4NFEA

Human kallikrein-related peptidase 2 in complex with benzamidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
227
Chain Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Kallikrein-2
total genus 51
structure length 227
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA01
2HWLB 5G4BA 1KYNA 1QQ4A 4I32A 2NWNA 2ZEBA 3SNAA 2VVCA 1CA0B 2FO9A 1H8IH 4Y8ZA 1HUTH 1P2JA 1JXPA 1C9TA 3A89A 4JCNA 2IPHA 3BEIB 5EPNA 3GY3A 3A7WA 1DX5M 3ZZ8A 1GDUA 3V0XA 3MO6A 2BDGA 3TK5A 4X2WA 1AE5A 1DWBH 3VB4A 2BLOA 4D8NA 3H7OA 1FIZA 2CN0H 1O2SA 5DG6A 5TJXA 3A7ZA 3D62A 2FX6A 4Y6DA 1ESAA 3U1IB 4JK6A 3H7TA 3LIWA 4AZ2B 1TNJA 3SU3A 3BEUA 4O03A 1GBAA 2BDBA 4Y76A 4JYUH 1P0SH 1SHYA 2VVVA 2F91A 1GBCA 4FU9A 1ZTKA 2BLVA 3TPIZ 2HOBA 3Q3XA 2BYAX 1B0EA 1NRQH 1O32A 1T8MA 1GG6B 1GMCF 1TMUH 1ZR0A 4DIIH 2O8LA 4HI3A 5LPRA 1C5YB 3NWUA 5FHTA 3ESTA 1JMOH 2OC1A 4MNVA 4CHAC 4K1SA 3HK6B 1TGSZ 1TQ7B 1FI8A 1MD8A 2J95A 2A4RA 2CV3A 2JETC 3P8OA 2ZGBH 3ATIA 1GDQA 3GDSA 3UIRA 4ZHLU 3M5NA 1E35B 4K3JA 1UTQA 3UFAA 7LPRA 1CT2E 4YLQH 3A7TA 3UNQA 1LCYA 5J4SA 4JYTA 2BTCE 2PGQB 3UQOA 3RXEA 2CF8H 1ABJH 4A92A 1JIMA 1WCZA 1A3EH 2OD3B 4K8BA 2SNWA 8ESTE 1SSXA 1G3BA 2TGTA 3Q77A 2UUFB 1Z8GA 1TPPA 3UR6A 4RN6A 1AUJA 1A3BH 4YOJA 1SQOA 2VINA 5F8ZA 1SGYE 2TPIZ 1GDNA 1UHBA 1GBHA 1MAXA 2AIQA 4MQAA 2Y81A 1SLUB 1YC0A 2LNCA 3LGWA 4KTUA 3SUEA 1KXDA 1KTTB 4NFEA 4YLUA 5JPMH 1V2PT 4MPXA 1O3BA 4IMZA 2TRMA 2Q6GA 1GBLA 1C1PA 1CGIE 1SGTA 3B23B 3SU4A 2W26A 2VGCB 1MQ5A 2VWNA 1YPEH 2BD2A 4X0WU 1CE5A 3SHCH 2WPJS 4Z0KA 4X8SH 5GXPA 1GJDB 1M9UA 2FOFA 1BTXA 1H8DH 2R9PA 3SZNA 2FDAA 5FX5A 1BJVA 1EJAA 1SOZA 4XOJA 1EPTC 2W7SA 1VCPA 4X2VA 4BAHB 2ZQ1A 1AFEH 1O3EA 3TU7H 2VIQA 1GVLA 1HNEE 3ELAH 2ZGCA 3MH5A 3SV9A 4AGKA 3BG8A 1A0JA 2FS9A 2BD4A 2RDLA 1WV7H 5HXFA 4NWKA 2EI7A 1TNHA 4NSYA 4UDWH 1C1MA 3A87A 1ELAA 4KKDA 3RXVA 4TWWA 4A5TS 1HAYB 2VWOA 2GDDA 4NSVA 3E8LA 2P3FH 1IQJA 1P57B 3A83A 1MTNC 1SGQE 3URCA 4NA7A 5F8XA 1S0QA 4K8YA 1MUEB 2GD4B 3ZVFA 1V2JT 1EJNA 2AH4X 3PMJA 1O38A 2PKSB 1ELTA 1P2QA 3LJJA 1TB6H 3ATLA 1RXPA 2P16A 3A82A 1INCA 3SBKA 1C2GA 3SORA 2C8XB 4Y10E 3C27B 1LHCH 1P05A 2G52A 1TA6A 2A5IA 4IGDA 3T29A 3AW0A 3UY9A 1O2HA 2NU4E 2FEQH 1TALA 3E0PB 3MH4A 4ABEA 3RC5A 2ZF0H 1HJ8A 2BOHB 2D8WA 1UTPA 3RXAA 1UK2A 5A09A 2BB4A 1YYY1 3E90B 1FAKH 3PM3A 1C5WB 3E0NB 4ISOA 4LZ1H 2GT7A 2OBQA 1DM4B 1O33A 1DANH 1GJ4H 1O34A 2P8OB 2Y5HA 3BG4C 2GX4A 8KME2 1SGPE 1DXWA 5C5NA 2IJOB 5JYIA 1HIAB 2O8WA 4ZXXH 3C1KA 2OUAA 5JBAS 1LMWB 5CHAC 4AG1A 1MTVA 5FX6A 2FOGA 1GMCG 2HPQH 4CRBA 1EX3A 1GI2A 5DGJA 1XVOA 2IN2A 3KCGH 1GBIA 4OGXA 3ZV9A 5AF9H 5LPEA 1IQNA 3SV7A 4A6LA 2J2UA 3S0NA 4ABGA 1GJ8B 2BXUH 3BN9A 4I8LA 1W12U 2Y7XA 3F6UH 1KDQA 1O5AB 3BTEE 3LDXH 4WMFA 1C1RA 1YPMH 2ZHFH 1DOJA 1KLJH 1BTHH 5L2YH 5A8YA 1J16A 1UO6A 1HJAC 4IMQA 1GPZA 5AFZH 2AERH 5I25A 1TRYA 3RUOA 3E16B 2ASUB 1GBFA 3W95A 1PPFE 1OPHB 1SC8U 3OX7U 3SHAH 1C1QA 9ESTA 3D23A 1PYTC 1HAVA 3RM2H 3M5MA 1C2FA 1KLIH 3A7YA 2PSYA 3IWMA 1O2MA 3PTNA 4YM9A 5GDSH 1TGNA 2J92A 1O3MA 4LOYH 1PPGE 2FLRH 2FXRA 2PUQH 1C1VH 3RXCA 1MCTA 1UTMA 4KTSA 1GJBB 5AFYH 1C9PA 1VGCC 2BY5X 2ZHDA 4FUDA 3NPSA 2GCHG 3S7HB 1NRPH 4B73A 3NKKA 4XSKU 2C8YB 1DWCH 1TBQH 1TONA 4GHTA 4INKA 3M7TA 1C5SA 1DWEH 2G51A 2C3SA 1FQ3A 1XUFA 1NU9A 3QLPH 1NROH 2B8OH 1L1NA 5C5OA 1DUEA 1FDPA 1OXGA 4R0IA 1V2MT 5HM9A 4CRFA 2SFAA 4YT7H 1D6WA 8GCHG 5DP3A 1HAIH 1FIWA 1GVZA 1Z6EA 1BJUA 2Z9LA 3RXSA 5GJ4B 1GHZA 5A2MH 1N6XA 1DLEA 4J2YB 1LQEA 2A7JA 1LVBA 2ZNKH 5IYTA 2A1DB 2YOLA 2ZFFH 1E38B 2OBOA 1AZZA 1HYLA 2WPMS 2F9OA 2BDAA 1HAXB 2W3KA 3F68H 5ESTE 1W13U 1EZXC 1G37A 4B74A 4YO9A 1F5RA 3RLYH 1ZTJA 3ATMA 2R2MB 3SNCA 4ABIA 3RXTA 1NO9H 1TGBA 1BTYA 3ZZ5A 2PSXA 1UTOA 1DVAH 4YESB 1SGNE 2ZGJA 1O3CA 4ZHMU 1GBMA 1YBWA 3KQCA 3PMHB 1XXFA 1FONA 3HATH 3F9FA 3QZQA 1C4V2 3L33A 4MG3A 3NK8A 1H9IE 1SQTA 2DUCA 3EYDA 1Y3VA 4ZKRU 5E0GA 2ALPA 1MZAA 1DY8A 1G3EA 1PQ8A 4X6OA 2Q6FA 3RXFA 3SV2H 3S9BA 1YPJH 1K1NA 1P2NA 2BQ6B 1V2LT 4YT6H 2ULLA 2BLQA 1LDTT 3GDVA 1DPOA 4X6MA 1NC6A 1O3HA 3P8GA 3VGCB 3D65E 4AX9H 3QTOH 2OC7A 1O2RA 3SJIA 3G01A 5FAHA 1K1MA 2AMQA 2PTNA 1B5GH 2TGPZ 1O3LA 4KP0A 2ANMH 1TRNA 3BV9B 4U32A 1FN8A 4YOGA 5B6OA 1GI9B 1YPHE 1QY6A 1BHXB 1EAUA 2BDIA 1K9OE 1P11E 1XVMA 2BD7A 5EPYA 2QCYA 2VIWA 4AB8A 3LT3A 4BAOB 3QO6A 1IQGA 1TLDA 4ESTE 2QYIA 3F9EA 2O9QA 3BTQE 1HAHH 4RSPA 3SJ9A 4MNYA 2F9NA 5L2ZH 1XUKA 3UTUH 4U2WA 4YOIA 1S6FA 1NESE 2FTLE 1OWEA 1CGHA 3MYWA 4GVUA 3P17H 1IQKA 4WMEA 3MTYA 4Q7YA 1V2RT 4DIHH 8GCHF 3ZZ9A 2P3UB 2OC0A 1IAUA 1O2KA 4JZFH 3A7VA 4Y79A 3R3GB 1Z1JA 2OINA 1CQQA 3K6YA 2ZTXA 2WPKS 4TPIZ 2Y7ZA 1BIOA 1AN1E 3RXJA 1OWJA 1TMTH 1QIXB 2PLXA 3ATKA 1QB6A 1D6RA 1L4DA 2WPIS 4Q2KA 4YZUA 3RXKA 2H5DA 4NA9H 3SN8A 5LH8A 1AE8H 2GCHF 5HGGA 2C90B 4AFQA 1BZXE 3GYMA 1NPMA 1TX8A 2R0LA 1TGTA 1IQFA 1P2OA 3GICB 2G55A 2TBSA 5IDKA 2Y5FA 1S81A 3PWBA 4HFPB 1KXAA 4B1TA 3A8BA 1RS0A 1UVOA 2CGAA 4I8HA 1MH0A 5C1YA 2ILNA 2OQUA 3QDZB 1OYQA 3BTKE 3ODDA 4B75A 1NFXA 3A81A 1PJPA 1S6HA 3FVFB 4LXBH 1JOUB 4IC6A 2DE8A 4GPGA 1AWFH 1VITF 2VIVA 3TJOA 4AB9A 1TE0A 3D49H 1Y5BT 4MPVA 5I46H 2D26C 