1ZZZA

Trypsin inhibitors with rigid tripeptidyl aldehydes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Highly selective mechanism-based thrombin inhibitors: structures of thrombin and trypsin inhibited with rigid peptidyl aldehydes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zzzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zzzA02
1ZTLA 2BVSH 1BJVA 5A0AE 1K1JA 3W95A 1WOFA 3RXCA 3A88A 1T31A 2OC8A 3VXEH 1EZSC 2BLQA 1RXPA 4ZAEA 3T26A 1A5GH 4FUDA 2V3HH 4ZROA 2XBYA 3T5FH 5EGMA 2QV1A 2BY9X 4JZEH 1HAYB 4CH8B 2XCFA 3ATIA 4YTAA 1P11E 4FUIA 4CRGA 1ZTJA 3E8LA 1TGNA 1HJAB 2F9UA 3KIDU 1CBWC 3RXVA 2H9TH 5FCKA 5DPAA 4HGCA 4Y8XA 3S9CA 2LPRA 2AGIX 1ZR0A 2XW9A 1MKXK 1XUFA 3LT3A 1A2CH 4D7GA 1RD3B 3E3TA 3RC4A 2AMDA 3ZZ6A 3ZZBA 2H6MA 2BD3A 1BZXE 2Z9GA 5EPYA 2BDCA 1BB0B 5JBCS 2BQ6B 2EEKA 3D65E 2FOHA 3T25A 1TALA 3ZZ5A 4O9VA 4I31A 2V3OH 1YP9A 1YCPH 1O5AB 2GKVE 4B2CA 1PFXC 4X0WU 4K1TA 1V2QT 1F5KU 3GY3A 1QRZA 2HNTE 4MPUA 5FHTA 2Y80A 1EAXA 3EA9A 4K69A 4HZHA 1P01A 1SVPA 1DWBH 1YYY1 4I8LA 1GHBF 5FPSA 1A4WH 3MMGA 1TE0A 3RXTA 4XSKU 2Z3EA 4AB9A 1GG6B 1FY3A 1OYTH 4JK5A 5FBEA 2F9PA 3VB6A 3LH1A 1ABJH 1YPJH 5IYTA 2BZ6H 2GT7A 3SGQE 2ZHEH 4ABAA 6ESTA 1RRKA 4GAWA 3SBKA 4JCNA 1BOQA 1C2IA 1C4Y2 1YBWA 3DFLA 1QJ1B 3U8RH 3STJA 5JDUB 2G00A 1C5PA 2J9NA 2ZGCA 7ESTE 1GBLA 4AFSA 4ZKRU 3RC5A 1K9OE 1TBRH 1SG8B 1F5LA 2B9LA 2OD3B 2VWNA 1OPHB 5A0CA 1ZJKA 2ZPRA 2VGCB 1ZHPA 3TLOA 1KTTB 3RXUA 4RN6A 1MD7A 3KL6A 1PYTD 2WPJS 4BNRA 2EI8A 1PQ7A 1NTPA 1MTSA 1EAIA 4U32A 3F1SB 1TMBH 2A32A 3PO1B 2ZKSA 1ZRKA 3GCHB 4BAMB 1C5SA 3PWBA 1BTPA 1Z71A 1SGTA 1A5IA 2Z9IA 2ZFSA 1OP8A 1QBNA 4UE7H 3ZZCA 4ZMAH 1LVMA 2BD2A 3NCLA 1TYNA 1MMJN 2ZCKP 4NIXA 1IQNA 5FPTA 4ZKSU 1ELCA 1GGDC 2QY0B 3RXKA 1ELFA 1BMLA 1DWEH 1TPAE 1QFKH 4YM9A 1FI8A 4GHQA 3V3MA 3LU9B 1CO7E 3SV6A 1VJ9U 4X2WA 5C1XA 1AD8H 3MU8A 3EDXB 4CR9A 2B8OH 2FIRH 1GI7B 2G55A 4IN2A 2Q6DA 4K5ZA 1TBZH 4X6MA 5E0HA 2FLRH 1GI4A 4JK6A 1ELTA 1UTOA 3ATMA 3PYHA 4D76A 5GCHF 2CHAB 2BY8X 3KHVA 2VIQA 3MTYA 3PMJA 2BXUH 4K2YA 2A7CA 1W0ZU 1MU8B 1HJAC 2VVVA 1QQ4A 1PPCE 1TX7A 1CSOE 3GY5A 2V35A 1NFXA 1C2JA 1ELGA 1GI1A 3QX5H 2ZQ1A 3MO3A 4MPXA 1CT0E 1P2MA 2XBWA 1XM1A 4ZUHA 3A8BA 1QA0A 2XBXA 3OX7U 2BY7X 4ZKOU 3RDZA 2HVXA 1P02A 1MKWK 4IS5A 4UFDH 9ESTA 1UCYE 1CHOF 2Z6BD 2ZEBA 1ORFA 3P95A 5A8YA 1Q31A 1QTFA 2D2DA 4GCHF 1W11U 2WUCA 3RMLH 3GY7A 1GI5A 2SGPE 1KLJH 3M7TA 3Q00A 1ESTA 1NRRH 1P2JA 1YKTA 3MH4A 2I6SA 1HGTH 4MNWA 2Z9JA 3H5CB 2UUYA 3G01A 4X6OA 2BLWA 1EB2A 4I8HA 1HAOH 3P6ZB 3RU4T 2W7SA 2ZWLH 4OS1A 2UWOA 4MNVA 2ODPA 2H5DA 2F9NA 1OP0A 1TA2A 2YNBA 1BMAA 1SLVB 3BEUA 3UUZA 4SGAE 1C2KA 4ASHA 4ISOA 1ZHMA 1XKAC 1ZPZA 3BG4B 1FLEE 3LDXH 3P8GA 1GJ9B 1C1UH 1O2TA 1A0HB 3MNCA 1AB9C 1KTSB 2ZHFH 3L3TA 1RS0A 4CRFA 5SGAE 3ZVGA 1LKBA 3CS0A 2J2UA 1YPKH 4ABFA 4FUEA 1G37A 3UY9A 1DICA 2GP9B 1BTHH 1YPGH 4WJG2 1V2NT 3NUMA 5EQQA 1S81A 2A5KA 2BD5A 3SW2B 5L30H 2CMYA 1C5TA 3ZVCA 1T8MA 2SGEE 2TRMA 1G3CA 1P2NA 1CHGA 2JETB 4DURA 1W8BH 1LPGB 1HNEE 1SQAA 5GXPA 3PM3A 1AVGH 3ZYEA 1C1OA 1S85A 3S9AA 1TOMH 1ANBA 2GCHF 2PR3A 1LVOA 1H4WA 1V2KT 2Y82A 1P3CA 1WBGB 3VB4A 2ZGHA 1G2MA 5DP9A 5EQSA 1JXPA 1VITF 4MDSA 3GCHC 1DS2E 1NESE 1HAZB 2ZO3H 4ISNA 1D3TB 1ZPCA 1TPOA 4Y8ZA 2VB0A 1EAUA 1O3DA 4FU9A 4AN7A 4FUFA 4XDEA 3PROA 2CGAA 1CE5A 2I6QA 3F9EA 4JMYA 2VU8E 1RFNA 2ZGJA 4FUBA 5AFZH 4BAQB 1FY8E 1JMOH 2J34A 1T4UH 1TRNA 1GBMA 5FX5A 2GD4B 1RTFB 3ZZAA 1IQMA 3A86A 3RXQA 4DGJA 1UVUH 1O3CA 3E0PB 1V2PT 2QN5T 3LJJA 3UIRA 1QRXA 6GCHF 1CA0B 1O32A 4CREA 1P2IA 2OQUA 1C5VA 1EATA 1H9HE 2QC2A 1SGFA 2FX6A 2TGDA 1F92A 1DWDH 5F03A 2CN0H 3GISB 2BOHB 1O3BA 2VIDA 2ZQ2A 3RXIA 1GJ7B 2PTCE 1MTWA 1Z8RA 2ZHQH 5C1YA 1V2ST 1GJ4H 1QJ7B 3HGPA 1L1JA 1Z6JH 4VGCB 4M7GA 2OC7A 4KELA 5T6FA 3KGPA 2BD9A 1FONA 2ZP0H 1O3IA 3F9FA 5LPEA 1TMTH 3TK9A 3HKIB 1YPEH 1EXFA 3ZYDA 3I29A 5T3HA 1AU8A 1SQTA 1PPGE 3FP6E 3VGCB 3RXEA 2RG3A 3HKJB 1ABIH 1NO9H 1IQGA 1BRUP 2ZGXH 1YPMH 3P70B 1GMHF 1HV7A 1O38A 2Y81A 5A8ZA 1L4DA 1GVZA 1O2ZA 5C3NA 1Z7KA 3Q76A 1LDTT 3URDA 3M3VA 4YOJA 3OY5U 1P9UA 3C27B 4XE4A 3UNSA 5JBAS 2FOAA 4Y7BA 4D9QA 1NRSH 3RLWH 2BLOA 1OWKA 2LNCA 5E8EH 1UVOA 5DG6A 1DFPA 2ZFRH 1GHBG 3SZNA 1QIXB 3SU5A 2BDHA 2BDAA 4DIIH 1XXDA 4INHA 4WH8A 1DANH 2PLXA 1TNKA 2A5IA 2CF8H 2H9EH 1CBWB 1LHFH 1MH0A 1TFXA 2ZHWH 3BV9B 1HBTH 1GBHA 3UWJH 2DUCA 1IOEA 2J92A 1EP5A 4GLYA 1O34A 1A61H 1GI8B 3BEFB 2W5EA 2XYAA 4YO9A 1OWEA 4K8YA 3HPTB 1QB6A 2O8UA 4IGDA 3H7TA 1BTXA 1BBRK 1GJBB 1GHVH 3BTME 3BTEE 1AWFH 1AUJA 1A46H 3BTHE 3PV4A 1GI2A 2C93B 3BIUH 2ZC9H 4THNH 4Y8YA 5DP6A 1XX9A 3LC3A 1V2VT 1O2YA 1GI0A 3LOXA 1ANCA 2NU4E 2WPLS 3EQ0H 4B1TA 1CT2E 2G51A 2QAAA 3CS7A 1C5YB 1C2EA 1H8IH 1O2OA 5K0HA 1O2NA 1O5BB 1O30A 2FI5E 2G4UA 3MI4A 4AFQA 1Z8GA 1YCPK 3AAUA 3E90B 4U01A 2OQ5A 1YPHC 5EW2H 4NIWA 2F9VA 2TGPZ 3NK8A 3S7KB 1D3DB 2XBVA 3BTTE 2BLVA 2XCNA 3UOPA 4OS2A 3RMOH 3E0NB 1Q2WA 2O8MA 5EOKA 3P92A 4BAKB 4Y10E 1LQDB 4AOQA 5GIBA 4X1SU 3KNXA 3SNEA 5ABWA 2GTBA 5A2MH 1C2GA 5C20A 3IITA 1EX3A 2THFB 1MAXA 2C8YB 3BSQA 1A1RA 2ALPA 1C9TA 1ZSKA 1E35B 2FM2A 4X6NA 1B5GH 2GZ7A 1V2MT 1WQSA 4BXWA 