4NFEA

Human kallikrein-related peptidase 2 in complex with benzamidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
227
Chain Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-2
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 227
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nfeA01
2UUKB 4F49A 3VXFH 2A5AA 1E35B 3AAUA 5ESTE 3RM2H 1VITF 1VZQH 3PMJA 2SGFE 4OS1A 1ESBA 1ZMJA 4NIVA 1TA6A 1H4WA 4KELA 4NSVA 3JZ2B 1PQ5A 3T62A 4E05H 1V2OT 5DP9A 1D3QB 2R9PA 4MPWA 1ZTKA 4Y8YA 1V2QT 3U1JB 1QNJA 2O8UA 3SUDA 1XUJA 1QL8A 1LDTT 1O3NA 1V2VT 1XVMA 2BD8A 1MUEB 5EGMA 2HPPH 1UCYK 1D3PB 4B71A 4YOJA 1F0UA 5BPEA 2B0FA 4DURA 5JBBS 1FAXA 1TYNA 3RUOA 4FUBA 3SNDA 1LQDB 3I77A 1L0ZA 4MPXA 1OP2A 2G5VA 4ZAEA 1T8LA 1TONA 4Y0YE 4X6PA 3UUZA 1RD3B 2XBVA 1JIRA 4K1EA 3LC3A 3P8FA 3M61U 1C2DA 2QY0B 3GCNA 1BUIA 1SFIA 1GVZA 1KDQA 1SQTA 3LH1A 3S9AA 4IC5A 1V2ST 1PPZA 1T8MA 2UUYA 1JMOH 4FUGA 1DS2E 2FLRH 4AORA 2OBQA 1QA0A 2DUCA 1DXPA 3JZ1B 3BEFB 4OS6A 1V2WT 1WBGB 2HPQH 4IN1A 1EP6A 4BXSA 2UWOA 3LGTA 4UFFH 3PMBB 2W3IA 2SGEE 1DANH 1O33A 2F3CE 3QGNB 1AWHB 2R0LA 1SSXA 2NU4E 1H9IE 1HRTH 1P2MA 3TJNA 1VJAU 4FU8A 4AFZA 1MCVA 3WY8A 4Q7XA 2CXVA 2K1QA 3H7OA 1QB6A 4CHAC 1YPEH 1Z6JH 1Y5UT 4MNXA 1NU7B 1TE0A 4LZ1H 2Z6BD 4D76A 2G4UA 3QZQA 1C2EA 3MH4A 4ZHAA 1F7ZA 1GHAF 1Z7KA 1C5UA 3M7TA 2G55A 2HGTH 2ZQ1A 4D7GA 1FNIA 4U2WA 3UNQA 2GV6A 3GY7A 5DP7A 2P3TB 2ZU3A 3SO3A 3TGJE 4WXIA 1PFXC 3TITA 2YOLA 3RDZA 2FTMA 1C2MA 1O3HA 4KKDA 2Y80A 4Y8ZA 4IS5A 3K2UA 1ANEA 5A09A 1Z8RA 3QN7A 3ZYDA 2R0KA 3H5CB 1IHSH 2Y5HA 4CHAB 3LC5A 3P92A 1MKWH 1VR1H 1IQIA 3BSQA 2ZDMA 1YCPM 3QTOH 3K9XB 2UUFB 1P2NA 4UD9H 4OGXA 2VB0A 2W7SA 3BG4C 3KGPA 1Y5AT 1O2QA 1P03A 2O8LA 1UVOA 2P3UB 2BD4A 1AB9C 1GBFA 1MCTA 2FO9A 4X2WA 5JBTA 2ZTZA 1FIZA 4K1SA 1ESAA 1TWXB 3OSYA 1YCPH 1GBEA 1TB6H 5HGGA 1O2GH 3KF2A 1AY6H 4WMDA 2OC7A 2ZGXH 1HBTH 3QZRA 1QL9A 1HPGA 3KQBA 4INLA 3RXVA 1GJ8B 1O3LA 4YOGA 2ZG0H 1ELGA 1HLTH 1DY9A 1YPKH 4TYDA 1ELCA 5ETXA 1GMHF 1UTMA 3BTKE 1DY8A 2Q6DA 2ZWLH 1BRUP 1KY9A 2PGQB 2ALVA 1M9UA 1HAOH 3EQ0H 3BG4B 4FUJA 1VITH 1P3CA 1AB9B 3UTUH 1UVPA 1O3JA 2UWPA 4X0WU 2BY8X 4VGCC 1JIMA 6CHAC 3SN8A 1NROH 3MMGA 1AVGH 3SGBE 1ZJKA 5E0GA 2ZQ2A 1GBMA 4NFEA 1HDTH 1GJ7B 2PKAA 5EXLA 1NFXA 1B0FA 1OWDA 1GHYH 4A6LA 2ZIQH 1LHEH 1LHCH 1C5WB 8GCHF 1DFPA 3T28A 5TCAA 9ESTA 4MLFB 2BDHA 1HAIH 2C8WB 3ZZAA 3A7YA 5L2ZH 4LK4A 3U98H 4NGAH 4THNH 2FS9A 4FVDA 2FXRA 1CGJE 1QJ6B 2ZPRA 1GJDB 1D6RA 1EAXA 1O2UA 1TX7A 3RXAA 2J38A 1E0FD 2ZU4A 4SGAE 1UTJA 3LPRA 4JK5A 4VGCB 2FS8A 1G3EA 2BZAA 2EI7A 1LVMA 1CA8B 3RU4D 1EAWA 3LGUA 4BNRA 1THSH 2ZEBA 1K1MA 1Z6EA 6GCHG 5E0HA 1C5MD 2FOAA 3VFEA 4ESTE 1TFXA 3GISB 2ZHWH 4JCNA 1MTSA 3ZVFA 2A7CA 2GZ9A 3S0NA 3V12A 3P6ZB 2ZPQA 1FV9A 1L1GA 5L30H 2AFQB 5GJ4B 1P01A 1SG8B 3RXIA 5AVDA 2FYQA 3RXFA 3VEQB 3SUGA 4B75A 3ODFA 4X1SU 4ABJA 1V2KT 2Z9IA 4ZROA 1K1LA 5T6GA 5JB8S 2WPIS 3ZZCA 3MTYA 5FCRA 3ZVDA 5AFYH 2C93B 5GXPA 1BMAA 4CRAA 1ZZZA 1ZJDA 2QV1A 1HAVA 1VITG 1OYQA 1FUJA 3B9FH 1GJ9B 4Y79A 1ZHRA 1GVKB 1SVPA 1K21H 1GJCB 1FY3A 5CMXH 1GI8B 2QA9E 2WYGA 2P95A 2ZGHA 3MU8A 3UREA 1BTXA 1LKBA 4B73A 4GCHF 4CRGA 1MQ6A 2WUBA 4WXVA 1P9SA 1PPEE 1GHWH 1WUNH 1ZR0A 2C4FH 3FANA 4O3UA 4K69A 1SPJA 5FPTA 2WV4A 5K0HA 3LGWA 1QRZA 3VB3A 2GT8A 1UTQA 5E8EH 3RMLH 3LJOA 1C5VA 3RXHA 5HXFA 5C1XA 1O2VA 2IOTA 1XXDA 3CENA 4WVPE 1AUTC 2BD9A 1BMMH 2P8OC 1EJAA 2ZHQH 1VCQA 3BG8A 1EZQA 1OSSA 1P57B 1TPSA 2R2MB 4DT7B 3F9HA 4QT8C 3GYMA 1EB2A 1FQ3A 1Y3YA 1AHTH 1QB9A 1RJXB 4YO9A 1EX3A 1GI9B 1TMTH 2Z94A 8ESTE 3Q3YA 3M7UA 1N1LA 2PSYA 3KNXA 1D6WA 1QBVH 2BDYA 2GVFA 1TRMA 1HB0B 4X8VH 2VIWA 3K6YA 4A7IB 3GY2A 3S9BA 2NU2E 3RXLA 1A4WH 4MVNA 1MAYA 2ZF0H 4F4OC 1BTUA 4M7GA 1EASA 4Q2KA 2P8OB 1E37B 1Q31A 1JXPA 1KXFA 1C1UH 4TY7A 3U69H 3DD2H 1QBNA 1WYKA 1SMFE 2W3KA 1KXDA 2FLBH 1H8IH 1EP5A 3TNSA 4NZQA 3PWCA 4B2CA 3GYLB 3OY5U 1ZPBA 1Y3VA 2HWLB 1EZXC 3F9EA 3FZDA 3RMOH 1BBRE 4X2YA 9LPRA 1S81A 2YNBA 1GHVH 5DP4A 5F8TA 2YNAA 5BRRE 1FXYA 1UJ1A 1V3XA 2Q1JA 2PR3A 4Z0KA 2O8WA 1O38A 3MO9A 1GHAG 2TGDA 2ZC9H 2AMQA 4AGKA 2A0QB 1XUFA 4XBDA 4D9QA 4XSKU 1SR5C 1QQ4A 3SV2H 3W94A 1TNHA 1BMLA 2PGBB 4A1XA 3TIUA 4BANB 2ZKSA 1DDJA 2F9NA 2UUJB 1CGHA 3SU1A 2Z3EA 1XX9A 1HAPH 5DK1A 1F0SA 2EI6A 3L33A 2Q6GA 1EOJA 1HIAA 1G2LA 4X6OA 3PTNA 2B7DH 3UQVA 1NRSH 1KTTB 3PM3A 4BOHA 2O8TA 1C1QA 2OUAA 1YPGH 1O2YA 1A0LA 4B74A 1PYTD 2XCFA 1EZUC 4OS5A 1O2KA 2STBE 4H6TA 4WH6A 1HAHH 2HOBA 1LVYA 1ETSH 3M36A 3QK1A 5CHAC 1ANCA 5LGOA 1UK3A 4IW4E 5JPMH 3ZV9A 3ATLA 1UK2A 2QGRA 2AYWA 1XXFA 1W2KH 1C4Y2 3O8BA 2TGTA 2A7JA 1GBBA 3OTJE 2Y7ZA 1TX8A 1LO6A 3GDUA 4HI3A 1TRYA 1J15A 2BB4A 1TGSZ 2I6SA 2ZDLA 3C1KA 1GMHG 4BTIB 3RC6A 3E0PB 3MI4A 4CBOA 1UO6A 1NRQH 4AGJA 4UE7H 4AG2A 1LPKB 2ZGBH 1C1OA 3DA9B 1E36B 2A45B 3ZZ9A 3HK3B 2FOBA 1ZTLA 2BXUH 1KLIH 1O2NA 4FVBA 1IQNA 1WAYB 3TH2H 1CT0E 2XC5A 2QN5T 3MU5A 5CHAB 3S7KB 1AKSB 1UTPA 1C1PA 3IWMA 3LGYA 2XXLA 4Y0ZE 5K7RA 2F9PA 1ORFA 2VWNA 1J8AA 3D23A 4U01A 3TGKE 2J9NA 2FDAA 1FPHH 1TMUH 1A5IA 4ABAA 1UHBB 1FLEE 3U8TH 1C5PA 1J14A 1TBRH 4Y7AA 8GCHG 4X1NU 4HGCA 3SJIA 2JH5D 1V2UT 3ATWA 1BIOA 