4NFEA

Human kallikrein-related peptidase 2 in complex with benzamidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
227
Chain Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-2
total genus 51
structure length 227
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA01
1EZQA 3ATMA 3BG4B 1C2EA 1TALA 1OYQA 2Z94A 3GICB 1AMHA 2FI3E 3WY8A 2ZDLA 3PTNA 3TITA 3MNBA 4IGDA 1GBFA 1MAYA 1SHYA 1TGSZ 1TRMA 1UTLM 2D26C 4ZH8A 2PGBB 2W7UA 4ABDA 1DFPA 1TNKA 1TMBH 1MCVA 2ZQ2A 4FUIA 2SNVA 3CS7A 1HXEH 5LGOA 5TCCA 1AFQC 1O3LA 1AB9C 4LXBH 3L6PA 1OP2A 4X2WA 4Y79A 3HK6B 3RXSA 1TOMH 1WBGB 4A7IB 1HNEE 1MTNC 1O33A 1THPB 2J92A 3LU9B 4LOYH 1OSSA 2AFQB 2A5KA 4I32A 1NU7B 2A2QH 5EXMA 7ESTE 3RUOA 1M9UA 3EA9A 1A1RA 2FX6A 5GCHF 2EI7A 4O3UA 3KQBA 5F8TA 1HJAC 1IHTH 3ITIA 1N6YA 4WXVA 2HNTE 4AFQA 1C2DA 1TONA 1O3IA 4Y7AA 6GCHG 4A5TS 1DE7H 1GI3A 1DUAA 4JYTA 4A1VA 2OD3B 3RLYH 1ANDA 8GCHF 4FUJA 1HAZB 4ZHAA 1PQAA 3AW0A 4MLFB 5DP6A 3S0NA 3PTBA 1DLKB 2UUJB 4MPXA 3SUDA 4Y0ZE 1C5QA 2BDIA 2GX4A 4DW2U 1FAXA 1Y8TA 4HZHA 1J8AA 3RU4D 5EW1H 1O3AA 1SHHB 1UVTH 3RXVA 3ATWA 3RU4E 2XWBI 2GTBA 2ZCLP 4CBNA 3CENA 2RA0A 2QF0A 3BEFB 1O2NA 2CF9H 3VXEH 3UOUA 2ZU3A 3MYWA 1GMHG 3GY2A 8LPRA 2VWLA 5C20A 1C9PA 1OYTH 4JZFH 1O3BA 1ZSLA 2OC7A 1C5NH 2XBVA 2EA3A 4OGYA 1P8VC 1QB6A 3Q3XA 1GHAG 5FBIA 5JB8S 2V35A 1GMCG 3TK6A 2ZPSA 1G3EA 3ZVBA 3UUZA 1V2OT 1O2SA 1JWTA 2BTCE 2VGCB 1AE5A 1O3DA 1YCPK 3GY5A 1VITF 2JKHA 1QIXB 2AMPA 4NWLA 2BLVA 1ETRH 5DPAA 2XW9A 2XBYA 1N6XA 1G3CA 3DFJA 1LPZB 5E8EH 1O3PB 3D23A 2C3SA 1F0RA 4AFUA 3U8OH 2FXRA 1OXGA 1XVMA 4YOJA 1YM0A 3GCNA 2B7DH 3EGKH 3RC6A 3KQDA 3SV6A 2VH0A 4DCDA 1MTUA 4AYYB 2G4TA 3UY9A 3MH6A 2BLOA 4Z6AH 1C5XB 1XX9A 2OP9A 1NTPA 2HWLB 2QXHA 4YO9A 1QBVH 4OS1A 4K8YA 1O3NA 1FI8A 1ELTA 1C5RA 5FPYA 5HGGA 1UVUH 1WSSH 1GBLA 2F9PA 2BD4A 3ZZ8A 2J38A 3M3TA 3SGBE 1XUGA 4HI3A 1ELBA 2FS9A 2FO9A 2SGEE 3MH7A 1BT7A 5HM2A 4TYDA 1L1NA 1X7AC 1ZSJA 3A7YA 1GBEA 4VGCC 2QA9E 1HV7A 5JBBS 3OY6U 1CGJE 1BJUA 2TGTA 1CQQA 5DP3A 1GJDB 5FAHA 1CHGA 1LHDH 3E0PB 1AGJA 2BQ7B 3V3MA 1OWHA 1ID5H 1XUKA 1HAXB 4IBLH 1XUIA 1C1RA 1BBRK 5F6MA 2HRVA 1BA8B 4X8TH 2JH5D 1O2RA 4E7RG 2C4FH 1AVWA 2ZHWH 1K9OE 1YPKH 2KAIA 2ZDMA 1W8BH 1BTUA 3UREA 4JZEH 1QRZA 2Z9LA 4JK6A 3R0FA 3RMOH 3MO6A 4K69A 5IYTA 4DY7B 3KL6A 3QGJA 2WV5A 4ISNA 3SO3A 3SU2A 2PV9B 1HAYB 4ABHA 4AOQA 1TFXA 3B8JA 5JB9S 1H8DH 3RXFA 1E35B 4AFZA 4CRAA 4I8HA 2Y82A 1E0FD 3AAVA 5DO4H 2SGPE 2VU8E 2ZDKA 1F2SE 1O2LA 2WYJA 1TNJA 1HXFH 2QC2A 3ZZ7A 3Q3YA 1QURH 1L4ZA 4FUBA 1TX8A 1DT2A 3BF6H 3D49H 2SGFE 4AG1A 2IPHA 2FOGA 2FOBA 2O9QA 4UD9H 1C2MA 2GDEH 5BPEA 3Q77A 4X6OA 3A81A 1JRTA 4DG4A 5GPIB 1AE8H 2BM2A 1KXEA 2H9HA 1UCYE 3F9FA 1LMWB 4XBCA 1LVMA 1GVZA 1VGCB 5DJ7A 3SJ8A 3B23B 2YNBA 5F8ZA 1QRXA 1C2FA 1KSNA 1SQAA 1P2MA 5ESTE 1E37B 3W95A 4H4FA 4UFEH 1DY9A 3ZVAA 2ZHEH 3MOCA 4NIVA 3QZQA 1Z71A 2BYAX 2BX4A 1GHVH 3STJA 4NIWA 2GP9B 1Y3UA 2FLRH 2BD9A 1FONA 1QL8A 2ZGBH 4R0IA 1SGDE 1GI5A 2A4QA 2P8OC 1GPZA 3SU3A 1TPAE 2J34A 1S81A 3TIUA 4JYVH 2BDBA 2GZ9A 2A45B 1UHBB 2HGTH 1RJXB 3A89A 1MD7A 9LPRA 1EKBB 1AWFH 5EODA 3QLPH 2AMDA 3GY3A 1ZSKA 1P57B 2XCFA 3EQ0H 3M35A 1FY4A 8KME2 3U8TH 4IMQA 2H5CA 1GCTB 1KTTB 3U1JB 1CGIE 2PSYA 5L2YH 4U01A 4B2AA 1C5VA 1EAXA 1S6FA 2BD8A 4INHA 1O3HA 1G2LA 1P09A 2ZO3H 1GMDF 2G51A 3M5NA 2QV1A 1O3EA 2DE9A 3RP2A 4YT6H 2B9LA 1AIXH 2NWNA 1TNHA 3MO3A 5JBAS 1THSH 4AZ2B 1SVPA 4X1QU 3UQOA 2WPMS 3FP7E 1RIWB 4ISOA 4INKA 4ZAEA 4AG2A 1A7SA 1ETTH 1QCPA 3ZZ6A 1JIRA 1UTMA 4K8BA 4K5ZA 3LJJA 1P06A 3KGPA 1BUIA 4BTUB 1O2WA 3S69A 1HFDA 1RRKA 3I78A 3BTGE 5JYIA 1UK4A 1W7GH 1LKAA 3OSYA 6CHAB 1SGRE 1HAOH 1H9IE 4Y10E 3QDZB 2GKVE 4NWKA 5EPNA 5GWZA 1GMDG 3HGPA 1C2GA 2PWXA 1CHOF 1N8OB 1EZUC 1Y5UT 2F9NA 2WV4A 4CREA 2QN5T 4GUXA 4WWYA 3NPSA 3NUMA 4TPYA 4ZHMU 1DWCH 3E0NB 4U30A 2J9NA 1K1NA 1SGCA 3UNSA 2ZECA 4Y76A 3LONA 3RXIA 1C1PA 1CSOE 8ESTE 1HB0B 1ABIH 1SGEE 1AKSA 3BEUA 2VNTA 1LO6A 5A8XA 2BHGA 1GG6B 1CE5A 3UNQA 2ZZUH 3M37A 1GBIA 1SI5H 3M5OA 4GCHG 2V3OH 1L0ZA 2WPIS 5G4BA 4NSVA 1U6QA 2ZEBA 3SU6A 1GHYH 3MU5A 1Q3XA 1EXFA 1ESTA 1A46H 3MNCA 5FXLA 3RXMA 2ZKSA 4K1SA 4KELA 3ZZ9A 4K1EA 3FP6E 2FLBH 3VB5A 1GHBG 4JZDH 1GBCA 1BHXF 3UWIA 1ARBA 2ZU5A 3PROA 2BDCA 3RXCA 4BTIB 2Q6GA 1D3PB 3E16B 1MQ6A 4WY3A 2ZCKP 1FIWA 2CN0H 2F9OA 1QHRB 1BCUH 3I77A 4FXGH 4I31A 2TRMA 1NY22 4ABGA 4TY7A 2ZNKH 4B75A 3SUGA 1AQ7A 3SORA 1C4Y2 1W2KH 3GY7A 4RSPA 2QYIA 2Y7XA 3H7TA 1OP8A 2OC8A 4KTSA 1UVOA 1P2JA 1S85A 1FQ3A 1EZSC 1EAWA 3VB7A 1T32A 4MVNA 3BV9B 2BY9X 3EE0B 1YLDA 1YP9A 1HAIH 3SNEA 1H1BA 3OU0A 2FDAA 1KTSB 2Y6TA 1ZTLA 4WMFA 1V6DA 3M5LA 3O8BA 3SJIA 2HPQH 4X8SH 2VGCC 1MKXK 3A88A 1ZRBA 4O9VA 5BRRE 2IJOB 1O3OA 1PYTD 1TNIA 4ZXYH 1G3DA 1CA0B 4NFFA 2A4OA 1HBTH 3LJOA 3ELAH 2RCEA 1LHCH 3BEIB 4K3JA 2TGAA 3ZVCA 2B5TB 2XYAA 1D9IA 1YBWA 1D3TB 1A0HB 1CT0E 2BQWB 1MTVA 4AGKA 4BNRA 1SL3A 3I29A 1UMAH 1WTHD 3ZZ3A 3VB6A 1B5GH 1EB2A 3A7VA 2H6MA 2AMQA 1CA0C 2UWPA 2BY6X 1ZZZA 1SGFG 2UWOA 4UFGH 5JDUB 2XBWA 4D7FA 1AKSB 2LPRA 1LTOA 3EA8A 1HAVA 3QO6A 3K9XB 4MPVA 1OWDA 3OX7U 5E0JA 2G81E 1S5SA 2CHAB 1C5YB 2FS8A 2ZCHP 1AFEH 4OS4A 