3S7HB 1HAHH 3D23A 4CR5A 3ELAH 5C2ZA 2ZTYA 3ZZ8A 2BDYA 3K65B 1T7CA 4FUCA 2C4FH 1MAYA 4GHTA 5DP3A 4R8TB 3TIUA 3RXPA 4NSVA 2AGEX 1MBMA 5GCHG 1RIWB 3A7WA 4YT7H 3GCNA 1ZZZA 4FUGA 4TY7A 3F68H 2FLBH 3VXFH 1D3PB 1BRAA 2XTTB 1EZXC 1AVXA 4MVNA 1HIAA 4X2YA 1HIAB 1D9IA 1S6HA 4ZHAA 1ZOMA 1O3FA 4BAOB 2KAIA 2KAIB 1MQ6A 3E16B 4LZ4B 1GBBA 3GY2A 3LGVA 3A7ZA 1O3JA 5IDKA 3M5MA 3JZ1B 3T27A 4K8BA 5GWZA 1BIOA 1QA7A 3EYDA 3SQEE 1PPFE 3OY6U 1CHOG 1TRYA 1OX1A 2G4TA 3RXRA 1UTKA 1J16A 3VFEA 1CT4E 1ESBA 2CXVA 1EZUC 3QK1A 3OTJE 1NM6A 4GCHG 1GBTA 1O3OA 1TNJA 3GY8A 1KXCA 1P2QA 1QBOA 2H5CA 1O2XA 3E6PH 4WMDA 2G5NA 1AFQB 1G32B 2WPHS 2ILNA 1EOJA 2M5TA 1EJNA 2QXGA 3O8CA 1PQ5A 1OSSA 3M37A 1BRBE 1HRTH 1SLWB 5FX6A 1F0SA 1O2SA 4AB8A 1ANEA 1DLEA 3LONA 1GI6A 3LIWA 4B73A 5E0GA 1SGYE 1THRH 2XC4A 1OOKB 1F0RA 1PQAA 3QLPH 1BCUH 1DDJA 1LHDH 1GL1A 2A7HA 2PSYA 3OYPA 2SGFE 4K1SA 3ODFA 1WYKA 1JOUB 1DE7H 3QWCH 2YNAA 4KTUA 1SGRE 2V0BA 1FN6A 1KXEA 2CF9H 4O97A 1T8LA 7LPRA 1INCA 1T8NA 3QGNB 1SGNE 2P8OC 1EB1H 2F9OA 3SJ9A 1Y59T 2XXLA 4Y11E 2ANYA 1DY9A 1O33A 5C5OA 4XBBA 5HM9A 2F91A 2C8WB 2WPIS 3NXPA 1UTLM 2A45B 4IC5A 1V2OT 3RXJA 4A5TS 1K28D 1UVPA 2OC0A 1GHXH 1UCYH 1THPB 1EP6A 2ZCLP 3LGIA 1CGIE 2AGGX 1F0TA 1MD8A 1VCWA 2G52A 2GCTB 1MZDA 2J4IA 1ARCA 1YLCA 1PPBH 3D62A 1IAUA 2GCHG 2HNTC 3TK5A 3PMBB 1KY9A 2GDEH 2P3FH 2UUJB 3Q3KA 1QGFA 2ZU4A 1LKAA 1Z1IA 4X1PU 1VITG 3P17H 2BDGA 3BN9A 3M35A 4D9RA 4UONA 1O3NA 3BTWE 4CH2B 2VVCA 5AHGH 2NU3E 2JH0D 1AB9B 1SPJA 4NIYA 1J8AA 5TCCA 3PMHB 4DIHH 2AMQA 2D8WA 1P2OA 1IHSH 3D49H 1MTNC 2ZDNA 3SGAE 2FOEA 3U9AH 2C3SA 1LPKB 3UNQA 1GBCA 2BXTH 2UUKB 4AYYB 2VH0A 1AE8H 1P8VC 5K7RA 1SLUB 1TNIA 1GMDF 1QBVH 5GJ4B 3OSYA 3BIVH 3W94A 4TWYA 1SMFE 5FXLA 6GCHG 1SBWA 4ABGA 1JBUH 2VWLA 4YLUA 2QF3A 4X8TH 3RU4E 5JB8S 4IMZA 1RIWC 1UK2A 1F5RA 1ZSJA 4ABBA 2B5TB 3SJKA 4JZIA 3ZVDA 1HFDA 1FAXA 1C4V2 4BANB 5ESTE 1GHYH 3SUDA 1L1NA 3EA8A 3GYMA 4NCYA 2BD4A 2FP7B 3UNRA 4OS5A 1K22H 1BHXF 1O5EH 1YC0A 2HWLB 3RXSA 1BDAA 2HPQH 3BTKE 1XUIA 5EXMA 1GMHG 3M5NA 1D6RA 3GDUA 2FMJA 4A1VA 3TITA 3FVFB 3GDSA 3KQBA 2EI7A 2WPMS 4I32A 2P16A 1GCTC 3R0FA 3LGYA 5LPFA 5CHAC 4QT8C 4Y76A 1AFQC 2ZGBH 1GVKB 4B75A 2FEQH 4MPWA 4GVUA 2ANMH 4XOJA 3FFGA 2FTLE 2ALVA 1NRPH 1NZQH 1G9IE 2OTVA 1BRCE 4ABEA 2QXJA 1FY1A 4OGXA 3PLPA 4ISHH 4GUXA 2ZDAH 2VIWA 2VIPA 1EOLA 1SQOA 4MPVA 1BBRE 1DT2A 3A83A 5E2PA 2A4GA 3FP8E 4E05H 1LTOA 1AGJA 2GX4A 4A92A 1ETTH 3VPKA 1E0FD 2P59A 3AW1A 1HAGE 4Y7AA 1MCTA 1NT1A 3ATKA 4XBDA 2A7JA 2ZDKA 3SO3A 3WY8A 1C1SA 1AY6H 1GI9B 1S82A 2FOGA 3PTBA 1HXFH 4F49A 2AS9A 3RMNH 4NFEA 4UFFH 1SB1H 1HAIH 4MNYA 1YPLH 2FI3E 5J4QA 3SU6A 2OLGA 1AZ8A 1C1NA 5ETXA 3HK6B 1GBFA 3EGKH 4X6PA 7KMEH 4BTIB 1QL9A 3RXDA 2GCTC 2VIOA 1HPGA 2O8TA 5EQRA 4Y79A 1OWJA 5AVDA 4UFEH 1MTVA 3RXGA 1UJ1A 3GY6A 4Q7YA 1BTWA 1GHZA 1O3GA 3FZDA 4PROA 1O2WA 4YT6H 4O3TA 1P06A 1C5UA 2PGQB 4Q80A 3A8AA 3MHWU 1EPTC 2ZG0H 5EXNA 3A8DA 4K60A 2Y6TA 2D26C 2OBOA 4SGBE 3LKWA 3RXAA 3TVJB 1G3EA 1C1QA 1TNLA 2AMPA 1FIZA 1WCZA 1TMUH 4RKOB 1C5XB 2PV9B 4WWYA 1HYLA 2A4QA 1OKXA 1JIRA 1KSNA 3DFJA 2RA0A 2B0FA 2H2ZA 4U30A 2ZDLA 3S9BA 2A0QB 2PHBA 2A31A 2QYIA 1ESAA 1J9CH 1KIGH 4J1YA 5FCRA 1TNGA 3RXOA 1AUTC 1MTUA 4ZHLU 1O2PA 5H4IB 3ENSB 1K1LA 2BVXH 1G2LA 3FZZA 3HK3B 3TK6A 5C1UA 4ZXXH 3MYWA 3ZV8A 4GSOA 4X1QU 5TCAA 1A0LA 4JZ1A 1F2SE 2EC9H 2VH6A 3L6PA 5I46H 2AYWA 3F6UH 5FBIA 1W7XH 2IOTA 4NWKA 4AG1A 1O2UA 1P10A 4B74A 2ZTXA 2JH6D 3MNXA 1PPZA 1PQ8A 4NA9H 5I25A 1RGQA 1GL0E 1TX6A 1KLIH 1LO6A 2OINA 2VWMA 4OS6A 1TABE 1K1MA 3DD2H 3KQDA 1ZTKA 1SGQE 4Z6AH 4NZQA 4ZXYH 1D3QB 4DOQA 3A7VA 2ZNKH 3QZRA 1YM0A 5JBBS 1HB0B 4LOYH 1DWCH 5HXFA 1Z6EA 2P95A 1TGSZ 2EI6A 1IQLA 1EZQA 1AE5A 1GJAB 1NRQH 5E2OA 2BQ7B 3ZVFA 6CHAC 1OWDA 2RDLA 3TGKE 1O2KA 4IC6A 1P12E 1XVMA 3LC5A 1ZGIA 4K1EA 5CMXH 1G36A 2HOBA 1ZGVA 1CQQA 1FPHH 2Y5GA 1C2HA 1HDTH 3SI3H 2AFQB 3GCOA 2ZFTA 1XUGA 4OS4A 1SHHB 2NU1E 2A1DB 2JH5D 2XWAA 2Z3DA 3L33A 2ANKH 1P04A 3K6ZA 3QTVH 3UR9A 1H1BA 1GHAF 1S6FA 1FNIA 4JZFH 2CV3A 1N6XA 4NFFA 1AQ7A 1MKWH 2HGTH 3QDZB 4ESTE 1SOTA 1VZQH 1P03A 3MOCA 3SU4A 2ZFPH 2FOBA 2RA3A 2TGAA 3KCGH 3MH6A 1CA8B 2ZU3A 1P05A 1A7SA 2BM2A 3A84A 1KXDA 5DP8A 3TPIZ 1NPMA 5CE1A 1EJAA 3M61U 3QN7A 2ZDVH 1V2JT 1XVOA 3RMMH 1TRMA 5EG4A 4XBCA 1ZMLA 1A3EH 1KYNA 4XFQA 1S83A 1O2GH 3KQCA 1S84A 2FWWA 3H7OA 4LZ1H 1NU9A 2D1JA 5A0BA 3QO6A 1ZMNA 3T2NA 4ABJA 3ZV9A 3BF6H 4MTBA 2UUFB 1ELEE 1XXFA 1DUEA 3MNSA 1O3PB 1TWXB 1UO6A 3TGJE 2BMGB 3K2UA 4H6SB 4BAHB 1LQEA 3CP7A 1D4PB 1EKBB 2GV7A 2P8OB 2WINI 1C5RA 1BT7A 3SV7A 5L6NH 3S0NA 4WVPE 3SORA 2V6NA 1O5FH 4MLFB 1WV7H 3UR6A 3ZZ9A 1G30B 1GMDG 2ZPQA 1ETRH 1F7ZA 2ZCHP 1NFYA 2IN2A 2QF0A 4O03A 3SU0A 2STBE 1ELDE 1PYTC 3Q77A 3HGNA 2SNVA 1C2LA 3ZZDA 1EUFA 1W13U 2W26A 1M9UA 1WAYB 3SV9A 1UMAH 3RC6A 3TH3H 5HMAA 1EQ9A 1UCYK 2FTMA 2DE9A 3MU4A 1DM4B 5L2YH 2XWBI 1W14U 1TA6A 2GMTB 2VNTA 1IQKA 2ZU5A 1NS3A 4I33A 2FI4E 1E34B 4HI3A 1VJAU 1NFUA 1MTNB 2UWPA 1LPZB 2F83A 1SFQB 1AO5A 3AW0A 4RKJB 1S0QA 1C5LH 3BTDE 4TPIZ 1OXGA 1DITH 1FDPA 1BMNH 1GVLA 1YCPM 1BTUA 2Y7XA 1WSSH 3EA7A 3RXFA 4YESB 4D7FA 2YOLA 2TGTA 4IW4E 4ZHMU 1XKBC 