1OP2A

Crystal structure of aav-sp-ii, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Venom serine proteinase
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
total genus 53
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op2A02
3BTTE 2BMGB 1D9IA 1SR5C 1ANCA 3K9XB 5A0CA 1OWKA 1C2JA 2OQ5A 1TE0A 1DXWA 1YCPH 3GDUA 3M7UA 2A32A 4DCDA 3UNQA 1GWAA 4FUEA 1QB6A 2TPIZ 2ANYA 2A31A 2VWMA 2W7UA 3ZV8A 1MU6B 1NY22 1Z1IA 1NRRH 1OWHA 1TQ0B 1ZTLA 1MCTA 3IG6B 2SFAA 3S69A 4X6PA 4INHA 2Q1JA 1C1PA 1XM1A 2QA9E 1C2KA 2F9BH 3IWMA 3E1XB 4Y11E 1C5UA 4AZ2B 1IQHA 1TPSA 2G51A 1TX7A 3M5NA 4HTCH 2ZCKP 1K1IA 1C5VA 5CHAB 3ZV9A 1YPMH 5GCHG 1PQ5A 3A87A 2XXLA 1Z7KA 1DFPA 2YNBA 4ZKSU 3B23B 3DT0H 2GCTC 3SV2H 3UIRA 1OYTH 5L6NH 3FAOA 1TRYA 2PSYA 3UWJH 3UNSA 3GICB 1EZQA 2BD8A 3BTGE 4UFDH 4A7IB 2ZQ2A 1BRUP 4M7GA 5AHGH 3D49H 3MO3A 2XBXA 1UTKA 1GCTB 4H4FA 1J17T 1O3OA 1XUIA 5JB9S 1GI6A 1LDTT 2A7JA 2SNVA 3RXCA 1A1RA 4YT7H 4FVBA 1EXFA 2FEQH 2ZGXH 2BDIA 2FO9A 1TIOA 1HNEE 1HAYB 3TITA 3OY6U 5DPAA 2O8UA 2H5DA 1RTLA 2ZTXA 4A92A 1QA0A 1YP9A 1PPFE 3UPEA 1A2CH 2HOBA 1GJCB 3LDXH 4GSOA 4KKDA 1O2KA 2EEKA 2FOCA 3PV4A 2ZI2H 1G3CA 1GVZA 3RU4E 1EAIA 2AIPA 1FY8E 1BHXF 1MZDA 1H1BA 1NPMA 1AY6H 1C5PA 1ORFA 1Z71A 1C5RA 2UUKB 4YLQH 4NZQA 4AG2A 4TY7A 4I31A 1TOCB 1SSXA 3E0PB 1ELTA 1O2PA 2F9OA 4NSYA 1NFWA 1FUJA 1HIAB 1DITH 2TGAA 4BNRA 1AKSB 1GVLA 1ELEE 2BX4A 2FWWA 2O8WA 1OOKB 3FP6E 1TNIA 1UTMA 4A1TA 2P8OB 4FVDA 1AMHA 3A7XA 2ZDAH 1TWXB 2BQWB 1EAWA 2CF8H 3OTJE 1BJUA 2ZFTA 1GMHF 1IHSH 1K1LA 1EASA 4Y6DA 1P3CA 1UTOA 2TGTA 2QXHA 1QL9A 2D8WA 5EGMA 2FS9A 3V12A 3EDXB 2FXRA 1CHOG 2ZZUH 4X8VH 4E05H 1ELVA 3TU7H 2SNWA 5GDSH 1BMLA 2XC5A 3RXFA 2HPQH 3D62A 1W3CA 4X2WA 2BVRH 1EJAA 3SJ9A 3BTKE 1G32B 4D8NA 3SV7A 1BTPA 5BRRE 2A4GA 1INCA 5FPTA 1XUJA 2IOTA 1KLTA 1HIAA 3AASA 1AKSA 2ZU3A 4ISIH 4WH6A 1GHAF 5FXLA 2UUFB 3MTYA 1FY3A 4IS5A 3U8OH 1ELAA 1DDJA 1TMBH 1P11E 2PFEA 1GBFA 1SBWA 7ESTE 4TY6A 2BZAA 2H9TH 1FXYA 1FN8A 3M61U 5ESTE 3AAUA 4I8JA 3UR9A 1SLUB 3SU4A 5A0BA 5LPRA 1FIWA 2WUCA 3WY8A 4ABGA 2P94A 2PHBA 4UE7H 1ZR0A 3VB3A 3MH6A 1T8MA 4ZHLU 3M3SA 3E3TA 1F0UA 4NA9H 1E0FD 4LXBH 2PGBB 2ZDVH 1ETTH 2BD7A 1S84A 1KLIH 2Z9LA 2AH4X 1G2LA 1CSOE 2G52A 4AB9A 3M36A 2BD2A 9LPRA 2GCTB 3F9EA 2ZDNA 1P09A 1O3DA 3BTEE 3P17H 3P8GA 4Y0ZE 6GCHF 1XMNB 2XCNA 2SGPE 1UMAH 2VVVA 1QBOA 1TNGA 4NIXA 2GX4A 2ZCHP 3ODDA 1KY9A 3SOSA 4B1TA 1ZHRA 3CS0A 1ARCA 3ZZ6A 1IQFA 1IAUA 1E38B 2ZO3H 2NU2E 2H5CA 5ESBA 1OSSA 1GJ9B 1T8NA 4TYDA 1HCGA 1UCYH 1ZTJA 3TJUA 1T31A 3EYDA 1AUJA 4O9VA 1GL1A 2PWXA 1VJAU 1GMHG 2F9PA 2GT7A 3S7KB 2BY8X 2GZ7A 5FX6A 4ISOA 3GY7A 1X7AC 1MQ5A 1IHTH 1SLXB 1IQNA 2Z6BD 2GV7A 1HJ9A 1G3BA 2D2DA 1VITH 3T29A 1K21H 1LHFH 3A7ZA 1GBHA 3UFAA 5CE1A 1CA0C 1EB2A 1QGFA 4KTSA 1O3FA 4IBLH 4OS4A 3TIUA 1D3DB 4JZDH 4JZIA 2BY7X 1HAGE 2EI6A 3SJIA 2Q6FA 3VB7A 4K60A 2PR3A 4UFEH 1QY6A 3BTWE 3ZZ9A 1D6WA 5E2OA 3TK5A 1F0TA 4YT6H 1UJ1A 1NFUA 1L0ZA 1O3KA 2F9VA 2VH6A 3A8BA 5LH8A 5FX5A 3ZVAA 1GHAG 2SGQE 3M37A 1ESAA 2HNTC 2XNIA 3GYLB 1TMUH 2FI4E 3SQEE 4K8BA 4DURA 3RXKA 1NN6A 4IC6A 2VINA 2BY6X 3AVZA 3URDA 2ZEBA 5C67A 2VVUA 2A7HA 1P12E 1C5YB 2CJIA 3RXRA 3VB6A 1ZJKA 2WPMS 2J9NA 4AGJA 1EP6A 1O5AB 7LPRA 3SV8A 2DUCA 2Y5GA 2EI7A 1C5XB 4CH8B 3QUMP 4OS5A 4X1QU 2JH6D 2QC2A 3PTNA 2BQ6B 2P93A 5CMXH 3SU5A 4ABHA 5FBIA 1WCZA 3C1KA 5FBEA 1SGIB 3UOUA 4Y71A 3QLPH 2VWNA 6GCHG 5DJ7A 1PYTC 5DK1A 6LPRA 2FYQA 1BBRE 1KXDA 3RXDA 2BDGA 1C5SA 1DY8A 1HAZB 4J1YA 3SQHE 3SNCA 2PSXA 1C5WB 5JBTA 4CRAA 1MKWK 5K0HA 3ZVBA 2PGQB 1DM4B 1TRMA 1DPOA 1J14A 1ZJDA 1QJ6B 3TNTA 1PJPA 3A7TA 5FCRA 1NU7B 1BIOA 5C1UA 3UUZA 5A2MH 5TCCA 1C5NH 2ALPA 3PTBA 5E8EH 1TGBA 1WYKA 1EP5A 4B2CA 1PPEE 4ZMAH 2TGDA 5JBCS 2Z9JA 1ZZZA 2ZFFH 3BTME 1TX6A 1S83A 7GCHF 1O2JA 1GI8B 5EXLA 4F4OC 3S9AA 2B9LA 1L4DA 2ZGHA 1FLEE 2VIOA 4AN7A 1O3GA 1G37A 4ABEA 4R0IA 4MPXA 2QYIA 2QAAA 1UHBB 2R0KA 3MHWU 1NRSH 3RP2A 1Q2WA 1QR3E 5K7RA 1C1QA 1DWEH 4FU7A 1LVMA 4Q80A 1Y3UA 1JXPA 5EOKA 2F9NA 2GMTC 3STIA 1QB9A 2H9HA 1ZGVA 3KHVA 4BAHB 4IW4E 2ZFRH 2OQUA 4NA7A 5J4QA 5DP6A 4RSPA 1P2QA 1O3AA 1PFXC 5L30H 4UDWH 4FUHA 3GY8A 3UQVA 1FAKH 3ZYEA 2A5IA 4NIWA 1V2ST 3RXLA 1HAIH 2BLVA 2WPJS 2Y7XA 1FI8A 3I78A 4DJZB 1C5MD 1NU9A 3K65B 3NUMA 1EZSC 1MTSA 2AMPA 3SI4H 1C5LH 1O3NA 5LPFA 1MKXH 4NGAH 3ZZ5A 3HATH 1FPHH 4ABJA 2A7CA 2TGPZ 1SB1H 1LHCH 1TNHA 3SUDA 1QIXB 2IPHA 4JYTA 1U6QA 5F03A 4E7NA 3W94A 1O2QA 4AYVB 1ELDE 2Y6TA 4ZKRU 1D4PB 3KQBA 4FUJA 3MNCA 1RFNA 2QIQA 1LKBA 1UHBA 1FJSA 3ZZDA 3UWIA 1OP2A 1SGEE 1C1TA 1HBTH 1HUTH 4U30A 2JETC 3RUOA 3ZZBA 2GCHG 2R0LA 3LT3A 2Z3CA 1FDPA 3RMNH 4AFQA 3O8RA 1J8AA 1CGIE 2ZP0H 2ILNA 1CVWH 3A89A 4ZROA 1PPCE 1UK2A 2WUBA 3RMLH 1O35A 4NFEA 4QT8C 3ZVDA 1EAXA 1HFDA 2BYAX 1DE7H 1QQUA 2V0BA 4D76A 1W13U 3GDSA 3A7WA 1ESBA 4HI3A 1CQQA 4FUFA 3KQCA 3LGWA 1CE5A 2D1JA 2FX6A 2NU4E 3OX7U 1ETSH 5JB8S 3R0FA 5I25A 3TGKE 1OWDA 1L1JA 2O8LA 3U98H 1ZOMA 2AIQA 1C1SA 1C5QA 1LQEA 1HGTH 1IQMA 2FLBH 3D23A 2QGRA 4X2XA 1DLKB 1XUHA 2WV4A 5FCKA 4X8UH 1VJ9U 4XBBA 2AEIH 2Z9GA 1O2WA 1PPBH 1GHVH 4GUXA 3F9GA 3HGPA 1AZ8A 2V35A 2Q6DA 2J38A 3MWIU 