3UOPA 2VIPA 1BTWA 1TQ0B 4NIYA 1P04A 1C1TA 4YZUA 1A0LA 2Y5HA 3MU0A 1GDQA 6GCHF 1RS0A 2M5TA 3QN7A 4CRBA 1CT2E 3ZZCA 1V2LT 3OY5U 3H7OA 2CHAC 2OCVB 3TJUA 1GVLA 1ARCA 2XXLA 3K2UA 1T8OA 3S7KB 2QXJA 2Z6BD 1EPTB 2SNWA 3KNXA 1TGCA 4XOJA 1G36A 3TK5A 1YCPM 1UK3A 3K65B 3LC3A 1GGDB 3SOSA 1FJSA 4D9QA 1L1GA 3D62A 3LGUA 1EZXC 2Q6FA 3MNXA 3HATH 1T31A 5AVDA 1MZAA 1OWKA 4CRDA 1VR1H 1P2KA 3P6ZB 2ALPA 2ZHFH 3RU4T 2A32A 1VCPA 3LGTA 1FMGA 1OWEA 2BD5A 1C1QA 1EOJA 4LK4A 2Y81A 1J17T 4FUGA 4HFPB 1EUFA 2FOMB 1BMAA 4GCHF 3SN8A 1IQGA 1IQMA 1O2QA 2C8WB 3GOVB 3ODDA 4IN1A 1MH0A 4K60A 5A0BA 1SGFA 1GI9B 1A3EH 5DKMA 1C5ZB 1XMNB 4X2XA 3SU1A 3BTEE 5ESBA 5A8YA 2VIWA 2GGVB 1ZTJA 4X6MA 1CU1A 3TH4H 1NFYA 1O5CB 3GCTF 1BZXE 2ZI2H 1VCQA 2PTCE 4A6LA 1A5GH 4SGBE 2VWNA 1D3DB 3TH3H 1DDJA 2BZAA 1C5UA 2VVCA 3VFEA 2FWWA 5GDSH 1G3BA 1NRQH 4E7NA 4ZMAH 2H1UA 3HKIB 2BD3A 2Z3EA 4ZKSU 3SU0A 1QA7A 3ENSB 3A86A 4YOGA 3SQHE 1YPJH 3SV9A 1UHBA 1GBMA 1TMTH 1SLWB 4TY6A 3SNAA 5C5NA 3IG6B 1ANBA 3M7UA 1AN1E 2BB4A 1ZHMA 1TA6A 1TBRH 4WH8A 1TPSA 1E34B 3BTME 1O2PA 3SU5A 3DA9B 1GBBA 1IHSH 2JH0D 2WUCA 1V2WT 4XSKU 2CF8H 1OKXA 1PPFE 1CVWH 1J9CH 4MDSA 2O8MA 1HDTH 1W11U 1NM6A 1P9SA 4BAHB 2P16A 4ISLA 2TGDA 3ZVGA 3M36A 1C9TA 1WAYB 1KLIH 2HNTC 2JH6D 3Q00A 1Z1JA 2GCHF 1EP5A 4TWWA 3UR6A 4AORA 1OWJA 2XCNA 1AD8H 2ESTE 2ZGCA 1Z6EA 2OLGA 1ELEE 1BTYA 1O5DH 2FOHA 1J15A 3KQCA 2BQ6B 2FIRH 2SGQE 1C5TA 2BX3A 4H6TA 1BMLA 1DWEH 5IDKA 1DSUA 1Z8GA 2VIOA 4IC6A 4Q7XA 4ZROA 3SNCA 4A92A 1NFWA 2RDLA 2A4GA 4R8TB 1ESBA 2C90B 4AN7A 5C1YA 1B0EA 2G5NA 3PV4A 1K22H 1P2IA 2WUBA 1UTQA 2SGDE 3LKWA 4BAKB 1QL7A 4K2YA 4Y11E 1DXWA 1EP6A 2HOBA 2VWOA 4FVBA 1HIAA 3SQEE 1MUEB 3E91A 3SBKA 7KMEH 1O2KA 5K0HA 1OWIA 1MBQA 3SGAE 3KHVA 5J4SA 1HGTH 2ALVA 3KEEA 3M7QA 1S84A 5A09A 3UNRA 1EJMA 2PFEA 2PKAB 2WPHS 1H9LB 5TJXA 2D2DA 5EPYA 1ZGIA 2AEIH 3A7XA 1DWDH 4FU7A 4MPUA 2A2XH 3T62A 3NK8A 3W94A 1TRYA 3E1XB 1Q2WA 4X8UH 1NZQH 1GMHF 3FZZA 1G2MA 1WYKA 1TPOA 5DK1A 4RN6A 2CMYA 3MU1A 4NGAH 1F7ZA 4U32A 3SHCH 1O0DH 1SLXB 4LZ4B 2SGAA 2GMTC 4ISIH 4YLQH 2EC9H 2D1JA 2AERH 1DANH 3UIRA 1BDAA 2ZGXH 1A0JA 1SLUB 1Y59T 3ZZ5A 2VINA 1P2OA 1K21H 1CHOG 3BN9A 1GVKB 4I8JA 4XFQA 2R0LA 3FANA 4DIIH 3T28A 4Q2KA 1CGHA 4DT7B 4XBDA 5C2ZA 4X2YA 1AZ8A 3LGVA 1O5BB 1KXBA 4D7GA 3P70B 2GVFA 3RXQA 2THFB 2HVXA 1KDQA 1W13U 5LPEA 2FYRA 4I8LA 2PW8H 1H9HE 6ESTA 2HNTF 3T2NA 3SJOA 4XDEA 4ZUHA 1TA2A 1F5LA 1GJ7B 1W0ZU 3P17H 3RM0H 2BXUH 4MG3A 3L33A 1S83A 1RD3B 1V2UT 2Y80A 2FOCA 4GLYA 5GCHG 1PPBH 1P2QA 2PKSC 1AUJA 2ZFTA 3MMGA 1CA8B 1VITH 2XBXA 1TPPA 1PPGE 1DITH 1KDQB 2OINA 3T5FH 3UFAA 1K1IA 3HPTB 2Y5FA 1ZPBA 2OBQA 1C1UH 5SGAE 3L3TA 1J14A 4FUDA 2ZC9H 1Y3XA 4ABEA 3RMLH 1YPEH 2YOLA 3URCA 1TBQH 3BTDE 4Y0YE 3ZVFA 4X0WU 1BMMH 1FZZA 2ZDVH 9ESTA 2Y5GA 3QK1A 4X6PA 4NZQA 4MNYA 2GCTB 1ZYOA 2PKSB 4ZKRU 2AS9A 4CRFA 2ZTZA 1FY8E 1HPGA 4F49A 3RXPA 1WCZA 1Z7KA 1O2OA 4B73A 2ANKH 4MNWA 4I33A 1V2PT 1Q31A 1O2ZA 2BOHB 4HTCH 4B74A 4MTBA 2FMJA 4GAWA 4U2WA 3QGNB 2ZHDA 1MD8A 1AHTH 3GCTG 2YNAA 5A8ZA 1A2CH 1MKWH 1IQFA 4WJG2 2CV3A 1GCDA 2ANWA 1C1SA 2C93B 1GI8B 5JPMH 1PPHE 4CH8B 1J16A 1BRCE 1TGBA 2ASUB 1D3QB 2XC5A 3SZNA 5HMAA 4NCYA 5E0GA 2G52A 1BJVA 5FX6A 2ODYB 1P11E 5TCAA 2Z3CA 2KAIB 5CMXH 4D8NA 1PYTC 4SGAE 2FX4A 3FZDA 1NRSH 1YLCA 4CRGA 2ODQA 1XUHA 2GV7A 3V0XA 1BBRH 3SV8A 4BXWA 3MU8A 3AVZA 2XC0A 7LPRA 2NU2E 4FUFA 3P95A 1ELVA 1GBJA 1SBWA 1EPTA 3MTYA 4H6SB 4BANB 3IITA 1LKBA 5EU8A 3M3VA 4AB9A 3ESTA 1C1WH 1Y3YA 2QIQA 5LH8A 3K6YA 1GHWH 3MWIU 2ZHQH 1VJAU 1AWHB 3PWCA 1GBHA 1TLDA 1VGCC 4X1SU 1ZLRA 5AHGH 1C5OH 2W5EA 1VZQH 2FM2A 2ILNA 1BHXB 1PFXC 1V3XA 1DM4B 4E05H 1AI8H 5AFYH 3ZVDA 1ORFA 2BOKA 3A85A 1C5LH 2BD2A 3OTJE 4FU8A 3SV2H 2R3YA 1TOCB 2OXSA 3PLBA 1PQ5A 1N1LA 2F91A 5E2PA 1TQ7B 5EXLA 5JBTA 3NZIA 3KQEA 4E06H 1MZDA 3RXHA 3TU7H 5EOKA 1FY1A 1O3JA 2ZGHA 3A7TA 1GJCB 3RXRA 1ANCA 1NN6A 5C1UA 1NESE 4JK5A 3P8FA 4ZKNU 3A83A 3F1SB 3F6UH 4ABAA 1GJAB 3RXKA 4ISHH 1Z8JB 4WXIA 1K1LA 1YF4A 1ZPCA 1WQVH 2BDAA 1Z8RA 3KCGH 2NU4E 1T7CA 3QWCH 1Y3WA 5CHAC 2O8UA 2JETC 1AZZA 2R2MB 5PTPA 1F5RA 2SFAA 3SV7A 1YCPH 1HLTH 2W26A 1O2YA 1ZR0A 2R3UA 1BTXA 1Z6JH 5F8XA 1RTFB 3RM2H 4BOHA 1MTSA 3GYLB 2FTLE 1C1VH 1GJ8B 1TB6H 3RMNH 3P8GA 3MI4A 5ETXA 1IQIA 1WOFA 3ZVEA 3O8CA 1YPGH 4AX9H 2XWAA 1GJ5H 3R3GB 2FI5E 3HGNA 2H9EH 2PHBA 1ELAA 4OGXA 3T27A 4ZXXH 1BTHH 2K1QA 2V0BA 2BY5X 1FUJA 1F0TA 3LIWA 1WTGH 3UR9A 4NIXA 1QQUA 4JMYA 1O3CA 2F3CE 2I6SA 4CH2B 1EJNA 1IOEA 1V2TT 3RDZA 3BTKE 3RLWH 1EAIA 1ZMLA 1DSTA 4MNXA 3VGCC 1LVOA 3LH3A 5C5OA 2VJ1A 1O5EH 1TX7A 1GBDA 3C1KA 3F9EA 3D65E 1CBWB 3P8OA 4WMDA 1ZRKA 1FPCH 5I46H 1DY8A 1ZMNA 4LZ1H 3TK9A 1NROH 1SQOA 1UTOA 4MPWA 3RC5A 2EEKA 1QB1A 1SFQB 3RXTA 1W14U 2AYWA 1L2EA 2ZFQH 1DVAH 4K1TA 2A5IA 2GT8A 2FYQA 3GCOA 2ZPRA 2UUFB 5E0HA 1W10U 2BMGB 5GXPA 4A1TA 5JBCS 1FXYA 3IWMA 3V13A 1C5MD 3SW2B 1B7XB 3RXUA 5DP7A 4MNVA 4YM9A 1QBOA 1VCWA 1P03A 3TGKE 1N8OC 1O32A 1GGDC 1C2LA 3NKKA 1MU8B 1KYNA 1O2GH 3PB1E 4RKJB 1C2IA 1F92A 5L6NH 1HAGE 2UUKB 3S7HB 1O3MA 4Y7BA 1GL0E 1NC6A 5A0AE 2OC1A 2H9TH 4B2BA 1O35A 3TJVA 3TPIZ 2HALA 1UTNA 1W12U 1RXPA 3SUEA 