4NFEA

Human kallikrein-related peptidase 2 in complex with benzamidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
227
Chain Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-2
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 227
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA01
3CS7A 1UTNA 3VB4A 1ZJKA 1GJ6A 4HFPB 2P8OB 4OS5A 2ZDMA 1GBKA 4FUDA 2J92A 3GYMA 4KGAA 1ZGVA 1JXPA 1J15A 2HOBA 1A5GH 1BOQA 3UWIA 2FZZA 4KKDA 1GJ5H 1Z8JB 2QXJA 2HWLB 1UK4A 3A83A 1UO6A 1CVWH 1O2VA 5C5NA 1OWEA 2QGRA 1NM6A 1SQTA 2Y6TA 2BQ6B 1GHXH 2P3UB 2ZZUH 3T25A 1PQ5A 2RG3A 4U32A 5EXNA 3RU4E 1O35A 2GCHF 2R3YA 1A3BH 2ZGCA 4I33A 3TNSA 2F83A 1AKSB 3RLYH 1PQAA 3SGBE 4UEHH 1TGSZ 4UD9H 4JMYA 1JBUH 2H9HA 1B0FA 1F92A 1FN8A 1QCPA 1TX6A 3HKJB 3O8RA 2ZHWH 4NFEA 1SGFG 1GL0E 2GT8A 3ZZ7A 1CA8B 4WXVA 2LPRA 1HAIH 4UFGH 3QDZB 4DCDA 3UQVA 3MHWU 1IAUA 4DY7B 3EQ0H 3SO3A 1DWEH 3OTJE 2C93B 2AMQA 1QY6A 4GVUA 1TFXA 2BLOA 2JKHA 3UREA 3UFAA 1PPBH 5DP8A 3PO1B 5FAHA 3AAVA 2J94A 4H4FA 1TGBA 3STIA 2A4RA 5C1YA 2PTNA 1AFEH 2ZDNA 2DE9A 1T8NA 2OC0A 1ZOMA 2OBQA 4O9VA 1WUNH 1SLUB 1ZPBA 1V2JT 2J38A 2B9LA 4I8GA 1PPFE 5F8ZA 3S9AA 2G51A 1J14A 1BJVA 2GGVB 5FX6A 2FOBA 3KEEA 1NRPH 1C2LA 2W3KA 1L1NA 1MQ5A 1LPZB 3MO9A 1CBWB 1MKXK 4D9RA 1C5RA 3SV7A 1CU1A 2NU2E 4Y7AA 3GY4A 1LVBA 2I6QA 1GVKB 3NWUA 5JDUB 1VCWA 2AS9A 4BOHA 1BRAA 2FI4E 4AB9A 5LPRA 2G5NA 1DWDH 1ESAA 1P12E 2WPLS 2ZPSA 1V2QT 2HNTC 1K1LA 1DLEA 4Y8XA 4WXIA 7LPRA 1FZZA 1TLDA 2WPIS 2SGPE 4MPXA 2FP7B 2V6NA 3DUXH 2F9BH 4Q7XA 4NIYA 4RKJB 1IHTH 1FIWA 1WOFA 3RXSA 3A87A 4FUBA 1DLKB 5E0HA 3T5FH 1LCYA 1SMFE 2VH6A 4FVBA 3UPEA 3DA9B 4UFEH 3M35A 5TCAA 2A5KA 1P8VC 1SL3A 1NFYA 1RS0A 1P2MA 1HAOH 2R0LA 3Q00A 4DG4A 1O0DH 1FONA 1C1MA 1C5TA 1O3NA 2THFB 3P70B 3V7TA 1KY9A 4O03A 3ZVEA 1XXDA 1Z6JH 4K8YA 2ILNA 1O2GH 2BDBA 1CT0E 1GMCF 5T3HA 1QHRB 1MTUA 2TRMA 1AI8H 1BA8B 1GDQA 1D3TB 1RTLA 2JH5D 2V3OH 4A92A 1VJ9U 1C2IA 1XUHA 1ETRH 2HALA 3MH5A 1A5HA 1A2CH 1BRBE 1C2JA 1GMDG 1BTXA 1GVLA 2ZU2A 3HGPA 1ZR0A 5A8ZA 2BD9A 4JK6A 1YM0A 2OBOA 1ELFA 4OS1A 1GWAA 1K1MA 3VGCB 1AKSA 1IQKA 2P3TB 3EE0B 2F91A 2C8XB 1HIAB 1TWXB 1TMTH 4ABIA 2XBXA 1KTTB 1L4DA 4Y0ZE 4CRBA 4WMEA 2QV1A 4FUCA 1EJAA 4WJG2 1VJAU 2FXRA 1ZRBA 1N8OB 4I8KA 4ZROA 2OINA 2WV4A 1GHVH 4E06H 2AMPA 2ZTYA 4X6OA 2VIOA 4O3UA 1Z8GA 3K9XB 1SHYA 1C5MD 2NU1E 2ZU3A 1THPB 4Q2KA 3BEIB 4H42U 4U2WA 4Y11E 5AHGH 4SGAE 1QA7A 1HB0B 5F8XA 5EPNA 2PGQB 1MTNC 2A4OA 1EUFA 3SNBA 1AZ8A 3P17H 3BTDE 1NFUA 1J17T 2VVUA 3QTOH 4AFQA 1A46H 5FXLA 4CHAC 1CHGA 3TGJE 1LVMA 4NWLA 4A1VA 2P95A 3RXCA 1P9UA 3TK5A 3ZZBA 2ZHQH 4YOGA 1LVOA 1B0EA 7KMEH 4DURA 4U01A 1O39A 1SGPE 1NTPA 4ABFA 3A8CA 5J4QA 3NUMA 4X1QU 4F49A 1SPJA 1F0TA 2XC0A 3RC4A 1BHXB 2BMGB 2C3SA 4MTBA 3A7VA 5HXFA 1O3JA 3GCTG 3ZZ9A 1A0HB 3DD2H 2ZC9H 5GPIB 4JZ1A 1Z8RA 3RDZA 1XUIA 1A61H 1EASA 2F3CE 3FZZA 1FY1A 2AGGX 1EJNA 1HLTH 2IJOB 3MO6A 1LHEH 1QRWA 4F4OC 1QL8A 4K1TA 2D1JA 4LOYH 1SI5H 3E0PB 3VGCC 1C5SA 1O2WA 1AVWA 1XM1A 3A7YA 3P8NA 4OS4A 4DJZB 1N1LA 1F5RA 3TU7H 5DP4A 4XBCA 1C1PA 2BYAX 1CHOG 2BZ6H 3RXRA 1KLJH 7ESTE 3BIUH 1C1UH 1KXDA 1YF4A 1FV9A 4HTCH 3LH3A 3ZZ4A 4BAOB 4AG2A 1G3EA 1GI2A 2GCTB 1SGYE 1N8OC 3SNDA 2FOAA 1TAWA 5CHAB 3SU5A 5DP5A 4BXSA 3URCA 8GCHG 4KP0A 4AG1A 2GDEH 1MCVA 2BDYA 3EAJA 5EODA 3SU1A 1GI0A 1CT4E 4MPWA 2BDHA 4B73A 3BSQA 2BD3A 2Z9IA 1A7SA 5HGGA 3AASA 2ZGBH 2VIPA 2F9VA 3BG4C 5DKMA 1ZSJA 1AN1E 3O8BA 1Y3WA 1ELBA 1EQ9A 2FLBH 4VGCB 1GJCB 4AFZA 1O3CA 2ZFRH 2XYAA 4XBBA 5G4BA 1P3EA 3VB7A 2ZI2H 3SUGA 5DP9A 4NIWA 1UVTH 1XVMA 1TA6A 1QR3E 1EAXA 2A2QH 2C8WB 4O3TA 2ANMH 1W0YH 3OY6U 4X6PA 1Z1IA 5AVDA 1C2KA 1NC6A 3HK3B 4FUJA 3M7UA 5EW1H 3MWIU 3KN2A 2RCEA 2Z3CA 1GMDF 3U69H 5FBIA 1ZHMA 1W8BH 3PWCA 3TK9A 3PLBA 4MLFB 3HKIB 1GBBA 1WBGB 3TVJB 2PSXA 1ARBA 2BZAA 1V3XA 5CMXH 1ACBE 2BLWA 3ZZCA 3TNTA 1O32A 5GDSH 2TIOA 2G8TA 1EOLA 4DIHH 3D62A 1F0UA 1DITH 4X8VH 5JBAS 2UWPA 2A7JA 2GD4B 2ZFTA 1O36A 1Z6EA 2A0QB 1S0QA 3TK6A 3RMLH 2Z6BD 2ZWLH 3TJVA 1T32A 3OU0A 3M3SA 3BTFE 1BBRK 1NT1A 1D3DB 1KXBA 3R0FA 2B8OH 4ESTE 1P04A 2H1UA 4I8HA 3UUZA 3DFLA 4ASHA 3GDVA 1FQ3A 1BTPA 3LGTA 2VWOA 3LGWA 4NIVA 3SU3A 2SGDE 1W7XH 3TLOA 4RKOB 1MKXH 5CHAC 3DT0H 5T6GA 2J4IA 1WV7H 2ZHDA 2WPJS 1P0SH 2AH4X 5AF9H 1Q2WA 4YLQH 3R3GB 3ZVDA 2PKSB 4Q7YA 2HVXA 2HPQH 4DIIH 3P8GA 1XVOA 1P03A 1QBNA 3P92A 1V2WT 6GCHG 2BVRH 2XWBI 4WMFA 2XCNA 1ELAA 3SUEA 5EW2H 1XUJA 4VGCC 1O5FH 1NRRH 4TPYA 3RXTA 1MUEB 1TGTA 4ZAEA 1QB9A 2ZU4A 3GCHB 1AE8H 1HCGA 3CS0A 1GJ9B 1CO7E 2FS9A 3T26A 2AIPA 1VZQH 1O2IA 3LJOA 3PMJA 1O3OA 1ZJDA 4DVAU 3M7QA 2B7DH 1TMBH 1DOJA 2OQUA 3U8OH 4BAHB 2ANWA 1TQ0B 3VB5A 4DW2U 4GUXA 2AERH 2GCHG 4X6MA 2JH6D 2Z9JA 2QY0B 2AYWA 2ZPQA 1O2PA 1C2DA 3U8TH 1TNGA 1CHOF 1LMWB 2CF8H 2EI8A 2D2DA 1NRQH 3UIRA 2G4TA 5T6FA 2HLCA 4MQAA 1AQ7A 3MH4A 3ENSB 1O3BA 1S82A 3VXFH 2D8WA 4H6SB 1C1TA 2R2WU 1QA0A 8GCHF 4ZHLU 4X1PU 5C5OA 3MI4A 3PMAB 1O2LA 1SR5C 2XC4A 1V2TT 1XUFA 1EPTA 1W0ZU 1AVGH 2XBWA 1CE5A 3URDA 1L4ZA 3TH4H 1V2NT 5DO4H 2ZCHP 1W3CA 1FAKH 1O3GA 2Z3EA 2AMDA 1GDUA 3K2UA 3S69A 2GV6A 1O2HA 1RIWB 2WPHS 1FN6A 1TMUH 1L1JA 1S84A 4UFDH 