3TGIE 2VIDA 1ELFA 1OWJA 3MU8A 5TCAA 1O30A 1YCPK 2W3IA 1SQOA 2GD4B 2C8YB 1C9TA 1TGTA 1C4U2 1XUFA 2GDDA 1DUAA 3SORA 3ZYDA 1XUKA 3FP8E 2WPHS 2XBWA 2CXVA 4JMYA 1P01A 2Z3EA 1H9LB 4INKA 2XBVA 1MAXA 1GG6C 1T7CA 2FI3E 1KSNA 2FOAA 4UFGH 1P05A 1NRPH 5FAHA 4OGYA 3MH7A 3OSYA 1KXCA 1FAXA 3TH2H 3L3TA 4Y8YA 2J34A 1KXEA 5FPYA 1NZQH 1THSH 2WPIS 1CT2E 3MFJA 3TH3H 1W8BH 4YTAA 1J15A 3SJ8A 1P2MA 4ESTE 3VB5A 3MO6A 3UREA 2FODA 2BD5A 2J94A 1P10A 4NFFA 3UOPA 2ANMH 1H9HE 5F8ZA 3SV9A 3ZZAA 4NIVA 3H7TA 4WWYA 1QA7A 1OWEA 1BRBE 1D3PB 2TBSA 1SGNE 4ZKNU 1VCQA 2GMTB 4ISLA 4Y7AA 5E0HA 1YPEH 2ZHWH 3RDZA 4ZHMU 3VGCC 4JYUH 1UVTH 3GY5A 1Y3WA 3S7HB 4KELA 3V0XA 4DIHH 2G81E 5F6MA 1YCPM 1CHGA 1SLWB 3RC5A 1SQTA 1BTWA 2O8MA 3RXMA 2ZHQH 2HGTH 1YPLH 3MNBA 3LONA 4MLFB 1HRTH 4X1RU 1KXAA 2R2MB 4GHTA 1YPKH 3S9BA 3MU0A 1CHOF 2R3UA 2AMQA 2H2ZA 2ZKSA 3QK1A 1OWIA 3BIUH 3E16B 3BG4B 8KME2 1V2UT 3A80A 3NK8A 1GHWH 5DP4A 1QBNA 1NS3A 5AF9H 1TA6A 1C1UH 3BTHE 1NRQH 1Z8IB 2BD9A 4K5ZA 1C2FA 1GHBF 1CA8B 3PLBA 1TNJA 1GHZA 1BBRK 3PWBA 2BQ7B 1KTTB 1MZAA 1S0RA 2QXGA 5EPNA 1GMDF 5ABWA 1K28D 5EXNA 1YBWA 2JETB 5EW2H 4D9QA 3RC6A 2OC7A 2ZGBH 1H9IE 1G3DA 3LU9B 3A88A 5DP3A 1WQVH 2Y82A 1WSSH 2P59A 3E6PH 4UONA 3KN2A 4O97A 4JCNA 2EC9H 2QV1A 2ODPA 1MUEB 3T5FH 1P2KA 1GJBB 1SFIA 2HNTE 1WUNH 2GV6A 3GCNA 1HLTH 2BXTH 3QO6A 2FX4A 2ASUB 1T4UH 4HFPB 1O2HA 2ALVA 1TABE 1GDQA 1BRAA 5GJ4B 8GCHF 2FOEA 1AE5A 2XYAA 1BQYA 4WY3A 1C2MA 2PW8H 1BRCE 4XBCA 1SHHB 1O3CA 4UD9H 1K1OA 3QZQA 4JK5A 2DE8A 1ANEA 1RJXB 1DX5M 4BAQB 1BUIA 2ZIQH 4MNVA 1DY9A 1GMCF 2ZHEH 2OLGA 6CHAC 1Y3YA 3MO9A 1GBKA 2VB0A 2F83A 3PROA 3EA7A 1TGNA 2ODYB 1EOLA 1C2IA 1YF4A 1MMJN 4FU8A 4FUBA 3U8RH 2SGFE 1SGCA 3T2NA 1LMWB 2BY9X 3BEFB 2B7DH 2OINA 1BMAA 2Z9KA 4ABFA 1V2RT 1B0FA 2IJOB 4O03A 1O3LA 1MQ6A 4MQAA 1SFQB 5A8XA 1V2TT 1GG6B 1FPCH 2B0FA 1RIWC 1T32A 1FZZA 4Y76A 5EQQA 1WTGH 3EA9A 8ESTE 2A2QH 1SGQE 3N7OA 1EOJA 1O2TA 4ISHH 3O8DA 2XW9A 2W7SA 3T25A 4I32A 1NC6A 6ESTA 1OP8A 1W10U 1GHBG 5FPSA 2BOHB 1BMMH 4DIIH 4CRFA 1K1NA 4KTCA 1NM6A 3BN9A 4TWWA 3UQOA 1GMDG 1F5KU 1JWTA 3PMAB 4ISNA 1FV9A 2HWLB 1V2KT 2G00A 3EQ0H 1GBLA 3SGAE 2OC8A 1XKAC 4LZ1H 4WF8A 3DA9B 4B73A 1A3EH 1MBQA 2FYRA 1O2UA 1ZSKA 4IMQA 4FUDA 2HNTF 4OS6A 3ZZ8A 3S0NA 1Q31A 1HDTH 1SPJA 4GLYA 1UTQA 2VIQA 3VGCB 4Y79A 1TPAE 2QY0B 2TIOA 4NA8A 1H4WA 1W7XH 4O3UA 2CGAA 3RXUA 3OY5U 2BVSH 2VWOA 3Q76A 2K1QA 2SGEE 2FIRH 8GCHG 1AVWA 1MTUA 1Y8TA 2F3CE 1UTJA 5EODA 2ZU1A 1O2NA 5E0JA 4KP0A 1MCVA 4MNYA 5G4BA 4A1VA 1DWDH 1EPTC 1QFKH 5IYTA 1JBUH 1YLCA 1PPZA 1GJ4H 4OS2A 4Q2KA 3TVJB 4WMEA 1F0RA 1FY1A 1AVXA 3SJKA 4IN1A 3GCHC 1ZLRA 1T8OA 1UVPA 1O3MA 3LGYA 2UUYA 2P95A 4TWYA 2GGVB 1ZSLA 1O33A 1GMCG 1LO6A 4BXWA 3VB4A 1EATA 4B71A 1GBJA 3UTUH 3EA8A 3STJA 2BDCA 3SO3A 1AB9C 5AVDA 4X0WU 3JZ1B 4BAOB 2H6MA 3RXHA 4XFQA 3ZZ3A 4AB8A 4DGJA 1HJ8A 4I7YH 1RTKA 3RXEA 5I46H 3DHKH 4NCYA 1O2YA 3P70B 1WAYB 3AW0A 2OBOA 2ZPQA 1O3IA 5LPEA 1CT0E 1AN1E 1SG8B 3BG8A 1ZMLA 2J95A 1ZSJA 2FLRH 1S0QA 5EQSA 8LPRA 1A46H 1OP0A 1GJ7B 1AHTH 1PPGE 2D26C 5DG6A 2A4QA 3DUXH 1ZYOA 2C4FH 3B9FH 1RRKA 1O31A 1HYLA 1LPZB 1HAXB 3M7QA 1MBMA 4X6NA 3Q00A 1GL0E 3FANA 2W26A 1TNLA 3KIDU 4TPYA 1GBBA 4AG1A 1LQDB 1ZPCA 1K1JA 4INLA 1B7XB 4HGCA 3M5MA 1MTWA 3Q3YA 1N1LA 1RS0A 2ZU2A 1UVOA 1EAUA 3RXOA 1KDQB 6CHAB 1AFQC 1V2QT 1O5DH 5HM9A 5L2YH 3BEUA 3K6YA 3A8AA 3RM2H 2ZU5A 2QN5T 2ANKH 4Z0KA 5DP9A 3NWUA 2PUQH 2FESH 1O3JA 3B8JA 1HB0B 2G5VA 1ABIH 1FY5A 1AVGH 1ZMNA 2BDBA 4I8LA 3PWCA 1EJMA 1DVAH 1VGCC 4ASHA 1RIWB 2A4OA 1J9CH 3T62A 1WBGB 4BTUB 3M35A 1ELGA 2R2WU 4KTUA 2BLWA 1F5RA 3G01A 2GCHF 4J2YB 2AS9A 5JDUB 3RXQA 2BDHA 4WJG2 1C1NA 1SMFE 4XOJA 3RXSA 3KCGH 2RG3A 2OD3B 1CGHA 2OC1A 1V2OT 2BX3A 5JYIA 3E0NB 4AX9H 4X8TH 3MMGA 3RXAA 1Z6EA 2Z7FE 5GIBA 1C1MA 2C93B 2RDLA 1C2LA 3V3MA 1KDQA 2OUAA 3ATWA 5A8YA 3MI4A 1ZTKA 4RKJB 1SOTA 2B5TB 1GPZA 2ULLA 4CRCA 1F2SE 3SHCH 4TPIZ 4ZKOU 4I8KA 3GY4A 3GYMA 1OKXA 1P9SA 3NXPA 3SJOA 3HKJB 2XC4A 3SZNA 1MTVA 1SOZA 1AWHB 1AO5A 1V2PT 1V2WT 2FP7B 2ZGCA 1NRNH 3ODFA 1QB1A 3KEEA 3QGNB 1XVMA 4FXGH 3PO1C 4BTIB 5HGGA 2GZ8A 3URCA 1P2JA 1BHXB 2A1DB 3ENSB 1ZHPA 2G5NA 1GVKB 5C2ZA 3LGTA 3SUGA 7KMEH 3BEIB 1LKAA 2C3SA 3MU1A 1QQ4A 4NWKA 1N8OC 3LGVA 1EPTB 2Y81A 1MKWH 1MD7A 1QRZA 2ZFQH 4R8TB 4Q7YA 1A3BH 4FU9A 4IMZA 2PKSC 5H4IB 4A6LA 3GCHB 4WVPE 3FP7E 3HK6B 1FIZA 3NCLA 4X8SH 2FOHA 2ZGJA 2FPZA 4Y10E 1UK4A 1ARBA 4D7FA 1UTPA 1NO9H 1RGQA 1DLEA 5T3HA 3BTDE 2C90B 2LPRA 3RXBA 3AAVA 1KLJH 4Q7XA 1GBTA 1W14U 5ETXA 1AB9B 5HM2A 3KL6A 3QDZB 2WV5A 4YOIA 1LVYA 1S81A 1Y3VA 1ABJH 2R3YA 3ZZ4A 1MTNC 3RM0H 1T8LA 1GHXH 1CA0B 1YGCH 1YPJH 3U1IB 4H6SB 1F92A 4B75A 4ZXYH 1TMTH 3PMHB 3O8BA 1WOFA 1TX8A 4GCHF 3GDVA 2Y80A 2ZQ1A 4WXVA 3LC5A 2Z94A 3L33A 1JIRA 1GI9B 3SNDA 4OS1A 1P04A 2VNTA 4YM9A 1EPTA 1TOMH 2B8OH 1CO7E 1PYTD 2QF0A 1E37B 3SU2A 1BT7A 2HRVA 1LVBA 1O2VA 4Y7BA 3RXJA 2JH5D 1VR1H 1BITA 5DP8A 1BMNH 3SGBE 1O3BA 3SNEA 4A1XA 1O37A 1QNJA 4E06H 3LKWA 2OC0A 1GBEA 3U69H 1UCYE 3VEQB 2G55A 1NFYA 5A8ZA 2BDYA 3JZ2B 3M5LA 3V7TA 2VH0A 1Z8GA 1P0SH 1CT4E 3A7YA 1C1OA 3A86A 4MNWA 4AOQA 5L2ZH 3GY6A 1QL7A 3V13A 1O32A 