WBGB 2AMDA 1NSTA 1BTUA 2B7DH 3LGVA 2V8OA 3ADDA 4QT8C 2PX3A 1UBGA 1G3EA 3V4FA 1F0TA 1KAGA 2VIVA 1E0KA 4B76A 4YLUA 1GBMA 1QVRA 3WXMA 3DA9B 4HI3A 1XXHA 1MU6B 3KFXA 3THYB 2FGKA 4UFEH 1PJRA 3FTQA 1E1RA 4Y7AA 1JPNA 5C5OA 3TGPA 3QXSA 4JZIA 4AY2A 1R0WA 1OWJA 3C5HA 3VB5A 3NH9A 6LPRA 1SQOA 3I78A 2WAXA 2C90B 4Q00A 5FR1A 1R5BA 5DI3A 1KJZA 5EP2A 4X2YA 4R8TB 4M53A 1HAVB 4MNYA 4M9SA 1QG2A 2QBYA 1A4WH 3LGUA 4ISHH 2ANYA 2FTLE 3EA9A 3A82A 3OY5U 1II0A 9LPRA 2G81E 1VCQA 3EWSA 2XITA 3S7KB 3GLGB 2Y5FA 4GOXA 5AVDA 3BTTE 4RCZA 5HCNA 4VGCC 2GMTB 1EX3A 2QTFA 1FTNA 4Q7KA 3QN7A 4MA4A 3X1XA 5B58C 1GHAG 2BXTH 1JEEA 3UMSA 1T8TA 3I62A 1MZAA 1Z6YA 2OE2A 1MR3F 4DGJA 4K8OA 2J7PA 5KPDA 2Z4RA 1WSSH 1E4VA 2ZRHA 4S35A 1ELDE 1G3QA 1WXRA 4DLZA 3KL6A 3MNBA 1QURH 5CLQA 1Z29A 3KTAA 1J15A 2FU5C 2WINI 2CK3A 2P6UA 1G37A 2FV8A 3TSWA 2GXQA 4BTUB 4Y8YA 4IDOA 1KXFA 5ABWA 3VX4A 2PBRA 4OHXA 3U98H 4Q9HA 2WUBA 1RD3B 1SQTA 1SHZA 1LB1B 3WNDA 4C0QC 3ZVLA 5FR2A 2QXHA 5GJCA 1COWD 3K0FB 2HYIC 2BHRA 2IUSA 5K8UA 4O3MA 4TL9A 4DCDA 1DXPA 2J87A 2PKAA 4QOSA 2AL7A 1O2OA 3KB1A 3QG5A 5DH9A 5KOYA 1DVAH 3MH4A 2CBZA 3KQKA 1UDXA 4ZV4A 1Z83A 4Z0KA 4UD9H 4EQ6B 1H9LB 4HLDA 1ELTA 1D6RA 1A2BA 1WQVH 2KE5A 1O2NA 3OY6U 2XNSA 3FMPB 1JR3A 1AKEA 4ERNA 3MWLA 2EQBA 4IW4E 3N2EA 2H7VA 4WVPE 4E7RG 4CHAC 3K0EA 2G0NA 5FBRB 2V6JA 1NKTA 1VIYA 1GPZA 4WY3A 4X1PU 1RFNA 1SGRE 2OCBA 3TRFA 1MU8B 3ATKA 1DAEA 1V2VT 5G3ZA 3SE0A 2D74A 3BAFA 3VR1A 3NDBB 1J70A 421PA 2XTNA 5JI2E 2CV3A 4PSKA 3UWJH 4CRCA 2OXCA 5IT5A 1GGDB 1U8YA 2ZJ2A 3FYHA 4BFSA 2NPIA 5LDDC 4Q9IA 1C2KA 2FOCA 3TAUA 1ZNWA 3MTYA 1VCIA 3LH5A 1K28D 1W49A 2IYLD 1NMZA 1P01A 1M1YE 2OSBA 4ZKEA 3PQCA 3SYNA 1DM4B 4BANB 3I3SR 1UCYK 2VP5A 1C2IA 1AKYA 1ZBDA 1FY5A 1YPKH 4NIXA 4TYWA 3ZZ5A 4D0NA 1TPPA 2JH6D 1TGCA 2XBXA 2P8OB 1KK3A 1X8JA 