2OC8A

Structure of hepatitis c viral ns3 protease domain complexed with ns4a peptide and ketoamide sch503034
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis C virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 42
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc8A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc8A01
4RKOB 1QQ4A 4MNVA 1DS2E 2BOHB 1PPFE 3SV9A 1EASA 5DP7A 1ID5H 1SGFA 3NZIA 4FUBA 2BYAX 9LPRA 1K2I1 1RTKA 3LJOA 3ZZ4A 1JOUB 1KTSB 3FP7E 1O3FA 1OP0A 4I31A 1QQUA 1OWJA 5EPYA 2QN5T 1A2CH 1W8BH 2SGPE 1JRTA 1GBEA 1UHBA 5F8TA 5IDKA 1A3EH 1DANH 1YPGH 3SI3H 1EZXC 5FCRA 1W13U 3ATLA 3M3TA 2RCEA 3T27A 2PR3A 2BD7A 1TB6H 4E05H 1MAXA 5E2OA 1W11U 2H6MA 3RXBA 1HNEE 4UEHH 1B0FA 1SR5C 3VEQB 3NK8A 3LIWA 4CH2B 3HGNA 4MPXA 1V2WT 4FUDA 1F0SA 1NS3A 1MKXK 3OTPA 1E0FD 4WY3A 3SUFA 1JRSA 4TY7A 8KME2 1O2XA 3GY7A 3Q3XA 5DP4A 3TNTA 1SC8U 3OU0A 3BEUA 5JPMH 2HNTC 1QA0A 2PSXA 1GBKA 3TU7H 1C5VA 4BAKB 1P2IA 4IN2A 2BY7X 2VIWA 3TK9A 1QJ6B 2AIQA 4TPYA 1J8AA 1NFUA 3RXVA 3GDSA 3GICB 1TNKA 4AORA 3Q3KA 1O2PA 1L0ZA 3NPSA 1K28D 1WTHD 2ZU3A 4NWKA 3ZVFA 1KXDA 5T6DA 3LJJA 1D6RA 1SFIA 1QRZA 1O39A 1O5EH 3LGTA 2BHGA 1PQ5A 3QDZB 1C4V2 1LPGB 1Z6JH 4MG3A 3RUOA 1HIAA 2BQ6B 1PPZA 1TA2A 1GDNA 2FP7B 2P8OB 2NU1E 2BD5A 4GAWA 4KTCA 2O8WA 1BUIA 1HPGA 5HYOA 1AHTH 3EDXB 2O8LA 5L30H 3MU1A 4IS5A 1LPKB 1F5KU 2CF8H 2XC4A 1QCPA 1O3OA 2ZG0H 5FBIA 1GHWH 1ZHMA 2PWXA 1W0YH 2WPKS 1LVYA 4AFUA 2QCYA 5EQQA 1MU6B 4CRGA 1QY6A 1O3JA 4JK6A 2C90B 1HAZB 1NROH 3M5NA 2ZTYA 4Y7BA 1UTNA 2ZPQA 3SUGA 3W95A 1ACBE 1V2JT 3E91A 1GHVH 1OKXA 1GGDB 1MTUA 1SLWB 2FO9A 3LU9B 4O3UA 3VXFH 3OYPA 5C1XA 1FN8A 5HXFA 1HAGE 2Z94A 1EXFA 2BZ6H 1CT4E 1ZGIA 1P2NA 3SJ9A 3E8LA 3A7XA 2OC0A 5CE1A 3P6ZB 3I29A 1MMJN 3MH7A 4CHAC 1ZHRA 2Z3EA 3ZVBA 1P12E 1H8IH 1TYNA 3RXSA 1ANDA 3RLYH 1H1BA 1LVOA 3FVFB 3A85A 2C3SA 1KXCA 1HAVA 4KGAA 1DDJA 4BTTB 5A8XA 3ESTA 1GL0E 4FU7A 1TRNA 2ZPRA 1GJ4H 1Z8JB 2ZHWH 4I8LA 2NU4E 1WBGB 3GISB 1TGTA 1AD8H 3PLBA 4INHA 5GCHF 4ABJA 1ESAA 4ZHMU 3CP7A 4ZMAH 1MD7A 1Z8IB 1OWKA 4WMFA 1UTJA 3PV4A 5PTPA 1RXPA 3U8OH 4B2AA 5AHGH 3MI4A 5FX6A 3STJA 1N1LA 2C8ZB 1BTPA 2G00A 2QA9E 2WHXA 1C2LA 1AMHA 1EAIA 1ELFA 5SGAE 2O8UA 1EATA 3E90B 3MYWA 2BDHA 2G5VA 2BD3A 4TWYA 1UCYK 4WH6A 1O3CA 3RXIA 3SNAA 3RC6A 3KQDA 1GG6B 4WMDA 1AFEH 5C5NA 1MAYA 2UUYA 1L1NA 3ODDA 1O2YA 1GBMA 4DW2U 2VB0A 3RXHA 2NU3E 1UTLM 3EGKH 5DGJA 4MLFB 1O2UA 1MZAA 2GCTC 2ZWLH 1P02A 2A4QA 1TPPA 4AYYB 1O3NA 1S0QA 4DURA 4F4OC 3PMBB 1O3DA 1XVOA 4UFGH 4ZAEA 1FY8E 4X2WA 4ISOA 2ZQ1A 5C20A 3RXAA 1PYTD 5GCHG 1AIXH 3PV5A 4JZDH 1D3QB 2G5NA 3PO1B 3GCTF 1BRCE 4I8KA 3O8CA 5JBTA 1PJPA 1T4UH 3PLPA 3M5LA 3IWMA 4A6LA 3JZ1B 1C5YB 1O33A 3O8BA 4B76A 1EB2A 2QF3A 4OS6A 4ZKOU 4K1TA 5DG6A 4JYTA 1K1MA 1IQHA 5A8YA 3M61U 1WTGH 2DE8A 2J9NA 3RXJA 4I8HA 4ZKNU 1IQIA 1O31A 2PKAB 3K2UA 2P3TB 1FONA 1SBWA 1VGCB 1YBWA 2OXSA 2BB4A 4A5TS 5F8XA 4JZEH 2A45B 2ZU1A 1INCA 2ZFRH 4MQAA 1BA8B 1VCQA 1RS0A 1XMNB 3SV2H 1MBQA 4NSVA 2QC2A 1GBAA 2FOFA 1WXRA 4KTUA 3BTDE 1K1IA 5DO4H 1HAXB 1KLTA 1WOFA 3BEFB 2ZO3H 5A0AE 3MU8A 1FY3A 3SZEA 1FAXA 3URDA 1EPTA 1V2VT 3GCTG 2OBOA 1VITF 1P01A 1DT2A 1UVSH 3PMHB 4NIYA 2SGFE 1J17T 2A31A 1V6DA 4O97A 1LHFH 4K1EA 1F5RA 1RIWB 3VB4A 4D7FA 1GBJA 4YLQH 3KCGH 1HAHH 1S6HA 2FI4E 2TGAA 1DY8A 3DUXH 1BHXB 1HAOH 1E37B 3ATMA 2FOMB 1FIWA 2Y5FA 4BXSA 5ETXA 2H2ZA 1O2WA 2NU2E 1ESBA 3ZZ6A 4ABGA 3SJKA 1DSUA 1AKSB 1HXEH 1O3IA 2QV1A 2A4GA 3VB7A 4Y8YA 3UWIA 1XM1A 2NU0E 2ZDKA 1KIGH 1LCYA 1P09A 2ZGHA 1CGIE 4F49A 1Z8RA 3RXTA 2BD8A 1DWDH 1G2MA 2CHAC 5F6MA 1Y3YA 3BG4B 1GHBF 1G37A 1VITG 2J94A 2ZDMA 1O2RA 4YTAA 4AB8A 5LH8A 3ZZ9A 1IOEA 1O3HA 1S83A 2O9QA 3TJUA 4Y6DA 1TGSZ 1Z6EA 3FP8E 4CRBA 4WJG2 1FXYA 1QHRB 1TGNA 1P06A 1DVAH 3TNSA 1C1UH 4BAOB 1T31A 2OLGA 5GIBA 1MTSA 1G2LA 3T5FH 1O3LA 2IJD1 1AUTC 4MDSA 1S82A 3UR6A 2BDIA 1VZQH 1AVWA 1HAIH 1DICA 1UK3A 1T8MA 2C8XB 2ZU4A 4Z0KA 3I77A 3EYDA 1ZMLA 1DXPA 3T26A 3U1IB 3U9AH 1SLVB 5ESTE 4YOIA 2WV4A 3AW0A 1C5PA 4I8JA 2IPHA 2V0BA 4KP0A 1NRSH 3E16B 4Y8XA 3V7TA 1W10U 3SOSA 1L4DA 2Y80A 5I46H 1NT1A 2AFQB 4B1TA 1C5XB 1XXDA 3GCHC 3LGWA 2IOTA 4FUJA 3SGBE 1G3DA 3AVZA 3V0XA 3UR9A 3UREA 4WXIA 1EP5A 1SG8B 2JH6D 5K0HA 4NCYA 3ATKA 1MH0A 1J15A 1MKXH 2WYJA 4M7GA 5A0BA 4AGJA 1L2EA 1SGTA 1PYTC 5I25A 5FAHA 3N7OA 1S5SA 4D7GA 4HZHA 3BTQE 1GBHA 1OYQA 4ZUHA 5B6LA 1YPEH 1N8OB 2Z6BD 1C1PA 1C1SA 1WU1A 2FYQA 2BZAA 1P9UA 1XKBC 2OQ5A 3M5MA 5F8ZA 4WF8A 1BRUP 1AB9B 5BRRE 3U69H 2FOGA 1VGCC 1V2KT 3TJVA 8LPRA 4X6OA 1DSTA 1SFQB 2F9NA 1GWAA 1O5AB 1KXFA 1XKAC 2ZDNA 1GVKB 4MNYA 1T8LA 5EXLA 4NA7A 2Y7ZA 3O8DA 1OS8A 1OWDA 1UK2A 3FANA 2PTNA 2W3KA 3K9XB 4A1TA 2FI3E 1XXFA 1FY5A 2V35A 1TNHA 4NZQA 1BBRE 1D9IA 1DM4B 1ZTKA 2CF9H 1YCPH 1AWHB 3RXDA 2XCFA 3GY8A 1IAUA 1PQAA 3OSYA 1GJCB 1SGIB 2GT7A 4LZ1H 1UHBB 1GBLA 1G30B 1TOMH 3LGVA 2G81E 1K1JA 1QBVH 4JZIA 5AFZH 1O2OA 3RXLA 1EAXA 3M3VA 4X8TH 1EZQA 2B9LA 2FPZA 3NCLA 1WQVH 1RTFB 5DP6A 1OWIA 2PHBA 1O3AA 1EAWA 1LDTT 1V2ST 5H4IB 1SQOA 1TONA 1BOQA 1OP2A 3NWUA 4ZROA 2CN0H 1DWEH 3VGCB 3MU0A 4YO9A 1IHSH 2ODQA 2IJOB 3UPEA 2UWLA 4AFSA 1GJAB 2CXVA 