1B0EA 1GI0A 3BTQE 4MDSA 1QURH 1P3EA 3MU5A 1GJ8B 1Y5UT 5E2PA 1O2GH 3LGIA 2BTCE 1TONA 1GJ5H 1K9OE 5E0GA 3Q77A 1KIGH 4AORA 2ZWLH 4Z6AH 2XWBI 1YPGH 4ZXXH 1O36A 1VGCB 4WXIA 1IQGA 5GXPA 1C4Y2 4X2VA 1BOQA 2BVXH 3PMBB 1PQ8A 1YPHC 4IGDA 1TFXA 4CHAC 1O3EA 1P2IA 2F9UA 2OTVA 1S6HA 2NU3E 3S9CA 4X1SU 1XVOA 1G9IE 1AIXH 4CH2B 4BOHA 1DT2A 3MH5A 3FVFB 1QL8A 3T26A 1PPHE 1A4WH 4U2WA 1LHGH 3NKKA 1Z8RA 3RXGA 3ATMA 1DWBH 1L4ZA 1EUFA 1GI3A 2ZHFH 3GY2A 1FQ3A 5PTPA 1QRXA 2FMJA 1MD8A 3DFLA 3SV6A 3KQEA 4AFSA 1GHYH 3T27A 2AMDA 1O2XA 4PROA 4GCHG 2XC0A 3TJNA 4KGAA 1Z8JB 1IQEA 3PO1B 3E90B 4X6MA 3ZZ7A 4DG4A 2VIWA 4FUGA 4MTBA 1OX1A 1EQ9A 2AGEX 1L1GA 1W7GH 1BTUA 4JZFH 2J92A 3TGJE 1A61H 3BSQA 1N8OB 1ID5H 4CR9A 1RTFB 3DFJA 4THNH 2Q6GA 4X1NU 9ESTA 3A85A 1G3EA 2PKSB 2ZC9H 3GY3A 3TLOA 1HXFH 3RXTA 2W5EA 1AE8H 2WYGA 5EW1H 1K22H 3RMMH 2NWNA 1C5OH 4CBNA 1C1RA 3A84A 3LOXA 2P3FH 3NPSA 5A0AE 1YM0A 5GWZA 1SL3A 4CRGA 1W0YH 3DD2H 1VITF 3R3GB 4H42U 3PB1E 2CF9H 1THPB 2VU8E 1AFEH 1SC8U 2ZFPH 1GBCA 4NSVA 2F91A 3PYHA 1MTNB 2BDAA 3C27B 3VXFH 1AD8H 3ELAH 5DP7A 4ABBA 1HAHH 2XRCA 1C2GA 5HYOA 1NESE 1DWCH 1NROH 1DXPA 1SGDE 1D3QB 1UO6A 3FZZA 2VIPA 5TJXA 5HXFA 1TPOA 3RLWH 3MH4A 1BTXA 1GI7B 4DY7B 4YO9A 3K2UA 1Y5BT 1E34B 3PLKA 3SU3A 3TH4H 4NG9H 1GI2A 1LPGB 1CBWC 1GI5A 2JKHA 2FTLE 4MNXA 2UWLA 1SVPA 4JZ1A 3P6ZB 4XE4A 1BJVA 1E36B 2BOKA 3AW1A 1D3TB 3EE0B 3F68H 3QX5H 2PLXA 4ZHAA 3NZIA 1TRNA 5SGAE 1EX3A 3M3TA 5F8XA 1H8IH 3GCTF 1NFXA 3LH3A 1TAWA 2PKAB 1O5FH 2TRMA 1P06A 2A0QB 2VWLA 4GVUA 1C2HA 2ZHDA 2RA0A 1LHEH 3TJOA 1IOEA 2ZFSA 4ABIA 2WYJA 1XX9A 1H8DH 3CS7A 1SLVB 1K1MA 1FONA 2R9PA 2J4IA 2V3OH 2H9EH 3VPKA 3RLYH 1W2KH 1A0JA 3EAJA 4HZHA 1BBRH 5JBBS 1GBMA 2ZA5A 1RD3B 1TBQH 1G30B 1XXDA 1BCUH 3F9HA 1EZXC 1JMOH 2P16A 3I29A 1A0HB 1WV7H 4K3JA 2J2UA 2OBQA 1C1VH 1ZPZA 1EB1H 3ATLA 4MPWA 4CHAB 1LTOA 3PMJA 4CREA 1PQ7A 2I6QA 1SI5H 2ZPRA 1S6FA 2UWOA 1C2DA 1WU1A 1VITG 2ZNKH 1AI8H 1C5ZB 1TBZH 1SGFA 2PKAA 3SUEA 4K2YA 1TGCA 5LGOA 1W0ZU 1GBIA 2ZDLA 4BTTB 4LK4A 3K6ZA 1LHDH 3UY9A 4I8GA 1MH0A 4AFZA 1HAPH 3A7VA 3U8TH 1AZZA 3E91A 4B2AA 1CGJE 3MU4A 4DT7B 3QWCH 3RXIA 3PM3A 1A5GH 1P57B 2EI8A 1DS2E 1O34A 2P3TB 5B6OA 1DICA 1KXFA 2FOFA 1PQAA 2WINI 5DO4H 1FMGA 3BF6H 1GGDC 3P8OA 3RXPA 2BD4A 1C4V2 4YZUA 1Y5AT 3RXVA 2VGCC 2A45B 1OXGA 2FOGA 2RA3A 2ZTZA 1XXFA 3LGUA 3IITA 3SN8A 2QXJA 1O2OA 2IN2A 3GCTG 1C2EA 4SGAE 2CHAC 3ZVGA 3SGQE 1ELBA 3GCOA 2PV9B 4IN2A 1HPGA 1LPKB 1UCYK 2BD3A 2M5TA 1HJAC 1KYNA 2BHGA 2VVCA 4E7RG 1GI4A 3KQDA 1LCYA 3P92A 4LOYH 1O0DH 1OS8A 1O3HA 1QRWA 1DSTA 1B5GH 4U32A 1AQ7A 2O8TA 2ZU4A 1ZRKA 1Y59T 2FTMA 1EZUC 4VGCC 2Y7ZA 4MPVA 3QGJA 1V2MT 1V2NT 4ZUHA 1GDNA 3RU4T 1A0LA 2OCVB 5C1YA 2AGGX 2G4UA 2SGDE 3OU0A 1IQIA 1E35B 1CBWB 2Z9IA 1TBRH 2NU1E 2HPPH 2ZTYA 1ZPBA 2XWAA 3TK6A 1UVUH 1V2VT 1KTSB 2I6SA 1D6RA 1SHYA 2KAIB 1G2MA 4Y0YE 2STBE 1TLDA 2PTCE 1P9UA 4O3TA 5JPMH 1L2EA 1O5GH 3GOVB 4JK6A 4GPGA 2HALA 1JIMA 3UNRA 4B74A 2C8WB 1UVSH 2V6NA 3MNSA 3QZRA 4NZLA 3BIVH 1O2IA 1UK3A 4BXSA 1BTZA 1BZXE 3T28A 1P2OA 4AFUA 1ELCA 1C1WH 1TQ7B 1BTHH 1O2RA 2G8TA 3F1SB 4SGBE 4LZ4B 3GISB 2AYWA 1S85A 4GHQA 4F49A 4XDEA 1EKBB 1O5EH 1UTNA 2QXIA 5T6DA 1T4VH 3H5CB 4U01A 1ZMJA 2LNCA 1F7ZA 2ANWA 4MG3A 1N6XA 1JOUB 4X2YA 2C8XB 1DANH 1YLDA 1WQSA 2VJ1A 4X6OA 3EGKH 4A5TS 1SGTA 4Q7ZA 5C1XA 1QCPA 1V6DA 1BB0B 2HVXA 1O2ZA 1MAYA 2STAE 3P8NA 2FDAA 1RXPA 1BDAA 3HGNA 1JRSA 1Z1JA 4B2BA 1BTYA 3PLPA 3TPIZ 1YPHE 2XBYA 3OYPA 3UR6A 2KAIA 1A7SA 1L1NA 3CENA 4YLUA 1FNIA 2FS8A 1W11U 5C5NA 1O5BB 1S82A 4UFFH 1O5CB 1AWFH 3SNAA 4WH8A 3F6UH 5EPYA 1Z6JH 2Y5HA 1AGJA 1LVOA 5IDKA 1VCWA 3LC3A 1P2NA 2W3KA 5C3NA 5GPIB 4H6TA 1C5TA 1WTHD 2BZ6H 2FZZA 3TJVA 4K1TA 5T6FA 2NU0E 3CP7A 4IC5A 1TYNA 1TA2A 2Z3DA 2FOBA 2CN0H 1K1PA 2OP9A 4BAKB 2ODQA 2A5KA 1V2LT 2FM2A 5FHTA 4NWLA 4D7GA 1TALA 1SGPE 1GGDB 3ZZCA 4I8HA 1FY4A 1K2I1 2DE9A 2QCYA 1SQAA 4AGKA 2QF3A 1QHRB 2BXUH 2VGCB 5F8TA 3SU1A 3A82A 4ABDA 4YOJA 3Q3XA 3ZVFA 4AYYB 2BM2A 2GTBA 2CHAB 1GBAA 4CRDA 4OGXA 4BAMB 2JH0D 4DW2U 1C9PA 3HPTB 1O39A 1G36A 5BPEA 2P3UB 1HAOH 2GZ9A 1HJAB 2BLOA 3I77A 1ESTA 1O2MA 2ZECA 3LIWA 1DOJA 3MNXA 4ZH8A 1O3PB 4I33A 5AFZH 2AERH 2UWPA 4DVAU 2A2XH 3QTVH 1TB6H 1MKXK 2ZG0H 3LPRA 1DSUA 1GBDA 1S5SA 4Y8ZA 1TNKA 3RC4A 1NTPA 2HLCA 4RKOB 5EQRA 3TK9A 2GT8A 4ZAEA 1EJNA 2AFQB 3LJJA 3P8FA 4K1SA 1J16A 4VGCB 3SNBA 2XTTB 5J4SA 2ZCLP 1OYQA 3M5OA 4RN6A 1F0SA 1QJ1B 4ABAA 4MVNA 3U9AH 1W12U 2A4RA 2EA3A 2ZDKA 3FZDA 2ZDMA 5CHAC 2A5AA 4JZEH 4GAWA 4CBOA 1GJDB 2H1UA 3SUFA 1YYY1 4MPUA 1HXEH 1GCDA 3E8LA 5DGJA 1VCPA 3RMOH 2C8ZB 3KNXA 3W95A 1ZRBA 3SW2B 2ZF0H 3RU4D 1YKTA 2GP9B 1QBVH 2PUXB 4XSKU 3ITIA 4DOQA 4WMFA 2WPLS 1GDUA 2THFB 2VIVA 2OXSA 2AGIX 1OPHB 1N6YA 2V3HH 3BG4C 1ZGIA 1A5HA 3A81A 1GCTC 1O2LA 2ESTE 3D65E 4FUIA 5EXMA 4OS7A 5HMAA 3O8CA 3ATKA 1P02A 5C20A 3HK3B 1F5LA 3ZVEA 1GI1A 2PTNA 1SGYE 1TGSZ 2GKVE 4YOGA 1ANDA 3LH1A 5A09A 4JYVH 3KGPA 3VXEH 2UUJB 1V3XA 5DKMA 4Y8XA 1GJ6A 1AFQB 1HV7A 4WMDA 1Y3XA 3HKIB 1ANBA 1SGFG 3SBKA 2CMYA 1HAVB 3U1JB 2BLQA 3ZVCA 1ETRH 4B76A 3TNSA 1XKBC 3SI3H 1VZQH 5GCHF 1QJ7B 3BV9B 4XBDA 4YESB 1CU1A 7GCHG 3LJOA 3KF2A 3SU6A 2YOLA 3M3VA 1P8VC 5T6GA 1A5IA 4BANB 1DUEA 2ZPSA 2CV3A 3VFEA 3ESTA 3BTFE 5EU8A 2BY5X 1IQJA 3A8DA 1UTLM 1MU8B 4CRBA 2SGAA 1NT1A 2GVFA 2BB4A 1KXBA 1O2SA 1QTFA 3Q3KA 1ZHMA 2FI5E 3MYWA 4X1PU 3A83A 3A8CA 3SU0A 1TPPA 5C5OA 2G4TA 4UEHH 2P8OC 5DP5A 1AU8A 5JBAS 1O38A 4K8YA 1GJAB 1IQLA 3P95A 1BA8B 1ACBE 3SHAH 1FN6A 3FFGA 4D9RA 5EG4A 3MOCA 1JRTA 1THRH 1IQKA 2FOMB 2Y5FA 1XUGA 1M9UA 5AFYH 1V2JT 1AUTC 3L6PA 1Q3XA 3ATIA 2O9QA 2WPKS 4NIYA 3H7OA 3QN7A 3QTOH 4K1EA 4CR5A 1HAVA 3M7TA 1SGRE 1P03A 4FUCA 3F9FA 1YC0A 4K69A 2RCEA 2XCFA 2GDEH 2YNAA