4XE4A 4Y6DA 5AFZH 1WTHD 2BB4A 1L2EA 3SHAH 1GHAG 2FX6A 1IQNA 3GY6A 2PKSC 1C5PA 1CGJE 1FJSA 2B0FA 1P02A 4ZHAA 4MNXA 3Q3XA 1H9IE 3AW1A 3BTQE 5A8XA 2TBSA 2ESTE 1BTZA 5DP6A 3KHVA 5A8YA 1A1RA 1ZTJA 4XOJA 1ZZZA 2A32A 4CBNA 1ZSKA 1ESBA 1GDNA 5EQQA 1IQFA 4NA9H 1QB6A 1OYQA 1HAHH 1TOCB 1SGQE 1NU7B 3SZNA 1HV7A 1NFXA 5ESTE 3ZZDA 1HAVB 1RJXB 1ZHRA 2FODA 2VGCB 5B6OA 3BG8A 3RU4D 4IC6A 1ZSLA 3SU2A 4CRDA 1UTKA 4ISOA 4JZFH 5K7RA 3BTHE 2FM2A 2BY7X 4WH6A 2WUBA 2ZQ2A 2O8TA 1LQDB 2QXGA 1DE7H 1BIOA 1UHBB 2NU0E 4GPGA 1C1SA 3BV9B 4YZUA 3MU4A 3B9FH 4Y71A 2WYJA 2O8MA 2OUAA 2Z94A 3SI4H 3UNRA 3KNXA 1O5EH 1AMHA 1KYNA 2FI5E 1YCPM 1HXFH 3T29A 4ZXYH 1F2SE 1KLIH 1P05A 1K9OE 1OPHB 1K1PA 4MG3A 4ZKNU 1GMCG 3S9BA 2XC5A 1OWDA 1EX3A 1QURH 1FXYA 1O34A 6GCHF 4D76A 1P01A 3SNCA 1W13U 2FX4A 1C2MA 3ATWA 1JIMA 1RIWC 4Y8ZA 4GCHF 2EI7A 1BMMH 1D3QB 1HYLA 3UNQA 4FU7A 1ELVA 2R0KA 1DS2E 3F68H 1NS3A 1SFQB 1SGEE 1SGRE 1RTKA 4AOQA 4DOQA 1H1BA 1HXEH 2H9TH 1EZUC 1GHBG 1ANEA 3RLWH 2W26A 1BMAA 3K65B 5HMAA 3RXBA 4ABDA 1N6YA 1OWJA 1MMJN 1LVYA 3KGPA 1O2RA 1QRZA 3A82A 3A88A 2A2XH 2Z9KA 3BN9A 5F03A 5CE1A 2J34A 3FANA 1T8OA 4KTSA 1IOEA 1TPAE 1GI8B 5FX5A 2VGCC 1HJ9A 4OS6A 2RA3A 1O3AA 1UCYK 3A80A 1THSH 5T6DA 4AB8A 4ZUHA 1IQMA 1WQSA 2OC7A 1CA0C 4Y0YE 3LGUA 4TY6A 3SQEE 2AGEX 4HZHA 1SB1H 1SLWB 1M9UA 2ZU5A 3RM0H 5A0BA 4FUEA 1O2YA 1FIZA 4LK4A 1ESTA 1O3FA 2ZHEH 1TBRH 1GBDA 1S6FA 1TNHA 1GHAF 2G52A 3VB3A 3OY5U 2PV9B 4TYDA 1ANBA 2WPMS 5F6MA 1HBTH 2PR3A 1U6QA 1H8IH 1GBMA 5E0GA 5PTPA 3TJUA 3UOPA 4I8LA 1YPLH 1GBCA 3V0XA 3S7HB 3QTVH 3SORA 4GSOA 1GI3A 2IPHA 1BBRH 2DUCA 1VCPA 1GJ7B 1C5UA 1YPMH 3T62A 1QNJA 4AYYB 2G55A 2VWLA 5GIBA 1OXGA 3MMGA 3PROA 1PYTD 1DANH 4X6NA 1L1GA 1UHBA 1QBOA 3GY8A 4J1YA 5DP3A 4GAWA 1QRXA 2TGPZ 1LHCH 3CENA 1MTNB 1O5CB 1TB6H 1UK3A 2FWWA 1SGNE 5I46H 1DT2A 1Y3XA 1UCYE 2C8ZB 4IN1A 4CHAB 1QJ1B 2OQ5A 4E05H 5I25A 3RXLA 1UVPA 4AGKA 3GY2A 1TNJA 1BJUA 1EKBB 1O5GH 3PV4A 2AIQA 1FY8E 1QJ7B 2OD3B 1OS8A 1ZMJA 2ZGJA 4IW4E 1OKXA 2OLGA 2XBVA 4NSVA 2VINA 4Y76A 4TWWA 1O2MA 3I78A 4LXBH 4X2XA 4WMDA 3RU4T 3ZZ3A 4YTAA 1F0RA 1DDJA 5A0AE 1JWTA 1Y3UA 1FI8A 4YOJA 5E2OA 1UTMA 4KELA 1CSOE 4UFFH 4ZMAH 3PWBA 4CH2B 3MFJA 3IITA 1LO6A 1UJ1A 4IBLH 1Y3VA 1V2ST 1YPHC 1ZGIA 3K6ZA 1AZZA 1AWFH 1GHBF 3FP8E 2PKAB 4UONA 1BUIA 1NN6A 1C2HA 4BANB 1A4WH 1O3MA 4K1EA 1RTFB 3MNCA 4JK5A 4FXGH 3GY3A 2V0BA 1P3CA 2PLXA 3T27A 2PGBB 3U98H 5EOKA 1GBJA 5TCCA 1P2QA 3Q77A 1HUTH 1NZQH 2ALPA 1AY6H 2O8LA 1FLEE 1TNLA 2YNBA 3BG4B 5FBEA 6CHAB 1TA2A 4FUGA 1VITH 4OS2A 2RA0A 2ZNKH 3QZRA 1MU6B 1TABE 1V2VT 1SGIB 2P93A 4YESB 3N7OA 2VIWA 5FHTA 3O8CA 4CRCA 4PROA 4IMQA 4NSYA 1D9IA 1O2JA 3D49H 3RXAA 1E35B 1GHZA 2P59A 2A5IA 5L6NH 1DFPA 1GBLA 1SG8B 3GOVB 1FY5A 3LKWA 3NZIA 2GTBA 1SGCA 2QIQA 3ZVFA 1SHHB 3ZZ5A 1Y59T 1EATA 4INHA 3V12A 4CR9A 3MU8A 1XUGA 1ARCA 2ZGXH 3RXVA 3PLPA 4INKA 4NCYA 3KF2A 3UOUA 3BTEE 1ETSH 2BDAA 1UTJA 1P09A 4D7GA 4R8TB 1GHWH 2BY9X 1BTYA 3CP7A 2VH0A 4ZHMU 1DY8A 9LPRA 3U1JB 1K28D 1GCDA 2Z3DA 2RDLA 1RD3B 1YKTA 1MD8A 2CF9H 3RMMH 1PPCE 1ID5H 2GVFA 2BDCA 3LPRA 1IQGA 1GL1A 3G01A 2ZP0H 1GCTB 4BNRA 2FS8A 1WYKA 3LOXA 1TRMA 1MTSA 3QX5H 3IG6B 2OP9A 1B5GH 3T28A 1YPGH 2Y81A 1P10A 3UNSA 2FLRH 1H8DH 2BD2A 1BHXF 1BMNH 5A09A 3ESTA 3UQOA 5EXLA 5JBCS 2P16A 2ULLA 5AFYH 2FESH 2ZFPH 2GZ8A 2ZO3H 1TGNA 1ELCA 2UWLA 4U30A 2OC8A 5JB8S 3QUMP 5DPAA 1C5LH 1EB1H 4UDWH 1K1NA 4CBOA 2UUKB 1ELGA 3PM3A 1XMNB 5F8TA 4X1SU 6CHAC 5ABWA 2CJIA 5GCHF 1O3PB 1J9CH 1Q3XA 1FMGA 1YPKH 3E3TA 2ALVA 3LC5A 1TE0A 1D4PB 2QC2A 4RSPA 4OGYA 4NA8A 2XRCA 3FVFB 2H5DA 3ODDA 1AHTH 2XW9A 3PMBB 1ELDE 4JCNA 2VVCA 8ESTE 4ABHA 1O2OA 2JH0D 3QZQA 1KDQB 1Y8TA 2FMJA 3I77A 4JZIA 1HIAA 4D9QA 2ZDKA 4ISLA 3Q76A 4H6TA 1ETTH 1B7XB 1MCTA 1UMAH 2GX4A 1BTWA 3ZV9A 2XCFA 1C2FA 1OP0A 2VJ1A 1V2MT 1SSXA 5L30H 4ABBA 1EP6A 1TQ7B 1UCYH 3AVZA 3ITIA 1G2LA 6ESTA 4FU9A 1K22H 1BT7A 1SC8U 1F5KU 1Q31A 4AORA 4NG9H 3RXOA 3E91A 4K1SA 1D6RA 2Z9GA 3MO3A 2ODQA 4Z6AH 1T4VH 3E90B 1C9TA 2PWXA 1E0FD 1O2NA 4THNH 2XNIA 1GBEA 1AU8A 4K5ZA 5A0CA 1GCTC 1OYTH 3SV2H 2ZQ1A 3OX7U 1A3EH 2FI3E 5C20A 7GCHF 3E0NB 3SU4A 3DHKH 4ABJA 2FOMB 2SGAA 4AZ2B 1MD7A 1C5QA 1BCUH 1W7GH 5DG6A 1G32B 1QB1A 3FAOA 1PPZA 1LHDH 5C1XA 2G5VA 4NIXA 3SGAE 1S85A 4R0IA 1O3EA 1SQOA 3V13A 1ANCA 1LKBA 1P11E 1AE5A 1GJAB 1JIRA 3MU1A 2Z9LA 1ABIH 5FPTA 4CRGA 2HNTE 3TGKE 2OC1A 2QYIA 2GDDA 4QT8C 4GCHG 1SVPA 1TNKA 3M5OA 1D6WA 1YYY1 3S0NA 1QQUA 2G81E 1C5XB 3T2NA 4XSKU 4ABAA 5DJ7A 1IQIA 3RXFA 2UUJB 2PHBA 1TRNA 2CHAB 4B76A 2EC9H 2SFAA 3ELAH 5E0JA 2QXIA 3ZVBA 2OCVB 1O2ZA 3VB6A 3W95A 1Y5UT 3SBKA 1YP9A 1QGFA 4JYVH 2PTCE 3B23B 2CMYA 5IDKA 4YO9A 1JRTA 2ZFQH 3RMNH 2GZ7A 2VVVA 1BBRE 1A0JA 1O3IA 1GMHF 2BDGA 3SHCH 3S9CA 3F9HA 4IMZA 4X8UH 3SUFA 1MKWK 4IC5A 2STBE 4BAQB 6LPRA 3F9FA 1C5OH 2H2ZA 1SBWA 1HFDA 1NFWA 1MAXA 5JBBS 1GGDB 2A45B 1PYTC 1KXEA 2AGIX 2K1QA 2QN5T 2Y82A 3LGVA 2FOHA 1C5WB 1WTGH 2P3FH 2W3IA 1NU9A 1YPHE 5EGMA 4ZKSU 1OSSA 2FYRA 1BTHH 2VWNA 2Z7FE 1C5YB 1KXCA 2ASUB 4I32A 1OWKA 4A5TS 5EPYA 1W11U 3RXHA 4GHTA 2SNVA 1GJBB 1VR1H 4IN2A 1C2GA 4MNYA 3U8RH 3PTBA 2HPPH 5HYOA 2EI6A 1YCPK 4M7GA 