1OP2A

Crystal structure of aav-sp-ii, a glycosylated snake venom serine proteinase from agkistrodon acutus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
234
structure length
234
Chain Sequence
VIGGNECDINEHRFLVAFFNTTGFFCGGTLINPEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNNNEVLDKDIMLIKLDKPISNSKHIAPLSLPSSPPSVGSVCRIMGWGSITPVKETFPDVPYCANINLLDHAVCQAGYPELLAEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFQGIVSYGAHPCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Venom serine proteinase
publication title Crystal Structures and Amidolytic Activities of Two Glycosylated Snake Venom Serine Proteinases
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.-:
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op2A02
2NU2E 1RTKA 2Z9GA 1PPFE 1W3CA 3F9EA 1TQ7B 1THSH 3E6PH 3UTUH 2GTBA 1DM4B 1CA8B 1RJXB 4HFPB 4CH2B 1Z8GA 1P3CA 1KXCA 2FOCA 4CHAB 3SU6A 1QA7A 1T4UH 6GCHF 1ELVA 2AGIX 3M5NA 3PO1C 3RXEA 5J4QA 3VB6A 1V2QT 2XNIA 1C5ZB 1XUKA 1BRUP 3R0FA 1OP0A 2JH0D 1T32A 4B2AA 5BPEA 3UQVA 1AE5A 2BQWB 1IQKA 3LH3A 5DP5A 4CRAA 3F1SB 4B1TA 1O2KA 3MWIU 2PGQB 1ZTJA 3GY3A 5GJ4B 2Y81A 1W14U 3LT3A 3I77A 1U6QA 1P09A 3A88A 4X6OA 1P2QA 4FUDA 3RXKA 1UHBA 2Z3EA 3E0NB 4YESB 5T6GA 2HALA 3VB5A 1CU1A 3O8CA 2GP9B 2FZZA 1S6FA 5HGGA 4WMDA 4TWWA 2VVCA 4UFDH 1GPZA 3STIA 3CENA 1AY6H 6LPRA 1ABJH 1TGBA 5I25A 1IQLA 1BZXE 1PQ5A 5A2MH 3RM0H 3QO6A 4X2WA 1C1TA 1O2SA 3E91A 4K8YA 2ZQ1A 1PPEE 2UUFB 4XSKU 1BJVA 5FBEA 2RA0A 1WUNH 2UWLA 1AKSB 5H4IB 3TJNA 1SGPE 2J92A 3RMMH 3SZNA 1ELFA 1O30A 1TFXA 4LK4A 1GCTB 1Y5BT 1ZHMA 2OC8A 3ELAH 3D49H 3V0XA 1AZZA 4YLQH 2ZC9H 3ZZBA 1XVMA 3EA8A 1GHBG 2JETC 1EPTB 1GI8B 3GCHB 1P02A 3BTDE 3MMGA 4IGDA 1GBHA 3U1IB 1GJ7B 3ENSB 3QGNB 1JMOH 2ZWLH 4X1RU 3LGIA 3BIVH 2HNTE 4AB9A 1LQEA 2QYIA 3S0NA 4NWLA 2HPPH 1O31A 3BTFE 1MTNC 3TH3H 2GT7A 2OP9A 1BUIA 1A0JA 2WINI 1J15A 1V2KT 1A3EH 1W10U 3A7XA 1RIWC 3I29A 2VWNA 1CA0B 1EASA 1QBVH 1EZQA 1A3BH 3IWMA 1DUEA 5A8ZA 3L33A 3LGUA 1ZGVA 4ABGA 2P3TB 1Q3XA 3NCLA 1N6XA 3T5FH 2QXIA 1GWAA 1EXFA 1SOZA 3GYLB 4DIHH 1A4WH 2LNCA 2A5IA 1Y5AT 1S0RA 1D3DB 1HUTH 1PFXC 1L1GA 2HNTC 5F8ZA 2BZAA 2P94A 2YNAA 1QRZA 1SR5C 3OTJE 2PLXA 1EJAA 2XRCA 3TH2H 7ESTE 3T27A 3S69A 1KTSB 1HIAA 4E7NA 3WY8A 1VCPA 3PV4A 3TGJE 2FOHA 5EXLA 5LPFA 3A8DA 3PMBB 1HCGA 1NZQH 3QZRA 4NA7A 5GPIB 1KXEA 4SGAE 2Z9IA 1TLDA 5F03A 5CE1A 1DLKB 1HDTH 3V7TA 2OC7A 3PLPA 3S7KB 6CHAB 2ZU5A 3BTTE 3U8RH 4X8TH 1O2GH 4XDEA 1TMTH 4Q7YA 1O5CB 3BF6H 1HYLA 3BTEE 1FY5A 2V0BA 2O9QA 3C27B 3M7QA 1F7ZA 1E0FD 1UCYE 3F6UH 3QDZB 2G4TA 2ZDAH 1UTMA 2D1JA 3SJKA 1YKTA 1O3LA 1JXPA 4U32A 2G8TA 1NESE 3A7VA 3MOCA 1F0TA 4AGJA 3PWBA 3P8OA 8GCHG 2PR3A 4WH8A 4Q7XA 1GI0A 1KDQB 4BTIB 1D6WA 2OBQA 1RGQA 2SGDE 7GCHF 1P3EA 3RXTA 2ASUB 5JPMH 1BRCE 1IHSH 1LHCH 