3FANA 1TYNA 1OWHA 1GHAG 2XWAA 4WMDA 5C1UA 1GBKA 1YCPH 2QF3A 4KELA 2B7DH 4SGBE 3UQVA 3VB5A 1O3PB 5BRRE 1NY22 5TCAA 3GY6A 1BRBE 3IITA 4MPWA 1FUJA 3URDA 1KDQB 1TX7A 3F9HA 3FAOA 4FVDA 2ZCKP 3V13A 1HRTH 2PW8H 1O2YA 4X1SU 4TPYA 4Y7AA 3HPTB 1MTSA 3UNSA 3HK3B 2PFEA 4MPUA 3PV4A 1KLTA 1BMNH 5DK1A 3MU4A 4GLYA 5EQSA 1IQHA 4XE4A 5DP9A 1A0HB 3LKWA 4Y8XA 1NTPA 1V3XA 2G81E 2ZFPH 2C4FH 3M5OA 5E0HA 1EAIA 5A8ZA 4CH8B 2ZDVH 2BY9X 3UWJH 3ZVDA 2Z9JA 3DFJA 1SBWA 3M36A 1BTWA 2FTMA 1P9UA 1HBTH 3LGUA 1GJ5H 2H9TH 1H4WA 2BQWB 4UFFH 4XDEA 3GY8A 1S85A 4CBOA 1N8OB 4UFGH 2P94A 4ZKOU 2ZDAH 3TIUA 3OY6U 1TQ0B 3BTHE 2F3CE 3F1SB 1MBQA 3KQDA 5FBEA 3OY5U 2GMTC 1IHSH 1SVPA 1P01A 2BMGB 3RXQA 3LGVA 1HCGA 3PO1C 2GMTB 3RLWH 1BCUH 3U8TH 4CH2B 1TNLA 1SLVB 3DUXH 1SGCA 2XW9A 7ESTE 1P3EA 2NU2E 2Z3DA 1SI5H 1J9CH 2OTVA 1QTFA 1QCPA 1QB1A 4FUJA 1HV7A 3JZ2B 4WY3A 1ID5H 3UWIA 1S82A 2A5AA 1C1WH 1O36A 2GVFA 4BOHA 3AVZA 3M7UA 3SNDA 1BQYA 2ZHWH 1FY1A 1ZJDA 2P93A 3A7XA 1O2GH 3WY8A 1GG6C 4UE7H 2UWLA 1LVOA 1GHYH 1MCVA 1O35A 2BZ6H 4INHA 4X2XA 1TGCA 1WTGH 3RC4A 1OSSA 1C5VA 1DS2E 4O3UA 4INLA 1BA8B 2A31A 2PKAB 6CHAB 1O31A 1W10U 2O8UA 2R3YA 1E37B 4DCDA 1PQAA 3AW1A 4X8VH 1GHVH 3RXRA 1WUNH 2BD3A 1DDJA 1NFYA 3E6PH 1O2OA 3PLPA 4LZ4B 4D9QA 1QFKH 2OXSA 5ESBA 3PMAB 1T32A 1SLXB 1FN6A 1MD7A 3T5FH 3TGJE 2ZU3A 1L0ZA 1GHWH 1DSTA 4O3TA 1IHTH 4B76A 1PPEE 4ABBA 4AORA 1KSNA 1RRKA 2BY7X 4ZAEA 3SNEA 2CJIA 4UD9H 1HAZB 1SGDE 3RXMA 4BTTB 2RA3A 4X6PA 4B71A 1WYKA 3CP7A 5F03A 1ZYOA 3A88A 2RA0A 3E91A 1YF4A 3TLOA 2B9LA 2CF9H 4CRCA 3MNSA 4Y11E 4ISLA 5DKMA 3SOSA 2FOAA 1TIOA 2OCVB 1OOKB 2ODYB 1BHXF 1SB1H 2WPLS 2ZWLH 1V2WT 1VCWA 1G36A 1AD8H 3JZ1B 1QJ1B 3P8FA 1ZGIA 4ABDA 2BY8X 2GCTB 3SJKA 1Q3XA 4JZEH 1O2JA 2O8MA 4M7GA 2BX3A 1C5UA 1O2WA 2JH5D 1GCDA 2FYQA 1T8OA 2ZZUH 4WH8A 1WTHD 3SUFA 3ATWA 1AKSB 2VGCC 3ZVAA 1C2IA 1QL7A 3MU8A 1OYTH 1P06A 1C1TA 2ZDLA 4D7GA 2FWWA 2FS8A 1GJCB 1S5SA 1UJ1A 3MHWU 4D76A 1QNJA 4NFFA 2ZA5A 1AVGH 4CHAB 3ITIA 1QRXA 1P2IA 3SU2A 1EATA 1GJ6A 3EA7A 4E7NA 5GPIB 1ELGA 1LPGB 1TPAE 3RU4D 1CBWC 1C2JA 3T28A 2BOKA 2ZDKA 1J8AA 5CE1A 2Y80A 2SGAA 1Y3XA 2STBE 2FOBA 1GBJA 5GCHF 3NXPA 2KAIB 1AQ7A 2LPRA 3I29A 1TX6A 4B2CA 1C5QA 2THFB 2J4IA 2F9UA 1LKAA 4FUGA 4ZMAH 1T31A 4JZIA 1NRSH 3OYPA 1T4UH 1ETTH 3AASA 1C1SA 1ZHRA 1XXDA 3LJOA 1QRZA 2AGIX 1LHFH 3DT0H 2HLCA 3NUMA 5AVDA 1ANCA 4OS4A 1F0TA 3QK1A 4NZLA 1VITH 2XNIA 4UEHH 1A7SA 1O2ZA 4NA8A 1FY4A 3RXPA 1QQUA 1F7ZA 2BDYA 2JETB 1C1OA 1FMGA 4Q7ZA 1V2NT 1FNIA 5C67A 3BTFE 4X8TH 1LQDB 1UCYK 3DFLA 5GCHG 3B8JA 5TCCA 1D3QB 4DGJA 1LVMA 2V3HH 4DG4A 2BD5A 2FM2A 3A80A 3AAUA 4H42U 1BMAA 3ENSB 1V6DA 5PTPA 1DE7H 1O5EH 1FXYA 3TJVA 2F9VA 2H9EH 1NZQH 1BRUP 1ZJKA 4I8JA 2BQ7B 3ZZBA 1GGDC 1HPGA 1WQVH 4XBDA 2GV7A 1MMJN 2H6MA 2V6NA 1MKWK 1VR1H 2A45B 2AMPA 3P8NA 1TABE 1A5HA 1LVYA 6GCHG 4IC5A 4Q7XA 3QX5H 1XUHA 2QXHA 1EXFA 1L2EA 1HJAB 2VH0A 4QT8C 1NFWA 2SNVA 5C2ZA 1C5TA 4UFEH 1V2UT 1IQIA 1C2LA 1SGFA 3P92A 1H1BA 4ABFA 1G3DA 2HVXA 1O37A 1CT4E 2G00A 3GCTG 1AHTH 1TWXB 4AYYB 1MTNB 5EU8A 1V2KT 2C93B 1JBUH 2WYJA 1F0RA 2VIOA 5J4QA 1EAWA 1GJAB 1LTOA 3UNRA 7KMEH 2XCNA 3FP8E 1CVWH 1XM1A 2EA3A 1C2HA 5E8EH 3PO1B 1SGEE 2GT8A 1P2KA 4NZQA 4TY7A 4ABHA 3BEFB 3LH3A 3A86A 6CHAC 1BBRK 1D9IA 2PWXA 1LHDH 1H9LB 2AFQB 4AFZA 2QC2A 4BAMB 3SUDA 2FI4E 5JDUB 1NT1A 4AOQA 1GCTC 2HALA 2AYWA 2ODQA 4ISNA 1O0DH 4KGAA 3A8DA 1O5BB 4X1NU 2ZHQH 3KIDU 2NU3E 4FU7A 2ZTYA 3MH6A 2R2WU 1EASA 3ZZDA 3HKIB 2J34A 1XUGA 1TOCB 1W7XH 4DY7B 3SI3H 2W7UA 1ZLRA 4BANB 1C1NA 1O2QA 1BDAA 3RXUA 2WV4A 2A7HA 4X1RU 4FXGH 4DOQA 3OTJE 1F2SE 1SFIA 4JZ1A 1NRNH 3HGPA 2OC8A 4I8GA 2BD9A 4TY6A 1MAYA 1OP2A 1MKWH 1QJ6B 2Y5GA 5DP6A 1ELDE 1C5RA 1L1GA 1Q31A 5E2OA 1O5GH 4E05H 1F5LA 2HNTE 1HIAA 2Z3CA 1V2OT 3TK9A 1N8OC 3Q3KA 1ZRKA 3CENA 4HTCH 4NIVA 1NU7B 3K65B 2WUBA 2UWPA 2PR3A 2Z3EA 2V0BA 1DXPA 4O9VA 2GTBA 1A0LA 1HXFH 2HNTC 1EAXA 3ZZ6A 3VB6A 3PROA 3T25A 1ESBA 1O2PA 5EW2H 2G5NA 3KNXA 3MO9A 4CREA 5DP4A 4TWYA 1O5FH 1QA7A 1T7CA 4X6NA 2XBVA 3GDUA 1BMMH 3M35A 1O3KA 3H5CB 1EPTB 2TIOA 3ZVGA 1C2KA 3BTGE 3LGIA 1AKSA 1BBRE 3RM0H 1ANDA 1QGFA 4GAWA 2HNTF 1GMDF 4K1TA 3ODFA 4UONA 2H2ZA 2QXIA 2EI8A 2QAAA 4E06H 1TNGA 1LHEH 3UPEA 4XBCA 4ZKNU 4K5ZA 4FVBA 3RMNH 1FV9A 4BNRA 5GIBA 1GBTA 2H5CA 2AGGX 1C5LH 2R0KA 1AO5A 3Q00A 1B7XB 1ETSH 3BSQA 5K7RA 1N1LA 3DD2H 2CMYA 1D3DB 1BB0B 4BAQB 1PFXC 1C5OH 2ESTE 1C2EA 1YLDA 5E2PA 1SGRE 4F49A 5A0AE 2G4UA 1W14U 1GHAF 2TGDA 3M3VA 1CSOE 2ZTZA 1P9SA 5T6DA 2A4GA 3MU1A 3ZYDA 3FZZA 3SU6A 1A2CH 1P2MA 1FY3A 2ZGXH 1SGFG 1O3JA 3A8AA 1K1OA 3MMGA 1SMFE 1P10A 4UFDH 5DP5A 4R8TB 1TPSA 3LGYA 1GMDG 2QN5T 1AFQB 2QA9E 1EZUC 1OWIA 2BDCA 2V3OH 3GCOA 1SFQB 3SNBA 5C3NA 1NFUA 1VZQH 2XBWA 2XTTB 3BTME 1IQEA 4TYDA 2ALVA 1YCPK 1ORFA 2A0QB 5E0JA 5FCRA 1V2TT 2J38A 1W8BH 1ANEA 1ETRH 2VB0A 1DY9A 1CBWB 4NGAH 1EQ9A 2ODPA 3F9GA 4ASHA 1YCPM 1WAYB 1ZZZA 2ZCHP 1W7GH 3SJOA 4YTAA 1S83A 2JH6D 1BTPA 1BTUA 1G30B 5EQQA 4AG2A 1OP0A 1ZTLA 3EGKH 1CT0E 2ZG0H 8LPRA 2XBYA 1BITA 3W94A 4ZUHA 4ZKSU 4WXVA 3PLBA 1O3GA 1C4Y2 1HAOH 4NIWA 2FOMB 1SLWB 1AWHB 1FAXA 1K21H 1LPKB 1UVPA 7GCHF 5ABWA 2EC9H 