2Q6GA 4AYVB 3UTUH 3PYHA 2BOHB 2ZGHA 5FCRA 3UWJH 1DSTA 2BX4A 2XWAA 3VEQB 2HGTH 3SJOA 5LGOA 1HJAC 4B2BA 1W2KH 1CQQA 2O8UA 1ABJH 2SGFE 4MNWA 1BTUA 4NZQA 4XFQA 3BTGE 1E37B 4X1RU 2ZDAH 2PFEA 3SV6A 1F5LA 1S81A 1T31A 4MDSA 5C1UA 3P6ZB 3M3VA 4NA7A 2UUYA 4YT6H 1GPZA 2CHAC 3MH7A 1WQVH 4FUHA 3SU0A 1FNIA 4DGJA 3A81A 4B1TA 1O31A 4I8JA 3ZZ8A 2VU8E 1CA0B 1UTQA 2ZCLP 1F0SA 4JYUH 1LPGB 1RGQA 2Y80A 1OP2A 3QGNB 8KME2 1C1WH 2Q6DA 3RXQA 1JMOH 2FIRH 1TIOA 1G36A 3UY9A 1MTVA 2VIVA 3DFJA 3KCGH 1K1IA 1T8LA 2ODYB 1V6DA 1GBIA 4JZDH 4O97A 2C8YB 4Y8YA 1ELEE 1GHYH 1DUAA 2TPIZ 1S6HA 1LPKB 3RXKA 4X8SH 2O9QA 3M5NA 1KXAA 1WU1A 3E6PH 2PUQH 3SJ8A 1V2PT 1FY4A 1HAZB 2BX3A 1GGDC 1DWCH 1J16A 1O2KA 1P2KA 4WY3A 2BTCE 3C27B 1AUTC 1IHSH 1O2TA 3F9EA 2TGDA 2ZDVH 1DWBH 1YPEH 1S5SA 1HAGE 3MTYA 1O3HA 1QL9A 1GI6A 3D23A 4TPIZ 3E16B 1FY3A 1HAXB 3M5MA 1FPHH 3S7KB 1TRYA 2W7UA 4X8TH 1TBQH 1DVAH 2A31A 3GDSA 4ISHH 1HJ8A 3OSYA 2BD5A 3EGKH 1OWHA 1WCZA 4E7RG 5GWZA 3QLPH 1UVUH 1MZAA 1T7CA 2J9NA 2GMTC 2FOCA 3LH1A 5E8EH 5FPYA 3SGQE 1O2UA 2NWNA 1O38A 2C90B 4B74A 2F9PA 4TY7A 5JB9S 1NPMA 3M3TA 3ATIA 2QA9E 1BMLA 4A7IB 3VFEA 1YPJH 2UUFB 1HDTH 3MNBA 1GI5A 3BTME 2HNTF 2TGTA 1G9IE 1VITG 3F1SB 1C4V2 2Q6FA 1OWIA 2C4FH 2ZF0H 1LKAA 4DT7B 1DX5M 1O30A 1T8MA 3LONA 3RXPA 3M36A 1TGCA 2VWMA 1UTOA 2IN2A 2BVSH 4J2YB 4TWYA 3QWCH 3RXUA 5K0HA 1IQHA 1QFKH 4KTCA 3MOCA 8LPRA 4D8NA 1N6XA 2FTLE 1UVOA 1XX9A 1HNEE 3SW2B 5C67A 2ZFSA 1UVSH 3BEFB 3GICB 1TX7A 1E38B 4SGBE 2WUCA 4B2CA 1O5AB 3H7OA 1WSSH 3KIDU 1V2KT 2CN0H 3RXGA 1RXPA 2QF3A 4NZLA 2FTMA 1IQJA 3GY5A 1ZHPA 2EA3A 2GT7A 1MBQA 2F9OA 2VB0A 2XBYA 5HM2A 2CXVA 2SNWA 1C1NA 1XKAC 3M37A 3EA9A 2ZFFH 1HAVA 4MNVA 1O5BB 1O5DH 3ZVGA 2P8OC 1G37A 3M5LA 5BRRE 4BXWA 1EZQA 3P8OA 4YM9A 4WWYA 4X2WA 3BTWE 1LDTT 9ESTA 4CR5A 1MZDA 1TPOA 3A7WA 2F9UA 2A1DB 2SGQE 1O37A 1DXPA 1Z8IB 3NCLA 1SGTA 3TITA 3GCOA 1A5IA 2P94A 4YOIA 1AGJA 3SUDA 3TPIZ 1VGCB 4K2YA 4WH8A 2JETB 2BY6X 1ZYOA 3A89A 1EOJA 1EP5A 4OS7A 3LT3A 2QF0A 5EQRA 3SJIA 4Y79A 2TGAA 1CGHA 1MQ6A 4ZKOU 5EXMA 1DSUA 2W7SA 3NK8A 1UTPA 3A7ZA 4FU8A 1IQLA 4HI3A 1MU8B 3B8JA 4X0WU 1GJDB 1QL7A 1THRH 5GCHG 3RXJA 2I6SA 2ZU1A 2BD7A 2FO9A 3TJOA 2J2UA 1Z71A 1MBMA 3RC6A 4AN7A 1NY22 5E2PA 2ODPA 3ZZ6A 1BQYA 1K1JA 4AX9H 1QQ4A 2GV7A 1AVXA 1GI9B 1F7ZA 3QGJA 3A84A 3SJKA 2BQ7B 4E7NA 3PO1C 2WINI 4A6LA 2NU4E 1G3DA 3A7XA 4XDEA 1NROH 3AAUA 3JZ1B 2B5TB 4AFSA 2NU3E 3SN8A 1GVZA 2YOLA 1MKWH 5JYIA 1K2I1 1TONA 3GY7A 2BOKA 1RRKA 5EQSA 1C4U2 1FDPA 1MTWA 2G4UA 5FCKA 3BIVH 1O2QA 5DP7A 4B75A 2HRVA 3M7TA 3TH3H 3OYPA 1O2SA 2WPKS 3P95A 2ZIQH 3QK1A 5H4IB 1GI1A 3FFGA 2ANKH 3STJA 1CBWC 4KTUA 2KAIB 1C1RA 2BHGA 3NKKA 4Q7ZA 2FPZA 1INCA 2BY8X 1GI4A 2CGAA 7GCHG 1VITF 1KIGH 5JPMH 3RXEA 1C5ZB 2AFQB 3ZVCA 1YBWA 3RC5A 1VGCC 2JETC 3HGNA 1YCPH 1DICA 2ZHFH 2PUXB 3TJNA 5EG4A 1YLDA 4Y7BA 5L2ZH 2Q1JA 1EXFA 1EB2A 3PTNA 1TX8A 1V2RT 3MNSA 1JRSA 1CT2E 3GISB 4I7YH 4Q80A 1P2JA 3KQBA 3GYLB 4ZH8A 3A8AA 1K21H 1TPPA 1EZSC 2ZKSA 1GJ4H 1Y5BT 5GXPA 1G30B 4MPUA 1W12U 3IWMA 1AD8H 1P2OA 1ZMNA 3A8BA 1SQAA 1HPGA 3MH6A 2BM2A 4ISNA 3AW0A 3E1XB 1S0RA 2H6MA 1VCQA 1C2EA 1V2OT 4X2YA 1V2LT 4CREA 2AEIH 1EAWA 1QIXB 3PB1E 3RP2A 1RFNA 2GKVE 3KQCA 2GP9B 4NWKA 1W10U 2FOFA 3ATMA 1BITA 2J95A 3I29A 1AFQB 1SLVB 1TNIA 4X2VA 5GJ4B 2G00A 2ZG0H 5C3NA 1GBHA 2ZDLA 2FEQH 4MPVA 1EAUA 1HGTH 2QCYA 3SNEA 2ZA5A 2A4QA 1WAYB 2LNCA 3ZZAA 1GMHG 3QN7A 1SFIA 3LU9B 1GG6B 2V3HH 1Y5AT 1OOKB 2A7HA 2IOTA 3ZYDA 4NFFA 1T4UH 1AO5A 4MVNA 3M61U 1Z7KA 1PPHE 1TBZH 1QJ6B 3TGIE 2ZTXA 3TH2H 4A1TA 3RXMA 5DK1A 4OGXA 1H9HE 3LJJA 1J8AA 1TOMH 2VIQA 2STAE 2F9NA 3C1KA 2O8WA 3P8FA 3LGIA 2W5EA 1DUEA 1YGCH 3U9AH 2BLVA 5LPFA 3W94A 2H5CA 5ETXA 3TIUA 1XKBC 3MU5A 2BVXH 3H5CB 3WY8A 5LH8A 1LHFH 1NO9H 3BF6H 1W14U 1Z1JA 1SGFA 2OTVA 4NGAH 1TALA 2ZPRA 2PKAA 4WVPE 2ZECA 1GBAA 1HAPH 1GBFA 1BB0B 1EPTB 1GBTA 1BRCE 2SGEE 3UR6A 1O3LA 3D65E 2ANYA 1GJ8B 3U1IB 2Y7XA 1ELTA 4K69A 5TJXA 1SOTA 2KAIA 1C5VA 2BLQA 4BAMB 2Y5GA 1HRTH 1SLXB 3HPTB 1P9SA 5JBTA 4UE7H 1OP8A 1HAYB 1ZTKA 1AFQC 1KTSB 1NESE 4LZ4B 4Z0KA 4BTUB 2BD8A 3HATH 1ZLRA 3SQHE 1O3KA 1KSNA 4RN6A 4INLA 1LHGH 3LIWA 1XXFA 2EEKA 4ZXXH 1YC0A 1P2NA 3NPSA 2YNAA 4CH8B 4K8BA 1C4Y2 1GG6C 2Y5FA 2A5AA 1D3PB 2PSYA 4Y10E 3NXPA 4XBDA 1IQEA 4K3JA 1DY9A 1ZMLA 1C1OA 5IYTA 2ZEBA 3ZV8A 2V35A 2Y7ZA 1JOUB 3SV8A 1O2XA 2GCTC 3SOSA 3ATKA 3KQEA 3RMOH 2DE8A 3VPKA 1YLCA 1KXFA 4AFUA 1XUKA 1PPGE 1C1VH 4I31A 2OXSA 1HJAB 3K6YA 1SOZA 1ZPZA 2A4GA 4BTIB 2BXTH 4FUFA 4ABGA 1EZXC 3RXDA 1FAXA 3LGYA 3JZ2B 1MAYA 1Y3YA 3FP6E 5SGAE 3UR9A 3LDXH 1TYNA 4CRFA 2R3UA 1UTLM 1EPTC 1MH0A 1ZPCA 3KQDA 3SNAA 1K1OA 3GCTF 3ZVAA 1BZXE 1H4WA 5HM9A 4ZKRU 2BXUH 3L33A 3SI3H 4CRAA 1DPOA 4JYTA 3MU0A 3A7TA 5J4SA 2ZTZA 1AWHB 3KL6A 1AB9B 3EYDA 2QXHA 4YT7H 3Q3KA 1C9PA 4HGCA 1ZTLA 3Q3YA 1PPEE 1PQ7A 1P06A 1EJMA 1FPCH 3ODFA 2H9EH 3EA8A 1GI7B 3EA7A 2R9PA 3GCNA 1BRUP 2M5TA 1KDQA 3RM2H 4AGJA 1AUJA 3GDUA 3PMHB 3SU6A 5LPEA 1OX1A 2A7CA 3A86A 1G2MA 1CGIE 4IGDA 4A1XA 3L6PA 4D7FA 5C2ZA 4BTTB 3SV9A 3RUOA 1AIXH 4FUIA 3E8LA 1L0ZA 2BY5X 3RXIA 2XXLA 3A8DA 3QO6A 3SJ9A 1A0LA 1P2IA 3F9GA 4B2AA 3O8DA 4WF8A 1NRNH 2GMTB 3VXEH 3LC3A 1TPSA 2FOEA 1C1QA 3A85A 3F6UH 3HK6B 3MYWA 3BEUA 3MNXA 1SGDE 1NRSH 2ZCKP 4IS5A 3BTKE 4JZEH 1X7AC 2QAAA 2VNTA 3BTTE 2WYGA 1FUJA 2D26C 2R2MB 2BQWB 3GCHC 2GZ9A 4FVDA 4LZ1H 3FZDA 1E36B 2BD4A 4GLYA 2CV3A 5ESBA 1PQ8A 5EU8A 2PW8H 1H9LB 2XTTB 2WV5A 1DM4B 5FPSA 2FYQA 1G3BA 1LQEA 1LTOA 4ISIH 1KLTA 2Y5HA 1DXWA 1G3CA 1AB9C 4YLUA 1O3DA 1P57B 3PLKA 4X1NU 5BPEA 3FP7E 3L3TA 4BAKB 1O33A 1QBVH 3ZYEA 1BDAA 1PJPA 4K60A 1E34B 2FDAA 4B71A 3H7TA 1QTFA 2VIDA 4GHQA 1ORFA 3EDXB 4ABEA 5A2MH 1UK2A 1ZRKA 2BDIA 3ATLA 5DGJA 1ANDA 1S83A 1V2UT 2FOGA 2UWOA 5L2YH 1EAIA 3V3MA 1C5NH 1PFXC
