1ZZZA

Trypsin inhibitors with rigid tripeptidyl aldehydes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highly selective mechanism-based thrombin inhibitors: structures of thrombin and trypsin inhibited with rigid peptidyl aldehydes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zzzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1zzzA02
2G5VA 3BEUA 3GY3A 1P12E 1FY1A 1V2JT 1C1PA 3F9EA 3SJ9A 4K8YA 1S6HA 4FU8A 2STBE 7LPRA 1ZGIA 5E0HA 2WUCA 1SGIB 1W10U 1BTYA 3MHWU 3TGIE 1OX1A 1JXPA 1T8LA 3HK3B 1GJ6A 2PSYA 3U98H 1P2NA 1MTNC 1H9HE 1G37A 4BTTB 1A5HA 1KSNA 3BIUH 1GI6A 5LPFA 4B75A 1Y8TA 1UMAH 4K5ZA 1C2EA 4MPXA 3ZZ7A 2TIOA 4O03A 1ZYOA 1IAUA 1FY8E 4FUGA 4F4OC 1FY4A 1OP0A 4OGXA 2GCTB 3MU0A 1TNHA 1FMGA 1VCPA 1S82A 5E8EH 1O3DA 1PPHE 2GT7A 2Q1JA 1MAYA 1ZZZA 4BOHA 1ZTKA 2BMGB 3TVJB 1O2NA 1QJ1B 1HXEH 3SQHE 1BITA 1L1NA 3VB6A 2ALVA 2ANKH 4B2AA 2UUKB 5DP7A 2VGCB 1FV9A 2A4OA 2FPZA 4X2XA 3N7OA 4FU7A 1GVZA 1GGDC 1NRSH 2BD9A 1UK2A 2ZGJA 1WQSA 3BN9A 1O34A 1LPGB 5C5NA 5FHTA 1G32B 1HAGE 1LPZB 1IQJA 5B6OA 4MPVA 1VITG 2Q6FA 1NFYA 2CHAC 2JKHA 1AE5A 2XRCA 2VWLA 1KXCA 3JZ1B 3TU7H 1HYLA 1C2GA 4ZROA 1C5QA 1IQMA 3A8BA 3H7OA 2BQ7B 5EOKA 2B5TB 2FS9A 2BZ6H 4X2YA 3VEQB 9ESTA 2XTTB 3LJOA 1DSTA 3VFEA 2Z9IA 1LHCH 1SLWB 4UE7H 1QL9A 1XUIA 2RG3A 3NKKA 5A8ZA 4IGDA 4YO9A 1ELEE 1WSSH 2PR3A 1W7XH 1D3QB 4UFFH 5GXPA 1WYKA 2GZ9A 1L4ZA 4TPYA 1KLIH 4JMYA 1VGCB 4K1TA 4B2BA 2Y82A 1ESBA 3ZZAA 1FPCH 3R0FA 2UWOA 1Y5UT 2OINA 1SBWA 3I78A 5GJ4B 3BSQA 1AO5A 1F92A 2TGPZ 3PV4A 4IMZA 4YZUA 2B0FA 1T8MA 2OC0A 1GMHF 1THPB 1ZJDA 1CA0C 2ZCKP 3GDSA 4ISLA 2XC0A 3RXMA 1BRUP 1WTHD 4ZUHA 5T3HA 1QCPA 2VIPA 1O3IA 8GCHF 4LOYH 2H9EH 1YPKH 4K8BA 3STJA 1GBFA 3EGKH 3LKWA 1YF4A 3AAVA 1K22H 1S81A 3GCOA 4CHAB 3A7WA 3ZVEA 2Y5FA 1T31A 3AAUA 3M5MA 1HJ9A 2VIVA 3QUMP 3A7ZA 1G36A 3A82A 2V35A 1TA2A 1GI8B 3RXKA 2GX4A 2GMTB 1O2RA 1PYTC 3LH3A 3O8CA 4GHTA 1O2WA 1UCYK 3QGNB 8GCHG 1S85A 1EJAA 1Z6EA 1AN1E 2A7HA 4XBDA 1N1LA 1GHBF 2FOEA 2R2MB 4DURA 1DX5M 1M9UA 2GTBA 1DDJA 5FXLA 4WH8A 3LC5A 1GBLA 3O8RA 8LPRA 1V2MT 3UUZA 1CVWH 2SNVA 2UWLA 1SGCA 1P2OA 1Z71A 2CJIA 2G55A 1EZSC 7GCHG 1AZZA 3M5LA 1GI0A 4A1VA 2QXIA 1RIWB 3SNCA 3MU1A 1TFXA 2H5DA 4MNWA 3SU0A 1MD7A 1EATA 5J4SA 1DXPA 5JBTA 3KQEA 4TWWA 2F91A 2O8UA 3R3GB 1D3PB 1NRQH 1SGFA 1P57B 1TALA 5AF9H 4GCHF 5JBCS 1TBRH 3EA9A 1JIRA 2BDIA 1QBNA 2BYAX 1ZHMA 4X2VA 5JBAS 4MPUA 5I46H 5EW2H 4ABFA 1C2IA 1LO6A 2DE8A 2HNTE 3RXGA 1DT2A 4YM9A 3MFJA 2TPIZ 3QK1A 2ZDKA 2C8YB 1C1RA 1DWDH 4JYTA 4H42U 1GJBB 4CH2B 3S0NA 1GJCB 4UD9H 2HGTH 1YLCA 1UVSH 1OYQA 1SGEE 2AH4X 4X8VH 1XX9A 1C4Y2 3MO6A 2BY6X 3BF6H 3RXAA 5HGGA 1V2RT 1SGFG 1GHZA 2BVRH 1VCQA 4CRFA 3RM2H 1P2IA 2Z7FE 1FQ3A 1O38A 3TH3H 1O2LA 3OY6U 4DT7B 4IC5A 3RXVA 1K1MA 4RKOB 1HRTH 3UNQA 4X1SU 1HAIH 1ZPCA 2Z94A 3ENSB 3M3SA 2F9BH 1QJ7B 3F9HA 2FLBH 1GMDF 2ZFRH 1GHVH 1THRH 1C5WB 1BTWA 4R8TB 2ZA5A 3SJOA 4ABEA 3GCHC 4K1SA 3A8CA 4FUJA 2WPIS 1UTNA 3MWIU 1LHDH 4DIHH 3PMBB 2ZWLH 2BD3A 4K69A 2FX6A 3UNSA 1DY9A 1GDUA 1HV7A 3S69A 1OPHB 4MNYA 3P6ZB 4YLUA 4NGAH 1Y5AT 5FPYA 1G2MA 3TK5A 2FTLE 2G4TA 1GL1A 1PPCE 1RTFB 1SLUB 1F5RA 1GHYH 2OBOA 3MU8A 4XE4A 3ZVFA 1C2HA 1ELGA 1QQ4A 1Y59T 2JH5D 1E38B 4NCYA 3PLPA 1YP9A 1XKBC 3LT3A 4JZEH 4AFZA 1HGTH 1IOEA 1QA0A 1SL3A 2BOHB 3BTGE 7ESTE 1NU9A 5T6FA 4WXVA 2XC4A 1NS3A 4IS5A 1MU8B 1Y3XA 2ZFTA 5H4IB 2W7UA 1Q2WA 2SGPE 1UO6A 1S6FA 5T6DA 4CRCA 2M5TA 1NT1A 4JZDH 4A92A 3TLOA 2B7DH 2AFQB 1YCPM 1FY3A 2ZTYA 3SU1A 3GOVB 1LQEA 1TAWA 1TA6A 4O3TA 3A85A 2BX4A 1Z1JA 2GGVB 4WH6A 1PQ5A 3ZZ9A 1EOJA 1GHBG 1MBQA 1QY6A 4FVBA 3P8OA 2RDLA 1TMTH 2XCFA 1CO7E 3M3VA 1NTPA 2FWWA 1GG6B 3QZRA 4BTIB 1F2SE 2BD8A 1GI7B 3HPTB 4XFQA 5BPEA 2ZHEH 1Z8RA 3RU4D 1AB9C 4BXWA 3UWJH 4NWLA 3GDUA 1GJ4H 2A31A 4MNVA 4Z6AH 1ESTA 1LVMA 2NU2E 3F1SB 1EOLA 3CS0A 1ZMLA 5F8XA 1TPOA 1C5VA 2BTCE 5HMAA 2ASUB 3SNAA 5L2YH 4I8HA 3T29A 3RC6A 2GCHG 5C1YA 1TX6A 2VIWA 5A0BA 3D49H 3PO1B 1UTPA 3U69H 3T26A 5E2PA 2ZGCA 3FFGA 1FLEE 1V2PT 3AASA 4X1NU 3QGJA 2ZIQH 1AD8H 2GKVE 3KGPA 1K2I1 4X8UH 3T25A 2WPKS 4FVDA 1MKXH 3O8BA 1O3PB 2UUJB 1O3NA 5C20A 1TX7A 4X6MA 3FZDA 4D9RA 5EXLA 5J4QA 3RMNH 2VVUA 1A0HB 1P0SH 3P17H 1TPPA 3KQCA 1GG6C 1P09A 4PROA 5JB8S 3M35A 2ODQA 1O3GA 3A8DA 1DLKB 5F8TA 1Z7KA 3GCNA 1L1GA 1HAXB 1O2UA 2QIQA 1O32A 1P01A 5GDSH 3RXLA 1QR3E 2ILNA 1TPSA 1D6WA 1ANBA 2VINA 1TPAE 2PW8H 3V3MA 1MH0A 3QX5H 2GP9B 3ZYEA 1P9UA 1ZOMA 4YOIA 1ZRKA 3BTDE 5JB9S 3ZZBA 3O8DA 3EDXB 1TNGA 3ODFA 1PJPA 2HLCA 2VWMA 4UEHH 4A6LA 3ZYDA 4OS5A 5TCAA 1RRKA 4JK6A 5DO4H 5A2MH 4AB9A 4ZKOU 5FBEA 4RSPA 3Q76A 4IN2A 1IQNA 2J92A 1CU1A 3BTWE 2ZQ2A 3K65B 4ZAEA 4MLFB 1RS0A 2FIRH 2F9VA 4U01A 1P05A 1HJ8A 1OWKA 1AWFH 5EQQA 4K1EA 2JH0D 2Z9GA 3T62A 5DP6A 2AGGX 5F03A 4DJZB 3A87A 4WWYA 3RM0H 3M5NA 3HKIB 3U8RH 2RA0A 1YYY1 4FUBA 1ESAA 2ZTXA 1C2LA 2QF3A 2ZQ1A 3L33A 3Q3YA 4AORA 1ANCA 3NWUA 4NSVA 6CHAB 1P06A 3K6YA 1S0QA 1OS8A 3UNRA 2BX3A 2ANYA 2BOKA 4BTUB 3LGIA 1A0JA 2BD4A 1O2IA 2C4FH 2FM2A 1MAXA 2O8MA 3OU0A 3EE0B 4AYVB 1GHXH 4DCDA 1E36B 1HAOH 1AY6H 1YPJH 3PROA 2F9UA 4NIXA 1OYTH 1TMBH 1RTLA 1FPHH 1YM0A 2NU3E 4MTBA 3TNSA 