chains in the Genus database with same CATH superfamily
3BTTE 2BMGB 1D9IA 1SR5C 1ANCA 3K9XB 5A0CA 1OWKA 1C2JA 2OQ5A 1TE0A 1DXWA 1YCPH 3GDUA 3M7UA 2A32A 1SQRA 4DCDA 3UNQA 1GWAA 4FUEA 1QB6A 2TPIZ 2ANYA 2A31A 2VWMA 2W7UA 3ZV8A 1MU6B 1NY22 1Z1IA 1NRRH 1OWHA 1TQ0B 5EJZA 1ZTLA 1MCTA 3IG6B 5KECA 2SFAA 4OM9A 3S69A 4X6PA 4INHA 2Q1JA 3AK5A 1C1PA 1XM1A 2QA9E 1C2KA 2F9BH 3IWMA 3E1XB 4Y11E 1C5UA 4AZ2B 1IQHA 1TPSA 2G51A 1TX7A 3M5NA 3N7EA 4HTCH 2ZCKP 1K1IA 1C5VA 1VKYA 5CHAB 3ZV9A 1YPMH 5GCHG 1PQ5A 3A87A 2XXLA 1Z7KA 1DFPA 4B6FA 2YNBA 4ZKSU 3B23B 3DT0H 2GCTC 3SV2H 3UIRA 1OYTH 5L6NH 3FAOA 1TRYA 2PSYA 3UWJH 3UNSA 3GICB 1EZQA 2BD8A 3BTGE 4UFDH 4A7IB 2ZQ2A 1BRUP 4M7GA 5AHGH 3OEED 3D49H 3MO3A 2XBXA 1UTKA 1GCTB 4H4FA 1J17T 1O3OA 3DSOA 1XUIA 5JB9S 1GI6A 1LDTT 2A7JA 2SNVA 3RXCA 1A1RA 4YT7H 4FVBA 1EXFA 2FEQH 2ZGXH 2BDIA 2FO9A 1TIOA 1HNEE 1HAYB 3TITA 3OY6U 5DPAA 2O8UA 2H5DA 1RTLA 2ZTXA 4A92A 1QA0A 1YP9A 1PPFE 3UPEA 1A2CH 2HOBA 1GJCB 3LDXH 2J97A 4GSOA 1NBME 4KKDA 1O2KA 2EEKA 2FOCA 3PV4A 2ZI2H 1G3CA 1GVZA 3N7DA 1EAIA 3RU4E 2AIPA 1FY8E 1BHXF 1MZDA 1H1BA 1NPMA 1AY6H 1C5PA 1ORFA 1Z71A 1C5RA 2UUKB 4YLQH 4NZQA 3FKSD 4AG2A 4TY7A 4I31A 1TOCB 1SSXA 5HKKD 3E0PB 1ELTA 1O2PA 2F9OA 4NSYA 1NFWA 1FUJA 1HIAB 1DITH 2TGAA 4BNRA 1AKSB 1GVLA 2L74A 1ELEE 2BX4A 2FWWA 2L6OA 2O8WA 4HG6A 1OOKB 3FP6E 1TNIA 1UTMA 4A1TA 2P8OB 4FVDA 1AMHA 3A7XA 2ZDAH 1TWXB 2BQWB 1EAWA 2CF8H 3OTJE 1BJUA 2ZFTA 1GMHF 1IHSH 1K1LA 1EASA 4Y6DA 1P3CA 1UTOA 2TGTA 2QXHA 1QL9A 2D8WA 5EGMA 2FS9A 3V12A 3EDXB 2FXRA 1CHOG 2ZZUH 4X8VH 4E05H 1ELVA 3TU7H 2SNWA 5GDSH 1BMLA 2XC5A 3F0OA 2YMSD 3RXFA 5EJ1A 2HPQH 3D62A 1W3CA 4X2WA 2BVRH 1EJAA 3SJ9A 3BTKE 1G32B 4D8NA 3SV7A 1BTPA 5BRRE 2A4GA 2K8IA 1INCA 5FPTA 1XUJA 2IOTA 1KLTA 1HIAA 3AASA 1AKSA 2ZU3A 4ISIH 4WH6A 1GHAF 5FXLA 2UUFB 3MTYA 1FY3A 4IS5A 3U8OH 1ELAA 1DDJA 1TMBH 1P11E 2PFEA 1GBFA 1SBWA 7ESTE 5F53A 4TY6A 2BZAA 2H9TH 1FXYA 1FN8A 3M61U 5ESTE 3AAUA 4I8JA 3UR9A 1SLUB 3SU4A 5A0BA 5LPRA 1FIWA 2WUCA 3WY8A 4ABGA 2P94A 2PHBA 4UE7H 1ZR0A 3VB3A 3MH6A 1T8MA 4ZHLU 3M3SA 3E3TA 1F0UA 4NA9H 2IPQX 1E0FD 4LXBH 2PGBB 2ZDVH 1ETTH 2BD7A 1S84A 1KLIH 2Z9LA 2AH4X 1G2LA 1CSOE 2G52A 4AB9A 3M36A 2BD2A 9LPRA 2EQNA 2GCTB 3F9EA 2ZDNA 1P09A 1O3DA 3BTEE 3P17H 3P8GA 4Y0ZE 6GCHF 1XMNB 2XCNA 2SGPE 1UMAH 2VVVA 4DT4A 1QBOA 1TNGA 4NIXA 2GX4A 2ZCHP 3ODDA 1KY9A 3SOSA 4B1TA 1ZHRA 3CS0A 1ARCA 3ZZ6A 1IQFA 1IAUA 3PRDA 1E38B 2ZO3H 3H09A 2NU2E 2H5CA 5ESBA 1OSSA 1GJ9B 1T8NA 4TYDA 1HCGA 1UCYH 1ZTJA 3TJUA 1T31A 3EYDA 1AUJA 4O9VA 1GL1A 2PWXA 1VJAU 1GMHG 2F9PA 2GT7A 3S7KB 2BY8X 2GZ7A 5FX6A 4ISOA 3GY7A 1X7AC 1MQ5A 1IHTH 1SLXB 1IQNA 2Z6BD 2GV7A 1HJ9A 1G3BA 2D2DA 1VITH 3T29A 1K21H 1LHFH 3A7ZA 1GBHA 3UFAA 5CE1A 1CA0C 1EB2A 1QGFA 4KTSA 1O3FA 4IBLH 4OS4A 3TIUA 1D3DB 4JZDH 4JZIA 2BY7X 1HAGE 2EI6A 3DSPA 3SJIA 2Q6FA 3VB7A 4K60A 2PR3A 4UFEH 1QY6A 3BTWE 3ZZ9A 1D6WA 5E2OA 3TK5A 1F0TA 4YT6H 1UJ1A 1MABB 1NFUA 1L0ZA 1O3KA 2F9VA 2VH6A 3A8BA 5LH8A 5FX5A 3ZVAA 1GHAG 2SGQE 3M37A 1ESAA 2HNTC 2XNIA 3GYLB 1TMUH 2FI4E 3SQEE 4K8BA 4DURA 3RXKA 1NN6A 4IC6A 4M9FA 2VINA 2BY6X 3AVZA 3URDA 2ZEBA 5C67A 2VVUA 2A7HA 1P12E 1C5YB 2CJIA 3RXRA 3VB6A 1ZJKA 2WPMS 2J9NA 4AGJA 1EP6A 1O5AB 7LPRA 3SV8A 2DUCA 2Y5GA 2EI7A 1C5XB 4CH8B 3QUMP 4OS5A 4X1QU 2JH6D 2QC2A 3PTNA 2BQ6B 3WWBA 2P93A 5CMXH 3SU5A 4ABHA 5FBIA 1WCZA 3C1KA 5FBEA 4ASUD 1SGIB 3UOUA 4Y71A 3QLPH 2VWNA 6GCHG 1E1RD 5DJ7A 1PYTC 5DK1A 6LPRA 2FYQA 1BBRE 1KXDA 3RXDA 2BDGA 1C5SA 1DY8A 1HAZB 5FL7D 4J1YA 2HLDD 3SQHE 3SNCA 2PSXA 1C5WB 5JBTA 4CRAA 1MKWK 5K0HA 3ZVBA 5IK2D 2PGQB 1DM4B 1TRMA 1DPOA 1J14A 1ZJDA 1QJ6B 3TNTA 1PJPA 3A7TA 5FCRA 5CDFE 1NU7B 1BIOA 5C1UA 3UUZA 5A2MH 2KFWA 5TCCA 1C5NH 2ALPA 3PTBA 5E8EH 1TGBA 1WYKA 1EP5A 4B2CA 1PPEE 4ZMAH 2TGDA 5JBCS 2Z9JA 1ZZZA 5C0UA 2ZFFH 3BTME 1TX6A 1S83A 7GCHF 1O2JA 1GI8B 5EXLA 4F4OC 3S9AA 2B9LA 1L4DA 2ZGHA 1FLEE 2VIOA 4AN7A 1O3GA 1G37A 4ABEA 4R0IA 4MPXA 2QYIA 2QAAA 1UHBB 2R0KA 3FOAA 3MHWU 1NRSH 3RP2A 1Q2WA 1COWD 1QR3E 5K7RA 3F2GA 1C1QA 1DWEH 4FU7A 1LVMA 4Q80A 1Y3UA 1JXPA 5EOKA 2F9NA 2GMTC 3STIA 1QB9A 2H9HA 3F2FA 1ZGVA 3KHVA 4BAHB 1OHHD 4IW4E 2AHME 3KQ5A 2ZFRH 2OQUA 2V3MA 4NA7A 5J4QA 5DP6A 4RSPA 1P2QA 1NBMD 4Q63A 1O3AA 1PFXC 5L30H 4UDWH 4FUHA 3GY8A 5HIZA 3UQVA 1FAKH 4FOUC 3ZYEA 2A5IA 4NIWA 1V2ST 3RXLA 1HAIH 2BLVA 2WPJS 2Y7XA 1FI8A 3I78A 4DJZB 1C5MD 1NU9A 3K65B 3NUMA 1EZSC 1MTSA 5DSFA 2AMPA 3SI4H 1C5LH 1O3NA 5LPFA 1MKXH 4NGAH 3KYGA 3ZZ5A 3HATH 1FPHH 4ABJA 2A7CA 2TGPZ 1SB1H 1LHCH 1TNHA 4XRNA 3SUDA 1QIXB 2IPHA 