4A1TA 1N8OC 3TH4H 2R2MB 1T32A 5A09A 2ZDMA 4CBOA 3O8DA 2HRVA 1GBEA 1ZJDA 4WMFA 1AVWA 1O3MA 2ULLA 4X2XA 5LGOA 1GJ8B 2QXHA 1DXWA 1L1GA 1HJ9A 2W3IA 1BJUA 3JZ2B 2QGRA 1IQHA 3LGUA 5FAHA 3EE0B 3MH5A 4DW2U 3A80A 1O3LA 1V2TT 1A0JA 1FN8A 1LVYA 4YLQH 1LMWB 5DP5A 1GBJA 1FJSA 1SOZA 1O2IA 2STAE 4Y0ZE 2WYGA 2BQWB 5A8XA 2H1UA 2XC0A 1ZYOA 3SU3A 4JZDH 2J95A 3O8RA 4WXIA 5EXLA 1C5ZB 2GV6A 1HAXB 4LXBH 1FY5A 2PKAA 2PKAB 3SUGA 1GCTB 1QNJA 1O2HA 1CVWH 5CHAB 2A4RA 4A6LA 3TU7H 2IJOB 1P09A 4A1XA 1LHGH 4FXGH 3U8TH 3STIA 2XC5A 4ISIH 2VVUA 1XUJA 4X8VH 3MO6A 1SGCA 3UOUA 4NIVA 3SUFA 2WUBA 1TBQH 4R0IA 3V0XA 3SU1A 1RTKA 3BTFE 3ZZ4A 3TJVA 3TJOA 1LHCH 3MNBA 7GCHF 1D6WA 3BEIB 3A7YA 3RUOA 1ELAA 3GCTF 3MU1A 2VWOA 1NROH 2ODQA 4Q7XA 1THSH 4BTTB 1O2QA 3RM2H 1SGDE 3KQEA 1EASA 1O3KA 1TGTA 2AERH 2FO9A 1FPCH 2EA3A 1BBRH 4UDWH 1CGJE 3ESTA 1BA8B 4GPGA 6LPRA 2PUXB 2CJIA 3RXHA 3IG6B 3ITIA 1SR5C 2OUAA 5HM2A 1Y8TA 1O0DH 1UVTH 1HLTH 2GGVB 4FUHA 3TNSA 1B0EA 3PWCA 2Q6GA 1RTLA 3TGIE 5FPYA 3Q3XA 1K1OA 1N6YA 2R3UA 4BXSA 1C1MA 1HXEH 2ZFFH 3SI4H 3T28A 2A2QH 5GDSH 1F0UA 4JYVH 1GJ5H 2XNIA 2BDBA 4CRAA 1AN1E 4LK4A 5PTPA 4JYTA 1TPSA 4NWLA 3SNCA 1P3EA 3LJOA 1EPTA 3S69A 1GDNA 4ABIA 5C67A 2GMTC 1EPTB 1QJ6B 1VCQA 1WTHD 3GOVB 3LPRA 1Y3VA 1O36A 5F8ZA 2NU2E 3A7XA 1G3BA 1OWHA 1NFWA 2A5AA 1O2VA 1S5SA 3DT0H 3VEQB 3B23B 1HUTH 3MH7A 1OP2A 1HAVA 1P0SH 1X7AC 1YGCH 1SFIA 4CRBA 5BPEA 1HAVB 8LPRA 4IBLH 2Z7FE 3ZZ7A 5AF9H 2B7DH 4HFPB 3QGJA 3UFAA 1O3EA 1QHRB 2O9QA 1YLDA 2HNTF 2PTNA 8ESTE 2R0KA 1TNHA 4WY3A 2ZU1A 1FY4A 1W3CA 3SN8A 1O2MA 1VGCC 4JYUH 3M5OA 5E0JA 1VITH 4X1NU 2ODYB 2GVFA 5DP7A 1UVSH 4AYVB 1Z8JB 2WYJA 1J15A 3P8FA 5DJ7A 3R3GB 2HLCA 1O5CB 2ZZUH 1O31A 2TBSA 3SJIA 1T8OA 3K9XB 1SL3A 2O8LA 2Z3CA 2PKSC 1SLXB 3PMAB 2C8ZB 3EAJA 3GICB 1PJPA 2IPHA 3RLYH 2ANWA 4NSYA 2C8XB 5JYIA 2G8TA 2G5VA 1IQIA 2FXRA 1BMMH 1GHAG 4DCDA 4FU7A 1IQJA 1GMCF 4DY7B 1B7XB 1GI3A 3U69H 1RJXB 4INKA 3A89A 1QL7A 3SQHE 1HCGA 1DSTA 1WQVH 3A85A 1BTZA 1T4VH 2P3UB 1MBQA 2OP9A 1CU1A 5LH8A 2BVRH 4CHAB 3Q3YA 3PLKA 1H9IE 2FYRA 1YF4A 1ZRBA 3DHKH 2GZ9A 3F9GA 6CHAB 1OS8A 1FAKH 4Q7ZA 2ZIQH 3PTNA 4AX9H 2BDIA 5B6OA 1PPEE 1K1IA 1UK4A 1PPHE 3VB3A 4B2BA 4IMQA 4AGKA 1UTPA 3BTGE 1IQEA 8GCHF 1ANDA 2ZFQH 4X8UH 1K21H 4FVDA 3VB5A 3NPSA 1UTQA 1MKXH 2ZHDA 3NZIA 2J94A 3QTOH 1DY8A 1TPPA 1QL8A 5DO4H 4IN1A 3SJ8A 1V2LT 1DOJA 1Z8IB 1QY6A 1L4ZA 1QRWA 1TX8A 2SFAA 2R0LA 2FYQA 4BTUB 4KKDA 1C1TA 1MCVA 1TIOA 3GDVA 3PLBA 5J4SA 5DK1A 1C4U2 3MFJA 1K1PA 2OCVB 3TJUA 4J2YB 1SGEE 4NG9H 1NC6A 5JB9S 3U98H 2BYAX 4AG2A 1VR1H 3LH3A 1GDUA 4AORA 1SGPE 3U1IB 5HYOA 4I8KA 4DVAU 4ZKNU 3KEEA 1C5NH 4H6TA 4DG4A 1HAPH 2NWNA 1TQ0B 4Z0KA 1WUNH 1QURH 2ESTE 3E91A 1O39A 3ZVBA 4FUJA 1JIMA 2ASUB 4YOGA 2BTCE 1UHBA 4X2VA 1UHBB 1QCPA 2K1QA 1GG6C 3QUMP 1A5HA 1N1LA 1MUEB 1NY22 1C1WH 3FAOA 4CRCA 1FIWA 3O8BA 1ZSLA 4B71A 4KP0A 3U8OH 3UQVA 4K3JA 2R2WU 1BUIA 1TGCA 4AFUA 4FU8A 3SHAH 1KLTA 4Y71A 1UTNA 4DT7B 1KDQA 2JKHA 2OXSA 1AI8H 1KDQB 2QIQA 5TJXA 1V6DA 2WV5A 3AASA 2QA9E 4ZH8A 2J38A 1HJ8A 3RP2A 1JWTA 2Y5FA 3A82A 4TYDA 2PWXA 4X1RU 2FOCA 1J14A 2ZU2A 3SV2H 3SHCH 3SNBA 1O35A 2SNWA 2FODA 5T6DA 2C90B 1KXFA 3A81A 3KN2A 2VGCC 1C5OH 2ZA5A 1V2UT 2Y5HA 4Y6DA 1QB1A 1BQYA 1NN6A 1ELBA 1B0FA 4ABHA 1J17T 1L0ZA 1P2KA 3M7QA 1LVBA 4AFZA 1WTGH 2GDDA 1V2WT 3FANA 3VB7A 3PO1C 1SGFG 4B76A 2BX4A 3SV8A 1ARBA 3A7TA 2Q6FA 2Z9KA 5DGJA 1ZPBA 3DUXH 3TH2H 2VJ1A 3LGWA 3RM0H 2Z94A 3SOSA 1TGBA 1C2FA 4INLA 1UK3A 1C1PA 4KGAA 2SGQE 2VINA 3ATLA 4CHAC 1DSUA 1N8OB 4WH6A 1JRSA 2TPIZ 2BD8A 3UTUH 1SI5H 1ZHRA 1E36B 3A8CA 4BOHA 1FXYA 1QQUA 5EPNA 3UQOA 2PFEA 4E7NA 1S0RA 1EJMA 2WPKS 1V2RT 3SUEA 3RXBA 5G4BA 2PUQH 1O2RA 4RSPA 1QR3E 2ZECA 1MQ5A 4OGYA 2XRCA 5DP4A 1C5WB 3UWIA 4MQAA 7GCHG 4WXVA 2G81E 1O2JA 2CHAC 1C2MA 1W7GH 2Q1JA 4HTCH 3ZVEA 3GCTG 2FOMB 2ZF0H 3B8JA 4E06H 1TONA 1Y5AT 3P8OA 4WMEA 2PSXA 4UD9H 4U2WA 3BTQE 2BD7A 2OC1A 9LPRA 1AIXH 5EW1H 1TB6H 3N7OA 3RU4D 2O8WA 1FQ3A 1ZMJA 1CGHA 2AEIH 5C5NA 4WF8A 3M7UA 2FZZA 1Y3UA 1O2LA 1H8DH 3MO9A 1SGIB 1ETSH 3T29A 3QZQA 3C1KA 4B2AA 1V3XA 1XUKA 2AIPA 4D8NA 3SU2A 1GBDA 1TOCB 3LGTA 4KTSA 3URCA 3FP7E 3AVZA 2DE8A 2FESH 1O37A 1Y3XA 5JPMH 2ZPSA 1JRTA 1Y5UT 2FX4A 3K6YA 1DX5M 1OYQA 3MU0A 1SSXA 1E38B 1GHWH 1MZAA 3BG8A 3V7TA 1NRNH 1L2EA 3NKKA 5DKMA 1C5MD 4NGAH 4O3UA 1AMHA 1VCPA 4NA8A 4Q2KA 3SNDA 2FPZA 3ZZ3A 5EU8A 1IQFA 1LHEH 4UFGH 3CENA 1W12U 2PW8H 1FV9A 2SGDE 1C1VH 1Z1JA 2AIQA 2HPPH 3NWUA 2BY6X 1A3BH 3BG4C 4TPYA 5HGGA 3SNAA 4DJZB 1TLDA 4CBNA 3SGBE 5JBTA 1LCYA 1IHTH 4UEHH 4I7YH 1C1RA 2W7UA 2F9BH 5F8TA 1DVAH 1K1NA 1TAWA 3UREA 4KTCA 5T6GA 3I77A 1U6QA 3V12A 2QXIA 1O3AA 3B9FH 4MNXA 1AWHB 2FS9A 2GT8A 3M3TA 2P3TB 3M3SA 3PB1E 1Y5BT 1YPHE 5L2ZH 1AZZA 3V13A 1E37B 2BOKA 1DXPA 3UPEA 3A87A 1MU6B 2FDAA 3T62A 1ACBE 2PGBB 4NZLA 1W0YH 4AZ2B 3ODDA 4F4OC 1BITA 3M5LA 1DUAA 1XMNB 2R9PA 1GCDA 4H42U 3OU0A 4A7IB 4Y0YE 1K2I1 2JETC 1GBIA 1O5GH 2QCYA 4TY6A 1AHTH 3I78A 2P93A 1BTYA 8KME2 2GZ8A 2FOFA 5AFYH 3TJNA 4YZUA 2BX3A 1GJCB 5F8XA 1OWIA 1KXAA 3MU5A 1P9SA 1GDQA 4H4FA 1O5DH 1GMCG 5ESBA 3RXMA 1GBAA 3HATH 2Y7ZA 1NU7B 3RXLA 2BB4A 1G3DA 1GJDB 1H9LB 3M36A 4I8JA 4ISLA 1KXBA 2H9HA 2WV4A 3KF2A 3E1XB 4NA7A 2AH4X 1ID5H 1VGCB 2BY5X 2UWLA 1C2DA 3AAVA 4E7RG 4X8SH 3MWIU 2SGAA 3DA9B 1FUJA 3U1JB 2P94A 2A2XH 2BZAA 1C5QA 1DLKB 3SJOA 1UTMA 1BHXB 3GYLB 1TQ7B 2TIOA 2BHGA 1CA0C 1ELVA 1FZZA 2VIVA 2NU0E 2PKSB 2OBQA 3TNTA 8GCHG 1UTJA 1AFEH 2RCEA 2ZI2H 3ATWA 2FS8A 2HALA 3P8NA 4FVBA 2R3YA 1C9PA 5GPIB 1P57B 1XUHA 4ABDA 1GPZA 1AKSA 4VGCC 1QB9A 1O3HA 1AKSB 1EAWA 4OS7A 3IWMA 1FMGA 4TWWA 3ZVAA 1ZLRA 4AGJA 1SHYA 2Z9LA 1Y3WA 1Q3XA 1W10U 4I8GA 3F9HA 4MG3A 4CRDA 1DPOA 3GY4A 2W3KA 3VGCC 1GBKA 5F6MA 5BRRE 1Y3YA 2ZTZA 2F3CE 5LPRA 1W2KH 1GJ6A 1GGDB 1WU1A 2A4OA 1SC8U 4YOIA 1GWAA 5EODA