4BAOB 3SUEA 3GY4A 4J2YB 4LZ1H 2P93A 1LKAA 4BAMB 1C1QA 3RXUA 1NPMA 6GCHF 1A7SA 3OSYA 2PTNA 1W7GH 3FP8E 2AERH 1C5ZB 1BT7A 1O33A 3URCA 1JWTA 1KXBA 1AUTC 1O5CB 3M7UA 2PGQB 4NA9H 1O2ZA 2V3OH 4LZ4B 1XXFA 1O3OA 2AGEX 3L6PA 1P11E 2OD3B 2FXRA 3K2UA 5EQSA 1EJMA 5PTPA 2CF8H 1UTKA 1NESE 1V2OT 1WAYB 2W26A 1AUJA 5FAHA 2BLQA 3S9CA 2AMPA 3ATLA 3M5OA 1O2YA 5AHGH 2QCYA 4KKDA 3SNBA 3MH5A 1C5OH 1EZXC 2AMDA 1NRRH 1G3CA 3SJIA 1A0LA 3SOSA 1LVOA 2PKSB 1DFPA 3ESTA 1MCVA 1TNKA 1CGJE 5EPYA 1IQEA 2WPLS 3BTKE 3TJNA 1ZPZA 4I8JA 4NIYA 3LJJA 3RXBA 2WPJS 4K60A 1C2DA 5IDKA 1CT2E 1HJAB 5GPIB 1TGNA 2QY0B 1RD3B 1MU6B 1O3AA 3KL6A 1A5GH 3RP2A 2Q6GA 3ZV8A 1F0TA 3B8JA 3T27A 1SVPA 1UK3A 2SFAA 2ZU4A 3MNSA 1LVBA 1HAVB 4E06H 1UVTH 3LH1A 3LC3A 2BDCA 2XWBI 2CMYA 3LDXH 1EP5A 1EPTC 1HCGA 3FANA 1AE8H 1HIAA 3A80A 2D8WA 4WJG2 1VITF 2G52A 2ZFPH 4AFSA 3UREA 1O3JA 2FZZA 4WMDA 1QFKH 1VGCC 1HBTH 2ZG0H 5FPTA 4Y7AA 1BBRK 1BOQA 3QN7A 1O35A 1T7CA 3PWBA 1BQYA 3HKJB 2ZDVH 4RN6A 2OQ5A 1P3CA 1SQAA 1QB9A 1CGIE 1XM1A 5GCHG 2AIQA 1ELVA 1DLEA 3QO6A 1HAPH 1BTXA 2BDHA 1A4WH 3C1KA 4NFFA 2P59A 3BTME 3M61U 4X1RU 2BM2A 3MH4A 3LGWA 1O2VA 3B23B 1TOMH 2OCVB 2ZO3H 2TGDA 1OWEA 4A7IB 1N8OB 2GDDA 2IN2A 1C5PA 2G00A 5GWZA 9LPRA 1TRMA 1XVMA 2FI5E 1PPBH 4O97A 2ZKSA 4U32A 1V2QT 3U1JB 1YCPK 2C93B 4Z0KA 1O39A 3MNXA 2ZFQH 4HFPB 1SI5H 1BHXB 5DJ7A 3C27B 1AU8A 4VGCC 1AIXH 1EUFA 1F7ZA 1Q3XA 1TOCB 1V2KT 1BBRE 1EASA 5T6GA 1ARBA 1FIZA 1K28D 3MH6A 4X0WU 1K1NA 1DXWA 3F6UH 2GDEH 3GCTF 1GBBA 4I8GA 4AX9H 3MNBA 3RLYH 1SR5C 2C8ZB 3W95A 1FY5A 2ZFSA 5SGAE 1GI9B 1O3FA 1GVLA 1GJDB 1V2WT 4OS6A 1SGNE 2GT8A 3FP7E 4KTSA 3DA9B 2GZ7A 1GPZA 4HTCH 1PYTD 4TY7A 3PMHB 5AVDA 1FZZA 4ABGA 1DWEH 4AG2A 5TCCA 1ARCA 1IQKA 2XNIA 1DANH 3S9AA 5DG6A 3E8LA 3ZZ4A 1E34B 3SGQE 3GY5A 2TRMA 1L0ZA 1O2XA 3GYLB 1GI5A 1W12U 1AKSA 1LKBA 3PLKA 1T4VH 2FOCA 1WTGH 4AOQA 1FIWA 1TBQH 5DPAA 3ZZ3A 1H4WA 2ALPA 1PQAA 1AFEH 1MKXK 5LPRA 3SN8A 2HALA 3MU4A 3LU9B 2ULLA 2VIDA 4K2YA 5JPMH 1GBKA 3E6PH 1XXDA 5DP5A 2G8TA 1H8IH 1YPLH 1C5NH 2VNTA 4INHA 2FDAA 1CT4E 3TH2H 1HAVA 3D23A 3S7KB 1MBMA 2RA3A 3P92A 1CQQA 4CRDA 1O3LA 1V6DA 2H9TH 3SU3A 1K21H 3V0XA 1IQHA 2XBYA 4CRAA 2NU0E 2TBSA 2Z9LA 2FP7B 2PTCE 3A8AA 1UTMA 2VU8E 3P8NA 3CS7A 3UOUA 2BQ6B 1C2JA 2BY7X 1DY8A 1C1TA 1BMLA 1KLJH 1G30B 5DKMA 1TLDA 2ZNKH 2PFEA 1UTJA 2PGBB 4U2WA 1O2QA 1AGJA 2HPPH 4KTUA 1DM4B 2HWLB 2PWXA 1EAXA 1KXAA 3Q77A 3BEIB 1BCUH 2Y7ZA 3SO3A 2UUYA 2KAIA 2VVCA 2QF0A 1DSUA 1ZMJA 3EYDA 2AEIH 1H9IE 1IQLA 1SMFE 1BTZA 1QA7A 3RDZA 3ZZ5A 1GBDA 4D76A 1GHWH 1TGSZ 2J38A 2WPMS 2W3IA 1EAIA 4NFEA 4WMFA 2EI7A 1MZAA 1PPGE 1GL0E 2DUCA 3PMJA 2G5NA 4DG4A 4ABAA 4GAWA 4TY6A 2JETC 1BA8B 2BLOA 4JYUH 2J9NA 1W13U 1K1OA 2Y80A 2ANWA 1NROH 3HATH 4MG3A 2NWNA 1O2SA 3I77A 4HZHA 4RKJB 2GV7A 2ZP0H 2EA3A 1BB0B 1KXFA 3FP6E 4ZHAA 1W11U 4MVNA 4NWKA 3ODDA 2SGAA 2R3UA 3BIVH 4JZFH 1DPOA 2QA9E 4ZXYH 1OOKB 2ZDMA 1O2OA 1FAXA 2H2ZA 1TABE 5A0CA 2PUQH 1K1LA 3RXPA 3BTFE 3NXPA 1ID5H 1O3MA 4JYVH 2P8OB 5I25A 3VGCC 1BMMH 2CF9H 2JH6D 1HLTH 1ELFA 1J17T 3RUOA 2BLVA 1Q31A 2WUBA 2R2WU 2OC8A 3MNCA 2OC1A 5L6NH 1W0ZU 3MOCA 1OSSA 3I29A 1H1BA 3UQOA 3MTYA 1WUNH 1UCYE 1Z8GA 4XBCA 3ZVBA 1EQ9A 1V3XA 1HXFH 2P3UB 2HOBA 2A1DB 3P8FA 1WOFA 4ABJA 1TWXB 1ETSH 4Y8ZA 4I33A 3TJUA 1GBMA 1TIOA 2OTVA 4ABIA 3RMMH 2O8LA 1GBEA 1KTSB 5EXMA 1W0YH 1RTKA 1CE5A 1TGBA 3SUDA 2F9PA 1O3KA 1O30A 2I6SA 4DW2U 1GJ5H 4YT7H 1IQFA 3QTVH 1O37A 3RC4A 1TYNA 1F5KU 4OS2A 4H6SB 1MD8A 2ODYB 1C5TA 2GV6A 1O2GH 1YPGH 2XCNA 4I31A 2ZGHA 1J9CH 1ZTJA 3M37A 3TJOA 1X7AC 1C9TA 4UFGH 4IBLH 1VR1H 3QLPH 2P95A 1BJVA 2BXTH 1G3EA 2WINI 2O9QA 3PYHA 1W3CA 2OXSA 5L2ZH 1DS2E 2B9LA 2FS8A 4JK5A 4AFQA 1NO9H 4CBNA 2W7SA 2YNBA 2OC7A 3VB4A 1WV7H 1FJSA 2V6NA 4NG9H 3ZV9A 3PMAB 2ZGXH 4B2CA 1SFQB 5C1XA 1ZMNA 1SHHB 1MTVA 1EXFA 3DUXH 1A61H 1H8DH 3BTEE 3SHCH 1QHRB 2FOHA 2VH6A 2WV4A 3UOPA 1CHGA 2BDBA 2KAIB 2XBXA 8ESTE 5FCKA 1SOZA 1QJ6B 2F9NA 2ZPQA 2C90B 2AMQA 2BY8X 1YBWA 1ELBA 5ESBA 3LIWA 1YPHC 2HPQH 1YKTA 2BZAA 2OQUA 2PSXA 4ZMAH 1OWDA 3VB7A 1ACBE 1LHEH 5K0HA 4YOGA 2BD7A 2A5IA 2H6MA 1F0RA 1LVYA 3ITIA 1P10A 1SGRE 3GCTG 1EZUC 3H7TA 5DGJA 1JRSA 3SUFA 2ODPA 2SGFE 2J94A 2B8OH 1XUJA 3KN2A 1HDTH 4I7YH 3RXSA 1B5GH 1TQ0B 1TNIA 1C5YB 4NA7A 1K9OE 4ZKSU 3UFAA 1MTWA 1CA8B 3OYPA 8KME2 2G51A 4D7FA 3GISB 1CBWB 2ZGBH 1NY22 1FDPA 1ANEA 1UVPA 2VVVA 2ZECA 3BG4C 3SGAE 3SU2A 5EW1H 1MCTA 1C5LH 1GBIA 4UONA 1UCYH 1P2QA 3MI4A 4UFDH 1KXDA 1QB6A 2J2UA 2VJ1A 1VJ9U 2A4GA 2HVXA 5A09A 3SHAH 2G4UA 2QAAA 1J8AA 5EPNA 1E37B 1UJ1A 5C5OA 1ELTA 1FI8A 5DP8A 1EP6A 4UFEH 2XW9A 1O5BB 5F6MA 2XWAA 3BV9B 4BAHB 1YGCH 1HPGA 1HAYB 2THFB 3ZVAA 1TB6H 1AHTH 1ZSJA 1L1JA 1ZGVA 2AGIX 4IW4E 1INCA 1ELCA 3LPRA 3UR6A 1XUFA 1Y3WA 3RU4E 1J16A 1DITH 1O5DH 2GD4B 1AB9B 1F0SA 4JZ1A 4I8KA 1GCTB 3SV8A 2P16A 3A84A 2OP9A 1JRTA 4IC6A 3TNTA 1OKXA 4WXIA 2GMTC 2FYRA 1A5IA 1K1JA 1IQGA 1P2KA 3AVZA 2FI3E 3LGYA 4B74A 1QGFA 2ZCHP 3A7YA 3U1IB 4HI3A 2Z3CA 4H6TA 1L2EA 1ABJH 3ZZ6A 1MTSA 4XBBA 5G4BA 1FN8A 1OXGA 2NU1E 2A32A 1BBRH 5HYOA 2W5EA 3SJ8A 4B73A 1D9IA 3A7XA 1PQ8A 1GI3A 5ESTE 1LHFH 5F8ZA 2A45B 4Q7YA 2XXLA 1C1WH 1N6YA 