2HVXA 4ISHH 2OQ5A 4Y71A 4NFFA 1JRTA 1BMAA 1DDJA 5AFZH 4AX9H 1GBJA 1FY3A 1SGFG 1AO5A 2BD4A 1CVWH 2XYAA 2FIRH 1ARBA 2G52A 3UNQA 3RU4D 4KTSA 1Y3WA 3LGVA 1YPMH 4I31A 2Y6TA 2CJIA 4Y7AA 4XBBA 1EKBB 3AASA 1L1JA 5C5NA 4Y79A 5E8EH 2LPRA 1DWCH 2ZCKP 3CS0A 3OU0A 4YT6H 2ZPSA 4H42U 2CHAC 2OLGA 2BDGA 3GY8A 2F9UA 3B23B 1E34B 1CGHA 1LO6A 4X8UH 4FUJA 2A7CA 4DG4A 2STAE 3D62A 4VGCB 4Q7ZA 2O8TA 3UR6A 1QRWA 2BXTH 2P95A 1ORFA 3AVZA 2OINA 3HKJB 4Y10E 1FMGA 4ZKRU 1T7CA 2CN0H 3GDVA 1H9HE 5LGOA 1Y3VA 3ATKA 1P9SA 3HKIB 1O37A 4R8TB 5G4BA 1O3GA 1O5FH 2RDLA 5GCHG 2W26A 1LVBA 1MKXH 3E16B 4B2CA 2PKSB 4FVBA 2AH4X 4WMFA 1MTSA 3RXCA 1IAUA 1YPGH 3PB1E 5EPNA 5DG6A 3H7OA 2ANWA 2Q6DA 1E36B 1GMHF 2W5EA 4B75A 2ZFRH 1FAXA 3FP7E 1GJ8B 3AAVA 3RXIA 3IITA 2IPHA 3PLBA 4NSVA 4Y76A 1AUJA 1ZR0A 1KSNA 3DT0H 1UVUH 1LCYA 2BOKA 3RC4A 1O2QA 1XX9A 3OY6U 2ZO3H 1VJAU 3A8AA 3FZZA 1AI8H 1C1RA 2VWOA 1SLVB 2DE9A 2FPZA 2IJOB 1HJAC 5DP8A 1S0QA 2RG3A 1C2FA 4A1VA 3ZZ4A 1TQ0B 1XKBC 4JYTA 1DSUA 1KLTA 1S82A 2GVFA 1V2TT 1TALA 1D3PB 5JBBS 2OXSA 2BLVA 2V35A 4NZLA 5EG4A 4BXWA 1H1BA 1O3PB 1ESTA 1O2OA 4MNXA 3A84A 1O5EH 4ZHMU 4J1YA 3AW1A 5E0HA 1P2KA 4NSYA 4I8GA 1MZAA 2J38A 2ZCHP 2AIQA 2SGAA 2PV9B 1ACBE 1NU7B 2IOTA 3TGIE 2ZPRA 3NK8A 2GZ9A 4KTCA 3RDZA 2D26C 1MBMA 1GGDB 1SOTA 1NRNH 1FJSA 4MNVA 4NG9H 2ZU3A 1O2ZA 1V2NT 4YM9A 2ZDMA 4CBOA 3PMJA 1S6HA 3DUXH 3MO6A 2BHGA 1E37B 2P93A 4BAKB 4H6TA 1J14A 5HM9A 2C8WB 5K7RA 1O2MA 2ULLA 5PTPA 3W95A 3ZZDA 1TX7A 1EOLA 1QRXA 1ELBA 2STBE 3A86A 2R9PA 1H9LB 1LHEH 4M7GA 3RXLA 1Z8IB 1DS2E 1GBAA 4WXVA 1BJUA 1DSTA 3RXJA 1FZZA 2C93B 1HBTH 1G3CA 1KIGH 3W94A 3GICB 1C1UH 1JWTA 2ZKSA 2J4IA 2Z3CA 3R3GB 4NIXA 3SU5A 1MKXK 1O38A 3ATMA 4PROA 1GBTA 3BTQE 2ZQ2A 2B8OH 2BDHA 5FHTA 4E06H 9ESTA 2VNTA 4OGYA 3E3TA 3MNBA 2SGEE 1AE8H 1O5AB 1NM6A 1ABIH 1CT2E 4DIIH 1C9TA 1Y5UT 1C5OH 2ZGHA 2V3OH 2GV6A 1AQ7A 5FCKA 1GL1A 1A5GH 1VCQA 4GPGA 1O3AA 1J16A 3A7TA 1WU1A 1W7GH 3SUDA 4XE4A 3GY2A 3SHAH 1UO6A 1XVOA 1P05A 2FTLE 2XBYA 3KF2A 1K21H 1G36A 1W12U 1V2MT 4CHAC 3ZV8A 1XUFA 5FX6A 4K1TA 2ZF0H 3URDA 1VR1H 2WYJA 1C1MA 1C2LA 1NU9A 1UTLM 1C5PA 4A92A 1PQ7A 1GI5A 1OYQA 2AMDA 1CSOE 1DANH 2TRMA 1HJ9A 1VZQH 3K2UA 3PLKA 1PYTD 4YOIA 1XUGA 2BY7X 1FY4A 4NFEA 5ETXA 4K1EA 1GMDF 1AVXA 4O9VA 1CHOG 3UPEA 5DJ7A 2F9OA 3KGPA 1ZPCA 4DW2U 2OBOA 1HPGA 1K1JA 3O8DA 1H9IE 1GMCF 1O2LA 1V3XA 1OWHA 1C5QA 1HAZB 1FAKH 3MO3A 2AFQB 2H6MA 1Z71A 2TGAA 5EU8A 1BBRH 3TK9A 2G4UA 2B5TB 2VB0A 4XOJA 1LHGH 2ZECA 2BM2A 1V2VT 3EDXB 3RXFA 1GI1A 2FI4E 1ETRH 4YTAA 3ZZ9A 2UUYA 2QXGA 1EJMA 1GHVH 3MH5A 3A81A 2AEIH 2K1QA 5JYIA 5C1YA 1VCWA 1QURH 4Y8XA 1N8OC 1GCTC 2QAAA 4FUEA 2VGCB 1JOUB 3Q77A 1UVOA 1IQJA 3RMOH 5SGAE 1JIMA 1V2PT 1E38B 1EPTC 3GCHC 1C4V2 2XWBI 1HAVA 1MQ6A 2R0KA 1GBCA 2HRVA 1P2MA 1G32B 1BB0B 4X1NU 4CREA 4LXBH 4GLYA 4KTUA 