chains in the Genus database with same CATH superfamily
1ZTLA 2BVSH 1BJVA 3OE7D 5A0AE 1K1JA 3W95A 1WOFA 3DSGA 3A88A 3RXCA 1T31A 2OC8A 3VXEH 1EZSC 2BLQA 1RXPA 4ZAEA 3T26A 1A5GH 4FUDA 2V3HH 4ZROA 2XBYA 3T5FH 1YY3A 5EGMA 2QV1A 2BY9X 4JZEH 1HAYB 3OAAD 4CH8B 2XCFA 3ATIA 4YTAA 1P11E 4FUIA 4CRGA 1ZTJA 3E8LA 1TGNA 1HJAB 2F9UA 2VBCA 3KIDU 5EJZA 1CBWC 3RXVA 2H9TH 5FCKA 5DPAA 4HGCA 4Y8XA 3S9CA 2LPRA 5B6LA 5F53A 2AGIX 1ZR0A 2XW9A 1MKXK 1XUFA 3LT3A 1A2CH 4D7GA 1RD3B 3E3TA 3RC4A 2AMDA 3ZZ6A 3ZZBA 2H6MA 2BD3A 1BZXE 2Z9GA 5EPYA 2BDCA 1BB0B 5JBCS 2KM0A 2BQ6B 2EEKA 3D65E 2FOHA 3T25A 1TALA 3ZZ5A 4O9VA 4I31A 2V3OH 1YP9A 1YCPH 1O5AB 2GKVE 4B2CA 5C17A 1PFXC 4X0WU 4K1TA 1V2QT 1F5KU 3GY3A 1QRZA 2HNTE 4MPUA 5FHTA 2Y80A 1EAXA 3EA9A 4K69A 4HZHA 1P01A 1SVPA 2IJD1 1DWBH 1YYY1 3FOAA 4I8LA 1GHBF 5FPSA 1A4WH 3MMGA 1TE0A 3RXTA 4XSKU 2Z3EA 4AB9A 1GG6B 1FY3A 1OYTH 4JK5A 5FBEA 2F9PA 3VB6A 3LH1A 1ABJH 1YPJH 5IYTA 2BZ6H 2GT7A 3SGQE 2ZHEH 4ABAA 6ESTA 1RRKA 4GAWA 3SBKA 4JCNA 1BOQA 1C2IA 1C4Y2 1YBWA 3DFLA 1QJ1B 3U8RH 3STJA 5JDUB 3NRLA 2G00A 1C5PA 2J9NA 2ZGCA 4RT1A 7ESTE 1GBLA 1NBME 4AFSA 4ZKRU 3RC5A 1K9OE 1TBRH 1SG8B 1F5LA 2B9LA 2OD3B 2VWNA 1OPHB 2W6ID 5A0CA 1ZJKA 2ZPRA 2VGCB 1YLNA 1ZHPA 3TLOA 1KTTB 1WDIA 4RN6A 1H8ED 3RXUA 1MD7A 3KL6A 1PYTD 2WPJS 4BNRA 2EI8A 3EE7A 1PQ7A 1NTPA 1MTSA 1EAIA 4U32A 3F1SB 1TMBH 2A32A 3PO1B 2ZKSA 1ZRKA 2WPDD 2KCPA 3GCHB 4BAMB 1C5SA 3PWBA 1BTPA 1Z71A 2CK3D 4TSFD 1SGTA 1A5IA 2Z9IA 2ZFSA 1OP8A 1QBNA 4M9FA 4UE7H 3ZZCA 4ZMAH 1LVMA 2BD2A 2RFKC 3N99A 3NCLA 2JIZD 1MMJN 1TYNA 2ZCKP 4NIXA 1IQNA 5FPTA 4ZKSU 1ELCA 1GGDC 2QY0B 3RXKA 1ELFA 1BMLA 1DWEH 1TPAE 1QFKH 4YM9A 1FI8A 4GHQA 3V3MA 3LU9B 1CO7E 3SV6A 1VJ9U 4X2WA 5C1XA 1AD8H 3MU8A 1VKYA 3EDXB 4CR9A 2B8OH 2FIRH 1GI7B 2G55A 4IN2A 2Q6DA 4K5ZA 1TBZH 4X6MA 5E0HA 2FLRH 1GI4A 4JK6A 1ELTA 1UTOA 3ATMA 3PYHA 4D76A 5GCHF 2CHAB 2BY8X 3KHVA 3PRBA 2VIQA 3MTYA 3PMJA 2BXUH 4K2YA 2A7CA 1W0ZU 1MU8B 1HJAC 2VVVA 1QQ4A 1PPCE 1TX7A 1CSOE 3GY5A 2V35A 1NFXA 1C2JA 1ELGA 1GI1A 3QX5H 2ZQ1A 3MO3A 4MPXA 1CT0E 1P2MA 2XBWA 1XM1A 3SZEA 4ZUHA 3A8BA 3UB0A 1QA0A 2XBXA 3OX7U 2WZQA 2BY7X 4ZKOU 3RDZA 2HVXA 1P02A 1MKWK 4IS5A 4UFDH 9ESTA 1UCYE 1CHOF 2Z6BD 2ZEBA 1ORFA 3P95A 5A8YA 1Q31A 1QTFA 2D2DA 2GJGA 4GCHF 1W11U 2WUCA 3RMLH 3GY7A 1GI5A 2SGPE 1KLJH 3M7TA 3Q00A 1ESTA 1NRRH 4ASUD 1P2JA 1YKTA 1FX0B 3MH4A 2I6SA 1HGTH 3OFND 4MNWA 2Z9JA 3H5CB 2UUYA 1SQRA 3G01A 4X6OA 2BLWA 1EB2A 4I8HA 1HAOH 3P6ZB 3RU4T 2W7SA 2ZWLH 4OS1A 2UWOA 4MNVA 2ODPA 2H5DA 2F9NA 1OP0A 1TA2A 2YNBA 1BMAA 1SLVB 3BEUA 2F43B 4SGAE 3UUZA 1C2KA 4ASHA 4ISOA 1ZHMA 1XKAC 1ZPZA 3BG4B 1FLEE 3DSOA 3LDXH 3P8GA 1GJ9B 1C1UH 1O2TA 1A0HB 3MNCA 1AB9C 1KTSB 2ZHFH 3L3TA 1RS0A 4CRFA 5SGAE 3ZVGA 1LKBA 3CS0A 2J2UA 1YPKH 2JDID 4ABFA 4P02A 5KECA 4FUEA 1G37A 3UY9A 1DICA 2GP9B 1BTHH 1YPGH 4WJG2 1V2NT 3NUMA 5EQQA 1S81A 2A5KA 2BD5A 3SW2B 5L30H 2CMYA 1C5TA 3ZVCA 1T8MA 3F2HA 2SGEE 2TRMA 1G3CA 1P2NA 1CHGA 2JETB 4DURA 4RT0A 1W8BH 1LPGB 1HNEE 1SQAA 5GXPA 3PM3A 1AVGH 3ZYEA 1C1OA 1S85A 3S9AA 3DCLA 1TOMH 1ANBA 2GCHF 2PR3A 2J5UA 1LVOA 1H4WA 1V2KT 2Y82A 1P3CA 1WBGB 3VB4A 2ZGHA 1G2MA 5DP9A 5EQSA 1JXPA 1VITF 4MDSA 3GCHC 1DS2E 1NESE 1HAZB 2ZO3H 4ISNA 1D3TB 1ZPCA 1TPOA 4Y8ZA 2VB0A 1EAUA 1O3DA 4FU9A 4AN7A 4FUFA 4XDEA 3PROA 2CGAA 1CE5A 2I6QA 5HIYA 3F9EA 4JMYA 5C94A 2VU8E 1RFNA 2ZGJA 4FUBA 5AFZH 4BAQB 1FY8E 1JMOH 2J34A 1T4UH 3KYGA 1TRNA 1GBMA 2F4LA 5FX5A 2GD4B 1RTFB 3ZZAA 1IQMA 3A86A 3RXQA 4DGJA 1UVUH 1O3CA 3E0PB 1V2PT 2QN5T 3LJJA 3UIRA 1QRXA 2V3MA 6GCHF 1CA0B 1O32A 4CREA 1P2IA 2OQUA 1C5VA 1EATA 1H9HE 2QC2A 1SGFA 2FX6A 2TGDA 1F92A 1DWDH 5F03A 2CN0H 3GISB 2BOHB 1O3BA 2VIDA 2ZQ2A 3RXIA 1GJ7B 2PTCE 1MTWA 1Z8RA 2ZHQH 5DN6D 5C1YA 1V2ST 1GJ4H 1QJ7B 3HGPA 1L1JA 1Z6JH 4VGCB 4M7GA 2OC7A 4P00A 4KELA 5T6FA 3KGPA 2BD9A 1FONA 2ZP0H 1O3IA 3F9FA 5LPEA 1TMTH 3TK9A 3HKIB 1YPEH 1EXFA 3ZYDA 3I29A 5T3HA 1AU8A 5EIYA 1SQTA 1PPGE 3FP6E 3VGCB 3RXEA 2RG3A 3HKJB 1ABIH 1NO9H 1IQGA 1BRUP 5HIZA 2ZGXH 1YPMH 3P70B 1GMHF 1HV7A 1O38A 2Y81A 5A8ZA 1L4DA 1GVZA 1O2ZA 5C3NA 1Z7KA 3Q76A 1LDTT 3URDA 3M3VA 2IPQX 4YOJA 3OY5U 1P9UA 3U28C 3C27B 4XE4A 3UNSA 5JBAS 2FOAA 4Y7BA 4D9QA 1NRSH 4RI0A 2BLOA 3RLWH 1OWKA 2LNCA 5E8EH 1E1RD 1UVOA 5DG6A 1DFPA 2ZFRH 1GHBG 3SZNA 1QIXB 3SU5A 2LP6A 2BDHA 2BDAA 4DIIH 1XXDA 3WWBA 4INHA 4WH8A 3OEED 1DANH 2PLXA 1TNKA 2A5IA 2CF8H 2H9EH 1CBWB 1LHFH 1MH0A 1TFXA 2ZHWH 3BV9B 1HBTH 1GBHA 3UWJH 2DUCA 1IOEA 2J92A 1EP5A 4GLYA 1O34A 