2J9NA 2QSZA 3M1IA 4LOYH 1WP9A 1UTLM 1ZSKA 5JJKA 2ZREA 1C2JA 2WWFA 4LC0A 5GDSH 3SJOA 4LZ1H 2ZR9A 4NCNA 3SJ8A 4K2YA 2ZJ5A 1GBFA 3QEOA 1EP5A 3F68H 1VDZA 3GJ7A 2FFAA 1G3DA 1C5NH 2NU3E 3LJOA 1QNJA 5FBIA 1NO9H 1DWDH 2FYRA 3T25A 3H7OA 2FPLA 4XVQA 4BZQA 1GJ4H 1E9AA 3VR2A 3GY3A 5JBTA 3AGPA 4EJSC 4ASHA 4DOQA 2JASA 3CKLA 4I4LA 1GDQA 2LCFA 3A1VA 3ASYA 1LF0A 1NROH 3NUMA 4HDQB 3DT0H 3ZQJA 4X2VA 3GEEA 1ZZZA 1ORFA 4FMBB 1NN0A 3S1AA 2YWHA 3GLIA 1V6DA 2A4QA 1LQEA 3NK8A 4GAWA 4QBIA 2AYWA 5CHAC 3B9QA 4HZIA 2FJUA 1ZHRA 2ZDLA 3T5FH 2WSSD 2A5DA 3OFNA 2A2ZA 3GMTA 2BXUH 4XWAA 5FL7D 3SYJA 1XXHB 4ABIA 4EJSA 1O34A 5D3MA 3KKNA 2BLVA 2C77A 4W9MC 3KUDA 1WAYB 3SV6A 1TA6A 5JEEA 2PKSB 3GDSA 1CBUA 4U32A 1KTVA 4TTPA 2P59A 2VHQA 3UMRA 4B3GA 3FB4A 3MU8A 2ZJ8A 2ORVA 2KJQA 2ZU3A 1C5UA 5DI3B 1S82A 2XXAA 3ZZUA 3NHAA 1NMXA 3TVJB 1YM0A 3B1WA 3E1XB 1XPOA 5FPTA 1Z8RA 1E38B 2QBYB 4P0TA 3VGCB 4IVPA 5CDFE 3AKEA 1HJAC 4KSBA 1TPZA 1BRBE 2JLRA 1VHTA 2ZRJA 3RC8A 1R8SA 3UOUA 4QBHA 3OEHD 1RRCA 4FVBA 3T62A 1AIXH 4MDSA 1GI0A 3EPHA 1T7CA 2W0MA 1RRGA 3CR7A 1OYQA 2BM0A 3TKLA 5GPIB 1SXJD 1EXFA 4A1FA 4AG1A 1T0HB 1KO8A 1Z6JH 3KKQA 2BX4A 1JRSA 4FUDA 4UXIA 3ZVMA 3ZZBA 1G5RA 4K1SA 1SKYB 1MH0A 2UZ3A 2C03A 2Z9IA 3EZ9A 1HH4A 3L2OB 3KXKA 2FS9A 2G5VA 1Z8GA 2FLBH 1IXRC 3ZD6A 5FTMA 1SULA
chains in the Genus database with same CATH superfamily
3WVNA 3OCUA 1FS6A 1VG9B 1BX3A 2EJTA 3HPQA 5DTRA 3KTAB 2JFUA 3CW9A 3C3YA 4NBTA 4ZOEA 5L8VA 4RHFA 3V7YA 3EZ7A 3ZJUA 2KB0A 4ZOCA 2XNDD 3OUZA 1JHMA 1ZPDA 2UWPA 3V7TA 3FYTA 4P5PA 4N3AA 4IXMA 2KCAA 3C6MA 4YDRA 3K0HA 1GI5A 5FNZA 2VXOA 1N3YA 2PKAB 3UFXB 1NQAO 2BJHA 4I1YA 2Z4TA 5D6OA 3EIEA 4NCJA 2GVFA 4K5ZA 1DEHA 4HEQA 2XNCA 1HM5A 4LDPA 2AG8A 1YS7A 6PFKA 1TCCA 2D0PB 4NP6A 5C8YB 1XELA 1XK6A 2HCBA 3BWDD 4D42A 1ORHA 3GUCA 4JQYA 