4JYTA 3SZEA 1U6QA 5F03A 4E7NA 3W94A 1O2QA 4AYVB 1ELDE 2Y6TA 4ZKRU 1D4PB 3KQBA 4FUJA 2JIZD 2KR7A 3MNCA 1RFNA 2QIQA 1LKBA 1UHBA 1FJSA 3ZZDA 3UWIA 1OP2A 1SGEE 1C1TA 1HBTH 1HUTH 4U30A 2JETC 3RUOA 3ZZBA 2GCHG 2R0LA 3LT3A 2Z3CA 1FDPA 3RMNH 4AFQA 3O8RA 1J8AA 1CGIE 2ZP0H 2ILNA 1CVWH 3A89A 4YXWD 4ZROA 1PPCE 1UK2A 2WUBA 3RMLH 3F0PA 1O35A 4NFEA 4QT8C 3ZVDA 1EAXA 1HFDA 2BYAX 1DE7H 1QQUA 2V0BA 4D76A 1W13U 2V7QD 3GDSA 3A7WA 1ESBA 1KMHB 4HI3A 1CQQA 4FUFA 3KQCA 3LGWA 1CE5A 2D1JA 2WPDD 2FX6A 2NU4E 3OX7U 1ETSH 5JB8S 3R0FA 5I25A 3TGKE 1OWDA 1L1JA 1W0JD 2O8LA 3U98H 1ZOMA 2AIQA 1C1SA 1C5QA 1LQEA 1HGTH 1IQMA 2FLBH 2QF4A 2QGRA 3D23A 4X2XA 1DLKB 1XUHA 2WV4A 5FCKA 4X8UH 1VJ9U 4XBBA 2AEIH 2Z9GA 1O2WA 1PPBH 1GHVH 4GUXA 3F9GA 3HGPA 1AZ8A 2V35A 2Q6DA 2J38A 3MWIU 3TGIE 2VIDA 1ELFA 1OWJA 3MU8A 5TCAA 5C94A 1O30A 1YCPK 2HVYB 2JDID 2W3IA 1SQOA 2GD4B 2C8YB 1C9TA 1TGTA 1C4U2 1XUFA 2GDDA 1DUAA 3SORA 3ZYDA 1XUKA 3FP8E 2WPHS 2XBWA 2CXVA 4JMYA 1P01A 2Z3EA 2VBCA 1H9LB 4INKA 3SYJA 2XBVA 1MAXA 1GG6C 1T7CA 2FI3E 1KSNA 2FOAA 4UFGH 1P05A 1NRPH 5FAHA 4OGYA 3MH7A 3OSYA 1KXCA 1FAXA 3TH2H 3L3TA 4Y8YA 2J34A 1KXEA 5FPYA 1NZQH 1THSH 2WPIS 2XNDD 1CT2E 3MFJA 3TH3H 1W8BH 5EJLA 4YTAA 1J15A 3SJ8A 1P2MA 4ESTE 3VB5A 3MO6A 3UREA 2FODA 2BD5A 2J94A 1P10A 4NFFA 3UOPA 2ANMH 1H9HE 5F8ZA 3SV9A 3ZZAA 4NIVA 3H7TA 1S6LA 4WWYA 1QA7A 1OWEA 1BRBE 1D3PB 2TBSA 1SGNE 4ZKNU 1VCQA 2GMTB 4ISLA 4Y7AA 5E0HA 1YPEH 2ZHWH 3RDZA 4ZHMU 3VGCC 4JYUH 1UVTH 3GY5A 1Y3WA 3S7HB 4KELA 3V0XA 4DIHH 2G81E 5F6MA 1YCPM 1CHGA 1SLWB 3RC5A 1SQTA 1BTWA 2O8MA 3RXMA 2ZHQH 2HGTH 1YPLH 3MNBA 3LONA 4MLFB 3MQKC 2OK5A 1HRTH 4X1RU 1KXAA 2R2MB 4GHTA 1YPKH 3S9BA 3MU0A 1CHOF 2R3UA 2AMQA 2H2ZA 2ZKSA 3QK1A 1OWIA 3BIUH 3E16B 4P02A 3BG4B 8KME2 1V2UT 3A80A 3NK8A 3U28C 1GHWH 5DP4A 1QBNA 1NS3A 3FO8D 5AF9H 1TA6A 1C1UH 2PP6A 3BTHE 1NRQH 1Z8IB 2BD9A 4K5ZA 1C2FA 2WSSD 1GHBF 3DCLA 1CA8B 3PLBA 1TNJA 1GHZA 1BBRK 3PWBA 2BQ7B 1KTTB 1MZAA 1S0RA 2QXGA 5EPNA 1GMDF 5ABWA 1K28D 5EXNA 1YBWA 2JETB 5EW2H 4D9QA 3RC6A 2OC7A 3N99A 2ZGBH 1H9IE 1G3DA 4Z1MD 3LU9B 3A88A 3PV2A 5DP3A 1WQVH 2Y82A 1WSSH 2P59A 3E6PH 4UONA 3KN2A 4O97A 4JCNA 2EC9H 2QV1A 2ODPA 1MUEB 3T5FH 1P2KA 1GJBB 1SFIA 2HNTE 1WUNH 2GV6A 3WW7A 3GCNA 1HLTH 3EE7A 2BXTH 3QO6A 2FX4A 2ASUB 1T4UH 4HFPB 1O2HA 2ALVA 1TABE 1GDQA 1BRAA 5GJ4B 8GCHF 2FOEA 1AE5A 2XYAA 1BQYA 2LELA 4WY3A 1C2MA 2PW8H 1BRCE 4XBCA 1SHHB 1O3CA 4UD9H 1K1OA 3QZQA 4JK5A 2DE8A 1ANEA 5CHBA 1RJXB 1DX5M 4BAQB 1BUIA 2ZIQH 4MNVA 3OTPA 1DY9A 1GMCF 2ZHEH 2OLGA 6CHAC 1Y3YA 3MO9A 1GBKA 2VB0A 2F83A 3PROA 3EA7A 1TGNA 2ODYB 1EOLA 1C2IA 1YF4A 1MMJN 4FU8A 4FUBA 3U8RH 2SGFE 1SGCA 3T2NA 1LMWB 2BY9X 3BEFB 2B7DH 2OINA 1BMAA 2Z9KA 4ABFA 1V2RT 1B0FA 2IJOB 4O03A 1O3LA 3GS9A 1MQ6A 4MQAA 1SFQB 5A8XA 1V2TT 2QE7D 1GG6B 1FPCH 2B0FA 1RIWC 1T32A 1FZZA 4Y76A 5EQQA 1WTGH 3EA9A 8ESTE 2A2QH 1SGQE 3N7OA 1EOJA 1O2TA 4ISHH 3O8DA 2XW9A 2W7SA 3T25A 4I32A 1NC6A 6ESTA 1OP8A 1W10U 1GHBG 5FPSA 2BOHB 1BMMH 4DIIH 4CRFA 1K1NA 4KTCA 1NM6A 3BN9A 4TWWA 3UQOA 1GMDG 1F5KU 1JWTA 3PMAB 5DN6D 4ISNA 1FV9A 2HWLB 1V2KT 2G00A 3EQ0H 1GBLA 3SGAE 2OC8A 1XKAC 3F3BA 4LZ1H 4WF8A 3DA9B 4B73A 1A3EH 1MBQA 2FYRA 3KYFA 1O2UA 1ZSKA 4IMQA 4FUDA 2HNTF 4OS6A 3ZZ8A 3S0NA 1Q31A 1HDTH 1SPJA 4GLYA 1UTQA 2VIQA 3VGCB 4Y79A 1TPAE 2QY0B 2TIOA 4NA8A 1H4WA 2JJ1D 1W7XH 4O3UA 2CGAA 3RXUA 3OY5U 2BVSH 2VWOA 3Q76A 2K1QA 2SGEE 2FIRH 8GCHG 1AVWA 1MTUA 1Y8TA 2F3CE 1UTJA 2LP6A 5EODA 2ZU1A 1O2NA 5E0JA 4KP0A 1MCVA 4MNYA 5G4BA 4A1VA 1DWDH 1EPTC 1QFKH 5IYTA 1JBUH 1YLCA 1PPZA 1GJ4H 4OS2A 4Q2KA 3TVJB 4WMEA 1F0RA 1FY1A 1AVXA 3SJKA 4IN1A 3GCHC 1QZ8A 1ZLRA 1T8OA 1UVPA 1O3MA 3LGYA 2UUYA 2P95A 4TWYA 2K0QA 2GGVB 1ZSLA 1O33A 1GMCG 1LO6A 4BXWA 3VB4A 1EATA 1BMFD 4B71A 1GBJA 3UTUH 3EA8A 3STJA 2BDCA 3SO3A 1AB9C 5AVDA 4X0WU 3JZ1B 4BAOB 2H6MA 3RXHA 4XFQA 3ZZ3A 4AB8A 4DGJA 1HJ8A 4I7YH 1RTKA 3RXEA 5I46H 3DHKH 4NCYA 1O2YA 3P70B 1WAYB 3AW0A 2OBOA 2ZPQA 1O3IA 5LPEA 1CT0E 1AN1E 1SG8B 3BG8A 1ZMLA 2J95A 1ZSJA 2FLRH 1S0QA 5EQSA 8LPRA 4TSFD 1A46H 1OP0A 1GJ7B 1AHTH 1PPGE 2D26C 5DG6A 2A4QA 3DUXH 4P00A 1ZYOA 2C4FH 1EFRD 2W6ID 3B9FH 1RRKA 1O31A 1HYLA 1LPZB 1HAXB 3M7QA 1MBMA 4X6NA 3Q00A 1GL0E 3FANA 5B6LA 2W26A 2J5UA 1TNLA 3KIDU 4TPYA 1GBBA 4AG1A 1LQDB 1ZPCA 1K1JA 4INLA 1B7XB 4HGCA 3M5MA 1MTWA 3Q3YA 1N1LA 1RS0A 2ZU2A 1UVOA 1H8HD 1K0HA 1EAUA 3RXOA 1KDQB 6CHAB 1AFQC 1V2QT 1O5DH 5HM9A 5L2YH 3BEUA 3K6YA 3A8AA 3RM2H 2ZU5A 2QN5T 2ANKH 4Z0KA 1YLNA 5DP9A 3NWUA 2PUQH 2FESH 1O3JA 1SKYE 3B8JA 1HB0B 2G5VA 1ABIH 1FY5A 1AVGH 1ZMNA 2BDBA 4I8LA 3PWCA 1EJMA 1DVAH 1VGCC 4ASHA 1RIWB 4RT1A 2A4OA 1J9CH 3T62A 1WBGB 4BTUB 3M35A 2WHXA 1ELGA 2R2WU 4KTUA 2BLWA 1F5RA 3G01A 2GCHF 4J2YB 2AS9A 5KEDA 5JDUB 3RXQA 2BDHA 4WJG2 1C1NA 1SMFE 4RT0A 4XOJA 3RXSA 3KCGH 2KX4A 2RG3A 2OD3B 1CGHA 2OC1A 1V2OT 2BX3A 5JYIA 3E0NB 3VG8A 4AX9H 4X8TH 3MMGA 3RXAA 1Z6EA 2Z7FE 5GIBA 1C1MA 2C93B 2RDLA 1C2LA 3V3MA 1KDQA 2OUAA 3ATWA 5A8YA 3MI4A 1ZTKA 4RKJB 1SOTA 2B5TB 1GPZA 2ULLA 4CRCA 1F2SE 3SHCH 4TPIZ 4ZKOU 4I8KA 2QF5A 3GY4A 3GYMA 1OKXA 1P9SA 3NXPA 3SJOA 3HKJB 2XC4A 3SZNA 1MTVA 1SOZA 1AWHB 1AO5A 