5TJXA 4CREA 4WVPE 1OWHA 4D8NA 2Y5HA 4GCHG 1RIWC 3UR9A 2BVSH 1V2ST 1V2TT 1ZHPA 3SBKA 1TQ7B 2J95A 5K7RA 2WPHS 1YPEH 1AFQB 1ABIH 4OS1A 2HNTC 3D62A 1G3DA 3SW2B 1C4V2 1Y5BT 2BLWA 2GCTC 2TGTA 1Z1IA 3SV9A 1SC8U 3KEEA 2FOFA 1C4U2 3SU6A 1MTUA 2OBQA 2O8TA 3KHVA 3K9XB 1E35B 2ZC9H 2WYGA 4Q80A 1J15A 1QRZA 1EJNA 1FN6A 3SNEA 2P3TB 1SSXA 3DHKH 4AZ2B 1GI2A 3OY5U 2WV5A 4O3UA 1P2MA 1O0DH 2FEQH 5HM9A 1DUEA 3QDZB 1ELDE 1O3EA 4LXBH 2BD2A 1ETTH 3A83A 2R3YA 4GHQA 3JZ2B 2Y7XA 1KLTA 1TONA 1DE7H 1UHBA 2ZPSA 3IWMA 1UHBB 1ZPBA 3EQ0H 1H9LB 2A5KA 1O5AB 2OLGA 7KMEH 1TRNA 2EI8A 4A1XA 3BEFB 4FUDA 4Y8YA 3GICB 2GVFA 3A7VA 2F9OA 3AW0A 1HAZB 3GY2A 4Y79A 2QN5T 5CE1A 1HIAB 1ZHRA 4OGYA 3D65E 4NIVA 2XYAA 1S83A 3P95A 3CP7A 1N6XA 4CRBA 2FO9A 4K3JA 1T8OA 6CHAC 2VH0A 1YLDA 2XBVA 4NIWA 3RXTA 1GI1A 1EAUA 1BRBE 1BZXE 3EA8A 1BTHH 1GBAA 4E7NA 6GCHG 2AYWA 1SOTA 2C8XB 1ETRH 2EEKA 2FI4E 3QWCH 3ATKA 1C5RA 2Y6TA 2UWPA 1UTOA 3NUMA 1GBCA 3URDA 3SU5A 1QTFA 4ZH8A 4B1TA 1FONA 5GIBA 1QBOA 4ABHA 1NU7B 6LPRA 1Z6JH 5EODA 2Z9KA 5GCHF 2FTMA 4TWYA 1TX8A 1A1RA 2D2DA 1XUKA 1SQOA 4Q7XA 1FUJA 1SLVB 1SB1H 1BTUA 1SLXB 1ORFA 4ISHH 3GDVA 3IITA 1ZRBA 1C1SA 1QURH 1ANDA 2VGCC 4NZQA 2EI6A 2SGEE 1DOJA 3F68H 3RXFA 4Y7BA 4HGCA 4R0IA 2A0QB 1LMWB 2R0LA 4LK4A 2ZDNA 2R0KA 3T28A 3ZVGA 2C8WB 4XOJA 3SV6A 4INKA 4DOQA 1AKSB 2CV3A 1WQVH 3T2NA 2CHAB 1QL8A 1D3DB 3EA7A 1ZSKA 3ATMA 2AS9A 5JBBS 3ELAH 4CBOA 1BIOA 2HNTF 1P03A 3RLWH 1D6RA 1O2KA 2WYJA 4X1PU 1P8VC 2IJOB 5FX6A 2BDYA 2Z3EA 3NCLA 1BRAA 2ZDAH 5C67A 2GZ8A 1PPZA 1JOUB 2A7CA 2ZEBA 2BD5A 5JYIA 4MQAA 1XMNB 2VIQA 3GY6A 1BTPA 1DWBH 3KNXA 1GMCG 3B9FH 3RXHA 2H1UA 2JETB 2BHGA 1KIGH 4AB8A 3M36A 2CN0H 4CHAC 3TPIZ 4YLQH 2A4QA 3F9GA 1GDNA 4X2WA 3GY7A 1C2KA 4E7RG 5HXFA 1EB1H 2FESH 2FODA 3STIA 5LH8A 5L30H 1NFXA 5AFZH 3VXEH 2VWOA 1C5UA 1MKWH 4X6PA 2ZHFH 3P70B 3V12A 1EAWA 1MTNB 1G2LA 3OX7U 3OTJE 4DGJA 4AGKA 2CGAA 2J34A 1ZLRA 2YNAA 2A2QH 3PO1C 1GJ7B 4INLA 1TNJA 1D3TB 1O5FH 4F49A 4I32A 4IMQA 2H5CA 1PPFE 4Y10E 1T32A 1W14U 1GVKB 3RMOH 1P3EA 1AMHA 4YT6H 4BAQB 1THSH 4Q7ZA 1EB2A 1XUGA 3PTNA 4J1YA 1C1VH 4Y11E 2PV9B 3A88A 5DK1A 3SJKA 3RC5A 5CHAB 7GCHF 4E05H 4MDSA 4CRGA 1YPHE 4Y8XA 4ISOA 1HFDA 1GJAB 3S9BA 3RMLH 1WCZA 4TPIZ 3UWIA 2SNWA 3MU5A 1C9PA 3E3TA 3V7TA 3ATIA 4A5TS 1EPTA 4GVUA 1C1MA 1QRXA 1OWIA 2BB4A 1K1PA 5ABWA 3MO9A 1TNLA 3M3TA 1C1OA 5EG4A 3CENA 3RXIA 1N8OC 4SGBE 2Y5GA 1CHOG 2BXUH 1GBJA 2OUAA 5E2OA 1IQIA 4FU9A 1GJ9B 3SUGA 2HRVA 4X8TH 1P02A 4OS7A 4DVAU 1AWHB 1B0FA 1BJUA 2FOBA 3BG8A 5BRRE 1MMJN 1W2KH 3RU4T 2ZU1A 3HK6B 4ISIH 3A7TA 1NRNH 4X6NA 5FPSA 4KELA 1YPMH 2Z9JA 1MUEB 1VCWA 1O2PA 3K6ZA 4ISNA 1TGCA 5DP9A 3V13A 1MZDA 1K1IA 2ANMH 1O3HA 2DE9A 3SI4H 2QYIA 1F5LA 2W3KA 1OP8A 1A3BH 1EZQA 2FLRH 4H4FA 2BDGA 2QGRA 4YOJA 1LCYA 3LOXA 1KYNA 2A2XH 3Q3XA 3SORA 4Y0YE 1TMUH 1A3EH 3VB5A 3SGBE 2D26C 1YC0A 4AG1A 3KIDU 3MO3A 5E0GA 1XKAC 3SZNA 4IN1A 5LPEA 3GY8A 2SGDE 4ASHA 2R9PA 2GCHF 3TITA 1FAKH 2ZPRA 1SQTA 1AI8H 3ZZDA 3KQBA 3VPKA 1LQDB 1UVOA 3M7QA 2D1JA 5FX5A 3H5CB 1O3CA 1BDAA 1CHOF 1RGQA 2ZTZA 2I6QA 3RXCA 1NZQH 3W94A 2V0BA 1NN6A 3GYMA 1ZJKA 2ZU2A 1DUAA 3IG6B 4DY7B 1IHTH 2SGQE 3TIUA 1S0RA 3PTBA 5FBIA 3L3TA 1D4PB 2A4RA 5ETXA 2C3SA 4D9QA 1CA0B 1DVAH 3T5FH 2TGAA 1ZR0A 1NFWA 1S84A 4YESB 3AW1A 3DT0H 1GHAF 1NC6A 1AVWA 1HAHH 2FX4A 2Z6BD 3LGVA 2P3FH 3HGPA 4SGAE 1HUTH 3P8GA 2ZHDA 1P9SA 2NU4E 1EPTB 4U30A 4BANB 3TGKE 3A89A 4QT8C 3E0PB 2Y81A 1V2UT 4ZKNU 1MQ5A 1SPJA 3RXDA 4Y6DA 3TJVA 3BTTE 2O8WA 1KXEA 4FUCA 4CH8B 1Z8JB 3NPSA 1GCTC 5FCRA 3TK6A 2PHBA 3RXRA 1DWCH 2VB0A 4M7GA 3DFJA 1GMHG 1ZSLA 4Y76A 1RJXB 4GPGA 1KDQA 1G3BA 4NSYA 2ZZUH 1TGTA 3VGCB 1RXPA 1V2VT 2ESTE 5CMXH 3HGNA 3E16B 2BQWB 2FMJA 3A81A 1E0FD 1DICA 2ZF0H 1B0EA 1QRWA 3M7TA 5EXNA 2BY5X 1SGTA 3SV2H 1C5SA 1GMCF 1C1NA 3PWCA 4FXGH 1O2MA 3MH7A 4OS4A 4THNH 1TE0A 1JBUH 3BTQE 1V2NT 3ATWA 1QNJA 5A8XA 4VGCB 1NFUA 4MNXA 4A1TA 4XDEA 1MQ6A 1C2FA 5CHAC 2QXGA 1S5SA 4ZHMU 1IHSH 1HNEE 4ABDA 3BTHE 3RXQA 5JDUB 2PKAA 3SQEE 3UY9A 1O2JA 1BMNH 1QL7A 3UTUH 1C1UH 2QV1A 2XC5A 2G81E 2UUFB 4XSKU 1EX3A 1HB0B 5E0JA 1BUIA 1PQ7A 1ZTLA 1SHYA 1A46H 3TGJE 1WBGB 3FVFB 1TRYA 2H9HA 1GCDA 1WU1A 1U6QA 4NA8A 2AIPA 4X1QU 1QIXB 1O2HA 3SV7A 2PKAB 1AQ7A 4FUFA 4AGJA 2QXHA 1SGDE 2ZU5A 4JZIA 4ZXXH 1NM6A 4TYDA 3GCHB 1SGQE 4DIIH 1SGYE 1CGHA 3DD2H 3FAOA 1GBHA 5DP3A 3EAJA 2RCEA 5DP4A 1EKBB 1UTQA 4KP0A 1T8NA 1Y3VA 4I8LA 1P04A 5EGMA 4YTAA 4CR5A 2IPHA 3E0NB 4ABBA 1SGPE 5C2ZA 3E90B 1PFXC 1Z8IB 1O5GH 4UDWH 3TK9A 3SU4A 1UVUH 1T4UH 1GHAG 1Y3UA 2J4IA 3PB1E 2ZHWH 4FUEA 1CBWC 3LGUA 1C2MA 1RFNA 2IOTA 3BG4B 1VITH 3UIRA 2ZCLP 3Q00A 2LNCA 2PUXB 3U8OH 1CSOE 2YOLA 1YCPH 3PM3A 1OWJA 6ESTA 2FOGA 1GGDB 2PKSC 1JIMA 4BNRA 1NRPH 4WF8A 4BXSA 4B76A 2ZI2H 5IYTA 5EU8A 5EQRA 4GLYA 4B71A 4KTCA 2BDAA 3WY8A 2V3HH 3ZZCA 1HJAC 1KTTB 4AN7A 1GJ8B 1GWAA 4AFUA 4WMEA 3TH4H 3QTOH 1SG8B 4GSOA 4ESTE 1KDQB 1J14A 1JMOH 1F0UA 1UK4A 1GBTA 3U8TH 4FUHA 2A5AA 2A7JA 2K1QA 2BVXH 4O9VA 5LGOA 4X6OA 3VB3A 2EC9H 5A0AE 1MKWK 3S7HB 2STAE 4Y0ZE 2Q6DA 1O2TA 4BAKB 2VIOA 4X8SH 3DFLA 3ZZ8A 1SFIA 2ZHQH 2ZU3A 3MYWA 1BRCE 1KY9A 2FOMB 3U9AH 3ZVCA 2QXJA 1LHGH 2P94A 3UQVA 5AFYH 1BMAA 1QB1A 5C1UA 1P2JA 2BY9X 1FNIA 1V2LT 2XBWA 3ZVDA 3UPEA 3MMGA 4ZKRU 1AZ8A 1GI4A 3LGTA 3LONA 3PLBA 1OP2A 2QC2A 1C5MD 4KGAA 1QQUA 1LDTT 1UTLM 3KQDA 4CR9A 4FUIA 3KF2A 1GMDG 1O36A 1AFQC 4NZLA 4Q2KA 2FYQA 4GUXA 5C3NA 1FXYA 1LPKB 2ZFFH 3FZZA 4Y71A 1ELAA 1QBVH 3RXOA 5HM2A 1A2CH 1PPEE 3RXJA 3A86A 2VWNA 2CXVA 1BHXF 1W8BH 3VXFH 1C5XB 2F83A 3G01A 3QZQA 2LPRA 1AVXA 1O31A 1B7XB 2P8OC 4MPWA 1O3BA 5A8YA 3E1XB 1LTOA 1CT0E 3F9FA 3SI3H 2F3CE 4WY3A 4JCNA 1XVOA 2ZDLA 3Q3KA 3KCGH 1O5EH 4ZHLU 3NZIA 3SNDA 1AVGH 1XUHA 1TBZH 1Y3YA 1L4DA 3E91A 4D7GA 2FOAA 4AYYB 3RXEA 1GDQA 1VZQH 3NK8A 2PLXA 1VJAU 2Z3DA 1G9IE