1OX1A 1L4ZA 3IG6B 1P12E 1E36B 3RXOA 6LPRA 3KF2A 2BVRH 1EPTA 2FX4A 4GCHF 5A0BA 1O2IA 2ZU1A 2Z9IA 3P95A 2SGFE 2FLBH 1DICA 1O3NA 2FYRA 2FESH 1VJ9U 1G2MA 1RGQA 1W0YH 1FPCH 1SR5C 3LPRA 3L3TA 6ESTA 3TVJB 2FMJA 3LONA 2QF0A 1BBRH 1J15A 1O5CB 1BRCE 1GVKB 3BF6H 3GCHB 2RG3A 2ANKH 3S9CA 3LOXA 3SI4H 3ZVEA 1GI3A 3KL6A 3VGCC 3ZZAA 4VGCC 2PTCE 3RC6A 5CMXH 1ZSLA 4KTCA 1C1UH 4JMYA 1K1LA 3QTVH 3UOPA 1Z1IA 1GBDA 1MKXH 2YNAA 1HAGE 1WBGB 1O2XA 4Y0ZE 3PWCA 1V2VT 1HAVB 2FOEA 2WUCA 1QL8A 2ZFRH 3GCNA 4K60A 1JRTA 3VB3A 4JZDH 3VB7A 3SQHE 4XFQA 1GGDB 2JH0D 3BIVH 1YKTA 1N6YA 3RMOH 1XKAC 5HYOA 1PQ5A 2I6SA 4ZXYH 3SUGA 1GI4A 3TNSA 2FIRH 1DLKB 1RJXB 2DE9A 1UCYH 4U01A 3U8RH 3A85A 4OS1A 5H4IB 2OP9A 1A61H 3UR9A 1HGTH 2PKAA 4DW2U 1QR3E 1H9HE 3VXEH 1C5ZB 2W3IA 1JRSA 4AYVB 1D4PB 1GHXH 2PKSC 2VWMA 5DP7A 3MOCA 2ZI2H 3STIA 2P95A 3NZIA 1TRMA 6GCHF 5JB8S 2IOTA 4D9RA 3KQEA 3S69A 3TJUA 3TGIE 2Q6DA 1SOTA 4X8UH 1AGJA 4U30A 2D1JA 4CRGA 3RMLH 4IN2A 4BTUB 1PQ7A 1XUIA 1BOQA 2C8WB 1Z6JH 3M5LA 4JK5A 1Y3UA 5EG4A 3V7TA 4RKOB 1VGCB 1ZOMA 2STAE 5A0CA 1EOLA 2HGTH 1F5KU 1TOMH 3UREA 1RIWC 2PV9B 1ARCA 1Y5AT 3L6PA 4HGCA 1SGIB 1ELEE 1ABIH 1CU1A 2AS9A 5CHAB 3ZVBA 5FCKA 1C5XB 4XBBA 2ZDNA 1P03A 1YPGH 2XCFA 4NCYA 1O3DA 1QBNA 1AFQC 1CHOG 2J94A 1WSSH 5C20A 1P3CA 1ZHPA 3BG4B 1G3CA 1QHRB 1YLCA 3GY5A 1DT2A 3RXGA 1Y59T 1GJ7B 3SO3A 4D7FA 1AB9C 3HGNA 5T6FA 1BUIA 1KXFA 5FXLA 3VFEA 1MZDA 1V2ST 1C2MA 2VIDA 1DWDH 1AZ8A 5EXMA 1QBOA 4JYVH 2BX4A 1S0RA 4OGYA 4DURA 2QIQA 1B0FA 1KY9A 1G2LA 3KN2A 4ABAA 4NWLA 2K1QA 1T8LA 4OS5A 1EKBB 4GHQA 3N7OA 3BTWE 1EB2A 1T8NA 1TBZH 2O8TA 1O5DH 2SGEE 2I6QA 3E1XB 3FFGA 4Y0YE 9LPRA 1K1JA 4X2YA 3SW2B 2XWBI 4IS5A 2XC4A 1A1RA 2W5EA 3GOVB 5A8XA 4B2AA 5EOKA 3RMMH 3SGQE 3P70B 4I7YH 1EZQA 3EA9A 1CHOF 2ZKSA 3V12A 2HRVA 4I31A 2P8OC 3MU0A 4RKJB 3ZVCA 1RTFB 4ABJA 1MU6B 1NM6A 3TITA 5F6MA 1ESTA 1XUJA 2VVUA 2XC0A 1Q2WA 1AU8A 3STJA 3SGAE 2A4OA 1SQAA 1EB1H 3TH4H 1GJ9B 2GGVB 1QA0A 1CA8B 5L30H 2HPPH 1IOEA 2PHBA 2BLWA 3RDZA 1K1PA 3EDXB 4MLFB 3I78A 1RTLA 1QURH 3SV6A 1YPLH 4X1PU 3T27A 1Y3WA 2ANWA 4FUBA 1GI6A 1OS8A 5GWZA 1Y3YA 2GZ8A 4AN7A 1J17T 2CXVA 1QRWA 2G8TA 1EOJA 1FY5A 2FI5E 4FUCA 1RD3B 5DJ7A 2G5VA 2Z9KA 1NRRH 3TJNA 1K28D 3TH3H 2Z7FE 1A5GH 3KQBA 1X7AC 1MTWA 2Z6BD 1O30A 2GKVE 4DJZB 1CO7E 1PYTD 2ZU2A 4A1TA 3DHKH 3SU1A 4FUFA 4HZHA 1CA0C 3QWCH 1ZHMA 1MKXK 4Y71A 1GMHG 3TNTA 1VCQA 1BMLA 1QJ7B 4AFSA 3VEQB 1C5MD 1ZPBA 1YP9A 1GI7B 4IBLH 4NIYA 4BXSA 5AHGH 3VXFH 2Z9GA 1WQSA 3ZZ7A 1THRH 1W3CA 3T62A 1RFNA 2QV1A 3GY7A 1QBVH 3O8BA 4GUXA 2A2XH 3FP6E 5DPAA 1ELCA 1UVSH 3EAJA 1HFDA 1ZMJA 1BRAA 2AIPA 2GDEH 3A84A 3R0FA 3SQEE 3V3MA 1GMHF 3Q3YA 2GCTC 2FI3E 2ZGHA 1O2LA 2ANYA 3RP2A 5EXLA 5T3HA 2A7CA 3U1JB 1MBMA 1UVUH 1Z8IB 3A8CA 1UTJA 1OWDA 3U9AH 1ARBA 2WINI 1GI8B 1Z8JB 2ZFTA 1WU1A 1LPZB 2B5TB 5LGOA 2EI6A 1ZPCA 1AVWA 4VGCB 3GY4A 2UWOA 1O3OA 1UTLM 1ZGVA 2M5TA 3NCLA 5JBCS 1IQLA 2QY0B 4SGAE 3KGPA 4FU8A 1ZPZA 1TNKA 1FZZA 1DITH 3BTDE 5FPTA 3M3TA 1W11U 2F83A 2P3TB 1UK3A 2WYGA 5FPSA 4GSOA 2UUJB 2YNBA 4OS7A 1HB0B 1BT7A 1PPCE 4OS2A 4LK4A 2KAIA 3U8OH 1FLEE 1UTNA 1O39A 1ELVA 2UUKB 2V35A 2ZPQA 2ZPSA 3Q76A 2ZDMA 3VPKA 2AGEX 1VJAU 1OP8A 3CS7A 1FPHH 2QGRA 5F8TA 1P09A 3PB1E 1O3FA 3QZRA 1T4VH 5LPFA 2GZ9A 1GWAA 1EP6A 3MI4A 3QGJA 4H4FA 2A5KA 5C1XA 3O8CA 2NU1E 3MNXA 1L1JA 3RU4E 3FZDA 1ELFA 3ZYEA 1PPBH 3GYLB 4AFUA 3S9AA 2ZFSA 2R3UA 4FUIA 4THNH 1HAPH 2ZO3H 4DT7B 1F0UA 4MNXA 1LO6A 1YPHC 3EE0B 2SGDE 2GV6A 2XYAA 1D3PB 2BM2A 1P8VC 1QB9A 3EA8A 1A5IA 2VJ1A 4F4OC 2ZCLP 2ZP0H 1C5NH 3LC5A 2XC5A 2F9BH 1S84A 1EJMA 3LU9B 4WVPE 3T2NA 1JIRA 4BTIB 2WV5A 1O3IA 1SL3A 4E7RG 1IQMA 1UCYE 4FUHA 5EGMA 1DFPA 3DA9B 1A46H 1P04A 1ZMLA 1KXBA 2TGAA 2A32A 3MFJA 3EQ0H 2BY6X 1KIGH 4WF8A 1THSH 2C8ZB 2PUXB 4OS6A 1MU8B 5JBBS 4B2BA 3TK6A 3QGNB 4WH6A 2BD8A 1LHGH 1NS3A 1GI5A 2ZPRA 1THPB 1VITG 3MU5A 2FPZA 3MO3A 5FPYA 1KTSB 1AB9B 3E3TA 5EW1H 5JBTA 3O8DA 4ISHH 2FODA 2Q1JA 3OU0A 4NIXA 3RXLA 1XMNB 1O2TA 1K2I1 2XXLA 3QN7A 1FJSA 3ZV8A 2P59A 3S7KB 1MQ6A 1EZSC 3I77A 1RTKA 1GHBF 1GI1A 2VNTA 1E34B 1PPHE 3GY2A 4ZH8A 5HM2A 1MTUA 2FOHA 4FUEA 1AVXA 2BHGA 3KHVA 4Y7BA 2RCEA 1TFXA 1AMHA 1UVTH 1Y5UT 2AMDA 2SGQE 1HLTH 3SU0A 2QXGA 4J1YA 1YGCH 4IW4E 2ZQ2A 1A4WH 1C2DA 1FY8E 1GL1A 1ZSJA 1ZRBA 2SGPE 3ZZ4A 4ISIH 1AI8H 3HKJB 1E0FD 3SU5A 4A1VA 2BDHA 3MH7A 1ZMNA 3MNBA 4MNWA 1U6QA 1AY6H 3UUZA 4WXIA 3SGBE 5BPEA 2UUYA 4Q80A 1DSUA 3SV8A 4PROA 3LH1A 3RU4T 1TAWA 1UK4A 3K6ZA 3M61U 2EEKA 3M37A 3LGTA 1ACBE 5FBIA 4A1XA 5K0HA 3U98H 3BIUH 4CR9A 1HDTH 1G32B 4I8KA 4K2YA 1QL9A 3RXDA 4DVAU 1OWKA 4MDSA 1Z7KA 2A2QH 2GP9B 2F9PA 2VIPA 4O97A 1J14A 5T6GA 1XKBC 1TBRH 3PMBB 3FP7E 1AUTC 3SJ8A 1HXEH 2ZU5A 2H9HA 1GBBA 1ANBA 1Z8RA 1K22H 1GI0A 3MNCA 4NG9H 1F92A 1TA2A 1ZSKA 4K1EA 2NU0E 4BXWA 4Z6AH 2VH6A 4A7IB 1YM0A 4MVNA 5DP8A 2OQ5A 4X1QU 5SGAE 1RIWB 3CS0A 2CHAC 1CGJE 3AAVA 1SHHB 1P02A 3QUMP 4H6TA 2BXTH 3P6ZB 4MTBA 4AGJA 1W0ZU 2PGBB 2ZU4A 1C4U2 2GZ7A 5EODA 1BTZA 4GCHG 3RXBA 1KXEA 5HMAA 1UMAH 2ZIQH 2Y6TA 3GCHC 3B9FH 3OSYA 3PTBA 2AEIH 4WWYA 7GCHG 2Z94A 3GCTF 3T26A 2ZFQH 5DO4H 2BVSH 2ZHEH 5ETXA 1W2KH 1O2UA 2FP7B 4BAKB 1V2QT 1K1IA 1GBEA 2D2DA 2WPHS 1TPOA 2ZC9H 4IN1A 4CR5A 5EXNA 1SG8B 1XX9A 3M3SA 1Y8TA 1OKXA 1EUFA 2QXJA 3LC3A 5L6NH 1WOFA 4CBNA 4WJG2 4ZROA 2FZZA 3K2UA 1YPKH 1TNIA 3TH2H 3UOUA 2B0FA 1O2VA 1AIXH 3RXIA 1NN6A 1Z71A 1O3AA 2FOCA 1GCTB 2A4QA 4CRAA 2OLGA 2VU8E 3PLKA 1LKBA 1GHBG 4K69A 1CHGA 2XRCA 4I33A 3TGKE 4H6SB 1HJ9A 2JKHA 5EQRA 1C5PA 1DUAA 1EP5A 3GISB 3BTTE 2H1UA 2BZAA 1JWTA 1D3TB 1GL0E 4CRDA 3O8RA 3KEEA 2G4TA 1G9IE 1TMBH 2J9NA 4Y8YA 1F0SA 3MWIU 2CHAB 3RXHA 2BVXH 3ZZCA 2Y82A 1ELBA 4ZHAA 2VWLA 1KXCA 1PPZA 1SPJA 1UHBB 3PYHA 2ZECA 1O2NA 3ZZ3A 3K9XB 3M7QA 5JB9S 2XBXA 1UTKA 3U69H