1V2PT 1V2WT 1YWUA 2FP7B 1NRNH 2ZGCA 3ODFA 1QB1A 3KEEA 3QGNB 1XVMA 4FXGH 3PO1C 4BTIB 5HGGA 2GZ8A 3URCA 1P2JA 1BHXB 2A1DB 3ENSB 1ZHPA 2F43B 2G5NA 1GVKB 3NRLA 5C2ZA 3LGTA 3SUGA 7KMEH 3BEIB 1LKAA 2C3SA 3MU1A 1QQ4A 4NWKA 1N8OC 3LGVA 1EPTB 2Y81A 1MKWH 1MD7A 1QRZA 2ZFQH 4R8TB 4Q7YA 1A3BH 4FU9A 4IMZA 2PKSC 5H4IB 4A6LA 3GCHB 3UB0A 4WVPE 3FP7E 3HK6B 1FIZA 3NCLA 4X8SH 2FOHA 2ZGJA 2FPZA 4Y10E 1UK4A 1ARBA 4B6EA 3F2HA 4D7FA 1UTPA 4RI0A 1NO9H 1RGQA 1DLEA 5T3HA 3BTDE 2C90B 2LPRA 3RXBA 3AAVA 1KLJH 4Q7XA 2RDEA 1GBTA 1W14U 5ETXA 1AB9B 5HM2A 3KL6A 3QDZB 2WV5A 4YOIA 1LVYA 1S81A 1Y3VA 1ABJH 2R3YA 3ZZ4A 1MTNC 3RM0H 1T8LA 1GHXH 1CA0B 1YGCH 1YPJH 3U1IB 4H6SB 1F92A 4B75A 4ZXYH 1TMTH 3PMHB 3O8BA 1WOFA 4F55A 1TX8A 2KCAA 4GCHF 3UAIC 3GDVA 2Y80A 2ZQ1A 4WXVA 3LC5A 2Z94A 3L33A 1JIRA 1GI9B 3SNDA 4OS1A 1P04A 2VNTA 4YM9A 1EPTA 1TOMH 2B8OH 1CO7E 4ACBA 1PYTD 2QF0A 1E37B 3SU2A 1BT7A 2W6JD 2HRVA 1LVBA 1O2VA 4Y7BA 3RXJA 3ZIAD 2JH5D 1VR1H 1BITA 5DP8A 1BMNH 3SGBE 3OE7D 1O3BA 2JJ2D 3SNEA 1O37A 1QNJA 4A1XA 3LKWA 4E06H 2OC0A 1GBEA 3U69H 1UCYE 3VEQB 2G55A 1NFYA 5A8ZA 2BDYA 3JZ2B 3M5LA 3V7TA 2VH0A 1Z8GA 1P0SH 1CT4E 3A7YA 1C1OA 3A86A 4MNWA 4AOQA 5L2ZH 3GY6A 1QL7A 3V13A 1O32A 1B0EA 1GI0A 3OFND 3BTQE 4MDSA 1QURH 1P3EA 3MU5A 1GJ8B 1Y5UT 5E2PA 1O2GH 3LGIA 2BTCE 1TONA 1GJ5H 1K9OE 5E0GA 3Q77A 1KIGH 4AORA 2ZWLH 4Z6AH 2KCYA 1YPGH 2XWBI 2EY4C 1O36A 1VGCB 4WXIA 4ZXXH 1IQGA 5GXPA 1C4Y2 4X2VA 1BOQA 2BVXH 3PMBB 1PQ8A 1YPHC 4IGDA 1TFXA 4CHAC 1O3EA 1P2IA 2F9UA 2OTVA 1S6HA 2NU3E 4ZCNA 3S9CA 4X1SU 1XVOA 1G9IE 1AIXH 4CH2B 4BOHA 1DT2A 3MH5A 3FVFB 1QL8A 2M2AA 3T26A 1PPHE 1A4WH 4U2WA 1LHGH 3NKKA 1Z8RA 3RXGA 3ATMA 1DWBH 1L4ZA 1EUFA 1GI3A 2ZHFH 3GY2A 1FQ3A 5PTPA 1QRXA 2FMJA 1MD8A 3DFLA 3SV6A 3KQEA 4AFSA 1GHYH 3T27A 2AMDA 1O2XA 4PROA 4GCHG 2XC0A 3TJNA 4KGAA 1Z8JB 1IQEA 3PO1B 3E90B 4X6MA 3ZZ7A 4DG4A 2VIWA 4FUGA 4MTBA 1OX1A 1EQ9A 1H8ED 2AGEX 1L1GA 1W7GH 1BTUA 4JZFH 2J92A 3TGJE 1A61H 3BSQA 1N8OB 1ID5H 4CR9A 2J98B 1RTFB 3DFJA 4THNH 2Q6GA 4X1NU 9ESTA 3A85A 1G3EA 2PKSB 2ZC9H 3GY3A 3TLOA 1HXFH 3RXTA 2W5EA 1AE8H 2WYGA 5EW1H 1K22H 3RMMH 2NWNA 1C5OH 4CBNA 3CNRA 1C1RA 3A84A 3LOXA 2P3FH 3NPSA 5A0AE 1YM0A 5GWZA 1SL3A 4CRGA 1W0YH 3DD2H 1VITF 3R3GB 4H42U 3PB1E 2CF9H 1THPB 2VU8E 1AFEH 1SC8U 2ZFPH 1GBCA 4NSVA 2F91A 3WWFA 3PYHA 2YMSC 1MTNB 2BDAA 3C27B 3VXFH 1AD8H 3ELAH 5DP7A 4ABBA 1HAHH 2XRCA 1C2GA 5HYOA 1NESE 1DWCH 1NROH 1DXPA 1SGDE 1D3QB 1UO6A 3FZZA 2VIPA 5TJXA 5HXFA 2IJD1 5HIYA 1TPOA 3RLWH 3MH4A 1BTXA 1GI7B 4DY7B 4YO9A 3K2UA 1Y5BT 1E34B 3PLKA 4TT3D 3SU3A 3TH4H 4NG9H 1GI2A 1LPGB 1CBWC 1GI5A 2JKHA 2FTLE 4MNXA 2UWLA 1SVPA 4JZ1A 3P6ZB 4XE4A 2J98A 1BJVA 1E36B 2BOKA 3AW1A 1D3TB 3EE0B 3F68H 3QX5H 2PLXA 4ZHAA 3NZIA 1TRNA 5SGAE 1EX3A 3M3TA 5F8XA 1H8IH 3GCTF 1NFXA 3LH3A 1TAWA 2PKAB 1O5FH 4FETA 2TRMA 1P06A 2A0QB 2VWLA 4GVUA 1C2HA 2ZHDA 2RA0A 2WV9A 1LHEH 3TJOA 1IOEA 2ZFSA 4ABIA 2WYJA 1XX9A 1H8DH 3CS7A 1SLVB 5T1VA 1K1MA 1FONA 2R9PA 2J4IA 2V3OH 2H9EH 3VPKA 3RLYH 1W2KH 1A0JA 3EAJA 4HZHA 1BBRH 5JBBS 1GBMA 2ZA5A 1RD3B 1TBQH 1G30B 1XXDA 1BCUH 3F9HA 1EZXC 1JMOH 2P16A 3I29A 1A0HB 1WV7H 4K3JA 2J2UA 2OBQA 1C1VH 1ZPZA 1EB1H 3ATLA 4MPWA 4CHAB 1LTOA 3PMJA 4CREA 3DSGA 1PQ7A 2I6QA 1SI5H 2ZPRA 1S6FA 2UWOA 1C2DA 1WU1A 1VITG 2ZNKH 1AI8H 1C5ZB 1TBZH 1SGFA 2PKAA 3SUEA 4K2YA 1TGCA 5LGOA 2KCPA 1W0ZU 1GBIA 2ZDLA 4BTTB 1W0KD 4LK4A 3K6ZA 1LHDH 3UY9A 4I8GA 1MH0A 4AFZA 1HAPH 3A7VA 3U8TH 1AZZA 3E91A 4B2AA 1CGJE 3MU4A 4DT7B 3QWCH 3RXIA 3PM3A 1A5GH 1P57B 2EI8A 1DS2E 1O34A 2P3TB 5B6OA 1DICA 1KXFA 2FOFA 1PQAA 2WINI 5DO4H 1FMGA 3BF6H 3PV5A 1GGDC 3P8OA 3RXPA 2CK3D 2BD4A 1C4V2 4YZUA 1Y5AT 3RXVA 2KCOA 2VGCC 2A45B 1OXGA 2FOGA 2RA3A 2ZTZA 1XXFA 3LGUA 3IITA 3SN8A 2QXJA 1O2OA 2IN2A 3GCTG 1C2EA 4SGAE 2CHAC 3ZVGA 3SGQE 1ELBA 3GCOA 2PV9B 4IN2A 1HPGA 1LPKB 1UCYK 2BD3A 2M5TA 1HJAC 1KYNA 2BHGA 2VVCA 4E7RG 1GI4A 3KQDA 1LCYA 3P92A 4LOYH 1O0DH 1OS8A 1O3HA 1QRWA 1DSTA 1B5GH 2YMSB 1AQ7A 2O8TA 4U32A 2ZU4A 1ZRKA 1Y59T 2FTMA 1EZUC 4VGCC 2Y7ZA 4MPVA 5C0TA 3QGJA 3W1EA 1V2MT 1V2NT 4ZUHA 1GDNA 3RU4T 1A0LA 2F4LA 2OCVB 2AGGX 5C1YA 2G4UA 2SGDE 3OU0A 1IQIA 1E35B 1CBWB 2Z9IA 1TBRH 2NU1E 2HPPH 2ZTYA 4Q4LA 1ZPBA 2XWAA 3TK6A 1UVUH 1V2VT 1KTSB 2I6SA 1D6RA 1SHYA 1E79D 2KAIB 1G2MA 2GJGA 4Y0YE 2STBE 3PRBA 1TLDA 2PTCE 1P9UA 4O3TA 5JPMH 1L2EA 1O5GH 3GOVB 4JK6A 4GPGA 2HALA 1JIMA 3UNRA 4B74A 2C8WB 1UVSH 2V6NA 3MNSA 3QZRA 4NZLA 3BIVH 1O2IA 1UK3A 4BXSA 1BTZA 1BZXE 3T28A 1P2OA 4AFUA 1ELCA 1C1WH 1TQ7B 1BTHH 1O2RA 2G8TA 3F1SB 4SGBE 1WDIA 4LZ4B 1E1QD 3GISB 2AYWA 1S85A 4GHQA 4F49A 4XDEA 1EKBB 1O5EH 1UTNA 2QXIA 5T6DA 1FX0B 1T4VH 3H5CB 4U01A 1ZMJA 2LNCA 1F7ZA 2ANWA 4MG3A 1N6XA 2RFKC 1JOUB 4X2YA 2C8XB 1DANH 1YLDA 1WQSA 2VJ1A 4X6OA 3EGKH 4A5TS 1SGTA 4Q7ZA 5C1XA 1QCPA 1V6DA 1BB0B 1WXRA 2HVXA 1O2ZA 1MAYA 2STAE 3P8NA 2FDAA 1RXPA 1BDAA 3HGNA 1JRSA 1Z1JA 4B2BA 1BTYA 3PLPA 3TPIZ 1YPHE 2XBYA 3OYPA 3UR6A 2KAIA 1A7SA 1L1NA 3CENA 4YLUA 1FNIA 2FS8A 1W11U 5C5NA 1O5BB 1S82A 4UFFH 1O5CB 1AWFH 3SNAA 4WH8A 3F6UH 5EPYA 1Z6JH 2Y5HA 1AGJA 1LVOA 5IDKA 1VCWA 3LC3A 1P2NA 2W3KA 5C3NA 5GPIB 4H6TA 