2OC8A

Structure of hepatitis c viral ns3 protease domain complexed with ns4a peptide and ketoamide sch503034
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
183
structure length
183
Chain Sequence
MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hepatitis C virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 42
structure length 183
sequence length 183
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc8A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc8A01
4F4OC 1S6HA 1SHYA 1OWDA 3I77A 1P0SH 1TGSZ 1DWBH 4B2CA 2FYRA 1IQHA 1CBWB 1ELGA 1GBJA 4MTBA 2AYWA 1QR3E 2RA0A 3LGVA 1THSH 4DJZB 2BTCE 1GCDA 4ABIA 3SZNA 1ARCA 3BTTE 1BRUP 1W7XH 1PQ5A 1RIWC 4FUJA 3G01A 1OWJA 2FZZA 3ZVGA 3BG4C 1DX5M 3SN8A 2VU8E 2GCHG 2ALVA 3RM0H 1EKBB 1TMTH 3RXUA 4ABEA 4O3UA 4FUFA 1FN8A 4Z0KA 1O2RA 2GT8A 2PSYA 1G37A 3LT3A 5C3NA 1ZHPA 3OX7U 2QAAA 2V35A 2BVXH 2XCFA 1S82A 1K1MA 2A7CA 2STAE 1UTOA 1K21H 4X1NU 2HNTE 1GHXH 1WUNH 2EC9H 5EXNA 1SLUB 3UR9A 5BRRE 1NTPA 1V2UT 4HZHA 5EW2H 2DE8A 4ZKNU 1FAXA 1MH0A 2OK5A 4ZHLU 4BAOB 1GHVH 3TK5A 3MU4A 1ELEE 4U01A 1V2QT 3P17H 1YPMH 2BY9X 2VWOA 4XDEA 1QA0A 1FNIA 2FOEA 4YT6H 3RLWH 3QO6A 2XBYA 1OX1A 3RU4E 4ESTE 2UUJB 3SJIA 4XSKU 1WTHD 1C2DA 2C8WB 5C2ZA 1GI9B 1ABJH 2P3FH 4RSPA 1GCTC 2OBOA 3E0NB 3LGIA 2AFQB 3RU4T 1IQEA 3MH6A 1GG6B 3FAOA 4F49A 1P9UA 2GP9B 1EZQA 1TRYA 4WF8A 4BAMB 1K1PA 3KQCA 1T8NA 1HAIH 4LZ4B 1UVSH 1VCWA 3A86A 1HLTH 4FUDA 4YLQH 3TGKE 4B73A 1KXFA 4NGAH 3EQ0H 3GCTG 1Q31A 2Z94A 2AGEX 7GCHG 1P57B 1HJ9A 3QZRA 1HIAA 3GCTF 1Z8GA 1G3CA 1N6XA 1ZTKA 5E2PA 1TPSA 1ID5H 4JZDH 2BDAA 1FUJA 2STBE 2UUFB 1J9CH 1BTYA 3BSQA 1YC0A 2FOFA 3SQHE 2A32A 1O36A 2XBWA 1DLEA 1UMAH 3TU7H 5EOKA 1O3FA 5DP3A 1O3GA 1MQ6A 3KF2A 4K60A 4AFQA 4FUEA 1C1RA 3E91A 1ANEA 1J15A 3T28A 2BXTH 1EOJA 1V2VT 3M36A 3VB6A 3SGBE 4X6MA 5ESBA 1O2KA 1EPTC 5CHAB 1O2JA 3BV9B 1O5BB 1EB2A 1MTUA 2Y82A 3MU0A 4Y7BA 5GJ4B 3PLBA 4OS5A 4O9VA 5E2OA 1ANDA 3ATIA 4UEHH 4DIIH 2PFEA 1TNKA 3KQBA 5AFYH 5E8EH 4GSOA 3RXCA 2H9EH 2WV9A 2A1DB 1O2TA 2OTVA 1QBVH 1WU1A 1ZGVA 3TVJB 2OC1A 2SGDE 3SU3A 1SGYE 2ZGHA 1LVOA 4D7GA 1GJ8B 1P2IA 5GXPA 1O33A 2EI8A 4CH8B 2PWXA 2G52A 2ZHWH 5EQSA 2G00A 1C1TA 1W12U 1D3DB 3F9GA 1MCTA 2NU2E 4RKOB 1ZPBA 4U30A 4R0IA 1QNJA 1UO6A 1GVLA 2ANMH 4ZKRU 1S83A 1QL7A 1SLXB 1IHTH 1GJCB 1P10A 1GBAA 1FPCH 3P8OA 5GWZA 1CHGA 3SZEA 1V2JT 4B6FA 4JZFH 1YM0A 3MH4A 4U32A 3LH3A 3F9HA 1O3HA 5A0AE 3MO6A 2W5EA 4D9QA 1YBWA 3EE0B 1ELVA 3NK8A 3VB3A 2QIQA 2KAIB 2AH4X 1HJAB 3ZZ5A 4BTIB 1U6QA 2XW9A 1AKSB 1YPHE 3LPRA 3UQVA 1UCYE 4XFQA 1AB9B 1MTNB 4Y0ZE 4TWYA 2BVSH 1O3CA 3BTQE 1B5GH 2FI4E 5EQRA 2NU4E 2R9PA 1INCA 1ZSKA 3SU2A 2VWLA 4OS6A 1NFUA 1TX6A 1SGQE 3VGCC 4J2YB 1G3BA 2ZPRA 3RDZA 1SFQB 1ZLRA 2VIOA 5DK1A 3O8CA 1D3TB 2QGRA 1B0FA 5DO4H 1SLVB 5FX5A 2FP7B 1TQ7B 1T8LA 2FOHA 3AW0A 3FP8E 1J17T 2LNCA 5HGGA 1GHAG 1C1WH 1LPKB 3ZZBA 1GGDC 1O30A 3PROA 4KGAA 1NPMA 4Y8XA 1PQAA 2QC2A 1CGHA 3ZZ7A 1P02A 3RXGA 2QV1A 5HMAA 1GBLA 2BD4A 1S0QA 1UTMA 2FO9A 3UY9A 1EP5A 1CT4E 2ODQA 3S7KB 2GX4A 1MBMA 3EYDA 1RTLA 2GVFA 4AYVB 1YCPH 1TYNA 2PKSB 2D2DA 1P05A 4YLUA 1EASA 1L1GA 3K9XB 1DT2A 1EZXC 2V0BA 1E37B 1XXDA 4U2WA 1S85A 2FM2A 1O0DH 3C27B 1H1BA 1VZQH 2ZHDA 4X1SU 1NC6A 5FXLA 2BVRH 2Y80A 1SLWB 1HFDA 2Z3EA 2ANYA 1C2GA 4E7RG 3MU5A 1HJ8A 4DURA 2SNVA 1G3EA 2FOCA 1ABIH 1G36A 2H9HA 1C2EA 4AGJA 1AQ7A 2Y7ZA 2BLOA 3SYJA 2VGCB 3RC6A 3MYWA 1GBKA 3T26A 1QJ7B 4ABJA 1W0YH 1UCYH 1GBIA 1UK2A 1QL9A 3A7ZA 2PKAB 3GDSA 1AUTC 1VITG 2TBSA 4R8TB 1QB6A 3E90B 1FONA 4I8JA 1BHXB 3RXTA 3C1KA 5A8XA 2NU3E 3QUMP 4CRAA 3MI4A 1SGFA 1AI8H 1QIXB 4OS7A 1Y5AT 1TNIA 1HCGA 1O32A 3SW2B 2QXIA 3JZ1B 4X2WA 1L0ZA 1PJPA 4ZMAH 4DGJA 2C8XB 1GI2A 1J8AA 3U9AH 3PMBB 1V2PT 3RMLH 1FY3A 4B75A 3M5OA 1ZMJA 1QURH 4NSYA 1TA2A 1IQGA 4ISNA 1UVPA 2W7UA 3R3GB 5JPMH 3MWIU 4I8KA 1OXGA 1W0ZU 1D9IA 3GICB 3FP7E 5F8XA 1O2HA 2O8UA 3LIWA 1MZDA 5EG4A 2PR3A 3SU5A 8ESTE 2J4IA 3LJJA 1LHEH 1F7ZA 3U98H 4INLA 3W94A 5A8ZA 3AW1A 3UIRA 3PWBA 3TGJE 1UVOA 1O34A 2ZFRH 5GPIB 5L2YH 2D1JA 2UWOA 3K6YA 3ZYDA 4FUIA 2EA3A 4I33A 2GD4B 3BN9A 3ODDA 2FLBH 2FOBA 1O2IA 1IQJA 2VVCA 4Y10E 3EA7A 4O97A 1QQ4A 4AGKA 1CBWC 1OYTH 3ZZ8A 1F92A 2KAIA 3GY4A 3KGPA 1QGFA 1AKSA 2GZ9A 4FUHA 1O31A 2I6QA 1BBRE 2VNTA 1D4PB 2H2ZA 3T25A 3ENSB 1HAPH 2CN0H 1DXPA 3FANA 3RXJA 1RS0A 3D49H 2BLQA 5T6FA 4X2VA 4X6OA 1V2LT 2PTNA 2EEKA 3RXFA 1HAVB 1C1QA 3M3SA 2OC0A 2F9OA 2IN2A 1F0RA 4O03A 5E0HA 4Y6DA 1T31A 4A5TS 2VIVA 2F9NA 1EZUC 4AOQA 2HWLB 3BTEE 4MNYA 1RGQA 4IN2A 3SGAE 1A1RA 1T4VH 3SJ9A 1C2KA 5AFZH 2B0FA 1S0RA 6ESTA 2QCYA 4XBDA 5C1YA 1XUGA 1SGDE 4DT7B 4WWYA 2CHAB 1C5QA 1XXFA 1NFWA 2RCEA 1QCPA 1P2JA 1DPOA 3T2NA 3RMNH 2I6SA 3GOVB 2HNTF 3PLKA 1UTJA 1Z1JA 2VIPA 4FUGA 3BTKE 2ZPQA 1GG6C 3M5MA 1GHBF 2Z9GA 2J92A 2PTCE 1FIWA 2QXJA 1E0FD 3NKKA 4WJG2 4FU8A 1QRWA 1O2GH 4UONA 3RXPA 2B5TB 1SC8U 3BEIB 2G55A 4DY7B 4IW4E 2O8MA 2AMQA 1Y8TA 1BRBE 4ABAA 1ETTH 2ZG0H 1CGJE 3F9EA 3VB7A 1P03A 1D3QB 2G81E 1TPOA 1UCYK 2FYQA 3V3MA 1KDQB 2OINA 3L3TA 5J4SA 3BEUA 3ZZDA 4Y8YA 1C5TA 1G9IE 2P93A 9ESTA 2PKAA 4BXWA 3ZYEA 1CT0E 2AIQA 3A80A 4IN1A 4IS5A 2A31A 2FESH 