3SJKA 3UOPA 4I33A 1P2IA 1AMHA 2BLVA 1UTKA 3FP7E 3LIWA 5FX6A 1T8NA 3MU0A 1EZSC 2H6MA 3P8GA 1LPZB 1EXFA 1Z71A 3KHVA 2ZDKA 4ZHMU 1QFKH 5DP3A 3TH3H 1P9UA 3VB6A 1W10U 1C5QA 5EQSA 5E2PA 1Z1IA 2NU1E 5F6MA 3FP8E 5E0JA 3FVFB 1QTFA 3RC5A 3ZZ7A 2Z9GA 1UCYH 1SOTA 4ZHLU 4ZH8A 1QBOA 3R0FA 1SGRE 4WMEA 5A0CA 5LPEA 3LJJA 4B76A 2ZU2A 2GCTC 3SW2B 1JOUB 3HKJB 1EQ9A 1HJ8A 3TVJB 1LMWB 2CN0H 3PB1E 2GGVB 4K3JA 1QGFA 1WOFA 1BJVA 2QCYA 1OYTH 2KAIA 2PV9B 1GBJA 3GCHC 3M5OA 4ZKNU 1BTPA 3PV4A 2OD3B 1LKAA 1VGCC 2A4GA 1GJAB 4Q7ZA 2Z9KA 1UTOA 3TH4H 2F83A 5EPNA 1X7AC 3VB5A 1GGDC 4ZKSU 1GDQA 1VCWA 2ZHDA 2G4TA 3BF6H 2VINA 1T4VH 1KYNA 1K28D 4NSYA 2ZTXA 3RXDA 1AO5A 4B2BA 3E1XB 3LU9B 1W0ZU 2QYIA 2GCTB 1BA8B 1T31A 2A32A 5EPYA 1ETTH 3SJ8A 2BD5A 1XUIA 2HNTE 1P2KA 1KLTA 2XRCA 1GBIA 1OWJA 4KGAA 4GCHG 1RFNA 2H9HA 1S84A 1NTPA 2BY9X 3RLYH 1DITH 3GCHB 1KTSB 3RXRA 1C1MA 1W11U 2Z9LA 5FCKA 3STIA 3A84A 1VGCB 5F8XA 1FI8A 1UVSH 4YZUA 1P0SH 4Y10E 2BDIA 4K1TA 1BTWA 2WUCA 1XM1A 5T6FA 1GJ5H 4RKOB 4AOQA 1HAGE 3M7QA 1GGDB 1MU6B 1G3DA 4AYVB 4NZLA 2BLOA 1C1TA 4IC6A 1C5TA 4OS2A 3RXOA 2AH4X 2QAAA 3BTEE 2ZTYA 1L1JA 2Q6FA 5EG4A 2OCVB 1EKBB 4PROA 1BHXB 2VJ1A 2C8XB 3ZZ6A 3LH3A 2SNVA 4Z6AH 1O5CB 3KQCA 1NU9A 1NPMA 3P95A 4XOJA 4CRBA 2BLQA 1AFEH 2ASUB 2GZ8A 1WQVH 2O8MA 5CE1A 3QO6A 2FOEA 3EDXB 5C2ZA 2ANYA 4GPGA 4FU9A 4GAWA 1XUHA 1NFUA 4AFUA 2FI4E 1TAWA 2BY6X 1ABJH 1TBZH 3SNAA 1CA0C 1AVWA 2EEKA 1PPHE 2ILNA 1Y3UA 3A89A 3GY8A 4CRFA 1OWHA 5EQRA 1MTWA 5GPIB 4E7RG 2EA3A 4INKA 4AX9H 1C1WH 1BRBE 1CE5A 1BQYA 3Q3KA 1BTYA 1G9IE 3MH5A 1DWBH 3ZYEA 3E91A 2ZP0H 1ACBE 6ESTA 3TGIE 4ABHA 1O3CA 2CHAC 4ZKRU 2HLCA 1KIGH 1YGCH 1TPOA 2OC1A 2ZFPH 3M3SA 1O5GH 5E2OA 1FN6A 4RN6A 2OQ5A 4I8GA 3SI3H 3SI4H 2JKHA 4KTSA 1CQQA 2ODYB 2WINI 3HPTB 2ZHEH 1O2MA 4JYVH 3LKWA 2VVCA 2VH6A 2SGAA 1CA0B 3BTGE 3MH6A 2QC2A 3TK9A 1V2RT 1QL7A 3OX7U 1MU8B 1QCPA 3PROA 2O9QA 4CRDA 1QQUA 1Z1JA 2BY7X 2ZO3H 1O31A 1O2WA 5EXNA 2XYAA 3NCLA 2CHAB 3F68H 3SV7A 1NT1A 2G00A 4YESB 4X8SH 2ZFSA 1HGTH 1KXAA 4I7YH 3T2NA 3TPIZ 1SGYE 3KQDA 3BTME 3ZVBA 1C5RA 3FAOA 1AKSA 2AS9A 5LH8A 1LHDH 3BTTE 4NIWA 3URCA 3ATIA 2OLGA 4ABBA 5DKMA 2TGAA 2I6QA 1FJSA 3SV9A 3SQEE 3A83A 2WPKS 1S85A 1TA2A 4WF8A 1OKXA 3UY9A 4AYYB 3SORA 1SGQE 2J4IA 2V0BA 4ABEA 3PLBA 4DJZB 1MAXA 4IMQA 4UEHH 2VH0A 2SFAA 1P09A 3Q77A 2ANMH 2RA3A 1C5SA 3TK6A 1BITA 1CT2E 4FUDA 1K9OE 2ALPA 3EA7A 4NIYA 1FN8A 4FXGH 1PPGE 1CHGA 1TPAE 2VWOA 1NRRH 3GOVB 2ZFFH 2FM2A 4K2YA 1UMAH 3GCTG 3MHWU 2H9EH 1O3AA 3Q3XA 1O3GA 3BEUA 3PTBA 1AWFH 1BMNH 1C4V2 5EODA 7KMEH 1W0YH 4NWKA 1DXWA 1DE7H 4XE4A 4ZXXH 2AGIX 2BXTH 4FUHA 1MZDA 2W7UA 1O35A 5EOKA 1OXGA 4DIHH 2GP9B 2VIQA 1EPTC 1PQAA 1S82A 2XCNA 3UOUA 3T26A 1NS3A 1GPZA 2C3SA 2UWLA 2Y6TA 4O03A 1YM0A 2B8OH 1B0EA 2P94A 1C1NA 5C5OA 3SU4A 5HM2A 4CRCA 4WY3A 2SNWA 3BTQE 2BLWA 1ZMLA 1S6FA 5A8YA 1ARBA 1A5HA 2GDEH 4I31A 1BT7A 1HXEH 1S0RA 1DOJA 3SU0A 1VJ9U 2ZECA 3G01A 1XKAC 3ZZ5A 2OC8A 4MNVA 1GBLA 1RRKA 5IDKA 3N7OA 3QWCH 1O36A 5ABWA 2WPHS 4IBLH 2GTBA 4Y71A 1EPTB 1EUFA 1SLXB 2B5TB 4YLUA 1GJ6A 2VWMA 3GCOA 7ESTE 2A2XH 3F9FA 4GHTA 5FPSA 4O3TA 1AIXH 5I25A 1TRNA 1K1NA 1SGCA 1TABE 4YM9A 3UWJH 3BIUH 1DWEH 2FIRH 1D4PB 4H6SB 2IPHA 1T4UH 1DSTA 1L2EA 1ZSKA 4TPIZ 2W26A 2XW9A 3GY4A 3U8RH 4B2AA 1C1SA 1OWEA 2H5DA 1ZSLA 1QURH 3SNBA 5EU8A 2Y5FA 1XUKA 2PSXA 3EAJA 1S0QA 5A8ZA 4ZXYH 1CSOE 3M5LA 1TOMH 1J16A 3S7HB 4HTCH 1HV7A 1UTLM 1GI6A 2A5KA 3ELAH 3F1SB 1SQOA 4DCDA 1O2SA 2VIVA 4CH2B 2D2DA 5A0BA 4FUIA 4TPYA 2AMPA 1V2PT 3QUMP 4ZKOU 1MMJN 1VCPA 1U6QA 2EI8A 3T29A 1C2JA 2BY5X 1A7SA 2Z3DA 3VPKA 3IITA 1AZZA 1K2I1 1RGQA 1ZYOA 1MTUA 3A7ZA 2A5IA 3SHCH 2VNTA 3E8LA 2XBYA 1BB0B 1SGNE 3QDZB 2ZGJA 1YBWA 3EGKH 1HYLA 1GBKA 1RS0A 4GSOA 1LCYA 4KTCA 2BHGA 1P11E 2PTNA 1AQ7A 3NZIA 3GY6A 3SZNA 3A7VA 4GUXA 2FOHA 1O5FH 3A81A 2SGDE 2BVXH 2ZI2H 1GBDA 1TALA 1TMBH 1IOEA 2IN2A 3U1IB 1DWCH 5C3NA 2R2WU 1G3CA 2G51A 1QR3E 2OINA 3L3TA 1GJ4H 2F9OA 1CBWC 1HXFH 3RXSA 5AF9H 1CVWH 1P05A 1P06A 1WTGH 3DUXH 5G4BA 1FIWA 1FPCH 1IQGA 1HJ9A 1TNJA 5TCCA 1FMGA 4LOYH 3A88A 5DO4H 1E34B 4Y11E 1FONA 2LNCA 4OS7A 1PJPA 1N6YA 1PQ7A 4DY7B 1KDQB 4NA9H 2F9UA 3SGQE 2W5EA 2ESTE 1BDAA 1FY4A 5FPYA 2DE8A 2HRVA 1WQSA 1Z8IB 3A8AA 1V2JT 1F0TA 1SLVB 1SGFA 1CBWB 4JYUH 1A46H 4RKJB 5GIBA 3H7TA 4Y76A 3SV8A 3RXPA 2FMJA 3V13A 1ETRH 1HJAC 1BTHH 4E06H 3M3TA 2WV5A 1CO7E 1TQ7B 4DW2U 5DPAA 2VGCC 1GMCF 4WH8A 1YKTA 3A8BA 3SJ9A 2HNTF 1A61H 2GT7A 5DG6A 3GY5A 2BD2A 1P12E 1A3EH 3LGIA 1SGDE 2QXJA 1ZGVA 3UNRA 3KCGH 5FHTA 1W13U 1GDNA 1DX5M 3U8OH 1DUEA 1G3BA 1NN6A 1GCTC 5PTPA 1FY5A 2BZ6H 4GHQA 1UVTH 1BTZA 2CJIA 4WJG2 1V6DA 2GKVE 3E16B 3E3TA 5GCHF 1P2OA 1XMNB 1HJAB 4ISIH 2ZCHP 3LOXA 2FP7B 2VGCB 1SHHB 2C8ZB 6LPRA 2VVUA 2Y5GA 2RCEA 3P8OA 1BOQA 1TGTA 3MNBA 1OOKB 1XVOA 2VIPA 1Z8JB 3NUMA 1IQEA 1BBRK 3BTHE 3V0XA 1PPBH 1YF4A 1H9LB 3A7TA 3PLPA 2BVSH 3AW1A 1RTLA 5T6DA 2FESH 2VIDA 4X2VA 2XBWA 5C67A 2AGGX 1AD8H 1GCTB 5FAHA 1SFQB 4JZDH 4TWWA 1RTKA 1YC0A 5AHGH 1SGEE 2BD3A 3M3VA 5TJXA 1BHXF 3BN9A 4IMZA 2Y7XA 1AVXA 2FODA 1XKBC 1MTNC 2NWNA 3OY6U 4XDEA 4XBCA 1W7XH 1KSNA 2VVVA 3KIDU 3VGCC 1GG6C 1NO9H 