chains in the Genus database with same CATH superfamily
3KYFA 2RFKC 2G5VA 3BEUA 3GY3A 1P12E 1FY1A 1V2JT 1C1PA 3F9EA 3SJ9A 4K8YA 1S6HA 4FU8A 2STBE 7LPRA 1ZGIA 5E0HA 2WUCA 1SGIB 1W10U 1BTYA 3MHWU 3TGIE 1OX1A 1JXPA 1T8LA 3HK3B 1GJ6A 1NBMD 2PSYA 3U98H 1P2NA 1MTNC 1H9HE 1G37A 4BTTB 1A5HA 1KSNA 3BIUH 1GI6A 5LPFA 4AC9A 1H8ED 4B75A 1Y8TA 1UMAH 4K5ZA 1C2EA 4MPXA 3ZZ7A 2TIOA 4O03A 1ZYOA 1IAUA 1FY8E 4RI0A 4FUGA 4F4OC 1FY4A 1OP0A 4OGXA 2GCTB 3MU0A 1TNHA 1FMGA 1VCPA 1S82A 5E8EH 1O3DA 1PPHE 2GT7A 1OHHD 2Q1JA 1MAYA 1ZZZA 4BOHA 1ZTKA 1QZ8A 2BMGB 3TVJB 2IJD1 1O2NA 1QJ1B 1HXEH 3SQHE 1BITA 1L1NA 2K0QA 3VB6A 2ALVA 2ANKH 3UAIC 4B2AA 2UUKB 5DP7A 2VGCB 1FV9A 2A4OA 2FPZA 4X2XA 3N7OA 4FU7A 1GVZA 1GGDC 1NRSH 2BD9A 1UK2A 2ZGJA 1WQSA 3BN9A 1O34A 1LPGB 5C5NA 5FHTA 1G32B 1HAGE 1LPZB 1IQJA 5B6OA 4MPVA 4B6FA 1VITG 2Q6FA 1NFYA 2CHAC 2JKHA 1AE5A 2XRCA 2VWLA 1KXCA 3JZ1B 3TU7H 1HYLA 1C2GA 4ZROA 1C5QA 1E1QD 1IQMA 3A8BA 3H7OA 2BQ7B 5EOKA 2B5TB 2FS9A 2BZ6H 4X2YA 3VEQB 9ESTA 2XTTB 3LJOA 1DSTA 3VFEA 2Z9IA 1LHCH 1SLWB 4UE7H 1QL9A 1XUIA 2RG3A 3NKKA 5A8ZA 4IGDA 4YO9A 1ELEE 1WSSH 3FN8A 2PR3A 1W7XH 1D3QB 4UFFH 5GXPA 1WYKA 2GZ9A 1L4ZA 1COWD 4TPYA 1KLIH 4JMYA 1VGCB 4K1TA 4B2BA 2Y82A 1ESBA 3ZZAA 1FPCH 3R0FA 2UWOA 1Y5UT 2OINA 1SBWA 3I78A 4DT4A 5GJ4B 3BSQA 3PRDA 1AO5A 1F92A 2TGPZ 3PV4A 4IMZA 4YZUA 2B0FA 1T8MA 2OC0A 1GMHF 1THPB 1ZJDA 1CA0C 2ZCKP 3GDSA 3F0OA 4ISLA 2XC0A 3RXMA 1BRUP 1WTHD 4ZUHA 5T3HA 1QCPA 2VIPA 1O3IA 8GCHF 4LOYH 2H9EH 1YPKH 4K8BA 3STJA 1GBFA 3EGKH 1W0JD 3LKWA 1YF4A 3AAVA 1K22H 1S81A 3GCOA 4CHAB 3A7WA 3ZVEA 2Y5FA 1T31A 3AAUA 3M5MA 1YLNA 1HJ9A 2VIVA 3QUMP 3A7ZA 1G36A 3A82A 2V35A 1TA2A 4ZCNA 1GI8B 3RXKA 2GX4A 2GMTB 1O2RA 1PYTC 3LH3A 3O8CA 4GHTA 1O2WA 1UCYK 3PV2A 3QGNB 8GCHG 4HG6A 1S85A 1EJAA 1Z6EA 1AN1E 2A7HA 4XBDA 1N1LA 1GHBF 2FOEA 2R2MB 4DURA 4TT3D 1DX5M 1M9UA 2GTBA 1DDJA 2JDID 5FXLA 4WH8A 3LC5A 1GBLA 3O8RA 8LPRA 1V2MT 3UUZA 1CVWH 2SNVA 2UWLA 1SGCA 1P2OA 1Z71A 2CJIA 2G55A 1EZSC 7GCHG 1AZZA 3M5LA 1GI0A 4A1VA 2QXIA 1RIWB 3SNCA 3MU1A 1TFXA 2H5DA 4MNWA 3SU0A 1MD7A 1EATA 5J4SA 1DXPA 5JBTA 3KQEA 4TWWA 2F91A 2O8UA 3R3GB 1D3PB 1NRQH 1SGFA 1P57B 1TALA 5AF9H 4GCHF 5JBCS 1TBRH 3EA9A 1JIRA 3N99A 3OEHD 2BDIA 1QBNA 2BYAX 1ZHMA 4X2VA 5JBAS 2PP6A 4MPUA 5I46H 5EW2H 4ABFA 1C2IA 1LO6A 2DE8A 2HNTE 3RXGA 1DT2A 4YM9A 3MFJA 2TPIZ 3QK1A 2ZDKA 2C8YB 2M2AA 1C1RA 1DWDH 4JYTA 4H42U 1GJBB 4CH2B 3S0NA 1GJCB 4UD9H 2HGTH 1YLCA 1UVSH 1OYQA 1SGEE 2AH4X 2L6OA 4X8VH 1XX9A 3ZIAD 1C4Y2 3MO6A 2BY6X 3BF6H 2KX4A 3RXAA 5HGGA 1V2RT 1SGFG 1GHZA 2BVRH 1VCQA 4CRFA 3RM2H 1P2IA 2Z7FE 1FQ3A 1O38A 3TH3H 4FETA 1O2LA 3OY6U 4DT7B 4IC5A 3RXVA 1K1MA 4RKOB 1HRTH 3UNQA 4X1SU 1HAIH 1H8HD 1ZPCA 2Z94A 3ENSB 4YXWD 3M3SA 2F9BH 1QJ7B 3F9HA 2FLBH 1GMDF 2ZFRH 1GHVH 1THRH 1C5WB 1BTWA 4R8TB 2ZA5A 3SJOA 1SQRA 4ABEA 3GCHC 4K1SA 3A8CA 4FUJA 2WPIS 1UTNA 3MWIU 1LHDH 4DIHH 3PMBB 2ZWLH 2BD3A 4K69A 2FX6A 3UNSA 1DY9A 1GDUA 1HV7A 3S69A 1OPHB 4MNYA 3P6ZB 4YLUA 2J98B 4NGAH 2KCPA 1Y5AT 5FPYA 1G2MA 3TK5A 2FTLE 2G4TA 1GL1A 1PPCE 1RTFB 1SLUB 5C17A 1F5RA 1GHYH 2OBOA 3MU8A 4XE4A 3ZVFA 1C2HA 1ELGA 1QQ4A 1Y59T 2JH5D 1E38B 4NCYA 3PLPA 1YP9A 1XKBC 3LT3A 3SZEA 4JZEH 4AFZA 1HGTH 4F55A 1IOEA 1FX0B 1QA0A 1SL3A 2BOHB 3BTGE 7ESTE 1NU9A 3CNRA 5T6FA 4WXVA 2XC4A 1NS3A 4IS5A 1MU8B 1Y3XA 2ZFTA 5H4IB 2W7UA 1Q2WA 2SGPE 1UO6A 1S6FA 5T6DA 4CRCA 2M5TA 1NT1A 4JZDH 4A92A 3TLOA 2B7DH 2AFQB 1YCPM 1FY3A 2ZTYA 3SU1A 3GOVB 1LQEA 1TAWA 1TA6A 4O3TA 3A85A 2BX4A 1Z1JA 2GGVB 4WH6A 1PQ5A 3ZZ9A 1EOJA 4Q4LA 1GHBG 1MBQA 1QY6A 4FVBA 3P8OA 2RDLA 1TMTH 2XCFA 1CO7E 3M3VA 1NTPA 2FWWA 1GG6B 3QZRA 4BTIB 1F2SE 2BD8A 1GI7B 3HPTB 4XFQA 5BPEA 2ZHEH 3KQ5A 1Z8RA 3RU4D 2W6ID 1AB9C 4RT0A 4BXWA 3UWJH 4NWLA 3GDUA 1GJ4H 2A31A 4MNVA 4Z6AH 1ESTA 1LVMA 2NU2E 3F1SB 1EOLA 3CS0A 1ZMLA 5F8XA 1TPOA 1C5VA 2BTCE 5HMAA 2ASUB 3SNAA 5L2YH 4I8HA 3T29A 3RC6A 2GCHG 5C1YA 1TX6A 2VIWA 5A0BA 3D49H 3PO1B 1UTPA 3U69H 3T26A 5E2PA 2ZGCA 3FFGA 1FLEE 1V2PT 3AASA 4X1NU 3QGJA 2ZIQH 1AD8H 2GKVE 3KGPA 1K2I1 4X8UH 3T25A 2WPKS 4FVDA 1MKXH 3O8BA 1O3PB 2UUJB 1O3NA 5C20A 1TX7A 4X6MA 2KZ4A 3FZDA 4D9RA 5EXLA 5J4QA 3RMNH 2VVUA 1A0HB 1P0SH 3P17H 1TPPA 3KQCA 1GG6C 1P09A 4PROA 5JB8S 1KMHB 3M35A 2ODQA 1O3GA 3A8DA 1DLKB 5F8TA 1Z7KA 3GCNA 1L1GA 1HAXB 1O2UA 2QIQA 1O32A 1P01A 5GDSH 3RXLA 1QR3E 2ILNA 1TPSA 1D6WA 1ANBA 2VINA 1TPAE 2PW8H 3V3MA 1MH0A 3QX5H 2GP9B 3ZYEA 1P9UA 1ZOMA 4YOIA 1ZRKA 3BTDE 5JB9S 3ZZBA 3O8DA 3EDXB 4FOUC 