1C5TA 1WTHD 2BZ6H 2FZZA 3TJVA 4K1TA 5T6FA 2NU0E 3CP7A 4IC5A 1UW7A 3FN8A 1TYNA 1TA2A 2Z3DA 2FOBA 2CN0H 1K1PA 2OP9A 4BAKB 2ODQA 2A5KA 1V2LT 2FM2A 5FHTA 4NWLA 4D7GA 1TALA 1SGPE 1GGDB 3ZZCA 2KM0A 4I8HA 1FY4A 1K2I1 2DE9A 2QCYA 1SQAA 4AGKA 2QF3A 1QHRB 2BXUH 2VGCB 5F8TA 3SU1A 3A82A 4ABDA 4YOJA 3Q3XA 3ZVFA 4AYYB 2BM2A 2GTBA 2CHAB 1GBAA 4CRDA 4OGXA 4BAMB 2JH0D 5EIYA 4DW2U 1C9PA 3HPTB 1O39A 1G36A 5BPEA 2P3UB 1HAOH 2GZ9A 1HJAB 2BLOA 3I77A 1ESTA 1O2MA 2ZECA 3LIWA 1DOJA 3MNXA 4ZH8A 1O3PB 4I33A 5AFZH 2AERH 2UWPA 4DVAU 2A2XH 3QTVH 1TB6H 1MKXK 2ZG0H 5GNDA 2XOKD 3LPRA 1DSUA 1GBDA 1S5SA 4Y8ZA 1TNKA 3RC4A 1NTPA 2HLCA 4RKOB 5EQRA 3TK9A 2GT8A 4ZAEA 1EJNA 2AFQB 3LJJA 3P8FA 4I86A 4K1SA 1J16A 4VGCB 3SNBA 2XTTB 5J4SA 2ZCLP 4XD7D 1OYQA 3M5OA 4RN6A 1F0SA 1QJ1B 4ABAA 4MVNA 3U9AH 1W12U 2A4RA 2EA3A 2ZDKA 3FZDA 2ZDMA 5CHAC 2A5AA 4JZEH 4GAWA 4CBOA 1GJDB 2H1UA 3SUFA 1YYY1 4MPUA 1HXEH 1GCDA 3E8LA 5DGJA 1VCPA 3RMOH 2C8ZB 3KNXA 3W95A 3OAAD 1ZRBA 3SW2B 2ZF0H 3RU4D 1YKTA 2GP9B 1QBVH 2PUXB 4XSKU 3ITIA 4DOQA 4WMFA 2WPLS 1GDUA 2THFB 2VIVA 2OXSA 2AGIX 1OPHB 1N6YA 2V3HH 3BG4C 1ZGIA 1A5HA 4AC9A 3A81A 1GCTC 1O2LA 2ESTE 3D65E 4FUIA 5EXMA 4OS7A 5HMAA 4ACAA 3O8CA 3ATKA 1P02A 5C20A 3HK3B 1F5LA 3ZVEA 1GI1A 2PTNA 1SGYE 1TGSZ 2GKVE 4YOGA 1ANDA 3LH1A 5A09A 4JYVH 3KGPA 3VXEH 2UUJB 1V3XA 5DKMA 4Y8XA 1GJ6A 1AFQB 1HV7A 4WMDA 1Y3XA 3HKIB 1ANBA 1SGFG 3SBKA 2CMYA 1HAVB 3U1JB 2BLQA 3ZVCA 1ETRH 4B76A 3TNSA 3OEHD 1XKBC 3SI3H 1VZQH 5GCHF 1QJ7B 3BV9B 4XBDA 4YESB 5KGOA 1CU1A 7GCHG 3LJOA 3KF2A 3SU6A 2YOLA 3M3VA 1P8VC 5T6GA 1A5IA 4BANB 1DUEA 2ZPSA 2CV3A 3VFEA 1YY3A 3BTFE 2KZ4A 2BY5X 3ESTA 5EU8A 1IQJA 3A8DA 1UTLM 1MU8B 4CRBA 2SGAA 1NT1A 2GVFA 2BB4A 1KXBA 1O2SA 1QTFA 3Q3KA 1ZHMA 2FI5E 3MYWA 4X1PU 3A83A 3A8CA 3SU0A 2WZQA 1TPPA 5C5OA 2G4TA 4UEHH 2P8OC 5DP5A 1AU8A 5JBAS 1O38A 4K8YA 1GJAB 1IQLA 5C17A 3P95A 1BA8B 1ACBE 3SHAH 1FN6A 3FFGA 4D9RA 5EG4A 3MOCA 1JRTA 1THRH 1IQKA 2FOMB 2Y5FA 1XUGA 1M9UA 5AFYH 1V2JT 1AUTC 3L6PA 1Q3XA 3ATIA 2O9QA 2WPKS 4NIYA 3H7OA 3QN7A 3QTOH 4K1EA 4CR5A 1HAVA 3M7TA 1SGRE 1P03A 4FUCA 3F9FA 1YC0A 4F48B 4K69A 2RCEA 2XCFA 2GDEH 2YNAA
chains in the Genus database with same CATH topology
3BTTE 2BMGB 1D9IA 1SR5C 1ANCA 3K9XB 5A0CA 1OWKA 1C2JA 2OQ5A 1TE0A 1DXWA 1YCPH 3GDUA 3M7UA 2A32A 4DCDA 3UNQA 1GWAA 4FUEA 1QB6A 2TPIZ 2ANYA 2A31A 2VWMA 2W7UA 3ZV8A 1MU6B 1NY22 1Z1IA 1NRRH 1OWHA 1TQ0B 1ZTLA 1MCTA 3IG6B 2SFAA 3S69A 4X6PA 4INHA 2Q1JA 1C1PA 1XM1A 2QA9E 1C2KA 2F9BH 3IWMA 3E1XB 4Y11E 1C5UA 4AZ2B 1IQHA 1TPSA 2G51A 1TX7A 3M5NA 4HTCH 2ZCKP 1K1IA 1C5VA 5CHAB 3ZV9A 1YPMH 5GCHG 1PQ5A 3A87A 2XXLA 1Z7KA 1DFPA 2YNBA 4ZKSU 3B23B 3DT0H 2GCTC 3SV2H 3UIRA 1OYTH 5L6NH 3FAOA 1TRYA 2PSYA 3UWJH 3UNSA 3GICB 1EZQA 2BD8A 3BTGE 4UFDH 4A7IB 2ZQ2A 1BRUP 4M7GA 5AHGH 3D49H 3MO3A 2XBXA 1UTKA 1GCTB 4H4FA 1J17T 1O3OA 1XUIA 5JB9S 1GI6A 1LDTT 2A7JA 2SNVA 3RXCA 1A1RA 4YT7H 4FVBA 1EXFA 2FEQH 2ZGXH 2BDIA 2FO9A 1TIOA 1HNEE 1HAYB 3TITA 3OY6U 5DPAA 2O8UA 2H5DA 1RTLA 2ZTXA 4A92A 1QA0A 1YP9A 1PPFE 3UPEA 1A2CH 2HOBA 1GJCB 3LDXH 4GSOA 4KKDA 1O2KA 2EEKA 2FOCA 3PV4A 2ZI2H 1G3CA 1GVZA 3RU4E 1EAIA 2AIPA 1FY8E 1BHXF 1MZDA 1H1BA 1NPMA 1AY6H 1C5PA 1ORFA 1Z71A 1C5RA 2UUKB 4YLQH 4NZQA 4AG2A 4TY7A 4I31A 1TOCB 1SSXA 3E0PB 1ELTA 1O2PA 2F9OA 4NSYA 1NFWA 1FUJA 1HIAB 1DITH 2TGAA 4BNRA 1AKSB 1GVLA 1ELEE 2BX4A 2FWWA 2O8WA 1OOKB 3FP6E 1TNIA 1UTMA 4A1TA 2P8OB 4FVDA 1AMHA 3A7XA 2ZDAH 1TWXB 2BQWB 1EAWA 2CF8H 3OTJE 1BJUA 2ZFTA 1GMHF 1IHSH 1K1LA 1EASA 4Y6DA 1P3CA 1UTOA 2TGTA 2QXHA 1QL9A 2D8WA 5EGMA 2FS9A 3V12A 3EDXB 2FXRA 1CHOG 2ZZUH 4X8VH 4E05H 1ELVA 3TU7H 2SNWA 5GDSH 1BMLA 2XC5A 3RXFA 2HPQH 3D62A 1W3CA 4X2WA 2BVRH 1EJAA 3SJ9A 3BTKE 1G32B 4D8NA 3SV7A 1BTPA 5BRRE 2A4GA 1INCA 5FPTA 1XUJA 2IOTA 1KLTA 1HIAA 3AASA 1AKSA 2ZU3A 4ISIH 4WH6A 1GHAF 5FXLA 2UUFB 3MTYA 1FY3A 4IS5A 3U8OH 1ELAA 1DDJA 1TMBH 1P11E 2PFEA 1GBFA 1SBWA 7ESTE 4TY6A 2BZAA 2H9TH 1FXYA 1FN8A 3M61U 5ESTE 3AAUA 4I8JA 3UR9A 1SLUB 3SU4A 5A0BA 5LPRA 1FIWA 2WUCA 3WY8A 4ABGA 2P94A 2PHBA 4UE7H 1ZR0A 3VB3A 3MH6A 1T8MA 4ZHLU 3M3SA 3E3TA 1F0UA 4NA9H 1E0FD 4LXBH 2PGBB 2ZDVH 1ETTH 2BD7A 1S84A 1KLIH 2Z9LA 2AH4X 1G2LA 1CSOE 2G52A 4AB9A 3M36A 2BD2A 9LPRA 2GCTB 3F9EA 2ZDNA 1P09A 1O3DA 3BTEE 3P17H 3P8GA 4Y0ZE 6GCHF 1XMNB 2XCNA 2SGPE 1UMAH 2VVVA 1QBOA 1TNGA 4NIXA 2GX4A 2ZCHP 3ODDA 1KY9A 3SOSA 4B1TA 1ZHRA 3CS0A 1ARCA 3ZZ6A 1IQFA 1IAUA 1E38B 2ZO3H 2NU2E 2H5CA 5ESBA 1OSSA 1GJ9B 1T8NA 4TYDA 1HCGA 1UCYH 1ZTJA 3TJUA 1T31A 3EYDA 1AUJA 4O9VA 1GL1A 2PWXA 1VJAU 1GMHG 2F9PA 2GT7A 3S7KB 2BY8X 2GZ7A 5FX6A 4ISOA 3GY7A 1X7AC 1MQ5A 1IHTH 1SLXB 1IQNA 2Z6BD 2GV7A 1HJ9A 1G3BA 2D2DA 1VITH 3T29A 1K21H 1LHFH 3A7ZA 1GBHA 3UFAA 5CE1A 1CA0C 1EB2A 1QGFA 4KTSA 1O3FA 4IBLH 4OS4A 3TIUA 1D3DB 4JZDH 4JZIA 2BY7X 1HAGE 2EI6A 3SJIA 2Q6FA 3VB7A 4K60A 2PR3A 4UFEH 1QY6A 3BTWE 3ZZ9A 1D6WA 5E2OA 3TK5A 1F0TA 4YT6H 1UJ1A 1NFUA 1L0ZA 1O3KA 2F9VA 2VH6A 3A8BA 5LH8A 5FX5A 3ZVAA 1GHAG 2SGQE 3M37A 1ESAA 2HNTC 2XNIA 3GYLB 1TMUH 2FI4E 3SQEE 4K8BA 4DURA 3RXKA 1NN6A 4IC6A 2VINA 2BY6X 3AVZA 3URDA 2ZEBA 5C67A 2VVUA 2A7HA 1P12E 1C5YB 