1A61H 1GI8B 3BEFB 3F2FA 4B6EA 2W5EA 2XYAA 4YO9A 1OWEA 4K8YA 3HPTB 1QB6A 2O8UA 4IGDA 3H7TA 1BTXA 1BBRK 1GJBB 1GHVH 3BTME 3BTEE 1AWFH 1AUJA 1A46H 3BTHE 3PV4A 5DSFA 1GI2A 2C93B 3BIUH 2ZC9H 4THNH 4Y8YA 5DP6A 1XX9A 3LC3A 1V2VT 1O2YA 1GI0A 3LOXA 1ANCA 2NU4E 2WPLS 3EQ0H 4B1TA 1CT2E 2G51A 2WHXA 2QAAA 3CS7A 1C5YB 1C2EA 1H8IH 1O2OA 5K0HA 1O2NA 1O5BB 1O30A 2FI5E 2G4UA 3MI4A 4AFQA 1Z8GA 5FL7D 1YCPK 3AAUA 3E90B 4U01A 2OQ5A 1YPHC 2J97A 5EW2H 4NIWA 2F9VA 2TGPZ 3NK8A 3S7KB 1D3DB 2XBVA 3BTTE 2KCAA 2BLVA 2XCNA 3UOPA 2QE7D 4OS2A 3RMOH 3E0NB 1Q2WA 2O8MA 5EOKA 3P92A 4BAKB 4Y10E 1LQDB 4AOQA 5GIBA 4X1SU 3KNXA 3SNEA 5ABWA 2GTBA 5A2MH 1C2GA 5C20A 3IITA 1EX3A 2THFB 1MAXA 2C8YB 3BSQA 1A1RA 2ALPA 1C9TA 1ZSKA 1E35B 2FM2A 4X6NA 1B5GH 2GZ7A 1V2MT 1WQSA 4BXWA 3S7HB 1HAHH 3D23A 4CR5A 3ELAH 5C2ZA 2ZTYA 3ZZ8A 2BDYA 3K65B 1T7CA 4FUCA 1UW7A 2C4FH 1MAYA 4GHTA 5DP3A 4R8TB 3TIUA 1E79D 3RXPA 4NSVA 2AGEX 1MBMA 5GCHG 3PV2A 1RIWB 3A7WA 4YT7H 3GCNA 1ZZZA 4FUGA 4TY7A 3F68H 2FLBH 3VXFH 3F2GA 1D3PB 1BRAA 2XTTB 2KCYA 1EZXC 1AVXA 4MVNA 1HIAA 4X2YA 1HIAB 1D9IA 1S6HA 4ZHAA 1ZOMA 1O3FA 5KGOA 2KAIA 4BAOB 2KAIB 1MQ6A 3E16B 2KX4A 1GBBA 3GY2A 3LGVA 3A7ZA 4LZ4B 1O3JA 5IDKA 3M5MA 3JZ1B 3T27A 4K8BA 5GWZA 2J98A 1BIOA 1QA7A 3EYDA 3SQEE 2J98B 1PPFE 3OY6U 4XRNA 1CHOG 1TRYA 1OX1A 2G4TA 3RXRA 1UTKA 1J16A 3VFEA 1CT4E 1ESBA 2CXVA 1EZUC 3QK1A 3OTJE 1NM6A 4GCHG 1GBTA 1O3OA 1TNJA 3GY8A 1KXCA 1P2QA 1QBOA 2QF5A 2H5CA 1O2XA 3E6PH 4WMDA 3FO8D 2G5NA 1AFQB 1G32B 2WPHS 2ILNA 1EOJA 5CDFE 2M5TA 1EJNA 2QXGA 3O8CA 1PQ5A 1OSSA 3M37A 1BRBE 1HRTH 1SLWB 5C0UA 5FX6A 1F0SA 1O2SA 4AB8A 1ANEA 1DLEA 3LONA 2HLDD 1GI6A 3LIWA 4B73A 5E0GA 1SGYE 1THRH 2XC4A 1OOKB 1F0RA 1PQAA 3QLPH 1BCUH 1DDJA 1LHDH 1QZ8A 2YMSD 1GL1A 2A7HA 2PSYA 3OYPA 2SGFE 4K1SA 3ODFA 1WYKA 1JOUB 1DE7H 3QWCH 2YNAA 4KTUA 1SGRE 2V0BA 4DT4A 1FN6A 1KXEA 2CF9H 4O97A 1T8LA 7LPRA 1INCA 1T8NA 5IK2D 3QGNB 1SGNE 2P8OC 2HVYB 3MQKC 1EB1H 2F9OA 3SJ9A 1Y59T 2XXLA 4Y11E 2ANYA 1DY9A 1O33A 5C5OA 4XBBA 5HM9A 2F91A 2C8WB 2WPIS 3NXPA 1UTLM 2A45B 4IC5A 1V2OT 3RXJA 4A5TS 1K28D 1UVPA 2OC0A 1GHXH 1UCYH 1THPB 1EP6A 2ZCLP 3LGIA 1CGIE 2AGGX 1F0TA 1MD8A 1VCWA 2G52A 2GCTB 1MZDA 2J4IA 1ARCA 1YLCA 1PPBH 3D62A 1IAUA 2GCHG 2HNTC 3TK5A 3PMBB 1KY9A 2GDEH 2P3FH 2UUJB 3Q3KA 1QGFA 2ZU4A 1LKAA 1Z1IA 4X1PU 1VITG 3P17H 2BDGA 3BN9A 3M35A 4D9RA 4UONA 1O3NA 3BTWE 4CH2B 2VVCA 5AHGH 2NU3E 2JH0D 1AB9B 1SPJA 4NIYA 1J8AA 5TCCA 3PMHB 4DIHH 2AMQA 2D8WA 1P2OA 1IHSH 3W1EA 3D49H 1MTNC 2ZDNA 3SGAE 2FOEA 3U9AH 2C3SA 1LPKB 3UNQA 1GBCA 2BXTH 2UUKB 4AYYB 2VH0A 1AE8H 1P8VC 5K7RA 1SLUB 1TNIA 5T1VA 1GMDF 1QBVH 5GJ4B 3OSYA 3BIVH 3W94A 4TWYA 1SMFE 5FXLA 6GCHG 1SBWA 4ABGA 1JBUH 2VWLA 4YLUA 2QF3A 4X8TH 3RU4E 5JB8S 4IMZA 1RIWC 1UK2A 1F5RA 1ZSJA 4ABBA 2B5TB 3SJKA 4JZIA 3ZVDA 1HFDA 1FAXA 1C4V2 4BANB 5ESTE 1GHYH 3SUDA 1L1NA 3EA8A 3GYMA 4NCYA 2BD4A 2FP7B 3UNRA 4OS5A 1K22H 1BHXF 1O5EH 1YC0A 2HWLB 3RXSA 1BDAA 2HPQH 3BTKE 1XUIA 5EXMA 1GMHG 3M5NA 1D6RA 3GDUA 1MABB 3DSPA 2FMJA 4A1VA 3TITA 3FVFB 3GS9A 3GDSA 3KQBA 2EI7A 2WPMS 4I32A 2P16A 1GCTC 5CHBA 3R0FA 3LGYA 5LPFA 5CHAC 4QT8C 4Y76A 1AFQC 2ZGBH 4F55A 1GVKB 1W0JD 4B75A 2FEQH 4MPWA 4GVUA 2ANMH 4XOJA 3FFGA 2FTLE 2K8IA 2ALVA 1NRPH 1NZQH 1G9IE 2OTVA 1BRCE 4ABEA 2QXJA 1FY1A 4OGXA 3PLPA 4ISHH 4GUXA 2ZDAH 2VIWA 2VIPA 1EOLA 1SQOA 4MPVA 1BBRE 1DT2A 2WSSD 3A83A 5E2PA 2A4GA 3FP8E 4E05H 1LTOA 1AGJA 2GX4A 4A92A 1ETTH 3VPKA 1E0FD 2P59A 3AW1A 1HAGE 4Y7AA 1MCTA 1NT1A 3ATKA 4XBDA 2A7JA 2ZDKA 3SO3A 3WY8A 1C1SA 3F3BA 1AY6H 2QF4A 1GI9B 1S82A 2FOGA 3PTBA 1HXFH 4F49A 2AS9A 3RMNH 4NFEA 4UFFH 1SB1H 1HAIH 4MNYA 1YPLH 2FI3E 5J4QA 3SU6A 2OLGA 1AZ8A 1C1NA 2EY4C 5ETXA 3HK6B 1GBFA 3EGKH 4X6PA 7KMEH 4BTIB 1QL9A 3RXDA 2GCTC 2VIOA 1HPGA 2O8TA 5EQRA 3AK5A 4Y79A 1OWJA 5AVDA 4UFEH 1MTVA 3RXGA 1UJ1A 3GY6A 4Q7YA 1BTWA 1GHZA 1O3GA 3FZDA 4PROA 1O2WA 4YT6H 4O3TA 1P06A 1C5UA 2PGQB 4Q80A 3A8AA 3MHWU 1EPTC 2ZG0H 5EXNA 5EJ1A 3A8DA 1BMFD 4K60A 2Y6TA 2D26C 2OBOA 4SGBE 3LKWA 3RXAA 3TVJB 1G3EA 1C1QA 1TNLA 2AMPA 1FIZA 1WCZA 1TMUH 4RKOB 1C5XB 2PV9B 4WWYA 1HYLA 2A4QA 1OKXA 2EQNA 1JIRA 3ZIAD 1KSNA 3DFJA 2RA0A 2B0FA 2H2ZA 4U30A 2ZDLA 3S9BA 2A0QB 2PHBA 2A31A 2QYIA 1ESAA 1J9CH 1KIGH 4J1YA 5FCRA 1TNGA 3PRDA 3RXOA 1AUTC 1MTUA 4ZHLU 1O2PA 5H4IB 4XD7D 3ENSB 1K1LA 2BVXH 1G2LA 3FZZA 3HK3B 3TK6A 5C1UA 4ZXXH 3MYWA 3ZV8A 4GSOA 4X1QU 5TCAA 1A0LA 1H8HD 4JZ1A 1F2SE 2EC9H 2VH6A 3L6PA 5I46H 2AYWA 3F6UH 5FBIA 1W7XH 2IOTA 4NWKA 4AG1A 1O2UA 1P10A 4B74A 2ZTXA 2JH6D 3MNXA 1PPZA 1PQ8A 4NA9H 5I25A 1RGQA 1GL0E 1TX6A 1KLIH 1LO6A 2OINA 1K0HA 2VWMA 4OS6A 1TABE 1K1MA 3DD2H 3KQDA 1ZTKA 1SGQE 4Z6AH 4NZQA 4ZXYH 1D3QB 4DOQA 3A7VA 2ZNKH 3QZRA 1YM0A 5JBBS 1HB0B 4LOYH 1DWCH 5HKKD 5HXFA 1Z6EA 2P95A 1TGSZ 2EI6A 1IQLA 1EZQA 1AE5A 1GJAB 1NRQH 5E2OA 2BQ7B 3ZVFA 6CHAC 1OWDA 2RDLA 3TGKE 1O2KA 4IC6A 1P12E 1XVMA 3LC5A 4AC9A 1ZGIA 4K1EA 5CMXH 1G36A 2HOBA 1ZGVA 1CQQA 1FPHH 2Y5GA 1C2HA 1HDTH 3SI3H 2AFQB 1NBMD 3GCOA 2YMSC 2ZFTA 1XUGA 4OS4A 1SHHB 2NU1E 2A1DB 2JH5D 2XWAA 2KFWA 2Z3DA 3L33A 2ANKH 1P04A 3K6ZA 3QTVH 3UR9A 1H1BA 1GHAF 1S6FA 1FNIA 4JZFH 2CV3A 1N6XA 4NFFA 