4MDSA 2BDGA 5GDSH 1S5SA 1E36B 3H7OA 4AG1A 2AGIX 4CRBA 2HRVA 2FDAA 1ORFA 2XXLA 3PWCA 4YOJA 3GY2A 3CP7A 4NA7A 2V6NA 5CE1A 1ZPZA 3H7TA 3RM2H 3P8GA 4JYTA 1LO6A 1Q3XA 1O2SA 5CHAC 3S9BA 3R0FA 3M61U 2ZFPH 1ELCA 1GBEA 4KP0A 2BDIA 1TFXA 3ZZ4A 1HBTH 4A1TA 1TBRH 4IGDA 1XVMA 3OY6U 1OWEA 1YKTA 1RFNA 1XUFA 1THPB 1GJ6A 4OS1A 2VBCA 1O5AB 1CA0B 1O3MA 1T4UH 1YPEH 3EAJA 1ELBA 1GBCA 1V2RT 8LPRA 1O3EA 1GI8B 2VJ1A 4JYUH 1IQKA 2HNTC 1G3DA 1OWKA 3Q00A 1K2I1 1P8VC 3UFAA 3SUFA 1ELAA 4AZ2B 2JH0D 2PGQB 3BTWE 4A1XA 4ZAEA 3QZQA 1TOMH 2ZFTA 3P6ZB 1A5HA 1NRNH 3ATLA 1V2WT 3KQDA 3SOSA 1ZGIA 2P95A 1PYTD 2BDYA 5B6OA 1GJAB 3SBKA 1C5OH 2Y7XA 1UTKA 1CO7E 3B23B 1MUEB 1C5WB 3OYPA 4DG4A 3RU4D 2H6MA 1AUJA 1QJ1B 1IQFA 5B6LA 3KEEA 3WY8A 1ZSJA 3SU4A 2ZC9H 1SPJA 1VR1H 3TJNA 2WYGA 4MPWA 1Y3UA 2BD5A 1CQQA 1O3NA 4YO9A 1HJAC 1GJ7B 4FUBA 3Q3YA 3GY8A 1VJAU 2Z9LA 1SHHB 1MTNC 2WPIS 2P16A 1C2HA 2BMGB 1JXPA 3QX5H 2YNBA 4X1PU 1N1LA 1P01A 3A7WA 4CR5A 1HAVA 4K1TA 2FI3E 4ZHMU 2ZQ1A 3HPTB 1MKWH 4ABGA 1TIOA 3MH7A 1AGJA 1BHXF 2ZHEH 3O8RA 3MU1A 4AG2A 1NROH 5FCKA 3MNSA 4BAQB 3U8RH 1O2NA 1GDNA 1M9UA 1L1JA 1PQ8A 2W26A 1EJMA 1EAXA 1KXBA 1W8BH 1FQ3A 4K2YA 4E05H 5LPRA 2BD7A 5A09A 4CRFA 4JCNA 2BQWB 5T6GA 1LVBA 2BYAX 1QA7A 1C2MA 1BMNH 1LDTT 1P12E 3ATMA 2XYAA 3PB1E 1GHYH 3QLPH 3RC4A 2VH6A 1TNJA 1ZTLA 2ZFSA 4MPVA 1YPJH 1BIOA 1YLDA 3H5CB 1L1NA 3BIVH 2F9UA 2DUCA 3A83A 5F03A 3ODFA 2UWLA 4BTUB 2SGPE 1AIXH 1FXYA 1N8OB 1AD8H 4Y76A 4ZHAA 3A8AA 1O3KA 2BB4A 1W2KH 5EODA 1GWAA 5A0CA 3UPEA 2O8LA 4Q7YA 1WTGH 1C5RA 3SHCH 1F0SA 2RG3A 3E6PH 2ZFFH 3ZVFA 4ABHA 2IJD1 1CE5A 1SGIB 5GNDA 1O2UA 1V2MT 1SGCA 2GV7A 1KIGH 3PYHA 4B2AA 3ZVCA 2ZU2A 3Q3KA 2NU1E 2FODA 3BTFE 3TJOA 4HI3A 4UFFH 5C67A 2OCVB 1C4V2 1QY6A 3TJVA 4K1SA 1DE7H 1TQ0B 3LDXH 3W95A 1L4ZA 1KDQA 5FBIA 1Z71A 2TPIZ 3EGKH 2VGCC 1YYY1 1BMAA 1GBBA 3GDUA 3M7TA 1ESAA 1KLIH 3F6UH 1V2OT 6CHAB 4XBBA 3PM3A 3OTJE 1C4U2 2P8OB 4DOQA 1AZ8A 1UK3A 5K7RA 2F9BH 1GVKB 3BTME 1H8IH 2XC4A 1ZTJA 2BQ7B 4Y79A 2BOHB 1QB9A 2Z9IA 4TY6A 4CBNA 1Y5BT 4GPGA 2LPRA 1O35A 4NIXA 1TGTA 3GCHC 2PHBA 1K1LA 3MU8A 3ZZ9A 1BA8B 2Q6FA 2HLCA 4AN7A 1VGCB 2VINA 3DD2H 2FI5E 3SQEE 1WYKA 5JB9S 5TCAA 1GI7B 2Q6DA 3P8FA 4YESB 2XTTB 1MBQA 4VGCB 1YPHC 3KN2A 3MMGA 4Z6AH 1VCPA 1GI3A 3RXAA 4IBLH 1C1MA 1O3AA 1V3XA 5ETXA 1Y3YA 3V12A 2A5IA 2JETB 1LKBA 3AVZA 2G4TA 1ZRKA 1T8OA 3DUXH 2BOKA 4X8TH 3RMOH 4MNWA 1LCYA 3BTGE 1YLCA 2TGTA 3JZ2B 4Q80A 4WH8A 3M35A 3TH2H 1HV7A 1WAYB 2GT7A 4E7NA 1B0EA 4TY7A 3TK6A 1FPHH 4CRDA 1A5GH 5JDUB 4X8UH 5H4IB 1ZHRA 5DP4A 2ZTXA 5EPNA 2PUQH 2R0LA 3B8JA 1BCUH 3TIUA 1MZAA 2YOLA 2FMJA 1SGNE 2GTBA 1CU1A 1C2JA 1MTVA 2GMTB 1KLTA 1V2NT 2WUBA 4NZQA 4UE7H 1ELTA 2J9NA 1SB1H 2PUXB 1GBTA 6LPRA 2ZEBA 4ZROA 4D76A 3CENA 2VIDA 1FI8A 5J4QA 3B9FH 3ZV9A 2C4FH 2FTMA 1EX3A 1TABE 4RKJB 4H42U 3SJKA 2Y6TA 3PV2A 1UK4A 2ZWLH 1PPZA 3NZIA 2HALA 3SNEA 1AY6H 3BIUH 1JMOH 1EJNA 3RLYH 1DWCH 1T8MA 2Z6BD 3DHKH 2BHGA 2GGVB 3LJOA 3K6ZA 3QGJA 3SU1A 3KIDU 1BRCE 1G32B 1MU8B 2BD2A 2XC5A 2AEIH 1F0UA 3BTDE 1ESBA 2QN5T 3A8BA 4D7FA 2OP9A 2R3UA 2VH0A 3ZVEA 1SI5H 1C1PA 2XWBI 1OS8A 1CVWH 1SQTA 1A4WH 1TMBH 5HM2A 2P59A 3D62A 1C2IA 1O2WA 2ANWA 1G2MA 1MAYA 1GI6A 5G4BA 2F83A 3GYMA 1FY1A 2GZ7A 3M5LA 4ZXXH 1SOTA 4Q7ZA 3O8DA 1A2CH 2H9TH 4MNVA 5C1XA 3MTYA 1EB1H 5T3HA 1YF4A 3NCLA 1UHBB 1BDAA 2CHAC 4TPYA 4CH2B 5DP5A 2ZU4A 2O9QA 3SJOA 1NFXA 5AF9H 3STJA 1KTTB 3MOCA 1AN1E 1EP6A 1EAIA 1NESE 4NZLA 1P11E 2Z3DA 2BD8A 4AB8A 3A87A 2SNWA 1GI1A 2NU0E 2BQ6B 4GHQA 3URCA 4ZKSU 2A2XH 2FPZA 1W13U 2C8YB 2PGBB 4WXIA 4DIHH 1A0LA 3ZVDA 1X7AC 2FWWA 3NWUA 1HUTH 4JYVH 1CT2E 2C90B 1O5CB 3ZZ3A 1J14A 3M37A 6GCHF 4UFDH 4Y7AA 3PLPA 1S84A 2GCTB 5LH8A 1DY9A 3LH1A 1IOEA 5C1UA 5JB8S 3HATH 1DY8A 2D26C 4OS4A 5K0HA 5GCHF 1O2QA 3VB4A 3BTHE 3LGUA 2A5KA 3DFJA 1ZZZA 2ZO3H 2G5VA 2WPLS 3A81A 4KELA 1OOKB 3E3TA 4K3JA 2W7SA 3LGTA 1A3BH 2A5AA 1DSTA 4WY3A 4D9RA 4X0WU 2Q6GA 2ZECA 1CHOF 5L30H 3CS7A 3RXBA 2BX3A 1HRTH 1TX8A 1RRKA 2FEQH 1TONA 2ZF0H 1QHRB 2P3UB 3GDVA 2WUCA 2BZAA 5DGJA 2HOBA 2NWNA 1GJ9B 3A7XA 1AWFH 1O5GH 3SGQE 2XBVA 4NA8A 1AFQC 1CA8B 1JWTA 2WPKS 2FX6A 4MPUA 3RXSA 1O2VA 1ZJKA 1H9LB 1O38A 1EOLA 4K69A 4IC5A 1O3LA 4I8GA 1HNEE 1IQLA 2VIWA 1IQIA 1BOQA 1CA0C 5EQQA 1MTWA 1DM4B 1LHGH 3AAUA 1NRPH 2FOMB 4FXGH 2IOTA 3SI3H 1FY8E 2J95A 3UOPA 1V6DA 3KCGH 1WCZA 2OQUA 3M7UA 1W7GH 4A6LA 1LQDB 2O8TA 5JBTA 2SFAA 3QGNB 4A7IB 1UVUH 2ULLA 4YZUA 5DP8A 4GLYA 5FHTA 1SGEE 3IG6B 3M3TA 2ZTZA 1GI0A 1GMDF 4QT8C 3VB5A 1MMJN 1DWDH 2BZ6H 2OBQA 2V3HH 3S7HB 1O2LA 4UD9H 1PPGE 2A4RA 1S81A 3VGCB 2J34A 2BY6X 1S6FA 1C4Y2 1C5MD 1GMCF 1O39A 1KTSB 4JK6A 1PFXC 4MVNA 1C9TA 3BG8A 1SGFG 4H6TA 4OGXA 1OKXA 1GGDB 1SOZA 2ZDNA 3F1SB 4YT7H 2CGAA 3IWMA 1SR5C 2R2WU 4CHAB 1JRTA 5DKMA 1J16A 1ZMNA 2TIOA 3PTBA 3A84A 4ISLA 5CMXH 1GDQA 1N6YA 4CRGA 3U8OH 3PO1B 4K1EA 1A7SA 1DWEH 2HGTH 4B76A 4KTCA 1TLDA 4DW2U 1C5XB 5F8TA 1AFEH 1ZOMA 1SGRE 1VCQA 1TWXB 2B7DH 1YCPK 1F0TA 2F9VA 1GBMA 3KHVA 1A5IA 3UUZA 4LOYH 3SV9A 4BOHA 3SHAH 1NZQH 3AASA 1EQ9A 4MQAA 4X2XA 3RP2A 1C1OA 4FUCA 3UWJH 2CV3A 4I7YH 1GHBG 1JRSA 2BY7X 1WOFA 2F91A 1WBGB 1GL0E 4Y8ZA 4YTAA 1C1SA 1OWIA 4OM9A 