1TNGA 3ODFA 1PJPA 2HLCA 2VWMA 4UEHH 4A6LA 3ZYDA 3FOAA 4OS5A 5TCAA 1RRKA 4JK6A 5DO4H 5A2MH 4AB9A 4ZKOU 5FBEA 4RSPA 3Q76A 4IN2A 1IQNA 2J92A 1CU1A 3BTWE 2ZQ2A 3K65B 4ZAEA 4MLFB 1RS0A 2FIRH 2XNDD 2F9VA 4U01A 1P05A 1HJ8A 2QF5A 1OWKA 1AWFH 5EQQA 4K1EA 2JH0D 2Z9GA 3T62A 5DP6A 2AGGX 5F03A 4DJZB 3A87A 2WSSD 4WWYA 3RM0H 3M5NA 3HKIB 3U8RH 2RA0A 1YYY1 4FUBA 1ESAA 4P02A 2ZTXA 1C2LA 2QF3A 2ZQ1A 3L33A 3Q3YA 4AORA 1ANCA 3NWUA 4NSVA 6CHAB 1P06A 3K6YA 1S0QA 1OS8A 3UNRA 2BX3A 2ANYA 2BOKA 4BTUB 3LGIA 1A0JA 2BD4A 1O2IA 2C4FH 2FM2A 1MAXA 2O8MA 3OU0A 3EE0B 4AYVB 1GHXH 4DCDA 1E36B 1HAOH 1AY6H 1YPJH 3PROA 2F9UA 4NIXA 1OYTH 1TMBH 1RTLA 1FPHH 1YM0A 2NU3E 4MTBA 3TNSA 4BAOB 3SUEA 3GY4A 4J2YB 4LZ1H 2P93A 1LKAA 4BAMB 1C1QA 3RXUA 1NPMA 6GCHF 1A7SA 3OSYA 3H09A 2PTNA 1W7GH 3FP8E 2AERH 1C5ZB 1BT7A 1O33A 3URCA 3WWBA 1JWTA 1KXBA 1AUTC 1O5CB 3M7UA 2PGQB 4NA9H 1O2ZA 2V3OH 4LZ4B 1XXFA 1O3OA 2AGEX 3L6PA 3U28C 1P11E 2WHXA 3NRLA 2OD3B 2FXRA 3K2UA 5EQSA 1EJMA 5PTPA 2CF8H 1UTKA 1NESE 1V2OT 1WAYB 2W26A 1AUJA 5FAHA 2BLQA 3S9CA 2AMPA 3ATLA 3M5OA 1O2YA 5AHGH 2QCYA 1EFRD 4KKDA 3MH5A 3SNBA 1C5OH 1EZXC 2AMDA 1NRRH 1G3CA 3SJIA 1A0LA 3SOSA 1LVOA 2PKSB 1DFPA 3ESTA 1MCVA 1TNKA 1CGJE 5EPYA 1IQEA 2WPLS 3BTKE 3OEED 3TJNA 1ZPZA 4I8JA 1BMFD 4NIYA 3LJJA 3RXBA 2WPJS 4K60A 1C2DA 5IDKA 1CT2E 1HJAB 5GPIB 1TGNA 2QY0B 1RD3B 1MU6B 1O3AA 3KL6A 1A5GH 4OM9A 3RP2A 2Q6GA 3ZV8A 1F0TA 3B8JA 3T27A 1SVPA 1UK3A 2SFAA 2ZU4A 3MNSA 1LVBA 1HAVB 4E06H 1UVTH 3LH1A 3LC3A 2BDCA 2XWBI 2CMYA 3LDXH 1EP5A 1EPTC 1HCGA 3FANA 1AE8H 1HIAA 3A80A 2D8WA 4WJG2 1VITF 2G52A 2ZFPH 4AFSA 3UREA 1O3JA 2FZZA 4WMDA 1QFKH 1VGCC 1HBTH 2ZG0H 5KECA 5FPTA 4Y7AA 1BBRK 4P00A 1BOQA 3QN7A 1O35A 1T7CA 3PWBA 1BQYA 3HKJB 2ZDVH 4RN6A 5C0TA 2OQ5A 1P3CA 1SQAA 1QB9A 1CGIE 1XM1A 5GCHG 2AIQA 1ELVA 1DLEA 3QO6A 1HAPH 1BTXA 2BDHA 1A4WH 3C1KA 4NFFA 2P59A 3BTME 3M61U 5B6LA 4X1RU 2BM2A 3MH4A 3LGWA 1O2VA 3B23B 1TOMH 2OCVB 2ZO3H 2TGDA 1OWEA 4A7IB 3W1EA 1N8OB 2GDDA 2IN2A 1C5PA 2G00A 3OE7D 5GWZA 9LPRA 1TRMA 1XVMA 2FI5E 1PPBH 4O97A 2ZKSA 4U32A 1V2QT 3U1JB 1YCPK 2C93B 4Z0KA 1O39A 3MNXA 2ZFQH 4HFPB 1SI5H 1BHXB 5DJ7A 3C27B 1AU8A 4VGCC 1AIXH 1EUFA 1F7ZA 2QE7D 1Q3XA 1TOCB 2KCAA 1V2KT 1BBRE 1EASA 2CK3D 5T6GA 1ARBA 1FIZA 1K28D 3MH6A 4X0WU 1K1NA 1DXWA 3F6UH 2GDEH 3GCTF 1GBBA 4I8GA 4AX9H 3MNBA 3RLYH 1SR5C 2C8ZB 3W95A 1FY5A 2ZFSA 5SGAE 1GI9B 1O3FA 1GVLA 1GJDB 1V2WT 4OS6A 1SGNE 4TSFD 2GT8A 3FP7E 4KTSA 3DA9B 2GZ7A 1GPZA 4HTCH 5KEDA 2YMSB 3AK5A 1PYTD 4TY7A 3PMHB 5AVDA 1FZZA 4ABGA 1DWEH 4AG2A 5TCCA 1ARCA 1IQKA 2XNIA 1DANH 3S9AA 5DG6A 3E8LA 3ZZ4A 1E34B 3SGQE 3GY5A 2TRMA 1L0ZA 1O2XA 3GYLB 1GI5A 1W12U 1AKSA 1LKBA 3PLKA 1T4VH 2FOCA 1WTGH 4AOQA 1FIWA 1TBQH 5DPAA 3ZZ3A 1H4WA 2ALPA 1K0HA 1PQAA 1AFEH 1MKXK 3PRBA 3SN8A 5LPRA 2HALA 3MU4A 3LU9B 2ULLA 2VIDA 4K2YA 2J97A 5JPMH 1GBKA 3OAAD 3E6PH 1XXDA 5DP5A 2G8TA 1H8IH 1YPLH 1C5NH 2VNTA 4INHA 2FDAA 1CT4E 3TH2H 1HAVA 3D23A 3S7KB 1MBMA 2RA3A 3P92A 1CQQA 4CRDA 1O3LA 1V6DA 2H9TH 3SU3A 1K21H 3V0XA 1IQHA 2XBYA 4CRAA 2NU0E 2TBSA 2LELA 2Z9LA 2FP7B 2PTCE 3A8AA 1UTMA 2VU8E 3P8NA 3CS7A 3UOUA 2BQ6B 1C2JA 2BY7X 1DY8A 1C1TA 1BMLA 1KLJH 1G30B 5DKMA 1TLDA 2ZNKH 2PFEA 1UTJA 2PGBB 4U2WA 1O2QA 1AGJA 2HPPH 4KTUA 1DM4B 2HWLB 2PWXA 1EAXA 1KXAA 3Q77A 3BEIB 1BCUH 2Y7ZA 3SO3A 2UUYA 2KAIA 2VVCA 2QF0A 4XD7D 1DSUA 1ZMJA 3EYDA 2AEIH 1H9IE 1IQLA 1SMFE 1BTZA 1QA7A 3RDZA 3ZZ5A 1GBDA 4D76A 1GHWH 1TGSZ 2J38A 2WPMS 2W3IA 1EAIA 4M9FA 4NFEA 4WMFA 2EI7A 1MZAA 1PPGE 1GL0E 2DUCA 3PMJA 2G5NA 4DG4A 4ABAA 4GAWA 4TY6A 2JETC 1BA8B 2BLOA 4JYUH 2J9NA 1W13U 1K1OA 2RDEA 2Y80A 2ANWA 1NROH 3HATH 2EQNA 4MG3A 2NWNA 1O2SA 3I77A 4HZHA 4RKJB 2GV7A 2J98A 2ZP0H 2EA3A 1BB0B 1KXFA 3FP6E 4ZHAA 1W11U 5EIYA 4MVNA 4NWKA 3ODDA 2SGAA 2R3UA 3BIVH 4JZFH 1DPOA 2QA9E 4RT1A 4ZXYH 1OOKB 2ZDMA 1O2OA 1FAXA 2H2ZA 1WXRA 1TABE 5A0CA 2PUQH 1K1LA 3RXPA 2W6JD 3BTFE 3NXPA 1ID5H 1O3MA 4JYVH 2HLDD 2P8OB 5I25A 2V7QD 3VGCC 1BMMH 2CF9H 5F53A 2JH6D 1HLTH 1ELFA 1J17T 3RUOA 2BLVA 1Q31A 2WUBA 2R2WU 2OC8A 3MNCA 2OC1A 5L6NH 1W0ZU 3MOCA 1OSSA 3I29A 1H1BA 3UQOA 3MTYA 1WUNH 1UCYE 1Z8GA 4XBCA 3ZVBA 1EQ9A 1V3XA 1HXFH 2P3UB 2HOBA 2A1DB 3P8FA 1WOFA 4ABJA 1TWXB 4ASUD 1ETSH 4Y8ZA 4I33A 3TJUA 1GBMA 1TIOA 2OTVA 4ABIA 3RMMH 2O8LA 1GBEA 1KTSB 5EXMA 1W0YH 1RTKA 1CE5A 1TGBA 3SUDA 2F9PA 1O3KA 1O30A 2I6SA 4DW2U 1GJ5H 4YT7H 1IQFA 3EE7A 3QTVH 1O37A 3RC4A 1TYNA 1F5KU 4OS2A 4H6SB 1MD8A 2ODYB 1C5TA 2GV6A 1O2GH 1YPGH 2XCNA 4I31A 2ZGHA 1J9CH 1ZTJA 3M37A 3TJOA 4ACBA 1X7AC 1C9TA 4UFGH 4IBLH 1VR1H 3QLPH 2P95A 1BJVA 2BXTH 1G3EA 2WINI 2O9QA 3PYHA 1W3CA 2OXSA 5L2ZH 1DS2E 2B9LA 2FS8A 4JK5A 4AFQA 1NO9H 4CBNA 2W7SA 2YNBA 2OC7A 3VB4A 1WV7H 1FJSA 2V6NA 4NG9H 3ZV9A 3PMAB 2ZGXH 4B2CA 1SFQB 5C1XA 1ZMNA 1SHHB 1MTVA 1EXFA 3DUXH 1A61H 3UB0A 1H8DH 3BTEE 3SHCH 1QHRB 2FOHA 2VH6A 2WV4A 3UOPA 1CHGA 2BDBA 2KAIB 2XBXA 8ESTE 5FCKA 1SOZA 1QJ6B 2F9NA 2ZPQA 2C90B 2AMQA 2BY8X 1YBWA 1ELBA 5ESBA 3LIWA 1YPHC 2HPQH 1YKTA 2BZAA 2OQUA 4I86A 2PSXA 4ZMAH 1OWDA 3VB7A 1ACBE 1LHEH 5K0HA 4YOGA 2BD7A 2A5IA 2H6MA 1F0RA 1LVYA 3ITIA 1P10A 1SGRE 3GCTG 1EZUC 3H7TA 5DGJA 1JRSA 3SUFA 2ODPA 