2THFB 1O3IA 2F9NA 5FXLA 4ABHA 1YBWA 3ZZCA 1C5XB 2G51A 2J9NA 1K1NA 4CR5A 1GBIA 1C4Y2 1PJPA 1TGCA 1IQHA 2VIDA 2F3CE 3P70B 1GBFA 4BNRA 1CA0C 2BQ7B 7LPRA 2H5DA 1F2SE 1TMUH 4X2VA 2ZU4A 5C2ZA 3NPSA 1VGCB 2FI5E 2FOBA 1B7XB 4OS1A 4IBLH 1O32A 1TAWA 3ZZ3A 1H8DH 1LTOA 1MCVA 1SGEE 3EGKH 2GKVE 3NUMA 5GIBA 1SQTA 2NU3E 1LPGB 3VFEA 3TLOA 4B73A 3SNEA 1GI7B 3UOPA 1H4WA 3GCTF 3ZZ7A 2VIPA 1O2HA 2TBSA 1WQVH 1C1PA 3T28A 1GJ4H 1PQAA 1K1OA 3TJUA 4RN6A 3GOVB 1GDUA 1GG6C 2VH6A 4X6NA 4JZDH 1G9IE 5DKMA 3RMLH 4ISNA 1TPAE 1EAUA 1QA0A 3SGBE 1HJ8A 1NRSH 1F5RA 2GDEH 4YZUA 1ZTKA 5T6DA 3SJIA 4BOHA 2VWMA 2UWPA 1UTOA 3KIDU 3PTBA 2ANMH 5L6NH 2BDIA 4JCNA 3MU1A 5A8YA 3CP7A 2JKHA 1HV7A 1O36A 1QQ4A 4TY6A 1NTPA 1MUEB 3VGCB 1NFUA 1V2WT 2WPIS 2Y82A 1G3DA 1JBUH 3KN2A 5HMAA 2QCYA 1HAPH 4ZXXH 3SV9A 4D7GA 4KGAA 2BXUH 4AB8A 3U98H 4X1PU 2BLOA 1BBRK 3H5CB 2BDBA 3RU4E 4K69A 1F0RA 3UQOA 3KL6A 3UNSA 3P17H 2R0LA 1O35A 4ABBA 4F4OC 3M35A 1THRH 2FX6A 1KTTB 3RLYH 1C1VH 3SW2B 1AN1E 3LH1A 1T8LA 1BOQA 3GY6A 4FUHA 1AU8A 1MMJN 4ISOA 5AVDA 1DXPA 1KLIH 1L2EA 2FTMA 1HB0B 3EE0B 1YPKH 3RXPA 4ZUHA 5A0CA 3EA7A 1GHXH 5TJXA 4NCYA 2ZFPH 5E2OA 2FP7B 1BRBE 3DFLA 1O3OA 4MDSA 3ZZ8A 3VXFH 4JYVH 2GV7A 1TNHA 1SGTA 1F0UA 4I32A 2GCHG 4DVAU 2J34A 1EB2A 2XBVA 4OGXA 1O3FA 2YOLA 3U1JB 1FLEE 1EAXA 3BN9A 2Y5GA 3GY7A 4JZEH 4FU7A 1ZMLA 3FVFB 4VGCC 3TITA 3P92A 2BY6X 1O2YA 1BMMH 4UONA 4UD9H 3URCA 1VITG 4I33A 4U01A 3MH4A 2BX3A 1IQFA 5DP3A 1J9CH 1K28D 2I6SA 3KQDA 4IN2A 5C1UA 4DT7B 3LDXH 1BTWA 1UHBB 1ZMNA 2A2QH 1FUJA 3JZ1B 1DLEA 3U9AH 2ZHDA 1RFNA 1LVYA 1SFQB 3QTOH 2ZDVH 1TMBH 3MYWA 1GBKA 2PKSC 4INHA 1CE5A 1ESBA 1KXBA 1MKWH 2UUJB 1SGRE 2VINA 4IMZA 1UTNA 2EI6A 5E2PA 1S83A 1OOKB 1BCUH 5FPSA 2BYAX 3RLWH 4CRBA 1XUHA 4CRFA 4X2XA 4NA8A 2Z9KA 3PYHA 2VVUA 3SQEE 1SGIB 1O2XA 4MPWA 3CS7A 1BMLA 1GI3A 1KXDA 1GHWH 4FU8A 1NO9H 2SNVA 2FS9A 2ZDNA 4RKOB 1YC0A 2ZDKA 5DPAA 4GSOA 1YF4A 1O5BB 2C90B 3MNSA 4YT7H 4UFGH 4ZKNU 2BD5A 1QNJA 1G2MA 1DUAA 4MLFB 3FAOA 3K9XB 2JH5D 3HPTB 1G30B 2PW8H 1WAYB 2G5VA 4IMQA 1WBGB 1NRPH 1QFKH 5AHGH 3LKWA 2XCFA 3RXVA 3ZZAA 3HGNA 1TGNA 3I78A 3S9CA 1FY8E 2WV4A 2BY9X 3H7TA 4JK6A 2PHBA 2HLCA 4I8KA 3NXPA 4AORA 2UWOA 2WUCA 5EW2H 3KEEA 2M5TA 2FX4A 2VJ1A 4Y6DA 4MPUA 1NFXA 1TIOA 1A1RA 2QIQA 4IN1A 2GMTC 1QBOA 2W3IA 3SNDA 1M9UA 2J94A 1AUTC 1EB1H 4MPXA 1MD7A 1GGDC 2QF3A 1LDTT 3O8RA 1O3KA 1HXEH 3LC3A 2ZDLA 3SGQE 3RC5A 4TY7A 2XC0A 2H2ZA 2SGPE 5DK1A 2B9LA 5ABWA 1NRRH 2FYRA 1C9PA 2XCNA 3QK1A 3LJOA 4TPYA 4B2BA 1O2JA 1UMAH 1O2PA 2ZG0H 3HK3B 3RXRA 3KQEA 1G37A 4YLUA 1ELGA 3RXBA 2QGRA 1LVMA 4OS2A 1FXYA 1MZDA 1SFIA 1GBDA 3SQHE 1WTGH 3FP6E 2FESH 5JDUB 2PSYA 3T2NA 1SHYA 2NU1E 1DT2A 2GD4B 1C4U2 2ZZUH 3GDSA 2SGFE 1SL3A 1SQAA 2BMGB 4BAHB 1GJBB 1EUFA 1MBQA 1ZOMA 4AFUA 1CO7E 3VEQB 1FY1A 2ZFTA 3KQBA 2Y5FA 1SHHB 