4K5ZA 1K1IA 1SGTA 2J38A 1MTSA 1UHBA 2ZGXH 3SUGA 2ZHFH 4AFUA 3H09A 4FU7A 1GJBB 1A3EH 5DJ7A 2P94A 2GKVE 4OGYA 3LONA 1B7XB 3HK3B 3HK6B 3U1IB 1A0HB 1UVTH 4GVUA 1WQVH 1N8OC 3IITA 1QFKH 2QY0B 2R2MB 1LMWB 1DICA 2ILNA 3P95A 1HAZB 2J2UA 7KMEH 1BBRH 1TB6H 1ANBA 3RXVA 3SV2H 1WQSA 1WV7H 4A1VA 1A0JA 4NIWA 2VB0A 4AX9H 1BMLA 2WYJA 4DCDA 1RTFB 2ZTYA 1HAGE 1C5ZB 4B74A 5I46H 2THFB 3SO3A 3I29A 4KTUA 4M7GA 2GDEH 1HXEH 2V3OH 1P2MA 2OQ5A 2A0QB 1EXFA 1GJDB 1HAYB 3RXIA 1AWHB 4NWKA 5AHGH 3A82A 1LVYA 6CHAC 1A61H 1FDPA 4Y71A 2P8OC 5DP6A 4X6NA 4WMDA 3S69A 1E38B 3MNXA 1TALA 4B1TA 2ZGJA 2A7HA 3AAVA 4YOIA 1HAOH 3VFEA 3SNCA 1UTQA 2ZDAH 1LHDH 1BTWA 4Y11E 3V13A 1WXRA 1XVOA 2BD9A 1VGCC 1K1NA 4AORA 1SVPA 1XKBC 1ZPCA 2ESTE 1BB0B 4I32A 1ETSH 1QRZA 2A4QA 2B8OH 3TPIZ 4GUXA 1PYTC 3SJ8A 3N7OA 1TGCA 2ZFQH 1F5LA 1PPEE 1VITH 2JETC 5PTPA 1YP9A 1TPPA 1Z1IA 2BDCA 4AFZA 4CR9A 2FS8A 1OWHA 2G8TA 1K1JA 3P92A 2ZU5A 5FCRA 3SUEA 2A2QH 3ZVBA 2OLGA 4NSVA 2AERH 1OSSA 1E35B 1O2OA 1GDUA 1K9OE 1RTKA 1MU6B 5DP9A 1XUHA 1LQEA 2H1UA 2WV4A 2ZDMA 2ZU3A 2WPMS 3LKWA 3U69H 4YM9A 4LK4A 2XNIA 1K1OA 3STIA 1QTFA 5ABWA 2ZPSA 1ACBE 1F5RA 1O2XA 3RXRA 4UFEH 1PPHE 1YPGH 5LPFA 3V0XA 2GMTC 3TNSA 1AB9C 4LZ1H 1LPZB 1ZJDA 2GCHF 2HVXA 2WINI 5DG6A 2CMYA 2ZP0H 5EGMA 1O3IA 3GCOA 1SL3A 3KQEA 1DITH 3SI4H 1ESTA 5IDKA 1Q2WA 2P3TB 2EI6A 3S9CA 1DVAH 2C3SA 2HPQH 1P09A 3ITIA 2AGGX 1KXAA 4I8LA 3GY5A 1MKXH 1SMFE 2BLVA 4GCHG 4MG3A 2DE9A 1O5FH 4SGAE 4ABDA 4GCHF 1GHZA 5F6MA 8GCHG 1T32A 1KY9A 2OC8A 3LU9B 7LPRA 1P06A 3K2UA 8GCHF 3LGYA 1EAUA 4NFFA 1NU9A 3E16B 2G4UA 1C9PA 1DDJA 1P2QA 1BTZA 2TGPZ 4NG9H 1FMGA 2G51A 1P9SA 2UUYA 3TH4H 4DVAU 4GHTA 3Q3XA 2VVVA 1F5KU 2PKSC 1C1UH 1LHCH 2FTLE 3FZDA 4JK5A 4FU9A 1NS3A 1BITA 2Y5HA 2BDHA 2Q1JA 1L2EA 1Z7KA 1GJ4H 2PW8H 4K8BA 1G30B 3TK9A 2WPHS 3MO9A 2AMPA 3Q76A 3ZZCA 2AS9A 3MHWU 1Y5UT 1KXEA 2ZDVH 4Q7XA 1OYQA 1O3JA 1CGIE 1ZMLA 3A7VA 7GCHF 1HDTH 4UDWH 1BBRK 1NRSH 3LC3A 5LPEA 2IPHA 4XE4A 5JBAS 1D6RA 3D23A 1TX7A 3V7TA 1NN6A 1TE0A 3E8LA 2ZKSA 3QWCH 5BPEA 1YPKH 1C5SA 1JOUB 2BXUH 2ZZUH 2GZ8A 1BRAA 1TBZH 4X2YA 3T62A 3A7YA 3RXQA 1AVGH 4ZH8A 1TBQH 4XOJA 1BJUA 2OD3B 4B2BA 1ZYOA 3EA8A 5E0GA 3M7QA 3SNBA 1BJVA 1K22H 3ESTA 3RXHA 1KLJH 1Y3XA 2WV5A 4GAWA 5F8ZA 3A8CA 1XX9A 2ASUB 2H5CA 2GCTC 1Y3WA 3RXEA 2XRCA 4CBOA 4X1QU 1RJXB 1P04A 2VVUA 1E34B 3RXOA 2ANKH 3HGPA 1O5DH 2FX4A 4X8SH 1FAKH 4FVBA 2BX4A 3SV8A 4K8YA 1OP2A 3RUOA 2UUKB 2ODYB 2SGFE 1BTPA 2JKHA 1GBFA 4D8NA 3A7TA 1GHWH 1GMHG 3VXEH 2TGDA 3GY3A 3U8TH 1V2TT 3MNCA 5FBEA 1GMHF 3L6PA 1ZR0A 4I8HA 4AYYB 5HYOA 4Q2KA 5SGAE 1BT7A 3QN7A 2FOAA 2ZCLP 3OTPA 1SSXA 5EXMA 4BANB 1AVWA 1BTHH 2QA9E 4X8VH 3SU0A 1UTPA 4WMEA 3EA9A 1BTXA 2OC7A 3F9FA 3FVFB 4WVPE 1FJSA 3AK5A 1RIWB 1FZZA 2A45B 1P3CA 1Z6JH 5JBBS 1DXWA 2Z7FE 3BG4B 1TRMA 2F9PA 4ABFA 1D6WA 1P2OA 5E0JA 5GIBA 2FXRA 1PPFE 2D8WA 4A92A 3O8BA 2QXGA 5FPTA 1TOCB 1Z8RA 3E0PB 3LGWA 1LVMA 1RD3B 2PV9B 3CS0A 3I78A 4NIVA 1O2MA 2A4OA 3P8NA 1NT1A 5DPAA 4J1YA 1QB1A 3GYLB 1G2LA 3UTUH 1FV9A 3K65B 5EU8A 4ASHA 1EATA 2O8WA 4B71A 1P3EA 2WHXA 1EUFA 1GVZA 3SNDA 3RXMA 2TGAA 2C8ZB 1BTUA 3ATKA 3PMJA 1DOJA 3HGNA 1MKWK 1QBNA 1JBUH 4YOGA 5HM9A 1MD8A 2XCNA 1HPGA 4TWWA 2ALPA 3VXFH 1MKXK 1CSOE 1FN6A 1GCTB 3QK1A 1QQUA 1JIRA 4X1RU 2BLWA 1MQ5A 2A4GA 1BUIA 4NA9H 1GHAF 3DFLA 3SU6A 4CHAC 3EDXB 5IYTA 3DT0H 2ZI2H 1AU8A 1TA6A 3BEFB 3MH5A 1GL1A 3SORA 3NXPA 1GI4A 1NM6A 4INKA 4SGBE 3PO1C 1BZXE 1O2PA 2CF8H 4BTTB 1IAUA 5TJXA 1TMUH 1O2YA 3GY7A 4ISHH 2VWNA 2GDDA 3FP6E 1MAXA 2C93B 1O3DA 2ZCHP 1ZSLA 4NFEA 3SUDA 2GV6A 1W10U 1DSUA 4JZEH 1GI5A 2BY5X 3PV5A 1A46H 2Y5GA 3TITA 1XKAC 1EJAA 1O3PB 4KTSA 3VPKA 1O5EH 5FAHA 2R0KA 3ZV8A 1IHSH 5DP7A 4WXVA 3F68H 2XBXA 1FY4A 4KKDA 3TJUA 4CREA 1Z8JB 3QTVH 1XUJA 6GCHG 4H4FA 5I25A 1NU7B 4O3TA 3MO3A 3ZZ6A 5L2ZH 3VEQB 3ELAH 1SQAA 4RN6A 1H8DH 5GCHG 1EPTB 2FLRH 5ESTE 2A7JA 2AMDA 1DLKB 1FLEE 4HGCA 2W3KA 1O3BA 4BAHB 1SG8B 4JZ1A 1XMNB 3RXDA 2BM2A 5A0BA 3RC5A 1TNHA 3UR6A 1KXDA 1DUAA 2VIQA 2RA3A 1EAWA 2TRMA 4UFGH 3SNAA 1C1NA 2HPPH 1VITF 2QYIA 1L4DA 3GCHB 1CHOG 1O37A 2IJOB 2JH6D 3LC5A 1IQMA 2VWMA 3QTOH 2RDLA 3LOXA 1O2ZA 3E1XB 4IC6A 4I31A 4RI0A 3UWIA 2F3CE 5JYIA 2QF3A 1NY22 2ZQ2A 1AE5A 1SFIA 3A88A 3T27A 7ESTE 3PMHB 1PPBH 3M3VA 1ARBA 3UQOA 1D3PB 1ZRBA 1DS2E 5EW1H 5HXFA 1ETRH 3UREA 1DFPA 1DUEA 2ZGBH 1O3OA 4HFPB 1AE8H 1GPZA 2ZHQH 2Z9JA 4INHA 1SGPE 2SGAA 1C2FA 3ZVAA 1HGTH 3KL6A 4AFSA 1TRNA 1MD7A 1Z8IB 4OS2A 2ZA5A 2BY8X 4IMZA 1AHTH 2QF0A 4WMFA 4E06H 5FPYA 3TGIE 1GBHA 1Z6EA 1TAWA 1HYLA 2ODPA 4BNRA 3QDZB 1NRRH 1W11U 1GMDG 1LTOA 1TGBA 1GJ5H 3D65E 4B6EA 4THNH 2H5DA 4XBCA 1W3CA 1QBOA 5C20A 1H4WA 3PMAB 2ZCKP 3NPSA 3GISB 3TLOA 1P2KA 3FFGA 3MNBA 1C2LA 3A85A 2G5NA 4JZIA 3UOUA 5FPSA 1GMCG 2PSXA 5EPYA 3OY5U 1C5VA 1IQNA 2CF9H 1GBDA 1HAHH 3S0NA 2SGQE 3DA9B 1JIMA 4NCYA 3HKJB 1H9IE 4HTCH 4ZXYH 1AO5A 3T5FH 1KYNA 2WZQA 1ZHMA 3ZZAA 1DANH 3SV7A 1FY5A 1C5NH 1AZZA 2OXSA 1UJ1A 3NUMA 3RXLA 2PLXA 2XWAA 1TNGA 5FX6A 1YGCH 3UNRA 2Z9KA 3PTNA 4MNXA 3S9AA 1LHFH 1THRH 4WH6A 2B9LA 4X6PA 3OU0A 3SV6A 1OP8A 1OPHB 2JH5D 3A89A 1C5PA 1QL8A 2BDBA 1T7CA 1UTLM 3TNTA 2YNAA 1BMMH 1XUKA 5C5NA 3BF6H 