2WPLS 3U8RH 2BMGB 1QRWA 4UE7H 5DK1A 1W2KH 2H1UA 3R0FA 3UOPA 1QB9A 2AMDA 4WH8A 2WV5A 3HGPA 1SOZA 1NFWA 2ZHFH 3PMJA 1Y59T 3ZVGA 1ARCA 4BNRA 2EA3A 3P8OA 1KLJH 4XE4A 1HXFH 3OTJE 1CBWB 1EKBB 3SU6A 4KTSA 2VU8E 1D3DB 1FDPA 4RSPA 4Q7XA 1C5NH 1V2PT 1QB1A 2O8MA 4I8GA 2TGTA 1CHOF 1C1TA 3U98H 1YCPM 2Y81A 4HGCA 1SB1H 1BMNH 1O2NA 3SGAE 4YM9A 4X6MA 1CQQA 3R3GB 2FS8A 1QL7A 5HM9A 1BHXF 1TQ7B 3PROA 3ZZCA 4D8NA 3VB3A 1EOLA 1A0HB 3O8RA 4AFQA 1DUAA 3SQHE 2XC5A 3SJ8A 2VH6A 1G3EA 1LTOA 4BXWA 4AOQA 1A0LA 3VPKA 3L6PA 1FAKH 5BPEA 2AEIH 2VNTA 1GJ9B 2FLBH 3AASA 1MTNB 3GY4A 4GVUA 1JBUH 4X6PA 1ZSJA 4CRCA 1UCYH 1CT0E 1EB1H 1O38A 1C2FA 4YZUA 3UNQA 2OQUA 3ZZ3A 3SU1A 1C2HA 1C1OA 2ALVA 5LGOA 1K1LA 1YLCA 2GMTB 1L1GA 2A2XH 5E8EH 1GBTA 2JETB 1HJ8A 1PPGE 4GSOA 1VCPA 1HFDA 4B73A 4Q7YA 1CHOG 1S0RA 4LXBH 3MO9A 1W12U 2ZC9H 5FHTA 1HGTH 1IQJA 1C5OH 3T28A 2Q6GA 1GL1A 2RG3A 2HGTH 3A7TA 1TX7A 2AIPA 8GCHF 2V3OH 2ZF0H 3SI4H 3BV9B 3GDVA 1O5GH 3RXPA 1YPHE 2TGDA 1A5HA 2Q1JA 1QBNA 1V2NT 4R0IA 4ZKRU 4I33A 1ARBA 4IMZA 1CO7E 4JZ1A 1ZHPA 1AFQC 1NRPH 4DIIH 4Y71A 2SNVA 1C5QA 2BD9A 1E36B 1MD8A 2ZZUH 3OY6U 3UUZA 1ETSH 1XUHA 3F1SB 3S9AA 3QTVH 2ZDVH 1V2MT 1C2DA 2XCNA 1GI3A 1FY1A 1A5IA 2OD3B 4DCDA 1V2RT 3UNRA 3QLPH 1ZMNA 1ZYOA 1D4PB 2BD2A 2OINA 1GJ5H 2VIOA 3ZZ5A 4Q2KA 1D3PB 8GCHG 1GCTB 1RFNA 3BTWE 2ASUB 4INLA 1Y3VA 1O2TA 1UTPA 2PUXB 1MQ6A 1BIOA 5ESBA 1LHCH 2THFB 3M7TA 3MH5A 3MNBA 5E0HA 1Z71A 4OGYA 1YCPK 5CHAB 2ZGJA 2C93B 6CHAB 2PW8H 4NA8A 1THSH 2CV3A 4X6NA 3ZZ7A 3A80A 3BTHE 2ZECA 3IITA 1G9IE 1VITH 3HK3B 1BJVA 4BTIB 1LPZB 1BQYA 2BDYA 3KQBA 3TH3H 2F9OA 3JZ2B 1O3PB 1ZJKA 2Z9JA 1UVPA 2GV7A 3DT0H 2F9UA 4B75A 1O32A 5DP9A 1THRH 4FUEA 1P2JA 2VGCC 4GLYA 1QB6A 1O2JA 4OS5A 1Q3XA 2J4IA 5EXNA 3UTUH 1QJ7B 2ULLA 1O3EA 3HATH 4XBBA 2W3IA 1PQ7A 5EOKA 5A8ZA 1GPZA 3WY8A 2BQWB 5HGGA 5EW1H 2DUCA 5TJXA 1S81A 2Z9KA 3B9FH 2ZHEH 1BTZA 3QO6A 7GCHG 3GY2A 2J95A 2SFAA 2Y5HA 2PKSC 4BAQB 3MU4A 3RXOA 3UY9A 4AFZA 5F03A 1QURH 4Y76A 3KNXA 3MU5A 4LZ4B 2ZDAH 1ELAA 3RC5A 3P70B 1DWBH 2BVSH 3A89A 2JH5D 1DY9A 1Y3XA 4AYVB 5EG4A 1JIRA 4Y79A 2ZPSA 1IQLA 1JMOH 1ZPCA 2QXIA 4XBCA 3ITIA 3ZYDA 1T32A 2ZA5A 1XUIA 1SHYA 3GY6A 1ELTA 1TBQH 5GXPA 4JZFH 2BTCE 2O8TA 1GI0A 1TA6A 2BVRH 5A09A 1QIXB 2HVXA 3MMGA 1A3BH 1GHXH 1Q2WA 3S7KB 2Z3DA 1XX9A 1AN1E 1ORFA 3RM0H 1BMLA 1S6FA 1GHZA 2ZFQH 5FPSA 4MPWA 2Y7XA 1O2VA 1PQ8A 3M7QA 3KIDU 1TPOA 5GJ4B 3PMAB 1E35B 1P0SH 1D6WA 3SNBA 1C5LH 2LNCA 3QWCH 1ZTLA 3ZZAA 1TBRH 1AZ8A 2OP9A 2PLXA 3BTKE 4WXVA 3KL6A 1HUTH 1L4ZA 1GBCA 1OP8A 1ELEE 3MHWU 3TIUA 3HK6B 5B6OA 2KAIA 3RXUA 2BLVA 1T8OA 2FOEA 3DA9B 3LC3A 1T7CA 3K65B 2Z3CA 2XBXA 3DD2H 1GJDB 3TPIZ 2ZDLA 4Y8ZA 3BTME 1H9HE 5DP5A 1GHAG 2H9HA 1DE7H 2A5AA 2GDEH 2ZP0H 2EI7A 1O2ZA 1DFPA 2BY6X 2QGRA 2QAAA 3I78A 4J2YB 4U32A 1GI8B 4FUHA 3A8BA 3C27B 1ELGA 4KELA 1AVGH 1SL3A 1IQNA 2GD4B 3L33A 1RJXB 2AGGX 2BY9X 1NO9H 2TPIZ 1P2MA 2PUQH 1A5GH 1MBMA 1GI9B 2Z9IA 3F9GA 3A86A 2AERH 1F5LA 1ETRH 2HOBA 1SGPE 2G51A 1QNJA 1C1MA 1DLEA 2CJIA 2P8OC 2HPPH 4ISLA 1RRKA 4NIWA 3EA9A 3FZZA 3ZYEA 2B8OH 4JYUH 2YNBA 3DFLA 2B0FA 1UVOA 3RMNH 1LMWB 3ZVDA 3C1KA 3P92A 1C1RA 1GDUA 1NU7B 2FDAA 3GYMA 2BDAA 4OS4A 2GCHG 3SNCA 1B0EA 2A32A 1YPJH 4I7YH 1EX3A 1AE5A 1G3CA 1K9OE 1TOCB 1ANCA 3BEIB 4UDWH 1X7AC 2ZHQH 3LDXH 3P8NA 2FOCA 4DVAU 3QGNB 1TQ0B 4NA9H 4X1SU 2BX4A 3P8GA 3Q76A 1LQEA 5JBBS 2HNTE 1IQFA 2TGPZ 1FI8A 2J92A 3A87A 2FX6A 1O2KA 1AO5A 1BBRK 2FOHA 1QRXA 5JDUB 1GGDC 4NWLA 1G36A 1PFXC 1C2EA 4B6EA 3K6YA 1SHHB 1HLTH 4ZXYH 2Y82A 1ZZZA 4UONA 1EJNA 1KSNA 3QK1A 1TNIA 2QXJA 1F7ZA 2W26A 1ETTH 2J34A 4K69A 2FYRA 4CRDA 2GX4A 1ANBA 1W3CA 1O37A 1AGJA 1SGRE 1ELDE 5DP8A 2TBSA 3MNCA 2SGDE 1ZPZA 2F9BH 1SVPA 3M7UA 1T4VH 1DWCH 3KF2A 1Z1IA 1FUJA 3T62A 1O2LA 1O35A 1M9UA 3GDUA 1BTYA 4BANB 2D2DA 2FEQH 4D9RA 4DY7B 2FWWA 3QZQA 3SHAH 5EPNA 5IYTA 1JWTA 2XC0A 4ESTE 1Y3UA 1HJ9A 4CBNA 1TMBH 2VWOA 2XRCA 1BT7A 3LC5A 5T6FA 3OY5U 5FCKA 2BLWA 2PV9B 3M37A 1MCVA 4K1SA 3BIUH 1YPHC 3EQ0H 2BD4A 3PB1E 2R2WU 4X1NU 1EUFA 1GMDG 2W7SA 1GG6C 1FZZA 2STAE 1GDQA 1CA0B 3FZDA 1DUEA 3VB6A 3EAJA 4K60A 1YLDA 3E0NB 2A7JA 2BLOA 2OC8A 3RDZA 1B5GH 2Q6DA 4B2BA 4YLUA 1HYLA 4FXGH 4XOJA 1AY6H 1BRBE 1F0TA 4FUGA 3SJIA 1SOTA 2VBCA 1ZSLA 3KEEA 3A88A 1OSSA 1C2KA 4DOQA 1T8NA 3F68H 2XBWA 3PO1C 1GBBA 3PWBA 3D23A 2ZTXA 3LH3A 4X2YA 1GMCF 1A1RA 4ZHLU 1IQMA 1MKWK 3BTGE 1FY4A 3BF6H 4BOHA 2OTVA 2F91A 4YT6H 1BTWA 1TMTH 3CS7A 1O2GH 3PWCA 1XUGA 3QX5H 2WV9A 3P8FA 2F9VA 4GHQA 3VXEH 1BB0B 2A0QB 2TIOA 1SGNE 2P3UB 1P05A 1SQTA 2QYIA 6LPRA 1YGCH 3MO3A 2OC1A 1AZZA 2ILNA 1AI8H 2DE9A 3RXQA 3SN8A 1BTUA 5CMXH 3S9CA 1QL9A 2A1DB 5EQRA 2ZFTA 4ZHAA 3TK5A 2BDGA 3LGUA 3RXRA 1FJSA 3K6ZA 2UUKB 1GJBB 1VJAU 4CREA 1BMMH 1O2HA 1OX1A 1C2JA 3T2NA 1O30A 5GNDA 1GMCG 3V13A 2ZQ2A 3GCOA 2VVCA 1J9CH 1TNGA 1DPOA 2XNIA 1K21H 1C9PA 3S0NA 3BG8A 2GP9B 3F6UH 1RIWC 1LKAA 3ZZDA 1NY22 3STIA 3TLOA 1WYKA 1HDTH 3D65E 2PTCE 1W0ZU 2ZGBH 1KDQA 4ABFA 2R3UA 3ZV8A 1NM6A 3SV7A 1O5DH 1CU1A 1NRNH 1JXPA 1KXEA 3UOUA 3A8AA 3LKWA 8ESTE 3V12A 4OS2A 2BVXH 1P11E 1Z8GA 4RN6A 1ABJH 4X8UH 2P93A 1UMAH 2FS9A 1TMUH 4TYDA 1G32B 4BAMB 4IC6A 