5EQRA 1MQ5A 2ZFRH 1GI7B 1LCYA 2G5VA 1ACBE 2XC4A 3PMHB 1VJ9U 1KIGH 3A80A 3F9GA 1THRH 3SNDA 1FNIA 1QL9A 1HJ8A 3LT3A 2LNCA 1NRNH 2GDDA 1TGNA 5L2ZH 4IC5A 5DG6A 1UK2A 4X1RU 1TABE 4AYVB 1HYLA 4NSYA 4BTTB 4HGCA 1IQHA 4MQAA 2ZQ1A 1DOJA 2GD4B 1HJAB 1O5GH 2UUYA 3M7TA 3ZZAA 2IN2A 3F9HA 1MAXA 2P8OB 1SGTA 1A4WH 3BIVH 1V2JT 5H4IB 1Y5AT 2FP7B 4YOIA 1CBWC 1BITA 2OQ5A 3E3TA 4XBBA 5EGMA 3E8LA 2FZZA 1MTWA 1NO9H 1T4VH 1GI2A 3NWUA 2H2ZA 4DIHH 1ANEA 3RXGA 3V7TA 4CR9A 2O8TA 3A7ZA 8GCHG 2PKAA 3GCHC 2ZFSA 4YTAA 3ZZDA 1ELGA 1WUNH 3TNTA 1LPKB 1GJ4H 1O2XA 5HYOA 1YC0A 2A1DB 1ZJDA 1MBMA 5T6DA 3A84A 4F4OC 2FEQH 2Z7FE 3A8DA 3PMJA 1TMUH 3JZ2B 1DLEA 3SI4H 1D6RA 3A82A 4IW4E 4Z0KA 3TJNA 4CHAB 2PGQB 1EX3A 5DP9A 3QZRA 1NT1A 1UTKA 1XKBC 4OS5A 2GZ7A 5HXFA 1P10A 2ZP0H 1HAVB 2ZGJA 3F68H 1IQLA 2WPJS 2ZFPH 1XUFA 3RMMH 3GDUA 2IOTA 4WF8A 4J2YB 4X8VH 3BTFE 1O2UA 3MH4A 4NG9H 1KLJH 3MO9A 3TGIE 4TWYA 1GJBB 2BY7X 2V6NA 1NU9A 1FAKH 1BRUP 1C2JA 5DGJA 1GHZA 2P59A 5GJ4B 3Q3KA 1O3KA 2R0KA 3DHKH 3O8DA 1S6HA 4NZLA 4I8KA 4AGJA 4Q7YA 1GI1A 3H5CB 1ZHRA 5C1XA 3DD2H 3AASA 1GI0A 3U69H 2DE8A 2NU3E 2C8YB 3TLOA 1QB9A 5I25A 5T3HA 4ABFA 2G55A 1O38A 1IQJA 1GHXH 1K2I1 3DFLA 3LDXH 1ZOMA 4NA8A 3S9BA 1DUEA 2ZIQH 3E90B 2I6QA 3EA7A 3KF2A 1MTNB 2FI4E 1WV7H 5K7RA 1A3BH 1GMCF 2ZA5A 4QT8C 2FESH 1RFNA 1RTLA 5AFZH 3VXFH 4X1PU 2ZTXA 3PMAB 1BOQA 2AGIX 3RXOA 1AFQB 1C4U2 2WINI 4JYUH 3GISB 2OUAA 4H42U 3C27B 2F83A 1O2MA 4BAMB 3P92A 3RXLA 3QTOH 5T6FA 3LPRA 2B8OH 1TNGA 1AU8A 1TRNA 1H8IH 1QQ4A 2VVUA 1GJ6A 4DGJA 2ZU1A 1P0SH 1GCTC 3B9FH 4AB8A 2BDGA 3M61U 1HAHH 3PO1C 4O3TA 2VIQA 4OS6A 5C67A 1SGQE 1A61H 2STBE 5FX5A 5LPFA 3PLPA 4BAOB 3KIDU 1BTPA 1O2HA 3GYMA 3GY8A 2AIQA 2NU0E 4Y71A 2VIVA 4B76A 1MU6B 4DJZB 3SU4A 2GZ8A 1QJ7B 3ATLA 2AGEX 1DX5M 3LOXA 2WYGA 3N7OA 5FPTA 2JETB 3VB3A 1JIMA 3JZ1B 1MKXH 3LGWA 1MKWK 1TX6A 1FV9A 2PUQH 4UFDH 3BIUH 3NCLA 2QY0B 2A7CA 2AH4X 1C1NA 1FN8A 2VH6A 3RXJA 4CBOA 2EI6A 1P2NA 1JXPA 2ULLA 1D6WA 2Q6DA 1FY3A 1O37A 1O34A 4X2VA 3ZV8A 1NRRH 2W3IA 3SJKA 1T8NA 4D9RA 4ZHLU 2Q1JA 2Y7ZA 2V3HH 4YLUA 3MNSA 4A1XA 3G01A 1T8LA 1RIWC 1O39A 2BLWA 3HKJB 1MMJN 2BVXH 3SGQE 1UTPA 2G00A 1CO7E 1G37A 2AGGX 4J1YA 1YPLH 1P9UA 4DVAU 1HRTH 2ZTYA 5ABWA 1AY6H 4FVDA 5DP4A 1LHFH 4Y8XA 3PWBA 2F9UA 4O97A 1SOTA 1O2IA 4ABIA 1C1MA 3M5MA 1BB0B 1GG6C 1GL1A 3URDA 1NFXA 2R9PA 3BTQE 3KN2A 2ANYA 4GHTA 2BDHA 1FDPA 4B71A 1GHAF 1BIOA 2ZFFH 4ABBA 1UVSH 1UVPA 4XE4A 3EDXB 3UQVA 3S9CA 3A7WA 3U98H 3BTWE 1L4DA 1IAUA 1KLTA 2Z3DA 2ZF0H 3LH1A 4D76A 4FUCA 3CS0A 3PO1B 2J95A 1OPHB 5AF9H 2G8TA 2QCYA 1QFKH 3GDSA 2FOEA 2OC0A 4FU9A 1P02A 2HLCA 1VITG 2P94A 1TAWA 1NS3A 2CGAA 1SB1H 1RTKA 3UTUH 1DXPA 1HCGA 3UPEA 4ASHA 1UCYK 4ZKOU 3SJ9A 2D8WA 3PLKA 1UO6A 4X6NA 4DOQA 4OS7A 5CHAB 3MH5A 4IS5A 3TH2H 1SOZA 1ESAA 1DS2E 5HM9A 1HIAB 4ESTE 1TIOA 1TE0A 1ZPZA 1F5KU 5F03A 1ABJH 5FCRA 3VB4A 5LPRA 2P3UB 2BDYA 2ZDNA 1IQEA 1L1JA 1SMFE 3HK3B 4OS2A 5FBEA 1BRAA 3QTVH 2ZPQA 3A8CA 1EAUA 2EI8A 4JZ1A 1ZMJA 4BAQB 3K6ZA 3T25A 3BG8A 1V2NT 4Y8YA 4KKDA 3RXDA 1JRSA 1TGTA 3RXEA 2FODA 1XM1A 1BBRE 2VB0A 1C1OA 2Z9GA 1O30A 3A8BA 4NFEA 5EQQA 3ZYDA 1Z1IA 3A87A 2C8ZB 2PTNA 4FUEA 4NA7A 1G30B 1QTFA 1LVYA 5EXNA 2H5DA 3E6PH 1C5PA 3GY4A 4KGAA 2R2WU 3VPKA 3LGYA 3CP7A 7GCHG 1GDUA 4Y6DA 1SR5C 1TNLA 5DP5A 1C2HA 1LQDB 1T8MA 1ZGVA 4TPIZ 3MHWU 3RXBA 1EPTC 1AVXA 4KP0A 4UEHH 1SQTA 1P01A 2O8LA 2WPKS 3VGCB 2F9VA 1K1MA 1B0FA 1FLEE 1PPEE 4CR5A 4X1NU 4IMZA 1SC8U 1WU1A 2GV6A 4KTCA 1E36B 5EW2H 1O2TA 1QBNA 2BZ6H 1OS8A 1C5WB 3ZZBA 5A0CA 1GI4A 1H4WA 1RGQA 1GDNA 2GCHG 1O3GA 4RKOB 4UONA 1JBUH 1C5SA 1OX1A 1JOUB 1O31A 1LHEH 2A0QB 4UDWH 1O2JA 1Y3VA 1A5IA 2BY8X 3T26A 3DT0H 1MCTA 1UJ1A 5C3NA 1SGIB 1XXFA 3GCHB 2ZWLH 1NFUA 4JZIA 1W7XH 1HJ9A 1XVOA 2J94A 3V12A 1O3FA 2TGPZ 1GJ9B 1LPGB 3FFGA 3STIA 1PQ7A 1IQNA 4YT7H 1S82A 3TVJB 1KXDA 2ODPA 1V2KT 2P93A 2XRCA 4THNH 1EJAA 3EYDA 4Q80A 1EASA 3S9AA 1QY6A 3BSQA 1F0SA 3ATIA 5CE1A 1AVGH 1K1JA 2CXVA 5E2OA 1LHGH 1V2VT 4GVUA 2W3KA 3SNBA 2BLQA 1GBKA 1C2KA 1EQ9A 1AB9B 1XUJA 5A2MH 1C4V2 1YYY1 3FVFB 3ODFA 2Z9JA 3OYPA 2VVVA 1QA0A 3FP8E 2P95A 1P3EA 4UE7H 1NRPH 1D4PB 3EAJA 2PLXA 4VGCB 1K1OA 1K28D 1SG8B 1YPHC 6CHAC 2P3TB 3TNSA 1FY5A 1T4UH 3U1IB 1NPMA 2VIDA 1OP0A 3AW1A 4B1TA 4INLA 1SGYE 1FPHH 3T29A 1KXFA 7GCHF 2ZG0H 3ZZ4A 1EB1H 1ELDE 1ZHPA 1PJPA 3Q76A 1O5AB 3PYHA 3PMBB 4DURA 2RA3A 2QXGA 3ATKA 2GCTC 1S0RA 3NXPA 2Z9IA 2A4RA 3M3SA 3PM3A 1W3CA 4CHAC 4GPGA 1O5FH 2FOFA 3AAUA 2TPIZ 1WQSA 4CRCA 3SHAH 2P3FH 2A31A 1SPJA 1XKAC 3BTHE 1TYNA 1DICA 2CJIA 2J2UA 2RG3A 2PUXB 1G9IE 1YKTA 1S0QA 4ABJA 5GIBA 2PR3A 1DPOA 2HPPH 4I7YH 2OBOA 1K1PA 2ZU2A 5EQSA 1P05A 2FPZA 4KTUA 4O03A 1JMOH 1TWXB 2A5AA 2QGRA 2BXTH 1EATA 5L30H 2XNIA 1W0YH 1QGFA 1O36A 4GHQA 2AIPA 1KXAA 1QJ1B 1GBTA 4B2CA 3U9AH 2BVRH 2OQUA 2Z9KA 1ZJKA 1YPMH 2ZU4A 2UWLA 3A8AA 1GHBF 1SGNE 2BD7A 4YESB 1AUTC 3VEQB 1KXCA 1DWBH 1E38B 5J4QA 3SI3H 1ELCA 1SSXA 1O2VA 3ZV9A 5DP8A 1IQKA 1V2QT 4M7GA 1F0UA 4NA9H 2W7SA 4PROA 1YGCH 2FOAA 4AFSA 1LDTT 4I8GA 1ETSH 1G32B 4IN2A 1LQEA 3QX5H 3TJOA 1GWAA 4FUHA 5FHTA 1UTJA 1SLVB 1V2ST 4Y8ZA 2A7HA 2O8WA 2G4UA 3BG4C 1ZTKA 2XTTB 3FAOA 2C8XB 2TBSA 1EOLA 3MU4A 1QRWA 1TBZH 2NU1E 2DUCA 1QJ6B 1SFIA 1PPCE 2GT7A 1BQYA 4Q7ZA 3BTTE 1GBAA 3SUFA 1UCYH 2WPLS 3ZYEA 3U8RH 3GY6A 1FIZA 1P12E 1BRBE 2QXIA 2TIOA 3GDVA 2GMTB 1KY9A 2B0FA 2BVSH 3UWJH 3RC4A 1CT4E 1QNJA 4WVPE 3TGJE 2F9BH 1V2RT 4GSOA 3O8RA 1Z8IB 1PPZA 1AO5A 1GI6A 6LPRA 2VWMA 4UFFH 3P8NA 5FPSA 1A5HA 1FN6A 1INCA 1HUTH 3RXAA 1OOKB 2ZDAH 1BTZA 5FCKA 1SGPE 5EG4A 1XXDA 2J4IA 4WMEA 1YPHE 1PQ8A 5B6OA 4JCNA 1BMNH 4BXSA 1V2MT 1P3CA 3LC5A 3QUMP 3LGIA 2A7JA 1HAPH 2ANMH 3DUXH 2PSXA 1ELFA 3MFJA 1QR3E 2QAAA 4WH6A 5T6GA 1LVBA 2FTMA 2OTVA 1Y5BT 2STAE 2QF3A