3C27B 1YYY1 3GY3A 4YOIA 3RU4T 4X6NA 1EAIA 1ELTA 2ZNKH 1IQKA 1UCYE 4X1RU 3Q76A 5L6NH 3NPSA 2PUQH 4DOQA 3A87A 3SU2A 3O8CA 4WMFA 1NC6A 1ELEE 1V2MT 3EA9A 5LPFA 1TPPA 2GX4A 4UFDH 1W8BH 1C9TA 3UPEA 2LPRA 5JBCS 5EW2H 1YPJH 2JH6D 4X1QU 5AFZH 1K22H 3RXEA 1OPHB 3ESTA 4D7FA 1MTNB 2CMYA 2QIQA 3MO6A 4R0IA 3QGJA 3AW0A 1SLUB 3GICB 1QB1A 2PKAB 1ZHMA 3VGCB 1GG6B 2WYJA 3LT3A 1MBQA 2OQUA 2GMTC 4HZHA 3M35A 4HFPB 1AI8H 4BTTB 1TNIA 1FDPA 1QY6A 3MO3A 2ZPSA 1O2PA 2OTVA 1KXBA 8LPRA 3RC4A 2AIPA 1DLKB 4KTUA 3BEIB 2ZGCA 2FWWA 1TOCB 1C2KA 2ZFQH 2ULLA 1ZRBA 1HAZB 2CGAA 4Y7BA 1RIWC 2XC0A 1YPMH 2ZZUH 4I8LA 5HMAA 5J4QA 1ZPZA 2BX4A 1O5AB 1NM6A 3VB7A 1O3FA 5DP5A 3IG6B 4WWYA 1C1VH 1P2JA 4BTUB 3CP7A 3KEEA 2ZHFH 2Y82A 2GMTB 3V3MA 1V2TT 4JZEH 1MBMA 1G37A 3ZVAA 1AE5A 2QXGA 1GMDF 1FZZA 5J4SA 1SL3A 1C1RA 1MKXK 4E7NA 3URDA 1W7GH 4CBNA 2DE9A 1DPOA 4I32A 5FBEA 4A1TA 4FU7A 1LTOA 2AMDA 3AAVA 1RIWB 1A0HB 3OYPA 4K8YA 1E38B 1TBQH 4TY6A 1F0RA 3A82A 2BDCA 3A86A 1G36A 1DT2A 1SB1H 2J92A 5EXMA 3ZZ3A 1O5EH 3L6PA 1HAVB 4H4FA 3A7XA 4U32A 5F8ZA 2ODPA 5SGAE 2FOCA 1OX1A 4UFEH 4O97A 1Q2WA 2BTCE 4MNWA 4ABIA 1SGTA 2GCHF 3EA8A 3DFJA 4FUEA 1CU1A 3PYHA 3RP2A 1BJUA 2D26C 1O3DA 4BAQB 1GBAA 1UTNA 3U9AH 1GI2A 4AG1A 1NY22 4B1TA 1P02A 1C5XB 2WPMS 1GCDA 3BTFE 2TIOA 1EJNA 4J1YA 2FPZA 2Z7FE 1RXPA 3BTDE 1C9PA 4D8NA 1P3EA 5FBIA 3M5NA 4H42U 3MU4A 1AZ8A 4JZ1A 1P2QA 2V3HH 2RG3A 3E0NB 1FAKH 1A2CH 1TNKA 5HYOA 4X6MA 2J2UA 2M5TA 4NA7A 3V7TA 4MDSA 1KXCA 2FYRA 3HGNA 4Q7YA 1IQFA 1EB1H 1HAXB 2WPJS 4UDWH 1TGBA 1W14U 4OGYA 1NZQH 1GHXH 1OP8A 2AGEX 4Y6DA 3S9CA 1TNLA 1WSSH 1MZAA 3TK5A 3KL6A 5B6OA 3A80A 2A7HA 3RLWH 4JZIA 1C5OH 1B5GH 2BDBA 3CS0A 4CR9A 1CGIE 2P93A 1JBUH 4AB9A 1J17T 2NU3E 5DP6A 3BIVH 3TLOA 1H9HE 1L1NA 1XUGA 1AU8A 2J94A 1QIXB 3E6PH 2ZU1A 1EAUA 1ZMNA 1NRPH 4BAOB 1THRH 1C5LH 4AN7A 3NWUA 4MNYA 1ZHPA 1O37A 2FOGA 3EYDA 1F92A 2FX6A 1TGNA 4GLYA 1HUTH 1GMCG 3Q00A 3BV9B 3TNTA 5FXLA 3ITIA 1CT4E 2ZCLP 4XFQA 2XBXA 2ANWA 5LPRA 1MTVA 2BVRH 4FUCA 7GCHF 1O34A 3SNCA 3ODDA 1SOZA 1UHBA 1SGIB 2ZU5A 2BQ6B 2PTCE 5L2YH 1GI4A 1MH0A 2V6NA 3T27A 1G32B 4CR5A 5JB9S 5EW1H 4NWLA 2XWBI 2A4OA 3ZZ8A 2BYAX 1K1IA 3UR9A 3SUEA 3MH7A 1QA7A 1MD8A 3UQOA 1Y5BT 2QXIA 4X1PU 1HFDA 1A5GH 1TX6A 3MNXA 3KN2A 5GCHG 3RMMH 4IGDA 5C5NA 2A1DB 2BOKA 3ZZDA 1TQ0B 1W12U 5F03A 1YLCA 2VIOA 3SBKA 3SNEA 3D65E 1LQEA 1SGPE 2CV3A 2PUXB 4X2XA 1T8OA 4I8HA 1L4DA 4A92A 3A8CA 3SV6A 1ZRKA 1HIAB 1OS8A 1Y59T 4DGJA 1UVUH 3I78A 1SI5H 1GI1A 1O32A 4NA8A 1A1RA 1MKWK 1HCGA 1O2JA 1O0DH 3AASA 4DVAU 1GBCA 4ASHA 4ZMAH 1J9CH 5T3HA 1D3TB 5HM9A 1NESE 3RXJA 1N8OC 1GHBF 1WCZA 1NFWA 1BRCE 3RXUA 2OBOA 2PHBA 3MU1A 1CHOF 4MPUA 1O2XA 3O8DA 1IHTH 4BAMB 2J95A 2THFB 2XTTB 1GDUA 3SGAE 4FUFA 5I46H 2C90B 4ABGA 1YCPK 4D9RA 4AZ2B 4OS4A 3M5MA 5IYTA 3PMHB 3STJA 1LVOA 1INCA 1C2LA 1GI3A 3ZZ4A 2QF3A 3MNCA 1GJBB 1C2GA 1ELAA 1WTHD 1T7CA 2QF0A 3PLKA 4ISHH 5DGJA 3UIRA 2QXHA 3NXPA 1EJMA 3ZVGA 1O5DH 2H9TH 6CHAB 1GBHA 2Y81A 5H4IB 3D62A 1THPB 1N8OB 4Q80A 4SGBE 3FP6E 4CH8B 2ODQA 3QX5H 3PWBA 1FY8E 1ZSJA 3PMAB 4BXWA 4Y8XA 3RU4E 1O3PB 1S6HA 1O3BA 1O2ZA 2OC0A 1WV7H 2IJOB 2VWLA 1BRAA 2STAE 1DM4B 1QJ7B 3GDSA 1K1PA 4R8TB 3A85A 2G5NA 3HATH 3TJUA 4A1VA 1JWTA 2BDGA 3RXGA 1SHYA 2A31A 1O39A 2P16A 2BOHB 4MG3A 3ZVEA 2Z9JA 5A0AE 2P3FH 1Y8TA 1PPCE 4MPVA 3B8JA 4K60A 1F2SE 4DG4A 2ZCKP 4ISLA 5FX5A 2R3YA 1QHRB 2ZDAH 1O2IA 5GWZA 3UR6A 3RXTA 1DLEA 4BAKB 2NU0E 3ATKA 3DT0H 2HVXA 1DSUA 1GI7B 1P04A 2H5CA 4A5TS 1LPGB 1F5KU 1EATA 4ABFA 4U30A 2PFEA 4K8BA 2SGPE 3NKKA 1GMDG 4UONA 1LHFH 3K6ZA 1O3EA 1HNEE 2KAIB 1GHZA 5C1UA 1OWIA 1QRWA 2BX3A 2V3OH 2JH0D 4ABDA 4ZUHA 1L4ZA 3W95A 1SGFG 1V2LT 3MNSA 3QTVH 1O2HA 1ELVA 1C2HA 3KQEA 3HK6B 4TWYA 4I8KA 3UFAA 3R3GB 5ESBA 1LHGH 1YP9A 3RXCA 3PO1C 4NIXA 3ZZBA 1PQ8A 1SQAA 2TGPZ 3EE0B 3F6UH 1ELFA 2PW8H 3DFLA 1KLJH 1ARCA 3UNSA 4KP0A 3MYWA 1C4U2 1P10A 2GCHG 5C1YA 3E90B 1B7XB 2WPLS 2FZZA 2F9VA 1P8VC 1PPFE 4RSPA 1O2TA 3I29A 3FFGA 2FOFA 2RA0A 2G52A 1ZTJA 3P17H 1V2NT 3SJOA 2G8TA 4O9VA 2D8WA 1PYTC 4LXBH 1QRXA 1O3KA 3LDXH 2FEQH 2OP9A 3PO1B 5JYIA 2FOMB 1TIOA 1F5RA 3FZZA 3OU0A 1DVAH 2XWAA 5GDSH 1G2MA 3SU5A 3VB4A 2AEIH 1ELDE 1ABIH 2ZFRH 3SOSA 4J2YB 1IQMA 3P8NA 4UFGH 1Y3WA 1D3DB 1AGJA 3SHAH 4CREA 1O3MA 1BBRH 1A0JA 3DHKH 4NG9H 8KME2 1WU1A 1KXEA 1ZOMA 1G30B 1F5LA 2ZDVH 3HKIB 1Q3XA 4XBBA 1O2RA 3MWIU 2BQWB 1AE8H 1S83A 2EC9H 2PLXA 1O3IA 1YPLH 2TPIZ 2V35A 3ATMA 2BMGB 1ZGIA 1IAUA 1TGCA 1SC8U 5A2MH 2JETC 5A8XA 1T32A 2ANKH 1N6XA 5JDUB 5JBAS 1SLWB 1W3CA 2R3UA 3ZV8A 3F9GA 1ELBA 3NK8A 2OXSA 1A3BH 1D9IA 4YT7H 3T5FH 2AERH 1GL0E 3O8RA 1HAYB 7GCHG 3RM0H 4AFSA 1O2OA 1YLDA 2FTLE 3TJOA 2ZA5A 3A7WA 2TRMA 2XNIA 1C5ZB 3B23B 3LGVA 5EQQA 1JRTA 4MQAA 3TU7H 3RXQA 1NFYA 2CF8H 2ZFTA 4K5ZA 4NCYA 3RMNH 1IQLA 2HALA 1ANBA 2FI3E 2H2ZA 2F91A 1GI5A 1K1OA 1ZPCA 1H1BA 2JETB 1JRSA 2BDAA 1AUJA 3BTWE 2G81E 3ENSB 1S5SA 2PKSC 4YT6H 1GBTA 1OWKA 4INHA 1O5BB 3QLPH 2FI5E 2BM2A 3A8DA 1H8DH 1QJ1B 4LZ4B 2F9BH 2A2QH 1TLDA 4GVUA 1UK4A 3ZVCA 2B9LA 1RTFB 2XC4A 1YPHC 1TNGA 4ISNA 2FX4A 4X8UH 1EPTA 1Z8GA 3GCTF 2ZDNA 5C20A 1ID5H 1C2FA 1BCUH 1EOLA 1AFQC 2A4QA 3P70B 3S69A 3MFJA 5DJ7A 2CF9H 3UWIA 1DWDH 1GHBG 2TBSA 2GZ7A 2PWXA 3RXBA 2D1JA 1CHOG 2P59A 2GDDA 7LPRA 1C5NH 2H1UA 2PKSB 3CS7A 3RXKA 1IQHA 1C2IA 3GDVA 3MOCA 2RDLA 3SUFA 1GWAA 3HGPA 2HNTC 3RXMA 3AVZA 1MQ5A 5DP8A 2AIQA 6GCHF 1O2LA 1LVBA 3SQHE 3T25A 3LONA 3SU3A 1MD7A 4JYTA 1BZXE 4DIIH 3M37A 2C8YB 1AFQB 2J34A 1C5YB 2SGQE 1SBWA 4AB8A 4NFFA 1GL1A 1GVLA 1ANDA 4IN2A 1MKXH 3VXEH 4JMYA 1ZLRA 4MTBA 1OP0A 2BD7A 4JK6A 3K65B 4YLQH 4BAHB 1GI0A 1DUAA 2GD4B 4I8JA 4ISOA 4YTAA 2BQ7B 1O30A 3TJVA 1K1JA 3SU6A 4AFQA 1Y3XA 2VU8E 4JZFH 4X8TH 3D49H 1O3OA 2A4RA 1ESTA 1IQJA 1DICA 1FY1A 1AN1E 1YPHE 2GV7A 1NRNH 2Z3CA
