4NFEA

Human kallikrein-related peptidase 2 in complex with benzamidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
227
Chain Sequence
b'IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-2
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
total genus 51
structure length 227
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA01
1C1OA 4MPUA 1QTFA 2BQ6B 2BLOA 1E36B 4J1YA 3P6ZB 2BZAA 3H7OA 1GI7B 4X1RU 1V2KT 3UNQA 4NWLA 1CA0B 5HM9A 4YO9A 2HLCA 2TBSA 1O2QA 2FS9A 2SGDE 3U8OH 3ZZ7A 3PB1E 3VB6A 2ANKH 1HAHH 2ZU1A 2LNCA 1BTXA 3LGWA 1ZMLA 3ZV9A 4BTUB 3RXRA 2VIDA 4X8TH 2BDGA 2O8UA 4AG1A 1V3XA 1SVPA 4O97A 5FXLA 1BRCE 1DY9A 2KAIB 3K6YA 2ZFFH 4MPWA 3UUZA 2FPZA 4YM9A 1DUAA 3K6ZA 1SGEE 2JETC 1GI0A 1RJXB 3GCTF 5JBAS 1N8OC 1NFUA 3MNCA 2YNAA 5T3HA 5JDUB 1KXDA 3SO3A 1FPCH 5CMXH 1UTLM 5JB9S 1C5QA 1LDTT 3VPKA 1MTVA 2BXUH 2W7SA 1IQLA 1QHRB 3TJNA 2THFB 4Q7ZA 4NIWA 3TGJE 1TGCA 3EA8A 1CT4E 3ZZBA 1MCVA 1MQ6A 2AMPA 1YPEH 3LONA 1OP8A 5JBBS 3O8DA 2GT8A 2G5VA 5AF9H 3PYHA 5TCAA 1K1LA 1TNGA 1C5PA 3AVZA 1BQYA 1AVXA 4MG3A 5GWZA 3P95A 4AG2A 3TGIE 3QX5H 1C4U2 3A8CA 1HIAB 1HJ9A 1QBVH 1XUKA 2P93A 3S69A 1C5RA 1EPTC 2B5TB 3GY8A 2B0FA 4ZKNU 2A4RA 1SGDE 4XSKU 2HOBA 1NROH 1TBQH 1SGIB 2Q1JA 2VH0A 1HAIH 5FAHA 3SW2B 1GBCA 2BD2A 6CHAB 1O2JA 4WH6A 3KL6A 2XYAA 2ZC9H 1AE5A 2FS8A 1BTUA 1GVZA 3RXHA 3SUGA 4DJZB 5K7RA 2VWLA 3AAVA 2EI6A 2FEQH 3SJIA 1FQ3A 1DY8A 1O5FH 1XM1A 3LH1A 1GWAA 2QCYA 4WVPE 3TJOA 4CH8B 2A5AA 1V2TT 4Y0ZE 3ODFA 1V2UT 2NU3E 1QJ6B 1BZXE 5F8TA 4LK4A 4BOHA 5T6DA 1HV7A 1H9IE 3ATWA 1WV7H 4AN7A 5E0JA 3FP7E 4NIVA 3STIA 4XOJA 3GDVA 3M36A 1IQHA 1FDPA 1ELTA 3LGYA 3RXTA 4A92A 3BV9B 2CN0H 1QB1A 2VINA 3QGNB 1E38B 1MAYA 4M7GA 3F9EA 3I77A 4UFEH 1G2LA 1KSNA 3SQHE 2QF0A 3SU4A 3MU8A 1GPZA 1WTHD 4H42U 5F03A 4CHAC 2FLBH 5DP5A 5DK1A 3K2UA 4TY7A 2BY7X 3NZIA 1OWDA 1TRMA 1NRPH 1O2UA 4TWYA 4WMFA 3MU4A 3RM2H 1HJ8A 1LVMA 1IQMA 4H4FA 2XCNA 2TPIZ 1Z6JH 3ITIA 1ZPCA 1ABJH 2F9VA 2P95A 2FTMA 2A7JA 3IG6B 4MNYA 1QL7A 1TRNA 3M5OA 1MKWH 3PMAB 1GGDB 2A4OA 2AEIH 5GCHG 3TH4H 2O8WA 1G3DA 4X0WU 4XBDA 3T62A 1XUGA 5FBEA 1HIAA 4K2YA 3TLOA 2VIQA 1D4PB 4K3JA 1W3CA 1SBWA 1K1JA 3TH3H 4Y11E 1UTMA 2WUBA 1O34A 6GCHF 1CSOE 3T5FH 2VU8E 1T4VH 8LPRA 1O2WA 2Z6BD 1B0EA 1DXPA 1O30A 1P0SH 1GHXH 1SGPE 2A45B 4WWYA 2FDAA 1C1NA 5A8XA 1O5GH 5AVDA 3GCOA 2NWNA 1Y3XA 2QF3A 1C9TA 1BUIA 2DE9A 1Z8IB 5DG6A 4RSPA 3VFEA 1Y3VA 1QRZA 3RDZA 4DG4A 4K1EA 1DWEH 1MH0A 1Z8JB 2BOKA 2FLRH 3V3MA 3V13A 4JYUH 4K1SA 5DPAA 3S9AA 3ZZ5A 3MH5A 2ZPSA 3RC6A 3BTGE 2KAIA 2QN5T 3BTWE 4MQAA 1SGFG 2ZEBA 2BVXH 3NUMA 1ETSH 4A1XA 1BCUH 4J2YB 2HVXA 1EB2A 6ESTA 5EQSA 1P3EA 3A8BA 4KTSA 2C4FH 1QB9A 3H7TA 1RXPA 1A7SA 1GCDA 1AVGH 1ZJDA 2HALA 4O3TA 4THNH 3RU4E 1QURH 1VITH 1BIOA 2G5NA 1S6FA 1B5GH 4FUHA 2VH6A 5A2MH 4I8LA 3OX7U 3PWBA 9ESTA 2C93B 2VGCB 3SU3A 1DITH 4I8GA 1W12U 1MZDA 1ZHMA 3MO6A 1SR5C 1C2HA 1K1PA 4R0IA 3S9BA 1F5RA 1S0RA 2BDIA 2STAE 1YCPH 2ZGHA 1O3IA 4KP0A 3BF6H 2ZGJA 2RA3A 3QUMP 4E7NA 4GCHG 2GDDA 4TPIZ 2WPHS 1K9OE 2O8LA 1BA8B 2ALPA 5T6FA 3RXSA 2Y81A 3DUXH 1W8BH 4ZKRU 4X6PA 3RXDA 4OS4A 1GDNA 1LVBA 2CGAA 3E6PH 4YLQH 2OBOA 1S81A 4X2YA 5E2OA 1DPOA 1Y59T 4CRBA 1O3DA 2H2ZA 1AFEH 3A87A 4NA8A 1H1BA 1VITF 1TNHA 1FNIA 1OXGA 2BD9A 1CA8B 4Y6DA 3ZVAA 1MBMA 4AORA 3RMNH 4D76A 1O2HA 3BTQE 2SGPE 3ZVEA 2PKAA 2CJIA 2XWBI 1GI9B 1GHVH 1PPCE 3JZ2B 5EQRA 1S6HA 1MU6B 2QAAA 2H5CA 1T7CA 1O3EA 3A82A 4ZAEA 2BD3A 3U69H 2F9NA 4A1VA 3TK5A 4X1QU 1W2KH 1AKSA 1AUTC 1PFXC 1GCTC 1GBMA 5GPIB 2WYGA 1J9CH 5IYTA 3I29A 1EOLA 1F92A 5JYIA 2PV9B 2VVCA 1GI5A 1BTYA 1G9IE 4CRDA 3LJOA 1HJAB 3ODDA 1XUFA 1ZR0A 1YLDA 2P8OB 5EXMA 4JK6A 1K1OA 3M5LA 1SOZA 2GGVB 4ZXYH 3TJUA 1UCYH 2HRVA 4HZHA 1GVLA 1PPBH 3T27A 1NU7B 2R2MB 4HGCA 5BRRE 1GCTB 4AFSA 4INKA 1EB1H 1D9IA 1O3JA 3MH6A 2GCTB 2G51A 2RCEA 2ZP0H 4GSOA 1EUFA 3SNEA 1EZQA 3MH7A 3A7YA 2ZDLA 1W11U 2CF8H 1MMJN 2BB4A 2ZHQH 2PKAB 4KTCA 3SV8A 1BMNH 3TIUA 1YC0A 1BOQA 1UVOA 1DVAH 1YGCH 3SZNA 2FIRH 1RFNA 1H4WA 4Y76A 3SGQE 3SU0A 5L30H 1O2RA 4CRGA 1PPGE 1GBEA 1O3NA 2Z9JA 2EI8A 1W13U 1BRBE 4TWWA 4NA7A 4HTCH 1UTJA 1CQQA 1V2QT 1IQEA 1O3GA 1PQ8A 1T8NA 3VEQB 1TOMH 2BLWA 2VWOA 4E06H 2BOHB 2UWPA 3RXIA 4XBBA 1SQOA 1QRXA 1DWBH 1C2MA 2M5TA 2P3TB 3PO1C 1ZMNA 4FU9A 2G00A 1QJ1B 4XFQA 4DIHH 1LTOA 5C20A 5LH8A 1ELGA 3TITA 2IPHA 1KY9A 1C1SA 1EKBB 1A4WH 1ZSKA 3NXPA 2R0KA 3BEUA 1LHDH 1ESAA 1JIRA 2PTNA 4A7IB 1PPZA 3TNTA 1PPFE 3C27B 2FI3E 3ZV8A 1C5UA 1SC8U 3O8CA 3BTFE 2FOAA 3KQDA 2ZNKH 1PQ7A 3V0XA 4GLYA 4IBLH 4AFQA 1LHGH 2GCHG 2VWNA 1YM0A 2P94A 2D26C 4BAOB 4ZH8A 4K5ZA 2A2QH 1UK3A 3M35A 2XC5A 3BIVH 3MHWU 5FPTA 1FAXA 1IQFA 1E37B 1PYTD 1YPGH 5FX5A 1L1GA 2GV7A 3A88A 5E8EH 2ZU2A 2ZF0H 2YNBA 4X1NU 1BTZA 5DP3A 4XE4A 4RKOB 3MO3A 3EGKH 1FJSA 1O2TA 1TNIA 4H6SB 1K2I1 1XX9A 3FVFB 4IN2A 3SV7A 5K0HA 1RGQA 1TNJA 1L4DA 2Y5GA 4ZHLU 1THSH 1EP5A 1GJAB 1V2NT 1FY1A 1AO5A 3VXEH 3Q76A 1EAXA 3PM3A 1LVYA 4U2WA 1GL1A 4ASHA 4ISLA 1FONA 1GBIA 1IHSH 3SNDA 4NSVA 2ZFTA 4INLA 1V2VT 3B8JA 4U30A 1GMDF 4FUGA 4B1TA 2WPJS 3SNCA 1ELVA 1CHOG 1OWKA 1Z1IA 1UK2A 4JMYA 3VGCC 1A3BH 3DFJA 1XUIA 1KDQB 1C1PA 