chains in the Genus database with same CATH superfamily
1EZQA 3ATMA 3BG4B 1C2EA 1TALA 1OYQA 2Z94A 3GICB 1AMHA 2FI3E 3WY8A 2ZDLA 1H8HD 3PTNA 3TITA 3MNBA 4IGDA 1GBFA 1MAYA 1SHYA 1TGSZ 1TRMA 1UTLM 2D26C 4ZH8A 2PGBB 2W7UA 4ABDA 1DFPA 1TNKA 1TMBH 1MCVA 2ZQ2A 4FUIA 2SNVA 3CS7A 1HXEH 5LGOA 5TCCA 1AFQC 1O3LA 1AB9C 4LXBH 3L6PA 1OP2A 4X2WA 4Y79A 3HK6B 3RXSA 1TOMH 1WBGB 4A7IB 1HNEE 1MTNC 3DSOA 1O33A 1THPB 2J92A 3LU9B 4LOYH 1OSSA 2AFQB 2A5KA 4I32A 1NU7B 2A2QH 5EXMA 7ESTE 3RUOA 1M9UA 3EA9A 1A1RA 2FX6A 5GCHF 2EI7A 4O3UA 3KQBA 5F8TA 4F48B 1HJAC 1IHTH 3ITIA 1N6YA 4WXVA 2HNTE 4AFQA 1C2DA 1TONA 1O3IA 2F4LA 4Y7AA 1H8ED 6GCHG 4A5TS 1DE7H 1GI3A 1DUAA 4JYTA 1SKYE 4A1VA 2OD3B 3RLYH 1ANDA 8GCHF 4FUJA 1HAZB 4ZHAA 1PQAA 3AW0A 4MLFB 5DP6A 3S0NA 3PTBA 1DLKB 2UUJB 4MPXA 3SUDA 4Y0ZE 1C5QA 2BDIA 2GX4A 4DW2U 1FAXA 1Y8TA 3KYFA 4HZHA 1J8AA 3RU4D 5EW1H 1O3AA 5C0TA 1SHHB 1UVTH 3RXVA 3ATWA 3RU4E 3PV2A 2XWBI 2GTBA 2ZCLP 4CBNA 3CENA 2RA0A 2QF0A 3BEFB 1O2NA 2CF9H 3VXEH 3UOUA 2ZU3A 3MYWA 1GMHG 3GY2A 8LPRA 2VWLA 2VBCA 4F55A 5C20A 1C9PA 1OYTH 4JZFH 1O3BA 1ZSLA 2OC7A 1C5NH 2XBVA 2EA3A 4OGYA 1P8VC 1QB6A 3Q3XA 1GHAG 5FBIA 5JB8S 2V35A 1GMCG 3TK6A 2ZPSA 4ACAA 1G3EA 3ZVBA 3UUZA 1V2OT 1O2SA 1JWTA 2BTCE 2VGCB 1AE5A 1O3DA 1YCPK 3GY5A 1VITF 2JKHA 1QIXB 2AMPA 4NWLA 2BLVA 1ETRH 5DPAA 2XW9A 2XBYA 1N6XA 1G3CA 3DFJA 1LPZB 5E8EH 1O3PB 3D23A 2C3SA 1F0RA 4AFUA 3U8OH 2FXRA 1OXGA 1XVMA 4TSFD 4YOJA 1YM0A 3GCNA 2B7DH 3EGKH 3RC6A 3KQDA 3SV6A 2VH0A 4DCDA 1MTUA 4AYYB 2G4TA 3UY9A 3MH6A 2BLOA 4Z6AH 1C5XB 1XX9A 2OP9A 1NTPA 2HWLB 2QXHA 4YO9A 1QBVH 4OS1A 4K8YA 4Q63A 1O3NA 1FI8A 1ELTA 1C5RA 5FPYA 5HGGA 1UVUH 1WSSH 1GBLA 2F9PA 2BD4A 3ZZ8A 2J38A 3M3TA 3SGBE 1XUGA 2HLDD 4HI3A 1ELBA 2FS9A 2FO9A 2SGEE 3MH7A 1BT7A 5HM2A 4TYDA 1L1NA 1X7AC 1ZSJA 3A7YA 1GBEA 4VGCC 2QA9E 1HV7A 5JBBS 3OY6U 1CGJE 1BJUA 2TGTA 1CQQA 5DP3A 1GJDB 5FAHA 1CHGA 1LHDH 3E0PB 1AGJA 2BQ7B 4OM9A 2JJ2D 3V3MA 1OWHA 1ID5H 1XUKA 1HAXB 2JIZD 4IBLH 1XUIA 1C1RA 1BBRK 5F6MA 2HRVA 1BA8B 1W0KD 4X8TH 2JH5D 1O2RA 4E7RG 2C4FH 1AVWA 2ZHWH 1K9OE 1YPKH 2KAIA 2ZDMA 1W8BH 1BTUA 3UREA 4JZEH 1QRZA 3DSGA 2Z9LA 4JK6A 3R0FA 3RMOH 3MO6A 4K69A 5IYTA 2QE7D 4DY7B 3KL6A 3QGJA 2WV5A 4ISNA 3SO3A 3SU2A 2PV9B 1HAYB 4ABHA 4AOQA 1TFXA 3B8JA 5JB9S 1H8DH 3RXFA 1E35B 4AFZA 4CRAA 4I8HA 2Y82A 5EJZA 1E0FD 3AAVA 5DO4H 2SGPE 2VU8E 2ZDKA 1F2SE 1O2LA 2WYJA 2L74A 1TNJA 1HXFH 2QC2A 3ZZ7A 3Q3YA 1QURH 1L4ZA 4FUBA 1TX8A 1DT2A 3BF6H 3D49H 2SGFE 4AG1A 2IPHA 2FOGA 2FOBA 2O9QA 4UD9H 1C2MA 2GDEH 5BPEA 3Q77A 4X6OA 3A81A 4RI0A 1JRTA 4DG4A 5GPIB 1AE8H 2BM2A 3GS9A 1KXEA 2H9HA 1UCYE 2RDEA 1LMWB 3F9FA 3F2FA 4XBCA 1LVMA 1GVZA 1VGCB 4HG6A 5DJ7A 1NBME 1MABB 3SJ8A 3B23B 2YNBA 5F8ZA 1QRXA 1C2FA 1KSNA 1SQAA 1P2MA 5ESTE 1E37B 3W95A 4H4FA 4UFEH 1DY9A 3ZVAA 2ZHEH 3MOCA 4NIVA 3QZQA 5EJLA 1Z71A 2BYAX 2BX4A 1GHVH 3STJA 4NIWA 2GP9B 1Y3UA 3F3BA 2FLRH 2BD9A 5FL7D 1FONA 1QL8A 2ZGBH 4R0IA 1SGDE 1GI5A 2A4QA 2P8OC 1GPZA 3SU3A 1TPAE 2J34A 1S81A 3TIUA 4JYVH 2BDBA 2GZ9A 1COWD 2A45B 1UHBB 2HGTH 1RJXB 3A89A 1MD7A 9LPRA 1EKBB 1AWFH 5EODA 3QLPH 2AMDA 3F2GA 3GY3A 1ZSKA 1P57B 2XCFA 3EQ0H 3M35A 1FY4A 8KME2 1BMFD 3U8TH 4AC9A 4IMQA 2H5CA 1GCTB 1KTTB 3U1JB 1CGIE 2PSYA 5L2YH 4U01A 4B2AA 1C5VA 1EAXA 1S6FA 2BD8A 4INHA 1O3HA 1G2LA 1P09A 2ZO3H 1GMDF 2G51A 3M5NA 2QV1A 1O3EA 2DE9A 3RP2A 3F0OA 4YT6H 2B9LA 2XOKD 1AIXH 2NWNA 1TNHA 3MO3A 5JBAS 1THSH 4AZ2B 1SVPA 4X1QU 3UQOA 5CDFE 2WPMS 3FP7E 1RIWB 4ISOA 4INKA 4ZAEA 4AG2A 1A7SA 1ETTH 1QCPA 3ZZ6A 1JIRA 1UTMA 4K8BA 4Z1MD 4K5ZA 3LJJA 1P06A 3KGPA 2KZ4A 2IJD1 1BUIA 4BTUB 1O2WA 3S69A 1HFDA 1RRKA 2EY4C 3I78A 3BTGE 5JYIA 1UK4A 1W7GH 1LKAA 3OSYA 6CHAB 5EJ1A 1SGRE 1HAOH 1H9IE 4Y10E 3QDZB 2GKVE 4NWKA 5EPNA 5GWZA 1GMDG 3HGPA 1C2GA 2PWXA 1CHOF 1N8OB 1EZUC 1Y5UT 2F9NA 2WV4A 4CREA 2QN5T 4GUXA 4WWYA 3NPSA 3NUMA 1S6LA 4TPYA 4ZHMU 1DWCH 3E0NB 4U30A 2J9NA 1K1NA 1SGCA 3UNSA 2ZECA 4Y76A 3LONA 3RXIA 1C1PA 1CSOE 8ESTE 1HB0B 1ABIH 1SGEE 1AKSA 3BEUA 2VNTA 1LO6A 5A8XA 2BHGA 1GG6B 1CE5A 3UNQA 2ZZUH 3M37A 1GBIA 1SI5H 3M5OA 4GCHG 2KCPA 2V3OH 1L0ZA 2WPIS 5G4BA 4NSVA 1U6QA 2ZEBA 3SU6A 1GHYH 3MU5A 1Q3XA 1EXFA 1ESTA 1A46H 3MNCA 5FXLA 3RXMA 2ZKSA 4K1SA 4KELA 3ZZ9A 3FO8D 4K1EA 3FP6E 2FLBH 3VB5A 1GHBG 4JZDH 1WXRA 1GBCA 1BHXF 3UWIA 1ARBA 2ZU5A 3PROA 2BDCA 3RXCA 4M9FA 4BTIB 2Q6GA 1D3PB 3E16B 1MQ6A 4WY3A 2ZCKP 1FIWA 2CN0H 2F9OA 1QHRB 1BCUH 3I77A 4FXGH 4I31A 2TRMA 1NY22 4ABGA 4TY7A 2ZNKH 4B75A 3SUGA 1SQRA 1AQ7A 3SORA 1C4Y2 1W2KH 3GY7A 4RSPA 2QYIA 