1BBRE 1TNKA 1A5HA 4IC6A 4AYYB 5DP4A 1MKWK 3MU5A 1IQGA 2FOGA 3ZVDA 5C20A 3SU0A 4KELA 2ZHQH 3TNTA 3BEIB 2W3KA 3P95A 1QL8A 4ABFA 1BRAA 3IG6B 4NIYA 5E0GA 5EXMA 1QB6A 5EXNA 1D3TB 1XM1A 1LHFH 1S5SA 4BTTB 1WSSH 2ZCLP 2G5NA 4ZHAA 2F83A 1XKAC 2FWWA 1FN8A 1LHDH 2Y5HA 1UTPA 1GVKB 5J4SA 3T26A 1UVSH 2G81E 1P04A 4MTBA 4THNH 3RU4T 2BQ6B 4A1TA 1YPHE 1NFWA 2O8MA 2ZPQA 4K60A 1DVAH 1ZPZA 1UTKA 2HGTH 1QTFA 5B6OA 1OX1A 1B0EA 2WYGA 2EI8A 3SOSA 2D2DA 1ETSH 1MH0A 1K1IA 1C2KA 2NU4E 3VXEH 1THPB 4UDWH 6ESTA 4FUBA 2F9VA 3GDUA 4AOQA 1RTFB 3HGPA 4WH6A 1OP8A 3VB4A 1ZPBA 4E7RG 4F49A 2CF8H 3GYMA 3PWCA 4GUXA 1HAOH 1L1NA 5FPYA 1C1QA 2BY5X 2BD7A 2JH6D 1BHXF 1PYTC 1CBWB 2ALPA 3F9HA 1TNIA 2P3FH 1HFDA 3GISB 3SI4H 1FIWA 4A5TS 3ODFA 2ZP0H 3ZVFA 2R3YA 2ZTZA 1C2DA 1CHGA 2FLBH 2P16A 1WV7H 1KXFA 3SV8A 2ZEBA 5EQRA 4DCDA 3E1XB 1YLCA 2FOMB 1WCZA 3MNXA 9LPRA 1D6RA 2C3SA 1BHXB 1G2LA 4GVUA 1OWJA 1V2OT 3D23A 3T62A 1XXFA 1ELTA 2EA3A 5FPTA 2VGCC 4OS4A 2A31A 4MQAA 4D76A 1LMWB 2CMYA 2ANYA 4X8SH 3V13A 3GCOA 1NC6A 1IHTH 1O2TA 1T8NA 1OYTH 2PGBB 2HPQH 5A0AE 5FX5A 1AWHB 2VIWA 1ZMJA 2OQUA 1ZLRA 5AFYH 4D8NA 1J8AA 3M5OA 3DFJA 1LVOA 1MTUA 3ATIA 2W7SA 3FANA 2ZA5A 1C1WH 3F68H 1GI2A 3UNRA 1L4ZA 1MD8A 5C1XA 1QBNA 1C2EA 3KCGH 3U8TH 3UREA 5JBTA 4JYUH 1AFEH 1C5UA 1OKXA 3ESTA 1T31A 4WVPE 2RCEA 3MH6A 2PKAA 3BTKE 5ESTE 1VGCC 4MNWA 4X1SU 1G3EA 4WF8A 3A7ZA 1SPJA 4AFZA 4JK5A 3EQ0H 3TIUA 4ZHLU 1B0FA 1NFYA 1RTLA 1O3HA 2GX4A 1YYY1 2KAIA 3K65B 1GHBF 1GBEA 3RXAA 2V3HH 1Y3UA 1EP6A 3LGYA 3E90B 1V2LT 5T3HA 2ZHWH 1AGJA 1O3DA 1UK2A 2TPIZ 2C8XB 3GY5A 1N6YA 3SV2H 1Z6EA 3A7WA 1TE0A 1HAYB 4CRCA 2AS9A 3VPKA 2PWXA 2Z6BD 1SGNE 3JZ2B 1AWFH 4WMEA 1H8IH 1PPCE 3VGCC 1F0SA 1Z8JB 5HYOA 4NWKA 1KY9A 2OUAA 1QL9A 1G3BA 3A7YA 1FPHH 2ODQA 1SSXA 1QB1A 5L30H 4X2YA 1GI9B 5EODA 3KHVA 1HAHH 3LGWA 8KME2 1OXGA 4LZ4B 2DE8A 1BT7A 1YP9A 3HATH 3K6ZA 4I8LA 1X7AC 2AMQA 2BVRH 1WQSA 5F8TA 1W13U 1P2JA 4K3JA 4YO9A 4ISIH 3MFJA 1GJ5H 1GHAG 1JIRA 3MH7A 4OS7A 5ESBA 3ZZ6A 1YCPM 1GMHG 2A1DB 4WXIA 5TCCA 3RXSA 2OD3B 4HI3A 3M36A 1F92A 4ASHA 1DPOA 3TK5A 2F9BH 4DJZB 1AB9B 3Q3XA 1ANDA 4IS5A 2FI3E 3SV6A 1C2IA 2O8LA 1P2OA 3A83A 2BOHB 1ZSJA 4BAMB 2OCVB 3BEUA 1TBZH 1YCPH 2BX4A 2P59A 2XTTB 1DY8A 2ZU1A 3OY5U 3QUMP 4K5ZA 1FN6A 3SUFA 1AHTH 1W8BH 2ZGCA 3BTHE 1C5SA 2O8WA 1SGQE 2D8WA 3MNCA 5A09A 2XW9A 4GAWA 1ZGIA 1FDPA 1HXFH 1XUIA 1A2CH 5C67A 1QY6A 3RXDA 2GGVB 1YPLH 4O03A 1W0YH 4B71A 1K2I1 4INLA 1IOEA 1BA8B 2WPMS 8ESTE 2BDCA 1BIOA 1FI8A 8GCHF 3PTNA 4FUFA 1TRYA 2EI7A 3SBKA 5DO4H 1SVPA 2A5AA 1VITH 2QF0A 3SUGA 1EX3A 1AKSA 2CV3A 2H5CA 3QWCH 2C8YB 1ANCA 2FMJA 2Q6GA 1MTWA 1TGTA 2ZTYA 3SNCA 1GBBA 5DGJA 3MTYA 1ETTH 1K22H 2NWNA 1OWIA 1DX5M 3SJ8A 1QQUA 1MU8B 2BLWA 3BG4B 5CHAB 5FCRA 3NKKA 3SU2A 1EPTA 3UIRA 3U8OH 2PUXB 1GI6A 1IQMA 3LPRA 1C5LH 1MAXA 1D3QB 