chains in the Genus database with same CATH superfamily
3CS7A 4XRNA 1UTNA 3VB4A 1ZJKA 1GJ6A 4HFPB 2P8OB 4OS5A 2ZDMA 2K8IA 1GBKA 4FUDA 2J92A 3GYMA 2J97A 1ZGVA 4KGAA 4RT1A 1JXPA 2KM0A 1J15A 2HOBA 1A5GH 1BOQA 3UWIA 2FZZA 4KKDA 1GJ5H 1Z8JB 2QXJA 2HWLB 1UK4A 3A83A 1UO6A 1CVWH 1O2VA 5C5NA 1OWEA 2QGRA 1NM6A 1SQTA 2Y6TA 3SYJA 2BQ6B 1GHXH 2P3UB 2IPQX 2ZZUH 3DSPA 3T25A 1PQ5A 2RG3A 3W1EA 4U32A 5EXNA 3RU4E 1O35A 2GCHF 2R3YA 2XOKD 1A3BH 2ZGCA 2KR7A 4I33A 3TNSA 2F83A 1AKSB 3RLYH 1PQAA 3SGBE 4UEHH 1TGSZ 4UD9H 4JMYA 1JBUH 2H9HA 1B0FA 1F92A 1FN8A 1QCPA 1TX6A 3HKJB 3O8RA 2ZHWH 4NFEA 1SGFG 1GL0E 2GT8A 3ZZ7A 1CA8B 4WXVA 2LPRA 1HAIH 4UFGH 3QDZB 4DCDA 3UQVA 3MHWU 1IAUA 4DY7B 3EQ0H 3SO3A 1DWEH 3OTJE 2C93B 2AMQA 5FL7D 1QY6A 4GVUA 1TFXA 2BLOA 2JKHA 3UREA 3UFAA 1PPBH 5DP8A 2LELA 3PO1B 5FAHA 3AAVA 2J94A 4H4FA 1TGBA 3STIA 2A4RA 5C1YA 5EJLA 3OTPA 2PTNA 2F43B 1AFEH 2ZDNA 2DE9A 1T8NA 2OC0A 1ZOMA 2OBQA 4O9VA 1WUNH 1SLUB 1ZPBA 1V2JT 2J38A 2B9LA 4I8GA 1PPFE 5F8ZA 3S9AA 2G51A 1J14A 1BJVA 2GGVB 5FX6A 2FOBA 3KEEA 1NRPH 1C2LA 2W3KA 1L1NA 1MQ5A 1LPZB 3MO9A 1CBWB 1MKXK 4D9RA 1C5RA 3SV7A 1CU1A 2NU2E 4Y7AA 3GY4A 1LVBA 2I6QA 1GVKB 3NWUA 5CDFE 5JDUB 1VCWA 2AS9A 4BOHA 1BRAA 2FI4E 4AB9A 5LPRA 2G5NA 1DWDH 1ESAA 1P12E 2WPLS 2ZPSA 1V2QT 2HNTC 1K1LA 1DLEA 4Y8XA 4WXIA 7LPRA 1FZZA 1TLDA 2WPIS 2SGPE 4MPXA 2FP7B 2EQNA 2V6NA 3DUXH 2F9BH 4Q7XA 4NIYA 4RKJB 1IHTH 1FIWA 1WOFA 3RXSA 3A87A 4FUBA 1DLKB 5E0HA 3T5FH 1LCYA 1SMFE 4RT0A 3U28C 2VH6A 4FVBA 3UPEA 3DA9B 4UFEH 3M35A 5TCAA 2A5KA 1P8VC 1SL3A 1NFYA 1RS0A 1P2MA 1HAOH 2R0LA 3Q00A 4DG4A 1O0DH 1FONA 1C1MA 1C5TA 1O3NA 2THFB 3P70B 3V7TA 1KY9A 4O03A 3ZVEA 1XXDA 1Z6JH 4K8YA 5GNDA 3CNRA 2ILNA 1O2GH 2BDBA 1CT0E 1GMCF 5T3HA 1QHRB 1MTUA 3NRLA 2TRMA 1AI8H 1BA8B 1GDQA 3PV2A 1D3TB 1RTLA 2JH5D 2V3OH 4A92A 1VJ9U 1C2IA 1XUHA 1ETRH 2HALA 1W0KD 3MH5A 1A5HA 1A2CH 1BRBE 3SZEA 1C2JA 1GMDG 1BTXA 1GVLA 2ZU2A 3HGPA 1ZR0A 5A8ZA 2BD9A 4JK6A 1YM0A 2OBOA 1ELFA 4HG6A 1GWAA 1K1MA 4OS1A 1AKSA 1IQKA 3VGCB 2P3TB 3EE0B 2F91A 2C8XB 1HIAB 1TWXB 1TMTH 4ABIA 2XBXA 1KTTB 1L4DA 4Y0ZE 4CRBA 4WMEA 2QV1A 4FUCA 1EJAA 4WJG2 1VJAU 2FXRA 1ZRBA 1N8OB 4I8KA 4ZROA 2OINA 2WV4A 1GHVH 4E06H 2AMPA 2ZTYA 4X6OA 2VIOA 4O3UA 1Z8GA 3K9XB 1SHYA 1C5MD 2NU1E 2ZU3A 1THPB 4Q2KA 3BEIB 4H42U 4U2WA 4Y11E 5AHGH 4SGAE 1QA7A 1HB0B 5F8XA 5EPNA 2PGQB 1MTNC 2A4OA 1EUFA 3SNBA 1AZ8A 3P17H 3BTDE 1NFUA 1J17T 2VVUA 3QTOH 1BMFD 4AFQA 1A46H 5FXLA 4CHAC 1CHGA 3TGJE 1LVMA 4NWLA 2KCOA 4A1VA 2P95A 3RXCA 1P9UA 3TK5A 3ZZBA 2ZHQH 4YOGA 1LVOA 1B0EA 7KMEH 4DURA 4U01A 1O39A 1SGPE 1NTPA 4ABFA 3A8CA 5J4QA 3NUMA 4X1QU 4F49A 1SPJA 1F0TA 2XC0A 3RC4A 5C94A 1BHXB 2BMGB 2C3SA 3H09A 2KCPA 4MTBA 3A7VA 5HXFA 1O3JA 3GCTG 2M2AA 3ZZ9A 1A0HB 3DD2H 2ZC9H 5GPIB 4JZ1A 1Z8RA 3RDZA 1XUIA 2JIZD 5DSFA 1A61H 1EASA 2F3CE 3FZZA 1FY1A 2AGGX 4XD7D 1EJNA 1HLTH 2IJOB 3MO6A 1LHEH 1QRWA 2L6OA 4F4OC 1QL8A 4K1TA 2D1JA 4LOYH 1SI5H 3E0PB 2KFWA 3VGCC 1C5SA 1O2WA 1AVWA 1XM1A 3A7YA 1FX0B 3P8NA 4OS4A 1N1LA 4DJZB 1F5RA 3TU7H 5DP4A 4XBCA 1C1PA 2BYAX 1CHOG 2BZ6H 3RXRA 1KLJH 7ESTE 3BIUH 1C1UH 1KXDA 1YF4A 1FV9A 4HTCH 3LH3A 3ZZ4A 4BAOB 3OE7D 4AG2A 1G3EA 1GI2A 2GCTB 1SGYE 1N8OC 3SNDA 2FOAA 1TAWA 5CHAB 3SU5A 5DP5A 4BXSA 3URCA 8GCHG 4KP0A 4AG1A 2GDEH 1MCVA 2BDYA 3EAJA 5EODA 3SU1A 1GI0A 1CT4E 4MPWA 2BDHA 4B73A 3BSQA 1K0HA 2BD3A 2Z9IA 1A7SA 5HGGA 3AASA 2ZGBH 1H8HD 2VIPA 2F9VA 3BG4C 5DKMA 1ZSJA 1AN1E 3O8BA 1Y3WA 1ELBA 1EQ9A 2FLBH 4VGCB 1GJCB 4AFZA 1O3CA 2ZFRH 2XYAA 4XBBA 5G4BA 1P3EA 3VB7A 4ACAA 2ZI2H 3SUGA 5DP9A 4NIWA 1UVTH 1XVMA 1TA6A 1QR3E 1EAXA 2A2QH 2C8WB 4O3TA 2ANMH 1W0YH 3OY6U 4X6PA 1Z1IA 5AVDA 1C2KA 1NC6A 3HK3B 4FUJA 3M7UA 5EW1H 3MWIU 3KN2A 2RCEA 2Z3CA 1GMDF 3U69H 5FBIA 1ZHMA 1W8BH 3PWCA 3TK9A 3PLBA 4MLFB 1E1RD 3HKIB 1GBBA 1WBGB 3TVJB 2PSXA 1ARBA 2BZAA 1V3XA 5CMXH 1ACBE 2BLWA 3ZZCA 3TNTA 1O32A 5GDSH 2TIOA 2G8TA 1EOLA 4DT4A 4DIHH 3D62A 1F0UA 1DITH 4X8VH 5JBAS 2UWPA 2A7JA 2GD4B 2ZFTA 1O36A 1Z6EA 2A0QB 1S0QA 3TK6A 3RMLH 2YMSD 2Z6BD 2ZWLH 3TJVA 3WWFA 1T32A 3OU0A 3M3SA 3BTFE 1BBRK 1NT1A 1D3DB 1KXBA 3R0FA 2B8OH 2WPDD 4ESTE 1P04A 2H1UA 4FOUC 4I8HA 3UUZA 3DFLA 4ASHA 3GDVA 1FQ3A 1BTPA 3LGTA 2V3MA 2VWOA 3LGWA 4NIVA 2SGDE 3SU3A 1W7XH 3TLOA 4RKOB 1MKXH 5CHAC 3DT0H 5T6GA 2J4IA 1WV7H 2ZHDA 2WPJS 1P0SH 2AH4X 5AF9H 1Q2WA 4YLQH 3R3GB 3ZVDA 2PKSB 4Q7YA 2HVXA 2HPQH 4DIIH 3P8GA 4B6EA 1XVOA 1P03A 1QBNA 1YY3A 3P92A 1V2WT 6GCHG 2BVRH 2XWBI 4WMFA 2XCNA 1ELAA 3SUEA 5EW2H 1XUJA 4VGCC 1O5FH 