2Y7XA 3H7TA 1OP8A 2OC8A 4KTSA 1UVOA 5C17A 1P2JA 1S85A 1FQ3A 1EZSC 1EAWA 3VB7A 1T32A 3FKSD 4MVNA 3BV9B 2BY9X 3EE0B 1UW7A 1YLDA 1YP9A 1OHHD 1HAIH 3SNEA 1H1BA 3OU0A 2FDAA 2RFKC 1KTSB 2Y6TA 1ZTLA 4WMFA 1V6DA 2J98B 3M5LA 3O8BA 3SJIA 2HPQH 4X8SH 2VGCC 3MQKC 1MKXK 3A88A 1ZRBA 2KFWA 4O9VA 5BRRE 2IJOB 1O3OA 1PYTD 1TNIA 4ZXYH 1G3DA 1CA0B 3F2HA 4NFFA 2A4OA 1HBTH 3LJOA 3ELAH 2KCOA 2RCEA 1LHCH 4DT4A 3BEIB 4K3JA 2TGAA 3ZVCA 2B5TB 2XYAA 1D9IA 1YBWA 1D3TB 1A0HB 1CT0E 2BQWB 1MTVA 4AGKA 4BNRA 1SL3A 3I29A 1UMAH 1WTHD 3ZZ3A 3VB6A 1B5GH 1EB2A 3A7VA 2H6MA 2AMQA 1CA0C 2UWPA 2BY6X 1ZZZA 1SGFG 2UWOA 4UFGH 5JDUB 2XBWA 4D7FA 2J97A 1AKSB 2LPRA 1LTOA 3EA8A 1HAVA 3QO6A 3K9XB 4MPVA 1OWDA 3OX7U 5E0JA 2G81E 1S5SA 2CHAB 1C5YB 2FS8A 2ZCHP 1AFEH 4OS4A 3UOPA 2VIPA 1BTWA 1TQ0B 4NIYA 2V7QD 1P04A 1C1TA 4YZUA 1A0LA 2Y5HA 3MU0A 1GDQA 6GCHF 1RS0A 2M5TA 3QN7A 4CRBA 1CT2E 3ZZCA 1V2LT 3OY5U 3H7OA 2CHAC 2OCVB 3TJUA 1GVLA 1ARCA 2XXLA 3K2UA 1T8OA 1WDIA 3S7KB 2QXJA 2Z6BD 1EPTB 2SNWA 3KNXA 1TGCA 4XOJA 1G36A 3TK5A 1YCPM 1UK3A 3K65B 3LC3A 1GGDB 3SOSA 1FJSA 4D9QA 1L1GA 3D62A 3LGUA 1EZXC 2Q6FA 3MNXA 3HATH 1T31A 3VG8A 5AVDA 1MZAA 1OWKA 4CRDA 1VR1H 1P2KA 3P6ZB 2ALPA 2ZHFH 3RU4T 2A32A 1VCPA 3LGTA 1FMGA 1OWEA 2BD5A 1C1QA 1EOJA 4LK4A 2Y81A 1J17T 3KQ5A 4FUGA 4HFPB 1EUFA 2FOMB 1BMAA 4GCHF 3SN8A 1IQGA 1IQMA 1O2QA 2C8WB 3GOVB 3ODDA 4IN1A 1MH0A 4K60A 5A0BA 1SGFA 1GI9B 1A3EH 5DKMA 1C5ZB 4B6FA 1XMNB 4X2XA 3SU1A 3BTEE 5ESBA 1E1RD 5A8YA 2VIWA 2GGVB 1ZTJA 2QF4A 4X6MA 1CU1A 3TH4H 1NFYA 1O5CB 3GCTF 2F43B 1BZXE 2ZI2H 1VCQA 2PTCE 4A6LA 1A5GH 4SGBE 2VWNA 1D3DB 3TH3H 1DDJA 2BZAA 1C5UA 2VVCA 3VFEA 2FWWA 5GDSH 1G3BA 5DSFA 1NRQH 4E7NA 4ZMAH 2H1UA 3HKIB 2BD3A 2Z3EA 4ZKSU 3SU0A 5DN6D 1QA7A 3ENSB 3A86A 4YOGA 3SQHE 1YPJH 3SV9A 1UHBA 1GBMA 1TMTH 1SLWB 4TY6A 3SNAA 5C5NA 3IG6B 1ANBA 3M7UA 5HIYA 1AN1E 2BB4A 1ZHMA 1TA6A 1TBRH 4WH8A 1TPSA 1E34B 3BTME 1O2PA 3SU5A 3DA9B 1GBBA 1IHSH 2JH0D 2WUCA 1EFRD 1V2WT 4XSKU 2CF8H 1OKXA 1PPFE 1CVWH 1J9CH 4MDSA 2O8MA 1HDTH 1W11U 1NM6A 1P9SA 4BAHB 2P16A 4ISLA 2TGDA 3ZVGA 2WHXA 3M36A 3F0PA 2LP6A 1C9TA 1WAYB 1KLIH 2HNTC 2JH6D 3Q00A 1Z1JA 2GCHF 1EP5A 4TWWA 3UR6A 4AORA 1OWJA 2XCNA 1AD8H 4ASUD 2ESTE 1YLNA 2ZGCA 1Z6EA 3DCLA 2OLGA 1ELEE 1BTYA 1O5DH 2FOHA 1J15A 3KQCA 2BQ6B 2FIRH 4TT3D 2SGQE 1C5TA 2BX3A 4H6TA 1BMLA 1DWEH 5IDKA 1DSUA 1Z8GA 2VIOA 4IC6A 4Q7XA 4ZROA 3SNCA 4A92A 1NFWA 2RDLA 2A4GA 4R8TB 1ESBA 2C90B 4AN7A 5C1YA 1B0EA 2G5NA 3PV4A 1K22H 1P2IA 2WUBA 1UTQA 2SGDE 3LKWA 4BAKB 1QL7A 4K2YA 4Y11E 1DXWA 1EP6A 2HOBA 2VWOA 4FVBA 1YWUA 1HIAA 3SQEE 1MUEB 3E91A 3SBKA 7KMEH 1O2KA 3PV5A 5K0HA 1OWIA 1MBQA 3SGAE 3KHVA 2HVYB 5J4SA 1HGTH 2ALVA 3KEEA 3M7QA 1S84A 5A09A 3UNRA 1EJMA 2PFEA 2PKAB 1H9LB 2WPHS 5TJXA 2D2DA 5EPYA 1ZGIA 2AEIH 3A7XA 1DWDH 4FU7A 4MPUA 2A2XH 3T62A 3NK8A 3W94A 1TRYA 1YY3A 3E1XB 1Q2WA 4X8UH 1NZQH 1GMHF 3FZZA 1G2MA 1WYKA 1TPOA 5DK1A 4RN6A 2CMYA 3MU1A 4NGAH 1F7ZA 4U32A 3SHCH 1O0DH 1SLXB 4LZ4B 2SGAA 2GMTC 4ISIH 4YLQH 2EC9H 2D1JA 2AERH 1DANH 3OEED 1BDAA 2ZGXH 3UIRA 1A0JA 1SLUB 1Y59T 3ZZ5A 2VINA 1P2OA 1K21H 1CHOG 3BN9A 1GVKB 4I8JA 4XFQA 2R0LA 3FANA 4DIIH 3T28A 4Q2KA 1CGHA 4DT7B 4XBDA 5C2ZA 4X2YA 1AZ8A 3LGVA 1O5BB 1KXBA 4D7GA 3P70B 2GVFA 3RXQA 2THFB 2HVXA 1KDQA 1W13U 5LPEA 2FYRA 4I8LA 2PW8H 1H9HE 6ESTA 2HNTF 3T2NA 3SJOA 4XDEA 4ZUHA 1TA2A 1F5LA 1GJ7B 1W0ZU 3P17H 3RM0H 2BXUH 4MG3A 3L33A 1S83A 1RD3B 1V2UT 2Y80A 2FOCA 4GLYA 5GCHG 1PPBH 1P2QA 2PKSC 1AUJA 2ZFTA 3MMGA 1CA8B 1VITH 2XBXA 1W0JD 1TPPA 1PPGE 1DITH 1KDQB 2OINA 5F53A 3T5FH 3UFAA 1K1IA 3HPTB 2Y5FA 3CNRA 2M2AA 1ZPBA 2W6ID 2OBQA 1C1UH 5SGAE 3L3TA 1J14A 4FUDA 2ZC9H 1Y3XA 4ABEA 3RMLH 1YPEH 2L6OA 2YOLA 3URCA 1TBQH 3BTDE 4Y0YE 3AK5A 3ZVFA 4X0WU 1NBMD 1BMMH 1FZZA 2ZDVH 9ESTA 2Y5GA 3QK1A 4X6PA 4NZQA 4MNYA 2GCTB 1ZYOA 2PKSB 4ZKRU 2AS9A 4CRFA 2ZTZA 1FY8E 1HPGA 4F49A 3RXPA 2WV9A 1WCZA 1Z7KA 1O2OA 4B73A 2ANKH 4MNWA 4I33A 1V2PT 1Q31A 1O2ZA 2BOHB 4HTCH 4B74A 4MTBA 2FMJA 4GAWA 4U2WA 3QGNB 2ZHDA 1MD8A 1AHTH 3GCTG 2YNAA 5A8ZA 1A2CH 1MKWH 1IQFA 4WJG2 2CV3A 1GCDA 2ANWA 1C1SA 2C93B 1GI8B 5JPMH 1PPHE 4CH8B 1J16A 1BRCE 1TGBA 2ASUB 1D3QB 2XC5A 3SZNA 5HMAA 4NCYA 5E0GA 2G52A 1BJVA 5FX6A 2ODYB 1P11E 5TCAA 2Z3CA 3OTPA 2KAIB 5CMXH 4D8NA 1PYTC 4SGAE 2FX4A 3FZDA 1NRSH 1YLCA 4CRGA 2ODQA 1XUHA 5C94A 2GV7A 3V0XA 1BBRH 3SV8A 4BXWA 2W6JD 3MU8A 3AVZA 5B6LA 2XC0A 7LPRA 2NU2E 4FUFA 3P95A 1ELVA 1GBJA 1SBWA 1EPTA 3MTYA 4H6SB 4BANB 3IITA 1LKBA 5EU8A 3M3VA 4AB9A 4P02A 3ESTA 1C1WH 1Y3YA 2QIQA 5LH8A 3K6YA 1GHWH 3MWIU 2ZHQH 1VJAU 1AWHB 3PWCA 1GBHA 5T1VA 1TLDA 1VGCC 4X1SU 1ZLRA 5AHGH 1C5OH 1E1QD 2W5EA 1VZQH 2FM2A 2ILNA 1BHXB 1VKYA 1PFXC 1V3XA 1DM4B 4E05H 5KECA 1AI8H 5AFYH 3ZVDA 1ORFA 2BOKA 3A85A 1C5LH 2BD2A 3OTJE 4FU8A 3SV2H 2R3YA 1TOCB 2OXSA 3PLBA 1PQ5A 1N1LA 2F91A 5E2PA 1TQ7B 5EXLA 5JBTA 3NZIA 3KQEA 4E06H 1MZDA 3RXHA 3TU7H 5EOKA 1FY1A 1O3JA 2ZGHA 3A7TA 1GJCB 3RXRA 1ANCA 1NN6A 5C1UA 1NESE 4JK5A 3P8FA 4ZKNU 4RT1A 3A83A 3F1SB 3F6UH 4ABAA 1GJAB 3RXKA 4ISHH 1Z8JB 4WXIA 1K1LA 1YF4A 1ZPCA 1WQVH 2BDAA 1Z8RA 3KCGH 2NU4E 1T7CA 3QWCH 1Y3WA 5CHAC 2O8UA 3SZEA 2JETC 