2V3OH 3ZVFA 5AFYH 5AHGH 2HWLB 3M7UA 2XBWA 1EZXC 1P12E 3GY7A 4BAQB 1GI8B 1OP2A 3ZZAA 4I8JA 2SFAA 4AB8A 1LMWB 5GDSH 3T28A 2H1UA 1AB9C 3LH3A 1AZ8A 3UNRA 1MTWA 3SU2A 5LPRA 1LPZB 4I32A 5FCKA 1O3HA 1AVWA 1ARCA 4B74A 3NPSA 1NRSH 4BXWA 5HMAA 4CHAB 1N1LA 4NIXA 4ESTE 3EA9A 1C4Y2 4TY6A 1AWFH 2Y5HA 3HK3B 1FN8A 1VJAU 4NSYA 1DX5M 1TGTA 3Q3KA 2F9OA 2Q6FA 1LQDB 1O3KA 2H5DA 2Z9KA 1ANEA 5DO4H 1L4ZA 3OYPA 3DT0H 2JH6D 2UWOA 5A8YA 3A84A 1ZPBA 3F9FA 1HRTH 2SGEE 2D8WA 1SGRE 1A5GH 5ETXA 1O2PA 1YPHE 1ZMJA 2FM2A 3FFGA 5E2PA 3EDXB 1GHZA 1GJ4H 2BD8A 1WTGH 4H6TA 4ABJA 1AI8H 3M37A 3MNBA 3SNAA 1L0ZA 2B8OH 2PKSB 1JRTA 3HATH 1HDTH 1FZZA 3RMMH 1LQEA 1MTNC 1OWEA 1P02A 4OGXA 4CREA 1SLXB 1C5OH 1HFDA 2AERH 1GJ9B 1WCZA 2ZECA 3PROA 3D49H 3M5NA 4ISIH 1TPSA 5I25A 1UHBA 5SGAE 2ZWLH 1DUEA 1WUNH 1QIXB 1XUHA 2A1DB 4IW4E 1GHYH 3FP8E 2BLQA 1VZQH 3ENSB 3T2NA 3RXCA 2H9TH 3VB3A 2A2XH 2G8TA 2XNIA 2XTTB 1FN6A 1PJPA 2K1QA 4IN1A 2ZPRA 1YCPK 4AFZA 4ZKSU 2FX6A 1ZHRA 8GCHF 1AMHA 3SGAE 3TVJB 1YBWA 2A5KA 1T8LA 1SLUB 4ZXXH 1H8DH 1YYY1 3EYDA 5HGGA 5C5NA 4NZQA 3RC5A 2QV1A 2CHAC 4NCYA 1Y5UT 1UMAH 3SQEE 1C1VH 3QTVH 1AIXH 1T32A 1DANH 2BD4A 5DP6A 4ZHMU 2BLVA 4VGCB 4SGBE 2FI4E 1O3MA 1K22H 1P01A 2J92A 4XDEA 3BTME 1SGYE 2OQUA 2SGFE 1TPAE 1ZGIA 1TLDA 2ZG0H 4ISHH 1ESTA 1SFIA 2Z9IA 3N7OA 3RLYH 4WY3A 4ABGA 3GYLB 1T31A 1UCYK 3PMBB 1Y3YA 1LHCH 2FODA 4YZUA 1UVSH 2QXJA 5L2YH 1X7AC 4JYVH 1UCYE 4X1SU 5B6OA 1ZTKA 3FANA 1GBAA 1HYLA 4U32A 1J8AA 2ZFSA 4RN6A 3SV2H 2OC0A 1DT2A 1EJAA 2J34A 1MQ5A 4Q7YA 4AFUA 2ZGXH 3ZZDA 1AQ7A 3AW1A 1ETTH 3BEFB 1P2OA 1OS8A 3HGNA 1SOTA 1NRRH 2PWXA 2ZA5A 1GBKA 1GMCG 2A7CA 3ZZ4A 1KLTA 2ODYB 4B75A 1BDAA 4NG9H 2OUAA 1VGCC 1H9HE 1GHWH 3KQEA 1GHAF 4Q2KA 3B9FH 1BMMH 3FZDA 3MU0A 1IQNA 3A81A 3M7QA 1MU8B 2DUCA 1TABE 2SGQE 1LHEH 1WSSH 3PLBA 1AZZA 2IOTA 1GJ6A 1KLIH 1PPEE 2ZCLP 3E90B 4FUDA 2ZQ2A 2VVUA 1A1RA 1NN6A 2G81E 1D3PB 3RMOH 1CT0E 5LPEA 2QC2A 1M9UA 1YPHC 3ATIA 2I6SA 1QQUA 1F0SA 4AOQA 1ZLRA 1AGJA 4IC5A 5PTPA 1P05A 1V2ST 1V2WT 3SNBA 1O2KA 1FV9A 2H9EH 1GBLA 5A09A 1Z71A 3A85A 3SHAH 3UWIA 3QGJA 2WV5A 2ZFPH 4K1TA 1QL8A 2VJ1A 1BB0B 1DDJA 1K21H 4MNVA 1O5BB 4NFEA 4X2XA 2ZI2H 1IQKA 2ZU5A 2FZZA 2ZDMA 1N6XA 4FUEA 1UO6A 1O3CA 1EAIA 4GPGA 3DFLA 4DW2U 1HPGA 1ZYOA 3MOCA 1ELFA 1QBOA 3RXPA 5C2ZA 2D2DA 2ZZUH 1IAUA 4JZ1A 1O2GH 3ZZCA 1D6WA 2QGRA 2AGEX 1F5LA 2BDHA 7GCHG 4MNWA 3A7WA 3RXUA 1GG6B 1TA6A 2R9PA 1GHBF 5G4BA 5EG4A 1MZAA 1NFWA 3UOPA 5LPFA 2C8XB 2O8TA 1W7GH 3GY3A 1S83A 1ANDA 2UUJB 3VB7A 1BTWA 6LPRA 4JZIA 5JBCS 1JWTA 4I8KA 4NIYA 3EE0B 1FY3A 1YCPM 1GMHG 1EXFA 1MAXA 3NK8A 3GY4A 4GHTA 4A6LA 3PTNA 4CH2B 1ACBE 1AB9B 2PTCE 3DA9B 3F9GA 3PO1B 3EQ0H 4Y0YE 1ELAA 1NM6A 3KEEA 1P10A 6GCHG 1C2GA 1NPMA 2G4TA 5GXPA 1BT7A 4Y8XA 1NTPA 5HXFA 1EJMA 1NRQH 1G3EA 3KNXA 3K65B 4JZEH 3I78A 4DURA 1QB6A 1HNEE 4KELA 5C1UA 3A7ZA 1FIWA 2ZTYA 4KTUA 4OS2A 4ISNA 1O2VA 4IS5A 4GUXA 1ELBA 2XC0A 1HCGA 2ZHFH 3A8DA 3OY6U 1SFQB 2D1JA 4UFDH 4F4OC 3S7HB 3QO6A 1CT2E 2F9BH 2Y5FA 3M5MA 2ZHDA 1C5WB 1IQJA 1G36A 4QT8C 1TMUH 1GDQA 2Y7ZA 1TMBH 3TPIZ 1GJ8B 2ZDVH 4O9VA 1EX3A 1H9LB 3BG4C 4CR5A 2FTLE 1O5DH 1GJCB 1ARBA 2ZHWH 1FPHH 2R2WU 2J38A 1EPTA 2P59A 2F83A 2GKVE 1KXBA 2ASUB 2QYIA 1JOUB 2G52A 2GTBA 3BTHE 4X8UH 2PUQH 2HNTE 1D3QB 2BY9X 1AHTH 3UR6A 4AZ2B 1VGCB 1F0TA 3VGCB 1J14A 3RXQA 3KGPA 1KIGH 1IQGA 1KYNA 1O3BA 3OTJE 1C1UH 1TPOA 2FOCA 4MPXA 2F3CE 1GMHF 1KLJH 2XWAA 1G3BA 4Y10E 1HAXB 1HAGE 1TB6H 4BTIB 2OC7A 1ANBA 1ELCA 1SPJA 2V6NA 4DVAU 2ZKSA 4X8VH 2GV6A 1NESE 4D7FA 2FP7B 3RP2A 2AMDA 2BVSH 1MD7A 1V2MT 3A7VA 1YPJH 3W95A 3T25A 5A0CA 1O2ZA 5L2ZH 3MU1A 1VJ9U 1CGJE 2XW9A 4KKDA 1GJ5H 1LPGB 4LOYH 3E1XB 5H4IB 5F8XA 2VIVA 1MD8A 1K1NA 1A3EH 5ABWA 1MTUA 1DWDH 3PTBA 1MKXK 3L6PA 4XBCA 2AS9A 1F0RA 4VGCC 1MTNB 2VVVA 4JZFH 3QZQA 1CBWB 1EAUA 3Q00A 2FI5E 1UTKA 1BRAA 2OCVB 4BAMB 1EJNA 4BANB 1D3DB 1ETRH 1HAZB 1DOJA 3A7TA 1ELDE 1FMGA 1SMFE 2QA9E 3T26A 2A7HA 3A7XA 1A2CH 5EODA 1O5CB 1Q2WA 3SJKA 4Y79A 3LC5A 4WXIA 3V7TA 1W0YH 4GAWA 4K8BA 3RMLH 3S7KB 1J15A 1FAKH 2AGGX 1JXPA 1TWXB 2H9HA 3QZRA 2XBYA 2GX4A 2OLGA 1HLTH 1GVKB 5ESTE 1GBTA 3ZZ8A 5LGOA 1P8VC 4D7GA 5DJ7A 3UPEA 2A4QA 1HAPH 2P3UB 1QCPA 1NRNH 4Y7AA 1HAVA 2BD5A 2BX4A 2OTVA 1BITA 1CBWC 2WPKS 3U9AH 3BTTE 3QDZB 3D23A 1KXEA 1NT1A 4X8SH 5JB8S 5EPYA 3GISB 4B2BA 1SHYA 3P8GA 1ZRBA 1O35A 4X6NA 1ZPZA 5FCRA 3LGUA 1INCA 1O38A 2NU2E 1BJUA 1MKXH 2ANWA 2JH5D 1P2NA 2FWWA 3BG8A 2ZCHP 2W26A 1HAOH 1C5NH 1C2FA 2TGAA 3MO9A 1ZJKA 2ZPQA 3KIDU 2UUFB 1LCYA 3Q77A 2XBXA 3QLPH 2FYQA 5C1XA 3Q3XA 4JYTA 4Y71A 4ZKOU 4D8NA 1C2DA 2BY6X 3KN2A 4CRFA 1KTSB 5J4QA 2QY0B 3KHVA 1HAVB 2J2UA 1K1IA 4AYYB 1C5TA 2PUXB 3KF2A 1DWCH 3S0NA 3ZVBA 5A0BA 1OWIA 1WYKA 4YOJA 2Q6DA 1DS2E 2BD7A 1O2IA 3QN7A 1BHXB 5DKMA 1PPHE 1T8MA 2ILNA 1RIWB 1TIOA 1BBRE 1TALA 2BY8X 3KQBA 1G2MA 1SG8B 2R0LA 2GZ9A 1BBRK 1AWHB 1GHAG 3ZVCA 1G3CA 1O3OA 3BN9A 3GY5A 3PWCA 1SGCA 1A0HB 4MLFB 4YT6H 2IJOB 2LPRA 2A5IA 2AFQB 4MTBA 1NZQH 1QFKH 2B7DH 5T6GA 3PMHB 5F6MA 1QBNA 2OQ5A 1QA0A 2ANYA 3MNXA 1TRYA 3UTUH 2ZGCA 1Q3XA 2ANMH 4CRCA 3SORA 1O3LA 2W5EA 3NCLA 1N6YA 3GCHB 3TH2H 3UWJH 1C5LH 2UUYA 1VCQA 