3EE0B 2BDCA 4AGKA 1O5FH 4WVPE 4DT7B 3BG4C 3QGJA 4INKA 3ZVEA 2ANKH 1DX5M 1HIAB 3A7WA 3M5OA 3CENA 1MTWA 2FTMA 1TBZH 2J38A 1V2OT 1ZRBA 1EJMA 1SLXB 2ZFPH 3MNSA 4GUXA 1QGFA 1RD3B 4ABAA 3E0PB 3S9BA 2K1QA 3RXFA 2BXUH 1C9TA 1BCUH 3L3TA 1BITA 4ISIH 1G3BA 1J16A 1EP6A 1FPHH 1LQDB 4HTCH 2HLCA 3SO3A 1V2QT 2B7DH 3PLKA 3UNSA 2WUBA 4Y10E 3Q00A 5FPYA 1YPKH 4LK4A 3RU4E 5L2ZH 4NG9H 3NUMA 2VWMA 2GZ9A 2A4OA 5ABWA 4QT8C 4Z6AH 3RM2H 4ZKSU 3BN9A 7ESTE 1SGYE 1UVTH 3ZZ8A 4CHAB 2PGBB 2PSYA 1H9LB 1MUEB 1N6YA 1CVWH 1HAPH 2AGIX 2I6SA 4SGBE 1KTTB 3UIRA 1ZMJA 4HI3A 5C5OA 2P3FH 1CA8B 2QXHA 2VWNA 4NIXA 1E38B 3OX7U 2GVFA 1P3EA 3SZNA 4A7IB 1GI5A 2QIQA 3SU5A 1LO6A 3S7HB 4CH8B 1TGCA 3U8TH 1N8OC 6GCHF 5A0CA 1A61H 1W7XH 1PPCE 1WV7H 4MVNA 1HAVB 2J2UA 2PGQB 3TGIE 3T25A 1AB9C 2F4LA 4TY6A 4A1VA 3LGYA 1C1QA 1LHGH 2FOBA 3SU0A 1H4WA 2VH0A 1P3CA 4AN7A 1F0UA 2FESH 1N6XA 1H9IE 1HRTH 4THNH 4U30A 1AVXA 4ABEA 1HBTH 2UWPA 3F9HA 2GTBA 2P16A 3LPRA 3TJNA 4UFFH 2AMQA 5E0GA 3SUEA 1PPEE 5L2YH 1JIMA 1Y5UT 4Y0YE 3ZZBA 1LVBA 1GI6A 5HMAA 2AMPA 5E2PA 5EODA 4BTUB 2GCTB 3E6PH 2RDLA 4X2VA 1TLDA 4CBOA 2G8TA 2YOLA 4MPVA 1UTKA 1WCZA 3A84A 2A7CA 2EI6A 3S69A 5DKMA 1A46H 1ESTA 1S85A 1TIOA 2QXGA 6GCHG 1P8VC 2BQ7B 4X8SH 3KQCA 1EJAA 5T6GA 4JYVH 2ZIQH 1SPJA 1YPMH 7GCHF 2ANMH 5LPEA 1CHGA 2KAIB 1C2MA 5JBAS 4OM9A 1WAYB 2FIRH 3ELAH 2Z9GA 1UJ1A 3RMLH 1Y8TA 4CR9A 1NC6A 3BTEE 1O5BB 3HPTB 1EQ9A 2HPQH 1LHDH 3M35A 3VGCC 2Q6FA 1BBRH 3T29A 4MNWA 4FVDA 1CT2E 3SYJA 4NZLA 4DIHH 1C5SA 2WPJS 1TALA 1LHEH 1O3KA 3QN7A 1TE0A 2R3YA 2ZTZA 2SGAA 2ZFFH 1BZXE 5TCAA 1ELCA 1XVMA 2R2MB 4TWWA 5EXMA 5FPTA 1HJAB 1NFXA 1D3TB 2EEKA 4X1QU 1V2TT 4DJZB 4BAHB 3RLWH 3B8JA 2XXLA 1CBWC 3PTNA 3A8DA 2HNTF 1NRRH 2XWAA 4Y7AA 5GDSH 4RI0A 4I32A 5GPIB 2G4UA 4AG2A 2FLRH 3RU4D 1ZPBA 1MCTA 5AVDA 1SLUB 4A1XA 2BM2A 1C5ZB 4IW4E 1BTHH 3D62A 5EGMA 3LT3A 4O03A 3AK5A 1RTLA 1CGJE 1QL8A 1F92A 5C1YA 1TPSA 2EI8A 2UUFB 3SORA 2FM2A 1K1NA 4O9VA 1OWHA 1C5UA 2SGEE 2M5TA 1EPTB 2V3HH 2ZHDA 1HCGA 4NIVA 2BY8X 2VIDA 1SGFG 1NESE 2XBYA 1GMHF 3A7YA 5J4QA 2WYGA 1MTNC 2P94A 2BDBA 2ESTE 3HKJB 1YM0A 4K3JA 1GHAF 1B7XB 1O5CB 1WSSH 5K7RA 2BLQA 1TRMA 2EC9H 1YP9A 3DHKH 1TRYA 1O0DH 2CHAB 1O3BA 2GMTC 1Y3WA 2BY5X 3GCNA 1EOJA 4GHTA 2JETC 4IGDA 5J4SA 1ZLRA 1K1PA 2AH4X 4AB9A 1TGBA 4B74A 4E7NA 2VJ1A 1IQKA 2GT8A 2R0KA 2ZCKP 1XUFA 1VCWA 1O3MA 2JH0D 1ELVA 2H5DA 1FNIA 3A82A 3SW2B 2BXTH 1K22H 2G55A 1BRAA 2R9PA 2FODA 5LPRA 1EAUA 1IQEA 1LVMA 1V3XA 1ZGVA 1TFXA 2F3CE 1P10A 4H4FA 4YESB 3MH6A 4PROA 3TGJE 2LPRA 4MNXA 2C8WB 2TRMA 3SUDA 3E3TA 4OGXA 4FUCA 5EW2H 5T3HA 3RXEA 2WUCA 1MKWH 2W5EA 1SGCA 3RXGA 4FUIA 3SQEE 1GMHG 1Y5AT 2P95A 1C5MD 1C1VH 1OYTH 3LOXA 2VIQA 2GV6A 5T1VA 4ZH8A 1P57B 2GCHF 1TNLA 3GY3A 4OS1A 2Z9LA 2ZCLP 7KMEH 2HWLB 3G01A 3H5CB 4FU8A 3TGKE 3SU3A 4MPUA 2ZGCA 3RC4A 1NN6A 4FUFA 1O36A 5L6NH 2HALA 3GCHB 1FV9A 1SGEE 1IQGA 4K2YA 2ALPA 3ATWA 4ASHA 1K1OA 1GBDA 3H09A 1BDAA 3RMMH 1FQ3A 1GCTC 1UTMA 1EZUC 1EZSC 3MFJA 1Z1JA 1DXWA 4H6SB 4X2XA 2SNWA 4ABHA 1GI4A 2ANYA 5CHAC 4GPGA 2CMYA 3V3MA 4H6TA 6CHAC 5C1UA 2XWBI 3BIVH 1BJUA 4SGAE 1YC0A 1MZDA 4AX9H 1F2SE 2ZI2H 3HKIB 4K8BA 3W94A 4XBDA 2A2QH 4NFEA 4ABIA 1NZQH 1P03A 1O2MA 2A7HA 1DOJA 1O34A 1BTXA 1UO6A 2CGAA 4M9FA 2A4RA 4IN1A 1TX6A 4E7RG 1XUKA 1HJAC 2AGEX 2H9TH 4CRFA 5AFYH 4ABBA 1C4U2 2FMJA 4RKJB 1UTOA 3MO6A 2OCVB 1W14U 5EQSA 4GCHF 3IG6B 1GVZA 2ZEBA 2ZU5A 2HRVA 3FAOA 1QA7A 3A83A 1IHTH 2RA3A 4E06H 5TCCA 1THPB 1AQ7A 1SI5H 4LOYH 1MQ5A 1O2SA 1OPHB 3MWIU 3TH4H 2C4FH 4KKDA 1TAWA 2VIPA 3LH1A 4K5ZA 1GMDF 3AW1A 4U2WA 4R8TB 1YKTA 4ABDA 1O2IA 2ZFSA 3MTYA 2ODPA 2QY0B 1CGHA 1GHYH 5HM2A 1EPTC 1TWXB 2W7UA 4DG4A 3PM3A 1MTVA 3URCA 2D1JA 2Y6TA 2NWNA 1GI1A 1YYY1 2WINI 1SMFE 2SGQE 3ODFA 1AE8H 5JB9S 4OS7A 1C2GA 3RXCA 2H9EH 3KQEA 1BMAA 1XUJA 1QBOA 1Y5BT 3DFJA 4UD9H 3SHCH 2H5CA 3A81A 3PYHA 1Z7KA 4X8VH 1KDQB 4IBLH 1FN6A 1CSOE 4D9QA 4GCHG 4VGCB 2G4TA 1U6QA 3VB5A 3TJOA 3P95A 4ISNA 3QUMP 2ODYB 3UWJH 3F9FA 3RMOH 1UCYE 4X0WU 3QTOH 2OC7A 3TH2H 3ENSB 1C2IA 2P59A 4YOGA 3LONA 2QF0A 1O3GA 1YPLH 2V6NA 2VWLA 3GY5A 2FXRA 2YNAA 3D49H 1ANEA 3CS0A 5DPAA 4WMEA 4UFDH 5A2MH 2D26C 3P17H 1QFKH 2D8WA 2ZGXH 3BTTE 1P2KA 2C8YB 2FZZA 1UK4A 3EA8A 3M36A 3TVJB 5AF9H 1A0JA 3A8CA 2XW9A 4X1RU 4D76A 4B6FA 4IC5A 1P2QA 4B71A 2PKAA 3GYLB 2IN2A 3PTBA 4AG1A 2A5KA 5G4BA 1UTQA 2JKHA 4Q7ZA 3GOVB 1GCDA 2Z7FE 4XDEA 3RP2A 5JB8S 4JCNA 2PFEA 4ISHH 1AU8A 2Y5GA 1E34B 1OOKB 1WUNH 3SNEA 2ANWA 2GDDA 1GHBG 4NGAH 1NPMA 4XFQA 3TK6A 2GZ8A 2F9PA 1C1WH 3ZVCA 2BOKA 3SU4A 6ESTA 1SSXA 1FLEE 4TPIZ 2ZKSA 2AYWA 4FVBA 3MH4A 2WPHS 1S84A 4Y0ZE 1ELBA 3BTFE 1VR1H 1GI7B 1P2OA 1GJ6A 1SQAA 1GI2A 1LKBA 2G52A 1FPCH 5FXLA 1KXAA 2VIVA 1GVLA 1QTFA 4AZ2B 4UFEH 4XSKU 3SNDA 1HV7A 5EU8A 5FBEA 1A4WH 2GKVE 2OK5A 4NSYA 2WPMS 5DJ7A 2ZCHP 3SGQE 1KY9A 1AFQB 4NFFA 1F0RA 9ESTA 1AKSA 2RA0A 2GGVB 4ZXXH 2OUAA 4WWYA 3KN2A 5E0JA 1DLKB 3M3SA 1FIZA 1NTPA 7LPRA 1P04A 2ZNKH 3Q3YA 4CR5A 1AWFH 2UUJB 1TABE 1W7GH 1GJ7B 3UFAA 1L1JA 4K8YA 2I6QA 3A7ZA 1TNJA 1HAYB 1V2UT 3ATIA 2WZQA 4H42U 4JK5A 3RU4T 4A92A 1GBIA 2VINA 1WQSA 2B5TB 1TX8A 4U01A 2OBQA 5JBCS 1UVUH 1H8DH 