1AZZA 2R2MB 5PTPA 1F5RA 2SFAA 3SV7A 1YCPH 1HLTH 2W26A 1O2YA 1ZR0A 2R3UA 1BTXA 1Z6JH 5F8XA 1RTFB 3RM2H 2QF5A 4BOHA 1MTSA 3GYLB 2FTLE 1C1VH 1GJ8B 1TB6H 3RMNH 3P8GA 3MI4A 5ETXA 1IQIA 1WOFA 3ZVEA 3O8CA 1YPGH 4AX9H 2XWAA 1GJ5H 3R3GB 2FI5E 3HGNA 2H9EH 2PHBA 2V3MA 1ELAA 4OGXA 3T27A 4ZXXH 1BTHH 2K1QA 2V0BA 5KEDA 2BY5X 1FUJA 1F0TA 3LIWA 1WTGH 3UR9A 4NIXA 1QQUA 2GJGA 4JMYA 5HIZA 1O3CA 2F3CE 2I6SA 4CH2B 1EJNA 3UB0A 1IOEA 1V2TT 3RDZA 3BTKE 3RLWH 1EAIA 1ZMLA 1DSTA 4MNXA 3VGCC 1LVOA 3LH3A 5C5OA 2VJ1A 3OE7D 1O5EH 1TX7A 1GBDA 3UAIC 3C1KA 3F9EA 3D65E 1CBWB 3P8OA 4WMDA 1ZRKA 1FPCH 5I46H 1DY8A 1ZMNA 4LZ1H 3TK9A 1NROH 2J5UA 1SQOA 1UTOA 4MPWA 3RC5A 3WWFA 2EEKA 1QB1A 1SFQB 2WZQA 3RXTA 1W14U 2AYWA 2JJ1D 1L2EA 2ZFQH 1DVAH 4K1TA 2A5IA 2GT8A 2FYQA 3GCOA 2ZPRA 2UUFB 5E0HA 1W10U 2BMGB 5GXPA 4A1TA 5JBCS 1FXYA 3IWMA 3V13A 1C5MD 3SW2B 1B7XB 3RXUA 5DP7A 2JDID 4MNVA 4YM9A 1QBOA 1VCWA 5C0UA 1P03A 3TGKE 1N8OC 1O32A 1GGDC 1C2LA 3NKKA 1MU8B 1KYNA 4P00A 1O2GH 3PB1E 4RKJB 1C2IA 1F92A 5L6NH 1HAGE 2UUKB 3S7HB 1O3MA 4Y7BA 1GL0E 1NC6A 5A0AE 2OC1A 2H9TH 4B2BA 1O35A 3TJVA 3TPIZ 2HALA 1UTNA 1W12U 1RXPA 3SUEA 5EQRA 1MQ5A 2ZFRH 2KCAA 1GI7B 1LCYA 2G5VA 1ACBE 2XC4A 2PP6A 3PMHB 1VJ9U 1KIGH 3A80A 3F9GA 1THRH 3SNDA 1FNIA 1QL9A 1HJ8A 3LT3A 2LNCA 1NRNH 4YXWD 2GDDA 1TGNA 5L2ZH 4IC5A 5DG6A 1UK2A 4X1RU 1TABE 4AYVB 1HYLA 4NSYA 4BTTB 4HGCA 1IQHA 4MQAA 2ZQ1A 1DOJA 2GD4B 1HJAB 1O5GH 2UUYA 3M7TA 3ZZAA 2IN2A 3F9HA 1MAXA 2P8OB 1SGTA 1A4WH 3BIVH 1V2JT 5H4IB 1Y5AT 2FP7B 4YOIA 1CBWC 1BITA 2K0QA 2OQ5A 2KM0A 3E3TA 3E8LA 4XBBA 5EGMA 4B6EA 4ZCNA 2FZZA 1MTWA 1NO9H 1T4VH 1GI2A 3NWUA 2H2ZA 4DIHH 1ANEA 3RXGA 3V7TA 4CR9A 2O8TA 3A7ZA 4I86A 8GCHG 2PKAA 3GCHC 2ZFSA 3N99A 4YTAA 3ZZDA 1ELGA 1WUNH 3TNTA 1LPKB 1GJ4H 1O2XA 5HYOA 1YC0A 2A1DB 1ZJDA 1MBMA 5T6DA 3A84A 4F4OC 2FEQH 3DSPA 2Z7FE 3A8DA 3PMJA 1TMUH 3JZ2B 1DLEA 3SI4H 1D6RA 3A82A 4IW4E 4Z0KA 3TJNA 4CHAB 2PGQB 1EX3A 5DP9A 3QZRA 1NT1A 3N7EA 5IK2D 1UTKA 1XKBC 1E79D 4OS5A 2GZ7A 5HXFA 1P10A 2ZP0H 1HAVB 2ZGJA 3F68H 1IQLA 2WPJS 2ZFPH 1XUFA 3RMMH 3GDUA 2IOTA 4WF8A 4J2YB 4X8VH 3BTFE 1O2UA 3MH4A 4NG9H 1KLJH 3MO9A 3TGIE 4TWYA 3ZIAD 1GJBB 2BY7X 2V6NA 1NU9A 1FAKH 1BRUP 1C2JA 5DGJA 1GHZA 2P59A 4FOUC 5EIYA 5GJ4B 3Q3KA 1O3KA 2R0KA 3DHKH 3O8DA 1S6HA 4NZLA 4I8KA 4AGJA 4ACBA 4Q7YA 1GI1A 3H5CB 1ZHRA 4XRNA 5C1XA 3DD2H 5HKKD 3AASA 1GI0A 2YMSB 2DE8A 2NU3E 3U69H 2C8YB 3TLOA 1QB9A 5I25A 5T3HA 4ABFA 2J98A 2G55A 1O38A 1IQJA 1GHXH 1K2I1 3DFLA 3LDXH 1ZOMA 4NA8A 3S9BA 1DUEA 2ZIQH 3E90B 2I6QA 3EA7A 3KF2A 1MTNB 2FI4E 1WV7H 5K7RA 1A3BH 3EE7A 1GMCF 2ZA5A 4QT8C 2FESH 1RFNA 1RTLA 5AFZH 3VXFH 4X1PU 2ZTXA 3PMAB 1BOQA 2AGIX 3RXOA 1AFQB 1C4U2 2WINI 4JYUH 3GISB 2OUAA 4H42U 3C27B 2F83A 1O2MA 4BAMB 3P92A 3RXLA 3QTOH 5T6FA 3LPRA 2B8OH 1TNGA 1AU8A 1TRNA 1H8IH 1QQ4A 2VVUA 1GJ6A 4DGJA 2ZU1A 1P0SH 1GCTC 3B9FH 4AB8A 2BDGA 3M61U 1HAHH 3PO1C 4O3TA 3NRLA 2VIQA 4OS6A 5C67A 1SGQE 1A61H 2STBE 5FX5A 5LPFA 3PLPA 4BAOB 3KIDU 3U28C 1BTPA 1O2HA 3GYMA 3GY8A 2AIQA 2NU0E 4Y71A 2VIVA 4B76A 1MU6B 4DJZB 3SU4A 2GZ8A 1QJ7B 3ATLA 5KGOA 2AGEX 1DX5M 3LOXA 2WYGA 3N7OA 5FPTA 2JETB 3VB3A 1JIMA 3JZ1B 1MKXH 3LGWA 1MKWK 1TX6A 1FV9A 2PUQH 4UFDH 3BIUH 3NCLA 2QY0B 2A7CA 2AH4X 1C1NA 1FN8A 2VH6A 3RXJA 4CBOA 2EI6A 1P2NA 1JXPA 2ULLA 1D6WA 2Q6DA 1FY3A 1O37A 1O34A 4X2VA 3ZV8A 1NRRH 2W3IA 3SJKA 1T8NA 4D9RA 4ZHLU 2Q1JA 2Y7ZA 3WWBA 2V3HH 4YLUA 3MNSA 4A1XA 3G01A 1T8LA 1RIWC 1O39A 2BLWA 2YMSD 1MMJN 2BVXH 3HKJB 3SGQE 1UTPA 2G00A 1CO7E 1G37A 2AGGX 4J1YA 1YPLH 1P9UA 4DVAU 1HRTH 2ZTYA 5ABWA 1AY6H 4FVDA 5DP4A 1LHFH 4Y8XA 3OAAD 3PWBA 2F9UA 4O97A 1SOTA 1O2IA 4ABIA 1C1MA 3M5MA 1BB0B 1GG6C 1GL1A 3URDA 1NFXA 2R9PA 2IPQX 3BTQE 3KN2A 2ANYA 4GHTA 2BDHA 1FDPA 4B71A 1GHAF 1BIOA 2ZFFH 4ABBA 2KX4A 1UVSH 1UVPA 4XE4A 3EDXB 3UQVA 3S9CA 3A7WA 3U98H 3WW7A 3BTWE 2OK5A 1L4DA 1IAUA 5CHBA 1KLTA 2Z3DA 2ZF0H 3LH1A 4D76A 4FUCA 3CS0A 3PO1B 2J95A 1OPHB 5AF9H 3OEHD 2G8TA 2QCYA 4XD7D 1QFKH 3GDSA 2FOEA 2OC0A 4FU9A 1P02A 2HLCA 1VITG 2P94A 1TAWA 1NS3A 2CGAA 1SB1H 1RTKA 3UTUH 1DXPA 1HCGA 3UPEA 4ASHA 1UCYK 4ZKOU 3SJ9A 2D8WA 3PLKA 1UO6A 4X6NA 2LELA 4DOQA 4OS7A 5CHAB 3MH5A 4IS5A 3TH2H 1SOZA 2XNDD 1ESAA 1DS2E 5HM9A 1HIAB 4ESTE 1TIOA 1TE0A 1ZPZA 1F5KU 5F03A 1ABJH 5FCRA 1QZ8A 3VB4A 3H09A 5LPRA 2P3UB 2BDYA 2ZDNA 1IQEA 1L1JA 1SMFE 3HK3B 4OS2A 5FBEA 1BRAA 3QTVH 2ZPQA 3A8CA 1EAUA 2EI8A 4JZ1A 1ZMJA 4BAQB 3K6ZA 3T25A 2CK3D 1V2NT 3BG8A 4Y8YA 4KKDA 3RXDA 1JRSA 1TGTA 3RXEA 2FODA 1XM1A 1BBRE 2VB0A 1C1OA 2Z9GA 1O30A 3A8BA 4NFEA 5EQQA 3ZYDA 1Z1IA 3A87A 2C8ZB 2PTNA 4FUEA 4NA7A 1G30B 1QTFA 1LVYA 1FX0B 5EXNA 2H5DA 2KR7A 1C5PA 3E6PH 3GY4A 4KGAA 2R2WU 3VPKA 3LGYA 3CP7A 7GCHG 1GDUA 4Y6DA 1SR5C 1TNLA 5DP5A 1C2HA 1LQDB 1T8MA 1ZGVA 4TPIZ 3MHWU 3RXBA 1EPTC 1AVXA 4KP0A 4UEHH 1SQTA 1P01A 2O8LA 2WPKS 3VGCB 2F9VA 1K1MA 1B0FA 1FLEE 1PPEE 4CR5A 4X1NU 4IMZA 1SC8U 1WU1A 2GV6A 4KTCA 1E36B 5EW2H 1O2TA 1QBNA 2BZ6H 1OS8A 1C5WB 3ZZBA 5A0CA 1GI4A 1H4WA 1RGQA 1GDNA 1KMHB 2GCHG 1O3GA 4RKOB 2EQNA 2WSSD 4UONA 1JBUH 1C5SA 2WPDD 4Q4LA 1OX1A 1JOUB 1O31A 4FETA 3W1EA 1LHEH 2A0QB 3N7DA 4UDWH 1O2JA 1Y3VA 