2CF9H 1F2SE 1C5XB 3SV6A 3RXGA 1QRWA 3UQOA 1XUJA 3MU5A 2WV4A 1S82A 2WINI 8GCHG 4BAHB 1TMTH 5EU8A 3FAOA 2Y82A 4F49A 1JIMA 4FUCA 1UVPA 2Q6GA 4FU7A 1QQ4A 2ODPA 2C90B 2GMTB 1ABIH 1Y8TA 4LZ1H 3FP6E 1TAWA 1Z8RA 3A8AA 3AAUA 1L1JA 1UJ1A 1V2RT 2FOHA 3E0PB 8KME2 1TGBA 2HNTC 1P2MA 4YOIA 1GJDB 1O2XA 4UFFH 2Z94A 5EW2H 4D9QA 3UQVA 1BJVA 1O31A 2ZO3H 2UWLA 3DHKH 2V3HH 1C1MA 1ZHPA 3UR9A 4ABBA 2W7UA 3AASA 1BBRH 4GVUA 2WPLS 1V2PT 1YPKH 1C2LA 4NA9H 3GY2A 3GOVB 1ZTLA 2PFEA 1AY6H 2Z7FE 4ZUHA 4AB9A 5CE1A 3WY8A 2BDAA 1YPLH 4AX9H 4OS6A 4CR9A 3ESTA 1GBJA 2Z9LA 1UVUH 5E0HA 3UNSA 3SN8A 1OP0A 3VB4A 3O8BA 5FHTA 1B7XB 1O5EH 3O8RA 1TQ0B 4FUJA 2AIPA 2ZHEH 1A5IA 4HI3A 3LPRA 4ABIA 4YOGA 3EA7A 1EATA 1SL3A 1O2MA 3A89A 1EQ9A 4CBNA 3QTOH 1Q31A 4BNRA 5DP4A 1P03A 4IMZA 4CBOA 4X2WA 1TYNA 1Y5BT 4Q7XA 3UIRA 1KXFA 2GDEH 4ZROA 2C8WB 3E0NB 1NS3A 1ORFA 2J94A 2XC4A 2C3SA 3SI4H 1FLEE 1AN1E 4SGAE 2C8YB 1YLCA 1SLWB 2PGBB 4GCHF 2OC8A 3B23B 3RM0H 1A46H 3M3TA 1EPTB 2PKSC 3U98H 4BAKB 2HGTH 2W3IA 1O2SA 2H6MA 1GI2A 1MTSA 3GY6A 4K8YA 3VB5A 2BDCA 3UREA 1SSXA 1LPKB 1S5SA 2QXGA 1F5KU 2V35A 3BTDE 3L3TA 3MI4A 3RXMA 2WUCA 3CS0A 5A0AE 2A0QB 2R3YA 2ZCKP 5EPNA 3LGTA 1G32B 5FPSA 4JK5A 1E35B 2RDLA 5J4SA 4WF8A 1LKBA 2BX3A 1Z6EA 2QXHA 4CRAA 1EOJA 2OINA 1C1RA 4LXBH 3S9CA 5I46H 4TPYA 3RXAA 3SI3H 2J95A 1TBRH 1NFXA 3ATLA 3R3GB 1ID5H 3U8TH 1PQAA 1CGIE 1GI6A 2BQ7B 2ZQ1A 3NKKA 3SJOA 4FXGH 1N8OB 4ZMAH 1UTPA 3ATKA 1S0QA 4Z0KA 2GCTC 3BSQA 5ESBA 3LIWA 1UTQA 1GHBG 3E8LA 1GBFA 1FUJA 1DLEA 1P57B 2PSYA 9LPRA 1TNKA 4MDSA 1OYTH 2QXIA 2CV3A 2AYWA 3M3SA 4DOQA 1VCWA 1SLVB 1XKBC 4JZDH 3RUOA 1TGNA 1SQTA 2P8OC 2G55A 2J4IA 2ZDKA 1NU9A 2TRMA 1P3CA 1F7ZA 1BHXF 3JZ1B 3UOUA 5C5OA 1VCPA 2J9NA 4OS7A 1S84A 1CU1A 4NFFA 1YF4A 5EXNA 4I7YH 2TGDA 1HJAC 1KXCA 5DGJA 1C2KA 3LGIA 2VIPA 1SB1H 1TE0A 1Z7KA 1C5ZB 3R0FA 1ZOMA 4X6MA 1ZTJA 4O3UA 3P8NA 3P92A 4LZ4B 1XVMA 5BPEA 1XKAC 2PR3A 4UDWH 2SGAA 1CE5A 1BRUP 2ULLA 4BXSA 4WH8A 1DFPA 3VXFH 2CXVA 4IMQA 3TK6A 2BTCE 2ZDAH 4U01A 1E0FD 1T8OA 1LVOA 2JKHA 1SQAA 2BM2A 1SGFA 1EP6A 4NGAH 1GBDA 1C2IA 2ZU4A 2BMGB 1LO6A 2OBQA 3LDXH 1V2OT 2F9UA 1AFQB 1GMCF 1G37A 2FOMB 4DIIH 2GD4B 4ABHA 1HGTH 1FIZA 2C8ZB 2AH4X 2P16A 3ZVGA 3SV9A 1AU8A 4YT7H 2XRCA 2PLXA 4MPVA 2Y6TA 1XXDA 4B2AA 2BDYA 4FU8A 4DCDA 3ZZ9A 3ZZ6A 1C2EA 1OWJA 3C1KA 2Z9GA 1BMAA 3HGPA 3OY5U 1GI3A 4Y8YA 1D3TB 1L1NA 2GP9B 4OS5A 3U1JB 3D65E 1Y3WA 1A5HA 2CHAB 3LJJA 3RC4A 2HPPH 3IWMA 4I31A 2GMTC 4YLUA 2O8MA 3W94A 1C5MD 1GBBA 1RTKA 4Z6AH 2TGTA 2BDBA 1QA7A 1QY6A 1GG6C 3PLKA 4FUIA 4I33A 1JBUH 3UFAA 2ZDNA 2ESTE 1CHGA 4UONA 2WYJA 1C5VA 1DSUA 3MYWA 1D6RA 1EASA 5A8ZA 3DD2H 3RXEA 1BMLA 3RXJA 1RIWC 1PQ5A 2NU4E 2BQWB 3E91A 7KMEH 1L2EA 3MFJA 4K60A 2PW8H 1WBGB 1NC6A 3GDUA 2ZIQH 1LKAA 7GCHF 3D62A 3U1IB 5GJ4B 3FZZA 5CHAC 1GJ7B 2ZTZA 3BG4B 1CGHA 1QL9A 1NY22 1ANCA 1AE8H 2ZFRH 3RU4T 3TJVA 1F0UA 1WQVH 3CP7A 2TIOA 4DGJA 1DSTA 1HXFH 2Z3EA 1NFYA 2G4UA 1UK4A 2JH0D 3TK9A 4UFGH 3E3TA 3T29A 4Y7BA 3LOXA 3PLPA 4AYVB 1SI5H 1A61H 4MNXA 3ZYDA 3HKJB 3LKWA 2VIOA 4ABFA 1C4V2 1TOCB 1CVWH 3SBKA 2STBE 4E7RG 2EI7A 3SOSA 3MMGA 2JETB 1V6DA 4ABEA 4IC6A 4BTTB 4I8HA 1UHBB 1T4UH 3PV4A 1TFXA 1GGDC 1B0FA 1ZZZA 1GL0E 3SJ9A 5DP9A 4AGJA 2BXTH 2WPIS 4IGDA 5C67A 1HB0B 2EEKA 3F1SB 1MCTA 1HXEH 3GCHC 3ZZ3A 3ZYEA 1C1QA 2R3UA 1V2JT 1HBTH 2ZFQH 3LC3A 2B9LA 1TX6A 2GZ8A 1Z1JA 3SUEA 4MVNA 2XCFA 4YESB 5JBTA 1DM4B 5HYOA 1HUTH 1C1TA 3SU5A 2F91A 3PMJA 4K69A 2VGCC 3M3VA 2OP9A 2ODQA 1Z8GA 4ZHAA 3K9XB 1GI1A 2P3FH 5DP7A 1GBHA 1DICA 2UUKB 2AMQA 1KDQA 4AGKA 1O3FA 1BTPA 2FOFA 1O32A 4KGAA 1RTLA 1VR1H 4FUFA 1CO7E 1W10U 2FX4A 3LU9B 2QIQA 5FBIA 1TONA 1LHFH 1THPB 1MUEB 1RTFB 2IN2A 5GIBA 1EZSC 4Q80A 2BZ6H 1U6QA 1W0ZU 2RA0A 3M61U 1HAYB 3SU1A 3V12A 1C1WH 2OXSA 1AFQC 3MTYA 2TGPZ 2EA3A 1C9PA 3F9HA 3HKIB 2ZGBH 6CHAC 1WAYB 1OX1A 3P17H 1ZRKA 1EZUC 1QGFA 1ESBA 3HPTB 4HFPB 3RXOA 3MH4A 1AD8H 2AGIX 4O03A 1OSSA 5AFZH 8ESTE 2PGQB 4A1TA 3SHCH 1IHTH 3RLWH 1C5YB 1WOFA 3MWIU 1YPMH 2ZU3A 1OOKB 2FYRA 1PYTC 4FUBA 4ISOA 3URDA 2BVRH 1TGSZ 3L33A 4OS1A 3RXLA 1G30B 2I6QA 1P9SA 1QJ7B 1QR3E 4FVDA 2V0BA 1C5SA 1J16A 2Y80A 1A0JA 3P70B 4UD9H 2NU1E 1DXWA 4X1PU 1DE7H 1C2JA 4RKJB 3P8FA 1GJBB 1ELEE 3SUDA 1VITG 3BTKE 4WJG2 3ATMA 4B73A 5EOKA 5EGMA 3TU7H 1TQ7B 3CENA 1JRSA 4B76A 2FO9A 3F68H 1SGQE 3SJ8A 4E05H 3STJA 3A86A 5HM2A 1EAWA 1THRH 2FESH 1IOEA 4ABAA 1OYQA 3HK6B 1O37A 1O2OA 4UEHH 3Q3YA 3RU4D 1QNJA 1O0DH 1BTHH 1FI8A 3BIUH 5C3NA 5GCHF 5EQQA 7ESTE 3TGKE 3F6UH 1P2JA 3GYMA 1GI4A 1XMNB 1YKTA 3SUFA 1P09A 2GVFA 2GZ7A 3BEIB 2OC1A 2O9QA 1V2LT 4NZLA 1GDUA 5CHAB 2FOEA 4R8TB 4WMEA 5JPMH 1O33A 2HPQH 5E0GA 5FPYA 1O5AB 1DLKB 1NO9H 1OKXA 1OPHB 1MKWK 2SNWA 1W14U 2GCHF 1P06A 1RD3B 1SHHB 1ZSLA 4ABDA 5IDKA 1TX8A 1E34B 2OD3B 1W7XH 2PHBA 1O2YA 5EW1H 2BHGA 1OWHA 3GCNA 1ZSJA 4GHQA 3ELAH 3IITA 5TCCA 4OGYA 2A32A 3KCGH 1FY8E 3EAJA 1P9UA 7LPRA 2FOBA 4NWKA 3P8OA 5EXLA 4DY7B 2RG3A 4TYDA 3G01A 2VWMA 2GT7A 1MBQA 2ZTXA 3GICB 3RXFA 4INHA 3A80A 3AW0A 1SGNE 3SGBE 3OSYA 1UTNA 2FXRA 3U8RH 2VB0A 1FY5A 2F9PA 1TA2A 3RXKA 2PSXA 4PROA 4X2VA 1TNLA 4B2CA 1O2LA 1UVTH 1P2IA 3RXVA 3KQCA 3NWUA 1XXFA 3LGVA 1A0LA 3QWCH 1KXAA 5C1YA 2VNTA 2VIWA 3H5CB 4DT7B 1H8IH 1P11E 1P2KA 1Y5AT 3GDSA 3URCA 1WQSA 1XVOA 3MNSA 1AKSB 2XBVA 5F8ZA 3M7TA 2XXLA 4UE7H 1O3AA 2Y7XA 1GMDG 4YTAA 3QK1A 3TNSA 4Y8ZA 2BY5X 1CHOF 1K28D 1TX7A 3ZVDA 1Y3UA 3OU0A 2Z3DA 2NU0E 1IQIA 3CS7A 2CMYA 1RRKA 2A4GA 4B71A 1ZGVA 2WPMS 2YOLA 1P2QA 3GCTG 2HNTF 2Z3CA 4A5TS 1P04A 2FMJA 3BTEE 1TBZH 5L6NH 1JMOH 1FY4A 3A83A 3SU6A 1AUJA 1TPPA 2DE8A 1O3PB 5TJXA 4D9RA 2FOGA 1WU1A 1UTOA 1KTTB 2AIQA 4WMDA 4FVBA 5DP8A 1O39A 3UY9A 2SNVA 3E16B 4X6OA 2ALVA 2W3KA 4JCNA 3RXBA 1J17T 1FXYA 1O2NA 2BYAX 5FX6A 2EC9H 2A31A 4WXVA 1K1MA 3LT3A 1S85A 1RS0A 1YP9A 1CA0C 1SGTA 1O36A