3ATWA 4ISIH 1C5LH 2EI7A 3GCNA 3Q77A 1ANCA 1Y3VA 1MCVA 4ISOA 1RXPA 4TYDA 1C5YB 1SBWA 3HKIB 4LXBH 4CRCA 4H6SB 3RXKA 1Y59T 2ZGCA 5AVDA 1KSNA 1F2SE 2ZU1A 3OSYA 1AVXA 1HIAB 3M5NA 1ELFA 5JBCS 3A8DA 3RMMH 4IMQA 2ZDKA 5A2MH 1W14U 1YCPM 2M5TA 1YPLH 1P2NA 1TPAE 2W3IA 3L33A 2AIPA 1V2KT 1K28D 4ZUHA 2FOGA 4ZKOU 2FS9A 1UTNA 3GY6A 4BAKB 1C5UA 5TCCA 8KME2 2Y5FA 1EZSC 2F4LA 1VJ9U 3MFJA 1NO9H 1EPTA 4JMYA 4ABBA 5L6NH 1BQYA 2CXVA 1OP0A 9LPRA 2ZNKH 1TGNA 2R3YA 4PROA 3KNXA 4BXSA 3UNQA 4AB9A 1HAXB 2J94A 1LPGB 2SGEE 1C1VH 2QXHA 1NRQH 5T6DA 3U1JB 1HB0B 1SQOA 5EXLA 2Y81A 4MPXA 1PPCE 5T1VA 2OUAA 1KXCA 5A8YA 2BD3A 3PV4A 1WSSH 1NFYA 2UWPA 3T29A 5LGOA 4NWLA 1QJ6B 2CJIA 1AFQB 1HXFH 4FVDA 1ELDE 1V2ST 4MLFB 4VGCC 2WPJS 1XUIA 2Z3CA 1TNLA 3P70B 2ZDLA 4TPIZ 4M9FA 2ZIQH 1XM1A 3URDA 4Y0YE 3TH3H 1LKAA 5C5OA 1QRXA 1AMHA 4NIYA 2FIRH 1PQ7A 2XC0A 3FZZA 1FIZA 3UNSA 2K1QA 1H9HE
chains in the Genus database with same CATH superfamily
4F4OC 1S6HA 1SHYA 1OWDA 3I77A 1P0SH 1TGSZ 2M2AA 2L6OA 1DWBH 4B2CA 2FYRA 1IQHA 1CBWB 2KR7A 1ELGA 1GBJA 4MTBA 2AYWA 1QR3E 2RA0A 3LGVA 1THSH 4DJZB 2BTCE 1GCDA 4ABIA 3SZNA 2QF5A 1ARCA 3BTTE 1BRUP 1W7XH 1PQ5A 1RIWC 4FUJA 5C94A 3G01A 1OWJA 2FZZA 3ZVGA 3BG4C 1DX5M 2JJ1D 2VU8E 3SN8A 2GCHG 2ALVA 3RM0H 1EKBB 1TMTH 3RXUA 4ABEA 4O3UA 4FUFA 1FN8A 4Z0KA 1O2RA 2GT8A 2PSYA 1G37A 3LT3A 5C3NA 1ZHPA 3OX7U 5HIZA 2QAAA 2V35A 2BVXH 2XCFA 1S82A 1K1MA 2A7CA 2STAE 1UTOA 1K21H 4X1NU 2HNTE 1GHXH 1WUNH 2EC9H 5EXNA 1SLUB 3UR9A 5BRRE 1NTPA 4I86A 1V2UT 4HZHA 5EW2H 2DE8A 4ZKNU 1FAXA 1MH0A 2OK5A 4ZHLU 4BAOB 1GHVH 3TK5A 3MU4A 1ELEE 4U01A 1V2QT 3P17H 1YPMH 3FKSD 2BY9X 2VWOA 4XDEA 1QA0A 1FNIA 2FOEA 4YT6H 3RLWH 3QO6A 3UB0A 2XBYA 1OX1A 3RU4E 4ESTE 2UUJB 3SJIA 4XSKU 1WTHD 1C2DA 2C8WB 5C2ZA 1GI9B 1ABJH 2P3FH 4RSPA 1GCTC 2OBOA 3E0NB 3LGIA 2AFQB 3RU4T 1IQEA 3MH6A 1GG6B 3FAOA 4F49A 1P9UA 2GP9B 1EZQA 1TRYA 4WF8A 4BAMB 1K1PA 3KQCA 1T8NA 1HAIH 4LZ4B 1UVSH 1VCWA 3A86A 1HLTH 4FUDA 4YLQH 3TGKE 4B73A 1KXFA 4NGAH 3EQ0H 3GCTG 1Q31A 2Z94A 2AGEX 7GCHG 1P57B 1HJ9A 3QZRA 1HIAA 3GCTF 1Z8GA 1G3CA 1N6XA 1ZTKA 5E2PA 1TPSA 1ID5H 4JZDH 2BDAA 1FUJA 2STBE 2UUFB 1J9CH 1BTYA 2V7QD 2J98A 3BSQA 1YC0A 2FOFA 3SQHE 2J97A 2A32A 1O36A 2XBWA 1DLEA 1UMAH 3TU7H 5EOKA 1O3FA 5DP3A 1O3GA 1MQ6A 3KF2A 4K60A 4AFQA 4FUEA 1C1RA 3E91A 1ANEA 1J15A 3T28A 2BXTH 1EOJA 1V2VT 2LELA 3M36A 3VB6A 3SGBE 4X6MA 5ESBA 1O2KA 1EPTC 5CHAB 1O2JA 3BV9B 1O5BB 1EB2A 1MTUA 2Y82A 3MU0A 5EJLA 4Y7BA 5GJ4B 1EFRD 3PLBA 4OS5A 4O9VA 5E2OA 1ANDA 3ATIA 4UEHH 4DIIH 2PFEA 1TNKA 3KQBA 5AFYH 5E8EH 4GSOA 3RXCA 2H9EH 2WV9A 2A1DB 1O2TA 2OTVA 1QBVH 1WU1A 1ZGVA 3TVJB 2OC1A 2SGDE 3SU3A 1SGYE 2ZGHA 1LVOA 4D7GA 1GJ8B 1P2IA 5GXPA 1O33A 2EI8A 4CH8B 2PWXA 2G52A 2ZHWH 5EQSA 2G00A 1C1TA 1W12U 4HG6A 1D3DB 3F9GA 4FOUC 1MCTA 2NU2E 4RKOB 1ZPBA 4U30A 4R0IA 1QNJA 1UO6A 1GVLA 2ANMH 4ZKRU 1S83A 1QL7A 1SLXB 1IHTH 1GJCB 1P10A 1FPCH 1GBAA 3P8OA 5GWZA 1CHGA 3SZEA 1V2JT 3KQ5A 4B6FA 4JZFH 1YM0A 3MH4A 4U32A 3LH3A 3F9HA 1O3HA 5A0AE 3MO6A 2W5EA 4D9QA 1YBWA 3EE0B 1ELVA 3NK8A 3VB3A 2QIQA 3FOAA 5HIYA 2KAIB 2AH4X 1HJAB 3ZZ5A 4BTIB 1U6QA 2XW9A 1AKSB 1YPHE 3LPRA 3UQVA 1UCYE 4XFQA 1AB9B 1MTNB 4Y0ZE 4YXWD 4TWYA 2BVSH 1O3CA 3BTQE 1B5GH 2FI4E 5EQRA 2NU4E 2R9PA 1INCA 1ZSKA 3SU2A 2VWLA 4OS6A 1NFUA 1TX6A 1SGQE 3VGCC 4J2YB 1G3BA 2ZPRA 4P00A 3RDZA 1SFQB 1ZLRA 2VIOA 5DK1A 3O8CA 1D3TB 2QGRA 1B0FA 5DO4H 1SLVB 2WPDD 2FP7B 5FX5A 1TQ7B 1T8LA 2FOHA 3AW0A 3FP8E 1J17T 2LNCA 5HGGA 1GHAG 1C1WH 1LPKB 3ZZBA 1GGDC 1O30A 3PROA 4KGAA 1NPMA 4Y8XA 1PQAA 2QC2A 1CGHA 3ZZ7A 1P02A 3RXGA 2QV1A 5HMAA 1GBLA 2BD4A 1S0QA 1UTMA 2FO9A 3UY9A 1EP5A 1CT4E 2ODQA 3S7KB 2GX4A 1MBMA 3EYDA 1RTLA 2GVFA 4AYVB 1YCPH 3VG8A 1TYNA 2PKSB 2D2DA 3FO8D 1P05A 4YLUA 1EASA 1L1GA 3K9XB 1DT2A 1COWD 1EZXC 2V0BA 1E37B 1QZ8A 1XXDA 4U2WA 1NBMD 1S85A 4ACAA 2FM2A 1O0DH 3C27B 1H1BA 1VZQH 2ZHDA 4X1SU 1NC6A 5FXLA 2BVRH 2Y80A 1SLWB 1HFDA 2Z3EA 2ANYA 1C2GA 4E7RG 3MU5A 1HJ8A 4DURA 2SNVA 1G3EA 2FOCA 1ABIH 1G36A 2H9HA 1C2EA 2HVYB 4AGJA 1AQ7A 2Y7ZA 2BLOA 3SYJA 2VGCB 3RC6A 3MYWA 1GBKA 3T26A 1KMHB 1QJ7B 4ABJA 1W0YH 1MABB 1UCYH 1GBIA 1UK2A 1QL9A 3A7ZA 2PKAB 3GDSA 1AUTC 1VITG 2TBSA 4R8TB 1QB6A 3E90B 1FONA 4I8JA 1BHXB 3RXTA 3C1KA 5A8XA 2NU3E 3QUMP 4CRAA 3MI4A 1SGFA 1AI8H 1QIXB 4OS7A 1Y5AT 1TNIA 1HCGA 1O32A 3SW2B 2QXIA 3JZ1B 4X2WA 1L0ZA 1PJPA 4ZMAH 4DGJA 2C8XB 1GI2A 1J8AA 2EY4C 3U9AH 3PMBB 1V2PT 3RMLH 1FY3A 4B75A 3F0OA 3M5OA 1ZMJA 1QURH 4NSYA 1TA2A 1IQGA 4ISNA 1UVPA 2W7UA 3R3GB 5JPMH 3MWIU 4I8KA 1OXGA 1W0ZU 1D9IA 3GICB 3FP7E 5F8XA 1O2HA 2O8UA 3LIWA 1MZDA 5EG4A 2PR3A 3SU5A 8ESTE 2J4IA 3LJJA 1LHEH 1F7ZA 3U98H 4INLA 3W94A 5A8ZA 3AW1A 3UIRA 2QF4A 3PWBA 3TGJE 1UVOA 1O34A 2ZFRH 5GPIB 5L2YH 2D1JA 2UWOA 3K6YA 3ZYDA 4FUIA 2EA3A 4I33A 2GD4B 3BN9A 3ODDA 2FLBH 1E1RD 1O2IA 2FOBA 1IQJA 2VVCA 4Y10E 1YWUA 3EA7A 4O97A 1QQ4A 4AGKA 1CBWC 1OYTH 3ZZ8A 1F92A 2KAIA 3GY4A 1H8ED 3KGPA 1QGFA 1AKSA 2GZ9A 4FUHA 1O31A 2I6QA 1BBRE 2VNTA 1D4PB 2H2ZA 2KX4A 3T25A 3ENSB 1HAPH 2CN0H 1DXPA 3FANA 3RXJA 1RS0A 3D49H 2BLQA 5T6FA 4X2VA 4X6OA 1V2LT 2PTNA 2EEKA 3RXFA 1HAVB 1C1QA 3M3SA 2OC0A 2F9OA 2IN2A 1F0RA 