chains in the Genus database with same CATH superfamily
2UUKB 4F49A 3VXFH 5CHBA 2A5AA 1E35B 3AAUA 5ESTE 3RM2H 1VITF 1VZQH 4P00A 3PMJA 2SGFE 4OS1A 1ESBA 4FETA 1ZMJA 4NIVA 1TA6A 4B6FA 3WW7A 1H4WA 4KELA 4NSVA 3JZ2B 1PQ5A 3T62A 4E05H 1V2OT 5DP9A 5HKKD 1D3QB 2R9PA 4MPWA 1ZTKA 4Y8YA 3VG8A 1V2QT 3PV5A 1QNJA 3U1JB 2O8UA 3SUDA 1XUJA 1QL8A 1LDTT 1O3NA 1V2VT 1XVMA 2BD8A 1MUEB 5EGMA 2HPPH 1UCYK 1D3PB 4B71A 4YOJA 1F0UA 5BPEA 2B0FA 4DURA 5JBBS 1FAXA 5GNDA 1TYNA 3RUOA 4FUBA 3SNDA 2JIZD 1LQDB 3I77A 1L0ZA 4MPXA 1OP2A 2G5VA 4ZAEA 1T8LA 1TONA 4Y0YE 4X6PA 3UUZA 1RD3B 2XBVA 1JIRA 4K1EA 3LC3A 3P8FA 3M61U 1KMHB 4P02A 1C2DA 2QY0B 3GCNA 1BUIA 1SFIA 1GVZA 1W0KD 1KDQA 1SQTA 3LH1A 3S9AA 3OEHD 4IC5A 1V2ST 1PPZA 1T8MA 2UUYA 1JMOH 4FUGA 1DS2E 2FLRH 4AORA 2KCYA 2OBQA 1QA0A 2DUCA 1DXPA 3JZ1B 3BEFB 4OS6A 1V2WT 1WBGB 2HPQH 4IN1A 1EP6A 4BXSA 2UWOA 3LGTA 4UFFH 3PMBB 2W3IA 2SGEE 1DANH 1O33A 2F3CE 2JDID 3QGNB 1AWHB 2IPQX 2R0LA 1SSXA 2NU4E 1H9IE 1HRTH 1P2MA 3TJNA 1VJAU 4FU8A 3KQ5A 4AFZA 1MCVA 3WY8A 4Q7XA 2CXVA 2K1QA 3H7OA 1QB6A 4CHAC 1YPEH 1MABB 1Z6JH 1Y5UT 4MNXA 1NU7B 1TE0A 4LZ1H 5KECA 2Z6BD 4D76A 2G4UA 3QZQA 1C2EA 3MH4A 4ZHAA 1F7ZA 1GHAF 1Z7KA 1C5UA 3M7TA 2G55A 2HGTH 2ZQ1A 4D7GA 1FNIA 4U2WA 3UNQA 2GV6A 3GY7A 5DP7A 2P3TB 2ZU3A 3SO3A 3TGJE 4WXIA 1PFXC 3TITA 2YOLA 3RDZA 2FTMA 1C2MA 1O3HA 4KKDA 2Y80A 4Y8ZA 4IS5A 3K2UA 1ANEA 5DN6D 5A09A 1Z8RA 3QN7A 3ZYDA 2R0KA 3H5CB 1IHSH 2Y5HA 4CHAB 3LC5A 3P92A 1MKWH 1VR1H 1SQRA 1IQIA 3BSQA 2ZDMA 1YCPM 3QTOH 3K9XB 2UUFB 1P2NA 4UD9H 4OGXA 2VB0A 2W7SA 3BG4C 3KGPA 1Y5AT 1O2QA 1P03A 3PV2A 2O8LA 1UVOA 2P3UB 2BD4A 1AB9C 2KM0A 1GBFA 1MCTA 2FO9A 4X2WA 5JBTA 2ZTZA 1FIZA 4K1SA 1ESAA 1TWXB 3OSYA 1YCPH 1GBEA 1TB6H 5HGGA 1O2GH 3KF2A 1AY6H 4WMDA 2OC7A 2ZGXH 1HBTH 3QZRA 1QL9A 1HPGA 3KQBA 4INLA 3RXVA 1GJ8B 1O3LA 4YOGA 2ZG0H 1ELGA 1HLTH 1DY9A 1YPKH 4TYDA 1ELCA 5ETXA 1GMHF 1UTMA 3BTKE 1DY8A 2Q6DA 2ZWLH 1BRUP 1KY9A 2PGQB 2ALVA 1M9UA 1HAOH 3EQ0H 3BG4B 4FUJA 1VITH 1P3CA 1AB9B 3UTUH 1UVPA 1O3JA 2UWPA 4X0WU 2BY8X 4VGCC 1JIMA 2XNDD 6CHAC 3SN8A 4F48B 1NROH 3MMGA 1AVGH 3SGBE 3H09A 1ZJKA 2K8IA 5E0GA 2ZQ2A 1GBMA 4NFEA 1HDTH 1GJ7B 2PKAA 5EXLA 1NFXA 1B0FA 1OWDA 1GHYH 4A6LA 2ZIQH 1LHEH 1LHCH 1C5WB 8GCHF 1DFPA 3T28A 5TCAA 9ESTA 4MLFB 2BDHA 1HAIH 2C8WB 3UAIC 3ZZAA 3A7YA 5L2ZH 4LK4A 3U98H 4NGAH 2L74A 4THNH 5B6LA 2FS9A 4FVDA 2FXRA 1CGJE 1QJ6B 2ZPRA 1GJDB 1D6RA 1EAXA 1O2UA 1TX7A 3RXAA 2J38A 1E0FD 2ZU4A 4SGAE 1UTJA 3LPRA 4JK5A 4VGCB 2FS8A 1G3EA 2BZAA 2EI7A 1LVMA 1CA8B 3RU4D 1E79D 1EAWA 3LGUA 4BNRA 1THSH 2ZEBA 1K1MA 1Z6EA 6GCHG 5E0HA 3WWFA 1C5MD 2FOAA 3VFEA 4ESTE 1TFXA 3GISB 2ZHWH 4JCNA 1MTSA 4XRNA 3ZVFA 2A7CA 2GZ9A 3S0NA 3V12A 3P6ZB 2ZPQA 1FV9A 1L1GA 5L30H 2AFQB 5GJ4B 1P01A 1SG8B 3RXIA 5C0UA 5AVDA 2FYQA 3RXFA 3VEQB 3SUGA 4B75A 3ODFA 4X1SU 4ABJA 1V2KT 2Z9IA 4ZROA 1K1LA 5T6GA 5JB8S 2WPIS 3ZZCA 3MTYA 5FCRA 3F2GA 5AFYH 3ZVDA 2C93B 5GXPA 1BMAA 4CRAA 1ZZZA 1ZJDA 2QE7D 2QV1A 1HAVA 1VITG 1OYQA 1FUJA 3B9FH 1GJ9B 4Y79A 1ZHRA 1GVKB 1SVPA 1K21H 1GJCB 1FY3A 5CMXH 1GI8B 2QA9E 2WYGA 2P95A 3WWBA 2ZGHA 3MU8A 3UREA 1BTXA 1LKBA 4B73A 4GCHF 4CRGA 1MQ6A 4TSFD 2WUBA 4WXVA 1P9SA 1PPEE 1GHWH 1WUNH 1ZR0A 2C4FH 3FANA 4O3UA 4K69A 1SPJA 5FPTA 2WV4A 5K0HA 3LGWA 1QRZA 3VB3A 2GT8A 1UTQA 5E8EH 3RMLH 3F0OA 3LJOA 3UB0A 1C5VA 3RXHA 5HXFA 5C1XA 1O2VA 2IOTA 1XXDA 3CENA 4WVPE 1AUTC 2BD9A 1BMMH 2P8OC 1EJAA 2ZHQH 1VCQA 3BG8A 1EZQA 1OSSA 1P57B 1TPSA 2R2MB 4DT7B 3F9HA 4QT8C 3GYMA 1EB2A 1FQ3A 1Y3YA 1AHTH 1QB9A 1RJXB 4RI0A 4TT3D 1EX3A 4YO9A 1GI9B 1TMTH 2Z94A 8ESTE 3Q3YA 3M7UA 1N1LA 2PSYA 3KNXA 1D6WA 1QBVH 2BDYA 2GVFA 1TRMA 1HB0B 4X8VH 2VIWA 3K6YA 4A7IB 3GY2A 3S9BA 2NU2E 3RXLA 1A4WH 4MVNA 1MAYA 2ZF0H 4F4OC 2KCAA 1BTUA 4M7GA 1EASA 4Q2KA 2P8OB 1E37B 1Q31A 1JXPA 1KXFA 1C1UH 4TY7A 3U69H 3W1EA 3DD2H 1QBNA 1WYKA 1SMFE 2W3KA 1KXDA 2FLBH 1H8IH 1EP5A 3TNSA 1K0HA 4NZQA 3PWCA 4B2CA 3GYLB 3OY5U 1ZPBA 1Y3VA 2HWLB 1EZXC 3FOAA 3F9EA 3FZDA 3RMOH 1BBRE 4X2YA 5IK2D 9LPRA 2KFWA 2JJ2D 1S81A 2YNBA 1SKYE 1GHVH 5DP4A 5F8TA 2YNAA 5BRRE 1FXYA 1UJ1A 1V3XA 2Q1JA 2PR3A 4Z0KA 2O8WA 1O38A 3MO9A 1GHAG 2TGDA 2ZC9H 3FO8D 2AMQA 4AGKA 2A0QB 1XUFA 4XBDA 4D9QA 4XSKU 1SR5C 1QQ4A 3SV2H 3W94A 1TNHA 1BMLA 2PGBB 4A1XA 3TIUA 4BANB 2ZKSA 1DDJA 2F9NA 2UUJB 1CGHA 3SU1A 2Z3EA 2M2AA 1XX9A 1HAPH 5DK1A 1F0SA 2EI6A 3L33A 2Q6GA 1EOJA 1HIAA 1G2LA 4X6OA 3PTNA 2B7DH 3UQVA 2AHME 1NRSH 1KTTB 3PM3A 4BOHA 2O8TA 1C1QA 2OUAA 1YPGH 1E1RD 1O2YA 1A0LA 4B74A 1PYTD 2XCFA 1EZUC 