1ZR0A 2UWOA 2ZU2A 1OXGA 5C2ZA 3E1XB 1CE5A 1ZTJA 1A7SA 1C5RA 3KGPA 1KXBA 3AAUA 1KLIH 1C1NA 2F83A 3RXMA 3F9EA 1MU8B 1KYNA 1J14A 2BX3A 2A5IA 2STBE 3BSQA 4FU9A 1V2LT 5JYIA 2WPIS 1VJ9U 4DGJA 1YF4A 1DITH 3SV6A 2AS9A 5GWZA 1C5WB 1P9SA 3B23B 2FOAA 3A7VA 3NKKA 3KHVA 5DP3A 1ZSKA 1QR3E 3SJOA 2VGCB 1AUJA 4J1YA 4HFPB 3TITA 4Y11E 4MTBA 1PPBH 2FI5E 4CRAA 4VGCC 4X1PU 2GZ7A 4O3TA 4YT7H 3H7OA 3LGIA 2XYAA 4IMQA 1SGQE 3MNXA 3EA7A 1OWEA 2VVUA 1ABIH 3UQOA 1QJ1B 3SBKA 1PPHE 4B2CA 3SU2A 3MOCA 1GJ8B 2FTLE 1C4Y2 1O2QA 5FX5A 2VVVA 1NRQH 3Q77A 1ZRKA 2XTTB 2PKSB 1CA0C 4JMYA 1FMGA 1NU9A 3ZVAA 4YOJA 1Q31A 3NXPA 3RXKA 4Q80A 1HB0B 3U1JB 3ZV9A 2R0LA 1C5TA 3UQVA 1GBFA 2XBVA 3FFGA 1TPAE 3FP6E 3VFEA 1ZJDA 1SGDE 1NFYA 3H7TA 3SV8A 5LPFA 1ZOMA 3QZRA 2FX4A 5C3NA 5C67A 1RGQA 3AAVA 3PV2A
chains in the Genus database with same CATH superfamily
4RKOB 1QQ4A 4MNVA 1DS2E 2BOHB 1PPFE 3SV9A 1EASA 5DP7A 1ID5H 1SGFA 3NZIA 4FUBA 2BYAX 9LPRA 1K2I1 1RTKA 3LJOA 3ZZ4A 1JOUB 1KTSB 3FP7E 1O3FA 1OP0A 4I31A 1QQUA 1OWJA 5EPYA 2QN5T 1A2CH 1W8BH 2SGPE 1JRTA 3F2HA 1GBEA 2J98B 1UHBA 5F8TA 5IDKA 1A3EH 1DANH 1YPGH 3SI3H 1EZXC 5FCRA 1W13U 3ATLA 3M3TA 2RCEA 3T27A 2PR3A 2BD7A 1TB6H 4E05H 1MAXA 5E2OA 1W11U 2H6MA 3RXBA 3OEED 1HNEE 4UEHH 1B0FA 1SR5C 3VEQB 3NK8A 3LIWA 4CH2B 3HGNA 4MPXA 1V2WT 2HVYB 4FUDA 1F0SA 1NS3A 1MKXK 3OTPA 1E0FD 4WY3A 3SUFA 1JRSA 4TY7A 8KME2 1O2XA 3GY7A 3Q3XA 5DP4A 3TNTA 1SC8U 3OU0A 3BEUA 5JPMH 2HNTC 1QA0A 2PSXA 1GBKA 3TU7H 1C5VA 4BAKB 1P2IA 4IN2A 2BY7X 2VIWA 3TK9A 1QJ6B 2AIQA 4TPYA 1J8AA 1NFUA 3RXVA 3GDSA 3GICB 1TNKA 4AORA 3Q3KA 1O2PA 1L0ZA 3NPSA 2KM0A 1K28D 1WTHD 2ZU3A 4NWKA 5EJZA 3ZVFA 1KXDA 5T6DA 3LJJA 1D6RA 1SFIA 1QRZA 1O39A 1O5EH 3LGTA 2BHGA 1PQ5A 3QDZB 1C4V2 1LPGB 1Z6JH 4MG3A 3VG8A 3RUOA 1HIAA 2KCPA 2BQ6B 1PPZA 1TA2A 1GDNA 2FP7B 2P8OB 2NU1E 4ASUD 2BD5A 4GAWA 4KTCA 2O8WA 1BUIA 1HPGA 5HYOA 1AHTH 3EDXB 2O8LA 5L30H 3MU1A 4IS5A 1LPKB 1F5KU 2CF8H 2XC4A 1QCPA 1O3OA 2ZG0H 5FBIA 1GHWH 1ZHMA 2PWXA 1W0YH 2WPKS 1LVYA 4AFUA 2QCYA 5EQQA 1MU6B 4CRGA 1QY6A 1O3JA 2KCYA 4JK6A 2C90B 1HAZB 2YMSB 1NROH 3M5NA 2ZTYA 4Y7BA 4XRNA 1UTNA 2ZPQA 3SUGA 3W95A 1ACBE 1V2JT 3E91A 1GHVH 1OKXA 1GGDB 1MTUA 1SLWB 2FO9A 3LU9B 4O3UA 3VXFH 3OYPA 5C1XA 1FN8A 5HXFA 1HAGE 2Z94A 1EXFA 2BZ6H 1CT4E 1ZGIA 1P2NA 3SJ9A 4FOUC 3E8LA 3A7XA 2OC0A 5CE1A 3P6ZB 1FX0B 3I29A 1MMJN 3MH7A 4CHAC 1ZHRA 2Z3EA 3ZVBA 1P12E 1H8IH 1TYNA 3RXSA 1ANDA 3RLYH 1H1BA 1LVOA 3FVFB 3A85A 2C3SA 1KXCA 1HAVA 4KGAA 1DDJA 3OAAD 4BTTB 5A8XA 3ESTA 1GL0E 4FU7A 1TRNA 2ZPRA 1GJ4H 1Z8JB 2ZHWH 4I8LA 2NU4E 3UAIC 1WBGB 3GISB 1TGTA 1AD8H 3PLBA 4INHA 5GCHF 4ABJA 1ESAA 4ZHMU 3CP7A 4ZMAH 1MD7A 1Z8IB 1OWKA 4WMFA 1UTJA 3PV4A 5PTPA 1RXPA 3U8OH 4B2AA 5AHGH 3MI4A 5FX6A 3STJA 1N1LA 2C8ZB 1BTPA 2G00A 2QA9E 2WHXA 1BMFD 1C2LA 2M2AA 1AMHA 1EAIA 1ELFA 5SGAE 2O8UA 1EATA 3E90B 3MYWA 2BDHA 2G5VA 2BD3A 4TWYA 4F55A 1UCYK 4WH6A 1O3CA 2V7QD 3RXIA 3SNAA 3RC6A 3KQDA 1GG6B 4WMDA 1AFEH 5C5NA 1MAYA 2UUYA 4ZCNA 1L1NA 3ODDA 1O2YA 1GBMA 4DW2U 2VB0A 3RXHA 2NU3E 1UTLM 3EGKH 5DGJA 4MLFB 1O2UA 1MZAA 2GCTC 2ZWLH 1P02A 2A4QA 1TPPA 4AYYB 1O3NA 1S0QA 5EJ1A 4DURA 4F4OC 3PMBB 3ZIAD 1O3DA 1XVOA 4UFGH 4ZAEA 1FY8E 4X2WA 4ISOA 2ZQ1A 5C20A 3RXAA 1PYTD 5GCHG 1AIXH 3PV5A 4JZDH 2J5UA 1D3QB 2G5NA 3PO1B 3GCTF 1BRCE 4I8KA 3O8CA 5JBTA 1PJPA 1T4UH 3PLPA 3M5LA 3IWMA 4A6LA 3JZ1B 1C5YB 1O33A 3O8BA 4B76A 1EB2A 2QF3A 4OS6A 4ZKOU 4K1TA 5DG6A 4JYTA 1K1MA 1IQHA 5A8YA 3M61U 1WTGH 2DE8A 2J9NA 3RXJA 4I8HA 4ZKNU 1IQIA 1O31A 2PKAB 3K2UA 2P3TB 1FONA 1SBWA 1VGCB 1YBWA 2OXSA 2BB4A 4A5TS 5F8XA 4JZEH 2A45B 2ZU1A 1INCA 2ZFRH 4MQAA 1BA8B 1VCQA 1RS0A 1XMNB 1E1RD 3SV2H 1COWD 1MBQA 4NSVA 2QC2A 1GBAA 2KFWA 2FOFA 1WXRA 4KTUA 3BTDE 1K1IA 5DO4H 1HAXB 1KLTA 1WOFA 3BEFB 2ZO3H 5A0AE 3MU8A 1FY3A 3SZEA 1FAXA 3URDA 1EPTA 1V2VT 3GCTG 2OBOA 1VITF 1P01A 1DT2A 1UVSH 3PMHB 4NIYA 2SGFE 1J17T 2A31A 1V6DA 4O97A 1LHFH 4K1EA 1F5RA 1RIWB 3VB4A 4D7FA 1GBJA 4YLQH 3KCGH 1HAHH 1S6HA 2CK3D 2FI4E 2TGAA 1DY8A 3DUXH 1BHXB 1HAOH 1E37B 3ATMA 2FOMB 1FIWA 2Y5FA 4BXSA 5ETXA 2H2ZA 1O2WA 2NU2E 1ESBA 3ZZ6A 4ABGA 3SJKA 1DSUA 1AKSB 1HXEH 1O3IA 2QV1A 2A4GA 3VB7A 4Y8YA 3UWIA 3WWFA 2KCAA 1XM1A 2NU0E 2ZDKA 1KIGH 1LCYA 1P09A 3UB0A 1WDIA 2ZGHA 1CGIE 4F49A 1Z8RA 3RXTA 2BD8A 1DWDH 1G2MA 2CHAC 5F6MA 1Y3YA 3BG4B 1GHBF 1G37A 1VITG 2J94A 2ZDMA 1O2RA 4YTAA 4AB8A 5LH8A 3ZZ9A 1IOEA 1O3HA 1S83A 2O9QA 3TJUA 4Y6DA 1TGSZ 1Z6EA 5CDFE 3FP8E 4CRBA 4WJG2 1FXYA 1QHRB 1TGNA 1P06A 1DVAH 3TNSA 1C1UH 4BAOB 4P02A 1T31A 2OLGA 5GIBA 1MTSA 1G2LA 3T5FH 1O3LA 2IJD1 1AUTC 4MDSA 1S82A 3OE7D 3UR6A 2BDIA 1VZQH 1AVWA 1HAIH 1DICA 3WW7A 1UK3A 1T8MA 2C8XB 2ZU4A 4Z0KA 3I77A 3EYDA 1ZMLA 1DXPA 3T26A 3U1IB 3U9AH 1SLVB 4TSFD 5ESTE 4YOIA 2WV4A 3AW0A 1C5PA 4I8JA 2IPHA 2V0BA 3N7EA 1NRSH 3E16B 4KP0A 4Y8XA 3V7TA 1W10U 3SOSA 1L4DA 2Y80A 5I46H 1NT1A 2AFQB 4B1TA 1C5XB 1XXDA 3GCHC 3LGWA 2IOTA 4FUJA 3SGBE 1G3DA 3AVZA 3V0XA 2LP6A 3UR9A 4WXIA 3UREA 1SQRA 1EP5A 1SG8B 2JH6D 5K0HA 4NCYA 3ATKA 1MH0A 1J15A 1MKXH 2WYJA 4M7GA 5A0BA 4AGJA 1L2EA 1SGTA 1PYTC 5I25A 5FAHA 3N7OA 1S5SA 4D7GA 4HZHA 3BTQE 1GBHA 1OYQA 4ZUHA 