chains in the Genus database with same CATH superfamily
2HWLB 5G4BA 1KYNA 1QQ4A 4I32A 2NWNA 2ZEBA 3OEED 3SNAA 2VVCA 1CA0B 2FO9A 1H8IH 4Y8ZA 1HUTH 1P2JA 1JXPA 2J5UA 1C9TA 3A89A 4JCNA 2IPHA 3BEIB 5EPNA 3GY3A 3A7WA 1DX5M 3ZZ8A 1GDUA 3V0XA 3MO6A 2BDGA 3TK5A 4X2WA 1AE5A 1DWBH 3VB4A 2BLOA 4D8NA 3H7OA 4F48B 1FIZA 2CN0H 1O2SA 5DG6A 5TJXA 3A7ZA 3D62A 2FX6A 4Y6DA 1ESAA 3U1IB 4JK6A 3H7TA 3LIWA 3PRBA 4AZ2B 1TNJA 3SU3A 3BEUA 4O03A 1GBAA 2BDBA 4Y76A 4JYUH 1P0SH 1SHYA 2VVVA 2F91A 1GBCA 2WZQA 4FU9A 1ZTKA 2BLVA 3TPIZ 2HOBA 3Q3XA 2BYAX 1B0EA 1NRQH 1O32A 1T8MA 1GG6B 1GMCF 1TMUH 1ZR0A 4DIIH 2O8LA 4HI3A 5LPRA 1C5YB 3NWUA 5FHTA 5DSFA 3ESTA 1JMOH 2OC1A 4MNVA 2VBCA 5KECA 4CHAC 4K1SA 3HK6B 1TGSZ 1TQ7B 1FI8A 1MD8A 2J95A 2A4RA 2CV3A 2JETC 3P8OA 2ZGBH 3ATIA 1GDQA 3GDSA 3UIRA 4ZHLU 3M5NA 1E35B 4K3JA 1UTQA 2M2AA 3UFAA 7LPRA 1CT2E 4YLQH 3A7TA 3UNQA 1LCYA 5J4SA 4JYTA 2BTCE 2PGQB 5EJLA 3UQOA 3RXEA 2CF8H 3OEHD 1ABJH 4A92A 1JIMA 1WCZA 1A3EH 2OD3B 4K8BA 2SNWA 8ESTE 1SSXA 1G3BA 2TGTA 4HG6A 3Q77A 2UUFB 1Z8GA 1TPPA 3UR6A 4RN6A 1AUJA 1A3BH 2J98A 4YOJA 1SQOA 2VINA 5F8ZA 1SGYE 2TPIZ 1GDNA 1UHBA 1GBHA 1MAXA 2AIQA 2JDID 3UB0A 4MQAA 2Y81A 1SLUB 1YC0A 2LNCA 3LGWA 4KTUA 3SUEA 1KXDA 1KTTB 4NFEA 4YLUA 5JPMH 1V2PT 4MPXA 1O3BA 4IMZA 2TRMA 2Q6GA 1GBLA 1C1PA 1CGIE 1SGTA 3B23B 3SU4A 2W26A 2VGCB 1MQ5A 2VWNA 1YPEH 2BD2A 4X0WU 1CE5A 3SHCH 2WPJS 4Z0KA 4X8SH 5GXPA 1GJDB 1M9UA 2FOFA 1BTXA 1H8DH 2R9PA 3SZNA 2FDAA 5FX5A 1BJVA 1EJAA 1NBMD 1SOZA 4XOJA 1EPTC 2W7SA 1VCPA 4X2VA 4BAHB 3DSPA 2ZQ1A 1AFEH 1O3EA 3TU7H 2VIQA 1GVLA 1HNEE 3ELAH 2ZGCA 3MH5A 3SV9A 4AGKA 3BG8A 5CHBA 1A0JA 2FS9A 2BD4A 2RDLA 1WV7H 5HXFA 4NWKA 2EI7A 1TNHA 4NSYA 4UDWH 1C1MA 3A87A 1ELAA 4KKDA 3RXVA 4TWWA 4A5TS 1HAYB 2VWOA 2GDDA 4NSVA 3E8LA 2P3FH 1IQJA 1P57B 3A83A 1MTNC 1SGQE 3URCA 4NA7A 5F8XA 1S0QA 4K8YA 1MUEB 2GD4B 3ZVFA 1V2JT 1EJNA 2AH4X 3PMJA 1O38A 2PKSB 1ELTA 1P2QA 3LJJA 1TB6H 3ATLA 1RXPA 2P16A 3A82A 1INCA 3SBKA 1C2GA 3SORA 2C8XB 4Y10E 3C27B 1LHCH 1P05A 2G52A 4I86A 1TA6A 2A5IA 4IGDA 3T29A 3AW0A 3UY9A 1O2HA 2NU4E 2FEQH 1TALA 3E0PB 3MH4A 4ABEA 3RC5A 2ZF0H 1HJ8A 2BOHB 2D8WA 1UTPA 3RXAA 1UK2A 2QE7D 5A09A 2BB4A 1YYY1 4OM9A 3E90B 1FAKH 3CNRA 3PM3A 1C5WB 3E0NB 4ISOA 4LZ1H 2GT7A 2OBQA 1DM4B 1O33A 1DANH 1GJ4H 1O34A 2P8OB 2Y5HA 3BG4C 2GX4A 8KME2 1SGPE 1DXWA 5C5NA 2IJOB 5JYIA 1HIAB 2O8WA 4ZXXH 3C1KA 2OUAA 5JBAS 1LMWB 3F0OA 2JJ1D 5CHAC 4AG1A 1MTVA 5FX6A 2FOGA 1GMCG 2HPQH 4CRBA 1EX3A 1GI2A 5DGJA 1XVOA 2IN2A 3KCGH 1GBIA 4OGXA 3ZV9A 1S6LA 5AF9H 5LPEA 1IQNA 3SV7A 4A6LA 2J2UA 3S0NA 4ABGA 1GJ8B 2BXUH 3WW7A 3BN9A 4I8LA 2W6JD 1W12U 2Y7XA 3F6UH 5C0TA 1KDQA 1O5AB 3BTEE 3LDXH 4WMFA 1C1RA 1YPMH 2ZHFH 1DOJA 1KLJH 1BTHH 5L2YH 5A8YA 1J16A 1UO6A 1HJAC 3PV2A 4IMQA 1GPZA 5AFZH 2AERH 2KFWA 5I25A 5HIYA 1TRYA 3RUOA 3E16B 2ASUB 1GBFA 3W95A 1PPFE 1OPHB 1SC8U 3OX7U 3SHAH 1C1QA 9ESTA 3D23A 1PYTC 1HAVA 3RM2H 3M5MA 1C2FA 1KLIH 3A7YA 3VG8A 2PSYA 3IWMA 1O2MA 3PTNA 4YM9A 5GDSH 1TGNA 2J92A 1O3MA 4LOYH 1PPGE 2FLRH 2FXRA 2PUQH 1C1VH 3RXCA 1MCTA 1UTMA 4KTSA 1GJBB 5AFYH 1C9PA 1VGCC 2BY5X 2ZHDA 2XBXA 4FUDA 3NPSA 2GCHG 3S7HB 1NRPH 4B73A 3NKKA 4XSKU 2C8YB 1DWCH 1TBQH 1TONA 4GHTA 4INKA 3M7TA 1C5SA 1DWEH 2G51A 2C3SA 1FQ3A 1XUFA 4Q63A 1NU9A 3QLPH 1NROH 2B8OH 1L1NA 5C5OA 1DUEA 1FDPA 1OXGA 4R0IA 1V2MT 5HM9A 4CRFA 2SFAA 4YT7H 3DSGA 1D6WA 8GCHG 5DP3A 1HAIH 1FIWA 1GVZA 1Z6EA 1BJUA 2Z9LA 3RXSA 5GJ4B 1GHZA 5A2MH 1N6XA 1DLEA 4J2YB 1LQEA 4RT1A 2A7JA 1LVBA 5HKKD 2ZNKH 5IYTA 2F4LA 2A1DB 2YOLA 2ZFFH 2RFKC 1E38B 2OBOA 1AZZA 1HYLA 2WPMS 2F9OA 2BDAA 1HAXB 2W3KA 3F68H 5ESTE 1W13U 1EZXC 1G37A 4B74A 4YO9A 1F5RA 3RLYH 1ZTJA 3ATMA 2R2MB 3SNCA 4ABIA 3RXTA 1NO9H 1TGBA 1BTYA 2CK3D 2PSXA 3ZZ5A 1UTOA 1DVAH 4YESB 1SGNE 2ZGJA 1O3CA 4ZHMU 1GBMA 1YBWA 3KQCA 3PMHB 1XXFA 1FONA 3HATH 3F9FA 3QZQA 1C4V2 3L33A 4MG3A 3NK8A 1H9IE 1SQTA 2DUCA 3EYDA 1Y3VA 4ZKRU 5E0GA 2ALPA 1MZAA 1DY8A 1G3EA 1PQ8A 4X6OA 2Q6FA 3RXFA 3SV2H 1YWUA 1YPJH 3S9BA 1K1NA 1P2NA 2BQ6B 1V2LT 4YT6H 2ULLA 2BLQA 1LDTT 3GDVA 1DPOA 3N99A 4X6MA 1NC6A 1O3HA 3P8GA 3VGCB 3D65E 4AX9H 3QTOH 2OC7A 1O2RA 3SJIA 3G01A 5FAHA 1K1MA 2AMQA 2PTNA 1B5GH 5HIZA 2TGPZ 1O3LA 4KP0A 2ANMH 1TRNA 3BV9B 4U32A 1FN8A 4YOGA 5B6OA 1GI9B 1YPHE 1QY6A 1BHXB 1EAUA 2BDIA 1K9OE 1P11E 1XVMA 2BD7A 5EPYA 2QCYA 2VIWA 4AB8A 3LT3A 4BAOB 3QO6A 1IQGA 1TLDA 4ESTE 2QYIA 3F9EA 2O9QA 3BTQE 1MABB 1HAHH 3OTPA 4RSPA 3SJ9A 4MNYA 2F9NA 5L2ZH 1XUKA 3UTUH 4U2WA 4YOIA 1S6FA 1NESE 2FTLE 1W0JD 1OWEA 1CGHA 3MYWA 