1AQ7A 1MKWH 2HGTH 3QDZB 4ESTE 1SOTA 1VZQH 1P03A 3MOCA 3SU4A 2ZFPH 2FOBA 2RA3A 2TGAA 3KCGH 3MH6A 1CA8B 2ZU3A 1P05A 1A7SA 2BM2A 3A84A 1KXDA 5DP8A 3TPIZ 1NPMA 5CE1A 1EJAA 3M61U 3QN7A 2ZDVH 1V2JT 1XVOA 3RMMH 1TRMA 5EG4A 4XBCA 1ZMLA 1A3EH 1KYNA 4XFQA 1S83A 1O2GH 3KQCA 1S84A 2FWWA 3H7OA 4LZ1H 1NU9A 2D1JA 5A0BA 3QO6A 1ZMNA 3T2NA 4ABJA 3ZV9A 3BF6H 4MTBA 2UUFB 1ELEE 1XXFA 1DUEA 3MNSA 1O3PB 1TWXB 1UO6A 3TGJE 2BMGB 3K2UA 4H6SB 4BAHB 1LQEA 2AHME 3CP7A 1D4PB 1EKBB 2GV7A 2P8OB 2WINI 1C5RA 1BT7A 3SV7A 5L6NH 3S0NA 4WVPE 3SORA 2V6NA 1O5FH 4MLFB 1WV7H 3UR6A 3ZZ9A 1G30B 1GMDG 2JJ2D 2ZPQA 1ETRH 1F7ZA 2ZCHP 1NFYA 2IN2A 2QF0A 4O03A 3SU0A 2STBE 1ELDE 1PYTC 3Q77A 3HGNA 2SNVA 1C2LA 3ZZDA 1EUFA 1W13U 2W26A 1M9UA 1WAYB 3SV9A 1UMAH 3RC6A 3TH3H 5HMAA 1EQ9A 1UCYK 2FTMA 2DE9A 3MU4A 1DM4B 5L2YH 2XWBI 1W14U 1TA6A 2GMTB 2VNTA 1IQKA 2ZU5A 1NS3A 4I33A 2FI4E 1E34B 4HI3A 1VJAU 1NFUA 1MTNB 2UWPA 1LPZB 2F83A 1SFQB 1AO5A 3AW0A 4RKJB 1S0QA 1C5LH 3BTDE 4TPIZ 1OXGA 1DITH 1FDPA 1BMNH 1GVLA 1YCPM 2KCOA 1BTUA 2Y7XA 1WSSH 3EA7A 3RXFA 4YESB 4D7FA 2YOLA 2TGTA 4IW4E 4ZHMU 1XKBC 4A1TA 1N8OC 3TH4H 2R2MB 1T32A 5A09A 2ZDMA 4CBOA 3O8DA 2HRVA 1GBEA 1ZJDA 4WMFA 1AVWA 1O3MA 2ULLA 4X2XA 5LGOA 1GJ8B 2QXHA 1DXWA 1L1GA 1HJ9A 2W3IA 1BJUA 3JZ2B 2QGRA 1IQHA 3LGUA 5FAHA 3EE0B 3MH5A 4DW2U 3A80A 1O3LA 1V2TT 1A0JA 1FN8A 1LVYA 4YLQH 1LMWB 5DP5A 1GBJA 1FJSA 1SOZA 1O2IA 2STAE 4Y0ZE 2WYGA 2BQWB 1WXRA 5A8XA 2H1UA 2XC0A 2M2AA 1ZYOA 3SU3A 4JZDH 2J95A 3O8RA 4WXIA 5EXLA 1C5ZB 2GV6A 1HAXB 4LXBH 1FY5A 2PKAA 2OK5A 2PKAB 4F48B 3SUGA 1GCTB 1QNJA 1O2HA 1CVWH 5CHAB 2A4RA 1W0KD 4A6LA 3TU7H 2IJOB 1P09A 4A1XA 1LHGH 4FXGH 5EJLA 3U8TH 3STIA 2XC5A 4ISIH 2VVUA 1XUJA 4X8VH 3MO6A 1SGCA 3UOUA 4NIVA 3SUFA 2WUBA 1TBQH 1YWUA 4R0IA 3V0XA 3N7EA 1RTKA 3SU1A 3BTFE 3ZZ4A 3TJVA 3TJOA 1LHCH 3MNBA 7GCHF 1D6WA 3BEIB 4B6FA 3A7YA 3RUOA 1ELAA 3GCTF 3MU1A 2VWOA 1NROH 2ODQA 4Q7XA 1THSH 4BTTB 1O2QA 3RM2H 1SGDE 3KQEA 1EASA 1O3KA 1TGTA 2AERH 2FO9A 1FPCH 2EA3A 1BBRH 4UDWH 1CGJE 3ESTA 3OEHD 1BA8B 4GPGA 6LPRA 2PUXB 2CJIA 3RXHA 4Q4LA 3IG6B 3ITIA 1SR5C 2OUAA 5HM2A 1Y8TA 1O0DH 1UVTH 1HLTH 2GGVB 4FUHA 3TNSA 1B0EA 3PWCA 2Q6GA 1RTLA 3TGIE 5FPYA 3Q3XA 1K1OA 1N6YA 2R3UA 4BXSA 1C1MA 1HXEH 3OTPA 2KZ4A 2ZFFH 3SI4H 3T28A 2A2QH 5GDSH 1F0UA 4JYVH 1GJ5H 2XNIA 2BDBA 4CRAA 1AN1E 4LK4A 5PTPA 4JYTA 1TPSA 4NWLA 1KMHB 3SNCA 3SYJA 1P3EA 3F0PA 1EPTA 3LJOA 1GDNA 3S69A 4ABIA 5C67A 2GMTC 1EPTB 1QJ6B 1VCQA 1WTHD 3GOVB 3LPRA 1Y3VA 1O36A 5F8ZA 2NU2E 3A7XA 1G3BA 1OWHA 1NFWA 2A5AA 1O2VA 1S5SA 3DT0H 3VEQB 3B23B 1HUTH 3MH7A 1OP2A 1HAVA 1P0SH 1X7AC 1YGCH 1SFIA 5GNDA 5BPEA 1HAVB 4CRBA 4IBLH 8LPRA 3KYFA 2Z7FE 3ZZ7A 5AF9H 2B7DH 4HFPB 3QGJA 3UFAA 1O3EA 1QHRB 2O9QA 1YLDA 2HNTF 2PTNA 8ESTE 2R0KA 1TNHA 4WY3A 2ZU1A 4I86A 1FY4A 1W3CA 3SN8A 1O2MA 1VGCC 4JYUH 3M5OA 5E0JA 1VITH 4X1NU 4Z1MD 2ODYB 2GVFA 5DP7A 1UVSH 4AYVB 1Z8JB 2WYJA 1J15A 3P8FA 5DJ7A 3R3GB 2HLCA 1O5CB 2ZZUH 1O31A 2TBSA 3SJIA 1T8OA 3K9XB 1SL3A 2O8LA 2Z3CA 2PKSC 1SLXB 3PMAB 2C8ZB 3EAJA 3GICB 1PJPA 2IPHA 3RLYH 2ANWA 4NSYA 2C8XB 5JYIA 2G8TA 2KR7A 2G5VA 1IQIA 2FXRA 1BMMH 1GHAG 4DCDA 4FU7A 1IQJA 1GMCF 4DY7B 1B7XB 1GI3A 3U69H 1RJXB 4INKA 4TT3D 3A89A 1QL7A 5KEDA 3SQHE 1HCGA 1DSTA 1WQVH 3A85A 1BTZA 1T4VH 2P3UB 1MBQA 2OP9A 1CU1A 5LH8A 2BVRH 4CHAB 3Q3YA 3H09A 3PLKA 1H9IE 2FYRA 1YF4A 1ZRBA 3DHKH 3CNRA 2GZ9A 3F9GA 6CHAB 1OS8A 1FAKH 4Q7ZA 2ZIQH 3PTNA 4AX9H 2BDIA 5B6OA 1PPEE 1K1IA 1UK4A 1PPHE 3VB3A 4B2BA 4IMQA 4AGKA 4YXWD 2RDEA 3FN8A 1UTPA 3BTGE 1IQEA 3F0OA 8GCHF 1ANDA 2ZFQH 4X8UH 2YMSB 1K21H 4FVDA 3VB5A 3NPSA 1UTQA 1MKXH 2ZHDA 3FKSD 3NZIA 2J94A 3QTOH 1DY8A 1TPPA 1QL8A 5DO4H 4IN1A 3SJ8A 1V2LT 1DOJA 1Z8IB 1QY6A 1L4ZA 1QRWA 1TX8A 2SFAA 2R0LA 2FYQA 4BTUB 4KKDA 1C1TA 1MCVA 1TIOA 3GDVA 3PLBA 4FETA 5J4SA 5DK1A 1C4U2 3MFJA 1K1PA 2OCVB 3TJUA 4J2YB 1SGEE 4NG9H 1NC6A 5JB9S 3U98H 2BYAX 4AG2A 1VR1H 3LH3A 1GDUA 4AORA 1SGPE 3U1IB 5HYOA 4I8KA 4DVAU 4ZKNU 3KEEA 1C5NH 4H6TA 4DG4A 1HAPH 1E1QD 2NWNA 1TQ0B 4OM9A 4Z0KA 1WUNH 1QURH 2ESTE 3E91A 1O39A 3ZVBA 4FUJA 1JIMA 2ASUB 4YOGA 2BTCE 1UHBA 4X2VA 1UHBB 1QCPA 2K1QA 1GG6C 3QUMP 1A5HA 1N1LA 1MUEB 2L6OA 1NY22 1C1WH 3FAOA 4CRCA 1FIWA 3O8BA 3WW7A 1ZSLA 4B71A 4KP0A 3U8OH 3UQVA 4K3JA 2R2WU 4ACAA 1BUIA 1TGCA 4AFUA 4FU8A 3SHAH 1KLTA 4Y71A 1UTNA 4DT7B 1KDQA 2JKHA 2OXSA 1AI8H 1KDQB 2QIQA 5TJXA 1V6DA 2WV5A 3AASA 2QA9E 4ZH8A 2J38A 1HJ8A 3RP2A 1JWTA 2Y5FA 3A82A 4TYDA 2PWXA 4X1RU 2FOCA 1J14A 2ZU2A 3SV2H 3SHCH 3SNBA 1O35A 2SNWA 2FODA 5T6DA 2C90B 1KXFA 3A81A 1COWD 3KN2A 3KQ5A 2VGCC 1C5OH 2ZA5A 1V2UT 2Y5HA 4Y6DA 1QB1A 1BQYA 1NN6A 1ELBA 1B0FA 4ABHA 2L74A 1J17T 2K0QA 1L0ZA 1P2KA 3M7QA 1LVBA 4AFZA 1WTGH 2GDDA 1V2WT 3FANA 2PP6A 3VB7A 3PO1C 1SGFG 4B76A 2BX4A 3SV8A 1ARBA 3A7TA 2Q6FA 2Z9KA 5DGJA 1ZPBA 3DUXH 3TH2H 2VJ1A 3LGWA 3RM0H 2Z94A 3SOSA 1TGBA 1C2FA 4INLA 1UK3A 1C1PA 4KGAA 2SGQE 2VINA 3ATLA 4CHAC 1DSUA 1N8OB 4WH6A 1JRSA 2TPIZ 2BD8A 3UTUH 1SI5H 1ZHRA 1E36B 3A8CA 4BOHA 1FXYA 3VG8A 1QQUA 5EPNA 3UQOA 2PFEA 4E7NA 1S0RA 1EJMA 2WPKS 1V2RT 3SUEA 3RXBA 5G4BA 2PUQH 1O2RA 4RSPA 1QR3E 2ZECA 1MQ5A 3PV5A 4OGYA 2XRCA 5DP4A 1C5WB 