1S6LA 5B6LA 1YPEH 1N8OB 2Z6BD 1C1PA 1C1SA 1WU1A 2FYQA 2BZAA 1P9UA 1XKBC 2OQ5A 3M5MA 5F8ZA 4WF8A 1BRUP 1AB9B 5BRRE 3U69H 2FOGA 5C94A 1VGCC 1V2KT 3TJVA 8LPRA 4X6OA 1DSTA 1SFQB 2F9NA 1GWAA 1O5AB 1KXFA 1XKAC 2ZDNA 1GVKB 4MNYA 1T8LA 5EXLA 4NA7A 2Y7ZA 4ACAA 3O8DA 1OS8A 1OWDA 1UK2A 3FANA 2PTNA 2W3KA 1OHHD 3K9XB 4A1TA 2FI3E 1XXFA 1FY5A 2V35A 1TNHA 4NZQA 1BBRE 1D9IA 1DM4B 1ZTKA 2CF9H 1YCPH 1AWHB 3RXDA 2XCFA 3GY8A 1IAUA 1PQAA 3OSYA 1GJCB 1SGIB 2GT7A 4LZ1H 1UHBB 1GBLA 1G30B 1TOMH 3LGVA 2G81E 1K1JA 1QBVH 4JZIA 5AFZH 1O2OA 3RXLA 1EAXA 3M3VA 4X8TH 2F43B 1EZQA 2B9LA 2FPZA 3NCLA 1WQVH 1RTFB 5DP6A 1OWIA 2PHBA 4FETA 1O3AA 1EAWA 1LDTT 1V2ST 5H4IB 1SQOA 1TONA 1BOQA 1OP2A 3NWUA 4ZROA 2CN0H 1DWEH 1E1QD 2GJGA 3VGCB 3MU0A 4YO9A 1IHSH 2L74A 2ODQA 2IJOB 3UPEA 2UWLA 4AFSA 1GJAB 2CXVA 2WPLS 3U8RH 2BMGB 1QRWA 4UE7H 5DK1A 1W2KH 2H1UA 3R0FA 3UOPA 1QB9A 2AMDA 4WH8A 2WV5A 3HGPA 1SOZA 1NFWA 2ZHFH 3PMJA 1Y59T 3ZVGA 1ARCA 4BNRA 2EA3A 3P8OA 1KLJH 4XE4A 1HXFH 3OTJE 1CBWB 1EKBB 3SU6A 4KTSA 2VU8E 1D3DB 1FDPA 4RSPA 4Q7XA 1C5NH 1V2PT 1QB1A 2O8MA 4I8GA 2TGTA 1CHOF 1C1TA 3U98H 1YCPM 2Y81A 2JJ1D 4HGCA 1SB1H 1BMNH 1O2NA 3SGAE 4YM9A 4X6MA 1H8HD 1CQQA 3R3GB 2FS8A 1QL7A 5HM9A 1BHXF 1TQ7B 3PROA 3ZZCA 4D8NA 3VB3A 1EOLA 1A0HB 3O8RA 4AFQA 1DUAA 3SQHE 2XC5A 3SJ8A 2VH6A 1G3EA 1LTOA 4BXWA 4AOQA 1A0LA 3VPKA 3L6PA 1FAKH 5BPEA 2AEIH 2VNTA 1GJ9B 2FLBH 3AASA 1MTNB 3GY4A 4GVUA 1JBUH 4X6PA 1ZSJA 4CRCA 1UCYH 1CT0E 1EB1H 1O38A 1C2FA 4YZUA 3UNQA 2OQUA 3ZZ3A 3SU1A 1C2HA 1C1OA 2ALVA 5LGOA 2KR7A 1K1LA 1YLCA 2GMTB 1L1GA 5IK2D 2A2XH 5E8EH 1GBTA 2JETB 1HJ8A 1PPGE 4GSOA 1VCPA 1HFDA 2EQNA 2W6JD 4B73A 4Q7YA 5C0TA 1CHOG 1S0RA 4LXBH 3MO9A 1W12U 2ZC9H 5FHTA 3NRLA 1HGTH 1IQJA 1C5OH 3T28A 2Q6GA 1GL1A 2RG3A 2HGTH 3A7TA 1TX7A 2AIPA 8GCHF 2V3OH 2ZF0H 3SI4H 3BV9B 3GDVA 1O5GH 3RXPA 1YPHE 2TGDA 5C17A 1A5HA 2Q1JA 1QBNA 1V2NT 2L6OA 4R0IA 4ZKRU 4I33A 1ARBA 4IMZA 2LELA 1CO7E 4JZ1A 1ZHPA 1AFQC 1NRPH 4DIIH 4Y71A 2SNVA 1C5QA 2BD9A 1E36B 1MD8A 2ZZUH 3OY6U 3UUZA 1ETSH 1XUHA 3F1SB 3S9AA 3QTVH 2ZDVH 1V2MT 1C2DA 2XCNA 1GI3A 1FY1A 1A5IA 2OD3B 4DCDA 1V2RT 3UNRA 3QLPH 1ZMNA 1ZYOA 1D4PB 2BD2A 2OINA 1GJ5H 2VIOA 3ZZ5A 4Q2KA 4Q63A 1D3PB 8GCHG 1GCTB 1RFNA 3BTWE 2ASUB 4INLA 1Y3VA 1O2TA 1UTPA 2PUXB 1MQ6A 1BIOA 5ESBA 1LHCH 2THFB 3M7TA 3MH5A 4I86A 3MNBA 5E0HA 1Z71A 4OGYA 1YCPK 5CHAB 2ZGJA 5KECA 2C93B 6CHAB 2PW8H 4NA8A 1THSH 2CV3A 4X6NA 3ZZ7A 3A80A 3BTHE 2ZECA 3IITA 5F53A 1G9IE 1VITH 3HK3B 1BJVA 4BTIB 1LPZB 1BQYA 2BDYA 2KCOA 3KQBA 3TH3H 2F9OA 3JZ2B 1EFRD 1O3PB 1ZJKA 2Z9JA 1UVPA 2GV7A 3DT0H 2F9UA 4B75A 2YMSD 1O32A 5DP9A 1THRH 4FUEA 1P2JA 2VGCC 4GLYA 1QB6A 1O2JA 4OS5A 5KEDA 1Q3XA 2J4IA 5EXNA 3UTUH 1QJ7B 2ULLA 1NBME 1O3EA 3HATH 4XBBA 2W3IA 2RDEA 4DT4A 1PQ7A 5EOKA 5A8ZA 3OEHD 1GPZA 3WY8A 2BQWB 5HGGA 5EW1H 2DUCA 5TJXA 1S81A 2Z9KA 3B9FH 2ZHEH 1BTZA 3QO6A 7GCHG 3GY2A 2J95A 2SFAA 2Y5HA 2PKSC 4BAQB 3MU4A 3RXOA 3UY9A 4AFZA 5F03A 1QURH 4Y76A 3KNXA 3MU5A 4LZ4B 1YLNA 2ZDAH 1ELAA 3RC5A 3P70B 1DWBH 2BVSH 3A89A 2JH5D 1DY9A 1Y3XA 2KX4A 4AYVB 1H8ED 5EG4A 1JIRA 4Y79A 2ZPSA 1IQLA 1JMOH 1ZPCA 2QXIA 4XBCA 3ITIA 3ZYDA 1T32A 2ZA5A 1XUIA 1SHYA 3GY6A 4HG6A 1ELTA 1TBQH 5GXPA 4JZFH 2BTCE 2O8TA 2KZ4A 1GI0A 1TA6A 2BVRH 5A09A 1QIXB 2HVXA 3MMGA 1A3BH 1GHXH 1Q2WA 3S7KB 2Z3DA 1XX9A 1AN1E 1ORFA 3RM0H 1BMLA 1S6FA 1GHZA 2ZFQH 5FPSA 4MPWA 2Y7XA 1O2VA 1PQ8A 3M7QA 3KIDU 1TPOA 5GJ4B 3PMAB 1E35B 1P0SH 1D6WA 3SNBA 1C5LH 2LNCA 3QWCH 1ZTLA 3ZZAA 1TBRH 1AZ8A 2OP9A 2PLXA 3BTKE 3KQ5A 4WXVA 3KL6A 1HUTH 1L4ZA 1GBCA 1OP8A 1ELEE 3MHWU 3TIUA 3HK6B 5B6OA 2KAIA 3RXUA 2BLVA 1T8OA 2FOEA 3DA9B 3LC3A 1YWUA 1T7CA 3K65B 2Z3CA 2XBXA 3DD2H 1GJDB 3TPIZ 2ZDLA 4Y8ZA 3BTME 1H9HE 5DP5A 1GHAG 2H9HA 1DE7H 2A5AA 2GDEH 2ZP0H 2EI7A 1O2ZA 1DFPA 2BY6X 2QGRA 2QAAA 3F3BA 3I78A 4J2YB 4U32A 1GI8B 4FUHA 3A8BA 3C27B 1ELGA 4KELA 1AVGH 1SL3A 1IQNA 2GD4B 3L33A 1RJXB 2AGGX 2BY9X 1NO9H 2TPIZ 1P2MA 2PUQH 1A5GH 1MBMA 3N7DA 1GI9B 1KMHB 2Z9IA 1UW7A 3F9GA 3A86A 2AERH 1F5LA 1ETRH 2HOBA 1SGPE 2G51A 1QNJA 1C1MA 1DLEA 3OFND 2CJIA 2P8OC 2HPPH 4ISLA 1RRKA 4NIWA 3EA9A 3FZZA 3ZYEA 4ACBA 2B8OH 4JYUH 2YNBA 3DFLA 2B0FA 1UVOA 3RMNH 1LMWB 3ZVDA 3C1KA 3P92A 1C1RA 1GDUA 1NU7B 2FDAA 3GYMA 2BDAA 4OS4A 2GCHG 3SNCA 1B0EA 2A32A 1YPJH 4I7YH 1EX3A 1AE5A 1G3CA 1K9OE 1TOCB 1ANCA 2XNDD 3BEIB 1X7AC 2ZHQH 3DCLA 3LDXH 4UDWH 3P8NA 2FOCA 4DVAU 3QGNB 2J97A 1TQ0B 4NA9H 4X1SU 2BX4A 3P8GA 3Q76A 1LQEA 5JBBS 2HNTE 3F0PA 1IQFA 2TGPZ 2YMSC 1FI8A 2J92A 3A87A 2FX6A 1O2KA 1AO5A 1BBRK 2FOHA 1QRXA 5JDUB 1GGDC 4NWLA 1G36A 1PFXC 1C2EA 4B6EA 3K6YA 1SHHB 1HLTH 4ZXYH 2Y82A 1ZZZA 5HIZA 4UONA 1EJNA 1KSNA 2JIZD 3QK1A 1TNIA 2QXJA 1F7ZA 2W26A 3DSGA 1ETTH 2J34A 4K69A 2FYRA 4CRDA 2GX4A 1ANBA 1W3CA 1O37A 1AGJA 1SGRE 1ELDE 5DP8A 2TBSA 3MNCA 2SGDE 1ZPZA 2F9BH 1SVPA 3M7UA 1T4VH 2QF4A 1DWCH 3KF2A 1Z1IA 1FUJA 3T62A 1O2LA 1O35A 1M9UA 3GDUA 1BTYA 4BANB 2D2DA 2FEQH 4D9RA 4DY7B 2FWWA 3QZQA 3SHAH 5EPNA 5IYTA 1JWTA 2XC0A 4ESTE 1Y3UA 1HJ9A 4CBNA 4Z1MD 1TMBH 2VWOA 2XRCA 1BT7A 3LC5A 5T6FA 3OY5U 5FCKA 2BLWA 2PV9B 3M37A 1MCVA 4K1SA 3BIUH 1YPHC 2IPQX 3EQ0H 2BD4A 3PB1E 2R2WU 