2FYQA 2ZHFH 1OWDA 1ZJKA 3M61U 1MTVA 3MU0A 1XXDA 8LPRA 5LH8A 1C2HA 1C5YB 1Y3XA 6CHAC 1OPHB 1CGIE 4GCHG 5A8XA 2P8OB 2PTCE 4MG3A 1O2VA 1FIZA 1DWDH 4O97A 1C5VA 2XXLA 3LJJA 2BD9A 4WJG2 3S7HB 4AZ2B 1C2GA 4K1SA 1ZSKA 3ZYEA 1HAVB 3ZVEA 4FU9A 1O5DH 1RD3B 3SGAE 1BTYA 3EYDA 5EW1H 1Y3YA 1BTXA 1LKAA 4ZXYH 4QT8C 2SGQE 2BD3A 3AW0A 4MPVA 2BD2A 5GCHF 5FBIA 1O2RA 5L2YH 1C1OA 1ELEE 1O3MA 2ODPA 1AFQB 2Y80A 3A89A 1QCPA 2ZGXH 1TOCB 4Y8YA 5F8XA 2W7UA 2OTVA 3M37A 1GJAB 1W0ZU 1TA6A 3LU9B 1TB6H 4TYDA 1VJ9U 1AVWA 2AMPA 1ZZZA 4CBNA 4Y7BA 2H9EH 1UK4A 4Y8ZA 1SQOA 4Y11E 1YCPK 3E0PB 2GZ7A 4JZ1A 4Y0ZE 1N8OB 3A8BA 2XBXA 1ELCA 2A4OA 3OYPA 4LOYH 1YLDA 5A0BA 3A82A 3UUZA 2P3UB 3VB7A 3ZVBA 3VB3A 3ZVCA 1QR3E 4Y0YE 2A32A 3TJVA 1DWEH 1GJDB 1SLUB 3M5MA 4O3TA 4BXSA 1KDQA 2BVSH 2QY0B 1O2IA 3ITIA 1RXPA 1KXAA 3OX7U 1BTPA 4BAOB 4D7FA 1SGYE 1GMDG 3RXUA 3D65E 1FPCH 1C5RA 3SI3H 3SN8A 1ZHRA 5E0JA 1O3JA 2GCTB 3M7UA 3ZZ5A 1P0SH 2ILNA 3ATWA 3BTGE 1MAYA 4ZAEA 3ZVGA 2Z94A 2OC1A 4DOQA 1TWXB 2C8ZB 2AGGX 4JZIA 1GMCG 1BTZA 3GCNA 3N7OA 3PROA 1OS8A 2WPKS 1Z8RA 2ZIQH 1P57B 3NWUA 1JRSA 1EAIA 1SGCA 1AMHA 1LKBA 3A80A 5EQSA 3QGJA 4UE7H 3KQCA 4ABIA 2GZ8A 4OS5A 3SJOA 4AFSA 4CR9A 1Z6JH 5JB9S 1GDNA 5LPEA 2Q6FA 3SORA 1NT1A 1OWKA 3PO1B 2A7JA 1GG6B 4TWYA 3K6YA 1O3CA 2FOAA 1A0LA 1SLXB 2TGTA 3BTWE 1PPBH 1CQQA 1O3EA 1O2UA 2XC5A 5F6MA 1AVGH 1CGJE 4LZ1H 1NPMA 4O3UA 4D9RA 2BDAA 1CT4E 1DICA 2HOBA 1W2KH 3M3SA 1TNJA 1DITH 3TJOA 3DHKH 2BLQA 2FEQH 2O8UA 2WPHS 4A1XA 2Q1JA 3B9FH 5LPRA 2CF9H 2WV5A 3RXGA 3OSYA 3TK6A 2BZ6H 2GT8A 3FP8E 2EEKA 3TH4H 4SGBE 1TYNA 2ZFQH 4K8BA 1GBLA 4NGAH 1J17T 1EAWA 3MI4A 1L0ZA 2FODA 1O2NA 1MCTA 3TNSA 4X1QU 1T4VH 7KMEH 4BAQB 1BTHH 3MHWU 1GDQA 2TGPZ 4E05H 1EZSC 4B74A 3BV9B 2Y7XA 2BD8A 1SI5H 4DGJA 1CBWC 3QZQA 3SHCH 1GHZA 1SC8U 4H4FA 4OS6A 3SUEA 1TABE 3RXMA 5HM2A 1DWBH 5C3NA 4XFQA 4KP0A 4HGCA 2A45B 1GHYH 2R2WU 3GCTG 1Y59T 3QN7A 4NA9H 3S9BA 2JETB 5IYTA 2BDYA 6GCHG 1OSSA 3M5LA 1HIAB 3P8GA 4NZQA 1A61H 2EC9H 2FDAA 2ZNKH 1PPHE 1A0HB 2NU0E 4AFQA 1TPPA 1Y8TA 3STJA 2OC0A 4CH8B 2XWAA 1V2ST 5L2ZH 1SB1H 4FUIA 1E35B 2FO9A 1MTNB 1QJ1B 2HNTF 2ZGJA 2R3UA 3RP2A 4YOGA 1EJNA 3PMHB 2XC4A 4X6MA 2CGAA 3ZYDA 1RIWB 1HAXB 4ESTE 1FONA 2F91A 4A7IB 1TPOA 4FUCA 1UVTH 5GDSH 3C1KA 4X6PA 2J2UA 3DD2H 2WUBA 2VH0A 1ZHPA 1AZ8A 1P01A 1T8MA 1CHOF 2ESTE 2C4FH 3QLPH 2VVVA 1C2MA 4J2YB 4WWYA 3ODDA 1XMNB 5T6FA 3Q3KA 5K0HA 2ALVA 1QJ6B 3MO9A 1LQDB 4ZH8A 3RMNH 1TNGA 1EATA 3MU4A 1Q2WA 1XUJA 2PTNA 3UOUA 2ODYB 1D9IA 1BTUA 1GI4A 1N1LA 1WOFA 1SGDE 3V3MA 1EQ9A 4Q2KA 1RS0A 2A7HA 2QA9E 1F5LA 1O3NA 1WTHD 1PPGE 1GHAF 2QN5T 1O5GH 2ZGBH 3BTME 1P2IA 3B8JA 4Z6AH 5JB8S 2BB4A 1GVZA 4ABEA 1K1PA 1YM0A 4A6LA 1ZRBA 4HTCH 1OP2A 3PM3A 1P06A 1S84A 4AG1A 3PMAB 4U30A 2SNWA 3L6PA 3QTVH 3RM2H 4I7YH 1P11E 5HXFA 1TA2A 1P8VC 3P8FA 