4OS5A 1O2KA 2STBE 4H6TA 4WH6A 1HAHH 2HOBA 1LVYA 1ETSH 3M36A 3QK1A 5CHAC 1ANCA 5LGOA 1UK3A 4IW4E 5JPMH 2YMSC 3ZV9A 3ATLA 1UK2A 2QGRA 2AYWA 1XXFA 1W2KH 1C4Y2 3O8BA 2TGTA 2A7JA 1GBBA 3OTJE 2Y7ZA 1TX8A 1LO6A 3GDUA 4HI3A 1TRYA 1J15A 2BB4A 1TGSZ 2I6SA 2ZDLA 3C1KA 1GMHG 4BTIB 3RC6A 3E0PB 3MI4A 4CBOA 1UO6A 1NRQH 4AGJA 4UE7H 3KYGA 4AG2A 1LPKB 2ZGBH 1C1OA 3DA9B 1E36B 2A45B 2J98A 3ZZ9A 3HK3B 2FOBA 1ZTLA 2BXUH 1KLIH 1O2NA 4FVBA 2HLDD 1IQNA 1WAYB 3TH2H 1CT0E 2XC5A 2QN5T 3MU5A 5CHAB 2J5UA 1UW7A 3S7KB 1AKSB 1UTPA 1C1PA 2YMSB 3IWMA 2XXLA 3LGYA 4Y0ZE 5K7RA 2F9PA 1ORFA 2VWNA 1J8AA 3D23A 4U01A 3TGKE 2J9NA 2FDAA 1FPHH 1TMUH 1A5IA 4ABAA 1UHBB 1FLEE 3U8TH 1C5PA 1J14A 1TBRH 4Y7AA 8GCHG 4X1NU 4HGCA 3SJIA 2JH5D 1V2UT 3ATWA 1BIOA 3SJKA 3UOPA 1H8ED 4I33A 1P2IA 1AMHA 2BLVA 2W6ID 1UTKA 2L6OA 3FP7E 3LIWA 5FX6A 1T8NA 4ZCNA 3MU0A 1EZSC 2H6MA 3OAAD 3P8GA 1LPZB 1EXFA 1Z71A 3KHVA 2ZDKA 4ZHMU 1QFKH 5DP3A 3TH3H 1P9UA 3VB6A 1W10U 1C5QA 5EQSA 5E2PA 1Z1IA 2NU1E 5F6MA 3FP8E 5E0JA 3FVFB 1QTFA 4I86A 3RC5A 3ZZ7A 2Z9GA 1UCYH 4F55A 1SOTA 4ZHLU 4ZH8A 1QBOA 3R0FA 1SGRE 4WMEA 5A0CA 5LPEA 3LJJA 2K0QA 4B76A 2ZU2A 2GCTC 3SW2B 1JOUB 3HKJB 1EQ9A 1HJ8A 3TVJB 1LMWB 2CN0H 3PB1E 2GGVB 4K3JA 1QGFA 1WOFA 1BJVA 2QCYA 1OYTH 2KAIA 2PV9B 1GBJA 3GCHC 3M5OA 4ZKNU 1BTPA 3PV4A 2OD3B 3FKSD 1LKAA 1VGCC 2A4GA 1GJAB 4Q7ZA 2Z9KA 1UTOA 3TH4H 2F83A 5EPNA 1X7AC 3VB5A 1GGDC 4ZKSU 1GDQA 1VCWA 2ZHDA 2G4TA 3BF6H 2VINA 1T4VH 1KYNA 1K28D 4NSYA 2ZTXA 3RXDA 1AO5A 2OK5A 4B2BA 3E1XB 3LU9B 1W0ZU 2QYIA 2GCTB 1BA8B 1T31A 2A32A 5EPYA 1ETTH 3SJ8A 2BD5A 1XUIA 2HNTE 1P2KA 1KLTA 2XRCA 1GBIA 1OWJA 4KGAA 4GCHG 1RFNA 2H9HA 1S84A 1NTPA 2BY9X 3RLYH 1DITH 2WV9A 1KTSB 3GCHB 3SZEA 3RXRA 1C1MA 1W11U 2Z9LA 5FCKA 3STIA 3A84A 1VGCB 5F8XA 1FI8A 1UVSH 4YZUA 1P0SH 4Y10E 2LELA 2BDIA 4K1TA 1BTWA 2WUCA 1XM1A 5T6FA 1GJ5H 4RKOB 4AOQA 2IJD1 1HAGE 3M7QA 1GGDB 1MU6B 1G3DA 4AYVB 4NZLA 2BLOA 1C1TA 4IC6A 1C5TA 4OS2A 3RXOA 2KCOA 2AH4X 2QAAA 3BTEE 2ZTYA 1L1JA 2Q6FA 5EG4A 2OCVB 1EKBB 4PROA 1BHXB 2VJ1A 2C8XB 2RFKC 3ZZ6A 3LH3A 2SNVA 4Z6AH 1O5CB 3KQCA 1NU9A 1NPMA 3P95A 4XOJA 2PP6A 4CRBA 2BLQA 1AFEH 2ASUB 2GZ8A 4XD7D 1WQVH 2O8MA 5CE1A 3QO6A 2FOEA 3OE7D 3EDXB 5C2ZA 2ANYA 4GPGA 4FU9A 4GAWA 1XUHA 1NFUA 4AFUA 2FI4E 1TAWA 2BY6X 1ABJH 1TBZH 3SNAA 1CA0C 1AVWA 2EEKA 1PPHE 2ILNA 1Y3UA 3A89A 3GY8A 4CRFA 1OWHA 5EQRA 1MTWA 5GPIB 4E7RG 2EA3A 4INKA 4AX9H 1C1WH 5C94A 1BRBE 1CE5A 1BQYA 3Q3KA 1BTYA 1G9IE 3MH5A 1DWBH 3ZYEA 3E91A 2ZP0H 1ACBE 6ESTA 3TGIE 4ABHA 1O3CA 2CHAC 4ZKRU 2HLCA 1KIGH 1YGCH 5HIZA 1TPOA 2OC1A 2ZFPH 3M3SA 1O5GH 5E2OA 1FN6A 4RN6A 2OQ5A 4I8GA 3SI3H 3SI4H 3OTPA 2JKHA 4KTSA 1CQQA 2ODYB 2WINI 3HPTB 2ZHEH 1O2MA 4JYVH 3LKWA 2VVCA 2VH6A 2SGAA 1CA0B 3BTGE 2JJ1D 3MH6A 2QC2A 3TK9A 1V2RT 1QL7A 3OX7U 1MU8B 1QCPA 3PROA 2O9QA 4CRDA 1QQUA 1Z1JA 2BY7X 2ZO3H 1O31A 1O2WA 5EXNA 3KYFA 2XYAA 3NCLA 2CHAB 3F68H 3SV7A 1NT1A 2G00A 4YESB 4X8SH 2ZFSA 1HGTH 1KXAA 4I7YH 3T2NA 3TPIZ 1SGYE 3KQDA 3BTME 3ZVBA 1C5RA 3FAOA 1AKSA 2AS9A 5LH8A 1LHDH 3BTTE 4NIWA 3URCA 3ATIA 2OLGA 4ABBA 5DKMA 2TGAA 2I6QA 1FJSA 1W0JD 3SV9A 3SQEE 3A83A 2WPKS 1S85A 1TA2A 4WF8A 1OKXA 3UY9A 4AYYB 3SORA 1SGQE 2J4IA 2V0BA 4ABEA 3PLBA 4DJZB 1MAXA 4IMQA 4UEHH 2VH0A 2SFAA 2KCPA 1P09A 3Q77A 2ANMH 2RA3A 1C5SA 3TK6A 1BITA 1CT2E 4FUDA 1K9OE 2ALPA 3EA7A 4NIYA 1FN8A 4FOUC 4FXGH 1PPGE 1CHGA 1TPAE 2VWOA 1NRRH 3GOVB 2ZFFH 2FM2A 4K2YA 1UMAH 3GCTG 3MHWU 2H9EH 1O3AA 3Q3XA 1O3GA 3BEUA 3PTBA 1AWFH 1BMNH 1C4V2 5EODA 7KMEH 1W0YH 4NWKA 1DXWA 1DE7H 4XE4A 4ZXXH 2AGIX 2BXTH 4FUHA 1MZDA 2W7UA 1O35A 3N99A 1OXGA 5EOKA 4DIHH 2GP9B 2VIQA 1EPTC 1PQAA 1S82A 2XCNA 3UOUA 3T26A 1NS3A 1GPZA 2C3SA 2UWLA 2Y6TA 4O03A 3FN8A 1YM0A 2B8OH 1B0EA 2P94A 1C1NA 5C5OA 3SU4A 5HM2A 2HVYB 4CRCA 4WY3A 2KR7A 2SNWA 3BTQE 2QF4A 2BLWA 1ZMLA 1S6FA 5A8YA 1ARBA 1A5HA 2GDEH 4I31A 1BT7A 1HXEH 1S0RA 1DOJA 3SU0A 1VJ9U 2ZECA 3G01A 1XKAC 3ZZ5A 2OC8A 4MNVA 1GBLA 1RRKA 5IDKA 3N7OA 3QWCH 1O36A 5ABWA 2WPHS 4IBLH 2GTBA 4Y71A 1EPTB 1EUFA 1SLXB 2B5TB 4YLUA 1GJ6A 2VWMA 3GCOA 7ESTE 2A2XH 3F9FA 4GHTA 5FPSA 4O3TA 1AIXH 5I25A 1TRNA 1K1NA 1SGCA 1TABE 4YM9A 3UWJH 3BIUH 1DWEH 2FIRH 1D4PB 4H6SB 2IPHA 1T4UH 1DSTA 5EJZA 1L2EA 1ZSKA 4TPIZ 2W26A 2XW9A 3GY4A 3U8RH 4B2AA 1C1SA 1OWEA 2H5DA 1ZSLA 1QURH 3SNBA 5EU8A 2Y5FA 1XUKA 2PSXA 2WSSD 3EAJA 1S0QA 5A8ZA 4ZXYH 2WPDD 1CSOE 3M5LA 1TOMH 1J16A 3S7HB 4HTCH 1HV7A 3F0PA 1UTLM 1GI6A 2A5KA 3CNRA 3ELAH 3F1SB 1SQOA 4DCDA 1O2SA 2VIVA 4CH2B 2D2DA 5A0BA 4FUIA 4TPYA 1NBME 2AMPA 1V2PT 3QUMP 4ZKOU 1MMJN 1VCPA 1U6QA 2EI8A 3OFND 3T29A 3EE7A 1C2JA 5C0TA 2BY5X 1A7SA 2Z3DA 3VPKA 3IITA 1AZZA 1K2I1 1RGQA 1ZYOA 1MTUA 3A7ZA 2A5IA 3SHCH 2VNTA 3E8LA 2XBYA 1BB0B 1SGNE 3QDZB 2ZGJA 2W6JD 1YBWA 3EGKH 1HYLA 1GBKA 2GJGA 1RS0A 4GSOA 3F2FA 1LCYA 4ACAA 4KTCA 2BHGA 1P11E 3N7EA 2PTNA 1AQ7A 3NZIA 3GY6A 3SZNA 3A7VA 4GUXA 2FOHA 1O5FH 3A81A 2SGDE 2BVXH 2ZI2H 1GBDA 1TALA 1TMBH 1IOEA 2IN2A 3U1IB 1DWCH 5C3NA 2R2WU 1G3CA 2G51A 1QR3E 2OINA 3L3TA 1GJ4H 2F9OA 1CBWC 1YWUA 1HXFH 3RXSA 5AF9H 1CVWH 1P05A 1P06A 1WTGH 3DUXH 5G4BA 1FIWA 1FPCH 1IQGA 1HJ9A 1TNJA 5TCCA 1FMGA 4LOYH 3A88A 