3MQKC 4O03A 5E0HA 4Y6DA 1T31A 4A5TS 3CNRA 2VIVA 2F9NA 1EZUC 4AOQA 2HWLB 3BTEE 3WW7A 4MNYA 1RGQA 4IN2A 3SGAE 1A1RA 1T4VH 3SJ9A 1C2KA 3OE7D 5AFZH 2B0FA 1S0RA 6ESTA 2QCYA 4XBDA 5C1YA 5EJZA 1XUGA 1SGDE 4DT7B 4WWYA 2CHAB 1C5QA 1XXFA 1NFWA 2RCEA 1QCPA 1P2JA 5IK2D 1DPOA 3T2NA 3RMNH 2I6SA 3GOVB 2HNTF 3PLKA 1UTJA 2WSSD 1Z1JA 2VIPA 4FUGA 3BTKE 2ZPQA 1GG6C 3M5MA 1GHBF 2Z9GA 2J92A 2PTCE 1FIWA 2QXJA 1E0FD 3NKKA 4WJG2 4FU8A 1QRWA 1O2GH 4UONA 3RXPA 2B5TB 1SC8U 3BEIB 2G55A 4DY7B 4IW4E 2O8MA 2AMQA 1Y8TA 1BRBE 4ABAA 1ETTH 2ZG0H 1CGJE 3F9EA 3VB7A 1P03A 1D3QB 2G81E 1TPOA 1UCYK 2JDID 2FYQA 3V3MA 1KDQB 2OINA 3L3TA 5J4SA 3BEUA 3ZZDA 4Y8YA 1C5TA 1G9IE 2P93A 9ESTA 2PKAA 4BXWA 2XNDD 1CT0E 3ZYEA 2AIQA 5DN6D 3A80A 4IN1A 4IS5A 2A31A 2FESH 4MDSA 2BDGA 5GDSH 1S5SA 1E36B 3H7OA 4AG1A 2AGIX 4CRBA 2HRVA 2FDAA 1ORFA 2XXLA 3PWCA 2KCPA 4YOJA 2KCYA 3GY2A 3CP7A 3F3BA 3W1EA 4NA7A 2V6NA 5CE1A 1ZPZA 3H7TA 3RM2H 3P8GA 4JYTA 1LO6A 1Q3XA 1O2SA 3F2GA 5CHAC 3S9BA 3R0FA 3M61U 2ZFPH 1ELCA 1GBEA 4KP0A 2BDIA 1TFXA 3ZZ4A 1HBTH 4A1TA 1TBRH 4IGDA 1XVMA 2YMSB 3OY6U 1OWEA 1YKTA 1RFNA 2W6ID 5KEDA 1XUFA 1THPB 1GJ6A 2VBCA 4OS1A 1O5AB 1CA0B 1O3MA 1T4UH 1YPEH 3EAJA 1ELBA 1GBCA 1V2RT 8LPRA 1O3EA 1GI8B 2VJ1A 4JYUH 1IQKA 2HNTC 1G3DA 1OWKA 3Q00A 1K2I1 1P8VC 3UFAA 3SUFA 1ELAA 4AZ2B 2JH0D 2PGQB 3BTWE 4A1XA 4ZAEA 3QZQA 1TOMH 2ZFTA 5KGOA 3P6ZB 1A5HA 1NRNH 3ATLA 1V2WT 3KQDA 3SOSA 1ZGIA 2P95A 1PYTD 2BDYA 5B6OA 1GJAB 3SBKA 1C5OH 2Y7XA 1UTKA 1CO7E 3B23B 1MUEB 1C5WB 3OYPA 4DG4A 3RU4D 2H6MA 1AUJA 1H8HD 3F0PA 1QJ1B 1IQFA 5B6LA 3KEEA 3WY8A 1ZSJA 3SU4A 2ZC9H 1SPJA 1VR1H 3TJNA 2WYGA 4MPWA 1Y3UA 2BD5A 1CQQA 1O3NA 4YO9A 1HJAC 1GJ7B 4FUBA 3Q3YA 3GY8A 1VJAU 2Z9LA 1SHHB 1MTNC 2WPIS 2P16A 1C2HA 2BMGB 1JXPA 3QX5H 2YNBA 4X1PU 1N1LA 2J5UA 1P01A 3A7WA 4CR5A 1HAVA 4K1TA 2FI3E 4ZHMU 2ZQ1A 3HPTB 1MKWH 4ABGA 1TIOA 3MH7A 1AGJA 1BHXF 2ZHEH 3O8RA 3MU1A 4AG2A 1NROH 5FCKA 3MNSA 4BAQB 3U8RH 1O2NA 1GDNA 1M9UA 1L1JA 1FX0B 1PQ8A 2W26A 1EJMA 1EAXA 1KXBA 1W8BH 1FQ3A 4K2YA 4E05H 5LPRA 2BD7A 5A09A 4CRFA 4JCNA 2BQWB 5T6GA 1LVBA 2BYAX 3OAAD 1QA7A 1C2MA 1BMNH 1LDTT 1P12E 3ATMA 2XYAA 3PB1E 1GHYH 3QLPH 3RC4A 2VH6A 1TNJA 1ZTLA 2ZFSA 4MPVA 1YPJH 1BIOA 4P02A 1YLDA 3H5CB 1L1NA 3BIVH 2F9UA 2DUCA 3A83A 5F03A 3ODFA 2UWLA 4BTUB 2SGPE 1AIXH 1FXYA 1N8OB 1W0KD 1AD8H 4Y76A 4ZHAA 3A8AA 1O3KA 2BB4A 1W2KH 5EODA 1GWAA 5A0CA 3UPEA 2O8LA 4Q7YA 1WTGH 1C5RA 3SHCH 1F0SA 2RG3A 3E6PH 2ZFFH 3ZVFA 4ABHA 2IJD1 1CE5A 1SGIB 2K8IA 1O2UA 5GNDA 1V2MT 1SGCA 2GV7A 1KIGH 3PYHA 4B2AA 3ZVCA 2ZU2A 3Q3KA 2NU1E 2FODA 3BTFE 3TJOA 4HI3A 4UFFH 5C67A 2OCVB 1C4V2 1QY6A 3TJVA 4K1SA 1DE7H 1TQ0B 3LDXH 3W95A 1L4ZA 1KDQA 5FBIA 1Z71A 2TPIZ 3EGKH 1WDIA 2VGCC 1YYY1 1BMAA 1GBBA 3GDUA 3M7TA 1ESAA 1KLIH 3F6UH 1V2OT 6CHAB 4XBBA 3PM3A 3OTJE 1C4U2 2P8OB 4DOQA 1AZ8A 1UK3A 5K7RA 3PRBA 1W0JD 1GVKB 2F9BH 3BTME 1H8IH 2XC4A 1ZTJA 2BQ7B 4Y79A 2BOHB 1QB9A 2Z9IA 4TY6A 4CBNA 1Y5BT 4GPGA 2LPRA 1O35A 4NIXA 1TGTA 1S6LA 3GCHC 2PHBA 1K1LA 3MU8A 3ZZ9A 1BA8B 2Q6FA 2HLCA 4AN7A 1VGCB 2VINA 3DD2H 2FI5E 3SQEE 1WYKA 5JB9S 5TCAA 1GI7B 2Q6DA 3P8FA 4YESB 2XTTB 1MBQA 4VGCB 1YPHC 3KN2A 3MMGA 4Z6AH 1VCPA 1GI3A 3RXAA 4IBLH 1C1MA 1O3AA 1V3XA 5ETXA 1Y3YA 3V12A 2A5IA 2JETB 1LKBA 3AVZA 2G4TA 1ZRKA 1T8OA 3DUXH 2BOKA 4X8TH 3RMOH 4MNWA 1LCYA 3BTGE 1YLCA 1BMFD 2TGTA 3JZ2B 4Q80A 4WH8A 3M35A 3TH2H 1HV7A 1WAYB 2GT7A 4E7NA 1B0EA 4F48B 4TY7A 3TK6A 1FPHH 4CRDA 1A5GH 5JDUB 4X8UH 5H4IB 1ZHRA 5DP4A 2ZTXA 5EPNA 2PUQH 2R0LA 3B8JA 1BCUH 3TIUA 1MZAA 2YOLA 2FMJA 2KM0A 1SGNE 2GTBA 1CU1A 1C2JA 1MTVA 2GMTB 1KLTA 1V2NT 2WUBA 3KYFA 4NZQA 3FN8A 4UE7H 1ELTA 2J9NA 1SB1H 2PUXB 1GBTA 6LPRA 2ZEBA 4ZROA 4D76A 3CENA 2VIDA 1FI8A 5J4QA 3B9FH 3ZV9A 2C4FH 2FTMA 1EX3A 1TABE 4RKJB 4H42U 3SJKA 2Y6TA 3PV2A 1UK4A 2ZWLH 4ASUD 1PPZA 3NZIA 2HALA 3SNEA 1AY6H 3BIUH 1JMOH 1EJNA 3RLYH 1DWCH 1T8MA 2Z6BD 3DHKH 2BHGA 2GGVB 3UAIC 3LJOA 3K6ZA 3QGJA 3SU1A 3KIDU 1BRCE 1G32B 1MU8B 2BD2A 2XC5A 2AEIH 1F0UA 3BTDE 1ESBA 3WWBA 2QN5T 3A8BA 4D7FA 2OP9A 2R3UA 2VH0A 3ZVEA 1SI5H 1C1PA 2XWBI 1OS8A 1CVWH 1SQTA 1A4WH 1TMBH 5HM2A 4Q63A 2P59A 3D62A 1C2IA 1O2WA 2ANWA 1G2MA 1MAYA 1GI6A 5G4BA 2F83A 3GYMA 1FY1A 2GZ7A 3M5LA 4ZXXH 1SOTA 4Q7ZA 3O8DA 1A2CH 2H9TH 4MNVA 5C1XA 3MTYA 1EB1H 5T3HA 1YF4A 3NCLA 1UHBB 1BDAA 2CHAC 4TPYA 4CH2B 4DT4A 5DP5A 2ZU4A 2O9QA 3SJOA 1NFXA 5AF9H 3STJA 1KTTB 3MOCA 1AN1E 1EP6A 1EAIA 1NESE 4NZLA 1P11E 2Z3DA 2BD8A 4AB8A 3A87A 2SNWA 1GI1A 2NU0E 2BQ6B 4GHQA 3URCA 4ZKSU 2A2XH 2FPZA 2KCAA 1W13U 2C8YB 2PGBB 4WXIA 4DIHH 1A0LA 3ZVDA 1X7AC 2FWWA 3NWUA 1HUTH 4JYVH 1CT2E 2C90B 1O5CB 3ZZ3A 1J14A 3M37A 6GCHF 4UFDH 4Y7AA 5EJ1A 3PLPA 4TSFD 4XD7D 1S84A 2GCTB 5LH8A 1DY9A 3LH1A 1IOEA 5C1UA 5JB8S 3HATH 1DY8A 2D26C 4OS4A 5K0HA 5GCHF 1O2QA 3VB4A 3BTHE 3LGUA 3DCLA 2A5KA 3DFJA 1ZZZA 2ZO3H 2G5VA 2WPLS 3A81A 4KELA 1OOKB 3E3TA 4K3JA 2W7SA 3LGTA 1A3BH 2A5AA 1DSTA 4WY3A 4D9RA 4X0WU 2Q6GA 2ZECA 4AC9A 1CHOF 5L30H 3CS7A 3RXBA 3F2HA 2BX3A 1HRTH 1TX8A 2HLDD 1RRKA 2FEQH 1TONA 2ZF0H 1QHRB 2P3UB 3GDVA 5C17A 2WUCA 2BZAA 5DGJA 2HOBA 2NWNA 1GJ9B 3A7XA 1AWFH 1O5GH 3SGQE 2XBVA 4NA8A 1AFQC 1CA8B 1JWTA 2WPKS 2FX6A 