4GVUA 3P17H 1IQKA 4WMEA 3MTYA 4Q7YA 1V2RT 4DIHH 8GCHF 3AK5A 3ZZ9A 2P3UB 2OC0A 1IAUA 1O2KA 4JZFH 3A7VA 4Y79A 3R3GB 1Z1JA 2OINA 1CQQA 3K6YA 2ZTXA 2WPKS 4TPIZ 2Y7ZA 1SQRA 1BIOA 1AN1E 3RXJA 1OWJA 1TMTH 1QIXB 2PLXA 3ATKA 1QB6A 1D6RA 1L4DA 2WPIS 4Q2KA 4YZUA 3RXKA 2H5DA 4NA9H 3SN8A 5LH8A 1AE8H 2GCHF 5HGGA 2C90B 4AFQA 1BZXE 3GYMA 1NPMA 1TX8A 2R0LA 2W6ID 1TGTA 1IQFA 1P2OA 3GICB 2G55A 2TBSA 5IDKA 2Y5FA 1S81A 3PWBA 4HFPB 1KXAA 4B1TA 3A8BA 1RS0A 1UVOA 2CGAA 4I8HA 1MH0A 5C1YA 2ILNA 2OQUA 3QDZB 1OYQA 3BTKE 3ODDA 4B75A 1NFXA 3A81A 1PJPA 1S6HA 3FVFB 4LXBH 1JOUB 4IC6A 2DE8A 1YY3A 4GPGA 1AWFH 1VITF 2VIVA 3TJOA 4AB9A 1TE0A 3D49H 1Y5BT 4MPVA 5I46H 2D26C 3FANA 1TYNA 1OWHA 1GHAG 2XWAA 4WMDA 5C1UA 1GBKA 1YCPH 2QF3A 4KELA 2B7DH 4SGBE 3UQVA 3VB5A 1O3PB 5BRRE 1NY22 5TCAA 3GY6A 1BRBE 1E1QD 3IITA 4MPWA 3MQKC 1FUJA 3URDA 1KDQB 1TX7A 3F9HA 3FAOA 4FVDA 2ZCKP 4Z1MD 3V13A 1HRTH 2PW8H 1O2YA 4X1SU 4TPYA 4Y7AA 3HPTB 1MTSA 3UNSA 2J97A 3HK3B 2PFEA 4MPUA 3PV4A 2WPDD 2HLDD 1KLTA 1BMNH 5DK1A 3MU4A 4GLYA 5EQSA 1IQHA 4XE4A 5DP9A 1A0HB 3LKWA 4Y8XA 1NTPA 1V3XA 2G81E 2ZFPH 2C4FH 3M5OA 5E0HA 1EAIA 5A8ZA 4CH8B 2ZDVH 2BY9X 3UWJH 3ZVDA 2Z9JA 3DFJA 3F2FA 1SBWA 3M36A 1BTWA 2FTMA 1P9UA 1HBTH 3LGUA 1GJ5H 2H9TH 1H4WA 2BQWB 4UFFH 5EJ1A 4XDEA 3GY8A 1S85A 2YMSC 4CBOA 1N8OB 1EFRD 2P94A 4UFGH 4ZKOU 2ZDAH 3TIUA 3OY6U 1TQ0B 3BTHE 2F3CE 3F1SB 1MBQA 3KQDA 5FBEA 2K8IA 3OY5U 2GMTC 1IHSH 1SVPA 4YXWD 1P01A 2BMGB 3RXQA 3LGVA 1HCGA 3PO1C 2GMTB 3RLWH 1BCUH 3U8TH 4CH2B 3NRLA 1TNLA 1SLVB 3DUXH 1SGCA 2XW9A 7ESTE 1P3EA 4P02A 2NU2E 2Z3DA 1SI5H 1J9CH 2OTVA 1QTFA 1QCPA 1QB1A 4FUJA 1HV7A 4RT0A 3JZ2B 4WY3A 1FX0B 1ID5H 3UWIA 1S82A 2A5AA 1C1WH 1O36A 2GVFA 4BOHA 5C17A 2KCYA 3AVZA 3M7UA 3SNDA 1BQYA 2ZHWH 1FY1A 1ZJDA 2P93A 3A7XA 1O2GH 3WY8A 1GG6C 4UE7H 2UWLA 1LVOA 1GHYH 1MCVA 1O35A 2BZ6H 4INHA 4X2XA 1TGCA 1WTGH 3RC4A 1OSSA 1C5VA 1DS2E 4O3UA 4INLA 1BA8B 2A31A 2PKAB 6CHAB 1O31A 1W10U 2O8UA 2R3YA 1E37B 4DCDA 1PQAA 3AW1A 4X8VH 1GHVH 3RXRA 1WUNH 2BD3A 1DDJA 1NFYA 3E6PH 1O2OA 3PLPA 4LZ4B 4D9QA 1QFKH 2OXSA 5ESBA 3PMAB 1T32A 1SLXB 1FN6A 1MD7A 3T5FH 3TGJE 2ZU3A 1L0ZA 1GHWH 1DSTA 4O3TA 1IHTH 4B76A 1PPEE 4ABBA 4AORA 2LP6A 1KSNA 1RRKA 3GS9A 2BY7X 4ZAEA 3SNEA 2CJIA 4UD9H 1HAZB 1SGDE 3RXMA 4BTTB 2RA3A 4X6PA 4B71A 1WYKA 3CP7A 5F03A 1ZYOA 3A88A 2RA0A 3E91A 1YF4A 3TLOA 2B9LA 2CF9H 4CRCA 3MNSA 4Y11E 4ISLA 5DKMA 3SOSA 2FOAA 1TIOA 2OCVB 1OOKB 2ODYB 1BHXF 1SB1H 2WPLS 2ZWLH 1V2WT 1VCWA 1G36A 1AD8H 3JZ1B 1QJ1B 3P8FA 1ZGIA 5KGOA 4ABDA 2BY8X 2GCTB 3SJKA 1Q3XA 2V3MA 4JZEH 1O2JA 2O8MA 4M7GA 2BX3A 1C5UA 1O2WA 2JH5D 1GCDA 2FYQA 1T8OA 3OFND 2ZZUH 4WH8A 1WTHD 3SUFA 3ATWA 1AKSB 2VGCC 3ZVAA 1C2IA 1QL7A 3MU8A 1OYTH 1P06A 1C1TA 2ZDLA 4D7GA 2FWWA 2FS8A 1GJCB 1S5SA 1UJ1A 3MHWU 4D76A 1QNJA 4NFFA 2ZA5A 1AVGH 4CHAB 3ITIA 1QRXA 1P2IA 3SU2A 1EATA 1OHHD 1GJ6A 3EA7A 4E7NA 5GPIB 1ELGA 1LPGB 1TPAE 3RU4D 5B6LA 1CBWC 1C2JA 1VKYA 2BOKA 2ZDKA 3T28A 1J8AA 5CE1A 2Y80A 2SGAA 1Y3XA 2STBE 2FOBA 2WHXA 1GBJA 5GCHF 3NXPA 2KAIB 2LPRA 1AQ7A 2KX4A 3I29A 1TX6A 4B2CA 1C5QA 2THFB 2J4IA 2F9UA 1LKAA 4FUGA 4ZMAH 1T31A 4JZIA 1NRSH 3OYPA 1T4UH 1ETTH 3AASA 1C1SA 1ZHRA 1XXDA 3LJOA 1QRZA 2AGIX 1LHFH 3DT0H 2HLCA 3NUMA 5AVDA 1ANCA 4OS4A 1F0TA 3QK1A 4NZLA 1VITH 2XNIA 4UEHH 1A7SA 1O2ZA 4NA8A 1FY4A 3RXPA 1QQUA 5GNDA 1F7ZA 2BDYA 2JETB 1C1OA 1FMGA 4Q7ZA 1V2NT 1FNIA 5C67A 3BTFE 4X8TH 1LQDB 1UCYK 3DFLA 3FN8A 2PP6A 5GCHG 3B8JA 5TCCA 1D3QB 5DN6D 4DGJA 1LVMA 2V3HH 1SKYE 4DG4A 2BD5A 2FM2A 3KYFA 3A80A 3AAUA 4H42U 1BMAA 3ENSB 1V6DA 5PTPA 1DE7H 1O5EH 1FXYA 3TJVA 2F9VA 2H9EH 1NZQH 1BRUP 1ZJKA 4I8JA 2BQ7B 3ZZBA 1GGDC 1HPGA 1WQVH 4XBDA 2GV7A 1MMJN 2H6MA 2V6NA 1MKWK 1VR1H 2A45B 2AMPA 3P8NA 1TABE 1A5HA 1LVYA 4FETA 6GCHG 4IC5A 4Q7XA 3QX5H 1XUHA 2QXHA 1EXFA 1L2EA 1HJAB 2VH0A 4QT8C 1NFWA 2SNVA 5C2ZA 2QF5A 1C5TA 4UFEH 1V2UT 1IQIA 1C2LA 1SGFA 1WDIA 3P92A 1H1BA 4ABFA 1G3DA 2HVXA 1O37A 1CT4E 2G00A 3GCTG 1AHTH 1TWXB 4AYYB 1MTNB 5EU8A 1V2KT 2C93B 1JBUH 2WYJA 1F0RA 2VIOA 5J4QA 1EAWA 1LTOA 3UNRA 7KMEH 2XCNA 3FP8E 5T1VA 1W0KD 1CVWH 1XM1A 2EA3A 1C2HA 5E8EH 3PO1B 1SGEE 2GT8A 1P2KA 4NZQA 4TY7A 4ABHA 3BEFB 3LH3A 3A86A 6CHAC 1BBRK 1D9IA 2PWXA 1LHDH 1H9LB 2AFQB 4AFZA 2QC2A 4BAMB 3SUDA 4ZCNA 2FI4E 5JDUB 1NT1A 4AOQA 1GCTC 2HALA 2AYWA 2ODQA 4ISNA 1O0DH 4KGAA 3A8DA 1O5BB 4X1NU 2YMSD 2ZHQH 3KIDU 2NU3E 4FU7A 2ZTYA 3MH6A 2R2WU 5CDFE 1EASA 3ZZDA 3HKIB 2XNDD 2J34A 1XUGA 1TOCB 1W7XH 4DY7B 3SI3H 2W7UA 1ZLRA 4BANB 1C1NA 1O2QA 1BDAA 3RXUA 2WV4A 2A7HA 4X1RU 4FXGH 3H09A 3OTJE 4DOQA 1F2SE 1SFIA 4JZ1A 4TT3D 1NRNH 3HGPA 2OC8A 4I8GA 2BD9A 4TY6A 1MAYA 1OP2A 1MKWH 1QJ6B 2Y5GA 5DP6A 2GJGA 1ELDE 4F55A 1C5RA 1L1GA 1Q31A 5E2OA 3SYJA 1O5GH 4E05H 2KM0A 1F5LA 2HNTE 1HIAA 2Z3CA 1V2OT 3TK9A 1N8OC 3Q3KA 1ZRKA 3CENA 4HTCH 4NIVA 1NU7B 3K65B 2WUBA 2UWPA 2PR3A 2Z3EA 2V0BA 1DXPA 4O9VA 2GTBA 1A0LA 1HXFH 2HNTC 1EAXA 3ZZ6A 2XOKD 3VB6A 3PROA 3T25A 2WV9A 1ESBA 1O2PA 5EW2H 2G5NA 3KNXA 3MO9A 4CREA 5DP4A 4TWYA 3N7DA 1O5FH 1QA7A 1T7CA 4X6NA 2XBVA 3GDUA 2KCPA 1BMMH 3M35A 1O3KA 3H5CB 1EPTB 2TIOA 3ZVGA 1C2KA 3BTGE 3LGIA 1AKSA 1BBRE 3RM0H 