chains in the Genus database with same CATH superfamily
1C1OA 4MPUA 1QTFA 2BQ6B 2BLOA 1E36B 4J1YA 3P6ZB 4ACBA 2BZAA 3H7OA 1GI7B 4X1RU 1V2KT 3UNQA 4NWLA 1CA0B 5HM9A 4YO9A 2HLCA 2TBSA 1O2QA 2FS9A 2SGDE 3U8OH 3ZZ7A 3PB1E 3VB6A 2ANKH 1HAHH 2ZU1A 2LNCA 1BTXA 5HKKD 3LGWA 1ZMLA 3ZV9A 4BTUB 3RXRA 2VIDA 4X8TH 2BDGA 2O8UA 4AG1A 1V3XA 1SVPA 4O97A 5FXLA 1BRCE 1DY9A 2KAIB 2XOKD 3K6YA 2ZFFH 4MPWA 3UUZA 2FPZA 4YM9A 1DUAA 3K6ZA 2WZQA 1SGEE 2JETC 3ZIAD 1GI0A 1RJXB 3GCTF 5JBAS 1N8OC 1NFUA 3MNCA 2YNAA 5T3HA 5JDUB 1KXDA 3NRLA 3SO3A 1FPCH 5CMXH 1UTLM 5JB9S 1C5QA 1LDTT 3VPKA 1E1RD 1MTVA 2BXUH 1YY3A 2W7SA 1IQLA 1QHRB 2KCPA 3TJNA 2THFB 4Q7ZA 4NIWA 3TGJE 1TGCA 3EA8A 1CT4E 3ZZBA 1MCVA 1MQ6A 2AMPA 1YPEH 3LONA 1OP8A 4Z1MD 5JBBS 3O8DA 2GT8A 2G5VA 5AF9H 3PYHA 5TCAA 1K1LA 1TNGA 1C5PA 3AVZA 1BQYA 1AVXA 4MG3A 5GWZA 3P95A 4AG2A 3TGIE 3QX5H 1C4U2 3A8CA 1HIAB 1HJ9A 1QBVH 1XUKA 2P93A 3S69A 1C5RA 1EPTC 2B5TB 3GY8A 2B0FA 4ZKNU 2A4RA 1SGDE 4XSKU 2HLDD 2HOBA 5EJLA 1NROH 1TBQH 1SGIB 2Q1JA 2VH0A 1HAIH 5FAHA 3SW2B 1GBCA 2BD2A 6CHAB 1O2JA 4WH6A 3KL6A 2XYAA 2ZC9H 1AE5A 2FS8A 1BTUA 1GVZA 3RXHA 3SUGA 4DJZB 5K7RA 2VWLA 3AAVA 2EI6A 2FEQH 3SJIA 1FQ3A 3FKSD 1DY8A 1O5FH 1XM1A 3N7EA 3LH1A 1GWAA 2PP6A 2QCYA 4WVPE 3TJOA 2A5AA 1V2TT 4Y0ZE 3ODFA 4CH8B 1V2UT 2NU3E 1QJ6B 1BZXE 5F8TA 4LK4A 4BOHA 5T6DA 1HV7A 1H9IE 3ATWA 1WV7H 4AN7A 5E0JA 3FP7E 4NIVA 3STIA 4XOJA 3GDVA 3M36A 1IQHA 1FDPA 1ELTA 2KCOA 3LGYA 3RXTA 4A92A 3BV9B 2CN0H 1QB1A 2VINA 3QGNB 1E38B 2GJGA 1MAYA 4M7GA 3F9EA 3I77A 4UFEH 1G2LA 1KSNA 3SQHE 2QF0A 3SU4A 3MU8A 1GPZA 1WTHD 4RT0A 4H42U 5F03A 4CHAC 2FLBH 5DP5A 4FETA 5DK1A 3K2UA 4TY7A 2BY7X 3NZIA 1OWDA 1TRMA 1NRPH 1O2UA 4TWYA 4WMFA 3MU4A 3RM2H 1HJ8A 1LVMA 1IQMA 4H4FA 2XCNA 2TPIZ 1Z6JH 3ITIA 1ZPCA 1ABJH 2F9VA 3PRBA 2P95A 2FTMA 2A7JA 3IG6B 4MNYA 1QL7A 1TRNA 3M5OA 1MKWH 3PMAB 1GGDB 2A4OA 2AEIH 5GCHG 3TH4H 2O8WA 1G3DA 4X0WU 4XBDA 3T62A 1XUGA 2V3MA 5FBEA 1HIAA 5DSFA 4K2YA 3TLOA 2VIQA 1D4PB 1MABB 4K3JA 2RDEA 1W3CA 1SBWA 1K1JA 3TH3H 4Y11E 1UTMA 2WUBA 1O34A 6GCHF 1CSOE 3T5FH 2VU8E 5FL7D 1T4VH 8LPRA 1O2WA 2Z6BD 1B0EA 1DXPA 2J98B 1O30A 1P0SH 1GHXH 1SGPE 2A45B 4WWYA 2FDAA 1C1NA 3F0PA 1O5GH 5AVDA 5A8XA 3GCOA 3AK5A 2NWNA 1Y3XA 2QF3A 1C9TA 1BUIA 3EE7A 2DE9A 1Z8IB 5DG6A 4RSPA 2F4LA 3VFEA 1Y3VA 1QRZA 3RDZA 4DG4A 4K1EA 1DWEH 1MH0A 1Z8JB 2BOKA 2FLRH 3V3MA 3V13A 4JYUH 4K1SA 5KGOA 5DPAA 3S9AA 3ZZ5A 3MH5A 2ZPSA 3RC6A 3BTGE 2KAIA 2RFKC 2QN5T 3BTWE 2KCAA 1SGFG 2ZEBA 4MQAA 2BVXH 3NUMA 1ETSH 4A1XA 1BCUH 1QZ8A 4J2YB 2HVXA 1EB2A 6ESTA 5EQSA 1P3EA 3A8BA 4KTSA 2C4FH 1QB9A 3H7TA 1RXPA 1A7SA 1GCDA 1AVGH 1ZJDA 2HALA 4O3TA 4THNH 3RU4E 1QURH 1VITH 1BIOA 2G5NA 1S6FA 1B5GH 4FUHA 2VH6A 5A2MH 4I8LA 3OX7U 3PWBA 9ESTA 2C93B 2VGCB 3SU3A 1DITH 4I8GA 1W12U 1MZDA 1ZHMA 3MO6A 1SR5C 1C2HA 1K1PA 4R0IA 3S9BA 1F5RA 1S0RA 2BDIA 2STAE 1YCPH 2ZGHA 1O3IA 4KP0A 3BF6H 2ZGJA 2RA3A 3QUMP 4E7NA 4GCHG 2GDDA 4TPIZ 2WPHS 1K9OE 2O8LA 1BA8B 2ALPA 5T6FA 3RXSA 3SZEA 2Y81A 3DUXH 1W8BH 4ZKRU 4X6PA 3RXDA 4OS4A 1GDNA 1LVBA 2CGAA 3E6PH 4YLQH 2OBOA 1S81A 4X2YA 5E2OA 1DPOA 1Y59T 4CRBA 1O3DA 2H2ZA 1AFEH 3A87A 4NA8A 1H1BA 1VITF 1TNHA 1FNIA 1OXGA 2BD9A 1CA8B 4Y6DA 3ZVAA 1MBMA 4AORA 3RMNH 4D76A 1O2HA 3BTQE 2SGPE 3ZVEA 2PKAA 2CJIA 2XWBI 1GI9B 1GHVH 1PPCE 3JZ2B 5EQRA 1S6HA 1MU6B 2QAAA 2H5CA 1T7CA 1O3EA 3A82A 4ZAEA 2BD3A 3U69H 2F9NA 4A1VA 3TK5A 4X1QU 1W2KH 1AKSA 1AUTC 1PFXC 1YLNA 1GCTC 1GBMA 5GPIB 2WYGA 1J9CH 5IYTA 3I29A 1EOLA 1F92A 5JYIA 2PV9B 2VVCA 1GI5A 4I86A 1BTYA 3PRDA 1G9IE 4CRDA 3LJOA 1HJAB 3ODDA 1XUFA 1ZR0A 1YLDA 2P8OB 5EXMA 4JK6A 1K1OA 3M5LA 1SOZA 2GGVB 2KM0A 4ZXYH 3TJUA 1UCYH 2HRVA 4HZHA 1GVLA 1PPBH 3T27A 1NU7B 2R2MB 4HGCA 5BRRE 1GCTB 4AFSA 4INKA 1EB1H 1D9IA 1O3JA 3MH6A 2GCTB 2G51A 2RCEA 2ZP0H 4GSOA 1EUFA 3SNEA 1EZQA 3PV5A 3MH7A 3A7YA 2ZDLA 1W11U 2CF8H 1MMJN 2BB4A 2ZHQH 2PKAB 4KTCA 3SV8A 1BMNH 3TIUA 1YC0A 1BOQA 1UVOA 1DVAH 1YGCH 3SZNA 2FIRH 2KFWA 1RFNA 1H4WA 4Y76A 3SGQE 3SU0A 5L30H 1O2RA 4CRGA 1PPGE 1GBEA 1O3NA 1YWUA 2EI8A 1W13U 2Z9JA 1BRBE 4TWWA 4NA7A 4HTCH 1UTJA 1CQQA 1V2QT 1IQEA 1O3GA 1PQ8A 1T8NA 3DSOA 3VEQB 1TOMH 2BLWA 4B6EA 2VWOA 4E06H 2BOHB 2UWPA 3RXIA 4XBBA 1SQOA 1QRXA 1DWBH 5C0UA 1C2MA 2M5TA 1NBME 2P3TB 3PO1C 1ZMNA 2KZ4A 2G00A 1QJ1B 4FU9A 5KECA 4XFQA 4DIHH 1LTOA 5C20A 5KEDA 5LH8A 1ELGA 3TITA 2IPHA 1KY9A 1C1SA 1EKBB 1A4WH 1ZSKA 3NXPA 2R0KA 3BEUA 1LHDH 1ESAA 1JIRA 2PTNA 4A7IB 1PPZA 3TNTA 1E79D 1PPFE 3C27B 3UB0A 2FI3E 3ZV8A 