2SGFE 2J94A 2B8OH 1XUJA 3KN2A 1HDTH 4I7YH 3RXSA 1B5GH 1TQ0B 1TNIA 1C5YB 4NA7A 1K9OE 4ZKSU 3UFAA 1MTWA 1CA8B 3OYPA 1YWUA 8KME2 2G51A 4D7FA 3GISB 1CBWB 5CHBA 2ZGBH 3OTPA 1NY22 1FDPA 1ANEA 1UVPA 2VVVA 2ZECA 3BG4C 3SGAE 3SU2A 5IK2D 1MCTA 1C5LH 5EW1H 1GBIA 4UONA 1UCYH 1P2QA 3MI4A 4UFDH 1KXDA 1QB6A 2J2UA 2VJ1A 1VJ9U 2A4GA 2HVXA 5A09A 3SHAH 2G4UA 2QAAA 1J8AA 5EPNA 1E37B 1UJ1A 5C5OA 1ELTA 1FI8A 5DP8A 5C0UA 1EP6A 4UFEH 2XW9A 1O5BB 5F6MA 2XWAA 3BV9B 4BAHB 1YGCH 1HPGA 1HAYB 2THFB 3ZVAA 1TB6H 1AHTH 1ZSJA 2QF4A 1L1JA 5T1VA 1ZGVA 2AGIX 4IW4E 1INCA 1ELCA 3LPRA 5KGOA 3UR6A 1XUFA 1Y3WA 3RU4E 5EJLA 1J16A 1DITH 1O5DH 2GD4B 1AB9B 1F0SA 4JZ1A 3KYGA 4I8KA 1GCTB 3SV8A 2P16A 3A84A 2OP9A 1JRTA 4IC6A 3TNTA 1OKXA 4WXIA 2GMTC 2FYRA 1A5IA 1K1JA 1IQGA 1P2KA 3AVZA 2FI3E 3LGYA 4B74A 1QGFA 2ZCHP 3A7YA 3U1IB 4HI3A 2Z3CA 4H6TA 1L2EA 1ABJH 3ZZ6A 1MTSA 4XBBA 5G4BA 4F48B 1FN8A 1OXGA 2NU1E 2A32A 1BBRH 5HYOA 2W5EA 3SJ8A 4B73A 1D9IA 3A7XA 1PQ8A 1GI3A 5ESTE 5HKKD 1LHFH 5F8ZA 2A45B 4Q7YA 2XXLA 1C1WH 1N6YA 5TJXA 4CREA 4WVPE 1OWHA 4D8NA 2Y5HA 4GCHG 1RIWC 3UR9A 2BVSH 1V2ST 1V2TT 1ZHPA 3SBKA 1TQ7B 2J95A 5C94A 5K7RA 2HVYB 2WPHS 1YPEH 1AFQB 1ABIH 4OS1A 2HNTC 3D62A 1G3DA 3SW2B 1C4V2 1Y5BT 2BLWA 2GCTC 2TGTA 1Z1IA 3SV9A 1SC8U 3KEEA 2FOFA 1C4U2 3SU6A 1MTUA 2OBQA 2O8TA 3KHVA 3K9XB 1E35B 2ZC9H 2WYGA 4Q80A 1J15A 1QRZA 1EJNA 1FN6A 3SNEA 2P3TB 1SSXA 3DHKH 5DN6D 4AZ2B 1GI2A 3OY5U 2WV5A 4O3UA 1P2MA 3DSOA 1O0DH 2FEQH 5HM9A 1DUEA 3QDZB 1ELDE 1O3EA 2AHME 4LXBH 1E79D 2BD2A 3DCLA 1ETTH 3A83A 2R3YA 4GHQA 3JZ2B 2Y7XA 3VG8A 1KLTA 1TONA 1DE7H 1UHBA 2ZPSA 3IWMA 1UHBB 1ZPBA 3EQ0H 5HIZA 1H9LB 2A5KA 1O5AB 2OLGA 7KMEH 1TRNA 2EI8A 4A1XA 1WDIA 1NBME 3BEFB 4FUDA 4Y8YA 3GICB 2GVFA 3A7VA 2F9OA 3AW0A 1HAZB 3GY2A 4Y79A 2QN5T 5CE1A 1HIAB 1ZHRA 4OGYA 3D65E 4NIVA 2XYAA 1S83A 3P95A 3CP7A 1N6XA 3F2HA 4CRBA 2FO9A 4K3JA 1T8OA 6CHAC 5HIYA 2VH0A 1YLDA 2XBVA 4NIWA 3RXTA 1GI1A 1EAUA 1BRBE 1BZXE 3EA8A 1BTHH 1GBAA 4E7NA 6GCHG 2AYWA 1SOTA 2C8XB 1ETRH 2EEKA 2FI4E 3QWCH 3ATKA 1C5RA 2Y6TA 2UWPA 1UTOA 3NUMA 1GBCA 3URDA 3SU5A 1QTFA 4ZH8A 4B1TA 1FONA 1W0KD 5GIBA 1QBOA 4ABHA 1NU7B 6LPRA 1Z6JH 5EODA 2Z9KA 5GCHF 2FTMA 4TWYA 1TX8A 1A1RA 4XRNA 2D2DA 1XUKA 3OFND 3F2FA 1SQOA 4Q7XA 1FUJA 1SLVB 1SB1H 1BTUA 1SLXB 2VBCA 1ORFA 4ISHH 3GDVA 3IITA 1ZRBA 1C1SA 1QURH 2GJGA 1ANDA 2VGCC 4NZQA 2EI6A 2SGEE 1DOJA 3F68H 3RXFA 4Y7BA 4HGCA 4R0IA 2A0QB 3FKSD 1LMWB 2R0LA 4LK4A 2ZDNA 2R0KA 3T28A 3ZVGA 2C8WB 4XOJA 3SV6A 4INKA 4DOQA 1AKSB 2CV3A 1WQVH 3T2NA 2CHAB 1QL8A 1D3DB 3EA7A 1ZSKA 3ATMA 2AS9A 5JBBS 3ELAH 4CBOA 1BIOA 2HNTF 1P03A 3RLWH 1D6RA 1O2KA 2WYJA 4X1PU 1P8VC 3GS9A 2IJOB 5FX6A 2BDYA 2Z3EA 3NCLA 1BRAA 2ZDAH 5C67A 2GZ8A 1PPZA 1JOUB 2A7CA 2ZEBA 2BD5A 5JYIA 4MQAA 1XMNB 2VIQA 3GY6A 1BTPA 1DWBH 3KNXA 1GMCG 3B9FH 3RXHA 2H1UA 2JETB 2BHGA 1KIGH 4AB8A 3M36A 2CN0H 2JJ1D 2EY4C 4CHAC 2KFWA 3TPIZ 4YLQH 2A4QA 3F9GA 1GDNA 4X2WA 3GY7A 1C2KA 4E7RG 5HXFA 1EB1H 2FESH 2FODA 3STIA 5LH8A 5L30H 1NFXA 5AFZH 3VXEH 2VWOA 1C5UA 1MKWH 4X6PA 2ZHFH 3P70B 3V12A 1EAWA 1MTNB 1G2LA 3OX7U 3OTJE 4DGJA 4AGKA 2CGAA 2J34A 1ZLRA 2YNAA 2A2QH 3PO1C 1GJ7B 4INLA 1TNJA 1D3TB 1O5FH 4F49A 2L74A 4I32A 4IMQA 2H5CA 1PPFE 4Y10E 1T32A 1W14U 1GVKB 3RMOH 2F4LA 1P3EA 2YMSC 1AMHA 4YT6H 4BAQB 1THSH 4Q7ZA 1EB2A 1XUGA 3PTNA 4J1YA 1C1VH 4Y11E 2K8IA 2PV9B 3A88A 5DK1A 3SJKA 3RC5A 5CHAB 7GCHF 4E05H 4MDSA 4CRGA 1YPHE 4Y8XA 2KR7A 4ISOA 1HFDA 1GJAB 1VKYA 3S9BA 3RMLH 1WCZA 4TPIZ 5FL7D 3UWIA 2SNWA 3MU5A 2YMSD 1C9PA 3E3TA 3V7TA 3ATIA 4A5TS 1EPTA 4GVUA 1C1MA 1QRXA 5CDFE 1OWIA 2BB4A 1K1PA 5ABWA 3MO9A 1TNLA 3M3TA 1C1OA 5EG4A 3CENA 3RXIA 1N8OC 4SGBE 2Y5GA 1CHOG 2BXUH 1GBJA 2OUAA 1UW7A 5E2OA 1IQIA 4FU9A 1GJ9B 3SUGA 2HRVA 4X8TH 1P02A 4OS7A 4DVAU 1AWHB 1B0FA 1BJUA 2FOBA 3BG8A 5BRRE 1MMJN 1W2KH 3RU4T 2ZU1A 3HK6B 4ISIH 3A7TA 1NRNH 4X6NA 5FPSA 4KELA 1YPMH 2Z9JA 1MUEB 1VCWA 1O2PA 1YY3A 2KM0A 3K6ZA 4ISNA 1TGCA 5DP9A 3V13A 1MZDA 1K1IA 2ANMH 1O3HA 2DE9A 3SI4H 2QYIA 1F5LA 2W3KA 1OP8A 1A3BH 1EZQA 2FLRH 4H4FA 2BDGA 2QGRA 4YOJA 1LCYA 3LOXA 1KYNA 2A2XH 3Q3XA 3SORA 4Y0YE 1TMUH 1A3EH 3VB5A 3SGBE 2D26C 1YC0A 4AG1A 3MQKC 3KIDU 1S6LA 3MO3A 5E0GA 1XKAC 3SZNA 4IN1A 5LPEA 3GY8A 2SGDE 4ASHA 2R9PA 2GCHF 3TITA 1FAKH 2ZPRA 1SQTA 1AI8H 3ZZDA 3KQBA 3VPKA 1LQDB 1UVOA 3M7QA 2D1JA 5FX5A 3H5CB 5EJ1A 1O3CA 1BDAA 1CHOF 1RGQA 2ZTZA 2I6QA 3RXCA 1NZQH 3W94A 2V0BA 1NN6A 3GYMA 1ZJKA 2ZU2A 1DUAA 3IG6B 4DY7B 1IHTH 2SGQE 3TIUA 1S0RA 3PTBA 5FBIA 3L3TA 1D4PB 2A4RA 5ETXA 3N7DA 2C3SA 4D9QA 1CA0B 1DVAH 2V3MA 2TGAA 3T5FH 1ZR0A 1NFWA 1S84A 4YESB 3AW1A 3DT0H 1GHAF 1NC6A 1AVWA 1HAHH 2FX4A 2Z6BD 3LGVA 2P3FH 3HGPA 4SGAE 1HUTH 3P8GA 2ZHDA 1P9SA 2NU4E 1EPTB 4U30A 4BANB 3DSGA 3TGKE 3A89A 4QT8C 3E0PB 2Y81A 1V2UT 4ZKNU 2JIZD 1MQ5A 1SPJA 3RXDA 4Y6DA 3TJVA 3BTTE 2O8WA 1KXEA 4FUCA 4CH8B 1Z8JB 3NPSA 1GCTC 5FCRA 2WV9A 3TK6A 2PHBA 3RXRA 1DWCH 2VB0A 4M7GA 3DFJA 1GMHG 1ZSLA 4Y76A 1RJXB 4GPGA 1KDQA 1G3BA 4NSYA 2ZZUH 1TGTA 3VGCB 1RXPA 1V2VT 2ESTE 5CMXH 3HGNA 3E16B 2BQWB 2FMJA 3A81A 1E0FD 1DICA 2ZF0H 1B0EA 1QRWA 3M7TA 5EXNA 2BY5X 1SGTA 3SV2H 1C5SA 1GMCF 1C1NA 1E1RD 3PWCA 