2GJGA 1NRRH 4TPYA 3RXTA 1MUEB 1TGTA 4ZAEA 1QB9A 2ZU4A 3GCHB 1AE8H 1HCGA 3CS0A 1GJ9B 1CO7E 2FS9A 3T26A 2AIPA 1VZQH 1O2IA 3OEED 3LJOA 3PMJA 1O3OA 1ZJDA 4DVAU 3M7QA 2B7DH 1TMBH 1DOJA 2OQUA 3U8OH 4BAHB 2ANWA 1TQ0B 3VB5A 4DW2U 4GUXA 2AERH 2GCHG 4X6MA 2JH6D 2Z9JA 2QY0B 2AYWA 5DN6D 2ZPQA 3FOAA 1O2PA 1C2DA 3U8TH 1TNGA 1CHOF 1LMWB 2CF8H 2EI8A 2D2DA 5F53A 1NRQH 3UIRA 1NBMD 2G4TA 5T6FA 2HLCA 4MQAA 1QZ8A 1AQ7A 3MH4A 3ENSB 1O3BA 1S82A 3VXFH 2D8WA 4H6SB 1C1TA 2R2WU 1QA0A 8GCHF 4ZHLU 4X1PU 5C5OA 3MI4A 3PMAB 1O2LA 1SR5C 2XC4A 1V2TT 3FN8A 1XUFA 1EPTA 1W0ZU 1AVGH 4Q4LA 2XBWA 1CE5A 3URDA 1L4ZA 3TH4H 1V2NT 5DO4H 2ZCHP 1W3CA 1FAKH 4RI0A 1O3GA 2Z3EA 2AMDA 2CK3D 1GDUA 3K2UA 3S69A 2GV6A 1O2HA 1RIWB 2WPHS 1FN6A 1TMUH 1L1JA 1S84A 4UFDH 4XE4A 4Y6DA 5AFZH 1WTHD 2KX4A 2BB4A 1L2EA 3SHAH 1GHAG 2FX6A 1IQNA 3GY6A 2PKSC 1C5PA 1CGJE 1FJSA 4YXWD 2B0FA 1P02A 4ZHAA 4MNXA 3Q3XA 1H9IE 3AW1A 3BTQE 5A8XA 3PRBA 2TBSA 2ESTE 1BTZA 5DP6A 5EJ1A 3KHVA 5A8YA 1A1RA 1ZTJA 4XOJA 1ZZZA 2A32A 4CBNA 1ZSKA 1ESBA 1GDNA 5EQQA 1IQFA 4NA9H 1QB6A 1OYQA 1HAHH 1TOCB 1SGQE 1NU7B 3SZNA 1HV7A 1NFXA 5ESTE 3PV5A 3ZZDA 1HAVB 1RJXB 1ZHRA 2FODA 2VGCB 5B6OA 3BG8A 3RU4D 4IC6A 1ZSLA 3SU2A 4CRDA 1UTKA 4ISOA 4JZFH 5K7RA 5C0TA 1E1QD 3BTHE 2FM2A 2BY7X 4WH6A 2WUBA 4ZCNA 2ZQ2A 2O8TA 1LQDB 2QXGA 1DE7H 1BIOA 1UHBB 2NU0E 4GPGA 1C1SA 3BV9B 4YZUA 3MU4A 3B9FH 4Y71A 2WYJA 2O8MA 2OUAA 2Z94A 3SI4H 3UNRA 3KNXA 1O5EH 1AMHA 1KYNA 2FI5E 1YCPM 1HXFH 3T29A 2KCYA 4ZXYH 1F2SE 1KLIH 1P05A 1K9OE 2JJ2D 1OPHB 1K1PA 4MG3A 4ZKNU 1GMCG 3S9BA 2XC5A 1OWDA 1EX3A 1QURH 1FXYA 1O34A 5HKKD 6GCHF 4D76A 1P01A 3SNCA 1W13U 2FX4A 1C2MA 3ATWA 1JIMA 1RIWC 4Y8ZA 4GCHF 2EI7A 1BMMH 1D3QB 3DSOA 5HIZA 1HYLA 5KECA 3UNQA 4FU7A 1ELVA 2R0KA 3F0PA 1DS2E 3F68H 1NS3A 1SFQB 1SGEE 1SGRE 1RTKA 4AOQA 5EIYA 4OM9A 4DOQA 1H1BA 1HXEH 2H9TH 1EZUC 1GHBG 1ANEA 3RLWH 4TT3D 2W26A 1BMAA 3K65B 5HMAA 3RXBA 4ABDA 1N6YA 1OWJA 2J98B 1MMJN 1LVYA 3KGPA 4F48B 1O2RA 1QRZA 3N99A 3A82A 3A88A 2A2XH 2Z9KA 3BN9A 5F03A 5CE1A 2J34A 3FANA 1T8OA 4KTSA 1IOEA 1TPAE 1GI8B 5FX5A 2VGCC 1HJ9A 4OS6A 2RA3A 1O3AA 1UCYK 3A80A 1THSH 5T6DA 4AB8A 4ZUHA 1IQMA 1WQSA 2OC7A 1CA0C 4Y0YE 3LGUA 4TY6A 3SQEE 2AGEX 4HZHA 1SB1H 1SLWB 1M9UA 2ZU5A 3RM0H 5A0BA 4FUEA 1O2YA 1FIZA 4LK4A 1ESTA 1O3FA 2ZHEH 1TBRH 3DSGA 1GBDA 2RDEA 1S6FA 1TNHA 1GHAF 2G52A 3VB3A 1YLNA 2PV9B 3OY5U 4TYDA 1ANBA 2WPMS 5F6MA 1HBTH 3AK5A 4I86A 2PR3A 1U6QA 1H8IH 1GBMA 5E0GA 5PTPA 3TJUA 3UOPA 4I8LA 1YPLH 1GBCA 3V0XA 3S7HB 3QTVH 3SORA 4GSOA 1GI3A 2IPHA 1BBRH 2DUCA 1VCPA 1GJ7B 1C5UA 1YPMH 3T62A 1QNJA 4AYYB 2G55A 2VWLA 5GIBA 1WXRA 1OXGA 3MMGA 3PROA 1PYTD 1DANH 4X6NA 1L1GA 1UHBA 1QBOA 3GY8A 4J1YA 5DP3A 4GAWA 1QRXA 2TGPZ 1LHCH 3CENA 1MTNB 1O5CB 1TB6H 1UK3A 2FWWA 1SGNE 5I46H 1DT2A 1Y3XA 1UCYE 2C8ZB 4IN1A 5HIYA 4CHAB 1QJ1B 2OQ5A 4E05H 5I25A 3RXLA 1UVPA 4AGKA 3GY2A 1TNJA 1BJUA 1EKBB 1O5GH 3PV4A 2AIQA 1FY8E 1QJ7B 2OD3B 3FKSD 1OS8A 1ZMJA 2ZGJA 4IW4E 1OKXA 2OLGA 2XBVA 2YMSC 2VINA 4NSVA 4Y76A 2J5UA 4TWWA 1O2MA 3I78A 4LXBH 4X2XA 4WMDA 1VKYA 3RU4T 2HVYB 3ZZ3A 2K0QA 4YTAA 1F0RA 1DDJA 5A0AE 1JWTA 1Y3UA 1FI8A 4YOJA 5E2OA 1UTMA 4KELA 1CSOE 4UFFH 4ZMAH 3PWBA 4CH2B 3MFJA 3OEHD 3IITA 1LO6A 1UJ1A 4IBLH 1Y3VA 1V2ST 1YPHC 4M9FA 1ZGIA 3K6ZA 1AZZA 1AWFH 5B6LA 1GHBF 3FP8E 2PKAB 4UONA 1BUIA 1NN6A 1C2HA 4BANB 1A4WH 1O3MA 4K1EA 1RTFB 3MNCA 4JK5A 4FXGH 3GY3A 2V0BA 1P3CA 2PLXA 3T27A 2PGBB 3U98H 5EOKA 1GBJA 3UAIC 5TCCA 1P2QA 3Q77A 1HUTH 1NZQH 2ALPA 1AY6H 2O8LA 1FLEE 1TNLA 2YNBA 3BG4B 5FBEA 6CHAB 1TA2A 4FUGA 1VITH 2JDID 4OS2A 2RA0A 2ZNKH 3QZRA 1MU6B 1TABE 1V2VT 1SGIB 2P93A 4YESB 3N7OA 2VIWA 5FHTA 4P00A 4CRCA 3O8CA 4PROA 4IMQA 4NSYA 1D9IA 1O2JA 3D49H 3RXAA 1E35B 1GHZA 2P59A 2A5IA 5L6NH 1DFPA 1GBLA 1SG8B 3GOVB 1FY5A 3LKWA 3NZIA 2GTBA 1SGCA 2QIQA 1E79D 3ZVFA 1SHHB 3ZZ5A 1Y59T 1EATA 4INHA 3V12A 4CR9A 3MU8A 1XUGA 1ARCA 2ZGXH 3RXVA 3PLPA 4INKA 4NCYA 3KF2A 3UOUA 3BTEE 1ETSH 2BDAA 1UTJA 1P09A 3EE7A 4D7GA 4R8TB 1GHWH 2BY9X 1BTYA 3CP7A 2VH0A 4ZHMU 1DY8A 9LPRA 3U1JB 1K28D 1GCDA 2Z3DA 2RDLA 1RD3B 1YKTA 1MD8A 2CF9H 3RMMH 1PPCE 1ID5H 2GVFA 2BDCA 3LPRA 1IQGA 1GL1A 3G01A 2ZP0H 1GCTB 4BNRA 2FS8A 1WYKA 3LOXA 1TRMA 1MTSA 3QX5H 3IG6B 2OP9A 1B5GH 3T28A 1YPGH 2Y81A 1P10A 3UNSA 2FLRH 1H8DH 2BD2A 1BHXF 1BMNH 5A09A 3ESTA 3UQOA 5EXLA 5JBCS 2P16A 2ULLA 5AFYH 2FESH 2ZFPH 2GZ8A 2ZO3H 1TGNA 1ELCA 2UWLA 4U30A 2OC8A 5JB8S 3QUMP 5DPAA 1C5LH 1EB1H 4UDWH 1K1NA 4Z1MD 4CBOA 2UUKB 1ELGA 3PM3A 1XMNB 5F8TA 4X1SU 6CHAC 5ABWA 2CJIA 5GCHF 1O3PB 1J9CH 1Q3XA 1FMGA 1YPKH 3E3TA 2ALVA 3LC5A 1TE0A 1D4PB 2QC2A 2KZ4A 4RSPA 4OGYA 4NA8A 2XRCA 3FVFB 2H5DA 2WHXA 1AHTH 2XW9A 3ODDA 1ELDE 3PMBB 2VVCA 4JCNA 8ESTE 4ABHA 1O2OA 2JH0D 3QZQA 1KDQB 1Y8TA 2FMJA 3I77A 4JZIA 1HIAA 4D9QA 2ZDKA 4ISLA 3Q76A 4H6TA 1ETTH 1B7XB 1MCTA 1UMAH 2GX4A 1BTWA 3ZV9A 2XCFA 1C2FA 1OP0A 2VJ1A 1V2MT 1SSXA 5L30H 4ABBA 1EP6A 1TQ7B 1UCYH 3AVZA 3F2HA 3ITIA 3N7DA 1G2LA 6ESTA 4FU9A 1K22H 1BT7A 1SC8U 1F5KU 1Q31A 4AORA 4NG9H 3RXOA 3E91A 4K1SA 1D6RA 2Z9GA 3MO3A 2ODQA 4Z6AH 1T4VH 3E90B 1C9TA 2PWXA 1E0FD 1O2NA 4THNH 2XNIA 1GBEA 1AU8A 4K5ZA 5A0CA 1GCTC 