3UWIA 4MQAA 7GCHG 4WXVA 2G81E 1O2JA 2CHAC 1C2MA 1W7GH 2Q1JA 4HTCH 3ZVEA 3GCTG 1S6LA 2FOMB 2ZF0H 3B8JA 4E06H 5C0TA 1TONA 1Y5AT 3P8OA 4WMEA 2PSXA 4UD9H 4U2WA 3BTQE 2BD7A 2OC1A 9LPRA 1AIXH 5EW1H 1TB6H 3N7OA 3RU4D 4HG6A 2O8WA 2V7QD 1FQ3A 1ZMJA 1CGHA 2AEIH 5C5NA 4WF8A 3M7UA 2FZZA 1Y3UA 1O2LA 1H8DH 3MO9A 1SGIB 1ETSH 3T29A 3QZQA 3C1KA 4B2AA 1V3XA 1XUKA 2AIPA 4D8NA 3SU2A 1GBDA 1TOCB 3LGTA 4KTSA 3URCA 3FP7E 3AVZA 2DE8A 2FESH 1O37A 1Y3XA 5JPMH 2ZPSA 2WV9A 1JRTA 1Y5UT 2FX4A 3K6YA 1DX5M 1OYQA 3MU0A 1SSXA 1E38B 1GHWH 1MZAA 3BG8A 3V7TA 1NRNH 1L2EA 3NKKA 5DKMA 1C5MD 2W6JD 4NGAH 4O3UA 1AMHA 1VCPA 4NA8A 4Q2KA 3SNDA 2FPZA 3ZZ3A 5EU8A 1IQFA 1LHEH 4UFGH 3CENA 2JJ1D 1W12U 2PW8H 1FV9A 2SGDE 1C1VH 1Z1JA 2AIQA 2HPPH 3NWUA 2BY6X 1A3BH 3BG4C 4TPYA 5HGGA 3SNAA 4DJZB 1TLDA 4CBNA 4ZCNA 3SGBE 5JBTA 1LCYA 1IHTH 4UEHH 4I7YH 1C1RA 2W7UA 2F9BH 5F8TA 1DVAH 1K1NA 1TAWA 3UREA 4KTCA 1SKYE 5T6GA 3I77A 1U6QA 3V12A 2QXIA 1O3AA 3B9FH 4MNXA 1AWHB 2FS9A 2GT8A 3M3TA 3UAIC 2P3TB 3M3SA 3PB1E 1Y5BT 1YPHE 5L2ZH 1AZZA 3V13A 1E37B 2BOKA 1DXPA 3UPEA 3A87A 1MU6B 2FDAA 4Q63A 3T62A 1ACBE 2PGBB 4NZLA 1W0YH 4AZ2B 3ODDA 4F4OC 1BITA 3M5LA 1DUAA 1XMNB 2R9PA 1GCDA 4H42U 3OU0A 4A7IB 4Y0YE 1K2I1 2JETC 1GBIA 1O5GH 2QCYA 4TY6A 1AHTH 3I78A 2P93A 1BTYA 8KME2 2GZ8A 2FOFA 5AFYH 3TJNA 4ACBA 4YZUA 2BX3A 1GJCB 5F8XA 1OWIA 1KXAA 3MU5A 1P9SA 2XNDD 1GDQA 4H4FA 1O5DH 1GMCG 5ESBA 3RXMA 1GBAA 3HATH 2Y7ZA 1NU7B 3RXLA 2BB4A 2LELA 1G3DA 1GJDB 3WWFA 1H9LB 3M36A 4I8JA 4ISLA 1KXBA 2H9HA 2WV4A 3KF2A 3E1XB 4NA7A 2AH4X 1ID5H 1VGCB 2BY5X 2UWLA 1C2DA 3AAVA 4E7RG 4X8SH 3MWIU 2SGAA 3DA9B 1FUJA 3U1JB 2P94A 2A2XH 2BZAA 1C5QA 1DLKB 3SJOA 1UTMA 1BHXB 3GYLB 1TQ7B 2TIOA 2BHGA 1CA0C 1ELVA 1FZZA 2VIVA 2NU0E 2PKSB 2OBQA 3TNTA 8GCHG 1UTJA 1AFEH 1OHHD 2RCEA 2ZI2H 3ATWA 2FS8A 2HALA 3N7DA 3P8NA 4FVBA 2R3YA 1C9PA 5GPIB 1P57B 1XUHA 4ABDA 1GPZA 1AKSA 4VGCC 1QB9A 1O3HA 1AKSB 1EAWA 4OS7A 3IWMA 1FMGA 4TWWA 3ZVAA 1ZLRA 4AGJA 1SHYA 2Z9LA 1Y3WA 1Q3XA 1W10U 4I8GA 3F9HA 4MG3A 4CRDA 1DPOA 3GY4A 2W3KA 2XOKD 3VGCC 1GBKA 5F6MA 5BRRE 1Y3YA 2ZTZA 2F3CE 5LPRA 1W2KH 1GJ6A 1GGDB 1WU1A 2A4OA 4FOUC 1SC8U 4YOIA 1EFRD 1GWAA 5EODA
chains in the Genus database with same CATH topology
1ZTLA 2BVSH 1BJVA 5A0AE 1K1JA 3W95A 1WOFA 3RXCA 3A88A 1T31A 2OC8A 3VXEH 1EZSC 2BLQA 1RXPA 4ZAEA 3T26A 1A5GH 4FUDA 2V3HH 4ZROA 2XBYA 3T5FH 5EGMA 2QV1A 2BY9X 4JZEH 1HAYB 4CH8B 2XCFA 3ATIA 4YTAA 1P11E 4FUIA 4CRGA 1ZTJA 3E8LA 1TGNA 1HJAB 2F9UA 3KIDU 1CBWC 3RXVA 2H9TH 5FCKA 5DPAA 4HGCA 4Y8XA 3S9CA 2LPRA 2AGIX 1ZR0A 2XW9A 1MKXK 1XUFA 3LT3A 1A2CH 4D7GA 1RD3B 3E3TA 3RC4A 2AMDA 3ZZ6A 3ZZBA 2H6MA 2BD3A 1BZXE 2Z9GA 5EPYA 2BDCA 1BB0B 5JBCS 2BQ6B 2EEKA 3D65E 2FOHA 3T25A 1TALA 3ZZ5A 4O9VA 4I31A 2V3OH 1YP9A 1YCPH 1O5AB 2GKVE 4B2CA 1PFXC 4X0WU 4K1TA 1V2QT 1F5KU 3GY3A 1QRZA 2HNTE 4MPUA 5FHTA 2Y80A 1EAXA 3EA9A 4K69A 4HZHA 1P01A 1SVPA 1DWBH 1YYY1 4I8LA 1GHBF 5FPSA 1A4WH 3MMGA 1TE0A 3RXTA 4XSKU 2Z3EA 4AB9A 1GG6B 1FY3A 1OYTH 4JK5A 5FBEA 2F9PA 3VB6A 3LH1A 1ABJH 1YPJH 5IYTA 2BZ6H 2GT7A 3SGQE 2ZHEH 4ABAA 6ESTA 1RRKA 4GAWA 3SBKA 4JCNA 1BOQA 1C2IA 1C4Y2 1YBWA 3DFLA 1QJ1B 3U8RH 3STJA 5JDUB 2G00A 1C5PA 2J9NA 2ZGCA 7ESTE 1GBLA 4AFSA 4ZKRU 3RC5A 1K9OE 1TBRH 1SG8B 1F5LA 2B9LA 2OD3B 2VWNA 1OPHB 5A0CA 1ZJKA 2ZPRA 2VGCB 1ZHPA 3TLOA 1KTTB 3RXUA 4RN6A 1MD7A 3KL6A 1PYTD 2WPJS 4BNRA 2EI8A 1PQ7A 1NTPA 1MTSA 1EAIA 4U32A 3F1SB 1TMBH 2A32A 3PO1B 2ZKSA 1ZRKA 3GCHB 4BAMB 1C5SA 3PWBA 1BTPA 1Z71A 1SGTA 1A5IA 2Z9IA 2ZFSA 1OP8A 1QBNA 4UE7H 3ZZCA 4ZMAH 1LVMA 2BD2A 3NCLA 1TYNA 1MMJN 2ZCKP 4NIXA 1IQNA 5FPTA 4ZKSU 1ELCA 1GGDC 2QY0B 3RXKA 1ELFA 1BMLA 1DWEH 1TPAE 1QFKH 4YM9A 1FI8A 4GHQA 3V3MA 3LU9B 1CO7E 3SV6A 1VJ9U 4X2WA 5C1XA 1AD8H 3MU8A 3EDXB 4CR9A 2B8OH 2FIRH 1GI7B 2G55A 4IN2A 2Q6DA 4K5ZA 1TBZH 4X6MA 5E0HA 2FLRH 1GI4A 4JK6A 1ELTA 1UTOA 3ATMA 3PYHA 4D76A 5GCHF 2CHAB 2BY8X 3KHVA 2VIQA 3MTYA 3PMJA 2BXUH 4K2YA 2A7CA 1W0ZU 1MU8B 1HJAC 2VVVA 1QQ4A 1PPCE 1TX7A 1CSOE 3GY5A 2V35A 1NFXA 1C2JA 1ELGA 1GI1A 3QX5H 2ZQ1A 3MO3A 4MPXA 1CT0E 1P2MA 2XBWA 1XM1A 4ZUHA 3A8BA 1QA0A 2XBXA 3OX7U 2BY7X 4ZKOU 3RDZA 2HVXA 1P02A 1MKWK 4IS5A 4UFDH 9ESTA 1UCYE 1CHOF 2Z6BD 2ZEBA 1ORFA 3P95A 5A8YA 1Q31A 1QTFA 2D2DA 4GCHF 1W11U 2WUCA 3RMLH 3GY7A 1GI5A 2SGPE 1KLJH 3M7TA 3Q00A 1ESTA 1NRRH 1P2JA 1YKTA 3MH4A 2I6SA 1HGTH 4MNWA 2Z9JA 3H5CB 2UUYA 3G01A 4X6OA 2BLWA 1EB2A 4I8HA 1HAOH 3P6ZB 3RU4T 2W7SA 2ZWLH 4OS1A 2UWOA 4MNVA 2ODPA 2H5DA 2F9NA 1OP0A 1TA2A 2YNBA 1BMAA 1SLVB 3BEUA 3UUZA 4SGAE 1C2KA 4ASHA 4ISOA 1ZHMA 1XKAC 1ZPZA 3BG4B 1FLEE 3LDXH 3P8GA 1GJ9B 1C1UH 1O2TA 1A0HB 3MNCA 1AB9C 1KTSB 2ZHFH 3L3TA 1RS0A 4CRFA 5SGAE 3ZVGA 1LKBA 3CS0A 2J2UA 1YPKH 4ABFA 4FUEA 1G37A 3UY9A 1DICA 2GP9B 1BTHH 1YPGH 4WJG2 1V2NT 3NUMA 5EQQA 1S81A 2A5KA 2BD5A 3SW2B 5L30H 2CMYA 1C5TA 3ZVCA 1T8MA 2SGEE 2TRMA 1G3CA 1P2NA 1CHGA 2JETB 4DURA 1W8BH 1LPGB 1HNEE 1SQAA 5GXPA 3PM3A 1AVGH 3ZYEA 1C1OA 1S85A 3S9AA 1TOMH 1ANBA 2GCHF 2PR3A 1LVOA 1H4WA 1V2KT 2Y82A 1P3CA 1WBGB 3VB4A 2ZGHA 1G2MA 5DP9A 5EQSA 1JXPA 1VITF 4MDSA 3GCHC 1DS2E 1NESE 1HAZB 2ZO3H 4ISNA 1D3TB 1ZPCA 1TPOA 4Y8ZA 2VB0A 