4MPUA 3RXSA 1O2VA 1ZJKA 1H9LB 1O38A 1EOLA 4K69A 4IC5A 1O3LA 2YMSC 4I8GA 1HNEE 1IQLA 2VIWA 1IQIA 1BOQA 1CA0C 5EQQA 1MTWA 1DM4B 1LHGH 2YMSD 3AAUA 1NRPH 2FOMB 4FXGH 2IOTA 3SI3H 1FY8E 2J95A 3UOPA 1V6DA 3KCGH 1WCZA 2OQUA 3M7UA 1W7GH 4A6LA 1LQDB 2O8TA 5JBTA 2SFAA 3QGNB 4A7IB 1UVUH 2ULLA 4YZUA 5DP8A 4GLYA 5FHTA 1SGEE 3IG6B 3M3TA 2ZTZA 1GI0A 1GMDF 4QT8C 3VB5A 1MMJN 1DWDH 2BZ6H 2OBQA 2V3HH 3GS9A 3S7HB 1O2LA 4UD9H 1PPGE 2A4RA 1S81A 3VGCB 1UW7A 4Z1MD 2J34A 2BY6X 1S6FA 1C4Y2 1C5MD 1GMCF 1O39A 1KTSB 4JK6A 1PFXC 4MVNA 1C9TA 3BG8A 1SGFG 4H6TA 4OGXA 1OKXA 1GGDB 1SOZA 2ZDNA 3F1SB 4YT7H 2CGAA 3IWMA 1SR5C 2R2WU 4CHAB 1JRTA 5DKMA 1J16A 1ZMNA 2TIOA 3PTBA 3A84A 4ISLA 5CMXH 1GDQA 1N6YA 4CRGA 4FETA 3U8OH 3PO1B 4K1EA 1A7SA 1DWEH 2HGTH 4B76A 4KTCA 1TLDA 4DW2U 1C5XB 5F8TA 1AFEH 1ZOMA 1SGRE 1VCQA 1TWXB 2B7DH 1YCPK 1F0TA 2F9VA 1GBMA 3KHVA 1A5IA 3UUZA 4LOYH 3SV9A 4BOHA 3SHAH 1NZQH 3AASA 1EQ9A 4MQAA 4X2XA 3RP2A 1C1OA 4FUCA 3UWJH 2CV3A 4I7YH 1GHBG 1JRSA 2BY7X 1WOFA 2F91A 1WBGB 1GL0E 2V3MA 4Y8ZA 4YTAA 1C1SA 1OWIA 4OM9A 4K5ZA 1K1IA 1SGTA 2J38A 5F53A 1MTSA 1UHBA 2ZGXH 3SUGA 2ZHFH 4AFUA 3H09A 4FU7A 1GJBB 1A3EH 5DJ7A 2P94A 2GKVE 4OGYA 3LONA 1B7XB 3HK3B 3HK6B 3U1IB 1A0HB 1UVTH 4GVUA 3PRDA 1SKYE 1WQVH 4RT1A 1N8OC 3IITA 1QFKH 2QY0B 2R2MB 1LMWB 1DICA 2ILNA 3P95A 1HAZB 2J2UA 7KMEH 1BBRH 3N7EA 1TB6H 1ANBA 3RXVA 3SV2H 1WQSA 1WV7H 2W6JD 4A1VA 1A0JA 4NIWA 1SQRA 2VB0A 5FL7D 4AX9H 1BMLA 2WYJA 4DCDA 1RTFB 2ZTYA 1HAGE 1C5ZB 4B74A 5I46H 2THFB 3SO3A 3I29A 4KTUA 4M7GA 2GDEH 1HXEH 2V3OH 1P2MA 2OQ5A 2A0QB 1EXFA 1GJDB 1HAYB 3RXIA 1AWHB 4NWKA 5AHGH 3A82A 1LVYA 1OHHD 6CHAC 1A61H 1FDPA 4Y71A 2P8OC 3KYGA 5DP6A 4X6NA 4WMDA 3S69A 1E38B 3MNXA 1TALA 4B1TA 2ZGJA 2A7HA 3AAVA 4YOIA 1HAOH 3VFEA 3SNCA 1UTQA 2ZDAH 1LHDH 1BTWA 4Y11E 3V13A 5CHBA 1WXRA 1XVOA 2BD9A 1VGCC 1K1NA 4AORA 1SVPA 1XKBC 1ZPCA 2ESTE 1BB0B 4I32A 1ETSH 1QRZA 2A4QA 2B8OH 3TPIZ 4GUXA 1PYTC 3SJ8A 3N7OA 1TGCA 2ZFQH 1F5LA 1PPEE 1VITH 2JETC 5PTPA 1YP9A 1TPPA 1Z1IA 2BDCA 4AFZA 4CR9A 2FS8A 1OWHA 2G8TA 1K1JA 3P92A 2ZU5A 5FCRA 3SUEA 2A2QH 2L74A 3ZVBA 2OLGA 4NSVA 2CK3D 2AERH 1OSSA 1E35B 1O2OA 1GDUA 1K9OE 1RTKA 1MU6B 5DP9A 1XUHA 1LQEA 3DSOA 2H1UA 2WV4A 4XRNA 2ZDMA 3DSGA 2ZU3A 2WPMS 3LKWA 3U69H 4YM9A 4LK4A 2XNIA 1K1OA 3STIA 1QTFA 5ABWA 2ZPSA 1ACBE 1F5RA 1O2XA 3RXRA 4UFEH 1PPHE 1YPGH 3U28C 5LPFA 3V0XA 2GMTC 3TNSA 1AB9C 4LZ1H 1LPZB 1ZJDA 2GCHF 2HVXA 2WINI 5DG6A 2CMYA 2ZP0H 5EGMA 1O3IA 3GCOA 1YLNA 1SL3A 3KQEA 1DITH 3SI4H 1ESTA 5IDKA 1Q2WA 2P3TB 2EI6A 3S9CA 1DVAH 2C3SA 2JIZD 2HPQH 1P09A 3ITIA 2AGGX 1KXAA 4I8LA 3GY5A 1MKXH 1SMFE 2BLVA 4GCHG 4MG3A 2DE9A 1O5FH 1YY3A 4SGAE 4ABDA 4GCHF 1GHZA 5F6MA 8GCHG 1T32A 1KY9A 2OC8A 3LU9B 7LPRA 1P06A 3K2UA 8GCHF 3LGYA 1EAUA 4NFFA 1NU9A 3E16B 2G4UA 4F55A 1C9PA 1DDJA 1P2QA 1BTZA 2TGPZ 5DSFA 2JJ2D 4NG9H 1FMGA 2G51A 1P9SA 2UUYA 3TH4H 4DVAU 4GHTA 3Q3XA 2VVVA 1F5KU 3OEED 2PKSC 1C1UH 1LHCH 2FTLE 3FZDA 4JK5A 4FU9A 1NS3A 1BITA 2Y5HA 2BDHA 2Q1JA 1L2EA 1Z7KA 1GJ4H 2PW8H 4K8BA 1G30B 3TK9A 2WPHS 3MO9A 2AMPA 3Q76A 3ZZCA 2AS9A 3MHWU 1Y5UT 1KXEA 2ZDVH 4Q7XA 1OYQA 1O3JA 1CGIE 1ZMLA 3A7VA 7GCHF 1HDTH 4UDWH 1BBRK 1NRSH 3LC3A 5LPEA 2IPHA 4XE4A 3ZIAD 5JBAS 1D6RA 3D23A 1TX7A 3V7TA 1NN6A 1TE0A 3E8LA 2ZKSA 3QWCH 5BPEA 1YPKH 1C5SA 2EQNA 1JOUB 2BXUH 2ZZUH 5C0TA 2GZ8A 1BRAA 1TBZH 4X2YA 3T62A 2RFKC 3A7YA 3RXQA 1AVGH 4ZH8A 1TBQH 4XOJA 1BJUA 2OD3B 4B2BA 1ZYOA 3EA8A 3DSPA 5E0GA 3M7QA 3SNBA 1BJVA 1K22H 3ESTA 3RXHA 1KLJH 1Y3XA 2WV5A 4GAWA 5F8ZA 3A8CA 1XX9A 2ASUB 2H5CA 2GCTC 1Y3WA 2LP6A 3RXEA 3OEHD 2XRCA 4CBOA 4X1QU 1RJXB 1P04A 2VVUA 1E34B 3RXOA 2ANKH 3HGPA 1O5DH 2FX4A 4X8SH 1FAKH 4FVBA 2BX4A 3SV8A 4K8YA 1OP2A 3RUOA 2UUKB 2ODYB 2SGFE 1BTPA 2JKHA 1GBFA 4D8NA 3A7TA 1GHWH 1GMHG 3VXEH 2TGDA 3GY3A 3U8TH 1V2TT 3MNCA 5FBEA 1GMHF 3L6PA 1ZR0A 4I8HA 4AYYB 5HYOA 4Q2KA 5SGAE 1BT7A 3QN7A 2FOAA 2ZCLP 3OTPA 1SSXA 5EXMA 4BANB 1AVWA 1BTHH 2QA9E 4X8VH 3SU0A 1UTPA 4WMEA 3EA9A 1BTXA 2OC7A 3F9FA 3FVFB 4WVPE 1FJSA 3AK5A 1RIWB 1FZZA 2A45B 4RT0A 1P3CA 1Z6JH 5JBBS 1DXWA 2Z7FE 3BG4B 1TRMA 2F9PA 4ABFA 1D6WA 1P2OA 5E0JA 5GIBA 2FXRA 1PPFE 2D8WA 4A92A 3O8BA 2QXGA 5FPTA 1TOCB 1Z8RA 3E0PB 3LGWA 1LVMA 1RD3B 2PV9B 3CS0A 3I78A 4NIVA 1O2MA 2A4OA 3P8NA 1NT1A 5DPAA 4J1YA 1QB1A 3GYLB 1G2LA 3UTUH 1FV9A 3K65B 5EU8A 4ASHA 1EATA 2O8WA 4B71A 1P3EA 2WHXA 1EUFA 1GVZA 3SNDA 3RXMA 2TGAA 2C8ZB 1BTUA 3ATKA 3F2FA 3PMJA 1DOJA 3HGNA 1MKWK 1QBNA 1JBUH 4YOGA 5HM9A 1MD8A 2XCNA 1HPGA 4TWWA 2ALPA 3VXFH 1MKXK 1CSOE 1FN6A 1GCTB 3QK1A 1QQUA 5C0UA 1JIRA 4X1RU 5CDFE 2BLWA 1MQ5A 2A4GA 1BUIA 4NA9H 1GHAF 3DFLA 3SU6A 4CHAC 3EDXB 5IYTA 3DT0H 2ZI2H 1AU8A 1TA6A 3BEFB 3MH5A 1E79D 1GL1A 3SORA 3NXPA 1GI4A 1NM6A 4INKA 4SGBE 3PO1C 1BZXE 1O2PA 2CF8H 4BTTB 1IAUA 5TJXA 1TMUH 1O2YA 3GY7A 4ISHH 2VWNA 2GDDA 3FP6E 1MAXA 2C93B 2KCOA 1O3DA 2ZCHP 1ZSLA 4NFEA 3SUDA 2GV6A 1W10U 1DSUA 4JZEH 1GI5A 2BY5X 3PV5A 1A46H 2Y5GA 3TITA 1XKAC 1EJAA 1O3PB 4KTSA 3VPKA 1O5EH 5FAHA 2R0KA 3ZV8A 1IHSH 5DP7A 4WXVA 3F68H 2XBXA 1FY4A 4KKDA 3TJUA 4CREA 1Z8JB 3QTVH 1XUJA 6GCHG 4H4FA 5I25A 1NU7B 4O3TA 3MO3A 3ZZ6A 5L2ZH 4Q4LA 3VEQB 3ELAH 1SQAA 4RN6A 