1C5UA 1SC8U 2HVYB 3O8CA 3BTFE 2FOAA 3KQDA 2ZNKH 1PQ7A 3V0XA 4GLYA 4IBLH 4AFQA 1VKYA 1LHGH 2GCHG 2VWNA 1YM0A 2P94A 5CHBA 2D26C 4BAOB 4ZH8A 4K5ZA 2A2QH 1UK3A 3M35A 2XC5A 3BIVH 3MHWU 5FPTA 1FAXA 1IQFA 1E37B 1PYTD 1YPGH 5FX5A 1L1GA 2GV7A 2F43B 3A88A 5E8EH 2ZU2A 2ZF0H 2YNBA 4X1NU 1BTZA 5DP3A 4XE4A 4RKOB 2L74A 3MO3A 3EGKH 1FJSA 1O2TA 1TNIA 1COWD 4H6SB 1K2I1 1XX9A 3FVFB 4IN2A 3SV7A 5K0HA 1RGQA 1TNJA 1L4DA 2Y5GA 4ZHLU 1THSH 1EP5A 1GJAB 1V2NT 1FY1A 2L6OA 1AO5A 1NBMD 3VXEH 3Q76A 5T1VA 1EAXA 3PM3A 2J98A 3WWFA 1LVYA 1W0JD 4U2WA 1GL1A 4ASHA 4ISLA 1FONA 1GBIA 1IHSH 3SNDA 4NSVA 2ZFTA 4INLA 1V2VT 3B8JA 4U30A 1GMDF 4FUGA 4B1TA 2WPJS 3SNCA 1ELVA 1CHOG 1OWKA 1Z1IA 1UK2A 4JMYA 2EY4C 3VGCC 1A3BH 3DFJA 1XUIA 1KDQB 1C1PA 2V3OH 3ZVFA 5AFYH 5AHGH 2HWLB 3M7UA 1UW7A 1WDIA 2XBWA 1EZXC 1P12E 3GY7A 4BAQB 1GI8B 1OP2A 3ZZAA 4I8JA 5HIZA 2SFAA 4AB8A 1LMWB 5GDSH 3T28A 2H1UA 1AB9C 3LH3A 1AZ8A 3UNRA 1MTWA 3SU2A 5LPRA 1LPZB 4I32A 5FCKA 1O3HA 1AVWA 1ARCA 4B74A 3NPSA 1NRSH 4BXWA 5HMAA 4CHAB 1N1LA 4NIXA 4ESTE 3EA9A 1C4Y2 4TY6A 1AWFH 2Y5HA 3HK3B 1BMFD 1FN8A 1VJAU 4NSYA 1DX5M 1TGTA 3Q3KA 2F9OA 3WWBA 2Q6FA 1LQDB 1O3KA 2H5DA 2Z9KA 1ANEA 5DO4H 1L4ZA 3OYPA 3DT0H 2JH6D 2UWOA 4XRNA 5A8YA 3A84A 1ZPBA 3F9FA 1HRTH 2SGEE 2D8WA 1SGRE 1A5GH 5ETXA 1O2PA 1YPHE 1ZMJA 2FM2A 3FFGA 5E2PA 3EDXB 1GHZA 1GJ4H 2BD8A 1WTGH 4H6TA 4ABJA 1AI8H 3M37A 3MNBA 3SNAA 1L0ZA 2B8OH 2PKSB 1JRTA 3HATH 1HDTH 1FZZA 3RMMH 1LQEA 1MTNC 1OWEA 1P02A 4OGXA 4CREA 1SLXB 1C5OH 1HFDA 2AERH 1GJ9B 1WCZA 2ZECA 3PROA 3D49H 3M5NA 4ISIH 1TPSA 5I25A 1UHBA 5SGAE 2ZWLH 1DUEA 1WUNH 1QIXB 1XUHA 2A1DB 4IW4E 1GHYH 3FP8E 2BLQA 1VZQH 3ENSB 3T2NA 3RXCA 2H9TH 3VB3A 2A2XH 2LELA 2G8TA 2XNIA 2XNDD 2XTTB 1FN6A 1PJPA 2K1QA 4IN1A 2ZPRA 1YCPK 4AFZA 4ZKSU 2FX6A 1ZHRA 8GCHF 1AMHA 3SGAE 3TVJB 1YBWA 2A5KA 1T8LA 1SLUB 4ZXXH 1H8DH 1YYY1 4ASUD 3EYDA 5HGGA 5EIYA 1OHHD 5C5NA 4NZQA 2WV9A 3RC5A 2QV1A 2CHAC 4NCYA 1Y5UT 1UMAH 2QE7D 3SQEE 1C1VH 3QTVH 1AIXH 1T32A 1DANH 2BD4A 5DP6A 4ZHMU 2BLVA 4VGCB 4SGBE 2FI4E 1O3MA 1K22H 2J5UA 1P01A 2J92A 4XDEA 3BTME 1SGYE 2OQUA 2SGFE 1TPAE 1ZGIA 1TLDA 2ZG0H 1WXRA 4ISHH 1ESTA 1SFIA 2Z9IA 3N7OA 3RLYH 4HG6A 4WY3A 4ABGA 3GYLB 1T31A 1UCYK 3GS9A 3PMBB 1Y3YA 1LHCH 2FODA 4YZUA 1UVSH 2QXJA 5HIYA 5L2YH 1X7AC 4JYVH 1UCYE 4X1SU 5B6OA 1ZTKA 3FANA 1GBAA 1HYLA 4U32A 1J8AA 2ZFSA 4RN6A 3SV2H 5DN6D 2OC0A 1DT2A 1EJAA 1SQRA 2J34A 1MQ5A 4Q7YA 4AFUA 2ZGXH 3ZZDA 1AQ7A 3AW1A 1ETTH 3BEFB 1P2OA 1OS8A 3HGNA 1SOTA 1NRRH 2PWXA 4RT1A 2ZA5A 1GBKA 1GMCG 2A7CA 3ZZ4A 1KLTA 2ODYB 4B75A 1BDAA 4NG9H 2OUAA 3OEHD 1VGCC 3OFND 1H9HE 1GHWH 3KQEA 1GHAF 4Q2KA 3B9FH 1BMMH 3FZDA 3MU0A 1IQNA 3A81A 3M7QA 1MU8B 2DUCA 1TABE 2SGQE 1LHEH 1WSSH 3PLBA 1AZZA 2IOTA 1GJ6A 1KLIH 1PPEE 2ZCLP 3E90B 4FUDA 2ZQ2A 2VVUA 1A1RA 1NN6A 2G81E 1D3PB 3RMOH 1CT0E 5LPEA 1SKYE 1M9UA 1YPHC 2QC2A 3ATIA 2I6SA 4YXWD 1QQUA 1F0SA 4AOQA 1ZLRA 1AGJA 4IC5A 5PTPA 1P05A 4Q4LA 1V2ST 1V2WT 3SNBA 1O2KA 1FV9A 2H9EH 1GBLA 5A09A 1Z71A 3A85A 3SHAH 3UWIA 3QGJA 2WV5A 2ZFPH 4K1TA 1QL8A 2VBCA 2VJ1A 1BB0B 1DDJA 1K21H 4MNVA 3CNRA 1O5BB 4NFEA 4X2XA 1EFRD 2K8IA 1IQKA 2ZI2H 2ZU5A 2FZZA 2IPQX 2ZDMA 1N6XA 4FUEA 1UO6A 1O3CA 1EAIA 4GPGA 3DFLA 4DW2U 1HPGA 1ZYOA 3MOCA 1ELFA 1QBOA 3RXPA 5C2ZA 2D2DA 2ZZUH 1IAUA 4JZ1A 1O2GH 3ZZCA 1D6WA 2QGRA 2AGEX 1F5LA 2BDHA 7GCHG 4MNWA 3A7WA 3RXUA 1GG6B 1TA6A 2R9PA 1GHBF 3F2FA 5G4BA 2AHME 5EG4A 2QF4A 1MZAA 1NFWA 3UOPA 5LPFA 2C8XB 2O8TA 1W7GH 3GY3A 1S83A 1ANDA 2UUJB 3VB7A 1BTWA 6LPRA 4JZIA 5JBCS 1JWTA 4I8KA 4NIYA 3EE0B 1FY3A 1YCPM 1GMHG 1EXFA 1MAXA 3NK8A 3F2GA 3GY4A 4GHTA 3PTNA 4A6LA 4CH2B 1ACBE 1AB9B 2PTCE 3DA9B 3F9GA 3PO1B 3EQ0H 4Y0YE 1ELAA 1NM6A 3KEEA 1P10A 6GCHG 1C2GA 1NPMA 2G4TA 5GXPA 1BT7A 4Y8XA 1NTPA 5HXFA 1EJMA 1NRQH 1G3EA 3KNXA 3K65B 4JZEH 3I78A 4DURA 1QB6A 1HNEE 4KELA 5C1UA 2EQNA 3A7ZA 1FIWA 2ZTYA 4KTUA 4OS2A 4ISNA 1O2VA 2KR7A 4IS5A 4GUXA 1ELBA 2XC0A 1HCGA 2ZHFH 3A8DA 3OY6U 1SFQB 2WPDD 2D1JA 4UFDH 4F4OC 3S7HB 3QO6A 1CT2E 2F9BH 2Y5FA 3M5MA 2ZHDA 1C5WB 1IQJA 3PV2A 1G36A 4QT8C 1TMUH 1GDQA 2Y7ZA 1TMBH 3TPIZ 4ACAA 1GJ8B 2ZDVH 4O9VA 1EX3A 1H9LB 3BG4C 4CR5A 2FTLE 1O5DH 1GJCB 1ARBA 5F53A 5EJZA 2ZHWH 1FPHH 2R2WU 2J38A 1EPTA 2P59A 2F83A 2GKVE 1KXBA 2ASUB 2QYIA 1JOUB 2G52A 2GTBA 3BTHE 4X8UH 2PUQH 2HNTE 1D3QB 2BY9X 1AHTH 3UR6A 4AZ2B 1VGCB 1F0TA 3VGCB 1J14A 3RXQA 3KGPA 1KIGH 1IQGA 1KYNA 1O3BA 3OTJE 3DCLA 3U28C 1C1UH 1TPOA 2FOCA 4MPXA 2F3CE 1GMHF 1KLJH 3F0OA 2XWAA 1G3BA 4Y10E 1HAXB 1HAGE 1TB6H 4BTIB 2OC7A 1ANBA 1ELCA 1SPJA 2V6NA 4DVAU 2ZKSA 4X8VH 2GV6A 1NESE 4D7FA 2FP7B 2WHXA 3RP2A 2AMDA 2BVSH 1MD7A 1V2MT 3A7VA 1YPJH 3W95A 3T25A 5A0CA 1O2ZA 5L2ZH 3MU1A 1VJ9U 1CGJE 2XW9A 4KKDA 1GJ5H 1LPGB 4LOYH 3E1XB 5H4IB 5F8XA 2VIVA 1MD8A 1K1NA 1A3EH 5ABWA 1MTUA 1DWDH 5IK2D 3PTBA 1MKXK 3L6PA 4XBCA 2AS9A 1F0RA 4VGCC 1MTNB 2VVVA 4JZFH 3QZQA 1CBWB 1EAUA 3Q00A 4XD7D 2FI5E 1UTKA 1BRAA 2OCVB 4BAMB 1EJNA 4BANB 1D3DB 1ETRH 1HAZB 1DOJA 3A7TA 1ELDE 1FMGA 1SMFE 2QA9E 3T26A 2A7HA 3A7XA 1A2CH 5EODA 1O5CB 1Q2WA 3SJKA 4Y79A 3LC5A 4WXIA 3V7TA 1W0YH 5C17A 4GAWA 4K8BA 3RMLH 3S7KB 1J15A 1FAKH 3WW7A 2AGGX 1JXPA 