1ANDA 1QGFA 4GAWA 2HNTF 1GMDF 4K1TA 3ODFA 4UONA 2H2ZA 2QXIA 2EI8A 2QAAA 4E06H 1TNGA 1LHEH 3UPEA 2K0QA 4XBCA 4ZKNU 4K5ZA 4FVBA 3RMNH 1FV9A 4BNRA 5GIBA 1GBTA 2H5CA 2AGGX 1C5LH 2R0KA 1AO5A 3F2HA 3Q00A 1B7XB 1ETSH 3BSQA 5K7RA 1N1LA 3DD2H 2CMYA 1D3DB 1BB0B 4BAQB 1PFXC 1C5OH 2ESTE 1C2EA 1YLDA 5E2PA 1SGRE 4F49A 5A0AE 2G4UA 1K0HA 1W14U 1GHAF 2TGDA 2OK5A 3M3VA 1CSOE 2ZTZA 1P9SA 5T6DA 2A4GA 5F53A 3MU1A 3ZYDA 3FZZA 3SU6A 1A2CH 1P2MA 1FY3A 2ZGXH 1SGFG 1O3JA 3A8AA 1K1OA 3MMGA 1SMFE 1P10A 4UFDH 5DP5A 4B6FA 4R8TB 1TPSA 3LGYA 1GMDG 2QN5T 1AFQB 2QA9E 1EZUC 1OWIA 2BDCA 2V3OH 3GCOA 1SFQB 3SNBA 5C3NA 1NFUA 1VZQH 2XBWA 2XTTB 3BTME 1IQEA 4TYDA 2ALVA 1YCPK 1ORFA 2A0QB 2YMSB 5E0JA 5FCRA 1V2TT 2J38A 1W8BH 4Q4LA 1ANEA 1ETRH 2VB0A 1DY9A 1CBWB 4NGAH 1EQ9A 2ODPA 3F9GA 4ASHA 1YCPM 1WAYB 1ZZZA 1YLNA 2ZCHP 1W7GH 3SJOA 4YTAA 1S83A 2JJ2D 2JH6D 1BTPA 1BTUA 2KR7A 1G30B 5EQQA 3OAAD 4AG2A 1OP0A 1ZTLA 3EGKH 5C0UA 1CT0E 2ZG0H 8LPRA 2XBYA 1BITA 3W94A 4ZUHA 3F3BA 4ZKSU 4WXVA 3PLBA 1O3GA 1C4Y2 1HAOH 4NIWA 2FOMB 1SLWB 1AWHB 1FAXA 1K21H 1LPKB 1UVPA 7GCHF 5ABWA 2EC9H 1OX1A 1L4ZA 3IG6B 1P12E 1E36B 3RXOA 6LPRA 3KF2A 2BVRH 1EPTA 2FX4A 4GCHF 5A0BA 1O2IA 2ZU1A 2Z9IA 3P95A 2SGFE 2FLBH 1DICA 1O3NA 2FYRA 1E1RD 2FESH 1VJ9U 1G2MA 1RGQA 1W0YH 1FPCH 1SR5C 3LPRA 3L3TA 6ESTA 3TVJB 2FMJA 3LONA 2QF0A 1BBRH 1J15A 1O5CB 5EIYA 1BRCE 1GVKB 3BF6H 3GCHB 2IPQX 2RG3A 2ANKH 3S9CA 3LOXA 3SI4H 4TSFD 3ZVEA 1GI3A 3KL6A 3VGCC 3ZZAA 4VGCC 5EJZA 2PTCE 3RC6A 5CMXH 1ZSLA 4KTCA 1C1UH 4JMYA 1K1LA 3QTVH 3UOPA 1Z1IA 1GBDA 1MKXH 2YNAA 1HAGE 1WBGB 1O2XA 4Y0ZE 3PWCA 1V2VT 1HAVB 2FOEA 2WUCA 1QL8A 2ZFRH 3GCNA 4K60A 1JRTA 3VB3A 4JZDH 3VB7A 3SQHE 4XFQA 1GGDB 2JH0D 3BIVH 1YKTA 1N6YA 3RMOH 1XKAC 5HYOA 1PQ5A 2I6SA 4ZXYH 3SUGA 1GI4A 3TNSA 2FIRH 3N7EA 3WWBA 1DLKB 1RJXB 2DE9A 1UCYH 4U01A 3U8RH 3A85A 4OS1A 5H4IB 2OP9A 1A61H 3UR9A 1HGTH 2PKAA 4DW2U 1QR3E 1H9HE 3VXEH 1C5ZB 2W3IA 1JRSA 4AYVB 1D4PB 1GHXH 2PKSC 2VWMA 5DP7A 3MOCA 2ZI2H 3STIA 2P95A 3NZIA 1TRMA 6GCHF 5JB8S 2IOTA 4D9RA 3KQEA 3S69A 3TJUA 3TGIE 1NBME 2Q6DA 1SOTA 4M9FA 4X8UH 5IK2D 1AGJA 4U30A 2D1JA 4CRGA 3RMLH 4IN2A 4BTUB 1PQ7A 1XUIA 1BOQA 2C8WB 1Z6JH 3M5LA 4JK5A 1Y3UA 5EG4A 3V7TA 4RKOB 1VGCB 1ZOMA 2STAE 5A0CA 1EOLA 2HGTH 1F5KU 1TOMH 3UREA 1RIWC 2PV9B 1ARCA 1Y5AT 3L6PA 4HGCA 1SGIB 1ELEE 1ABIH 1CU1A 2AS9A 5CHAB 3ZVBA 5FCKA 1C5XB 4XBBA 2ZDNA 3EE7A 1P03A 1YPGH 2XCFA 4NCYA 1O3DA 1QBNA 1AFQC 1CHOG 2J94A 1WSSH 5C20A 1P3CA 1ZHPA 3BG4B 1G3CA 1QHRB 1YLCA 3GY5A 1DT2A 3W1EA 3RXGA 1Y59T 1GJ7B 3SO3A 4D7FA 1AB9C 3HGNA 2L6OA 1BUIA 1BMFD 1KXFA 5FXLA 5T6FA 3VFEA 1MZDA 1V2ST 1C2MA 2VIDA 1DWDH 1AZ8A 5EXMA 1QBOA 4JYVH 2BX4A 1S0RA 3PV5A 4OGYA 4DURA 2QIQA 1B0FA 1KY9A 1G2LA 3KN2A 4ABAA 4NWLA 1QZ8A 1T8LA 2K1QA 4OS5A 1EKBB 4GHQA 3N7OA 3BTWE 1EB2A 1T8NA 1TBZH 2O8TA 1O5DH 2SGEE 2I6QA 3E1XB 3FFGA 4Y0YE 9LPRA 1K1JA 4X2YA 3SW2B 2XWBI 4IS5A 2XC4A 1A1RA 2W5EA 3GOVB 5A8XA 4B2AA 5EOKA 3RMMH 3SGQE 3P70B 4B6EA 1EZQA 4I7YH 3EA9A 1CHOF 3WWFA 2ZKSA 3V12A 2HRVA 4I31A 2P8OC 3MU0A 4RKJB 3ZVCA 1RTFB 4ABJA 1MU6B 1NM6A 3TITA 5F6MA 1ESTA 1XUJA 2VVUA 2XC0A 1Q2WA 1AU8A 3STJA 3SGAE 2A4OA 1SQAA 1EB1H 3TH4H 1GJ9B 2GGVB 1QA0A 1CA8B 5L30H 2HPPH 1IOEA 2PHBA 2BLWA 3RDZA 1K1PA 3EDXB 4MLFB 3I78A 1RTLA 1QURH 3SV6A 1YPLH 4X1PU 3T27A 5C94A 1Y3WA 2ANWA 4FUBA 1GI6A 1OS8A 5GWZA 1Y3YA 2GZ8A 2JIZD 1J17T 4AN7A 2CXVA 1QRWA 2G8TA 1EOJA 1FY5A 2FI5E 4FUCA 1RD3B 5DJ7A 3U28C 2G5VA 2Z9KA 1NRRH 3TJNA 1K28D 3TH3H 2Z7FE 1A5GH 3KQBA 1X7AC 1MTWA 2Z6BD 1O30A 2GKVE 4DJZB 1CO7E 1PYTD 2ZU2A 2WSSD 4A1TA 3DHKH 3SU1A 4FUFA 2L74A 4HZHA 1CA0C 3QWCH 1ZHMA 1MKXK 4Y71A 1GMHG 3TNTA 1VCQA 1BMLA 1QJ7B 4AFSA 3VEQB 1C5MD 1ZPBA 1YP9A 1GI7B 4IBLH 4NIYA 4BXSA 2QF4A 4FOUC 5AHGH 3VXFH 2Z9GA 1WQSA 3ZZ7A 1THRH 1W3CA 3T62A 1RFNA 2QV1A 3GY7A 1QBVH 1WXRA 3O8BA 4GUXA 2A2XH 4AC9A 3FP6E 5DPAA 1ELCA 2F43B 1UVSH 3EAJA 5FL7D 1HFDA 1ZMJA 1BRAA 2AIPA 2J98B 2GDEH 3A84A 3R0FA 3SQEE 3V3MA 1GMHF 3Q3YA 2GCTC 2FI3E 2ZGHA 1O2LA 2ANYA 3RP2A 5EXLA 5T3HA 2A7CA 4P00A 1MBMA 3U1JB 1UVUH 3DSOA 1Z8IB 3A8CA 1UTJA 1OWDA 2KCAA 3U9AH 1ARBA 2WINI 1GI8B 1Z8JB 2ZFTA 1WU1A 1LPZB 2B5TB 5LGOA 2EI6A 1ZPCA 1AVWA 4VGCB 3GY4A 2UWOA 1O3OA 1UTLM 1ZGVA 2M5TA 3NCLA 5JBCS 1IQLA 2QY0B 4SGAE 3KGPA 4FU8A 1ZPZA 1TNKA 1FZZA 1DITH 3BTDE 5FPTA 3UAIC 3M3TA 1W11U 2F83A 2P3TB 1UK3A 2WYGA 5FPSA 4GSOA 2UUJB 2YNBA 4OS7A 1HB0B 1BT7A 1PPCE 4OS2A 4LK4A 2KAIA 1H8ED 3U8OH 1FLEE 1UTNA 1O39A 1ELVA 2UUKB 2V35A 2ZPQA 2ZPSA 3Q76A 2ZDMA 3VPKA 2AGEX 1VJAU 1OP8A 3CS7A 1FPHH 2EY4C 2QGRA 5F8TA 1P09A 2V7QD 3PB1E 1O3FA 3QZRA 1T4VH 5LPFA 2GZ9A 1GWAA 1EP6A 3MI4A 3QGJA 4H4FA 2A5KA 5C1XA 3O8CA 2NU1E 3MNXA 1L1JA 3RU4E 3FZDA 1ELFA 3ZYEA 1PPBH 3GYLB 4AFUA 3S9AA 2ZFSA 2R3UA 4FUIA 4THNH 1HAPH 2ZO3H 4DT7B 1F0UA 4XRNA 4MNXA 1LO6A 1YPHC 3EE0B 2SGDE 1UW7A 2GV6A 2XYAA 1D3PB 2BM2A 1P8VC 1QB9A 3EA8A 1A5IA 2VJ1A 4F4OC 2ZCLP 2ZP0H 1C5NH 3LC5A 2XC5A 2F9BH 1S84A 1EJMA 3LU9B 4WVPE 3T2NA 1JIRA 4BTIB 2WV5A 1O3IA 1SL3A 4E7RG 1IQMA 1UCYE 4FUHA 5EGMA 2KZ4A 1DFPA 3DA9B 1A46H 1P04A 1ZMLA 1KXBA 2TGAA 2A32A 3MFJA 3EQ0H 2BY6X 1KIGH 4WF8A 1THSH 2C8ZB 