2CJIA 3RXRA 3VB6A 1ZJKA 2WPMS 2J9NA 4AGJA 1EP6A 1O5AB 7LPRA 3SV8A 2DUCA 2Y5GA 2EI7A 1C5XB 4CH8B 3QUMP 4OS5A 4X1QU 2JH6D 2QC2A 3PTNA 2BQ6B 2P93A 5CMXH 3SU5A 4ABHA 5FBIA 1WCZA 3C1KA 5FBEA 1SGIB 3UOUA 4Y71A 3QLPH 2VWNA 6GCHG 5DJ7A 1PYTC 5DK1A 6LPRA 2FYQA 1BBRE 1KXDA 3RXDA 2BDGA 1C5SA 1DY8A 1HAZB 4J1YA 3SQHE 3SNCA 2PSXA 1C5WB 5JBTA 4CRAA 1MKWK 5K0HA 3ZVBA 2PGQB 1DM4B 1TRMA 1DPOA 1J14A 1ZJDA 1QJ6B 3TNTA 1PJPA 3A7TA 5FCRA 1NU7B 1BIOA 5C1UA 3UUZA 5A2MH 5TCCA 1C5NH 2ALPA 3PTBA 5E8EH 1TGBA 1WYKA 1EP5A 4B2CA 1PPEE 4ZMAH 2TGDA 5JBCS 2Z9JA 1ZZZA 2ZFFH 3BTME 1TX6A 1S83A 7GCHF 1O2JA 1GI8B 5EXLA 4F4OC 3S9AA 2B9LA 1L4DA 2ZGHA 1FLEE 2VIOA 4AN7A 1O3GA 1G37A 4ABEA 4R0IA 4MPXA 2QYIA 2QAAA 1UHBB 2R0KA 3MHWU 1NRSH 3RP2A 1Q2WA 1QR3E 5K7RA 1C1QA 1DWEH 4FU7A 1LVMA 4Q80A 1Y3UA 1JXPA 5EOKA 2F9NA 2GMTC 3STIA 1QB9A 2H9HA 1ZGVA 3KHVA 4BAHB 4IW4E 2ZFRH 2OQUA 4NA7A 5J4QA 5DP6A 4RSPA 1P2QA 1O3AA 1PFXC 5L30H 4UDWH 4FUHA 3GY8A 3UQVA 1FAKH 3ZYEA 2A5IA 4NIWA 1V2ST 3RXLA 1HAIH 2BLVA 2WPJS 2Y7XA 1FI8A 3I78A 4DJZB 1C5MD 1NU9A 3K65B 3NUMA 1EZSC 1MTSA 2AMPA 3SI4H 1C5LH 1O3NA 5LPFA 1MKXH 4NGAH 3ZZ5A 3HATH 1FPHH 4ABJA 2A7CA 2TGPZ 1SB1H 1LHCH 1TNHA 3SUDA 1QIXB 2IPHA 4JYTA 1U6QA 5F03A 4E7NA 3W94A 1O2QA 4AYVB 1ELDE 2Y6TA 4ZKRU 1D4PB 3KQBA 4FUJA 3MNCA 1RFNA 2QIQA 1LKBA 1UHBA 1FJSA 3ZZDA 3UWIA 1OP2A 1SGEE 1C1TA 1HBTH 1HUTH 4U30A 2JETC 3RUOA 3ZZBA 2GCHG 2R0LA 3LT3A 2Z3CA 1FDPA 3RMNH 4AFQA 3O8RA 1J8AA 1CGIE 2ZP0H 2ILNA 1CVWH 3A89A 4ZROA 1PPCE 1UK2A 2WUBA 3RMLH 1O35A 4NFEA 4QT8C 3ZVDA 1EAXA 1HFDA 2BYAX 1DE7H 1QQUA 2V0BA 4D76A 1W13U 3GDSA 3A7WA 1ESBA 4HI3A 1CQQA 4FUFA 3KQCA 3LGWA 1CE5A 2D1JA 2FX6A 2NU4E 3OX7U 1ETSH 5JB8S 3R0FA 5I25A 3TGKE 1OWDA 1L1JA 2O8LA 3U98H 1ZOMA 2AIQA 1C1SA 1C5QA 1LQEA 1HGTH 1IQMA 2FLBH 3D23A 2QGRA 4X2XA 1DLKB 1XUHA 2WV4A 5FCKA 4X8UH 1VJ9U 4XBBA 2AEIH 2Z9GA 1O2WA 1PPBH 1GHVH 4GUXA 3F9GA 3HGPA 1AZ8A 2V35A 2Q6DA 2J38A 3MWIU 3TGIE 2VIDA 1ELFA 1OWJA 3MU8A 5TCAA 1O30A 1YCPK 2W3IA 1SQOA 2GD4B 2C8YB 1C9TA 1TGTA 1C4U2 1XUFA 2GDDA 1DUAA 3SORA 3ZYDA 1XUKA 3FP8E 2WPHS 2XBWA 2CXVA 4JMYA 1P01A 2Z3EA 1H9LB 4INKA 2XBVA 1MAXA 1GG6C 1T7CA 2FI3E 1KSNA 2FOAA 4UFGH 1P05A 1NRPH 5FAHA 4OGYA 3MH7A 3OSYA 1KXCA 1FAXA 3TH2H 3L3TA 4Y8YA 2J34A 1KXEA 5FPYA 1NZQH 1THSH 2WPIS 1CT2E 3MFJA 3TH3H 1W8BH 4YTAA 1J15A 3SJ8A 1P2MA 4ESTE 3VB5A 3MO6A 3UREA 2FODA 2BD5A 2J94A 1P10A 4NFFA 3UOPA 2ANMH 1H9HE 5F8ZA 3SV9A 3ZZAA 4NIVA 3H7TA 4WWYA 1QA7A 1OWEA 1BRBE 1D3PB 2TBSA 1SGNE 4ZKNU 1VCQA 2GMTB 4ISLA 4Y7AA 5E0HA 1YPEH 2ZHWH 3RDZA 4ZHMU 3VGCC 4JYUH 1UVTH 3GY5A 1Y3WA 3S7HB 4KELA 3V0XA 4DIHH 2G81E 5F6MA 1YCPM 1CHGA 1SLWB 3RC5A 1SQTA 1BTWA 2O8MA 3RXMA 2ZHQH 2HGTH 1YPLH 3MNBA 3LONA 4MLFB 1HRTH 4X1RU 1KXAA 2R2MB 4GHTA 1YPKH 3S9BA 3MU0A 1CHOF 2R3UA 2AMQA 2H2ZA 2ZKSA 3QK1A 1OWIA 3BIUH 3E16B 3BG4B 8KME2 1V2UT 3A80A 3NK8A 1GHWH 5DP4A 1QBNA 1NS3A 5AF9H 1TA6A 1C1UH 3BTHE 1NRQH 1Z8IB 2BD9A 4K5ZA 1C2FA 1GHBF 1CA8B 3PLBA 1TNJA 1GHZA 1BBRK 3PWBA 2BQ7B 1KTTB 1MZAA 1S0RA 2QXGA 5EPNA 1GMDF 5ABWA 1K28D 5EXNA 1YBWA 2JETB 5EW2H 4D9QA 3RC6A 2OC7A 2ZGBH 1H9IE 1G3DA 3LU9B 3A88A 5DP3A 1WQVH 2Y82A 1WSSH 2P59A 3E6PH 4UONA 3KN2A 4O97A 4JCNA 2EC9H 2QV1A 2ODPA 1MUEB 3T5FH 1P2KA 1GJBB 1SFIA 2HNTE 1WUNH 2GV6A 3GCNA 1HLTH 2BXTH 3QO6A 2FX4A 2ASUB 1T4UH 4HFPB 1O2HA 2ALVA 1TABE 1GDQA 1BRAA 5GJ4B 8GCHF 2FOEA 1AE5A 2XYAA 1BQYA 4WY3A 1C2MA 2PW8H 1BRCE 4XBCA 1SHHB 1O3CA 4UD9H 1K1OA 3QZQA 4JK5A 2DE8A 1ANEA 1RJXB 1DX5M 4BAQB 1BUIA 2ZIQH 4MNVA 1DY9A 1GMCF 2ZHEH 2OLGA 6CHAC 1Y3YA 3MO9A 1GBKA 2VB0A 2F83A 3PROA 3EA7A 1TGNA 2ODYB 1EOLA 1C2IA 1YF4A 1MMJN 4FU8A 4FUBA 3U8RH 2SGFE 1SGCA 3T2NA 1LMWB 2BY9X 3BEFB 2B7DH 2OINA 1BMAA 2Z9KA 4ABFA 1V2RT 1B0FA 2IJOB 4O03A 1O3LA 1MQ6A 4MQAA 1SFQB 5A8XA 1V2TT 1GG6B 1FPCH 2B0FA 1RIWC 1T32A 1FZZA 4Y76A 5EQQA 1WTGH 3EA9A 8ESTE 2A2QH 1SGQE 3N7OA 1EOJA 1O2TA 4ISHH 3O8DA 2XW9A 2W7SA 3T25A 4I32A 1NC6A 6ESTA 1OP8A 1W10U 1GHBG 5FPSA 2BOHB 1BMMH 4DIIH 4CRFA 1K1NA 4KTCA 1NM6A 3BN9A 4TWWA 3UQOA 1GMDG 1F5KU 1JWTA 3PMAB 4ISNA 1FV9A 2HWLB 1V2KT 2G00A 3EQ0H 1GBLA 3SGAE 2OC8A 1XKAC 4LZ1H 4WF8A 3DA9B 4B73A 1A3EH 1MBQA 2FYRA 1O2UA 1ZSKA 4IMQA 4FUDA 2HNTF 4OS6A 3ZZ8A 3S0NA 1Q31A 1HDTH 1SPJA 4GLYA 1UTQA 2VIQA 3VGCB 4Y79A 1TPAE 2QY0B 2TIOA 4NA8A 1H4WA 1W7XH 4O3UA 2CGAA 3RXUA 3OY5U 2BVSH 2VWOA 3Q76A 2K1QA 2SGEE 2FIRH 8GCHG 1AVWA 1MTUA 1Y8TA 2F3CE 1UTJA 5EODA 2ZU1A 1O2NA 5E0JA 4KP0A 1MCVA 4MNYA 5G4BA 4A1VA 1DWDH 1EPTC 1QFKH 5IYTA 1JBUH 1YLCA 1PPZA 1GJ4H 4OS2A 4Q2KA 3TVJB 4WMEA 1F0RA 1FY1A 1AVXA 3SJKA 4IN1A 3GCHC 1ZLRA 1T8OA 1UVPA 1O3MA 3LGYA 2UUYA 2P95A 4TWYA 2GGVB 1ZSLA 1O33A 1GMCG 1LO6A 4BXWA 3VB4A 1EATA 4B71A 1GBJA 3UTUH 3EA8A 3STJA 2BDCA 3SO3A 1AB9C 5AVDA 4X0WU 3JZ1B 4BAOB 2H6MA 3RXHA 4XFQA 3ZZ3A 4AB8A 4DGJA 1HJ8A 4I7YH 1RTKA 3RXEA 5I46H 3DHKH 4NCYA 1O2YA 3P70B 1WAYB 3AW0A 2OBOA 2ZPQA 1O3IA 5LPEA 1CT0E 1AN1E 1SG8B 3BG8A 1ZMLA 2J95A 1ZSJA 2FLRH 1S0QA 5EQSA 8LPRA 1A46H 1OP0A 1GJ7B 1AHTH 1PPGE 2D26C 5DG6A 2A4QA 3DUXH 1ZYOA 2C4FH 3B9FH 1RRKA 1O31A 1HYLA 1LPZB 1HAXB 3M7QA 1MBMA 4X6NA 3Q00A 1GL0E 3FANA 2W26A