5DO4H 1E34B 4Y11E 1FONA 2LNCA 4OS7A 1PJPA 1N6YA 1PQ7A 4DY7B 1KDQB 4NA9H 2F9UA 3SGQE 2W5EA 2ESTE 1BDAA 1FY4A 5FPYA 2DE8A 4M9FA 2HRVA 1WQSA 1Z8IB 3A8AA 1V2JT 1F0TA 1SLVB 1SGFA 1CBWB 4JYUH 1A46H 4RKJB 5GIBA 3H7TA 4Y76A 3SV8A 3RXPA 2FMJA 3V13A 1ETRH 1HJAC 2V3MA 1BTHH 1H8HD 4E06H 3M3TA 2WV5A 4YXWD 1CO7E 1TQ7B 4DW2U 5DPAA 2VGCC 1GMCF 4WH8A 1YKTA 3A8BA 3SJ9A 2HNTF 1A61H 2GT7A 5DG6A 3GY5A 2BD2A 1P12E 1A3EH 3LGIA 1SGDE 2QXJA 1ZGVA 2F4LA 3UNRA 3KCGH 5FHTA 1W13U 1GDNA 1DX5M 3U8OH 1DUEA 1G3BA 1NN6A 3F2HA 1GCTC 5PTPA 1FY5A 2BZ6H 4GHQA 1UVTH 1BTZA 2CJIA 4WJG2 1V6DA 2GKVE 3E16B 3E3TA 5GCHF 1P2OA 1XMNB 1HJAB 4ISIH 2ZCHP 3LOXA 2FP7B 2VGCB 1SHHB 2C8ZB 6LPRA 2VVUA 2Y5GA 2RCEA 3P8OA 1BOQA 1TGTA 3MNBA 1OOKB 1XVOA 2VIPA 1Z8JB 3NUMA 1IQEA 1BBRK 3BTHE 3V0XA 4Z1MD 1PPBH 1YF4A 1H9LB 3A7TA 3PLPA 2BVSH 3AW1A 1RTLA 5T6DA 2XOKD 2FESH 2VIDA 4X2VA 2XBWA 5C67A 2AGGX 1AD8H 1GCTB 5FAHA 1SFQB 4JZDH 4TWWA 1RTKA 1YC0A 5AHGH 1SGEE 2BD3A 3M3VA 5TJXA 4B6EA 1BHXF 3BN9A 3DCLA 4IMZA 2Y7XA 1AVXA 2FODA 1XKBC 1MTNC 2NWNA 3OY6U 4XDEA 4XBCA 1WXRA 2YMSD 1W7XH 1KSNA 2VVVA 3KIDU 3VGCC 1GG6C 1NO9H 3C27B 1YYY1 3GY3A 4YOIA 4ASUD 3RU4T 5KGOA 4X6NA 1EAIA 1ELTA 2ZNKH 1IQKA 1UCYE 4X1RU 3Q76A 2WZQA 5L6NH 3NPSA 2PUQH 4DOQA 3A87A 3SU2A 3O8CA 4WMFA 1NC6A 1ELEE 1V2MT 3EA9A 5LPFA 1TPPA 2GX4A 4UFDH 1W8BH 1C9TA 3UPEA 2LPRA 5JBCS 5EW2H 1YPJH 2JH6D 4X1QU 5AFZH 1K22H 2LP6A 1OPHB 3RXEA 3ESTA 4D7FA 1MTNB 2CMYA 2QIQA 3MO6A 4R0IA 3QGJA 3AW0A 1SLUB 3GICB 1QB1A 2PKAB 1ZHMA 3VGCB 1GG6B 2WYJA 3LT3A 4OM9A 1MBQA 2OQUA 2GMTC 4HZHA 3M35A 4HFPB 1AI8H 4BTTB 1TNIA 1FDPA 1QY6A 3MO3A 2ZPSA 1O2PA 2OTVA 1KXBA 8LPRA 3RC4A 2AIPA 1DLKB 4KTUA 3BEIB 2ZGCA 2FWWA 1TOCB 1C2KA 2ZFQH 3F3BA 2ULLA 1ZRBA 1HAZB 2CGAA 4Y7BA 1RIWC 2XC0A 1YPMH 2ZZUH 4I8LA 5HMAA 1OHHD 3NRLA 5J4QA 2J97A 1ZPZA 2BX4A 1O5AB 1NM6A 3VB7A 1O3FA 5DP5A 3IG6B 3PRBA 4WWYA 1C1VH 1P2JA 4BTUB 3CP7A 3KEEA 2ZHFH 2Y82A 2GMTB 3V3MA 1V2TT 4JZEH 1MBMA 1G37A 3ZVAA 1AE5A 2QXGA 1GMDF 1FZZA 5J4SA 1SL3A 1C1RA 1MKXK 4E7NA 3URDA 1W7GH 1YLNA 4CBNA 2DE9A 1DPOA 4I32A 5FBEA 4A1TA 4FU7A 1LTOA 2AMDA 3AAVA 1RIWB 1A0HB 1EFRD 3OYPA 4K8YA 1E38B 1TBQH 3DSPA 1VKYA 4TY6A 1F0RA 3A82A 2BDCA 3A86A 1G36A 1DT2A 1SB1H 2J92A 5EXMA 3ZZ3A 1O5EH 3L6PA 1HAVB 4H4FA 3A7XA 4U32A 5F8ZA 2ODPA 5SGAE 2FOCA 1OX1A 4UFEH 4O97A 1Q2WA 2BTCE 4MNWA 4ABIA 1SGTA 2GCHF 3EA8A 3DFJA 4FUEA 1CU1A 3PYHA 3RP2A 1BJUA 2D26C 4ACBA 1O3DA 4BAQB 1GBAA 1UTNA 3U9AH 1GI2A 4AG1A 1NY22 4B1TA 1P02A 1C5XB 2WPMS 1GCDA 3BTFE 2TIOA 1EJNA 2WHXA 4J1YA 2FPZA 2Z7FE 1RXPA 3BTDE 1C9PA 4D8NA 1P3EA 5FBIA 2F43B 3M5NA 4H42U 3MQKC 3MU4A 1AZ8A 4JZ1A 1P2QA 2V3HH 2RG3A 3E0NB 1FAKH 1A2CH 1TNKA 5HYOA 4X6MA 2J2UA 2CK3D 2M5TA 4NA7A 3V7TA 4MDSA 1KXCA 2FYRA 3HGNA 4Q7YA 1IQFA 1EB1H 1HAXB 2WPJS 4UDWH 1TGBA 1W14U 3N7DA 1NZQH 1GHXH 1OP8A 2AGEX 4OGYA 4Y6DA 3S9CA 1TNLA 1WSSH 1MZAA 3TK5A 3KL6A 5B6OA 3A80A 2A7HA 3RLWH 4JZIA 1C5OH 1B5GH 2BDBA 3CS0A 4CR9A 1CGIE 2P93A 1JBUH 4AB9A 1J17T 2EQNA 2NU3E 5DP6A 3BIVH 3TLOA 1H9HE 1L1NA 1XUGA 1AU8A 2J94A 1QIXB 3E6PH 2ZU1A 1EAUA 1ZMNA 1NRPH 4BAOB 1THRH 1C5LH 4AN7A 3NWUA 4MNYA 1ZHPA 1O37A 2FOGA 3EYDA 1F92A 2FX6A 1TGNA 4GLYA 1HUTH 1GMCG 1COWD 3Q00A 3BV9B 2KX4A 3TNTA 5FXLA 3ITIA 1CT4E 2ZCLP 4XFQA 2XBXA 2ANWA 5LPRA 1MTVA 4HG6A 2BVRH 4FUCA 7GCHF 1O34A 3SNCA 3ODDA 1SOZA 1UHBA 1SGIB 2ZU5A 2BQ6B 2PTCE 4AC9A 5L2YH 1GI4A 1MH0A 2V6NA 3T27A 1G32B 4CR5A 5JB9S 5EW1H 3DSOA 4NWLA 2XWBI 2A4OA 3ZZ8A 2BYAX 1K1IA 3UR9A 3SUEA 3MH7A 1QA7A 1MD8A 3UQOA 1Y5BT 5FL7D 2QXIA 4X1PU 1HFDA 1A5GH 1TX6A 3MNXA 3KN2A 5GCHG 3RMMH 4IGDA 5C5NA 2A1DB 2BOKA 3ZZDA 1E1QD 1TQ0B 1W12U 2RDEA 5F03A 1YLCA 2VIOA 3SBKA 3SNEA 3D65E 1LQEA 1SGPE 2CV3A 2PUXB 4X2XA 1T8OA 4I8HA 1L4DA 4A92A 3A8CA 3SV6A 1ZRKA 1HIAB 1OS8A 1Y59T 3ZIAD 4DGJA 1UVUH 4RT1A 3I78A 1SI5H 1GI1A 1O32A 4NA8A 1A1RA 1MKWK 1HCGA 1O2JA 1O0DH 3AASA 4DVAU 1GBCA 4ASHA 4ZMAH 1J9CH 5T3HA 5EJLA 1D3TB 5HM9A 1NESE 3RXJA 1N8OC 1GHBF 1WCZA 1NFWA 1BRCE 3RXUA 2OBOA 2PHBA 3MU1A 1CHOF 4MPUA 1O2XA 3O8DA 1IHTH 4BAMB 2J95A 2THFB 2XTTB 1GDUA 3SGAE 4FUFA 5I46H 2C90B 4ABGA 5KEDA 1YCPK 4D9RA 4AZ2B 4OS4A 3M5MA 5IYTA 5EIYA 3PMHB 3STJA 1LVOA 1INCA 1C2LA 1GI3A 3ZZ4A 3AK5A 2QF3A 3MNCA 1GJBB 1C2GA 1ELAA 5DSFA 1WTHD 1T7CA 2QF0A 3PLKA 4ISHH 5DGJA 3UIRA 2QXHA 2J98B 1EJMA 3NXPA 3ZVGA 1O5DH 5T1VA 2H9TH 6CHAB 1GBHA 2Y81A 4RT0A 5H4IB 3D62A 1THPB 1N8OB 4Q80A 4SGBE 3FP6E 4CH8B 2ODQA 3QX5H 3PWBA 1FY8E 1ZSJA 3PMAB 4BXWA 4Y8XA 3RU4E 1O3PB 1S6HA 1O3BA 1O2ZA 2OC0A 1WV7H 2IJOB 2VWLA 1BRAA 2STAE 1DM4B 1QJ7B 3GDSA 1K1PA 4R8TB 3A85A 2G5NA 3HATH 3TJUA 4A1VA 1JWTA 2BDGA 3RXGA 1SHYA 2A31A 1O39A 2P16A 2BOHB 4MG3A 3ZVEA 2Z9JA 5A0AE 2P3FH 1Y8TA 1PPCE 4MPVA 3B8JA 4K60A 1F2SE 2V7QD 4DG4A 1NBMD 2ZCKP 4ISLA 5FX5A 2R3YA 1QHRB 2ZDAH 1O2IA 5GWZA 3UR6A 3RXTA 4Q63A 1DLEA 4BAKB 2NU0E 3ATKA 3DT0H 1BMFD 2HVXA 1DSUA 1GI7B 1P04A 2H5CA 4A5TS 1LPGB 1F5KU 1EATA 4ABFA 4U30A 2PFEA 4K8BA 2SGPE 3NKKA 1GMDG 4UONA 1LHFH 3K6ZA 1O3EA 1HNEE 2KAIB 1GHZA 5C1UA 1OWIA 1QRWA 2BX3A 2V3OH 1YY3A 2JH0D 4ABDA 4ZUHA 1L4ZA 3W95A 1SGFG 1V2LT 3MNSA 3SYJA 3QTVH 1O2HA 1ELVA 1C2HA 