1TWXB 2H9HA 3QZRA 2XBYA 2GX4A 2OLGA 3KYFA 1HLTH 1GVKB 5ESTE 1GBTA 3FOAA 5B6LA 3ZZ8A 5LGOA 1P8VC 4D7GA 5DJ7A 3UPEA 2A4QA 1HAPH 2P3UB 1QCPA 1NRNH 3FO8D 4Y7AA 1HAVA 2BD5A 2BX4A 2OTVA 1BITA 1CBWC 2WPKS 3U9AH 3BTTE 3QDZB 3D23A 1KXEA 1NT1A 4X8SH 5JB8S 5EPYA 3GISB 4B2BA 1SHYA 3P8GA 1ZRBA 1O35A 4X6NA 1ZPZA 5FCRA 3LGUA 1INCA 1O38A 2NU2E 1BJUA 1MKXH 2ANWA 2JH5D 1P2NA 2FWWA 3BG8A 2ZCHP 2W26A 1HAOH 1C5NH 1C2FA 2TGAA 3MO9A 1ZJKA 2ZPQA 3OTPA 3KIDU 2UUFB 1LCYA 3Q77A 2XBXA 3QLPH 2FYQA 5C1XA 3Q3XA 4JYTA 4Y71A 4ZKOU 4D8NA 1C2DA 2BY6X 3KN2A 4CRFA 1KTSB 5J4QA 2QY0B 3KHVA 1HAVB 2J2UA 1K1IA 4AYYB 1C5TA 1K0HA 2PUXB 3KF2A 4TT3D 2W6ID 1DWCH 3S0NA 3ZVBA 5A0BA 1OWIA 1WYKA 4YOJA 2Q6DA 1DS2E 2BD7A 1O2IA 3QN7A 1BHXB 5DKMA 1PPHE 1T8MA 2ILNA 1RIWB 1TIOA 1BBRE 1TALA 2IJD1 2BY8X 3KQBA 1G2MA 1SG8B 2R0LA 2GZ9A 1BBRK 1AWHB 1GHAG 3ZVCA 4B6FA 1G3CA 1O3OA 3BN9A 3GY5A 3PWCA 1SGCA 1A0HB 3N99A 4MLFB 4YT6H 2IJOB 2LPRA 2A5IA 2AFQB 4MTBA 1NZQH 1QFKH 2B7DH 5T6GA 3PMHB 5F6MA 2KCYA 1QBNA 2KX4A 2OQ5A 1QA0A 2ANYA 3MNXA 1TRYA 3UTUH 2ZGCA 1Q3XA 2ANMH 4CRCA 3SORA 1O3LA 2W5EA 3NCLA 1N6YA 3GCHB 3TH2H 3FN8A 3UWJH 1C5LH 2UUYA 1VCQA 2CF9H 1F2SE 1C5XB 3SV6A 3RXGA 1QRWA 3UQOA 1XUJA 3MU5A 2OK5A 2WV4A 1S82A 2WINI 8GCHG 2JIZD 1TMTH 4BAHB 5EU8A 3FAOA 2Y82A 4F49A 1JIMA 4FUCA 1UVPA 2Q6GA 4FU7A 1QQ4A 2ODPA 2C90B 1H8HD 2GMTB 1ABIH 1Y8TA 4LZ1H 3FP6E 1TAWA 1Z8RA 3A8AA 3AAUA 1L1JA 1UJ1A 1V2RT 2FOHA 3E0PB 8KME2 1TGBA 2HNTC 1P2MA 4YOIA 1GJDB 1O2XA 4UFFH 2Z94A 5EW2H 4D9QA 3UQVA 1BJVA 1O31A 2ZO3H 2UWLA 3SYJA 3DHKH 2V3HH 1C1MA 1ZHPA 3UR9A 4ABBA 2W7UA 3AASA 1BBRH 4GVUA 2WPLS 2QF5A 1E1QD 1V2PT 1YPKH 4F55A 1C2LA 4NA9H 3GY2A 3GOVB 1ZTLA 2PFEA 1AY6H 2Z7FE 4ZUHA 4AB9A 5CE1A 3WY8A 2BDAA 1YPLH 4AX9H 4OS6A 4CR9A 4AC9A 3ESTA 1GBJA 2Z9LA 1UVUH 3OAAD 5E0HA 3UNSA 3SN8A 1OP0A 3VB4A 3O8BA 5FHTA 1B7XB 1O5EH 3O8RA 1TQ0B 4FUJA 2AIPA 2ZHEH 1A5IA 4HI3A 3LPRA 4ABIA 4YOGA 3EA7A 2WSSD 1EATA 1SL3A 1O2MA 3A89A 1EQ9A 4CBNA 3QTOH 1Q31A 4BNRA 5DP4A 1P03A 4IMZA 4CBOA 4X2WA 1TYNA 1Y5BT 4FOUC 4Q7XA 3UIRA 1KXFA 2GDEH 4ZROA 2C8WB 3E0NB 1NS3A 1ORFA 2J94A 2XC4A 2C3SA 3SI4H 1FLEE 1AN1E 4SGAE 2C8YB 1YLCA 1SLWB 2PGBB 4GCHF 2OC8A 3B23B 3RM0H 1A46H 3M3TA 1EPTB 2PKSC 3U98H 4BAKB 2V7QD 2HGTH 2W3IA 1O2SA 2H6MA 1GI2A 1MTSA 3GY6A 4K8YA 3VB5A 2BDCA 3UREA 1SSXA 1LPKB 1S5SA 2QXGA 1F5KU 2V35A 3BTDE 3L3TA 3MI4A 3RXMA 2WUCA 3CS0A 5A0AE 2A0QB 2R3YA 2ZCKP 5EPNA 3LGTA 1G32B 5FPSA 4JK5A 1E35B 2RDLA 5J4SA 4WF8A 1LKBA 2BX3A 1Z6EA 2QXHA 4CRAA 1EOJA 2OINA 1C1RA 4LXBH 3S9CA 5I46H 2LP6A 4TPYA 3RXAA 3SI3H 2J95A 1TBRH 1NFXA 3ATLA 3R3GB 1ID5H 3U8TH 1PQAA 1CGIE 1GI6A 3W1EA 2BQ7B 2ZQ1A 3NKKA 3SJOA 3DSGA 4FXGH 1N8OB 2YMSB 4ZMAH 1UTPA 3ATKA 1S0QA 3DSPA 2GCTC 3BSQA 5ESBA 4Z0KA 3LIWA 1UTQA 1GHBG 3E8LA 1GBFA 1FUJA 1DLEA 1P57B 2PSYA 9LPRA 1TNKA 4MDSA 1OYTH 2QXIA 2CV3A 2AYWA 3M3SA 4DOQA 1VCWA 1SLVB 1XKBC 4JZDH 3RUOA 1TGNA 1SQTA 3N7DA 2P8OC 2G55A 2J4IA 2ZDKA 1NU9A 4M9FA 2M2AA 2TRMA 1P3CA 4OM9A 1F7ZA 2CK3D 1BHXF 5C94A 3JZ1B 3UOUA 5C5OA 1VCPA 2J9NA 4OS7A 1S84A 1CU1A 4NFFA 1YF4A 5EXNA 4I7YH 2TGDA 1HJAC 1KXCA 5DGJA 1C2KA 3LGIA 2VIPA 1SB1H 1TE0A 1Z7KA 1C5ZB 3R0FA 1ZOMA 4X6MA 1ZTJA 4O3UA 3P8NA 3P92A 4LZ4B 1XVMA 5BPEA 1XKAC 3OE7D 2PR3A 4UDWH 2SGAA 1CE5A 1BRUP 2ULLA 4BXSA 4WH8A 1DFPA 3VXFH 2CXVA 4IMQA 3TK6A 2BTCE 2ZDAH 4U01A 1E0FD 1T8OA 1LVOA 2JKHA 1SQAA 2BM2A 1KMHB 1SGFA 1EP6A 4NGAH 1GBDA 1C2IA 2ZU4A 2BMGB 1LO6A 2OBQA 3LDXH 1V2OT 2F9UA 1AFQB 1GMCF 1G37A 2FOMB 4DIIH 2GD4B 4ABHA 1HGTH 1FIZA 2C8ZB 2AH4X 2P16A 3ZVGA 3F3BA 3SV9A 1AU8A 4YT7H 2XRCA 2PLXA 4MPVA 2Y6TA 1XXDA 4P00A 4B2AA 2BDYA 4FU8A 4DCDA 3ZZ9A 3ZZ6A 1C2EA 1OWJA 3C1KA 2Z9GA 1BMAA 3HGPA 3MQKC 3OY5U 1GI3A 4Y8YA 1D3TB 1L1NA 2GP9B 4OS5A 3U1JB 3D65E 1Y3WA 1A5HA 2CHAB 3LJJA 3RC4A 2HPPH 3IWMA 4I31A 2GMTC 4YLUA 2O8MA 3W94A 1C5MD 1GBBA 1RTKA 4Z6AH 2TGTA 2BDBA 1QA7A 1QY6A 1GG6C 3PLKA 4FUIA 4I33A 1JBUH 3UFAA 2ZDNA 2ESTE 3UAIC 1CHGA 4UONA 2WYJA 1C5VA 1DSUA 3MYWA 1D6RA 1EASA 5A8ZA 3DD2H 3RXEA 1BMLA 3RXJA 1RIWC 1PQ5A 2NU4E 2BQWB 3E91A 7KMEH 1L2EA 3MFJA 4K60A 2PW8H 1WBGB 1NC6A 3GDUA 2ZIQH 1LKAA 4DT4A 7GCHF 3D62A 3U1IB 5GJ4B 3FZZA 5CHAC 1GJ7B 2ZTZA 3BG4B 5EJ1A 1CGHA 1QL9A 1NY22 1ANCA 1AE8H 2ZFRH 3RU4T 3TJVA 1F0UA 1WQVH 3CP7A 2TIOA 4DGJA 1DSTA 1HXFH 2Z3EA 1NFYA 2G4UA 1UK4A 2JH0D 3TK9A 4UFGH 3E3TA 3T29A 4Y7BA 3LOXA 3PLPA 4AYVB 1SI5H 1A61H 4MNXA 3ZYDA 3HKJB 3LKWA 2VIOA 4ABFA 1C4V2 1TOCB 1CVWH 3SBKA 2STBE 4E7RG 2EI7A 3SOSA 3MMGA 2JETB 1V6DA 4ABEA 4IC6A 4BTTB 4I8HA 1UHBB 1T4UH 3PV4A 1TFXA 1GGDC 1B0FA 1ZZZA 1GL0E 2J97A 3SJ9A 5DP9A 4AGJA 2BXTH 2WPIS 4IGDA 5C67A 1HB0B 2EEKA 3F1SB 1MCTA 1HXEH 3GCHC 4ZCNA 3ZZ3A 3ZYEA 1C1QA 2R3UA 1V2JT 1HBTH 2ZFQH 3LC3A 2B9LA 1TX6A 2GZ8A 5C0TA 1Z1JA 3SUEA 4MVNA 2XCFA 4YESB 1W0KD 5JBTA 1DM4B 5HYOA 1HUTH 1C1TA 3SU5A 2F91A 3PMJA 4K69A 2VGCC 3M3VA 2OP9A 2ODQA 1Z8GA 4ZHAA 3K9XB 3OEED 1GI1A 2P3FH 5DP7A 1GBHA 1DICA 2UUKB 2AMQA 1KDQA 4AGKA 1O3FA 1BTPA 2FOFA 1O32A 4KGAA 1RTLA 1VR1H 4FUFA 1CO7E 1W10U 2FX4A 3LU9B 2QIQA 5FBIA 1TONA 1LHFH 1THPB 1MUEB 1RTFB 2IN2A 5GIBA 1EZSC 4Q80A 2BZ6H 1U6QA 1W0ZU 2RA0A 3M61U 1HAYB 