4X1NU 1EUFA 2QE7D 1GMDG 4Q4LA 1GG6C 2W7SA 1FZZA 2STAE 1GDQA 2RFKC 1CA0B 3FZDA 1DUEA 3VB6A 3EAJA 4K60A 1YLDA 3E0NB 2A7JA 1QZ8A 2BLOA 2OC8A 3RDZA 3EE7A 1B5GH 2Q6DA 4B2BA 4YLUA 1HYLA 4FXGH 4XOJA 1AY6H 1BRBE 1F0TA 4FUGA 3SJIA 1SOTA 2VBCA 1ZSLA 3KEEA 3A88A 1OSSA 1C2KA 4DOQA 1T8NA 3F68H 2XBWA 3PO1C 1GBBA 3PWBA 3D23A 2ZTXA 3LH3A 4X2YA 1GMCF 1A1RA 3F2GA 4ZHLU 1IQMA 1MKWK 3BTGE 1FY4A 3BF6H 4BOHA 2OTVA 2K0QA 2F91A 4YT6H 1BTWA 1TMTH 3CS7A 1O2GH 3PWCA 1XUGA 3QX5H 2WV9A 3P8FA 2F9VA 4GHQA 3VXEH 1BB0B 2A0QB 2TIOA 1SGNE 1K0HA 2P3UB 1P05A 1SQTA 2QYIA 6LPRA 1YGCH 3MO3A 2OC1A 1AZZA 2ILNA 1AI8H 2DE9A 3RXQA 3SN8A 1BTUA 5CMXH 3DSOA 3S9CA 1QL9A 2A1DB 5EQRA 2ZFTA 4ZHAA 3TK5A 2BDGA 3LGUA 3RXRA 1FJSA 3K6ZA 2UUKB 1GJBB 1VJAU 4CREA 1BMMH 1O2HA 1OX1A 1C2JA 3T2NA 1E79D 1O30A 5GNDA 3FKSD 1GMCG 3V13A 2ZQ2A 3GCOA 2VVCA 1J9CH 1TNGA 1DPOA 2XNIA 1K21H 1C9PA 3S0NA 3BG8A 2GP9B 3F6UH 1RIWC 1LKAA 3ZZDA 1NY22 3STIA 3TLOA 1WYKA 1HDTH 3D65E 2PTCE 1W0ZU 2ZGBH 1KDQA 4ABFA 2R3UA 3ZV8A 1NM6A 3SV7A 1O5DH 1CU1A 1NRNH 1JXPA 2HLDD 1KXEA 3UOUA 3A8AA 3LKWA 8ESTE 3V12A 4OS2A 2BVXH 1P11E 1Z8GA 4RN6A 1ABJH 4X8UH 2P93A 1UMAH 2FS9A 1TMUH 4TYDA 1G32B 4BAMB 4IC6A 3EE0B 2BDCA 4AGKA 1O5FH 4WVPE 4DT7B 3BG4C 3QGJA 5EIYA 4INKA 3ZVEA 2ANKH 1DX5M 1HIAB 3A7WA 3M5OA 3CENA 1MTWA 2FTMA 1TBZH 2J38A 1V2OT 1ZRBA 1EJMA 1SLXB 2ZFPH 3DSPA 3MNSA 1QGFA 1RD3B 4GUXA 3E0PB 4ABAA 2K1QA 3S9BA 3RXFA 2BXUH 1C9TA 1BCUH 3L3TA 1BITA 5HIYA 4ISIH 1G3BA 1J16A 1EP6A 1FPHH 1LQDB 4HTCH 2HLCA 3SO3A 1V2QT 2B7DH 3PLKA 3UNSA 2WUBA 4Y10E 3Q00A 5FPYA 1YPKH 4LK4A 3RU4E 5L2ZH 4NG9H 3NUMA 2VWMA 2GZ9A 2A4OA 5ABWA 4QT8C 4Z6AH 3RM2H 4ZKSU 3BN9A 7ESTE 1SGYE 1UVTH 3ZZ8A 4CHAB 2PGBB 2PSYA 1H9LB 1MUEB 1N6YA 1CVWH 1HAPH 2AGIX 2I6SA 4SGBE 1KTTB 3UIRA 1ZMJA 4HI3A 5C5OA 2P3FH 1CA8B 2QXHA 2VWNA 4NIXA 1E38B 3OX7U 2GVFA 3W1EA 1P3EA 3SZNA 4A7IB 1GI5A 2QIQA 3SU5A 1W0KD 1LO6A 3S7HB 4CH8B 1TGCA 3MQKC 3U8TH 1N8OC 6GCHF 5A0CA 1A61H 1W7XH 1PPCE 1WV7H 4MVNA 1HAVB 2J2UA 2PGQB 5C0UA 3TGIE 3FOAA 3T25A 1AB9C 2F4LA 4TY6A 4A1VA 3LGYA 1C1QA 1LHGH 2FOBA 3SU0A 1H4WA 2VH0A 1P3CA 4AN7A 1F0UA 2FESH 1N6XA 1H9IE 1HRTH 4THNH 4U30A 1AVXA 4ABEA 1HBTH 2UWPA 3F9HA 2GTBA 2P16A 3LPRA 3TJNA 4UFFH 2AMQA 5E0GA 3SUEA 1PPEE 5L2YH 1JIMA 1Y5UT 4Y0YE 3ZZBA 1LVBA 1GI6A 5HMAA 2AHME 2AMPA 5E2PA 5EODA 4BTUB 2GCTB 3E6PH 2RDLA 3PRDA 4X2VA 1TLDA 4CBOA 2G8TA 2YOLA 4MPVA 1UTKA 1WCZA 3A84A 2A7CA 2EI6A 3S69A 5DKMA 1A46H 1ESTA 3FO8D 5HKKD 1S85A 1TIOA 2QXGA 6GCHG 1P8VC 2BQ7B 4X8SH 3KQCA 1EJAA 5T6GA 4JYVH 2ZIQH 1SPJA 1YPMH 7GCHF 2ANMH 5LPEA 3GS9A 1CHGA 2KAIB 1C2MA 4OM9A 5JBAS 1WAYB 2FIRH 3ELAH 2Z9GA 1UJ1A 3RMLH 1Y8TA 4CR9A 1NC6A 3BTEE 1O5BB 3HPTB 1EQ9A 2HPQH 1LHDH 3M35A 3VGCC 2Q6FA 1BBRH 3T29A 4MNWA 4FVDA 1CT2E 3SYJA 3F0OA 4NZLA 4DIHH 1C5SA 2WPJS 1TALA 1LHEH 1O3KA 3QN7A 1TE0A 2R3YA 2ZTZA 2SGAA 2ZFFH 1BZXE 5TCAA 1ELCA 1XVMA 2R2MB 4TWWA 5EXMA 5FPTA 1HJAB 1NFXA 1D3TB 2EEKA 4X1QU 1V2TT 4DJZB 4BAHB 3RLWH 3B8JA 2XXLA 1CBWC 3PTNA 3A8DA 2HNTF 1NRRH 2XWAA 4Y7AA 5GDSH 4RI0A 4I32A 5GPIB 2G4UA 4AG2A 2FLRH 5CHBA 3RU4D 1ZPBA 1MCTA 5AVDA 1SLUB 4A1XA 2BM2A 1C5ZB 4IW4E 1BTHH 3D62A 5EGMA 3LT3A 4O03A 3AK5A 1RTLA 1CGJE 1QL8A 1F92A 2PP6A 5C1YA 1TPSA 2EI8A 2UUFB 3SORA 2FM2A 1K1NA 4O9VA 1OWHA 1C5UA 2SGEE 2M5TA 1EPTB 2V3HH 2ZHDA 1HCGA 4NIVA 2BY8X 2VIDA 1SGFG 1NESE 2XBYA 1GMHF 3A7YA 5J4QA 2WYGA 1MTNC 2P94A 2J98A 2BDBA 2ESTE 3HKJB 1YM0A 4K3JA 1GHAF 1B7XB 1O5CB 1WSSH 5K7RA 2BLQA 1TRMA 2EC9H 1YP9A 3DHKH 1TRYA 1O0DH 2CHAB 1O3BA 2GMTC 1Y3WA 2BY5X 3GCNA 1EOJA 4GHTA 2JETC 4IGDA 5J4SA 1ZLRA 1K1PA 2AH4X 4AB9A 1TGBA 4B74A 4E7NA 2VJ1A 1IQKA 2GT8A 2R0KA 2ZCKP 1XUFA 1VCWA 1O3MA 2JH0D 1ELVA 2H5DA 1FNIA 3A82A 3SW2B 3F2FA 2BXTH 1K22H 2G55A 1BRAA 2R9PA 2FODA 5LPRA 1EAUA 1IQEA 1LVMA 1V3XA 1ZGVA 1TFXA 2F3CE 1P10A 4H4FA 4YESB 3MH6A 4PROA 3TGJE 2LPRA 4MNXA 2C8WB 2TRMA 3SUDA 3E3TA 4OGXA 4FUCA 5EW2H 5T3HA 3RXEA 2WUCA 1MKWH 2W5EA 1SGCA 3RXGA 4FUIA 3SQEE 1GMHG 1Y5AT 2P95A 1C5MD 1C1VH 1OYTH 3LOXA 2VIQA 2GV6A 5T1VA 4ZH8A 5FL7D 1P57B 1W0JD 2GCHF 1TNLA 3GY3A 4OS1A 2Z9LA 2ZCLP 7KMEH 3FN8A 2HWLB 3G01A 3H5CB 4FU8A 3TGKE 3SU3A 4MPUA 2ZGCA 3RC4A 1NN6A 4FUFA 1O36A 5L6NH 2HALA 3GCHB 1FV9A 1SGEE 1IQGA 3U28C 4K2YA 2ALPA 3ATWA 4ASHA 1K1OA 1GBDA 3H09A 1BDAA 3RMMH 1FQ3A 1GCTC 1UTMA 1EZUC 1EZSC 3MFJA 1Z1JA 1DXWA 4H6SB 4X2XA 2SNWA 4ABHA 1GI4A 2ANYA 5CHAC 4GPGA 2QF5A 2CMYA 3V3MA 4H6TA 6CHAC 5C1UA 2XWBI 3BIVH 1BJUA 4SGAE 1YC0A 1MZDA 4AX9H 1F2SE 2ZI2H 3HKIB 4K8BA 4RT1A 3W94A 4XBDA 2A2QH 4NFEA 1NBMD 4ABIA 2XOKD 1NZQH 1P03A 1O2MA 2A7HA 1DOJA 1O34A 1BTXA 1UO6A 2CGAA 4M9FA 2K8IA 2A4RA 4IN1A 1TX6A 4E7RG 1XUKA 1HJAC 2AGEX 2H9TH 4CRFA 5AFYH 4ABBA 1C4U2 2FMJA 4RKJB 1UTOA 3MO6A 2OCVB 1W14U 5EQSA 4GCHF 3IG6B 1GVZA 5DSFA 2ZEBA 2ZU5A 2HRVA 4YXWD 3FAOA 1QA7A 3A83A 1IHTH 2RA3A 4E06H 3CNRA 5TCCA 1THPB 4F48B 1AQ7A 1SI5H 4LOYH 1MQ5A 1O2SA 1OPHB 3MWIU 3TH4H 2C4FH 4KKDA 1TAWA 2VIPA 3LH1A 4K5ZA 1GMDF 3AW1A 4U2WA 4R8TB 1YKTA 4ABDA 1O2IA 2ZFSA 3MTYA 2ODPA 3KYFA 2QY0B 1CGHA 1GHYH 5HM2A 1EPTC 1TWXB 2W7UA 4DG4A 3PM3A 3KYGA 1MTVA 3URCA 2D1JA 2Y6TA 1GI1A 2NWNA 1YYY1 