4FXGH 1O2MA 3MH7A 4OS4A 4THNH 1TE0A 1JBUH 3BTQE 1V2NT 3ATWA 1QNJA 5A8XA 4VGCB 1NFUA 4MNXA 4A1TA 4XDEA 2WZQA 1MQ6A 1C2FA 5CHAC 2QXGA 1S5SA 3F0PA 4ZHMU 1IHSH 1HNEE 4ABDA 3BTHE 3RXQA 5JDUB 2PKAA 3SQEE 3UY9A 1O2JA 1BMNH 4ACAA 1QL7A 3UTUH 1C1UH 2QV1A 2XC5A 2G81E 2UUFB 4XSKU 1EX3A 1HB0B 3F2GA 5E0JA 1BUIA 1PQ7A 1ZTLA 1SHYA 1A46H 3TGJE 1WBGB 3FVFB 1TRYA 2H9HA 1GCDA 1WU1A 1U6QA 4NA8A 2AIPA 4X1QU 1QIXB 1O2HA 3SV7A 2PKAB 1AQ7A 4FUFA 4AGJA 2QXHA 1SGDE 2ZU5A 4JZIA 4ZXXH 1NM6A 4TYDA 3GCHB 1SGQE 4DIIH 1SGYE 1CGHA 3DD2H 3FAOA 1GBHA 5DP3A 3EAJA 2RCEA 5DP4A 1EKBB 1UTQA 4Q63A 4KP0A 1T8NA 1Y3VA 3PV5A 4I8LA 1P04A 5EGMA 4YTAA 4CR5A 2IPHA 3E0NB 4ABBA 1SGPE 5C2ZA 3E90B 1PFXC 1Z8IB 1O5GH 4UDWH 3TK9A 3SU4A 1UVUH 1T4UH 1GHAG 2KCYA 1Y3UA 2J4IA 3PB1E 2ZHWH 4FUEA 1CBWC 3LGUA 1C2MA 1RFNA 2IOTA 3BG4B 1VITH 3SYJA 3UIRA 2ZCLP 3Q00A 2LNCA 2PUXB 3U8OH 1CSOE 2YOLA 1YCPH 3PM3A 4Z1MD 1OWJA 6ESTA 2FOGA 1GGDB 2PKSC 1JIMA 4BNRA 1NRPH 4WF8A 4BXSA 5DSFA 4B76A 2ZI2H 5IYTA 5GNDA 5EU8A 5EQRA 4GLYA 4B71A 4KTCA 2BDAA 3WY8A 2V3HH 3ZZCA 2F43B 1HJAC 1KTTB 4AN7A 5EJZA 1GJ8B 1GWAA 4AFUA 4WMEA 3TH4H 3QTOH 1SG8B 4GSOA 4ESTE 1KDQB 1J14A 1JMOH 1F0UA 1UK4A 1GBTA 3U8TH 4FUHA 2A5AA 2A7JA 2K1QA 2BVXH 2J5UA 4O9VA 5LGOA 4X6OA 3VB3A 2EC9H 5A0AE 1MKWK 3S7HB 2STAE 4Y0ZE 2LP6A 2Q6DA 1O2TA 4BAKB 3DSPA 2VIOA 4X8SH 3DFLA 3ZZ8A 1SFIA 2ZHQH 2ZU3A 3MYWA 1BRCE 1KY9A 2FOMB 3U9AH 3ZVCA 2QXJA 1LHGH 2P94A 3UQVA 5AFYH 1BMAA 2OK5A 1QB1A 5C1UA 1P2JA 2BY9X 1FNIA 2WPDD 1SKYE 1V2LT 2IPQX 2XBWA 3ZVDA 3UPEA 3MMGA 4ZKRU 1AZ8A 1GI4A 3LGTA 3LONA 3PLBA 1OP2A 2QC2A 1C5MD 4KGAA 1QQUA 4B6EA 1LDTT 1UTLM 3KQDA 3WW7A 4CR9A 4FUIA 3KF2A 1GMDG 1O36A 1AFQC 4NZLA 4Q2KA 2FYQA 4GUXA 5C3NA 1FXYA 3WWFA 1LPKB 2ZFFH 3FZZA 4Y71A 1ELAA 1QBVH 3RXOA 5HM2A 1A2CH 1PPEE 3RXJA 3A86A 1MABB 2VWNA 2CXVA 1BHXF 1W8BH 3VXFH 1C5XB 2F83A 3G01A 3QZQA 2LPRA 1AVXA 2JJ2D 1O31A 1B7XB 2P8OC 2XOKD 4MPWA 1O3BA 5A8YA 3E1XB 1LTOA 1CT0E 3F9FA 3SI3H 2F3CE 4WY3A 4JCNA 1XVOA 2ZDLA 3F3BA 3KCGH 3Q3KA 1O5EH 4ZHLU 2KCOA 3NZIA 3SNDA 1AVGH 1XUHA 1TBZH 1Y3YA 1L4DA 3E91A 3N7EA 4D7GA 2FOAA 4AYYB 3RXEA 1GDQA 1VZQH 3NK8A 2PLXA 1VJAU 3FO8D 2Z3DA 1G9IE
chains in the Genus database with same CATH topology
2G5VA 3BEUA 3GY3A 1P12E 1FY1A 1V2JT 1C1PA 3F9EA 3SJ9A 4K8YA 1S6HA 4FU8A 2STBE 7LPRA 1ZGIA 5E0HA 2WUCA 1SGIB 1W10U 1BTYA 3MHWU 3TGIE 1OX1A 1JXPA 1T8LA 3HK3B 1GJ6A 2PSYA 3U98H 1P2NA 1MTNC 1H9HE 1G37A 4BTTB 1A5HA 1KSNA 3BIUH 1GI6A 5LPFA 4B75A 1Y8TA 1UMAH 4K5ZA 1C2EA 4MPXA 3ZZ7A 2TIOA 4O03A 1ZYOA 1IAUA 1FY8E 4FUGA 4F4OC 1FY4A 1OP0A 4OGXA 2GCTB 3MU0A 1TNHA 1FMGA 1VCPA 1S82A 5E8EH 1O3DA 1PPHE 2GT7A 2Q1JA 1MAYA 1ZZZA 4BOHA 1ZTKA 2BMGB 3TVJB 1O2NA 1QJ1B 1HXEH 3SQHE 1BITA 1L1NA 3VB6A 2ALVA 2ANKH 4B2AA 2UUKB 5DP7A 2VGCB 1FV9A 2A4OA 2FPZA 4X2XA 3N7OA 4FU7A 1GVZA 1GGDC 1NRSH 2BD9A 1UK2A 2ZGJA 1WQSA 3BN9A 1O34A 1LPGB 5C5NA 5FHTA 1G32B 1HAGE 1LPZB 1IQJA 5B6OA 4MPVA 1VITG 2Q6FA 1NFYA 2CHAC 2JKHA 1AE5A 2XRCA 2VWLA 1KXCA 3JZ1B 3TU7H 1HYLA 1C2GA 4ZROA 1C5QA 1IQMA 3A8BA 3H7OA 2BQ7B 5EOKA 2B5TB 2FS9A 2BZ6H 4X2YA 3VEQB 9ESTA 2XTTB 3LJOA 1DSTA 3VFEA 2Z9IA 1LHCH 1SLWB 4UE7H 1QL9A 1XUIA 2RG3A 3NKKA 5A8ZA 4IGDA 4YO9A 1ELEE 1WSSH 2PR3A 1W7XH 1D3QB 4UFFH 5GXPA 1WYKA 2GZ9A 1L4ZA 4TPYA 1KLIH 4JMYA 1VGCB 4K1TA 4B2BA 2Y82A 1ESBA 3ZZAA 1FPCH 3R0FA 2UWOA 1Y5UT 2OINA 1SBWA 3I78A 5GJ4B 3BSQA 1AO5A 1F92A 2TGPZ 3PV4A 4IMZA 4YZUA 2B0FA 1T8MA 2OC0A 1GMHF 1THPB 1ZJDA 1CA0C 2ZCKP 3GDSA 4ISLA 2XC0A 3RXMA 1BRUP 1WTHD 4ZUHA 5T3HA 1QCPA 2VIPA 1O3IA 8GCHF 4LOYH 2H9EH 1YPKH 4K8BA 3STJA 1GBFA 3EGKH 3LKWA 1YF4A 3AAVA 1K22H 1S81A 3GCOA 4CHAB 3A7WA 3ZVEA 2Y5FA 1T31A 3AAUA 3M5MA 1HJ9A 2VIVA 3QUMP 3A7ZA 1G36A 3A82A 2V35A 1TA2A 1GI8B 3RXKA 2GX4A 2GMTB 1O2RA 1PYTC 3LH3A 3O8CA 4GHTA 1O2WA 1UCYK 3QGNB 8GCHG 1S85A 1EJAA 1Z6EA 1AN1E 2A7HA 4XBDA 1N1LA 1GHBF 2FOEA 2R2MB 4DURA 1DX5M 1M9UA 2GTBA 1DDJA 5FXLA 4WH8A 3LC5A 1GBLA 3O8RA 8LPRA 1V2MT 3UUZA 1CVWH 2SNVA 2UWLA 1SGCA 1P2OA 1Z71A 2CJIA 2G55A 1EZSC 7GCHG 1AZZA 3M5LA 1GI0A 4A1VA 2QXIA 1RIWB 3SNCA 3MU1A 1TFXA 2H5DA 4MNWA 3SU0A 1MD7A 1EATA 5J4SA 1DXPA 5JBTA 3KQEA 4TWWA 2F91A 2O8UA 3R3GB 1D3PB 1NRQH 1SGFA 1P57B 1TALA 5AF9H 4GCHF 5JBCS 1TBRH 3EA9A 1JIRA 2BDIA 1QBNA 2BYAX 1ZHMA 4X2VA 5JBAS 4MPUA 5I46H 5EW2H 4ABFA 1C2IA 1LO6A 2DE8A 2HNTE 3RXGA 1DT2A 4YM9A 3MFJA 2TPIZ 3QK1A 2ZDKA 2C8YB 1C1RA 1DWDH 4JYTA 4H42U 1GJBB 4CH2B 3S0NA 1GJCB 4UD9H 2HGTH 1YLCA 1UVSH 1OYQA 1SGEE 2AH4X 4X8VH 1XX9A 1C4Y2 3MO6A 2BY6X 3BF6H 3RXAA 5HGGA 1V2RT 1SGFG 1GHZA 2BVRH 1VCQA 4CRFA 3RM2H 1P2IA 2Z7FE 1FQ3A 1O38A 3TH3H 1O2LA 3OY6U 4DT7B 4IC5A 3RXVA 1K1MA 4RKOB 1HRTH 3UNQA 4X1SU 1HAIH 1ZPCA 2Z94A 3ENSB 3M3SA 2F9BH 1QJ7B 3F9HA 2FLBH 1GMDF 2ZFRH 1GHVH 1THRH 1C5WB 1BTWA 4R8TB 2ZA5A 3SJOA 4ABEA 3GCHC 4K1SA 3A8CA 4FUJA 2WPIS 1UTNA 3MWIU 1LHDH 4DIHH 3PMBB 2ZWLH 2BD3A 4K69A 2FX6A 3UNSA 1DY9A 1GDUA 1HV7A 3S69A 1OPHB 4MNYA 3P6ZB 4YLUA 4NGAH 1Y5AT 5FPYA 1G2MA 3TK5A 2FTLE 2G4TA 1GL1A 1PPCE 1RTFB 1SLUB 1F5RA 1GHYH 2OBOA 3MU8A 4XE4A 3ZVFA 1C2HA 1ELGA 1QQ4A 1Y59T 2JH5D 1E38B 4NCYA 3PLPA 1YP9A 1XKBC 3LT3A 4JZEH 4AFZA 