1A5IA 2BY8X 3T26A 3DT0H 1MCTA 1UJ1A 5C3NA 1SGIB 1XXFA 3GCHB 2ZWLH 1NFUA 4JZIA 1W7XH 1HJ9A 1XVOA 2J94A 3V12A 1O3FA 2TGPZ 1GJ9B 1LPGB 3FFGA 3STIA 1PQ7A 1IQNA 4YT7H 1S82A 3TVJB 1KXDA 2ODPA 1V2KT 2P93A 2XRCA 4THNH 1EJAA 3EYDA 4Q80A 1EASA 3S9AA 1QY6A 3BSQA 1F0SA 3ATIA 5CE1A 1AVGH 1K1JA 2CXVA 5E2OA 1LHGH 1V2VT 4GVUA 2W3KA 3SNBA 2BLQA 1GBKA 1C2KA 1EQ9A 1AB9B 1XUJA 5A2MH 1C4V2 1YYY1 3FVFB 3ODFA 2Z9JA 3OYPA 2VVVA 1QA0A 3FP8E 2P95A 1P3EA 4UE7H 1NRPH 1D4PB 3EAJA 2PLXA 4VGCB 1K1OA 1K28D 1SG8B 1YPHC 6CHAC 2P3TB 3TNSA 1FY5A 1T4UH 5GNDA 3U1IB 1NPMA 2VIDA 1OP0A 3AW1A 4B1TA 4INLA 1SGYE 1FPHH 3T29A 1KXFA 7GCHF 2ZG0H 3ZZ4A 1EB1H 1ELDE 1ZHPA 1PJPA 3Q76A 1O5AB 3PYHA 3PMBB 3FOAA 4DURA 2RA3A 2QXGA 3ATKA 2GCTC 1S0RA 3NXPA 2Z9IA 2A4RA 3M3SA 3PM3A 1W3CA 4CHAC 4GPGA 1O5FH 2FOFA 3AAUA 2TPIZ 1WQSA 4CRCA 3SHAH 2P3FH 2A31A 1SPJA 1XKAC 3BTHE 3OFND 1TYNA 2K8IA 4RT0A 1DICA 2CJIA 2J2UA 2RG3A 2PUXB 1G9IE 1YKTA 1S0QA 4ABJA 5GIBA 2PR3A 1DPOA 2HPPH 4I7YH 2OBOA 1K1PA 2ZU2A 5EQSA 1P05A 2FPZA 4KTUA 4O03A 1JMOH 1TWXB 2A5AA 2QGRA 2BXTH 1EATA 5L30H 2XNIA 2AHME 1W0YH 1QGFA 1O36A 4GHQA 2AIPA 1KXAA 1QJ1B 1GBTA 4B2CA 3U9AH 1K0HA 2YMSC 2BVRH 2OQUA 3FN8A 2Z9KA 1ZJKA 3PRDA 1YPMH 2ZU4A 2UWLA 3A8AA 1GHBF 1SGNE 2KCYA 2BD7A 4YESB 1AUTC 3SYJA 3VEQB 1KXCA 1DWBH 1E38B 5J4QA 3SI3H 1ELCA 1SSXA 1O2VA 3ZV9A 5DP8A 1IQKA 1V2QT 4M7GA 1F0UA 4NA9H 2W7SA 4PROA 1YGCH 2FOAA 4AFSA 1LDTT 4I8GA 1ETSH 1G32B 4IN2A 1LQEA 3QX5H 3TJOA 1GWAA 4FUHA 5FHTA 1UTJA 1SLVB 1V2ST 4Y8ZA 2A7HA 2O8WA 2G4UA 3BG4C 1ZTKA 2XTTB 3FAOA 2C8XB 2TBSA 1EOLA 3MU4A 1QRWA 1TBZH 2NU1E 2DUCA 1QJ6B 1SFIA 1PPCE 2GT7A 1BQYA 4Q7ZA 3BTTE 1GBAA 3SUFA 1UCYH 2WPLS 3ZYEA 3U8RH 3GY6A 1FIZA 1P12E 1BRBE 2QXIA 2TIOA 3GDVA 2GMTB 1KY9A 2B0FA 2BVSH 3UWJH 3RC4A 1CT4E 1QNJA 4WVPE 3TGJE 2F9BH 1V2RT 4GSOA 3O8RA 1Z8IB 1PPZA 1AO5A 1GI6A 6LPRA 2VWMA 4UFFH 3KYGA 3P8NA 5FPSA 1A5HA 1FN6A 1INCA 1HUTH 3RXAA 1OOKB 2ZDAH 1BTZA 5FCKA 1SGPE 5EG4A 3PRBA 1XXDA 2J4IA 4WMEA 1YPHE 1PQ8A 5B6OA 4JCNA 1BMNH 4BXSA 1V2MT 1P3CA 3LC5A 3QUMP 3LGIA 2A7JA 1HAPH 2ANMH 3DUXH 2PSXA 1ELFA 3MFJA 1QR3E 2QAAA 4WH6A 5T6GA 1LVBA 2FTMA 2OTVA 1Y5BT 2STAE 2QF3A
chains in the Genus database with same CATH topology
1EZQA 3ATMA 3BG4B 1C2EA 1TALA 1OYQA 2Z94A 3GICB 1AMHA 2FI3E 3WY8A 2ZDLA 3PTNA 3TITA 3MNBA 4IGDA 1GBFA 1MAYA 1SHYA 1TGSZ 1TRMA 1UTLM 2D26C 4ZH8A 2PGBB 2W7UA 4ABDA 1DFPA 1TNKA 1TMBH 1MCVA 2ZQ2A 4FUIA 2SNVA 3CS7A 1HXEH 5LGOA 5TCCA 1AFQC 1O3LA 1AB9C 4LXBH 3L6PA 1OP2A 4X2WA 4Y79A 3HK6B 3RXSA 1TOMH 1WBGB 4A7IB 1HNEE 1MTNC 1O33A 1THPB 2J92A 3LU9B 4LOYH 1OSSA 2AFQB 2A5KA 4I32A 1NU7B 2A2QH 5EXMA 7ESTE 3RUOA 1M9UA 3EA9A 1A1RA 2FX6A 5GCHF 2EI7A 4O3UA 3KQBA 5F8TA 1HJAC 1IHTH 3ITIA 1N6YA 4WXVA 2HNTE 4AFQA 1C2DA 1TONA 1O3IA 4Y7AA 6GCHG 4A5TS 1DE7H 1GI3A 1DUAA 4JYTA 4A1VA 2OD3B 3RLYH 1ANDA 8GCHF 4FUJA 1HAZB 4ZHAA 1PQAA 3AW0A 4MLFB 5DP6A 3S0NA 3PTBA 1DLKB 2UUJB 4MPXA 3SUDA 4Y0ZE 1C5QA 2BDIA 2GX4A 4DW2U 1FAXA 1Y8TA 4HZHA 1J8AA 3RU4D 5EW1H 1O3AA 1SHHB 1UVTH 3RXVA 3ATWA 3RU4E 2XWBI 2GTBA 2ZCLP 4CBNA 3CENA 2RA0A 2QF0A 3BEFB 1O2NA 2CF9H 3VXEH 3UOUA 2ZU3A 3MYWA 1GMHG 3GY2A 8LPRA 2VWLA 5C20A 1C9PA 1OYTH 4JZFH 1O3BA 1ZSLA 2OC7A 1C5NH 2XBVA 2EA3A 4OGYA 1P8VC 1QB6A 3Q3XA 1GHAG 5FBIA 5JB8S 2V35A 1GMCG 3TK6A 2ZPSA 1G3EA 3ZVBA 3UUZA 1V2OT 1O2SA 1JWTA 2BTCE 2VGCB 1AE5A 1O3DA 1YCPK 3GY5A 1VITF 2JKHA 1QIXB 2AMPA 4NWLA 2BLVA 1ETRH 5DPAA 2XW9A 2XBYA 1N6XA 1G3CA 3DFJA 1LPZB 5E8EH 1O3PB 3D23A 2C3SA 1F0RA 4AFUA 3U8OH 2FXRA 1OXGA 1XVMA 4YOJA 1YM0A 3GCNA 2B7DH 3EGKH 3RC6A 3KQDA 3SV6A 2VH0A 4DCDA 1MTUA 4AYYB 2G4TA 3UY9A 3MH6A 2BLOA 4Z6AH 1C5XB 1XX9A 2OP9A 1NTPA 2HWLB 2QXHA 4YO9A 1QBVH 4OS1A 4K8YA 1O3NA 1FI8A 1ELTA 1C5RA 5FPYA 5HGGA 1UVUH 1WSSH 1GBLA 2F9PA 2BD4A 3ZZ8A 2J38A 3M3TA 3SGBE 1XUGA 4HI3A 1ELBA 2FS9A 2FO9A 2SGEE 3MH7A 1BT7A 5HM2A 4TYDA 1L1NA 1X7AC 1ZSJA 3A7YA 1GBEA 4VGCC 2QA9E 1HV7A 5JBBS 3OY6U 1CGJE 1BJUA 2TGTA 1CQQA 5DP3A 1GJDB 5FAHA 1CHGA 1LHDH 3E0PB 1AGJA 2BQ7B 3V3MA 1OWHA 1ID5H 1XUKA 1HAXB 4IBLH 1XUIA 1C1RA 1BBRK 5F6MA 2HRVA 1BA8B 4X8TH 2JH5D 1O2RA 4E7RG 2C4FH 1AVWA 2ZHWH 1K9OE 1YPKH 2KAIA 2ZDMA 1W8BH 1BTUA 3UREA 4JZEH 1QRZA 2Z9LA 4JK6A 3R0FA 3RMOH 3MO6A 4K69A 5IYTA 4DY7B 3KL6A 3QGJA 2WV5A 4ISNA 3SO3A 3SU2A 2PV9B 1HAYB 4ABHA 4AOQA 1TFXA 3B8JA 5JB9S 1H8DH 3RXFA 1E35B 4AFZA 4CRAA 4I8HA 2Y82A 1E0FD 3AAVA 5DO4H 2SGPE 2VU8E 2ZDKA 1F2SE 1O2LA 2WYJA 1TNJA 1HXFH 2QC2A 3ZZ7A 3Q3YA 1QURH 1L4ZA 4FUBA 1TX8A 1DT2A 3BF6H 3D49H 2SGFE 4AG1A 2IPHA 2FOGA 2FOBA 2O9QA 4UD9H 1C2MA 2GDEH 5BPEA 3Q77A 4X6OA 3A81A 1JRTA 4DG4A 5GPIB 1AE8H 2BM2A 1KXEA 2H9HA 1UCYE 3F9FA 1LMWB 4XBCA 1LVMA 1GVZA 1VGCB 5DJ7A 3SJ8A 3B23B 2YNBA 5F8ZA 1QRXA 1C2FA 1KSNA 1SQAA 1P2MA 5ESTE 1E37B 3W95A 4H4FA 4UFEH 1DY9A 3ZVAA 2ZHEH 3MOCA 4NIVA 3QZQA 1Z71A 2BYAX 2BX4A 1GHVH 3STJA 4NIWA 2GP9B 1Y3UA 2FLRH 2BD9A 1FONA 1QL8A 2ZGBH 4R0IA 1SGDE 1GI5A 2A4QA 2P8OC 1GPZA 3SU3A 1TPAE 2J34A 1S81A 3TIUA 4JYVH 2BDBA 2GZ9A 2A45B 1UHBB 2HGTH 1RJXB 3A89A 1MD7A 9LPRA 1EKBB 1AWFH 5EODA 3QLPH 2AMDA 3GY3A 1ZSKA 1P57B 2XCFA 3EQ0H 3M35A 1FY4A 8KME2 3U8TH 4IMQA 