2WINI 1SMFE 2SGQE 3ODFA 1AE8H 5JB9S 4OS7A 1C2GA 3RXCA 2H9EH 3KQEA 1BMAA 1XUJA 1QBOA 1Y5BT 3DFJA 4UD9H 3SHCH 2H5CA 3A81A 3PYHA 1Z7KA 4X8VH 1KDQB 3N99A 4IBLH 5DN6D 1FN6A 2JJ2D 1CSOE 4D9QA 4GCHG 4VGCB 2EY4C 2G4TA 1U6QA 3VB5A 3TJOA 3P95A 4ISNA 3QUMP 2ODYB 3UWJH 3F9FA 3RMOH 1UCYE 3PRBA 4X0WU 3QTOH 2OC7A 3TH2H 3ENSB 1C2IA 2P59A 4YOGA 4TT3D 3LONA 2QF0A 1O3GA 1YPLH 2V6NA 2VWLA 3GY5A 2FXRA 2YNAA 3D49H 1ANEA 3CS0A 5DPAA 4WMEA 4UFDH 5A2MH 2D26C 3P17H 1QFKH 2D8WA 4RT0A 4AC9A 2ZGXH 3BTTE 1P2KA 2C8YB 2FZZA 1UK4A 3EA8A 3M36A 3TVJB 4XD7D 5AF9H 1A0JA 3A8CA 2XW9A 4X1RU 4D76A 4B6FA 4IC5A 1P2QA 4B71A 2PKAA 3GYLB 2IN2A 3PTBA 4AG1A 2A5KA 5G4BA 1UTQA 2JKHA 4Q7ZA 3GOVB 1GCDA 2Z7FE 4XDEA 3RP2A 1VKYA 5JB8S 4JCNA 2PFEA 4ISHH 1AU8A 2Y5GA 1E34B 1OOKB 1WUNH 3SNEA 2ANWA 2GDDA 1GHBG 4NGAH 1NPMA 4XFQA 3TK6A 2GZ8A 2F9PA 1C1WH 3ZVCA 2BOKA 3SU4A 6ESTA 1SSXA 1FLEE 4TPIZ 1YY3A 2ZKSA 2AYWA 4FVBA 3MH4A 2WPHS 1S84A 4Y0ZE 1ELBA 3BTFE 1VR1H 1GI7B 1P2OA 1GJ6A 1SQAA 1GI2A 1LKBA 2G52A 1FPCH 2V3MA 5FXLA 1KXAA 2VIVA 1GVLA 1QTFA 4AZ2B 4UFEH 4XSKU 2JDID 3SNDA 1HV7A 5EU8A 5FBEA 1A4WH 2GKVE 2OK5A 4NSYA 2WPMS 5DJ7A 2ZCHP 3SGQE 1KY9A 1AFQB 4NFFA 1F0RA 9ESTA 1AKSA 2RA0A 2GGVB 4ZXXH 2OUAA 4WWYA 3KN2A 5E0JA 1DLKB 3M3SA 1FIZA 1NTPA 7LPRA 1P04A 2ZNKH 3Q3YA 4CR5A 1AWFH 2UUJB 1TABE 1W7GH 1GJ7B 3UFAA 1L1JA 4K8YA 2WPDD 2I6QA 3A7ZA 1TNJA 1HAYB 1V2UT 2WZQA 3ATIA 4H42U 4JK5A 3RU4T 4A92A 1GBIA 2VINA 1WQSA 2B5TB 1TX8A 4P00A 2OBQA 4U01A 3WWBA 1UVUH 1H8DH 1ZR0A 2UWOA 5JBCS 2W6ID 2ZU2A 1OXGA 5C2ZA 3E1XB 1CE5A 1ZTJA 1A7SA 1C5RA 3KGPA 1KXBA 3AAUA 1KLIH 1C1NA 2WSSD 2F83A 3RXMA 3F9EA 1MU8B 1KYNA 1J14A 2BX3A 1SKYE 2A5IA 2STBE 3BSQA 4FU9A 1V2LT 5JYIA 2WPIS 1VJ9U 4DGJA 1YF4A 1DITH 3SV6A 2AS9A 5GWZA 1C5WB 1P9SA 3B23B 2FOAA 3A7VA 3NKKA 3KHVA 5DP3A 1ZSKA 1QR3E 3SJOA 2VGCB 1AUJA 4J1YA 4HFPB 3TITA 4Y11E 4MTBA 1PPBH 2FI5E 1MABB 4CRAA 4VGCC 4X1PU 2GZ7A 4O3TA 4YT7H 3H7OA 3LGIA 2XYAA 4IMQA 1SGQE 3MNXA 3EA7A 1OWEA 2VVUA 1ABIH 3UQOA 1QJ1B 3SBKA 1PPHE 4B2CA 3SU2A 3MOCA 1GJ8B 2FTLE 1C4Y2 1O2QA 5FX5A 2VVVA 1NRQH 3Q77A 1ZRKA 2XTTB 2PKSB 1CA0C 4JMYA 1FMGA 1NU9A 3ZVAA 4YOJA 1Q31A 3NXPA 3RXKA 4Q80A 1HB0B 3U1JB 3ZV9A 2R0LA 1C5TA 3UQVA 1GBFA 2XBVA 3FFGA 1TPAE 3FP6E 3VFEA 1ZJDA 5KGOA 1SGDE 1NFYA 3H7TA 3SV8A 5LPFA 1ZOMA 3QZRA 2FX4A 5C3NA 5C67A 1RGQA 3AAVA 3PV2A 5EJLA
chains in the Genus database with same CATH topology
4RKOB 1QQ4A 4MNVA 1DS2E 2BOHB 1PPFE 3SV9A 1EASA 5DP7A 1ID5H 1SGFA 3NZIA 4FUBA 2BYAX 9LPRA 1K2I1 1RTKA 3LJOA 3ZZ4A 1JOUB 1KTSB 3FP7E 1O3FA 1OP0A 4I31A 1QQUA 1OWJA 5EPYA 2QN5T 1A2CH 1W8BH 2SGPE 1JRTA 3F2HA 1GBEA 1UHBA 5F8TA 5IDKA 1A3EH 1DANH 1YPGH 3SI3H 1EZXC 5FCRA 1W13U 3ATLA 3M3TA 2RCEA 3T27A 2PR3A 2BD7A 1TB6H 4E05H 1MAXA 5E2OA 1W11U 2H6MA 3RXBA 3OEED 1HNEE 4UEHH 1B0FA 1SR5C 3VEQB 3NK8A 3LIWA 4CH2B 3HGNA 4MPXA 1V2WT 4FUDA 1F0SA 1NS3A 1MKXK 3OTPA 1E0FD 4WY3A 3SUFA 1JRSA 4TY7A 8KME2 1O2XA 3GY7A 3Q3XA 5DP4A 3TNTA 1SC8U 3OU0A 3BEUA 5JPMH 2HNTC 1QA0A 2PSXA 1GBKA 3TU7H 1C5VA 4BAKB 1P2IA 4IN2A 2BY7X 2VIWA 3TK9A 1QJ6B 2AIQA 4TPYA 1J8AA 1NFUA 3RXVA 3GDSA 3GICB 1TNKA 4AORA 3Q3KA 1O2PA 1L0ZA 3NPSA 2KM0A 1K28D 1WTHD 2ZU3A 4NWKA 3ZVFA 1KXDA 5T6DA 3LJJA 1D6RA 1SFIA 1QRZA 1O39A 1O5EH 3LGTA 2BHGA 1PQ5A 3QDZB 1C4V2 1LPGB 1Z6JH 4MG3A 3VG8A 3RUOA 1HIAA 2KCPA 2BQ6B 1PPZA 1TA2A 1GDNA 2FP7B 2P8OB 2NU1E 4ASUD 2BD5A 4GAWA 4KTCA 2O8WA 1BUIA 1HPGA 5HYOA 1AHTH 3EDXB 2O8LA 5L30H 3MU1A 4IS5A 1LPKB 1F5KU 2CF8H 2XC4A 1QCPA 1O3OA 2ZG0H 5FBIA 1GHWH 1ZHMA 2PWXA 1W0YH 2WPKS 1LVYA 4AFUA 2QCYA 5EQQA 1MU6B 4CRGA 1QY6A 1O3JA 2KCYA 4JK6A 2C90B 1HAZB 2YMSB 1NROH 3M5NA 2ZTYA 4Y7BA 1UTNA 2ZPQA 3SUGA 3W95A 1ACBE 1V2JT 3E91A 1GHVH 1OKXA 1GGDB 1MTUA 1SLWB 2FO9A 3LU9B 4O3UA 3VXFH 3OYPA 5C1XA 1FN8A 5HXFA 1HAGE 2Z94A 1EXFA 2BZ6H 1CT4E 1ZGIA 1P2NA 3SJ9A 3E8LA 3A7XA 2OC0A 5CE1A 3P6ZB 1FX0B 3I29A 1MMJN 3MH7A 4CHAC 1ZHRA 2Z3EA 3ZVBA 1P12E 1H8IH 1TYNA 3RXSA 1ANDA 3RLYH 1H1BA 1LVOA 3FVFB 3A85A 2C3SA 1KXCA 1HAVA 4KGAA 1DDJA 3OAAD 4BTTB 5A8XA 3ESTA 1GL0E 4FU7A 1TRNA 2ZPRA 1GJ4H 1Z8JB 2ZHWH 4I8LA 2NU4E 1WBGB 3GISB 1TGTA 1AD8H 3PLBA 4INHA 5GCHF 4ABJA 1ESAA 4ZHMU 3CP7A 4ZMAH 1MD7A 1Z8IB 1OWKA 4WMFA 1UTJA 3PV4A 5PTPA 1RXPA 3U8OH 4B2AA 5AHGH 3MI4A 5FX6A 3STJA 1N1LA 2C8ZB 1BTPA 2G00A 2QA9E 2WHXA 1C2LA 1BMFD 2M2AA 1AMHA 1EAIA 1ELFA 5SGAE 2O8UA 1EATA 3E90B 3MYWA 2BDHA 2G5VA 2BD3A 4TWYA 4F55A 1UCYK 4WH6A 1O3CA 2V7QD 3RXIA 3SNAA 3RC6A 3KQDA 1GG6B 4WMDA 1AFEH 5C5NA 1MAYA 2UUYA 4ZCNA 1L1NA 3ODDA 1O2YA 1GBMA 4DW2U 2VB0A 3RXHA 2NU3E 1UTLM 3EGKH 5DGJA 4MLFB 1O2UA 1MZAA 2GCTC 2ZWLH 1P02A 2A4QA 1TPPA 4AYYB 1O3NA 1S0QA 4DURA 4F4OC 3PMBB 3ZIAD 1O3DA 1XVOA 4UFGH 4ZAEA 1FY8E 4X2WA 4ISOA 2ZQ1A 5C20A 3RXAA 1PYTD 5GCHG 1AIXH 3PV5A 4JZDH 2J5UA 1D3QB 2G5NA 3PO1B 3GCTF 1BRCE 4I8KA 3O8CA 5JBTA 1PJPA 1T4UH 3PLPA 3M5LA 3IWMA 4A6LA 3JZ1B 1C5YB 1O33A 3O8BA 4B76A 1EB2A 2QF3A 4OS6A 4ZKOU 4K1TA 5DG6A 4JYTA 1K1MA 1IQHA 5A8YA 3M61U 1WTGH 2DE8A 2J9NA 3RXJA 4I8HA 4ZKNU 1IQIA 1O31A 2PKAB 3K2UA 2P3TB 1FONA 1SBWA 1VGCB 1YBWA 2OXSA 2BB4A 4A5TS 5F8XA 4JZEH 2A45B 2ZU1A 1INCA 2ZFRH 4MQAA 