1HGTH 1IOEA 1QA0A 1SL3A 2BOHB 3BTGE 7ESTE 1NU9A 5T6FA 4WXVA 2XC4A 1NS3A 4IS5A 1MU8B 1Y3XA 2ZFTA 5H4IB 2W7UA 1Q2WA 2SGPE 1UO6A 1S6FA 5T6DA 4CRCA 2M5TA 1NT1A 4JZDH 4A92A 3TLOA 2B7DH 2AFQB 1YCPM 1FY3A 2ZTYA 3SU1A 3GOVB 1LQEA 1TAWA 1TA6A 4O3TA 3A85A 2BX4A 1Z1JA 2GGVB 4WH6A 1PQ5A 3ZZ9A 1EOJA 1GHBG 1MBQA 1QY6A 4FVBA 3P8OA 2RDLA 1TMTH 2XCFA 1CO7E 3M3VA 1NTPA 2FWWA 1GG6B 3QZRA 4BTIB 1F2SE 2BD8A 1GI7B 3HPTB 4XFQA 5BPEA 2ZHEH 1Z8RA 3RU4D 1AB9C 4BXWA 3UWJH 4NWLA 3GDUA 1GJ4H 2A31A 4MNVA 4Z6AH 1ESTA 1LVMA 2NU2E 3F1SB 1EOLA 3CS0A 1ZMLA 5F8XA 1TPOA 1C5VA 2BTCE 5HMAA 2ASUB 3SNAA 5L2YH 4I8HA 3T29A 3RC6A 2GCHG 5C1YA 1TX6A 2VIWA 5A0BA 3D49H 3PO1B 1UTPA 3U69H 3T26A 5E2PA 2ZGCA 3FFGA 1FLEE 1V2PT 3AASA 4X1NU 3QGJA 2ZIQH 1AD8H 2GKVE 3KGPA 1K2I1 4X8UH 3T25A 2WPKS 4FVDA 1MKXH 3O8BA 1O3PB 2UUJB 1O3NA 5C20A 1TX7A 4X6MA 3FZDA 4D9RA 5EXLA 5J4QA 3RMNH 2VVUA 1A0HB 1P0SH 3P17H 1TPPA 3KQCA 1GG6C 1P09A 4PROA 5JB8S 3M35A 2ODQA 1O3GA 3A8DA 1DLKB 5F8TA 1Z7KA 3GCNA 1L1GA 1HAXB 1O2UA 2QIQA 1O32A 1P01A 5GDSH 3RXLA 1QR3E 2ILNA 1TPSA 1D6WA 1ANBA 2VINA 1TPAE 2PW8H 3V3MA 1MH0A 3QX5H 2GP9B 3ZYEA 1P9UA 1ZOMA 4YOIA 1ZRKA 3BTDE 5JB9S 3ZZBA 3O8DA 3EDXB 1TNGA 3ODFA 1PJPA 2HLCA 2VWMA 4UEHH 4A6LA 3ZYDA 4OS5A 5TCAA 1RRKA 4JK6A 5DO4H 5A2MH 4AB9A 4ZKOU 5FBEA 4RSPA 3Q76A 4IN2A 1IQNA 2J92A 1CU1A 3BTWE 2ZQ2A 3K65B 4ZAEA 4MLFB 1RS0A 2FIRH 2F9VA 4U01A 1P05A 1HJ8A 1OWKA 1AWFH 5EQQA 4K1EA 2JH0D 2Z9GA 3T62A 5DP6A 2AGGX 5F03A 4DJZB 3A87A 4WWYA 3RM0H 3M5NA 3HKIB 3U8RH 2RA0A 1YYY1 4FUBA 1ESAA 2ZTXA 1C2LA 2QF3A 2ZQ1A 3L33A 3Q3YA 4AORA 1ANCA 3NWUA 4NSVA 6CHAB 1P06A 3K6YA 1S0QA 1OS8A 3UNRA 2BX3A 2ANYA 2BOKA 4BTUB 3LGIA 1A0JA 2BD4A 1O2IA 2C4FH 2FM2A 1MAXA 2O8MA 3OU0A 3EE0B 4AYVB 1GHXH 4DCDA 1E36B 1HAOH 1AY6H 1YPJH 3PROA 2F9UA 4NIXA 1OYTH 1TMBH 1RTLA 1FPHH 1YM0A 2NU3E 4MTBA 3TNSA 4BAOB 3SUEA 3GY4A 4J2YB 4LZ1H 2P93A 1LKAA 4BAMB 1C1QA 3RXUA 1NPMA 6GCHF 1A7SA 3OSYA 2PTNA 1W7GH 3FP8E 2AERH 1C5ZB 1BT7A 1O33A 3URCA 1JWTA 1KXBA 1AUTC 1O5CB 3M7UA 2PGQB 4NA9H 1O2ZA 2V3OH 4LZ4B 1XXFA 1O3OA 2AGEX 3L6PA 1P11E 2OD3B 2FXRA 3K2UA 5EQSA 1EJMA 5PTPA 2CF8H 1UTKA 1NESE 1V2OT 1WAYB 2W26A 1AUJA 5FAHA 2BLQA 3S9CA 2AMPA 3ATLA 3M5OA 1O2YA 5AHGH 2QCYA 4KKDA 3SNBA 3MH5A 1C5OH 1EZXC 2AMDA 1NRRH 1G3CA 3SJIA 1A0LA 3SOSA 1LVOA 2PKSB 1DFPA 3ESTA 1MCVA 1TNKA 1CGJE 5EPYA 1IQEA 2WPLS 3BTKE 3TJNA 1ZPZA 4I8JA 4NIYA 3LJJA 3RXBA 2WPJS 4K60A 1C2DA 5IDKA 1CT2E 1HJAB 5GPIB 1TGNA 2QY0B 1RD3B 1MU6B 1O3AA 3KL6A 1A5GH 3RP2A 2Q6GA 3ZV8A 1F0TA 3B8JA 3T27A 1SVPA 1UK3A 2SFAA 2ZU4A 3MNSA 1LVBA 1HAVB 4E06H 1UVTH 3LH1A 3LC3A 2BDCA 2XWBI 2CMYA 3LDXH 1EP5A 1EPTC 1HCGA 3FANA 1AE8H 1HIAA 3A80A 2D8WA 4WJG2 1VITF 2G52A 2ZFPH 4AFSA 3UREA 1O3JA 2FZZA 4WMDA 1QFKH 1VGCC 1HBTH 2ZG0H 5FPTA 4Y7AA 1BBRK 1BOQA 3QN7A 1O35A 1T7CA 3PWBA 1BQYA 3HKJB 2ZDVH 4RN6A 2OQ5A 1P3CA 1SQAA 1QB9A 1CGIE 1XM1A 5GCHG 2AIQA 1ELVA 1DLEA 3QO6A 1HAPH 1BTXA 2BDHA 1A4WH 3C1KA 4NFFA 2P59A 3BTME 3M61U 4X1RU 2BM2A 3MH4A 3LGWA 1O2VA 3B23B 1TOMH 2OCVB 2ZO3H 2TGDA 1OWEA 4A7IB 1N8OB 2GDDA 2IN2A 1C5PA 2G00A 5GWZA 9LPRA 1TRMA 1XVMA 2FI5E 1PPBH 4O97A 2ZKSA 4U32A 1V2QT 3U1JB 1YCPK 2C93B 4Z0KA 1O39A 3MNXA 2ZFQH 4HFPB 1SI5H 1BHXB 5DJ7A 3C27B 1AU8A 4VGCC 1AIXH 1EUFA 1F7ZA 1Q3XA 1TOCB 1V2KT 1BBRE 1EASA 5T6GA 1ARBA 1FIZA 1K28D 3MH6A 4X0WU 1K1NA 1DXWA 3F6UH 2GDEH 3GCTF 1GBBA 4I8GA 4AX9H 3MNBA 3RLYH 1SR5C 2C8ZB 3W95A 1FY5A 2ZFSA 5SGAE 1GI9B 1O3FA 1GVLA 1GJDB 1V2WT 4OS6A 1SGNE 2GT8A 3FP7E 4KTSA 3DA9B 2GZ7A 1GPZA 4HTCH 1PYTD 4TY7A 3PMHB 5AVDA 1FZZA 4ABGA 1DWEH 4AG2A 5TCCA 1ARCA 1IQKA 2XNIA 1DANH 3S9AA 5DG6A 3E8LA 3ZZ4A 1E34B 3SGQE 3GY5A 2TRMA 1L0ZA 1O2XA 3GYLB 1GI5A 1W12U 1AKSA 1LKBA 3PLKA 1T4VH 2FOCA 1WTGH 4AOQA 1FIWA 1TBQH 5DPAA 3ZZ3A 1H4WA 2ALPA 1PQAA 1AFEH 1MKXK 5LPRA 3SN8A 2HALA 3MU4A 3LU9B 2ULLA 2VIDA 4K2YA 5JPMH 1GBKA 3E6PH 1XXDA 5DP5A 2G8TA 1H8IH 1YPLH 1C5NH 2VNTA 4INHA 2FDAA 1CT4E 3TH2H 1HAVA 3D23A 3S7KB 1MBMA 2RA3A 3P92A 1CQQA 4CRDA 1O3LA 1V6DA 2H9TH 3SU3A 1K21H 3V0XA 1IQHA 2XBYA 4CRAA 2NU0E 2TBSA 2Z9LA 2FP7B 2PTCE 3A8AA 1UTMA 2VU8E 3P8NA 3CS7A 3UOUA 2BQ6B 1C2JA 2BY7X 1DY8A 1C1TA 1BMLA 1KLJH 1G30B 5DKMA 1TLDA 2ZNKH 2PFEA 1UTJA 2PGBB 4U2WA 1O2QA 1AGJA 2HPPH 4KTUA 1DM4B 2HWLB 2PWXA 1EAXA 1KXAA 3Q77A 3BEIB 1BCUH 2Y7ZA 3SO3A 2UUYA 2KAIA 2VVCA 2QF0A 1DSUA 1ZMJA 3EYDA 2AEIH 1H9IE 1IQLA 1SMFE 1BTZA 1QA7A 3RDZA 3ZZ5A 1GBDA 4D76A 1GHWH 1TGSZ 2J38A 2WPMS 2W3IA 1EAIA 4NFEA 4WMFA 2EI7A 1MZAA 1PPGE 1GL0E 2DUCA 3PMJA 2G5NA 4DG4A 4ABAA 4GAWA 4TY6A 2JETC 1BA8B 2BLOA 4JYUH 2J9NA 1W13U 1K1OA 2Y80A 2ANWA 1NROH 3HATH 4MG3A 2NWNA 1O2SA 3I77A 4HZHA 4RKJB 2GV7A 2ZP0H 2EA3A 1BB0B 1KXFA 3FP6E 4ZHAA 1W11U 4MVNA 4NWKA 3ODDA 2SGAA 2R3UA 3BIVH 4JZFH 1DPOA 2QA9E 4ZXYH 1OOKB 2ZDMA 1O2OA 1FAXA 2H2ZA 1TABE 5A0CA 2PUQH 1K1LA 3RXPA 3BTFE 3NXPA 1ID5H 1O3MA 4JYVH 2P8OB 5I25A 3VGCC 1BMMH 2CF9H 2JH6D 1HLTH 1ELFA 1J17T 3RUOA 2BLVA 1Q31A 2WUBA 2R2WU 2OC8A 3MNCA 2OC1A 5L6NH 1W0ZU 3MOCA 1OSSA 3I29A 1H1BA 3UQOA 3MTYA 1WUNH 1UCYE 1Z8GA 4XBCA 3ZVBA 1EQ9A 1V3XA 1HXFH 2P3UB 2HOBA 2A1DB 3P8FA 1WOFA 4ABJA 1TWXB 1ETSH 4Y8ZA 4I33A