1H8DH 2IPQX 1K0HA 5GCHG 1EPTB 2FLRH 5ESTE 2A7JA 2AMDA 1DLKB 1FLEE 4HGCA 2W3KA 1O3BA 4BAHB 1SG8B 4JZ1A 1XMNB 3RXDA 5KECA 2BM2A 3N7DA 3RC5A 1TNHA 5A0BA 3UR6A 1KXDA 1DUAA 2VIQA 2RA3A 1EAWA 2TRMA 4UFGH 3SNAA 1NBME 2KZ4A 1E1QD 1C1NA 2HPPH 1VITF 2QYIA 1L4DA 3GCHB 1CHOG 1O37A 2IJOB 2JH6D 2K0QA 3LC5A 1IQMA 2VWMA 3QTOH 2RDLA 3LOXA 1O2ZA 3E1XB 2PP6A 4IC6A 4I31A 4RI0A 3UWIA 2F3CE 5JYIA 2QF3A 1NY22 2XOKD 2ZQ2A 1AE5A 1SFIA 3A88A 3T27A 7ESTE 3PMHB 1PPBH 3M3VA 1ARBA 3UQOA 1D3PB 1ZRBA 1DS2E 5EW1H 5HXFA 1ETRH 3UREA 1DFPA 1DUEA 2ZGBH 1O3OA 3N99A 4HFPB 1AE8H 1GPZA 2ZHQH 2Z9JA 4INHA 1SGPE 2SGAA 1C2FA 3ZVAA 1HGTH 3KL6A 4AFSA 2KFWA 1TRNA 1MD7A 1Z8IB 4OS2A 2ZA5A 2BY8X 4IMZA 1AHTH 2QF0A 4WMFA 4E06H 5FPYA 3TGIE 1GBHA 1Z6EA 1TAWA 1HYLA 2ODPA 4BNRA 3QDZB 1NRRH 1W11U 1VKYA 1GMDG 1LTOA 1TGBA 2RDEA 1GJ5H 3D65E 4B6EA 4THNH 4ACBA 2H5DA 4XBCA 1W3CA 1QBOA 5C20A 1H4WA 3PMAB 2ZCKP 3NPSA 3GISB 3TLOA 1P2KA 3FFGA 3MNBA 1C2LA 3A85A 2G5NA 4JZIA 3UOUA 5FPSA 1GMCG 2PSXA 5EPYA 2F43B 3OY5U 1C5VA 1IQNA 2CF9H 1GBDA 1HAHH 3S0NA 2SGQE 3DA9B 1JIMA 4NCYA 3HKJB 5EIYA 1H9IE 4HTCH 4ZXYH 1AO5A 3T5FH 1KYNA 2WZQA 1ZHMA 3ZZAA 1DANH 3SV7A 1FY5A 1C5NH 1AZZA 2OXSA 1UJ1A 3NUMA 3RXLA 2PLXA 2XWAA 1TNGA 2AHME 3NRLA 5FX6A 1YGCH 3UNRA 2Z9KA 3PTNA 4MNXA 3S9AA 1LHFH 1THRH 4WH6A 2B9LA 4X6PA 3OU0A 3SV6A 1OP8A 1OPHB 2JH5D 3A89A 1C5PA 1QL8A 2BDBA 1T7CA 1UTLM 3TNTA 2YNAA 1BMMH 1XUKA 5C5NA 3BF6H 3ATWA 4ISIH 1C5LH 2EI7A 3GCNA 3Q77A 1ANCA 2GJGA 1Y3VA 1MCVA 4ISOA 1RXPA 4TYDA 1C5YB 1SBWA 3HKIB 4LXBH 4CRCA 4H6SB 3RXKA 1Y59T 2ZGCA 5AVDA 1KSNA 1F2SE 2ZU1A 3OSYA 1AVXA 1HIAB 3M5NA 1ELFA 5JBCS 3A8DA 3RMMH 4IMQA 2ZDKA 5A2MH 1W14U 1YCPM 2M5TA 3OFND 1YPLH 2J98B 1P2NA 1TPAE 2W3IA 3L33A 2AIPA 1V2KT 1K28D 4ZUHA 2FOGA 4TT3D 4ZKOU 2FS9A 1UTNA 3GY6A 4BAKB 1C5UA 5TCCA 8KME2 2Y5FA 1EZSC 2F4LA 1VJ9U 3MFJA 1NO9H 1EPTA 4JMYA 4ABBA 5L6NH 2QE7D 1BQYA 2CXVA 1OP0A 9LPRA 2ZNKH 1TGNA 2R3YA 4PROA 3WWFA 3KNXA 4BXSA 3UNQA 4AB9A 1HAXB 2J94A 1LPGB 2SGEE 1C1VH 2QXHA 1NRQH 5T6DA 3U1JB 1HB0B 1SQOA 5EXLA 2Y81A 4MPXA 1PPCE 3EE7A 5T1VA 2OUAA 1KXCA 5A8YA 2BD3A 3PV4A 1WSSH 1NFYA 2UWPA 3T29A 5LGOA 4NWLA 1QJ6B 2CJIA 1AFQB 1HXFH 4FVDA 1ELDE 1V2ST 4MLFB 4VGCC 2WPJS 1XUIA 2Z3CA 1TNLA 3P70B 2ZDLA 4M9FA 4TPIZ 2ZIQH 1XM1A 3URDA 4Y0YE 3TH3H 5HKKD 1LKAA 5C5OA 1QRXA 1AMHA 4NIYA 2FIRH 1PQ7A 2XC0A 3FZZA 1FIZA 3UNSA 2K1QA 4ZCNA 1H9HE
chains in the Genus database with same CATH topology
4F4OC 1S6HA 1SHYA 1OWDA 3I77A 1P0SH 1TGSZ 2M2AA 2L6OA 1DWBH 4B2CA 2FYRA 1IQHA 1CBWB 2KR7A 1ELGA 1GBJA 4MTBA 2AYWA 1QR3E 2RA0A 3LGVA 1THSH 4DJZB 2BTCE 1GCDA 4ABIA 3SZNA 2QF5A 1ARCA 3BTTE 1BRUP 1W7XH 1PQ5A 1RIWC 4FUJA 3G01A 1OWJA 2FZZA 3ZVGA 3BG4C 1DX5M 3SN8A 2VU8E 2JJ1D 2GCHG 2ALVA 3RM0H 1EKBB 1TMTH 3RXUA 4ABEA 4O3UA 4FUFA 1FN8A 4Z0KA 1O2RA 2GT8A 2PSYA 1G37A 3LT3A 5C3NA 1ZHPA 3OX7U 2QAAA 2V35A 2BVXH 2XCFA 1S82A 1K1MA 2A7CA 2STAE 1UTOA 1K21H 4X1NU 2HNTE 1GHXH 1WUNH 2EC9H 5EXNA 1SLUB 3UR9A 5BRRE 1NTPA 1V2UT 4HZHA 5EW2H 2DE8A 4ZKNU 1FAXA 1MH0A 2OK5A 4ZHLU 4BAOB 1GHVH 3TK5A 3MU4A 1ELEE 4U01A 1V2QT 3P17H 1YPMH 3FKSD 2BY9X 2VWOA 4XDEA 1QA0A 1FNIA 2FOEA 4YT6H 3RLWH 3QO6A 3UB0A 2XBYA 1OX1A 3RU4E 4ESTE 2UUJB 3SJIA 4XSKU 1WTHD 1C2DA 2C8WB 5C2ZA 1GI9B 1ABJH 2P3FH 4RSPA 1GCTC 2OBOA 3E0NB 3LGIA 2AFQB 3RU4T 1IQEA 3MH6A 1GG6B 3FAOA 4F49A 1P9UA 2GP9B 1EZQA 1TRYA 4WF8A 4BAMB 1K1PA 3KQCA 1T8NA 1HAIH 4LZ4B 1UVSH 1VCWA 3A86A 1HLTH 4FUDA 4YLQH 3TGKE 4B73A 1KXFA 4NGAH 3EQ0H 3GCTG 1Q31A 2Z94A 2AGEX 7GCHG 1P57B 1HJ9A 3QZRA 1HIAA 3GCTF 1Z8GA 1G3CA 1N6XA 1ZTKA 5E2PA 1TPSA 1ID5H 4JZDH 2BDAA 1FUJA 2STBE 2UUFB 1J9CH 1BTYA 2V7QD 3BSQA 1YC0A 2FOFA 3SQHE 2A32A 1O36A 2XBWA 1DLEA 1UMAH 3TU7H 5EOKA 1O3FA 5DP3A 1O3GA 1MQ6A 3KF2A 4K60A 4AFQA 4FUEA 1C1RA 3E91A 1ANEA 1J15A 3T28A 2BXTH 1EOJA 1V2VT 3M36A 2LELA 3VB6A 3SGBE 4X6MA 5ESBA 1O2KA 1EPTC 5CHAB 1O2JA 3BV9B 1O5BB 1EB2A 1MTUA 2Y82A 3MU0A 4Y7BA 5GJ4B 1EFRD 3PLBA 4OS5A 4O9VA 5E2OA 1ANDA 3ATIA 4UEHH 4DIIH 2PFEA 1TNKA 3KQBA 5AFYH 5E8EH 4GSOA 3RXCA 2H9EH 2WV9A 2A1DB 1O2TA 2OTVA 1QBVH 1WU1A 1ZGVA 3TVJB 2OC1A 2SGDE 3SU3A 1SGYE 2ZGHA 1LVOA 4D7GA 1GJ8B 1P2IA 5GXPA 1O33A 2EI8A 4CH8B 2PWXA 2G52A 2ZHWH 5EQSA 2G00A 1C1TA 1W12U 1D3DB 3F9GA 1MCTA 2NU2E 4RKOB 1ZPBA 4U30A 4R0IA 1QNJA 1UO6A 1GVLA 2ANMH 4ZKRU 1S83A 1QL7A 1SLXB 1IHTH 1GJCB 1P10A 1GBAA 1FPCH 3P8OA 5GWZA 1CHGA 3SZEA 1V2JT 4B6FA 4JZFH 1YM0A 3MH4A 4U32A 3LH3A 3F9HA 1O3HA 5A0AE 3MO6A 2W5EA 4D9QA 1YBWA 3EE0B 1ELVA 3NK8A 3VB3A 2QIQA 3FOAA 2KAIB 2AH4X 1HJAB 3ZZ5A 4BTIB 1U6QA 2XW9A 1AKSB 1YPHE 3LPRA 3UQVA 1UCYE 4XFQA 1AB9B 1MTNB 4Y0ZE 4YXWD 4TWYA 2BVSH 1O3CA 3BTQE 1B5GH 2FI4E 5EQRA 2NU4E 2R9PA 1INCA 1ZSKA 3SU2A 2VWLA 4OS6A 1NFUA 1TX6A 1SGQE 3VGCC 4J2YB 1G3BA 2ZPRA 3RDZA 1SFQB 1ZLRA 2VIOA 5DK1A 3O8CA 1D3TB 2QGRA 1B0FA 5DO4H 1SLVB 5FX5A 2FP7B 2WPDD 1TQ7B 1T8LA 2FOHA 3AW0A 3FP8E 1J17T 2LNCA 5HGGA 1GHAG 1C1WH 1LPKB 3ZZBA 1GGDC 1O30A 3PROA 4KGAA 1NPMA 4Y8XA 1PQAA 2QC2A 1CGHA 3ZZ7A 1P02A 3RXGA 2QV1A 5HMAA 1GBLA 2BD4A 1S0QA 1UTMA 2FO9A 3UY9A 1EP5A 1CT4E 2ODQA 3S7KB 2GX4A 1MBMA 3EYDA 1RTLA 2GVFA 4AYVB 1YCPH 3VG8A 1TYNA 2PKSB 