3SU1A 3V12A 1C1WH 2OXSA 1AFQC 3MTYA 2TGPZ 2EA3A 1C9PA 3F9HA 4Q63A 3HKIB 1FX0B 2ZGBH 6CHAC 4F48B 1WAYB 1OX1A 3P17H 1ZRKA 1EZUC 1QGFA 1ESBA 3HPTB 4HFPB 2W6JD 3MH4A 3RXOA 1AD8H 3F2HA 2AGIX 4O03A 1OSSA 5AFZH 8ESTE 2PGQB 4A1TA 3SHCH 1IHTH 3RLWH 1C5YB 1WOFA 3MWIU 1YPMH 2ZU3A 1S6LA 1OOKB 2FYRA 1PYTC 4FUBA 4ISOA 3URDA 2BVRH 1TGSZ 3L33A 4OS1A 3RXLA 1G30B 2JJ2D 2I6QA 1P9SA 1QJ7B 1QR3E 4FVDA 2V0BA 1C5SA 1J16A 2Y80A 1A0JA 3P70B 4UD9H 2NU1E 1DXWA 4X1PU 1DE7H 1C2JA 4RKJB 3P8FA 1GJBB 1ELEE 3SUDA 1VITG 3BTKE 4WJG2 4TSFD 2YMSC 3ATMA 4B73A 5EOKA 5EGMA 3TU7H 1TQ7B 3CENA 1JRSA 4B76A 2FO9A 1H8ED 1SGQE 3F68H 4P02A 3SJ8A 4E05H 3STJA 3A86A 5HM2A 1EAWA 1THRH 2FESH 1IOEA 4ABAA 1OYQA 3HK6B 1O37A 1O2OA 4UEHH 3Q3YA 3RU4D 1QNJA 1O0DH 1BTHH 1FI8A 3BIUH 5C3NA 5GCHF 5EQQA 7ESTE 3TGKE 3F6UH 1P2JA 5CDFE 3GYMA 1GI4A 1XMNB 1YKTA 3SUFA 1P09A 2GVFA 2GZ7A 3BEIB 2OC1A 2O9QA 1V2LT 4NZLA 1GDUA 5CHAB 2FOEA 4R8TB 4WMEA 5JPMH 1O33A 2HPQH 5E0GA 5FPYA 1O5AB 1DLKB 1NO9H 1OKXA 3KYGA 1OPHB 2JDID 1MKWK 2SNWA 1W14U 2GCHF 1P06A 1RD3B 1SHHB 1ZSLA 4ABDA 5IDKA 1TX8A 1E34B 2OD3B 1W7XH 2PHBA 1O2YA 5EW1H 2BHGA 1OWHA 3GCNA 1ZSJA 2K0QA 4GHQA 3ELAH 3IITA 5TCCA 4OGYA 2A32A 3KCGH 1FY8E 3EAJA 1P9UA 7LPRA 2FOBA 3H09A 4NWKA 3P8OA 5EXLA 4DY7B 2RG3A 4TYDA 3G01A 2VWMA 2GT7A 1MBQA 2ZTXA 3GICB 3RXFA 4INHA 3A80A 3AW0A 1SGNE 3SGBE 3OSYA 1UTNA 2FXRA 3U8RH 2VB0A 1FY5A 2F9PA 1TA2A 3RXKA 2PSXA 4PROA 4X2VA 1TNLA 4B2CA 1O2LA 1UVTH 1P2IA 3RXVA 3KQCA 3NWUA 1XXFA 3LGVA 1A0LA 3QWCH 1KXAA 5C1YA 2VNTA 2VIWA 3H5CB 4DT7B 1H8IH 1P11E 1P2KA 1Y5AT 3GDSA 4RI0A 1WQSA 3URCA 1XVOA 3MNSA 1AKSB 2XBVA 5F8ZA 3M7TA 2JJ1D 2XXLA 4UE7H 1O3AA 2Y7XA 5GNDA 1GMDG 4YTAA 3QK1A 3TNSA 4Y8ZA 2BY5X 1CHOF 1K28D 1TX7A 3ZVDA 1Y3UA 3OU0A 2Z3DA 2NU0E 1IQIA 3CS7A 2CMYA 1RRKA 2A4GA 4B71A 1ZGVA 2WPMS 2YOLA 3VG8A 1P2QA 3GCTG 2HNTF 2Z3CA 4A5TS 1P04A 2FMJA 3BTEE 1TBZH 5L6NH 1JMOH 1FY4A 3A83A 3SU6A 1AUJA 1TPPA 2DE8A 1O3PB 5TJXA 4D9RA 2FOGA 1WU1A 1UTOA 1KTTB 2AIQA 4WMDA 4FVBA 5DP8A 1O39A 3UY9A 2SNVA 3KQ5A 3E16B 2YMSD 4X6OA 2ALVA 2W3KA 4JCNA 3RXBA 1J17T 1FXYA 1O2NA 2BYAX 5FX6A 2EC9H 2A31A 4WXVA 1K1MA 3LT3A 1S85A 1RS0A 1YP9A 1CA0C 1SGTA 1O36A
chains in the Genus database with same CATH topology
1C1OA 4MPUA 1QTFA 2BQ6B 2BLOA 1E36B 4J1YA 3P6ZB 2BZAA 3H7OA 1GI7B 4X1RU 1V2KT 3UNQA 4NWLA 1CA0B 5HM9A 4YO9A 2HLCA 2TBSA 1O2QA 2FS9A 2SGDE 3U8OH 3ZZ7A 3PB1E 3VB6A 2ANKH 1HAHH 2ZU1A 2LNCA 1BTXA 3LGWA 1ZMLA 3ZV9A 4BTUB 3RXRA 2VIDA 4X8TH 2BDGA 2O8UA 4AG1A 1V3XA 1SVPA 4O97A 5FXLA 1BRCE 1DY9A 2KAIB 3K6YA 2ZFFH 4MPWA 3UUZA 2FPZA 4YM9A 1DUAA 3K6ZA 1SGEE 2JETC 1GI0A 1RJXB 3GCTF 5JBAS 1N8OC 1NFUA 3MNCA 2YNAA 5T3HA 5JDUB 1KXDA 3SO3A 1FPCH 5CMXH 1UTLM 5JB9S 1C5QA 1LDTT 3VPKA 1MTVA 2BXUH 2W7SA 1IQLA 1QHRB 3TJNA 2THFB 4Q7ZA 4NIWA 3TGJE 1TGCA 3EA8A 1CT4E 3ZZBA 1MCVA 1MQ6A 2AMPA 1YPEH 3LONA 1OP8A 5JBBS 3O8DA 2GT8A 2G5VA 5AF9H 3PYHA 5TCAA 1K1LA 1TNGA 1C5PA 3AVZA 1BQYA 1AVXA 4MG3A 5GWZA 3P95A 4AG2A 3TGIE 3QX5H 1C4U2 3A8CA 1HIAB 1HJ9A 1QBVH 1XUKA 2P93A 3S69A 1C5RA 1EPTC 2B5TB 3GY8A 2B0FA 4ZKNU 2A4RA 1SGDE 4XSKU 2HOBA 1NROH 1TBQH 1SGIB 2Q1JA 2VH0A 1HAIH 5FAHA 3SW2B 1GBCA 2BD2A 6CHAB 1O2JA 4WH6A 3KL6A 2XYAA 2ZC9H 1AE5A 2FS8A 1BTUA 1GVZA 3RXHA 3SUGA 4DJZB 5K7RA 2VWLA 3AAVA 2EI6A 2FEQH 3SJIA 1FQ3A 1DY8A 1O5FH 1XM1A 3LH1A 1GWAA 2QCYA 4WVPE 3TJOA 4CH8B 2A5AA 1V2TT 4Y0ZE 3ODFA 1V2UT 2NU3E 1QJ6B 1BZXE 5F8TA 4LK4A 4BOHA 5T6DA 1HV7A 1H9IE 3ATWA 1WV7H 4AN7A 5E0JA 3FP7E 4NIVA 3STIA 4XOJA 3GDVA 3M36A 1IQHA 1FDPA 1ELTA 3LGYA 3RXTA 4A92A 3BV9B 2CN0H 1QB1A 2VINA 3QGNB 1E38B 1MAYA 4M7GA 3F9EA 3I77A 4UFEH 1G2LA 1KSNA 3SQHE 2QF0A 3SU4A 3MU8A 1GPZA 1WTHD 4H42U 5F03A 4CHAC 2FLBH 5DP5A 5DK1A 3K2UA 4TY7A 2BY7X 3NZIA 1OWDA 1TRMA 1NRPH 1O2UA 4TWYA 4WMFA 3MU4A 3RM2H 1HJ8A 1LVMA 1IQMA 4H4FA 2XCNA 2TPIZ 1Z6JH 3ITIA 1ZPCA 1ABJH 2F9VA 2P95A 2FTMA 2A7JA 3IG6B 4MNYA 1QL7A 1TRNA 3M5OA 1MKWH 3PMAB 1GGDB 2A4OA 2AEIH 5GCHG 3TH4H 2O8WA 1G3DA 4X0WU 4XBDA 3T62A 1XUGA 5FBEA 1HIAA 4K2YA 3TLOA 2VIQA 1D4PB 4K3JA 1W3CA 1SBWA 1K1JA 3TH3H 4Y11E 1UTMA 2WUBA 1O34A 6GCHF 1CSOE 3T5FH 2VU8E 1T4VH 8LPRA 1O2WA 2Z6BD 1B0EA 1DXPA 1O30A 1P0SH 1GHXH 1SGPE 2A45B 4WWYA 2FDAA 1C1NA 5A8XA 1O5GH 5AVDA 3GCOA 2NWNA 1Y3XA 2QF3A 1C9TA 1BUIA 2DE9A 1Z8IB 5DG6A 4RSPA 3VFEA 1Y3VA 1QRZA 3RDZA 4DG4A 4K1EA 1DWEH 1MH0A 1Z8JB 2BOKA 2FLRH 3V3MA 3V13A 4JYUH 4K1SA 5DPAA 3S9AA 3ZZ5A 3MH5A 2ZPSA 3RC6A 3BTGE 2KAIA 2QN5T 3BTWE 4MQAA 1SGFG 2ZEBA 2BVXH 3NUMA 1ETSH 4A1XA 1BCUH 4J2YB 2HVXA 1EB2A 6ESTA 5EQSA 1P3EA 3A8BA 4KTSA 2C4FH 1QB9A 3H7TA 1RXPA 1A7SA 1GCDA 1AVGH 1ZJDA 2HALA 4O3TA 4THNH 3RU4E 1QURH 1VITH 1BIOA 2G5NA 1S6FA 1B5GH 4FUHA 2VH6A 5A2MH 4I8LA 3OX7U 3PWBA 9ESTA 2C93B 2VGCB 3SU3A 1DITH 4I8GA 1W12U 1MZDA 1ZHMA 3MO6A 1SR5C 1C2HA 1K1PA 4R0IA 3S9BA 1F5RA 1S0RA 2BDIA 2STAE 1YCPH 2ZGHA 1O3IA 4KP0A 3BF6H 2ZGJA 2RA3A 3QUMP 4E7NA 4GCHG 2GDDA 4TPIZ 2WPHS 1K9OE 2O8LA 1BA8B 2ALPA 5T6FA 3RXSA 2Y81A 3DUXH 1W8BH 4ZKRU 4X6PA 3RXDA 4OS4A 1GDNA 1LVBA 2CGAA 3E6PH 4YLQH 2OBOA 1S81A 4X2YA 5E2OA 1DPOA 1Y59T 4CRBA 1O3DA 2H2ZA 1AFEH 3A87A 4NA8A 1H1BA 1VITF 