2PUXB 4OS6A 1MU8B 5JBBS 4B2BA 3TK6A 2EQNA 3QGNB 4WH6A 2BD8A 1LHGH 1NS3A 1GI5A 2ZPRA 1THPB 1VITG 3MU5A 2FPZA 3MO3A 5FPYA 1KTSB 1AB9B 3E3TA 5EW1H 5JBTA 3O8DA 4ISHH 2FODA 2Q1JA 3OU0A 4NIXA 3RXLA 1XMNB 1O2TA 1K2I1 2XXLA 3QN7A 1FJSA 3ZV8A 2P59A 4ASUD 3S7KB 1MQ6A 1EZSC 3I77A 1RTKA 1GHBF 1GI1A 2VNTA 3DCLA 3OE7D 1E34B 1PPHE 3GY2A 4ZH8A 5HM2A 1MTUA 2FOHA 4FUEA 1AVXA 2BHGA 3KHVA 4Y7BA 2RCEA 1TFXA 1AMHA 3FOAA 1UVTH 1Y5UT 2AMDA 2SGQE 1HLTH 3SU0A 2QXGA 4J1YA 1YGCH 4IW4E 2ZQ2A 4XD7D 1A4WH 1C2DA 1FY8E 3KQ5A 1GL1A 1ZSJA 1ZRBA 2SGPE 3ZZ4A 4ISIH 1AI8H 3HKJB 1E0FD 3SU5A 4A1VA 2KCOA 2BDHA 3MH7A 1ZMNA 3MNBA 4MNWA 1U6QA 1AY6H 3UUZA 4WXIA 3SGBE 5BPEA 2UUYA 4Q80A 1DSUA 3SV8A 4PROA 3LH1A 3RU4T 1TAWA 1H8HD 1UK4A 3K6ZA 3M61U 3PRDA 2EEKA 3M37A 3LGTA 1ACBE 5FBIA 4A1XA 5K0HA 3U98H 3BIUH 4CR9A 1HDTH 1G32B 4I8KA 2LELA 4K2YA 1QL9A 3RXDA 4DVAU 1OWKA 4MDSA 1Z7KA 2A2QH 2GP9B 2F9PA 2VIPA 4O97A 2IJD1 1J14A 5T6GA 1XKBC 1TBRH 3PMBB 3FP7E 1AUTC 3SJ8A 1HXEH 2ZU5A 2H9HA 1GBBA 1ANBA 1Z8RA 3KYGA 1K22H 1GI0A 3MNCA 4NG9H 1F92A 1TA2A 1ZSKA 4K1EA 2NU0E 4BXWA 4Z6AH 2VH6A 4A7IB 1YM0A 4MVNA 5DP8A 2OQ5A 1E79D 4X1QU 5SGAE 1RIWB 3CS0A 2CHAC 1CGJE 3AAVA 1SHHB 1P02A 3QUMP 4H6TA 2BXTH 3P6ZB 4MTBA 4AGJA 1W0ZU 5KEDA 2PGBB 2ZU4A 1C4U2 2GZ7A 2AHME 5EODA 1BTZA 4GCHG 3RXBA 1KXEA 5HMAA 1UMAH 2ZIQH 2Y6TA 4DT4A 3GCHC 3B9FH 3OSYA 3PTBA 2AEIH 4WWYA 7GCHG 2Z94A 3GCTF 3T26A 2ZFQH 5DO4H 2BVSH 4ACAA 2ZHEH 5ETXA 3F0PA 1W2KH 1O2UA 2FP7B 4BAKB 1V2QT 4ACBA 1K1IA 1GBEA 2D2DA 2WPHS 1TPOA 2ZC9H 1COWD 4IN1A 4CR5A 5EXNA 1SG8B 1XX9A 3F2GA 3FO8D 3M3SA 1Y8TA 1OKXA 1EUFA 2QXJA 3LC3A 3SZEA 5L6NH 1WOFA 4CBNA 4WJG2 3FKSD 4ZROA 2FZZA 3K2UA 1YPKH 1TNIA 3TH2H 3UOUA 2B0FA 1O2VA 1AIXH 2RDEA 3RXIA 1NN6A 1Z71A 1O3AA 2FOCA 1GCTB 2A4QA 4CRAA 2OLGA 2VU8E 3PLKA 1LKBA 1GHBG 4K69A 1CHGA 2XRCA 4I33A 3TGKE 4H6SB 1HJ9A 2JKHA 5EQRA 1C5PA 1DUAA 1EP5A 2HVYB 3GISB 3BTTE 4RI0A 2H1UA 2BZAA 1JWTA 1D3TB 1GL0E 4CRDA 3O8RA 3ZIAD 3KEEA 2G4TA 1G9IE 1TMBH 2J9NA 4Y8YA 1F0SA 3MWIU 1KMHB 2CHAB 3RXHA 2BVXH 3ZZCA 2Y82A 1ELBA 4ZHAA 2VWLA 1KXCA 1PPZA 1SPJA 1UHBB 3PYHA 2ZECA 1O2NA 3ZZ3A 3K9XB 3M7QA 5JB9S 1GJAB 1UTKA 3U69H
chains in the Genus database with same CATH topology
2HWLB 5G4BA 1KYNA 1QQ4A 4I32A 2NWNA 2ZEBA 3SNAA 2VVCA 1CA0B 2FO9A 1H8IH 4Y8ZA 1HUTH 1P2JA 1JXPA 1C9TA 3A89A 4JCNA 2IPHA 3BEIB 5EPNA 3GY3A 3A7WA 1DX5M 3ZZ8A 1GDUA 3V0XA 3MO6A 2BDGA 3TK5A 4X2WA 1AE5A 1DWBH 3VB4A 2BLOA 4D8NA 3H7OA 1FIZA 2CN0H 1O2SA 5DG6A 5TJXA 3A7ZA 3D62A 2FX6A 4Y6DA 1ESAA 3U1IB 4JK6A 3H7TA 3LIWA 4AZ2B 1TNJA 3SU3A 3BEUA 4O03A 1GBAA 2BDBA 4Y76A 4JYUH 1P0SH 1SHYA 2VVVA 2F91A 1GBCA 4FU9A 1ZTKA 2BLVA 3TPIZ 2HOBA 3Q3XA 2BYAX 1B0EA 1NRQH 1O32A 1T8MA 1GG6B 1GMCF 1TMUH 1ZR0A 4DIIH 2O8LA 4HI3A 5LPRA 1C5YB 3NWUA 5FHTA 3ESTA 1JMOH 2OC1A 4MNVA 4CHAC 4K1SA 3HK6B 1TGSZ 1TQ7B 1FI8A 1MD8A 2J95A 2A4RA 2CV3A 2JETC 3P8OA 2ZGBH 3ATIA 1GDQA 3GDSA 3UIRA 4ZHLU 3M5NA 1E35B 4K3JA 1UTQA 3UFAA 7LPRA 1CT2E 4YLQH 3A7TA 3UNQA 1LCYA 5J4SA 4JYTA 2BTCE 2PGQB 3UQOA 3RXEA 2CF8H 1ABJH 4A92A 1JIMA 1WCZA 1A3EH 2OD3B 4K8BA 2SNWA 8ESTE 1SSXA 1G3BA 2TGTA 3Q77A 2UUFB 1Z8GA 1TPPA 3UR6A 4RN6A 1AUJA 1A3BH 4YOJA 1SQOA 2VINA 5F8ZA 1SGYE 2TPIZ 1GDNA 1UHBA 1GBHA 1MAXA 2AIQA 4MQAA 2Y81A 1SLUB 1YC0A 2LNCA 3LGWA 4KTUA 3SUEA 1KXDA 1KTTB 4NFEA 4YLUA 5JPMH 1V2PT 4MPXA 1O3BA 4IMZA 2TRMA 2Q6GA 1GBLA 1C1PA 1CGIE 1SGTA 3B23B 3SU4A 2W26A 2VGCB 1MQ5A 2VWNA 1YPEH 2BD2A 4X0WU 1CE5A 3SHCH 2WPJS 4Z0KA 4X8SH 5GXPA 1GJDB 1M9UA 2FOFA 1BTXA 1H8DH 2R9PA 3SZNA 2FDAA 5FX5A 1BJVA 1EJAA 1SOZA 4XOJA 1EPTC 2W7SA 1VCPA 4X2VA 4BAHB 2ZQ1A 1AFEH 1O3EA 3TU7H 2VIQA 1GVLA 1HNEE 3ELAH 2ZGCA 3MH5A 3SV9A 4AGKA 3BG8A 1A0JA 2FS9A 2BD4A 2RDLA 1WV7H 5HXFA 4NWKA 2EI7A 1TNHA 4NSYA 4UDWH 1C1MA 3A87A 1ELAA 4KKDA 3RXVA 4TWWA 4A5TS 1HAYB 2VWOA 2GDDA 4NSVA 3E8LA 2P3FH 1IQJA 1P57B 3A83A 1MTNC 1SGQE 3URCA 4NA7A 5F8XA 1S0QA 4K8YA 1MUEB 2GD4B 3ZVFA 1V2JT 1EJNA 2AH4X 3PMJA 1O38A 2PKSB 1ELTA 1P2QA 3LJJA 1TB6H 3ATLA 1RXPA 2P16A 3A82A 1INCA 3SBKA 1C2GA 3SORA 2C8XB 4Y10E 3C27B 1LHCH 1P05A 2G52A 1TA6A 2A5IA 4IGDA 3T29A 3AW0A 3UY9A 1O2HA 2NU4E 2FEQH 1TALA 3E0PB 3MH4A 4ABEA 3RC5A 2ZF0H 1HJ8A 2BOHB 2D8WA 1UTPA 3RXAA 1UK2A 5A09A 2BB4A 1YYY1 3E90B 1FAKH 3PM3A 1C5WB 3E0NB 4ISOA 4LZ1H 2GT7A 2OBQA 1DM4B 1O33A 1DANH 1GJ4H 1O34A 2P8OB 2Y5HA 3BG4C 2GX4A 8KME2 1SGPE 1DXWA 5C5NA 2IJOB 5JYIA 1HIAB 2O8WA 4ZXXH 3C1KA 2OUAA 5JBAS 1LMWB 5CHAC 4AG1A 1MTVA 5FX6A 2FOGA 1GMCG 2HPQH 4CRBA 1EX3A 1GI2A 5DGJA 1XVOA 2IN2A 3KCGH 1GBIA 4OGXA 3ZV9A 5AF9H 5LPEA 1IQNA 3SV7A 4A6LA 2J2UA 3S0NA 4ABGA 1GJ8B 2BXUH 3BN9A 4I8LA 1W12U 2Y7XA 3F6UH 1KDQA 1O5AB 3BTEE 3LDXH 4WMFA 1C1RA 1YPMH 2ZHFH 1DOJA 1KLJH 1BTHH 5L2YH 5A8YA 1J16A 1UO6A 1HJAC 4IMQA 1GPZA 5AFZH 2AERH 5I25A 1TRYA 3RUOA 3E16B 2ASUB 1GBFA 3W95A 1PPFE 1OPHB 1SC8U 3OX7U 3SHAH 1C1QA 9ESTA 3D23A 1PYTC 1HAVA 3RM2H 3M5MA 1C2FA 1KLIH 3A7YA 2PSYA 3IWMA 1O2MA 3PTNA 4YM9A 5GDSH 1TGNA 2J92A 1O3MA 4LOYH 1PPGE 2FLRH 2FXRA 2PUQH 1C1VH 3RXCA 1MCTA 1UTMA 4KTSA 1GJBB 5AFYH 1C9PA 1VGCC 2BY5X 2ZHDA 4FUDA 3NPSA 2GCHG 3S7HB 1NRPH 4B73A 3NKKA 