3KQEA 3HK6B 4TWYA 4I8KA 3UFAA 3R3GB 5ESBA 1LHGH 1YP9A 3RXCA 3PRDA 3PO1C 4NIXA 3ZZBA 1PQ8A 1SQAA 2TGPZ 3EE0B 3F6UH 1ELFA 2PW8H 3DFLA 1KLJH 1ARCA 3UNSA 4KP0A 3MYWA 1C4U2 1P10A 2GCHG 5C1YA 3E90B 1B7XB 2WPLS 4Q4LA 2FZZA 1QZ8A 3U28C 2F9VA 1P8VC 1PPFE 2KZ4A 4RSPA 1O2TA 3I29A 3FFGA 1S6LA 2FOFA 2RA0A 2G52A 1ZTJA 3GS9A 3P17H 1V2NT 3SJOA 2G8TA 4O9VA 2EY4C 2D8WA 1PYTC 4LXBH 1QRXA 1O3KA 3LDXH 2FEQH 2OP9A 3PO1B 5JYIA 2FOMB 3OEED 1TIOA 1F5RA 3FZZA 3OU0A 1DVAH 2XWAA 5GDSH 1G2MA 3SU5A 3VB4A 4DT4A 2AEIH 1ELDE 1ABIH 2ZFRH 3SOSA 4J2YB 1IQMA 3P8NA 4UFGH 5HIYA 1Y3WA 1D3DB 1AGJA 3SHAH 4CREA 1O3MA 1BBRH 1A0JA 3DHKH 4NG9H 8KME2 1WU1A 1KXEA 1ZOMA 1G30B 1F5LA 2ZDVH 3HKIB 1Q3XA 4XBBA 1O2RA 3MWIU 2BQWB 1AE8H 1S83A 2EC9H 2PLXA 1O3IA 1YPLH 2TPIZ 2V35A 3ATMA 2BMGB 1ZGIA 1IAUA 1TGCA 1SC8U 5A2MH 2JETC 5A8XA 1T32A 2ANKH 1N6XA 5JDUB 5JBAS 1SLWB 5F53A 1W3CA 2R3UA 3ZV8A 2VBCA 3F9GA 1ELBA 3NK8A 2OXSA 1A3BH 1D9IA 4YT7H 3T5FH 2AERH 1GL0E 3O8RA 1HAYB 5C17A 7GCHG 3RM0H 4AFSA 1O2OA 1YLDA 2FTLE 3TJOA 2ZA5A 3A7WA 2TRMA 2XNIA 1C5ZB 3B23B 3LGVA 5EQQA 1JRTA 4MQAA 3TU7H 3RXQA 1NFYA 2CF8H 2ZFTA 4K5ZA 4NCYA 3RMNH 1IQLA 2HALA 1ANBA 2FI3E 2H2ZA 2F91A 1GI5A 1K1OA 1ZPCA 1FX0B 1H1BA 2JETB 1JRSA 2BDAA 1AUJA 3BTWE 2G81E 3ENSB 1S5SA 2PKSC 4YT6H 1GBTA 1OWKA 4INHA 1O5BB 3QLPH 3DSGA 2FI5E 2BM2A 3A8DA 1H8DH 1QJ1B 4LZ4B 2F9BH 2A2QH 1TLDA 4GVUA 1UK4A 3ZVCA 2B9LA 1RTFB 2XC4A 1YPHC 1TNGA 4ISNA 2FX4A 4X8UH 1EPTA 1Z8GA 3GCTF 2ZDNA 5C20A 1ID5H 1C2FA 1BCUH 1EOLA 1AFQC 2A4QA 3P70B 3S69A 3MFJA 5DJ7A 2CF9H 3UWIA 1DWDH 1WDIA 1GHBG 2TBSA 2GZ7A 2PWXA 3RXBA 2D1JA 1CHOG 2P59A 2GDDA 7LPRA 1C5NH 2H1UA 2PKSB 3CS7A 3RXKA 1IQHA 1C2IA 3GDVA 3MOCA 2RDLA 3SUFA 1GWAA 3HGPA 2HNTC 3RXMA 3AVZA 1MQ5A 5DP8A 2AIQA 6GCHF 1O2LA 1LVBA 3SQHE 3T25A 3LONA 3SU3A 1MD7A 4JYTA 1BZXE 4DIIH 3M37A 2C8YB 1AFQB 2QF5A 2J34A 1C5YB 2SGQE 1SBWA 4AB8A 4NFFA 1GL1A 1GVLA 1ANDA 4IN2A 1MKXH 3VXEH 4JMYA 5CDFE 1ZLRA 4MTBA 1OP0A 2BD7A 4JK6A 3K65B 4YLQH 4BAHB 1GI0A 1DUAA 2GD4B 4I8JA 4ISOA 4YTAA 2BQ7B 1O30A 3TJVA 1K1JA 3SU6A 4AFQA 5EJ1A 1Y3XA 2VU8E 4JZFH 4X8TH 3D49H 1O3OA 2A4RA 1ESTA 1IQJA 1DICA 1FY1A 1AN1E 1YPHE 2GV7A 1NRNH 2Z3CA
chains in the Genus database with same CATH topology
2UUKB 4F49A 3VXFH 2A5AA 1E35B 3AAUA 5ESTE 3RM2H 1VITF 1VZQH 3PMJA 2SGFE 4OS1A 1ESBA 1ZMJA 4NIVA 1TA6A 1H4WA 4KELA 4NSVA 3JZ2B 1PQ5A 3T62A 4E05H 1V2OT 5DP9A 1D3QB 2R9PA 4MPWA 1ZTKA 4Y8YA 1V2QT 3U1JB 1QNJA 2O8UA 3SUDA 1XUJA 1QL8A 1LDTT 1O3NA 1V2VT 1XVMA 2BD8A 1MUEB 5EGMA 2HPPH 1UCYK 1D3PB 4B71A 4YOJA 1F0UA 5BPEA 2B0FA 4DURA 5JBBS 1FAXA 1TYNA 3RUOA 4FUBA 3SNDA 1LQDB 3I77A 1L0ZA 4MPXA 1OP2A 2G5VA 4ZAEA 1T8LA 1TONA 4Y0YE 4X6PA 3UUZA 1RD3B 2XBVA 1JIRA 4K1EA 3LC3A 3P8FA 3M61U 1C2DA 2QY0B 3GCNA 1BUIA 1SFIA 1GVZA 1KDQA 1SQTA 3LH1A 3S9AA 4IC5A 1V2ST 1PPZA 1T8MA 2UUYA 1JMOH 4FUGA 1DS2E 2FLRH 4AORA 2OBQA 1QA0A 2DUCA 1DXPA 3JZ1B 3BEFB 4OS6A 1V2WT 1WBGB 2HPQH 4IN1A 1EP6A 4BXSA 2UWOA 3LGTA 4UFFH 3PMBB 2W3IA 2SGEE 1DANH 1O33A 2F3CE 3QGNB 1AWHB 2R0LA 1SSXA 2NU4E 1H9IE 1HRTH 1P2MA 3TJNA 1VJAU 4FU8A 4AFZA 1MCVA 3WY8A 4Q7XA 2CXVA 2K1QA 3H7OA 1QB6A 4CHAC 1YPEH 1Z6JH 1Y5UT 4MNXA 1NU7B 1TE0A 4LZ1H 2Z6BD 4D76A 2G4UA 3QZQA 1C2EA 3MH4A 4ZHAA 1F7ZA 1GHAF 1Z7KA 1C5UA 3M7TA 2G55A 2HGTH 2ZQ1A 4D7GA 1FNIA 4U2WA 3UNQA 2GV6A 3GY7A 5DP7A 2P3TB 2ZU3A 3SO3A 3TGJE 4WXIA 1PFXC 3TITA 2YOLA 3RDZA 2FTMA 1C2MA 1O3HA 4KKDA 2Y80A 4Y8ZA 4IS5A 3K2UA 1ANEA 5A09A 1Z8RA 3QN7A 3ZYDA 2R0KA 3H5CB 1IHSH 2Y5HA 4CHAB 3LC5A 3P92A 1MKWH 1VR1H 1IQIA 3BSQA 2ZDMA 1YCPM 3QTOH 3K9XB 2UUFB 1P2NA 4UD9H 4OGXA 2VB0A 2W7SA 3BG4C 3KGPA 1Y5AT 1O2QA 1P03A 2O8LA 1UVOA 2P3UB 2BD4A 1AB9C 1GBFA 1MCTA 2FO9A 4X2WA 5JBTA 2ZTZA 1FIZA 4K1SA 1ESAA 1TWXB 3OSYA 1YCPH 1GBEA 1TB6H 5HGGA 1O2GH 3KF2A 1AY6H 4WMDA 2OC7A 2ZGXH 1HBTH 3QZRA 1QL9A 1HPGA 3KQBA 4INLA 3RXVA 1GJ8B 1O3LA 4YOGA 2ZG0H 1ELGA 1HLTH 1DY9A 1YPKH 4TYDA 1ELCA 5ETXA 1GMHF 1UTMA 3BTKE 1DY8A 2Q6DA 2ZWLH 1BRUP 1KY9A 2PGQB 2ALVA 1M9UA 1HAOH 3EQ0H 3BG4B 4FUJA 1VITH 1P3CA 1AB9B 3UTUH 1UVPA 1O3JA 2UWPA 4X0WU 2BY8X 4VGCC 1JIMA 6CHAC 3SN8A 1NROH 3MMGA 1AVGH 3SGBE 1ZJKA 5E0GA 2ZQ2A 1GBMA 4NFEA 1HDTH 1GJ7B 2PKAA 5EXLA 1NFXA 1B0FA 1OWDA 1GHYH 4A6LA 2ZIQH 1LHEH 1LHCH 1C5WB 8GCHF 1DFPA 3T28A 5TCAA 9ESTA 4MLFB 2BDHA 1HAIH 2C8WB 3ZZAA 3A7YA 5L2ZH 4LK4A 3U98H 4NGAH 4THNH 2FS9A 4FVDA 2FXRA 1CGJE 1QJ6B 2ZPRA 1GJDB 1D6RA 1EAXA 1O2UA 1TX7A 3RXAA 2J38A 1E0FD 2ZU4A 4SGAE 1UTJA 3LPRA 4JK5A 4VGCB 2FS8A 1G3EA 2BZAA 2EI7A 1LVMA 1CA8B 3RU4D 1EAWA 3LGUA 4BNRA 1THSH 2ZEBA 1K1MA 1Z6EA 6GCHG 5E0HA 1C5MD 2FOAA 3VFEA 4ESTE 1TFXA 3GISB 2ZHWH 4JCNA 1MTSA 3ZVFA 2A7CA 2GZ9A 3S0NA 3V12A 3P6ZB 2ZPQA 1FV9A 1L1GA 5L30H 2AFQB 5GJ4B 1P01A 1SG8B 3RXIA 5AVDA 2FYQA 3RXFA 3VEQB 3SUGA 4B75A 3ODFA 4X1SU 4ABJA 1V2KT 2Z9IA 4ZROA 1K1LA 5T6GA 5JB8S 2WPIS 3ZZCA 3MTYA 5FCRA 3ZVDA 5AFYH 2C93B 5GXPA 1BMAA 4CRAA 1ZZZA 1ZJDA 2QV1A 1HAVA 1VITG 1OYQA 1FUJA 3B9FH 1GJ9B 4Y79A 1ZHRA 1GVKB 1SVPA 1K21H 1GJCB 1FY3A 5CMXH 1GI8B 2QA9E 2WYGA 2P95A 2ZGHA 3MU8A 3UREA 1BTXA 1LKBA 4B73A 4GCHF 4CRGA 1MQ6A 2WUBA 4WXVA 1P9SA 1PPEE 1GHWH 1WUNH 