4WH0A 4PAGA 3VR5A 1KQ3A 1BJRE 1QWSA 3MMZA 3V2HA 2NP7A 5FXLA 1LZLA 3WSTA 3TLXA 3A1NA 1NV8A 1SN7A 4A73A 2A7JA 1ONNA 4BUCA 4UNRA 2LNDA 5AW3A 2MTBA 1G9SA 1DCMA 3A32A 4B2YA 3CTPA 1SXJC 2A5KA 2X58A 2BDAA 2WJJA 3SF0A 3H8WA 3QEMB 3CN7A 4HGQA 1BHQ1 3P9PA 1VLZA 5HE8A 4IHJA 1BIFA 2C04A 1WV0A 5IWAB 4IY1A 1AS3A 1Q0ZA 5JBCS 3L8GA 3ZUGA 3G7NA 3MB5A 1P39A 4HAUA 1TTHA 4IGEA 2PZEA 1ZRKA 5EG4A 2Z2YA 1FBNA 3RXOA 1T36A 1C1RA 4UHJA 2WPDA 5DJ7A 1NVKA 4B83A 1U3VA 3PE4A 4CHAB 3GLTA 1ZW1A 1N33B 3OQHA 1MG5A 4X94A 1TVKB 1ADBA 4CN9A 3Q7SA 1KU6A 1U9YA 3DHWC 3VDQA 4MWOA 2AEMA 4I1OA 1F2VA 1O2VA 4OY3A 3SAJA 3JQ7B 1H69A 1SCKA 1NUAA 2PMDA 2FHPA 2BDIA 4X6LA 4R16A 3RXQA 1TQHA 1HT0A 3ZYZA 1E36B 2YOGA 3WADA 3OC0A 4M1QA 4TMVA 1BEZA 2HX1A 1N1GA 1J2UA 3TAXA 1MT0A 3IB3A 3E9DA 1R0YA 3BOSA 1QHNA 4PS1A 1PZGA 1WKBA 4F2GA 4RH1A 1O0BA 4LDQA 9GPBA 1TM3E 1U65A 3LGYA 5DXAA 1YFLA 3KQBA 1H1BA 4Y1FA 5LQCA 3V34A 1YCHA 4OLAA 4EPXA 2HJWA 1BWPA 4FHFA 2JLSA 4KFRA 3DL4A 1CF9A 3AL0C 1SBZA 1UC5B 4I1RA 2I91A 1TZBA 5D3MB 4PNEA 2BTQB 5TSDA 4YGYA 3VPCA 5JYCA 1NFWA 3ORRA 3H5IA 1KXDA 3FIJA 4M99A 2Z3DA 1ZD9A 1UK7A 1UODA 1AX9A 1C2GA 2Q2OA 3ZW8A 1XTKA 3AAVA 1LNQA 1DCTA 4MV3A 1UBJS 1WB5A 3R44A 1UK2A 5FUMA 2Q5OA 3PNBA 2CUTA 3KE9A 2NUPB 2QD5A 2VR1A 1TO2E 3MT8A 1Q50A 2H6MA 2PMEA 5K3DA 2WHRA 3GJRA 1H2XA 3FSJX 4YMTA 2D8AA 1NPTO 2DH6A 1W13U 2ALVA 2Z2JA 1K22H 1TO6A 3QLTA 2XH8A 3UGJA 4OGFA 4C7JA 4RHYA 2CNWA 4FBLA 2B92A 5DNVA 4IDFA 4BE4A 5T3HA 1GTVA 1NW8A 5C0OE 4W1RA 1VE5A 3OUUA 4B7ZA 2GZ3A 2WJIA 1JE1A 5KHLB 4DA8A 4MPTA 2WPJS 4R1LA 4UUQA 1FRZA 4B3JA 3TTVA 1R5OA 1E3EA 4P82A 1O3BA 3GGSA 2A35A 4HS9A 1O39A 4AJ4A 3KK0A 2EW1A 1YYY1 1Z2CA 4JJAA 3AHDA 1TW2A 3QE3A 2VQEB 3N53A 4OQFA 4O97A 4RAQA 1RQPA 3AX6A 2CMGA 3QUCA 4WCVA 1T2DA 4DDTA 3MWFA 4D4JA 4XGIA 1MKYA 1U0RA 3SV2H