2Y7ZA 2Z9JA 5I46H 4HZHA 1S81A 2J95A 4IC5A 4TPIZ 4X8VH 1ZTLA 1K1LA 2VWLA 3T25A 3TGKE 1INCA 1NRQH 4BTUB 1QIXB 4WY3A 2FLRH 2ZFSA 3KNXA 2H9TH 1TGSZ 4UEHH 3G01A 4I8JA 1QJ7B 1HGTH 1BQYA 2SFAA 4H6SB 1O39A 1W7XH 1P12E 2YNBA 2WPLS 2VU8E 3RXOA 5BRRE 2FOFA 3MU8A 2Z7FE 1SMFE 1TX6A 3LGTA 3Q3YA 3UWIA 2TIOA 1NS3A 2ZHEH 1YPHC 3UFAA 1T8OA 2A4RA 4JZFH 3V12A 1FV9A 2PSXA 1GJCB 3T29A 1QL7A 4FXGH 2Z9LA 1RRKA 1EOJA 5C5OA 1P10A 4Z0KA 1P2NA 4RSPA 1ELDE 2GMTB 4NIWA 2FXRA 3UWJH 1P9UA 2H1UA 3FZDA 3UY9A 1IQNA 3HK6B 1ANEA 1GCDA 4R0IA 1SBWA 3U69H 3EA9A 3NZIA 2BTCE 3TPIZ 1DXWA 1AB9C 4KKDA 2CHAB 1O3BA 1ID5H 1O0DH 1NROH 5TCAA 1GJ9B 1D4PB 3Q00A 2ANKH 3BG8A 1UK3A 2ZU2A 4GCHF 2A4QA 1TONA 1AD8H 4DY7B 2ZFFH 3A8CA 1UTQA 1HAIH 1TX8A 3M3VA 4GHQA 1UCYH 4AYVB 3M7TA 3LC5A 1WYKA 4ZROA 2DUCA 7GCHG 2R2MB 3TVJB 1DE7H 1ZSLA 4ZKOU 4MVNA 3RXQA 1IQEA 2BVXH 4FVDA 1C5MD 2WPJS 1ESAA 1ANBA 3SNAA 4ZMAH 3UR9A 1A7SA 1C1NA 1SLWB 2QV1A 2HWLB 3BSQA 1V6DA 3BIUH 2VIVA 5DP9A 1BITA 2XBWA 2QXHA 1EZXC 1NY22 2GDDA 1MU6B 1C1SA 1KYNA 3P6ZB 1Z1IA 4X0WU 3RUOA 1O33A 3FFGA 4K2YA 4UFEH 1GL0E 5JBCS 2VIOA 1O2WA 4NIVA 4INKA 5EQQA 1MQ5A 3BG4C 1ZJDA 1UTJA 5CHAC 4ABJA 1W11U 2A0QB 2AYWA 1C5TA 3TU7H 4B76A 2FOEA 1QHRB 1QGFA 4FUGA 2VIQA 3A85A 4GHTA 1C5WB 3EAJA 1QB9A 3L3TA 4AG2A 4ZKSU 1C2JA 1EP5A 2IN2A 2PUQH 1TPSA 5EGMA 1SG8B 1F5KU 1EZUC 3SJ9A 1HJAB 2GCHF 2A5KA 3A87A 5GWZA 1GBMA 4JMYA 3O8BA 3SNBA 2AERH 4CRDA 1Z1JA 2P8OC 2ZTXA 3F9GA 1OWEA 1IQIA 4YOJA 1DOJA 1HNEE 1YPEH 3LOXA 2PFEA 4BANB 1A46H 2AGEX 2G00A 1HAGE 1TBRH 2CXVA 2UUKB 1DY9A 1VITF 3SV7A 1K9OE 1LPKB 5CMXH 4CRGA 1AIXH 4IW4E 4U2WA 3AAUA 1LPZB 2TGDA 3P8NA 3SU1A 1TNLA 5IDKA 3SU3A 3ZVAA 5JBAS 1ZYOA 2FM2A 2B0FA 1PPZA 1TOMH 3E8LA 3LONA 1AFQC 2F9PA 1Q31A 4ABAA 1TRNA 1ARCA 2PKAB 4AGKA 1K1MA 2H9HA 1V2RT 3BEFB 1UVPA 2A4GA 3S9AA 3Q76A 1BDAA 3DA9B 5GXPA 4XBDA 1S85A 1TBQH 2BY8X 2RA3A 1TRMA 3LIWA 1NN6A 4RKJB 1GVLA 1V2UT 5DP6A 2KAIB 1YGCH 4UFFH 4ISLA 1SGFA 1O34A 1P03A 5EPYA 1L4DA 2QC2A 4XBCA 4DURA 1KLJH 1A5IA 1UCYK 1HRTH 2I6QA 3ZV9A 3RC6A 1FNIA 3SU4A 5DP7A 4AN7A 2AIPA 5EOKA 1GJ6A 2QXJA 3F9FA 3RXHA 3ATLA 1YPJH 1UJ1A 3QX5H 1C5NH 2ZI2H 2FS8A 5AF9H 1HLTH 4I8HA 2G55A 3SO3A 1PQ8A 4ABDA 2B7DH 1FQ3A 1B5GH 4MNYA 1CT0E 4Q80A 1Z7KA 2Z3DA 3GY4A 2GCTC 5FAHA 2V6NA 3M3TA 1V2JT 1BMNH 2A2XH 1ZRKA 1ELAA 4D9QA 1DFPA
chains in the Genus database with same CATH superfamily