1ZR0A 2C4FH 3FANA 4O3UA 4K69A 1SPJA 5FPTA 2WV4A 5K0HA 3LGWA 1QRZA 3VB3A 2GT8A 1UTQA 5E8EH 3RMLH 3LJOA 1C5VA 3RXHA 5HXFA 5C1XA 1O2VA 2IOTA 1XXDA 3CENA 4WVPE 1AUTC 2BD9A 1BMMH 2P8OC 1EJAA 2ZHQH 1VCQA 3BG8A 1EZQA 1OSSA 1P57B 1TPSA 2R2MB 4DT7B 3F9HA 4QT8C 3GYMA 1EB2A 1FQ3A 1Y3YA 1AHTH 1QB9A 1RJXB 4YO9A 1EX3A 1GI9B 1TMTH 2Z94A 8ESTE 3Q3YA 3M7UA 1N1LA 2PSYA 3KNXA 1D6WA 1QBVH 2BDYA 2GVFA 1TRMA 1HB0B 4X8VH 2VIWA 3K6YA 4A7IB 3GY2A 3S9BA 2NU2E 3RXLA 1A4WH 4MVNA 1MAYA 2ZF0H 4F4OC 1BTUA 4M7GA 1EASA 4Q2KA 2P8OB 1E37B 1Q31A 1JXPA 1KXFA 1C1UH 4TY7A 3U69H 3DD2H 1QBNA 1WYKA 1SMFE 2W3KA 1KXDA 2FLBH 1H8IH 1EP5A 3TNSA 4NZQA 3PWCA 4B2CA 3GYLB 3OY5U 1ZPBA 1Y3VA 2HWLB 1EZXC 3F9EA 3FZDA 3RMOH 1BBRE 4X2YA 9LPRA 1S81A 2YNBA 1GHVH 5DP4A 5F8TA 2YNAA 5BRRE 1FXYA 1UJ1A 1V3XA 2Q1JA 2PR3A 4Z0KA 2O8WA 1O38A 3MO9A 1GHAG 2TGDA 2ZC9H 2AMQA 4AGKA 2A0QB 1XUFA 4XBDA 4D9QA 4XSKU 1SR5C 1QQ4A 3SV2H 3W94A 1TNHA 1BMLA 2PGBB 4A1XA 3TIUA 4BANB 2ZKSA 1DDJA 2F9NA 2UUJB 1CGHA 3SU1A 2Z3EA 1XX9A 1HAPH 5DK1A 1F0SA 2EI6A 3L33A 2Q6GA 1EOJA 1HIAA 1G2LA 4X6OA 3PTNA 2B7DH 3UQVA 1NRSH 1KTTB 3PM3A 4BOHA 2O8TA 1C1QA 2OUAA 1YPGH 1O2YA 1A0LA 4B74A 1PYTD 2XCFA 1EZUC 4OS5A 1O2KA 2STBE 4H6TA 4WH6A 1HAHH 2HOBA 1LVYA 1ETSH 3M36A 3QK1A 5CHAC 1ANCA 5LGOA 1UK3A 4IW4E 5JPMH 3ZV9A 3ATLA 1UK2A 2QGRA 2AYWA 1XXFA 1W2KH 1C4Y2 3O8BA 2TGTA 2A7JA 1GBBA 3OTJE 2Y7ZA 1TX8A 1LO6A 3GDUA 4HI3A 1TRYA 1J15A 2BB4A 1TGSZ 2I6SA 2ZDLA 3C1KA 1GMHG 4BTIB 3RC6A 3E0PB 3MI4A 4CBOA 1UO6A 1NRQH 4AGJA 4UE7H 4AG2A 1LPKB 2ZGBH 1C1OA 3DA9B 1E36B 2A45B 3ZZ9A 3HK3B 2FOBA 1ZTLA 2BXUH 1KLIH 1O2NA 4FVBA 1IQNA 1WAYB 3TH2H 1CT0E 2XC5A 2QN5T 3MU5A 5CHAB 3S7KB 1AKSB 1UTPA 1C1PA 3IWMA 3LGYA 2XXLA 4Y0ZE 5K7RA 2F9PA 1ORFA 2VWNA 1J8AA 3D23A 4U01A 3TGKE 2J9NA 2FDAA 1FPHH 1TMUH 1A5IA 4ABAA 1UHBB 1FLEE 3U8TH 1C5PA 1J14A 1TBRH 4Y7AA 8GCHG 4X1NU 4HGCA 3SJIA 2JH5D 1V2UT 3ATWA 1BIOA 3SJKA 3UOPA 4I33A 1P2IA 1AMHA 2BLVA 1UTKA 3FP7E 3LIWA 5FX6A 1T8NA 3MU0A 1EZSC 2H6MA 3P8GA 1LPZB 1EXFA 1Z71A 3KHVA 2ZDKA 4ZHMU 1QFKH 5DP3A 3TH3H 1P9UA 3VB6A 1W10U 1C5QA 5EQSA 5E2PA 1Z1IA 2NU1E 5F6MA 3FP8E 5E0JA 3FVFB 1QTFA 3RC5A 3ZZ7A 2Z9GA 1UCYH 1SOTA 4ZHLU 4ZH8A 1QBOA 3R0FA 1SGRE 4WMEA 5A0CA 5LPEA 3LJJA 4B76A 2ZU2A 2GCTC 3SW2B 1JOUB 3HKJB 1EQ9A 1HJ8A 3TVJB 1LMWB 2CN0H 3PB1E 2GGVB 4K3JA 1QGFA 1WOFA 1BJVA 2QCYA 1OYTH 2KAIA 2PV9B 1GBJA 3GCHC 3M5OA 4ZKNU 1BTPA 3PV4A 2OD3B 1LKAA 1VGCC 2A4GA 1GJAB 4Q7ZA 2Z9KA 1UTOA 3TH4H 2F83A 5EPNA 1X7AC 3VB5A 1GGDC 4ZKSU 1GDQA 1VCWA 2ZHDA 2G4TA 3BF6H 2VINA 1T4VH 1KYNA 1K28D 4NSYA 2ZTXA 3RXDA 1AO5A 4B2BA 3E1XB 3LU9B 1W0ZU 2QYIA 2GCTB 1BA8B 1T31A 2A32A 5EPYA 1ETTH 3SJ8A 2BD5A 1XUIA 2HNTE 1P2KA 1KLTA 2XRCA 1GBIA 1OWJA 4KGAA 4GCHG 1RFNA 2H9HA 1S84A 1NTPA 2BY9X 3RLYH 1DITH 3GCHB 1KTSB 3RXRA 1C1MA 1W11U 2Z9LA 5FCKA 3STIA 3A84A 1VGCB 5F8XA 1FI8A 1UVSH 4YZUA 1P0SH 4Y10E 2BDIA 4K1TA 1BTWA 2WUCA 1XM1A 5T6FA 1GJ5H 4RKOB 4AOQA 1HAGE 3M7QA 1GGDB 1MU6B 1G3DA 4AYVB 4NZLA 2BLOA 1C1TA 4IC6A 1C5TA 4OS2A 3RXOA 2AH4X 2QAAA 3BTEE 2ZTYA 1L1JA 2Q6FA 5EG4A 2OCVB 1EKBB 4PROA 1BHXB 2VJ1A 2C8XB 3ZZ6A 3LH3A 2SNVA 4Z6AH 1O5CB 3KQCA 1NU9A 1NPMA 3P95A 4XOJA 4CRBA 2BLQA 1AFEH 2ASUB 2GZ8A 1WQVH 2O8MA 5CE1A 3QO6A 2FOEA 3EDXB 5C2ZA 2ANYA 4GPGA 4FU9A 4GAWA 1XUHA 1NFUA 4AFUA 2FI4E 1TAWA 2BY6X 1ABJH 1TBZH 3SNAA 1CA0C 1AVWA 2EEKA 1PPHE 2ILNA 1Y3UA 3A89A 3GY8A 4CRFA 1OWHA 5EQRA 1MTWA 5GPIB 4E7RG 2EA3A 4INKA 4AX9H 1C1WH 1BRBE 1CE5A 1BQYA 3Q3KA 1BTYA 1G9IE 3MH5A 1DWBH 3ZYEA 3E91A 2ZP0H 1ACBE 6ESTA 3TGIE 4ABHA 1O3CA 2CHAC 4ZKRU 2HLCA 1KIGH 1YGCH 1TPOA 2OC1A 2ZFPH 3M3SA 1O5GH 5E2OA 1FN6A 4RN6A 2OQ5A 4I8GA 3SI3H 3SI4H 2JKHA 4KTSA 1CQQA 2ODYB 2WINI 3HPTB 2ZHEH 1O2MA 4JYVH 3LKWA 2VVCA 2VH6A 2SGAA 1CA0B 3BTGE 3MH6A 2QC2A 3TK9A 1V2RT 1QL7A 3OX7U 1MU8B 1QCPA 3PROA 2O9QA 4CRDA 1QQUA 1Z1JA 2BY7X 2ZO3H 1O31A 1O2WA 5EXNA 2XYAA 3NCLA 2CHAB 3F68H 3SV7A 1NT1A 2G00A 4YESB 4X8SH 2ZFSA 1HGTH 1KXAA 4I7YH 3T2NA 3TPIZ 1SGYE 3KQDA 3BTME 3ZVBA 1C5RA 3FAOA 1AKSA 2AS9A 5LH8A 1LHDH 3BTTE 4NIWA 3URCA 3ATIA 2OLGA 4ABBA 5DKMA 2TGAA 2I6QA 1FJSA 3SV9A 3SQEE 3A83A 2WPKS 1S85A 1TA2A 4WF8A 1OKXA 3UY9A 4AYYB 3SORA 1SGQE 2J4IA 2V0BA 4ABEA 3PLBA 4DJZB 1MAXA 4IMQA 4UEHH 2VH0A 2SFAA 1P09A 3Q77A 2ANMH 2RA3A 1C5SA 3TK6A 1BITA 1CT2E 4FUDA 1K9OE 2ALPA 3EA7A 4NIYA 1FN8A 4FXGH 1PPGE 1CHGA 1TPAE 2VWOA 1NRRH 3GOVB 2ZFFH 2FM2A 4K2YA 1UMAH 3GCTG 3MHWU 2H9EH 1O3AA 3Q3XA 1O3GA 3BEUA 3PTBA 1AWFH 1BMNH 1C4V2 5EODA 7KMEH 1W0YH 4NWKA 1DXWA 1DE7H 4XE4A 4ZXXH 2AGIX 2BXTH 4FUHA 1MZDA 2W7UA 1O35A 5EOKA 1OXGA 4DIHH 2GP9B 2VIQA 1EPTC 1PQAA 1S82A 2XCNA 3UOUA 3T26A 1NS3A 1GPZA 2C3SA 2UWLA 2Y6TA 4O03A 1YM0A 2B8OH 1B0EA 2P94A 1C1NA 5C5OA 3SU4A 5HM2A 4CRCA 4WY3A 2SNWA 3BTQE 2BLWA 1ZMLA 1S6FA 5A8YA 1ARBA 1A5HA 2GDEH 4I31A 1BT7A 1HXEH 1S0RA 1DOJA 3SU0A 1VJ9U 2ZECA 3G01A 1XKAC 3ZZ5A 2OC8A 4MNVA 1GBLA 1RRKA 5IDKA 3N7OA 3QWCH 1O36A 5ABWA 2WPHS 4IBLH 2GTBA 4Y71A 1EPTB 1EUFA 1SLXB 2B5TB 4YLUA 1GJ6A 2VWMA 3GCOA 7ESTE 2A2XH 3F9FA 4GHTA 5FPSA 4O3TA 1AIXH 5I25A 1TRNA 1K1NA 1SGCA 1TABE 4YM9A 3UWJH 3BIUH 1DWEH 2FIRH 1D4PB 4H6SB 2IPHA