1BA8B 1VCQA 1RS0A 1XMNB 1E1RD 3SV2H 1MBQA 4NSVA 1COWD 2QC2A 1GBAA 2KFWA 2FOFA 1WXRA 4KTUA 3BTDE 1K1IA 5DO4H 1HAXB 1KLTA 1WOFA 3BEFB 2ZO3H 5A0AE 3MU8A 1FY3A 3SZEA 1FAXA 3URDA 1EPTA 1V2VT 3GCTG 2OBOA 1VITF 1P01A 1DT2A 1UVSH 3PMHB 4NIYA 2SGFE 1J17T 2A31A 1V6DA 4O97A 1LHFH 4K1EA 1F5RA 1RIWB 3VB4A 4D7FA 1GBJA 4YLQH 3KCGH 1HAHH 1S6HA 2CK3D 2FI4E 2TGAA 1DY8A 3DUXH 1BHXB 1HAOH 1E37B 3ATMA 2FOMB 1FIWA 2Y5FA 4BXSA 5ETXA 2H2ZA 1O2WA 2NU2E 1ESBA 3ZZ6A 4ABGA 3SJKA 1DSUA 1AKSB 1HXEH 1O3IA 2QV1A 2A4GA 3VB7A 4Y8YA 3UWIA 3WWFA 2KCAA 1XM1A 2NU0E 2ZDKA 1KIGH 1LCYA 1P09A 3UB0A 2ZGHA 1CGIE 4F49A 1Z8RA 3RXTA 2BD8A 1DWDH 1G2MA 2CHAC 5F6MA 1Y3YA 3BG4B 1GHBF 1G37A 1VITG 2J94A 2ZDMA 1O2RA 4YTAA 4AB8A 5LH8A 3ZZ9A 1IOEA 1O3HA 1S83A 2O9QA 3TJUA 4Y6DA 1TGSZ 1Z6EA 5CDFE 3FP8E 4CRBA 4WJG2 1FXYA 1QHRB 1TGNA 1P06A 1DVAH 3TNSA 1C1UH 4BAOB 1T31A 2OLGA 5GIBA 1MTSA 1G2LA 3T5FH 1O3LA 2IJD1 1AUTC 4MDSA 1S82A 3OE7D 3UR6A 2BDIA 1VZQH 1AVWA 1HAIH 1DICA 3WW7A 1UK3A 1T8MA 2C8XB 2ZU4A 4Z0KA 3I77A 3EYDA 1ZMLA 1DXPA 3T26A 3U1IB 3U9AH 1SLVB 5ESTE 4TSFD 4YOIA 2WV4A 3AW0A 1C5PA 4I8JA 2IPHA 2V0BA 4KP0A 1NRSH 3E16B 4Y8XA 3N7EA 3V7TA 1W10U 3SOSA 1L4DA 2Y80A 5I46H 1NT1A 2AFQB 4B1TA 1C5XB 1XXDA 3GCHC 3LGWA 2IOTA 4FUJA 3SGBE 1G3DA 3AVZA 3V0XA 3UR9A 3UREA 4WXIA 1EP5A 1SG8B 2JH6D 5K0HA 4NCYA 3ATKA 1MH0A 1J15A 1MKXH 2WYJA 4M7GA 5A0BA 4AGJA 1L2EA 1SGTA 1PYTC 5I25A 5FAHA 3N7OA 1S5SA 4D7GA 4HZHA 3BTQE 1GBHA 1OYQA 4ZUHA 1S6LA 5B6LA 1YPEH 1N8OB 2Z6BD 1C1PA 1C1SA 1WU1A 2FYQA 2BZAA 1P9UA 1XKBC 2OQ5A 3M5MA 5F8ZA 4WF8A 1BRUP 1AB9B 5BRRE 3U69H 2FOGA 1VGCC 1V2KT 3TJVA 8LPRA 4X6OA 1DSTA 1SFQB 2F9NA 1GWAA 1O5AB 1KXFA 1XKAC 2ZDNA 1GVKB 4MNYA 1T8LA 5EXLA 4NA7A 2Y7ZA 3O8DA 1OS8A 1OWDA 1UK2A 3FANA 2PTNA 2W3KA 1OHHD 3K9XB 4A1TA 2FI3E 1XXFA 1FY5A 2V35A 1TNHA 4NZQA 1BBRE 1D9IA 1DM4B 1ZTKA 2CF9H 1YCPH 1AWHB 3RXDA 2XCFA 3GY8A 1IAUA 1PQAA 3OSYA 1GJCB 1SGIB 2GT7A 4LZ1H 1UHBB 1GBLA 1G30B 1TOMH 3LGVA 2G81E 1K1JA 1QBVH 4JZIA 5AFZH 1O2OA 3RXLA 1EAXA 3M3VA 4X8TH 2F43B 1EZQA 2B9LA 2FPZA 3NCLA 1WQVH 1RTFB 5DP6A 1OWIA 2PHBA 4FETA 1O3AA 1EAWA 1LDTT 1V2ST 5H4IB 1SQOA 1TONA 1BOQA 1OP2A 3NWUA 4ZROA 2CN0H 1DWEH 1E1QD 3VGCB 3MU0A 4YO9A 1IHSH 2ODQA 2IJOB 3UPEA 2UWLA 4AFSA 1GJAB 2CXVA 2WPLS 3U8RH 2BMGB 1QRWA 4UE7H 5DK1A 1W2KH 2H1UA 3R0FA 3UOPA 1QB9A 2AMDA 4WH8A 2WV5A 3HGPA 1SOZA 1NFWA 2ZHFH 3PMJA 1Y59T 3ZVGA 1ARCA 4BNRA 2EA3A 3P8OA 1KLJH 4XE4A 1HXFH 3OTJE 1CBWB 1EKBB 3SU6A 4KTSA 2VU8E 1D3DB 1FDPA 4RSPA 4Q7XA 1C5NH 1V2PT 1QB1A 2O8MA 4I8GA 2TGTA 1CHOF 1C1TA 3U98H 1YCPM 2Y81A 2JJ1D 4HGCA 1SB1H 1BMNH 1O2NA 3SGAE 4YM9A 4X6MA 1H8HD 1CQQA 3R3GB 2FS8A 1QL7A 5HM9A 1BHXF 1TQ7B 3PROA 3ZZCA 4D8NA 3VB3A 1EOLA 1A0HB 3O8RA 4AFQA 1DUAA 3SQHE 2XC5A 3SJ8A 2VH6A 1G3EA 1LTOA 4BXWA 4AOQA 1A0LA 3VPKA 3L6PA 1FAKH 5BPEA 2AEIH 2VNTA 1GJ9B 2FLBH 3AASA 1MTNB 3GY4A 4GVUA 1JBUH 4X6PA 1ZSJA 4CRCA 1UCYH 1CT0E 1EB1H 1O38A 1C2FA 4YZUA 3UNQA 2OQUA 3ZZ3A 3SU1A 1C2HA 1C1OA 2ALVA 5LGOA 2KR7A 1K1LA 1YLCA 2GMTB 1L1GA 5IK2D 2A2XH 5E8EH 1GBTA 2JETB 1HJ8A 1PPGE 4GSOA 1VCPA 1HFDA 4B73A 2W6JD 4Q7YA 5C0TA 1CHOG 1S0RA 4LXBH 3MO9A 1W12U 2ZC9H 5FHTA 3NRLA 1HGTH 1IQJA 1C5OH 3T28A 2Q6GA 1GL1A 2RG3A 2HGTH 3A7TA 1TX7A 2AIPA 8GCHF 2V3OH 2ZF0H 3SI4H 3BV9B 3GDVA 1O5GH 3RXPA 1YPHE 2TGDA 5C17A 1A5HA 2Q1JA 1QBNA 1V2NT 4R0IA 2L6OA 4ZKRU 4I33A 1ARBA 4IMZA 2LELA 1CO7E 4JZ1A 1ZHPA 1AFQC 1NRPH 4DIIH 4Y71A 2SNVA 1C5QA 2BD9A 1E36B 1MD8A 2ZZUH 3OY6U 3UUZA 1ETSH 1XUHA 3F1SB 3S9AA 3QTVH 2ZDVH 1V2MT 1C2DA 2XCNA 1GI3A 1FY1A 1A5IA 2OD3B 4DCDA 1V2RT 3UNRA 3QLPH 1ZMNA 1ZYOA 1D4PB 2BD2A 2OINA 1GJ5H 2VIOA 3ZZ5A 4Q2KA 4Q63A 1D3PB 8GCHG 1GCTB 1RFNA 3BTWE 2ASUB 4INLA 1Y3VA 1O2TA 1UTPA 2PUXB 1MQ6A 1BIOA 5ESBA 1LHCH 2THFB 3M7TA 3MH5A 3MNBA 5E0HA 1Z71A 4OGYA 1YCPK 5CHAB 2ZGJA 2C93B 6CHAB 2PW8H 4NA8A 1THSH 2CV3A 4X6NA 3ZZ7A 3A80A 3BTHE 2ZECA 3IITA 5F53A 1G9IE 1VITH 3HK3B 1BJVA 4BTIB 1LPZB 1BQYA 2BDYA 2KCOA 3KQBA 3TH3H 2F9OA 3JZ2B 1O3PB 1EFRD 1ZJKA 2Z9JA 1UVPA 2GV7A 3DT0H 2F9UA 4B75A 2YMSD 1O32A 5DP9A 1THRH 4FUEA 1P2JA 2VGCC 4GLYA 1QB6A 1O2JA 4OS5A 1Q3XA 2J4IA 5EXNA 3UTUH 1QJ7B 2ULLA 1O3EA 3HATH 1NBME 4XBBA 2W3IA 4DT4A 1PQ7A 5EOKA 5A8ZA 3OEHD 1GPZA 3WY8A 2BQWB 5HGGA 5EW1H 2DUCA 5TJXA 1S81A 2Z9KA 3B9FH 2ZHEH 1BTZA 3QO6A 7GCHG 3GY2A 2J95A 2SFAA 2Y5HA 2PKSC 4BAQB 3MU4A 3RXOA 3UY9A 4AFZA 5F03A 1QURH 4Y76A 3KNXA 3MU5A 4LZ4B 2ZDAH 1ELAA 3RC5A 3P70B 1DWBH 2BVSH 3A89A 2JH5D 1DY9A 1Y3XA 4AYVB 1H8ED 5EG4A 1JIRA 4Y79A 2ZPSA 1IQLA 1JMOH 1ZPCA 2QXIA 4XBCA 3ITIA 3ZYDA 1T32A 2ZA5A 1XUIA 1SHYA 3GY6A 1ELTA 1TBQH 5GXPA 4JZFH 2BTCE 2O8TA 2KZ4A 1GI0A 1TA6A 2BVRH 5A09A 1QIXB 2HVXA 3MMGA 1A3BH 1GHXH 1Q2WA 3S7KB 2Z3DA 1XX9A 1AN1E 1ORFA 3RM0H 1BMLA 1S6FA 1GHZA 2ZFQH 5FPSA 4MPWA 2Y7XA 1O2VA 1PQ8A 3M7QA 3KIDU 1TPOA 5GJ4B 3PMAB 1E35B 1P0SH 1D6WA 3SNBA 1C5LH 2LNCA 3QWCH 1ZTLA 3ZZAA 1TBRH 1AZ8A 2OP9A 2PLXA 3BTKE 4WXVA 3KL6A 1HUTH 1L4ZA 1GBCA 1OP8A 1ELEE 3MHWU 3TIUA 3HK6B 5B6OA 2KAIA 3RXUA 2BLVA 1T8OA 2FOEA 3DA9B 3LC3A 1T7CA 3K65B 2Z3CA 2XBXA 3DD2H 1GJDB 3TPIZ 2ZDLA 4Y8ZA 3BTME 1H9HE 5DP5A 1GHAG 2H9HA 1DE7H 2A5AA