2NU2E 1RTKA 2Z9GA 1PPFE 1W3CA 3F9EA 1TQ7B 1THSH 3E6PH 3UTUH 2GTBA 1DM4B 5CHBA 1CA8B 1RJXB 4HFPB 4CH2B 1Z8GA 1P3CA 1KXCA 2WPDD 2FOCA 4CHAB 3SU6A 1QA7A 1T4UH 3SZEA 6GCHF 1ELVA 2AGIX 3M5NA 3OEHD 3PO1C 3RXEA 2KCAA 5J4QA 3VB6A 1V2QT 2XNIA 1C5ZB 1XUKA 1BRUP 3R0FA 1OP0A 2JH0D 1T32A 4B2AA 5BPEA 3UQVA 1AE5A 2BQWB 1IQKA 3LH3A 5DP5A 4CRAA 3F1SB 4B1TA 1O2KA 3MWIU 2PGQB 1ZTJA 3GY3A 5GJ4B 2Y81A 1W14U 3LT3A 3I77A 1U6QA 1P09A 3A88A 4X6OA 1P2QA 4FUDA 3RXKA 1UHBA 2Z3EA 3E0NB 4YESB 5T6GA 2HALA 3VB5A 1CU1A 3O8CA 2GP9B 2FZZA 1S6FA 5HGGA 4WMDA 4TWWA 3F0OA 2VVCA 4RI0A 3OEED 4UFDH 1GPZA 3STIA 3CENA 1AY6H 6LPRA 1ABJH 1TGBA 5DSFA 5I25A 1IQLA 1BZXE 2M2AA 1PQ5A 5A2MH 3RM0H 3QO6A 4X2WA 1C1TA 1O2SA 3E91A 4K8YA 2ZQ1A 1PPEE 2UUFB 4XSKU 1BJVA 5FBEA 2RA0A 1WUNH 2UWLA 1AKSB 5H4IB 3TJNA 5HIZA 1SGPE 2J92A 3RMMH 3SZNA 1ELFA 1O30A 1TFXA 4LK4A 1GCTB 1Y5BT 1ZHMA 2OC8A 3ELAH 3D49H 3V0XA 1AZZA 2KM0A 4YLQH 2ZC9H 3ZZBA 1XVMA 3EA8A 1GHBG 2JETC 1W0KD 1EPTB 1GI8B 3GCHB 1P02A 3BTDE 3MMGA 4IGDA 1GBHA 3U1IB 1GJ7B 3ENSB 3QGNB 1JMOH 2ZWLH 4X1RU 3LGIA 3BIVH 2HNTE 4AB9A 1LQEA 2QYIA 3S0NA 3EE7A 4NWLA 2HPPH 1O31A 3BTFE 1MTNC 3TH3H 2GT7A 2OP9A 1BUIA 1A0JA 2WINI 3WW7A 1J15A 1V2KT 1A3EH 1W10U 3A7XA 1RIWC 3I29A 2VWNA 1CA0B 1EASA 1QBVH 1EZQA 1A3BH 2WSSD 3IWMA 1DUEA 2KR7A 5A8ZA 3L33A 3LGUA 1ZGVA 4ABGA 2P3TB 1Q3XA 3NCLA 2OK5A 1N6XA 3T5FH 2QXIA 1GWAA 1EXFA 1SOZA 3GYLB 2W6ID 4DIHH 1A4WH 2LNCA 4Q4LA 2A5IA 1Y5AT 1S0RA 1D3DB 1HUTH 1PFXC 1L1GA 2HNTC 5F8ZA 2BZAA 2P94A 2YNAA 1QRZA 1SR5C 3OTJE 2RDEA 2PLXA 1EJAA 2XRCA 3TH2H 7ESTE 3T27A 3S69A 1KTSB 1HIAA 4E7NA 3WY8A 1VCPA 3PV4A 3TGJE 2FOHA 5EXLA 5LPFA 3A8DA 3PMBB 1HCGA 1NZQH 3QZRA 4NA7A 5GPIB 1KXEA 4SGAE 2K0QA 2RFKC 2XOKD 2Z9IA 1TLDA 5F03A 5CE1A 1DLKB 1HDTH 3V7TA 2OC7A 3PLPA 3S7KB 6CHAB 2ZU5A 3BTTE 3U8RH 4X8TH 1O2GH 4XDEA 1TMTH 4Q7YA 1O5CB 3BF6H 1HYLA 3BTEE 1FY5A 2V0BA 2O9QA 3C27B 3M7QA 1F7ZA 1E0FD 1UCYE 3F6UH 3QDZB 2G4TA 2ZDAH 1UTMA 2D1JA 3SJKA 1YKTA 1O3LA 1JXPA 4U32A 2G8TA 1NESE 3A7VA 3MOCA 1F0TA 2J5UA 3PWBA 3P8OA 4AGJA 2PR3A 4WH8A 4Q7XA 8GCHG 1GI0A 1KDQB 4BTIB 1D6WA 2OBQA 1RGQA 2SGDE 7GCHF 1P3EA 3RXTA 2ASUB 5JPMH 1BRCE 1IHSH 1LHCH 2HVXA 4ISHH 2OQ5A 4Y71A 4NFFA 1JRTA 4P02A 1BMAA 1DDJA 4OM9A 5AFZH 4AX9H 1GBJA 1FY3A 1SGFG 1AO5A 2BD4A 1CVWH 2XYAA 2FIRH 1ARBA 2G52A 3UNQA 3RU4D 4KTSA 1Y3WA 3LGVA 1YPMH 4I31A 2Y6TA 2CJIA 4Y7AA 4XBBA 1EKBB 3AASA 1L1JA 5C5NA 2V7QD 4Y79A 4HG6A 5E8EH 2LPRA 1DWCH 2ZCKP 3CS0A 3OU0A 4YT6H 2ZPSA 4F55A 4H42U 2CHAC 2OLGA 1FX0B 2BDGA 3GY8A 2F9UA 3B23B 1E34B 1CGHA 1LO6A 4X8UH 4FUJA 2A7CA 4DG4A 2STAE 3D62A 4VGCB 5C0TA 4Q7ZA 2O8TA 3UR6A 1QRWA 2BXTH 2P95A 1ORFA 3AVZA 2OINA 2QF4A 3HKJB 4Y10E 1FMGA 4ZKRU 1T7CA 2CN0H 3GDVA 1SQRA 1H9HE 5LGOA 1Y3VA 3ATKA 1P9SA 3HKIB 1O37A 2YMSC 4R8TB 5G4BA 1O3GA 1O5FH 2RDLA 1COWD 5GCHG 2W26A 1LVBA 1MKXH 3E16B 4B2CA 2PKSB 4FVBA 2AH4X 4WMFA 1MTSA 3RXCA 1IAUA 1YPGH 3PB1E 5EPNA 5DG6A 3H7OA 2ANWA 2Q6DA 1E36B 1GMHF 2W5EA 4B75A 2ZFRH 1FAXA 2K8IA 3FP7E 3UAIC 1GJ8B 3AAVA 3RXIA 3IITA 2IPHA 3F2GA 3PLBA 4NSVA 4Y76A 1AUJA 1ZR0A 3CNRA 1KSNA 3DT0H 1UVUH 1LCYA 1SKYE 2BOKA 1O2QA 1XX9A 3RC4A 3OY6U 2ZO3H 1VJAU 3A8AA 3FZZA 1AI8H 1C1RA 2VWOA 1SLVB 2DE9A 2FPZA 2IJOB 1HJAC 5DP8A 1YLNA 