1OYTH 3SV2H 4Q63A 2ZQ1A 3OX7U 1A3EH 2FI3E 5C20A 7GCHF 3E0NB 3SU4A 3DHKH 4ABJA 2FOMB 2SGAA 4AZ2B 1MD7A 1C5QA 1BCUH 1W7GH 5DG6A 1G32B 1QB1A 3FAOA 1PPZA 1LHDH 5C1XA 2G5VA 4NIXA 3SGAE 1S85A 4R0IA 1O3EA 1SQOA 3N7EA 3V13A 1ANCA 1H8ED 1LKBA 2QE7D 1P11E 1AE5A 1GJAB 1JIRA 3GS9A 3MU1A 2Z9LA 1ABIH 5KGOA 5FPTA 4CRGA 2HNTE 3TGKE 2OC1A 2QYIA 2GDDA 4QT8C 4GCHG 1SVPA 1TNKA 3M5OA 1D6WA 2WZQA 1YYY1 3S0NA 1QQUA 2G81E 1C5XB 3T2NA 4XSKU 4ABAA 5DJ7A 1IQIA 3RXFA 2UUJB 2PHBA 1TRNA 2CHAB 4B76A 2EC9H 2SFAA 3ELAH 5E0JA 2QXIA 3ZVBA 2OCVB 1O2ZA 3VB6A 3W95A 1Y5UT 3SBKA 1YP9A 1QGFA 4JYVH 2PTCE 3B23B 2CMYA 5IDKA 4YO9A 1JRTA 2OK5A 2ZFQH 3RMNH 2GZ7A 2VVVA 1BBRE 1A0JA 1O3IA 1GMHF 2BDGA 3SHCH 3S9CA 3F9HA 4IMZA 3UB0A 3OFND 4X8UH 3SUFA 1MKWK 4IC5A 2STBE 4BAQB 6LPRA 3F9FA 1C5OH 2H2ZA 1SBWA 1HFDA 1NFWA 1MAXA 5JBBS 1GGDB 2A45B 1PYTC 1KXEA 2AGIX 2K1QA 2QN5T 2XNDD 2Y82A 3LGVA 2FOHA 1C5WB 1WTGH 2P3FH 2W3IA 1NU9A 1YPHE 3FO8D 5EGMA 4ZKSU 1OSSA 2FYRA 1BTHH 2VWNA 2Z7FE 1C5YB 1KXCA 2ASUB 4I32A 1COWD 2QF4A 1OWKA 4A5TS 5EPYA 1W11U 3RXHA 4GHTA 2SNVA 1GJBB 1VR1H 4IN2A 1C2GA 4MNYA 3U8RH 3PTBA 2HPPH 5HYOA 2EI6A 1YCPK 4M7GA 2Q6GA 4AYVB 3UTUH 3PYHA 2BOHB 2ZGHA 5FCRA 3UWJH 1DSTA 2BX4A 2XWAA 3VEQB 2HGTH 3SJOA 5LGOA 1HJAC 4B2BA 1W2KH 1CQQA 2O8UA 1ABJH 2SGFE 4MNWA 1BTUA 4NZQA 4XFQA 3BTGE 1E37B 4X1RU 2ZDAH 2PFEA 3SV6A 1F5LA 1S81A 1T31A 4MDSA 5C1UA 3P6ZB 3M3VA 4NA7A 2UUYA 2EY4C 4YT6H 1GPZA 2CHAC 3MH7A 1WQVH 4FUHA 3SU0A 2L74A 1FNIA 4F55A 4DGJA 3A81A 4B1TA 1O31A 4I8JA 3ZZ8A 2VU8E 1CA0B 1UTQA 2ZCLP 2HLDD 1NBME 1F0SA 4JYUH 1LPGB 1RGQA 2Y80A 1OP2A 3QGNB 8KME2 1C1WH 2Q6DA 3RXQA 1JMOH 2FIRH 1TIOA 1G36A 3UY9A 1MTVA 2VIVA 3DFJA 3KCGH 1K1IA 1T8LA 4ASUD 2ODYB 1V6DA 1GBIA 4JZDH 4O97A 2C8YB 4Y8YA 1ELEE 1GHYH 3KQ5A 5C0UA 1DUAA 2TPIZ 1S6HA 1LPKB 3RXKA 4X8SH 2O9QA 3M5NA 1KXAA 1WU1A 3E6PH 2PUQH 3SJ8A 1V2PT 1FY4A 1HAZB 4TSFD 2BX3A 1GGDC 1DWCH 1J16A 1O2KA 1P2KA 4WY3A 2BTCE 3C27B 1AUTC 1IHSH 1O2TA 3F9EA 2TGDA 2ZDVH 1DWBH 1YPEH 1S5SA 1HAGE 1WDIA 3MTYA 1O3HA 3F0OA 1QL9A 1GI6A 3D23A 4TPIZ 3E16B 1FY3A 1HAXB 3M5MA 1FPHH 3S7KB 1TRYA 2W7UA 4X8TH 1TBQH 1DVAH 2A31A 3GDSA 3KYFA 1HJ8A 4ISHH 3OSYA 2BD5A 3EGKH 1OWHA 1WCZA 1SKYE 4E7RG 5GWZA 3QLPH 1UVUH 1MZAA 1T7CA 2J9NA 2GMTC 2FOCA 3LH1A 5E8EH 5FPYA 3SGQE 1O2UA 2NWNA 1O38A 1OHHD 2C90B 4B74A 2F9PA 4TY7A 5JB9S 1NPMA 3M3TA 3ATIA 2QA9E 1BMLA 4A7IB 3VFEA 1YPJH 2UUFB 1HDTH 3MNBA 1GI5A 3BTME 2HNTF 2TGTA 1G9IE 1VITG 3F1SB 1C4V2 2Q6FA 4FETA 1OWIA 2C4FH 2ZF0H 1LKAA 4DT7B 1DX5M 1O30A 1T8MA 3LONA 3RXPA 3M36A 1TGCA 2VWMA 1UTOA 2IN2A 2BVSH 2YMSB 4J2YB 4TWYA 3QWCH 3RXUA 5K0HA 1IQHA 1QFKH 4KTCA 3MOCA 8LPRA 4D8NA 1N6XA 2FTLE 1UVOA 1XX9A 1HNEE 3SW2B 5C67A 2ZFSA 1UVSH 3BEFB 3GICB 1TX7A 1E38B 4SGBE 2WUCA 4B2CA 1O5AB 3MQKC 3H7OA 1WSSH 3KIDU 1V2KT 2CN0H 3RXGA 1RXPA 2QF3A 4NZLA 2FTMA 1IQJA 3GY5A 1ZHPA 2EA3A 2GT7A 1MBQA 2F9OA 2VB0A 2XBYA 5HM2A 2CXVA 2SNWA 1C1NA 1XKAC 3M37A 3EA9A 2ZFFH 1HAVA 4MNVA 2IJD1 1O5BB 1O5DH 3ZVGA 2P8OC 1G37A 3M5LA 5BRRE 4BXWA 4P02A 1EZQA 3P8OA 4YM9A 4WWYA 4X2WA 3VG8A 3BTWE 1LDTT 9ESTA 4CR5A 1MZDA 1TPOA 3A7WA 2F9UA 2A1DB 2SGQE 5C17A 1O37A 1DXPA 1Z8IB 3NCLA 1SGTA 3TITA 3GCOA 1A5IA 2P94A 4YOIA 1AGJA 3SUDA 3TPIZ 1VGCB 4K2YA 4WH8A 2JETB 2BY6X 1ZYOA 3A89A 1EOJA 1EP5A 4OS7A 3LT3A 2QF0A 5EQRA 3SJIA 2JJ1D 4Y79A 2TGAA 1CGHA 3WWBA 1MQ6A 4ZKOU 5EXMA 1DSUA 2W7SA 3NK8A 1UTPA 3A7ZA 4FU8A 1IQLA 4HI3A 1MU8B 3B8JA 4X0WU 1GJDB 1QL7A 1THRH 5GCHG 3RXJA 4AC9A 2I6SA 2ZU1A 2BD7A 2FO9A 3TJOA 2J2UA 1Z71A 1MBMA 3RC6A 4AN7A 1NY22 5E2PA 1YWUA 2ODPA 3ZZ6A 1BQYA 1K1JA 4AX9H 3DCLA 1QQ4A 2GV7A 1AVXA 1GI9B 1F7ZA 3QGJA 3A84A 3SJKA 2BQ7B 4E7NA 3PO1C 2WINI 4A6LA 2NU4E 1G3DA 3A7XA 4XDEA 1NROH 3AAUA 2J98A 3JZ1B 2B5TB 4AFSA 2NU3E 3SN8A 1GVZA 2YOLA 1MKWH 5JYIA 1K2I1 1TONA 3GY7A 2BOKA 1RRKA 5EQSA 1C4U2 1FDPA 3KYGA 1MTWA 2G4UA 5FCKA 3BIVH 1O2QA 5DP7A 4B75A 2HRVA 3M7TA 3TH3H 3OYPA 1O2SA 2WPKS 3P95A 2ZIQH 3QK1A 5H4IB 1GI1A 3FFGA 2ANKH 2AHME 5T1VA 3STJA 1CBWC 4KTUA 2KAIB 1C1RA 2BHGA 3NKKA 4Q7ZA 2FPZA 1INCA 2BY8X 1GI4A 2CGAA 7GCHG 1VITF 1KIGH 5JPMH 3RXEA 1C5ZB 2AFQB 1W0JD 3ZVCA 1YBWA 3RC5A 1VGCC 2JETC 3HGNA 1YCPH 1DICA 2ZHFH 2PUXB 3TJNA 5EG4A 1YLDA 4Y7BA 5L2ZH 2Q1JA 1EXFA 1EB2A 1SQRA 3PTNA 1TX8A 1V2RT 1S6LA 3MNSA 1JRSA 1CT2E 3GISB 4I7YH 4Q80A 1P2JA 3KQBA 2KCAA 5EJZA 3GYLB 4ZH8A 3A8AA 1K21H 1TPPA 1EZSC 2ZKSA 1GJ4H 1Y5BT 5GXPA 2W6ID 1G30B 4MPUA 1W12U 3IWMA 1AD8H 1P2OA 1ZMNA 3A8BA 1SQAA 1HPGA 3MH6A 2BM2A 4ISNA 3AW0A 3E1XB 1S0RA 2H6MA 1VCQA 1C2EA 1V2OT 2QF5A 4X2YA 1V2LT 4CREA 2AEIH 5CHBA 1EAWA 1QIXB 3PB1E 3RP2A 1RFNA 2GKVE 3KQCA 2V7QD 2GP9B 4NWKA 1W10U 2FOFA 3ATMA 1BITA 2J95A 3I29A 1AFQB 1SLVB 1TNIA 4X2VA 5GJ4B 2G00A 2ZG0H 5C3NA 1GBHA 3OAAD 2ZDLA 2FEQH 4MPVA 1EAUA 1HGTH 2QCYA 3PRDA 3SNEA 2ZA5A 2A4QA 1WAYB 2LNCA 3ZZAA 1GMHG 3QN7A 1SFIA 3LU9B 1GG6B 2V3HH 1Y5AT 1OOKB 2A7HA 2IOTA 3ZYDA 4NFFA 1T4UH 1AO5A 4MVNA 3M61U 1Z7KA 1PPHE 1TBZH 1QJ6B 3TGIE 2ZTXA 3TH2H 4A1TA 3RXMA 5DK1A 4OGXA 1H9HE 3LJJA 1J8AA 1TOMH 3F2GA 2VIQA 2STAE 2F9NA 3C1KA 2O8WA 3P8FA 3LGIA 2W5EA 1DUEA 1YGCH 3U9AH 2BLVA 5LPFA 3W94A 2H5CA 5ETXA 