4XSKU 2C8YB 1DWCH 1TBQH 1TONA 4GHTA 4INKA 3M7TA 1C5SA 1DWEH 2G51A 2C3SA 1FQ3A 1XUFA 1NU9A 3QLPH 1NROH 2B8OH 1L1NA 5C5OA 1DUEA 1FDPA 1OXGA 4R0IA 1V2MT 5HM9A 4CRFA 2SFAA 4YT7H 1D6WA 8GCHG 5DP3A 1HAIH 1FIWA 1GVZA 1Z6EA 1BJUA 2Z9LA 3RXSA 5GJ4B 1GHZA 5A2MH 1N6XA 1DLEA 4J2YB 1LQEA 2A7JA 1LVBA 2ZNKH 5IYTA 2A1DB 2YOLA 2ZFFH 1E38B 2OBOA 1AZZA 1HYLA 2WPMS 2F9OA 2BDAA 1HAXB 2W3KA 3F68H 5ESTE 1W13U 1EZXC 1G37A 4B74A 4YO9A 1F5RA 3RLYH 1ZTJA 3ATMA 2R2MB 3SNCA 4ABIA 3RXTA 1NO9H 1TGBA 1BTYA 3ZZ5A 2PSXA 1UTOA 1DVAH 4YESB 1SGNE 2ZGJA 1O3CA 4ZHMU 1GBMA 1YBWA 3KQCA 3PMHB 1XXFA 1FONA 3HATH 3F9FA 3QZQA 1C4V2 3L33A 4MG3A 3NK8A 1H9IE 1SQTA 2DUCA 3EYDA 1Y3VA 4ZKRU 5E0GA 2ALPA 1MZAA 1DY8A 1G3EA 1PQ8A 4X6OA 2Q6FA 3RXFA 3SV2H 3S9BA 1YPJH 1K1NA 1P2NA 2BQ6B 1V2LT 4YT6H 2ULLA 2BLQA 1LDTT 3GDVA 1DPOA 4X6MA 1NC6A 1O3HA 3P8GA 3VGCB 3D65E 4AX9H 3QTOH 2OC7A 1O2RA 3SJIA 3G01A 5FAHA 1K1MA 2AMQA 2PTNA 1B5GH 2TGPZ 1O3LA 4KP0A 2ANMH 1TRNA 3BV9B 4U32A 1FN8A 4YOGA 5B6OA 1GI9B 1YPHE 1QY6A 1BHXB 1EAUA 2BDIA 1K9OE 1P11E 1XVMA 2BD7A 5EPYA 2QCYA 2VIWA 4AB8A 3LT3A 4BAOB 3QO6A 1IQGA 1TLDA 4ESTE 2QYIA 3F9EA 2O9QA 3BTQE 1HAHH 4RSPA 3SJ9A 4MNYA 2F9NA 5L2ZH 1XUKA 3UTUH 4U2WA 4YOIA 1S6FA 1NESE 2FTLE 1OWEA 1CGHA 3MYWA 4GVUA 3P17H 1IQKA 4WMEA 3MTYA 4Q7YA 1V2RT 4DIHH 8GCHF 3ZZ9A 2P3UB 2OC0A 1IAUA 1O2KA 4JZFH 3A7VA 4Y79A 3R3GB 1Z1JA 2OINA 1CQQA 3K6YA 2ZTXA 2WPKS 4TPIZ 2Y7ZA 1BIOA 1AN1E 3RXJA 1OWJA 1TMTH 1QIXB 2PLXA 3ATKA 1QB6A 1D6RA 1L4DA 2WPIS 4Q2KA 4YZUA 3RXKA 2H5DA 4NA9H 3SN8A 5LH8A 1AE8H 2GCHF 5HGGA 2C90B 4AFQA 1BZXE 3GYMA 1NPMA 1TX8A 2R0LA 1TGTA 1IQFA 1P2OA 3GICB 2G55A 2TBSA 5IDKA 2Y5FA 1S81A 3PWBA 4HFPB 1KXAA 4B1TA 3A8BA 1RS0A 1UVOA 2CGAA 4I8HA 1MH0A 5C1YA 2ILNA 2OQUA 3QDZB 1OYQA 3BTKE 3ODDA 4B75A 1NFXA 3A81A 1PJPA 1S6HA 3FVFB 4LXBH 1JOUB 4IC6A 2DE8A 4GPGA 1AWFH 1VITF 2VIVA 3TJOA 4AB9A 1TE0A 3D49H 1Y5BT 4MPVA 5I46H 2D26C 3FANA 1TYNA 1OWHA 1GHAG 2XWAA 4WMDA 5C1UA 1GBKA 1YCPH 2QF3A 4KELA 2B7DH 4SGBE 3UQVA 3VB5A 1O3PB 5BRRE 1NY22 5TCAA 3GY6A 1BRBE 3IITA 4MPWA 1FUJA 3URDA 1KDQB 1TX7A 3F9HA 3FAOA 4FVDA 2ZCKP 3V13A 1HRTH 2PW8H 1O2YA 4X1SU 4TPYA 4Y7AA 3HPTB 1MTSA 3UNSA 3HK3B 2PFEA 4MPUA 3PV4A 1KLTA 1BMNH 5DK1A 3MU4A 4GLYA 5EQSA 1IQHA 4XE4A 5DP9A 1A0HB 3LKWA 4Y8XA 1NTPA 1V3XA 2G81E 2ZFPH 2C4FH 3M5OA 5E0HA 1EAIA 5A8ZA 4CH8B 2ZDVH 2BY9X 3UWJH 3ZVDA 2Z9JA 3DFJA 1SBWA 3M36A 1BTWA 2FTMA 1P9UA 1HBTH 3LGUA 1GJ5H 2H9TH 1H4WA 2BQWB 4UFFH 4XDEA 3GY8A 1S85A 4CBOA 1N8OB 4UFGH 2P94A 4ZKOU 2ZDAH 3TIUA 3OY6U 1TQ0B 3BTHE 2F3CE 3F1SB 1MBQA 3KQDA 5FBEA 3OY5U 2GMTC 1IHSH 1SVPA 1P01A 2BMGB 3RXQA 3LGVA 1HCGA 3PO1C 2GMTB 3RLWH 1BCUH 3U8TH 4CH2B 1TNLA 1SLVB 3DUXH 1SGCA 2XW9A 7ESTE 1P3EA 2NU2E 2Z3DA 1SI5H 1J9CH 2OTVA 1QTFA 1QCPA 1QB1A 4FUJA 1HV7A 3JZ2B 4WY3A 1ID5H 3UWIA 1S82A 2A5AA 1C1WH 1O36A 2GVFA 4BOHA 3AVZA 3M7UA 3SNDA 1BQYA 2ZHWH 1FY1A 1ZJDA 2P93A 3A7XA 1O2GH 3WY8A 1GG6C 4UE7H 2UWLA 1LVOA 1GHYH 1MCVA 1O35A 2BZ6H 4INHA 4X2XA 1TGCA 1WTGH 3RC4A 1OSSA 1C5VA 1DS2E 4O3UA 4INLA 1BA8B 2A31A 2PKAB 6CHAB 1O31A 1W10U 2O8UA 2R3YA 1E37B 4DCDA 1PQAA 3AW1A 4X8VH 1GHVH 3RXRA 1WUNH 2BD3A 1DDJA 1NFYA 3E6PH 1O2OA 3PLPA 4LZ4B 4D9QA 1QFKH 2OXSA 5ESBA 3PMAB 1T32A 1SLXB 1FN6A 1MD7A 3T5FH 3TGJE 2ZU3A 1L0ZA 1GHWH 1DSTA 4O3TA 1IHTH 4B76A 1PPEE 4ABBA 4AORA 1KSNA 1RRKA 2BY7X 4ZAEA 3SNEA 2CJIA 4UD9H 1HAZB 1SGDE 3RXMA 4BTTB 2RA3A 4X6PA 4B71A 1WYKA 3CP7A 5F03A 1ZYOA 3A88A 2RA0A 3E91A 1YF4A 3TLOA 2B9LA 2CF9H 4CRCA 3MNSA 4Y11E 4ISLA 5DKMA 3SOSA 2FOAA 1TIOA 2OCVB 1OOKB 2ODYB 1BHXF 1SB1H 2WPLS 2ZWLH 1V2WT 1VCWA 1G36A 1AD8H 3JZ1B 1QJ1B 3P8FA 1ZGIA 4ABDA 2BY8X 2GCTB 3SJKA 1Q3XA 4JZEH 1O2JA 2O8MA 4M7GA 2BX3A 1C5UA 1O2WA 2JH5D 1GCDA 2FYQA 1T8OA 2ZZUH 4WH8A 1WTHD 3SUFA 3ATWA 1AKSB 2VGCC 3ZVAA 1C2IA 1QL7A 3MU8A 1OYTH 1P06A 1C1TA 2ZDLA 4D7GA 2FWWA 2FS8A 1GJCB 1S5SA 1UJ1A 3MHWU 4D76A 1QNJA 4NFFA 2ZA5A 1AVGH 4CHAB 3ITIA 1QRXA 1P2IA 3SU2A 1EATA 1GJ6A 3EA7A 4E7NA 5GPIB 1ELGA 1LPGB 1TPAE 3RU4D 1CBWC 1C2JA 3T28A 2BOKA 2ZDKA 1J8AA 5CE1A 2Y80A 2SGAA 1Y3XA 2STBE 2FOBA 1GBJA 5GCHF 3NXPA 2KAIB 1AQ7A 2LPRA 3I29A 1TX6A 4B2CA 1C5QA 2THFB 2J4IA 2F9UA 1LKAA 4FUGA 4ZMAH 1T31A 4JZIA 1NRSH 3OYPA 1T4UH 1ETTH 3AASA 1C1SA 1ZHRA 1XXDA 3LJOA 1QRZA 2AGIX 1LHFH 3DT0H 2HLCA 3NUMA 5AVDA 1ANCA 4OS4A 1F0TA 3QK1A 4NZLA 1VITH 2XNIA 4UEHH 1A7SA 1O2ZA 4NA8A 1FY4A 3RXPA 1QQUA 1F7ZA 2BDYA 2JETB 1C1OA 1FMGA 4Q7ZA 1V2NT 1FNIA 5C67A 3BTFE 4X8TH 1LQDB 1UCYK 3DFLA 5GCHG 3B8JA 5TCCA 1D3QB 4DGJA 1LVMA 2V3HH 4DG4A 2BD5A 2FM2A 3A80A 3AAUA 4H42U 1BMAA 3ENSB 1V6DA 5PTPA 1DE7H 1O5EH 1FXYA 3TJVA 2F9VA 2H9EH 1NZQH 1BRUP 1ZJKA 4I8JA 2BQ7B 3ZZBA 1GGDC 1HPGA 1WQVH 4XBDA 2GV7A 1MMJN 2H6MA 2V6NA 1MKWK 1VR1H 2A45B 2AMPA 3P8NA 1TABE 1A5HA 1LVYA 6GCHG 4IC5A 4Q7XA 3QX5H 1XUHA 2QXHA 1EXFA 1L2EA 1HJAB 2VH0A 4QT8C 1NFWA 2SNVA 5C2ZA 1C5TA 4UFEH 1V2UT 1IQIA 1C2LA 1SGFA 3P92A 1H1BA 4ABFA 1G3DA 2HVXA 1O37A 1CT4E 2G00A 3GCTG 1AHTH 1TWXB 4AYYB 1MTNB 5EU8A 1V2KT 2C93B 1JBUH 2WYJA 1F0RA 2VIOA 5J4QA 1EAWA 1GJAB 1LTOA 3UNRA 7KMEH 2XCNA 3FP8E 1CVWH 1XM1A 2EA3A 1C2HA 5E8EH 3PO1B 1SGEE 2GT8A 1P2KA