1EAUA 1O3DA 4FU9A 4AN7A 4FUFA 4XDEA 3PROA 2CGAA 1CE5A 2I6QA 3F9EA 4JMYA 2VU8E 1RFNA 2ZGJA 4FUBA 5AFZH 4BAQB 1FY8E 1JMOH 2J34A 1T4UH 1TRNA 1GBMA 5FX5A 2GD4B 1RTFB 3ZZAA 1IQMA 3A86A 3RXQA 4DGJA 1UVUH 1O3CA 3E0PB 1V2PT 2QN5T 3LJJA 3UIRA 1QRXA 6GCHF 1CA0B 1O32A 4CREA 1P2IA 2OQUA 1C5VA 1EATA 1H9HE 2QC2A 1SGFA 2FX6A 2TGDA 1F92A 1DWDH 5F03A 2CN0H 3GISB 2BOHB 1O3BA 2VIDA 2ZQ2A 3RXIA 1GJ7B 2PTCE 1MTWA 1Z8RA 2ZHQH 5C1YA 1V2ST 1GJ4H 1QJ7B 3HGPA 1L1JA 1Z6JH 4VGCB 4M7GA 2OC7A 4KELA 5T6FA 3KGPA 2BD9A 1FONA 2ZP0H 1O3IA 3F9FA 5LPEA 1TMTH 3TK9A 3HKIB 1YPEH 1EXFA 3ZYDA 3I29A 5T3HA 1AU8A 1SQTA 1PPGE 3FP6E 3VGCB 3RXEA 2RG3A 3HKJB 1ABIH 1NO9H 1IQGA 1BRUP 2ZGXH 1YPMH 3P70B 1GMHF 1HV7A 1O38A 2Y81A 5A8ZA 1L4DA 1GVZA 1O2ZA 5C3NA 1Z7KA 3Q76A 1LDTT 3URDA 3M3VA 4YOJA 3OY5U 1P9UA 3C27B 4XE4A 3UNSA 5JBAS 2FOAA 4Y7BA 4D9QA 1NRSH 3RLWH 2BLOA 1OWKA 2LNCA 5E8EH 1UVOA 5DG6A 1DFPA 2ZFRH 1GHBG 3SZNA 1QIXB 3SU5A 2BDHA 2BDAA 4DIIH 1XXDA 4INHA 4WH8A 1DANH 2PLXA 1TNKA 2A5IA 2CF8H 2H9EH 1CBWB 1LHFH 1MH0A 1TFXA 2ZHWH 3BV9B 1HBTH 1GBHA 3UWJH 2DUCA 1IOEA 2J92A 1EP5A 4GLYA 1O34A 1A61H 1GI8B 3BEFB 2W5EA 2XYAA 4YO9A 1OWEA 4K8YA 3HPTB 1QB6A 2O8UA 4IGDA 3H7TA 1BTXA 1BBRK 1GJBB 1GHVH 3BTME 3BTEE 1AWFH 1AUJA 1A46H 3BTHE 3PV4A 1GI2A 2C93B 3BIUH 2ZC9H 4THNH 4Y8YA 5DP6A 1XX9A 3LC3A 1V2VT 1O2YA 1GI0A 3LOXA 1ANCA 2NU4E 2WPLS 3EQ0H 4B1TA 1CT2E 2G51A 2QAAA 3CS7A 1C5YB 1C2EA 1H8IH 1O2OA 5K0HA 1O2NA 1O5BB 1O30A 2FI5E 2G4UA 3MI4A 4AFQA 1Z8GA 1YCPK 3AAUA 3E90B 4U01A 2OQ5A 1YPHC 5EW2H 4NIWA 2F9VA 2TGPZ 3NK8A 3S7KB 1D3DB 2XBVA 3BTTE 2BLVA 2XCNA 3UOPA 4OS2A 3RMOH 3E0NB 1Q2WA 2O8MA 5EOKA 3P92A 4BAKB 4Y10E 1LQDB 4AOQA 5GIBA 4X1SU 3KNXA 3SNEA 5ABWA 2GTBA 5A2MH 1C2GA 5C20A 3IITA 1EX3A 2THFB 1MAXA 2C8YB 3BSQA 1A1RA 2ALPA 1C9TA 1ZSKA 1E35B 2FM2A 4X6NA 1B5GH 2GZ7A 1V2MT 1WQSA 4BXWA 3S7HB 1HAHH 3D23A 4CR5A 3ELAH 5C2ZA 2ZTYA 3ZZ8A 2BDYA 3K65B 1T7CA 4FUCA 2C4FH 1MAYA 4GHTA 5DP3A 4R8TB 3TIUA 3RXPA 4NSVA 2AGEX 1MBMA 5GCHG 1RIWB 3A7WA 4YT7H 3GCNA 1ZZZA 4FUGA 4TY7A 3F68H 2FLBH 3VXFH 1D3PB 1BRAA 2XTTB 1EZXC 1AVXA 4MVNA 1HIAA 4X2YA 1HIAB 1D9IA 1S6HA 4ZHAA 1ZOMA 1O3FA 4BAOB 2KAIA 2KAIB 1MQ6A 3E16B 4LZ4B 1GBBA 3GY2A 3LGVA 3A7ZA 1O3JA 5IDKA 3M5MA 3JZ1B 3T27A 4K8BA 5GWZA 1BIOA 1QA7A 3EYDA 3SQEE 1PPFE 3OY6U 1CHOG 1TRYA 1OX1A 2G4TA 3RXRA 1UTKA 1J16A 3VFEA 1CT4E 1ESBA 2CXVA 1EZUC 3QK1A 3OTJE 1NM6A 4GCHG 1GBTA 1O3OA 1TNJA 3GY8A 1KXCA 1P2QA 1QBOA 2H5CA 1O2XA 3E6PH 4WMDA 2G5NA 1AFQB 1G32B 2WPHS 2ILNA 1EOJA 2M5TA 1EJNA 2QXGA 3O8CA 1PQ5A 1OSSA 3M37A 1BRBE 1HRTH 1SLWB 5FX6A 1F0SA 1O2SA 4AB8A 1ANEA 1DLEA 3LONA 1GI6A 3LIWA 4B73A 5E0GA 1SGYE 1THRH 2XC4A 1OOKB 1F0RA 1PQAA 3QLPH 1BCUH 1DDJA 1LHDH 1GL1A 2A7HA 2PSYA 3OYPA 2SGFE 4K1SA 3ODFA 1WYKA 1JOUB 1DE7H 3QWCH 2YNAA 4KTUA 1SGRE 2V0BA 1FN6A 1KXEA 2CF9H 4O97A 1T8LA 7LPRA 1INCA 1T8NA 3QGNB 1SGNE 2P8OC 1EB1H 2F9OA 3SJ9A 1Y59T 2XXLA 4Y11E 2ANYA 1DY9A 1O33A 5C5OA 4XBBA 5HM9A 2F91A 2C8WB 2WPIS 3NXPA 1UTLM 2A45B 4IC5A 1V2OT 3RXJA 4A5TS 1K28D 1UVPA 2OC0A 1GHXH 1UCYH 1THPB 1EP6A 2ZCLP 3LGIA 1CGIE 2AGGX 1F0TA 1MD8A 1VCWA 2G52A 2GCTB 1MZDA 2J4IA 1ARCA 1YLCA 1PPBH 3D62A 1IAUA 2GCHG 2HNTC 3TK5A 3PMBB 1KY9A 2GDEH 2P3FH 2UUJB 3Q3KA 1QGFA 2ZU4A 1LKAA 1Z1IA 4X1PU 1VITG 3P17H 2BDGA 3BN9A 3M35A 4D9RA 4UONA 1O3NA 3BTWE 4CH2B 2VVCA 5AHGH 2NU3E 2JH0D 1AB9B 1SPJA 4NIYA 1J8AA 5TCCA 3PMHB 4DIHH 2AMQA 2D8WA 1P2OA 1IHSH 3D49H 1MTNC 2ZDNA 3SGAE 2FOEA 3U9AH 2C3SA 1LPKB 3UNQA 1GBCA 2BXTH 2UUKB 4AYYB 2VH0A 1AE8H 1P8VC 5K7RA 1SLUB 1TNIA 1GMDF 1QBVH 5GJ4B 3OSYA 3BIVH 3W94A 4TWYA 1SMFE 5FXLA 6GCHG 1SBWA 4ABGA 1JBUH 2VWLA 4YLUA 2QF3A 4X8TH 3RU4E 5JB8S 4IMZA 1RIWC 1UK2A 1F5RA 1ZSJA 4ABBA 2B5TB 3SJKA 4JZIA 3ZVDA 1HFDA 1FAXA 1C4V2 4BANB 5ESTE 1GHYH 3SUDA 1L1NA 3EA8A 3GYMA 4NCYA 2BD4A 2FP7B 3UNRA 4OS5A 1K22H 1BHXF 1O5EH 1YC0A 2HWLB 3RXSA 1BDAA 2HPQH 3BTKE 1XUIA 5EXMA 1GMHG 3M5NA 1D6RA 3GDUA 2FMJA 4A1VA 3TITA 3FVFB 3GDSA 3KQBA 2EI7A 2WPMS 4I32A 2P16A 1GCTC 3R0FA 3LGYA 5LPFA 5CHAC 4QT8C 4Y76A 1AFQC 2ZGBH 1GVKB 4B75A 2FEQH 4MPWA 4GVUA 2ANMH 4XOJA 3FFGA 2FTLE 2ALVA 1NRPH 1NZQH 1G9IE 2OTVA 1BRCE 4ABEA 2QXJA 1FY1A 4OGXA 3PLPA 4ISHH 4GUXA 2ZDAH 2VIWA 2VIPA 1EOLA 1SQOA 4MPVA 1BBRE 1DT2A 3A83A 5E2PA 2A4GA 3FP8E 4E05H 1LTOA 1AGJA 2GX4A 4A92A 1ETTH 3VPKA 1E0FD 2P59A 3AW1A 1HAGE 4Y7AA 1MCTA 1NT1A 3ATKA 4XBDA 2A7JA 2ZDKA 3SO3A 3WY8A 1C1SA 1AY6H 1GI9B 1S82A 2FOGA 3PTBA 1HXFH 4F49A 2AS9A 3RMNH 4NFEA 4UFFH 1SB1H 1HAIH 4MNYA 1YPLH 2FI3E 5J4QA 3SU6A 2OLGA 1AZ8A 1C1NA 5ETXA 3HK6B 1GBFA 3EGKH 4X6PA 7KMEH 4BTIB 1QL9A 3RXDA 2GCTC 2VIOA 1HPGA 2O8TA 5EQRA 4Y79A 1OWJA 5AVDA 4UFEH 1MTVA 3RXGA 1UJ1A 3GY6A 4Q7YA 1BTWA 1GHZA 1O3GA 3FZDA 4PROA 1O2WA 4YT6H 4O3TA 1P06A 1C5UA 2PGQB 4Q80A 3A8AA 3MHWU 1EPTC 2ZG0H 5EXNA 3A8DA 4K60A 2Y6TA 2D26C 2OBOA 4SGBE 3LKWA 3RXAA 3TVJB 1G3EA 1C1QA 1TNLA 2AMPA 1FIZA 1WCZA 1TMUH 4RKOB 1C5XB 2PV9B 4WWYA 1HYLA 2A4QA 1OKXA 1JIRA 1KSNA 3DFJA 2RA0A 2B0FA 2H2ZA 4U30A 2ZDLA 3S9BA 2A0QB 2PHBA 2A31A 2QYIA 1ESAA 1J9CH 1KIGH 4J1YA 5FCRA 1TNGA 3RXOA 1AUTC 1MTUA 4ZHLU 1O2PA 5H4IB 3ENSB 1K1LA 2BVXH 1G2LA 3FZZA