3TIUA 1XKBC 3MU5A 2BVXH 3H5CB 2PP6A 3WY8A 1LHFH 1NO9H 5LH8A 3BF6H 1W14U 1Z1JA 1SGFA 2OTVA 4NGAH 1TALA 2ZPRA 2PKAA 4WVPE 2ZECA 1GBAA 1HAPH 1GBFA 1BB0B 1EPTB 1GBTA 1BRCE 2SGEE 3UR6A 1O3LA 3D65E 2ANYA 1GJ8B 3U1IB 2RFKC 2Y7XA 1ELTA 4K69A 5TJXA 1SOTA 2KAIA 1C5VA 2BLQA 4BAMB 2Y5GA 1HRTH 1SLXB 3HPTB 1P9SA 1KMHB 5JBTA 4UE7H 1OP8A 1HAYB 1ZTKA 1AFQC 1KTSB 1NESE 4LZ4B 4Z0KA 4BTUB 2BD8A 3HATH 1ZLRA 3SQHE 3F3BA 1O3KA 1KSNA 1MABB 4RN6A 4INLA 1LHGH 3LIWA 1XXFA 2EEKA 4ZXXH 1YC0A 1P2NA 3NPSA 2YNAA 2WV9A 4CH8B 2F4LA 4K8BA 1C4Y2 1GG6C 2Y5FA 2A5AA 1D3PB 2PSYA 4Y10E 3NXPA 4XBDA 1IQEA 4K3JA 1DY9A 1ZMLA 1C1OA 5IYTA 2ZEBA 2WSSD 3ZV8A 4ACBA 2V35A 2Y7ZA 1JOUB 3SV8A 1O2XA 2GCTC 3SOSA 3ATKA 3KQEA 3RMOH 2DE8A 3VPKA 1YLCA 1EFRD 1KXFA 4AFUA 1XUKA 1PPGE 1C1VH 4I31A 2OXSA 2VBCA 1HJAB 3K6YA 1SOZA 5KEDA 1ZPZA 2A4GA 4BTIB 2BXTH 4FUFA 4ABGA 1EZXC 3RXDA 1FAXA 3LGYA 3JZ2B 3F2FA 1MAYA 1Y3YA 3FP6E 5SGAE 2LP6A 3UR9A 3LDXH 1TYNA 4CRFA 2R3UA 1UTLM 1EPTC 1MH0A 1ZPCA 3KQDA 3SNAA 1K1OA 3GCTF 3ZVAA 1BZXE 1H4WA 5HM9A 4ZKRU 2BXUH 3L33A 3SI3H 4CRAA 1DPOA 4JYTA 2W6JD 3MU0A 3A7TA 5J4SA 2ZTZA 1AWHB 3KL6A 1AB9B 3EYDA 2QXHA 4YT7H 3Q3KA 1C9PA 4HGCA 1ZTLA 3Q3YA 1PPEE 1PQ7A 1P06A 1EJMA 1FPCH 3ODFA 2H9EH 3EA8A 1GI7B 3EA7A 1UW7A 2R9PA 3GCNA 1BRUP 2M5TA 1KDQA 3RM2H 4AGJA 1AUJA 3GDUA 3PMHB 3SU6A 5LPEA 1OX1A 2A7CA 3A86A 1G2MA 1CGIE 4IGDA 4A1XA 3L6PA 4D7FA 5C2ZA 4BTTB 3SV9A 3RUOA 1AIXH 4FUIA 3E8LA 1L0ZA 2BY5X 3RXIA 2XXLA 3A8DA 3QO6A 3SJ9A 1A0LA 1P2IA 3F9GA 4B2AA 3WW7A 3O8DA 4WF8A 1NRNH 2GMTB 3VXEH 3ZIAD 3LC3A 1TPSA 2FOEA 1C1QA 3A85A 3F6UH 3HK6B 3MYWA 3BEUA 3MNXA 1SGDE 1NRSH 2ZCKP 4IS5A 3BTKE 4JZEH 1X7AC 2QAAA 2VNTA 3BTTE 2WYGA 1FUJA 2D26C 2R2MB 2BQWB 3GCHC 2GZ9A 4FVDA 4LZ1H 3FZDA 1E36B 2BD4A 4GLYA 2CV3A 5ESBA 1PQ8A 5EU8A 2PW8H 1H9LB 2XTTB 4B6FA 2WV5A 1DM4B 5FPSA 2FYQA 1G3BA 1LQEA 1LTOA 4ISIH 1KLTA 2Y5HA 1DXWA 1G3CA 1AB9C 4YLUA 1O3DA 1P57B 3PLKA 5IK2D 4X1NU 5BPEA 3FP7E 3L3TA 4BAKB 1O33A 1QBVH 3ZYEA 1BDAA 1PJPA 4K60A 1E34B 2FDAA 4B71A 3H7TA 1QTFA 2VIDA 4GHQA 1ORFA 3EDXB 4ABEA 5A2MH 1UK2A 1ZRKA 2BDIA 3ATLA 5DGJA 1ANDA 1S83A 1V2UT 2FOGA 2UWOA 5L2YH 1EAIA 3V3MA 1C5NH 1PFXC
chains in the Genus database with same CATH topology
3CS7A 1UTNA 3VB4A 1ZJKA 1GJ6A 4HFPB 2P8OB 4OS5A 2ZDMA 1GBKA 4FUDA 2J92A 3GYMA 4KGAA 1ZGVA 1JXPA 1J15A 2HOBA 1A5GH 1BOQA 3UWIA 2FZZA 4KKDA 1GJ5H 1Z8JB 2QXJA 2HWLB 1UK4A 3A83A 1UO6A 1CVWH 1O2VA 5C5NA 1OWEA 2QGRA 1NM6A 1SQTA 2Y6TA 2BQ6B 1GHXH 2P3UB 2ZZUH 3T25A 1PQ5A 2RG3A 4U32A 5EXNA 3RU4E 1O35A 2GCHF 2R3YA 1A3BH 2ZGCA 4I33A 3TNSA 2F83A 1AKSB 3RLYH 1PQAA 3SGBE 4UEHH 1TGSZ 4UD9H 4JMYA 1JBUH 2H9HA 1B0FA 1F92A 1FN8A 1QCPA 1TX6A 3HKJB 3O8RA 2ZHWH 4NFEA 1SGFG 1GL0E 2GT8A 3ZZ7A 1CA8B 4WXVA 2LPRA 1HAIH 4UFGH 3QDZB 4DCDA 3UQVA 3MHWU 1IAUA 4DY7B 3EQ0H 3SO3A 1DWEH 3OTJE 2C93B 2AMQA 1QY6A 4GVUA 1TFXA 2BLOA 2JKHA 3UREA 3UFAA 1PPBH 5DP8A 3PO1B 5FAHA 3AAVA 2J94A 4H4FA 1TGBA 3STIA 2A4RA 5C1YA 2PTNA 1AFEH 2ZDNA 2DE9A 1T8NA 2OC0A 1ZOMA 2OBQA 4O9VA 1WUNH 1SLUB 1ZPBA 1V2JT 2J38A 2B9LA 4I8GA 1PPFE 5F8ZA 3S9AA 2G51A 1J14A 1BJVA 2GGVB 5FX6A 2FOBA 3KEEA 1NRPH 1C2LA 2W3KA 1L1NA 1MQ5A 1LPZB 3MO9A 1CBWB 1MKXK 4D9RA 1C5RA 3SV7A 1CU1A 2NU2E 4Y7AA 3GY4A 1LVBA 2I6QA 1GVKB 3NWUA 5JDUB 1VCWA 2AS9A 4BOHA 1BRAA 2FI4E 4AB9A 5LPRA 2G5NA 1DWDH 1ESAA 1P12E 2WPLS 2ZPSA 1V2QT 2HNTC 1K1LA 1DLEA 4Y8XA 4WXIA 7LPRA 1FZZA 1TLDA 2WPIS 2SGPE 4MPXA 2FP7B 2V6NA 3DUXH 2F9BH 4Q7XA 4NIYA 4RKJB 1IHTH 1FIWA 1WOFA 3RXSA 3A87A 4FUBA 1DLKB 5E0HA 3T5FH 1LCYA 1SMFE 2VH6A 4FVBA 3UPEA 3DA9B 4UFEH 3M35A 5TCAA 2A5KA 1P8VC 1SL3A 1NFYA 1RS0A 1P2MA 1HAOH 2R0LA 3Q00A 4DG4A 1O0DH 1FONA 1C1MA 1C5TA 1O3NA 2THFB 3P70B 3V7TA 1KY9A 4O03A 3ZVEA 1XXDA 1Z6JH 4K8YA 2ILNA 1O2GH 2BDBA 1CT0E 1GMCF 5T3HA 1QHRB 1MTUA 2TRMA 1AI8H 1BA8B 1GDQA 1D3TB 1RTLA 2JH5D 2V3OH 4A92A 1VJ9U 1C2IA 1XUHA 1ETRH 2HALA 3MH5A 1A5HA 1A2CH 1BRBE 1C2JA 1GMDG 1BTXA 1GVLA 2ZU2A 3HGPA 1ZR0A 5A8ZA 2BD9A 4JK6A 1YM0A 2OBOA 1ELFA 4OS1A 1GWAA 1K1MA 3VGCB 1AKSA 1IQKA 2P3TB 3EE0B 2F91A 2C8XB 1HIAB 1TWXB 1TMTH 4ABIA 2XBXA 1KTTB 1L4DA 4Y0ZE 4CRBA 4WMEA 2QV1A 4FUCA 1EJAA 4WJG2 1VJAU 2FXRA 1ZRBA 1N8OB 4I8KA 4ZROA 2OINA 2WV4A 1GHVH 4E06H 2AMPA 2ZTYA 4X6OA 2VIOA 4O3UA 1Z8GA 3K9XB 1SHYA 1C5MD 2NU1E 2ZU3A 1THPB 4Q2KA 3BEIB 4H42U 4U2WA 4Y11E 5AHGH 4SGAE 1QA7A 1HB0B 5F8XA 5EPNA 2PGQB 1MTNC 2A4OA 1EUFA 3SNBA 1AZ8A 3P17H 3BTDE 1NFUA 1J17T 2VVUA 3QTOH 4AFQA 1A46H 5FXLA 4CHAC 1CHGA 3TGJE 1LVMA 4NWLA 4A1VA 2P95A 3RXCA 1P9UA 3TK5A 3ZZBA 2ZHQH 4YOGA 1LVOA 1B0EA 7KMEH 4DURA 4U01A 1O39A 1SGPE 1NTPA 4ABFA 3A8CA 5J4QA 3NUMA 4X1QU 4F49A 1SPJA 1F0TA 2XC0A 3RC4A 1BHXB 2BMGB 2C3SA 4MTBA 3A7VA 5HXFA 1O3JA 3GCTG 3ZZ9A 1A0HB 3DD2H 2ZC9H 5GPIB 4JZ1A 1Z8RA 3RDZA 1XUIA 1A61H 1EASA 2F3CE 3FZZA 1FY1A 2AGGX 1EJNA 1HLTH 2IJOB 3MO6A 1LHEH 1QRWA 4F4OC 1QL8A 4K1TA 2D1JA 4LOYH 1SI5H 3E0PB 3VGCC 1C5SA 1O2WA 1AVWA 1XM1A 3A7YA 3P8NA 4OS4A 4DJZB 1N1LA 1F5RA 3TU7H 5DP4A 4XBCA 1C1PA 2BYAX 1CHOG 2BZ6H 3RXRA 1KLJH 7ESTE 3BIUH 1C1UH 1KXDA 1YF4A 1FV9A 4HTCH 3LH3A 3ZZ4A 4BAOB 4AG2A 1G3EA 1GI2A 2GCTB 1SGYE 1N8OC 