2D2DA 3FO8D 1P05A 4YLUA 1EASA 1L1GA 3K9XB 1DT2A 1COWD 1EZXC 2V0BA 1E37B 1XXDA 4U2WA 1NBMD 1S85A 2FM2A 1O0DH 3C27B 1H1BA 1VZQH 2ZHDA 4X1SU 1NC6A 5FXLA 2BVRH 2Y80A 1SLWB 1HFDA 2Z3EA 2ANYA 1C2GA 4E7RG 3MU5A 1HJ8A 4DURA 2SNVA 1G3EA 2FOCA 1ABIH 1G36A 2H9HA 1C2EA 4AGJA 1AQ7A 2Y7ZA 2BLOA 3SYJA 2VGCB 3RC6A 3MYWA 1GBKA 3T26A 1QJ7B 4ABJA 1KMHB 1W0YH 1MABB 1UCYH 1GBIA 1UK2A 1QL9A 3A7ZA 2PKAB 3GDSA 1AUTC 1VITG 2TBSA 4R8TB 1QB6A 3E90B 1FONA 4I8JA 1BHXB 3RXTA 3C1KA 5A8XA 2NU3E 3QUMP 4CRAA 3MI4A 1SGFA 1AI8H 1QIXB 4OS7A 1Y5AT 1TNIA 1HCGA 1O32A 3SW2B 2QXIA 3JZ1B 4X2WA 1L0ZA 1PJPA 4ZMAH 4DGJA 2C8XB 1GI2A 1J8AA 3U9AH 3PMBB 1V2PT 3RMLH 1FY3A 4B75A 3F0OA 3M5OA 1ZMJA 1QURH 4NSYA 1TA2A 1IQGA 4ISNA 1UVPA 2W7UA 3R3GB 5JPMH 3MWIU 4I8KA 1OXGA 1W0ZU 1D9IA 3GICB 3FP7E 5F8XA 1O2HA 2O8UA 3LIWA 1MZDA 5EG4A 2PR3A 3SU5A 8ESTE 2J4IA 3LJJA 1LHEH 1F7ZA 3U98H 4INLA 3W94A 5A8ZA 3AW1A 3UIRA 2QF4A 3PWBA 3TGJE 1UVOA 1O34A 2ZFRH 5GPIB 5L2YH 2D1JA 2UWOA 3K6YA 3ZYDA 4FUIA 2EA3A 4I33A 2GD4B 3BN9A 3ODDA 2FLBH 2FOBA 1O2IA 1E1RD 1IQJA 2VVCA 4Y10E 3EA7A 4O97A 1QQ4A 4AGKA 1CBWC 1OYTH 3ZZ8A 1F92A 2KAIA 3GY4A 1H8ED 3KGPA 1QGFA 1AKSA 2GZ9A 4FUHA 1O31A 2I6QA 1BBRE 2VNTA 1D4PB 2H2ZA 3T25A 3ENSB 1HAPH 2CN0H 1DXPA 3FANA 3RXJA 1RS0A 3D49H 2BLQA 5T6FA 4X2VA 4X6OA 1V2LT 2PTNA 2EEKA 3RXFA 1HAVB 1C1QA 3M3SA 2OC0A 2F9OA 2IN2A 1F0RA 4O03A 5E0HA 4Y6DA 1T31A 4A5TS 2VIVA 2F9NA 1EZUC 4AOQA 2HWLB 3BTEE 3WW7A 4MNYA 1RGQA 4IN2A 3SGAE 1A1RA 1T4VH 3SJ9A 1C2KA 3OE7D 5AFZH 2B0FA 1S0RA 6ESTA 2QCYA 4XBDA 5C1YA 1XUGA 1SGDE 4DT7B 4WWYA 2CHAB 1C5QA 1XXFA 1NFWA 2RCEA 1QCPA 1P2JA 5IK2D 1DPOA 3T2NA 3RMNH 2I6SA 3GOVB 2HNTF 3PLKA 1UTJA 2WSSD 1Z1JA 2VIPA 4FUGA 3BTKE 2ZPQA 1GG6C 3M5MA 1GHBF 2Z9GA 2J92A 2PTCE 1FIWA 2QXJA 1E0FD 3NKKA 4WJG2 4FU8A 1QRWA 1O2GH 4UONA 3RXPA 2B5TB 1SC8U 3BEIB 2G55A 4DY7B 4IW4E 2O8MA 2AMQA 1Y8TA 1BRBE 4ABAA 1ETTH 2ZG0H 1CGJE 3F9EA 3VB7A 1P03A 1D3QB 2G81E 1TPOA 1UCYK 2JDID 2FYQA 3V3MA 1KDQB 2OINA 3L3TA 5J4SA 3BEUA 3ZZDA 4Y8YA 1C5TA 1G9IE 2P93A 9ESTA 2PKAA 4BXWA 3ZYEA 1CT0E 2XNDD 2AIQA 5DN6D 3A80A 4IN1A 4IS5A 2A31A 2FESH 4MDSA 2BDGA 5GDSH 1S5SA 1E36B 3H7OA 4AG1A 2AGIX 4CRBA 2HRVA 2FDAA 1ORFA 2XXLA 3PWCA 2KCPA 4YOJA 2KCYA 3GY2A 3CP7A 3F3BA 3W1EA 4NA7A 2V6NA 5CE1A 1ZPZA 3H7TA 3RM2H 3P8GA 4JYTA 1LO6A 1Q3XA 1O2SA 5CHAC 3S9BA 3F2GA 3R0FA 3M61U 2ZFPH 1ELCA 1GBEA 4KP0A 2BDIA 1TFXA 3ZZ4A 1HBTH 4A1TA 1TBRH 4IGDA 1XVMA 2YMSB 3OY6U 1OWEA 1YKTA 1RFNA 2W6ID 1XUFA 1THPB 1GJ6A 4OS1A 2VBCA 1O5AB 1CA0B 1O3MA 1T4UH 1YPEH 3EAJA 1ELBA 1GBCA 1V2RT 8LPRA 1O3EA 1GI8B 2VJ1A 4JYUH 1IQKA 2HNTC 1G3DA 1OWKA 3Q00A 1K2I1 1P8VC 3UFAA 3SUFA 1ELAA 4AZ2B 2JH0D 2PGQB 3BTWE 4A1XA 4ZAEA 3QZQA 1TOMH 2ZFTA 3P6ZB 1A5HA 1NRNH 3ATLA 1V2WT 3KQDA 3SOSA 1ZGIA 2P95A 1PYTD 2BDYA 5B6OA 1GJAB 3SBKA 1C5OH 2Y7XA 1UTKA 1CO7E 3B23B 1MUEB 1C5WB 3OYPA 4DG4A 3RU4D 2H6MA 1AUJA 1H8HD 3F0PA 1QJ1B 1IQFA 5B6LA 3KEEA 3WY8A 1ZSJA 3SU4A 2ZC9H 1SPJA 1VR1H 3TJNA 2WYGA 4MPWA 1Y3UA 2BD5A 1CQQA 1O3NA 4YO9A 1HJAC 1GJ7B 4FUBA 3Q3YA 3GY8A 1VJAU 2Z9LA 1SHHB 1MTNC 2WPIS 2P16A 1C2HA 2BMGB 1JXPA 3QX5H 2YNBA 4X1PU 1N1LA 2J5UA 1P01A 3A7WA 4CR5A 1HAVA 4K1TA 2FI3E 4ZHMU 2ZQ1A 3HPTB 1MKWH 4ABGA 1TIOA 3MH7A 1AGJA 1BHXF 2ZHEH 3O8RA 3MU1A 4AG2A 1NROH 5FCKA 3MNSA 4BAQB 3U8RH 1O2NA 1GDNA 1M9UA 1L1JA 1FX0B 1PQ8A 2W26A 1EJMA 1EAXA 1KXBA 1W8BH 1FQ3A 4K2YA 4E05H 5LPRA 2BD7A 5A09A 4CRFA 4JCNA 2BQWB 5T6GA 1LVBA 2BYAX 3OAAD 1QA7A 1C2MA 1BMNH 1LDTT 1P12E 3ATMA 2XYAA 3PB1E 1GHYH 3QLPH 3RC4A 2VH6A 1TNJA 1ZTLA 2ZFSA 4MPVA 1YPJH 1BIOA 1YLDA 3H5CB 1L1NA 3BIVH 2F9UA 2DUCA 3A83A 5F03A 3ODFA 2UWLA 4BTUB 2SGPE 1AIXH 1FXYA 1N8OB 1W0KD 1AD8H 4Y76A 4ZHAA 3A8AA 1O3KA 2BB4A 1W2KH 5EODA 1GWAA 5A0CA 3UPEA 2O8LA 4Q7YA 1WTGH 1C5RA 3SHCH 1F0SA 2RG3A 3E6PH 2ZFFH 3ZVFA 4ABHA 2IJD1 1CE5A 1SGIB 2K8IA 1O2UA 5GNDA 1V2MT 1SGCA 2GV7A 1KIGH 3PYHA 4B2AA 3ZVCA 2ZU2A 3Q3KA 2NU1E 2FODA 3BTFE 3TJOA 4HI3A 4UFFH 5C67A 2OCVB 1C4V2 1QY6A 3TJVA 4K1SA 1DE7H 1TQ0B 3LDXH 3W95A 1L4ZA 1KDQA 5FBIA 1Z71A 2TPIZ 3EGKH 2VGCC 1YYY1 1BMAA 1GBBA 3GDUA 3M7TA 1ESAA 1KLIH 3F6UH 1V2OT 6CHAB 4XBBA 3PM3A 3OTJE 1C4U2 2P8OB 4DOQA 1AZ8A 1UK3A 5K7RA 3PRBA 2F9BH 1GVKB 1W0JD 3BTME 1H8IH 2XC4A 1ZTJA 2BQ7B 4Y79A 2BOHB 1QB9A 2Z9IA 4TY6A 4CBNA 1Y5BT 4GPGA 2LPRA 1O35A 4NIXA 1TGTA 1S6LA 3GCHC 2PHBA 1K1LA 3MU8A 3ZZ9A 1BA8B 2Q6FA 2HLCA 4AN7A 1VGCB 2VINA 3DD2H 2FI5E 3SQEE 1WYKA 5JB9S 5TCAA 1GI7B 2Q6DA 3P8FA 4YESB 2XTTB 1MBQA 4VGCB 1YPHC 3KN2A 3MMGA 4Z6AH 1VCPA 1GI3A 3RXAA 4IBLH 1C1MA 1O3AA 1V3XA 5ETXA 1Y3YA 3V12A 2A5IA 2JETB 1LKBA 3AVZA 2G4TA 1ZRKA 1T8OA 3DUXH 2BOKA 4X8TH 3RMOH 4MNWA 1LCYA 3BTGE 1YLCA 1BMFD 2TGTA 3JZ2B 4Q80A 4WH8A 3M35A 3TH2H 1HV7A 1WAYB 2GT7A 4E7NA 1B0EA 4TY7A 3TK6A 1FPHH 4CRDA 1A5GH 5JDUB 4X8UH 5H4IB 1ZHRA 5DP4A 2ZTXA 5EPNA 2PUQH 2R0LA 3B8JA 1BCUH 3TIUA 1MZAA 2YOLA 2FMJA 2KM0A 1SGNE 2GTBA 1CU1A 1C2JA 1MTVA 2GMTB 1KLTA 1V2NT 2WUBA 4NZQA 3FN8A 4UE7H 1ELTA 2J9NA 1SB1H 2PUXB 1GBTA 6LPRA 2ZEBA 4ZROA 4D76A 3CENA 2VIDA 1FI8A 5J4QA 3B9FH 3ZV9A 2C4FH 2FTMA 1EX3A 1TABE 4RKJB 4H42U 3SJKA 2Y6TA 3PV2A 1UK4A 2ZWLH 4ASUD 1PPZA 3NZIA 2HALA 3SNEA