2H5CA 1GCTB 1KTTB 3U1JB 1CGIE 2PSYA 5L2YH 4U01A 4B2AA 1C5VA 1EAXA 1S6FA 2BD8A 4INHA 1O3HA 1G2LA 1P09A 2ZO3H 1GMDF 2G51A 3M5NA 2QV1A 1O3EA 2DE9A 3RP2A 4YT6H 2B9LA 1AIXH 2NWNA 1TNHA 3MO3A 5JBAS 1THSH 4AZ2B 1SVPA 4X1QU 3UQOA 2WPMS 3FP7E 1RIWB 4ISOA 4INKA 4ZAEA 4AG2A 1A7SA 1ETTH 1QCPA 3ZZ6A 1JIRA 1UTMA 4K8BA 4K5ZA 3LJJA 1P06A 3KGPA 1BUIA 4BTUB 1O2WA 3S69A 1HFDA 1RRKA 3I78A 3BTGE 5JYIA 1UK4A 1W7GH 1LKAA 3OSYA 6CHAB 1SGRE 1HAOH 1H9IE 4Y10E 3QDZB 2GKVE 4NWKA 5EPNA 5GWZA 1GMDG 3HGPA 1C2GA 2PWXA 1CHOF 1N8OB 1EZUC 1Y5UT 2F9NA 2WV4A 4CREA 2QN5T 4GUXA 4WWYA 3NPSA 3NUMA 4TPYA 4ZHMU 1DWCH 3E0NB 4U30A 2J9NA 1K1NA 1SGCA 3UNSA 2ZECA 4Y76A 3LONA 3RXIA 1C1PA 1CSOE 8ESTE 1HB0B 1ABIH 1SGEE 1AKSA 3BEUA 2VNTA 1LO6A 5A8XA 2BHGA 1GG6B 1CE5A 3UNQA 2ZZUH 3M37A 1GBIA 1SI5H 3M5OA 4GCHG 2V3OH 1L0ZA 2WPIS 5G4BA 4NSVA 1U6QA 2ZEBA 3SU6A 1GHYH 3MU5A 1Q3XA 1EXFA 1ESTA 1A46H 3MNCA 5FXLA 3RXMA 2ZKSA 4K1SA 4KELA 3ZZ9A 4K1EA 3FP6E 2FLBH 3VB5A 1GHBG 4JZDH 1GBCA 1BHXF 3UWIA 1ARBA 2ZU5A 3PROA 2BDCA 3RXCA 4BTIB 2Q6GA 1D3PB 3E16B 1MQ6A 4WY3A 2ZCKP 1FIWA 2CN0H 2F9OA 1QHRB 1BCUH 3I77A 4FXGH 4I31A 2TRMA 1NY22 4ABGA 4TY7A 2ZNKH 4B75A 3SUGA 1AQ7A 3SORA 1C4Y2 1W2KH 3GY7A 4RSPA 2QYIA 2Y7XA 3H7TA 1OP8A 2OC8A 4KTSA 1UVOA 1P2JA 1S85A 1FQ3A 1EZSC 1EAWA 3VB7A 1T32A 4MVNA 3BV9B 2BY9X 3EE0B 1YLDA 1YP9A 1HAIH 3SNEA 1H1BA 3OU0A 2FDAA 1KTSB 2Y6TA 1ZTLA 4WMFA 1V6DA 3M5LA 3O8BA 3SJIA 2HPQH 4X8SH 2VGCC 1MKXK 3A88A 1ZRBA 4O9VA 5BRRE 2IJOB 1O3OA 1PYTD 1TNIA 4ZXYH 1G3DA 1CA0B 4NFFA 2A4OA 1HBTH 3LJOA 3ELAH 2RCEA 1LHCH 3BEIB 4K3JA 2TGAA 3ZVCA 2B5TB 2XYAA 1D9IA 1YBWA 1D3TB 1A0HB 1CT0E 2BQWB 1MTVA 4AGKA 4BNRA 1SL3A 3I29A 1UMAH 1WTHD 3ZZ3A 3VB6A 1B5GH 1EB2A 3A7VA 2H6MA 2AMQA 1CA0C 2UWPA 2BY6X 1ZZZA 1SGFG 2UWOA 4UFGH 5JDUB 2XBWA 4D7FA 1AKSB 2LPRA 1LTOA 3EA8A 1HAVA 3QO6A 3K9XB 4MPVA 1OWDA 3OX7U 5E0JA 2G81E 1S5SA 2CHAB 1C5YB 2FS8A 2ZCHP 1AFEH 4OS4A 3UOPA 2VIPA 1BTWA 1TQ0B 4NIYA 1P04A 1C1TA 4YZUA 1A0LA 2Y5HA 3MU0A 1GDQA 6GCHF 1RS0A 2M5TA 3QN7A 4CRBA 1CT2E 3ZZCA 1V2LT 3OY5U 3H7OA 2CHAC 2OCVB 3TJUA 1GVLA 1ARCA 2XXLA 3K2UA 1T8OA 3S7KB 2QXJA 2Z6BD 1EPTB 2SNWA 3KNXA 1TGCA 4XOJA 1G36A 3TK5A 1YCPM 1UK3A 3K65B 3LC3A 1GGDB 3SOSA 1FJSA 4D9QA 1L1GA 3D62A 3LGUA 1EZXC 2Q6FA 3MNXA 3HATH 1T31A 5AVDA 1MZAA 1OWKA 4CRDA 1VR1H 1P2KA 3P6ZB 2ALPA 2ZHFH 3RU4T 2A32A 1VCPA 3LGTA 1FMGA 1OWEA 2BD5A 1C1QA 1EOJA 4LK4A 2Y81A 1J17T 4FUGA 4HFPB 1EUFA 2FOMB 1BMAA 4GCHF 3SN8A 1IQGA 1IQMA 1O2QA 2C8WB 3GOVB 3ODDA 4IN1A 1MH0A 4K60A 5A0BA 1SGFA 1GI9B 1A3EH 5DKMA 1C5ZB 1XMNB 4X2XA 3SU1A 3BTEE 5ESBA 5A8YA 2VIWA 2GGVB 1ZTJA 4X6MA 1CU1A 3TH4H 1NFYA 1O5CB 3GCTF 1BZXE 2ZI2H 1VCQA 2PTCE 4A6LA 1A5GH 4SGBE 2VWNA 1D3DB 3TH3H 1DDJA 2BZAA 1C5UA 2VVCA 3VFEA 2FWWA 5GDSH 1G3BA 1NRQH 4E7NA 4ZMAH 2H1UA 3HKIB 2BD3A 2Z3EA 4ZKSU 3SU0A 1QA7A 3ENSB 3A86A 4YOGA 3SQHE 1YPJH 3SV9A 1UHBA 1GBMA 1TMTH 1SLWB 4TY6A 3SNAA 5C5NA 3IG6B 1ANBA 3M7UA 1AN1E 2BB4A 1ZHMA 1TA6A 1TBRH 4WH8A 1TPSA 1E34B 3BTME 1O2PA 3SU5A 3DA9B 1GBBA 1IHSH 2JH0D 2WUCA 1V2WT 4XSKU 2CF8H 1OKXA 1PPFE 1CVWH 1J9CH 4MDSA 2O8MA 1HDTH 1W11U 1NM6A 1P9SA 4BAHB 2P16A 4ISLA 2TGDA 3ZVGA 3M36A 1C9TA 1WAYB 1KLIH 2HNTC 2JH6D 3Q00A 1Z1JA 2GCHF 1EP5A 4TWWA 3UR6A 4AORA 1OWJA 2XCNA 1AD8H 2ESTE 2ZGCA 1Z6EA 2OLGA 1ELEE 1BTYA 1O5DH 2FOHA 1J15A 3KQCA 2BQ6B 2FIRH 2SGQE 1C5TA 2BX3A 4H6TA 1BMLA 1DWEH 5IDKA 1DSUA 1Z8GA 2VIOA 4IC6A 4Q7XA 4ZROA 3SNCA 4A92A 1NFWA 2RDLA 2A4GA 4R8TB 1ESBA 2C90B 4AN7A 5C1YA 1B0EA 2G5NA 3PV4A 1K22H 1P2IA 2WUBA 1UTQA 2SGDE 3LKWA 4BAKB 1QL7A 4K2YA 4Y11E 1DXWA 1EP6A 2HOBA 2VWOA 4FVBA 1HIAA 3SQEE 1MUEB 3E91A 3SBKA 7KMEH 1O2KA 5K0HA 1OWIA 1MBQA 3SGAE 3KHVA 5J4SA 1HGTH 2ALVA 3KEEA 3M7QA 1S84A 5A09A 3UNRA 1EJMA 2PFEA 2PKAB 2WPHS 1H9LB 5TJXA 2D2DA 5EPYA 1ZGIA 2AEIH 3A7XA 1DWDH 4FU7A 4MPUA 2A2XH 3T62A 3NK8A 3W94A 1TRYA 3E1XB 1Q2WA 4X8UH 1NZQH 1GMHF 3FZZA 1G2MA 1WYKA 1TPOA 5DK1A 4RN6A 2CMYA 3MU1A 4NGAH 1F7ZA 4U32A 3SHCH 1O0DH 1SLXB 4LZ4B 2SGAA 2GMTC 4ISIH 4YLQH 2EC9H 2D1JA 2AERH 1DANH 3UIRA 1BDAA 2ZGXH 1A0JA 1SLUB 1Y59T 3ZZ5A 2VINA 1P2OA 1K21H 1CHOG 3BN9A 1GVKB 4I8JA 4XFQA 2R0LA 3FANA 4DIIH 3T28A 4Q2KA 1CGHA 4DT7B 4XBDA 5C2ZA 4X2YA 1AZ8A 3LGVA 1O5BB 1KXBA 4D7GA 3P70B 2GVFA 3RXQA 2THFB 2HVXA 1KDQA 1W13U 5LPEA 2FYRA 4I8LA 2PW8H 1H9HE 6ESTA 2HNTF 3T2NA 3SJOA 4XDEA 4ZUHA 1TA2A 1F5LA 1GJ7B 1W0ZU 3P17H 3RM0H 2BXUH 4MG3A 3L33A 1S83A 1RD3B 1V2UT 2Y80A 2FOCA 4GLYA 5GCHG 1PPBH 1P2QA 2PKSC 1AUJA 2ZFTA 3MMGA 1CA8B 1VITH 2XBXA 1TPPA 1PPGE 1DITH 1KDQB 2OINA 3T5FH 3UFAA 1K1IA 3HPTB 2Y5FA 1ZPBA 2OBQA 1C1UH 5SGAE 3L3TA 1J14A 4FUDA 2ZC9H 1Y3XA 4ABEA 3RMLH 1YPEH 2YOLA 3URCA 1TBQH 3BTDE 4Y0YE 3ZVFA 4X0WU 1BMMH 1FZZA 2ZDVH 9ESTA 2Y5GA 3QK1A 4X6PA 4NZQA 4MNYA 2GCTB 1ZYOA 2PKSB 4ZKRU 2AS9A 4CRFA 2ZTZA 1FY8E 1HPGA 4F49A 3RXPA 1WCZA 1Z7KA 1O2OA 4B73A 2ANKH 4MNWA 4I33A 1V2PT 1Q31A 1O2ZA 2BOHB 4HTCH 4B74A 4MTBA 2FMJA 4GAWA 4U2WA 3QGNB 2ZHDA 1MD8A 1AHTH 3GCTG 2YNAA 5A8ZA 1A2CH 1MKWH 1IQFA 4WJG2 2CV3A 1GCDA 2ANWA 1C1SA 2C93B 1GI8B 5JPMH 1PPHE 4CH8B 1J16A 1BRCE 1TGBA 2ASUB 1D3QB 2XC5A 3SZNA 5HMAA 4NCYA 5E0GA