1TNHA 1FNIA 1OXGA 2BD9A 1CA8B 4Y6DA 3ZVAA 1MBMA 4AORA 3RMNH 4D76A 1O2HA 3BTQE 2SGPE 3ZVEA 2PKAA 2CJIA 2XWBI 1GI9B 1GHVH 1PPCE 3JZ2B 5EQRA 1S6HA 1MU6B 2QAAA 2H5CA 1T7CA 1O3EA 3A82A 4ZAEA 2BD3A 3U69H 2F9NA 4A1VA 3TK5A 4X1QU 1W2KH 1AKSA 1AUTC 1PFXC 1GCTC 1GBMA 5GPIB 2WYGA 1J9CH 5IYTA 3I29A 1EOLA 1F92A 5JYIA 2PV9B 2VVCA 1GI5A 1BTYA 1G9IE 4CRDA 3LJOA 1HJAB 3ODDA 1XUFA 1ZR0A 1YLDA 2P8OB 5EXMA 4JK6A 1K1OA 3M5LA 1SOZA 2GGVB 4ZXYH 3TJUA 1UCYH 2HRVA 4HZHA 1GVLA 1PPBH 3T27A 1NU7B 2R2MB 4HGCA 5BRRE 1GCTB 4AFSA 4INKA 1EB1H 1D9IA 1O3JA 3MH6A 2GCTB 2G51A 2RCEA 2ZP0H 4GSOA 1EUFA 3SNEA 1EZQA 3MH7A 3A7YA 2ZDLA 1W11U 2CF8H 1MMJN 2BB4A 2ZHQH 2PKAB 4KTCA 3SV8A 1BMNH 3TIUA 1YC0A 1BOQA 1UVOA 1DVAH 1YGCH 3SZNA 2FIRH 1RFNA 1H4WA 4Y76A 3SGQE 3SU0A 5L30H 1O2RA 4CRGA 1PPGE 1GBEA 1O3NA 2Z9JA 2EI8A 1W13U 1BRBE 4TWWA 4NA7A 4HTCH 1UTJA 1CQQA 1V2QT 1IQEA 1O3GA 1PQ8A 1T8NA 3VEQB 1TOMH 2BLWA 2VWOA 4E06H 2BOHB 2UWPA 3RXIA 4XBBA 1SQOA 1QRXA 1DWBH 1C2MA 2M5TA 2P3TB 3PO1C 1ZMNA 4FU9A 2G00A 1QJ1B 4XFQA 4DIHH 1LTOA 5C20A 5LH8A 1ELGA 3TITA 2IPHA 1KY9A 1C1SA 1EKBB 1A4WH 1ZSKA 3NXPA 2R0KA 3BEUA 1LHDH 1ESAA 1JIRA 2PTNA 4A7IB 1PPZA 3TNTA 1PPFE 3C27B 2FI3E 3ZV8A 1C5UA 1SC8U 3O8CA 3BTFE 2FOAA 3KQDA 2ZNKH 1PQ7A 3V0XA 4GLYA 4IBLH 4AFQA 1LHGH 2GCHG 2VWNA 1YM0A 2P94A 2D26C 4BAOB 4ZH8A 4K5ZA 2A2QH 1UK3A 3M35A 2XC5A 3BIVH 3MHWU 5FPTA 1FAXA 1IQFA 1E37B 1PYTD 1YPGH 5FX5A 1L1GA 2GV7A 3A88A 5E8EH 2ZU2A 2ZF0H 2YNBA 4X1NU 1BTZA 5DP3A 4XE4A 4RKOB 3MO3A 3EGKH 1FJSA 1O2TA 1TNIA 4H6SB 1K2I1 1XX9A 3FVFB 4IN2A 3SV7A 5K0HA 1RGQA 1TNJA 1L4DA 2Y5GA 4ZHLU 1THSH 1EP5A 1GJAB 1V2NT 1FY1A 1AO5A 3VXEH 3Q76A 1EAXA 3PM3A 1LVYA 4U2WA 1GL1A 4ASHA 4ISLA 1FONA 1GBIA 1IHSH 3SNDA 4NSVA 2ZFTA 4INLA 1V2VT 3B8JA 4U30A 1GMDF 4FUGA 4B1TA 2WPJS 3SNCA 1ELVA 1CHOG 1OWKA 1Z1IA 1UK2A 4JMYA 3VGCC 1A3BH 3DFJA 1XUIA 1KDQB 1C1PA 2V3OH 3ZVFA 5AFYH 5AHGH 2HWLB 3M7UA 2XBWA 1EZXC 1P12E 3GY7A 4BAQB 1GI8B 1OP2A 3ZZAA 4I8JA 2SFAA 4AB8A 1LMWB 5GDSH 3T28A 2H1UA 1AB9C 3LH3A 1AZ8A 3UNRA 1MTWA 3SU2A 5LPRA 1LPZB 4I32A 5FCKA 1O3HA 1AVWA 1ARCA 4B74A 3NPSA 1NRSH 4BXWA 5HMAA 4CHAB 1N1LA 4NIXA 4ESTE 3EA9A 1C4Y2 4TY6A 1AWFH 2Y5HA 3HK3B 1FN8A 1VJAU 4NSYA 1DX5M 1TGTA 3Q3KA 2F9OA 2Q6FA 1LQDB 1O3KA 2H5DA 2Z9KA 1ANEA 5DO4H 1L4ZA 3OYPA 3DT0H 2JH6D 2UWOA 5A8YA 3A84A 1ZPBA 3F9FA 1HRTH 2SGEE 2D8WA 1SGRE 1A5GH 5ETXA 1O2PA 1YPHE 1ZMJA 2FM2A 3FFGA 5E2PA 3EDXB 1GHZA 1GJ4H 2BD8A 1WTGH 4H6TA 4ABJA 1AI8H 3M37A 3MNBA 3SNAA 1L0ZA 2B8OH 2PKSB 1JRTA 3HATH 1HDTH 1FZZA 3RMMH 1LQEA 1MTNC 1OWEA 1P02A 4OGXA 4CREA 1SLXB 1C5OH 1HFDA 2AERH 1GJ9B 1WCZA 2ZECA 3PROA 3D49H 3M5NA 4ISIH 1TPSA 5I25A 1UHBA 5SGAE 2ZWLH 1DUEA 1WUNH 1QIXB 1XUHA 2A1DB 4IW4E 1GHYH 3FP8E 2BLQA 1VZQH 3ENSB 3T2NA 3RXCA 2H9TH 3VB3A 2A2XH 2G8TA 2XNIA 2XTTB 1FN6A 1PJPA 2K1QA 4IN1A 2ZPRA 1YCPK 4AFZA 4ZKSU 2FX6A 1ZHRA 8GCHF 1AMHA 3SGAE 3TVJB 1YBWA 2A5KA 1T8LA 1SLUB 4ZXXH 1H8DH 1YYY1 3EYDA 5HGGA 5C5NA 4NZQA 3RC5A 2QV1A 2CHAC 4NCYA 1Y5UT 1UMAH 3SQEE 1C1VH 3QTVH 1AIXH 1T32A 1DANH 2BD4A 5DP6A 4ZHMU 2BLVA 4VGCB 4SGBE 2FI4E 1O3MA 1K22H 1P01A 2J92A 4XDEA 3BTME 1SGYE 2OQUA 2SGFE 1TPAE 1ZGIA 1TLDA 2ZG0H 4ISHH 1ESTA 1SFIA 2Z9IA 3N7OA 3RLYH 4WY3A 4ABGA 3GYLB 1T31A 1UCYK 3PMBB 1Y3YA 1LHCH 2FODA 4YZUA 1UVSH 2QXJA 5L2YH 1X7AC 4JYVH 1UCYE 4X1SU 5B6OA 1ZTKA 3FANA 1GBAA 1HYLA 4U32A 1J8AA 2ZFSA 4RN6A 3SV2H 2OC0A 1DT2A 1EJAA 2J34A 1MQ5A 4Q7YA 4AFUA 2ZGXH 3ZZDA 1AQ7A 3AW1A 1ETTH 3BEFB 1P2OA 1OS8A 3HGNA 1SOTA 1NRRH 2PWXA 2ZA5A 1GBKA 1GMCG 2A7CA 3ZZ4A 1KLTA 2ODYB 4B75A 1BDAA 4NG9H 2OUAA 1VGCC 1H9HE 1GHWH 3KQEA 1GHAF 4Q2KA 3B9FH 1BMMH 3FZDA 3MU0A 1IQNA 3A81A 3M7QA 1MU8B 2DUCA 1TABE 2SGQE 1LHEH 1WSSH 3PLBA 1AZZA 2IOTA 1GJ6A 1KLIH 1PPEE 2ZCLP 3E90B 4FUDA 2ZQ2A 2VVUA 1A1RA 1NN6A 2G81E 1D3PB 3RMOH 1CT0E 5LPEA 2QC2A 1M9UA 1YPHC 3ATIA 2I6SA 1QQUA 1F0SA 4AOQA 1ZLRA 1AGJA 4IC5A 5PTPA 1P05A 1V2ST 1V2WT 3SNBA 1O2KA 1FV9A 2H9EH 1GBLA 5A09A 1Z71A 3A85A 3SHAH 3UWIA 3QGJA 2WV5A 2ZFPH 4K1TA 1QL8A 2VJ1A 1BB0B 1DDJA 1K21H 4MNVA 1O5BB 4NFEA 4X2XA 2ZI2H 1IQKA 2ZU5A 2FZZA 2ZDMA 1N6XA 4FUEA 1UO6A 1O3CA 1EAIA 4GPGA 3DFLA 4DW2U 1HPGA 1ZYOA 3MOCA 1ELFA 1QBOA 3RXPA 5C2ZA 2D2DA 2ZZUH 1IAUA 4JZ1A 1O2GH 3ZZCA 1D6WA 2QGRA 2AGEX 1F5LA 2BDHA 7GCHG 4MNWA 3A7WA 3RXUA 1GG6B 1TA6A 2R9PA 1GHBF 5G4BA 5EG4A 1MZAA 1NFWA 3UOPA 5LPFA 2C8XB 2O8TA 1W7GH 3GY3A 1S83A 1ANDA 2UUJB 3VB7A 1BTWA 6LPRA 4JZIA 5JBCS 1JWTA 4I8KA 4NIYA 3EE0B 1FY3A 1YCPM 1GMHG 1EXFA 1MAXA 3NK8A 3GY4A 4GHTA 4A6LA 3PTNA 4CH2B 1ACBE 1AB9B 2PTCE 3DA9B 3F9GA 3PO1B 3EQ0H 4Y0YE 1ELAA 1NM6A 3KEEA 1P10A 6GCHG 1C2GA 1NPMA 2G4TA 5GXPA 1BT7A 4Y8XA 1NTPA 5HXFA 1EJMA 1NRQH 1G3EA 3KNXA 3K65B 4JZEH 3I78A 4DURA 1QB6A 1HNEE 4KELA 5C1UA 3A7ZA 1FIWA 2ZTYA 4KTUA 4OS2A 4ISNA 1O2VA 4IS5A 4GUXA 1ELBA 2XC0A 1HCGA 2ZHFH 3A8DA 3OY6U 1SFQB 2D1JA 4UFDH 4F4OC 3S7HB 3QO6A 1CT2E 2F9BH 2Y5FA 3M5MA 2ZHDA 1C5WB 1IQJA 1G36A 4QT8C 1TMUH 1GDQA 2Y7ZA 1TMBH 3TPIZ 1GJ8B 2ZDVH 4O9VA 1EX3A 1H9LB 3BG4C 4CR5A 2FTLE 1O5DH 1GJCB 1ARBA 2ZHWH 1FPHH 2R2WU 2J38A 1EPTA 2P59A 2F83A 2GKVE 1KXBA 2ASUB 2QYIA 1JOUB 2G52A 2GTBA 3BTHE 4X8UH