3SNDA 2FOAA 1TAWA 5CHAB 3SU5A 5DP5A 4BXSA 3URCA 8GCHG 4KP0A 4AG1A 2GDEH 1MCVA 2BDYA 3EAJA 5EODA 3SU1A 1GI0A 1CT4E 4MPWA 2BDHA 4B73A 3BSQA 2BD3A 2Z9IA 1A7SA 5HGGA 3AASA 2ZGBH 2VIPA 2F9VA 3BG4C 5DKMA 1ZSJA 1AN1E 3O8BA 1Y3WA 1ELBA 1EQ9A 2FLBH 4VGCB 1GJCB 4AFZA 1O3CA 2ZFRH 2XYAA 4XBBA 5G4BA 1P3EA 3VB7A 2ZI2H 3SUGA 5DP9A 4NIWA 1UVTH 1XVMA 1TA6A 1QR3E 1EAXA 2A2QH 2C8WB 4O3TA 2ANMH 1W0YH 3OY6U 4X6PA 1Z1IA 5AVDA 1C2KA 1NC6A 3HK3B 4FUJA 3M7UA 5EW1H 3MWIU 3KN2A 2RCEA 2Z3CA 1GMDF 3U69H 5FBIA 1ZHMA 1W8BH 3PWCA 3TK9A 3PLBA 4MLFB 3HKIB 1GBBA 1WBGB 3TVJB 2PSXA 1ARBA 2BZAA 1V3XA 5CMXH 1ACBE 2BLWA 3ZZCA 3TNTA 1O32A 5GDSH 2TIOA 2G8TA 1EOLA 4DIHH 3D62A 1F0UA 1DITH 4X8VH 5JBAS 2UWPA 2A7JA 2GD4B 2ZFTA 1O36A 1Z6EA 2A0QB 1S0QA 3TK6A 3RMLH 2Z6BD 2ZWLH 3TJVA 1T32A 3OU0A 3M3SA 3BTFE 1BBRK 1NT1A 1D3DB 1KXBA 3R0FA 2B8OH 4ESTE 1P04A 2H1UA 4I8HA 3UUZA 3DFLA 4ASHA 3GDVA 1FQ3A 1BTPA 3LGTA 2VWOA 3LGWA 4NIVA 3SU3A 2SGDE 1W7XH 3TLOA 4RKOB 1MKXH 5CHAC 3DT0H 5T6GA 2J4IA 1WV7H 2ZHDA 2WPJS 1P0SH 2AH4X 5AF9H 1Q2WA 4YLQH 3R3GB 3ZVDA 2PKSB 4Q7YA 2HVXA 2HPQH 4DIIH 3P8GA 1XVOA 1P03A 1QBNA 3P92A 1V2WT 6GCHG 2BVRH 2XWBI 4WMFA 2XCNA 1ELAA 3SUEA 5EW2H 1XUJA 4VGCC 1O5FH 1NRRH 4TPYA 3RXTA 1MUEB 1TGTA 4ZAEA 1QB9A 2ZU4A 3GCHB 1AE8H 1HCGA 3CS0A 1GJ9B 1CO7E 2FS9A 3T26A 2AIPA 1VZQH 1O2IA 3LJOA 3PMJA 1O3OA 1ZJDA 4DVAU 3M7QA 2B7DH 1TMBH 1DOJA 2OQUA 3U8OH 4BAHB 2ANWA 1TQ0B 3VB5A 4DW2U 4GUXA 2AERH 2GCHG 4X6MA 2JH6D 2Z9JA 2QY0B 2AYWA 2ZPQA 1O2PA 1C2DA 3U8TH 1TNGA 1CHOF 1LMWB 2CF8H 2EI8A 2D2DA 1NRQH 3UIRA 2G4TA 5T6FA 2HLCA 4MQAA 1AQ7A 3MH4A 3ENSB 1O3BA 1S82A 3VXFH 2D8WA 4H6SB 1C1TA 2R2WU 1QA0A 8GCHF 4ZHLU 4X1PU 5C5OA 3MI4A 3PMAB 1O2LA 1SR5C 2XC4A 1V2TT 1XUFA 1EPTA 1W0ZU 1AVGH 2XBWA 1CE5A 3URDA 1L4ZA 3TH4H 1V2NT 5DO4H 2ZCHP 1W3CA 1FAKH 1O3GA 2Z3EA 2AMDA 1GDUA 3K2UA 3S69A 2GV6A 1O2HA 1RIWB 2WPHS 1FN6A 1TMUH 1L1JA 1S84A 4UFDH 4XE4A 4Y6DA 5AFZH 1WTHD 2BB4A 1L2EA 3SHAH 1GHAG 2FX6A 1IQNA 3GY6A 2PKSC 1C5PA 1CGJE 1FJSA 2B0FA 1P02A 4ZHAA 4MNXA 3Q3XA 1H9IE 3AW1A 3BTQE 5A8XA 2TBSA 2ESTE 1BTZA 5DP6A 3KHVA 5A8YA 1A1RA 1ZTJA 4XOJA 1ZZZA 2A32A 4CBNA 1ZSKA 1ESBA 1GDNA 5EQQA 1IQFA 4NA9H 1QB6A 1OYQA 1HAHH 1TOCB 1SGQE 1NU7B 3SZNA 1HV7A 1NFXA 5ESTE 3ZZDA 1HAVB 1RJXB 1ZHRA 2FODA 2VGCB 5B6OA 3BG8A 3RU4D 4IC6A 1ZSLA 3SU2A 4CRDA 1UTKA 4ISOA 4JZFH 5K7RA 3BTHE 2FM2A 2BY7X 4WH6A 2WUBA 2ZQ2A 2O8TA 1LQDB 2QXGA 1DE7H 1BIOA 1UHBB 2NU0E 4GPGA 1C1SA 3BV9B 4YZUA 3MU4A 3B9FH 4Y71A 2WYJA 2O8MA 2OUAA 2Z94A 3SI4H 3UNRA 3KNXA 1O5EH 1AMHA 1KYNA 2FI5E 1YCPM 1HXFH 3T29A 4ZXYH 1F2SE 1KLIH 1P05A 1K9OE 1OPHB 1K1PA 4MG3A 4ZKNU 1GMCG 3S9BA 2XC5A 1OWDA 1EX3A 1QURH 1FXYA 1O34A 6GCHF 4D76A 1P01A 3SNCA 1W13U 2FX4A 1C2MA 3ATWA 1JIMA 1RIWC 4Y8ZA 4GCHF 2EI7A 1BMMH 1D3QB 1HYLA 3UNQA 4FU7A 1ELVA 2R0KA 1DS2E 3F68H 1NS3A 1SFQB 1SGEE 1SGRE 1RTKA 4AOQA 4DOQA 1H1BA 1HXEH 2H9TH 1EZUC 1GHBG 1ANEA 3RLWH 2W26A 1BMAA 3K65B 5HMAA 3RXBA 4ABDA 1N6YA 1OWJA 1MMJN 1LVYA 3KGPA 1O2RA 1QRZA 3A82A 3A88A 2A2XH 2Z9KA 3BN9A 5F03A 5CE1A 2J34A 3FANA 1T8OA 4KTSA 1IOEA 1TPAE 1GI8B 5FX5A 2VGCC 1HJ9A 4OS6A 2RA3A 1O3AA 1UCYK 3A80A 1THSH 5T6DA 4AB8A 4ZUHA 1IQMA 1WQSA 2OC7A 1CA0C 4Y0YE 3LGUA 4TY6A 3SQEE 2AGEX 4HZHA 1SB1H 1SLWB 1M9UA 2ZU5A 3RM0H 5A0BA 4FUEA 1O2YA 1FIZA 4LK4A 1ESTA 1O3FA 2ZHEH 1TBRH 1GBDA 1S6FA 1TNHA 1GHAF 2G52A 3VB3A 3OY5U 2PV9B 4TYDA 1ANBA 2WPMS 5F6MA 1HBTH 2PR3A 1U6QA 1H8IH 1GBMA 5E0GA 5PTPA 3TJUA 3UOPA 4I8LA 1YPLH 1GBCA 3V0XA 3S7HB 3QTVH 3SORA 4GSOA 1GI3A 2IPHA 1BBRH 2DUCA 1VCPA 1GJ7B 1C5UA 1YPMH 3T62A 1QNJA 4AYYB 2G55A 2VWLA 5GIBA 1OXGA 3MMGA 3PROA 1PYTD 1DANH 4X6NA 1L1GA 1UHBA 1QBOA 3GY8A 4J1YA 5DP3A 4GAWA 1QRXA 2TGPZ 1LHCH 3CENA 1MTNB 1O5CB 1TB6H 1UK3A 2FWWA 1SGNE 5I46H 1DT2A 1Y3XA 1UCYE 2C8ZB 4IN1A 4CHAB 1QJ1B 2OQ5A 4E05H 5I25A 3RXLA 1UVPA 4AGKA 3GY2A 1TNJA 1BJUA 1EKBB 1O5GH 3PV4A 2AIQA 1FY8E 1QJ7B 2OD3B 1OS8A 1ZMJA 2ZGJA 4IW4E 1OKXA 2OLGA 2XBVA 4NSVA 2VINA 4Y76A 4TWWA 1O2MA 3I78A 4LXBH 4X2XA 4WMDA 3RU4T 3ZZ3A 4YTAA 1F0RA 1DDJA 5A0AE 1JWTA 1Y3UA 1FI8A 4YOJA 5E2OA 1UTMA 4KELA 1CSOE 4UFFH 4ZMAH 3PWBA 4CH2B 3MFJA 3IITA 1LO6A 1UJ1A 4IBLH 1Y3VA 1V2ST 1YPHC 1ZGIA 3K6ZA 1AZZA 1AWFH 1GHBF 3FP8E 2PKAB 4UONA 1BUIA 1NN6A 1C2HA 4BANB 1A4WH 1O3MA 4K1EA 1RTFB 3MNCA 4JK5A 4FXGH 3GY3A 2V0BA 1P3CA 2PLXA 3T27A 2PGBB 3U98H 5EOKA 1GBJA 5TCCA 1P2QA 3Q77A 1HUTH 1NZQH 2ALPA 1AY6H 2O8LA 1FLEE 1TNLA 2YNBA 3BG4B 5FBEA 6CHAB 1TA2A 4FUGA 1VITH 4OS2A 2RA0A 2ZNKH 3QZRA 1MU6B 1TABE 1V2VT 1SGIB 2P93A 4YESB 3N7OA 2VIWA 5FHTA 3O8CA 4CRCA 4PROA 4IMQA 4NSYA 1D9IA 1O2JA 3D49H 3RXAA 1E35B 1GHZA 2P59A 2A5IA 5L6NH 1DFPA 1GBLA 1SG8B 3GOVB 1FY5A 3LKWA 3NZIA 2GTBA 1SGCA 2QIQA 3ZVFA 1SHHB 3ZZ5A 1Y59T 1EATA 4INHA 3V12A 4CR9A 3MU8A 1XUGA 1ARCA 2ZGXH 3RXVA 3PLPA 4INKA 4NCYA 3KF2A 3UOUA 3BTEE 1ETSH 2BDAA 1UTJA 1P09A 4D7GA 4R8TB 1GHWH 2BY9X 1BTYA 3CP7A 2VH0A 4ZHMU 1DY8A 9LPRA 3U1JB 1K28D 1GCDA 2Z3DA 2RDLA 1RD3B 1YKTA 1MD8A 2CF9H 3RMMH 1PPCE 1ID5H 2GVFA 2BDCA 3LPRA 1IQGA 1GL1A 3G01A 2ZP0H 1GCTB 4BNRA 2FS8A 1WYKA 3LOXA 1TRMA 1MTSA 3QX5H 3IG6B 2OP9A 1B5GH 3T28A 1YPGH 2Y81A 1P10A