1S0QA 2RG3A 1C2FA 4A1VA 3ZZ4A 1TQ0B 1XKBC 4JYTA 1DSUA 1KLTA 1S82A 2GVFA 1V2TT 1TALA 1D3PB 5JBBS 2OXSA 2BLVA 2V35A 4NZLA 5EG4A 4BXWA 1H1BA 1O3PB 1ESTA 1O2OA 4MNXA 3A84A 1O5EH 4ZHMU 4J1YA 3AW1A 5E0HA 1P2KA 4NSYA 4I8GA 1MZAA 2J38A 2ZCHP 2AIQA 2SGAA 2PV9B 1ACBE 1NU7B 2IOTA 3W1EA 3TGIE 2KZ4A 2ZPRA 3NK8A 2GZ9A 4KTCA 3RDZA 2D26C 1MBMA 1GGDB 1SOTA 1NRNH 1FJSA 4MNVA 4NG9H 5C17A 2ZU3A 1O2ZA 1V2NT 4YM9A 2ZDMA 4CBOA 3PMJA 1S6HA 3DUXH 3MO6A 2BHGA 1E37B 2P93A 4BAKB 4H6TA 1J14A 5HM9A 5C94A 2C8WB 5K7RA 1O2MA 2ULLA 5PTPA 3W95A 3ZZDA 1TX7A 1EOLA 1QRXA 1ELBA 2STBE 3A86A 2R9PA 1H9LB 1LHEH 4M7GA 5EIYA 3RXLA 1Z8IB 1DS2E 1GBAA 4WXVA 1BJUA 1DSTA 3RXJA 1FZZA 2C93B 1HBTH 1G3CA 1KIGH 3W94A 3GICB 1C1UH 1JWTA 2ZKSA 2J4IA 2Z3CA 3R3GB 4NIXA 3SU5A 1MKXK 5GNDA 1O38A 3ATMA 4PROA 1GBTA 3BTQE 2ZQ2A 2B8OH 2BDHA 5FHTA 4E06H 9ESTA 2VNTA 4OGYA 3E3TA 3MNBA 2SGEE 1AE8H 1O5AB 1NM6A 1ABIH 1MABB 1CT2E 4DIIH 1C9TA 1Y5UT 2F4LA 1C5OH 2ZGHA 2V3OH 2GV6A 1AQ7A 5FCKA 1GL1A 1A5GH 1VCQA 4GPGA 1O3AA 1J16A 3A7TA 1WU1A 1E1RD 1W7GH 3SUDA 4XE4A 3GY2A 3SHAH 5B6LA 1UO6A 1XVOA 1P05A 2FTLE 2XBYA 3KF2A 1K21H 1G36A 1W12U 1V2MT 4CHAC 3ZV8A 1XUFA 5FX6A 4K1TA 2ZF0H 3URDA 1VR1H 2WYJA 1C1MA 1C2LA 1NU9A 1UTLM 1C5PA 4A92A 1PQ7A 1GI5A 1OYQA 2AMDA 1CSOE 1DANH 1S6LA 2TRMA 5DN6D 1HJ9A 1VZQH 3K2UA 3PLKA 1PYTD 4YOIA 1XUGA 2BY7X 1FY4A 4NFEA 5ETXA 4K1EA 1GMDF 1AVXA 4O9VA 1CHOG 3H09A 3UPEA 5DJ7A 2F9OA 3KGPA 1ZPCA 4DW2U 2OBOA 1HPGA 1K1JA 3O8DA 1H9IE 1GMCF 1O2LA 1V3XA 1OWHA 1C5QA 1HAZB 1FAKH 3MO3A 2AFQB 2H6MA 1Z71A 2TGAA 5EU8A 1BBRH 3TK9A 2G4UA 2B5TB 5IK2D 2VB0A 4XOJA 1LHGH 2ZECA 2BM2A 1V2VT 3EDXB 3RXFA 1GI1A 2FI4E 1ETRH 4YTAA 3ZZ9A 2UUYA 2QXGA 1EJMA 1GHVH 3MH5A 3A81A 3WWFA 2AEIH 2K1QA 4I86A 5JYIA 5C1YA 1VCWA 1QURH 4Y8XA 1N8OC 1GCTC 2QAAA 4FUEA 2VGCB 1JOUB 3Q77A 1UVOA 1IQJA 3RMOH 5SGAE 1JIMA 1V2PT 1E38B 1EPTC 3GCHC 1C4V2 2XWBI 1HAVA 1MQ6A 2R0KA 1GBCA 2HRVA 1P2MA 1G32B 1BB0B 4X1NU 3PRBA 4CREA 4LXBH 4GLYA 4KTUA 2THFB 1O3IA 2F9NA 5FXLA 4ABHA 2L74A 1YBWA 3ZZCA 1C5XB 1QZ8A 2G51A 2J9NA 1K1NA 4CR5A 1GBIA 1C4Y2 1PJPA 1TGCA 1IQHA 2VIDA 2F3CE 3P70B 1GBFA 4BNRA 1CA0C 2BQ7B 7LPRA 2H5DA 1F2SE 1TMUH 4X2VA 2ZU4A 5C2ZA 3NPSA 1VGCB 2FI5E 2FOBA 1B7XB 4OS1A 4IBLH 1O32A 1TAWA 3ZZ3A 1H8DH 1LTOA 1MCVA 1SGEE 3EGKH 2GKVE 3NUMA 5GIBA 1YY3A 1SQTA 2NU3E 1LPGB 3VFEA 3TLOA 4B73A 3SNEA 1GI7B 3UOPA 1H4WA 3GCTF 3ZZ7A 2VIPA 1O2HA 2TBSA 1WQVH 1C1PA 3T28A 1GJ4H 1PQAA 1K1OA 3TJUA 4RN6A 3GOVB 1GDUA 1GG6C 2VH6A 4X6NA 4JZDH 1G9IE 5DKMA 3RMLH 4ISNA 1TPAE 1EAUA 1QA0A 3SGBE 1HJ8A 1NRSH 1F5RA 2GDEH 4YZUA 1ZTKA 5T6DA 3SJIA 2QE7D 4BOHA 2VWMA 2UWPA 3KYGA 1UTOA 3KIDU 3PTBA 2ANMH 5L6NH 2BDIA 4JCNA 2WV9A 3MU1A 5A8YA 3CP7A 2JKHA 1HV7A 1O36A 1QQ4A 4TY6A 1NTPA 1MUEB 3VGCB 1NFUA 1V2WT 2WPIS 2Y82A 1G3DA 1JBUH 3KN2A 5HMAA 2QCYA 1HAPH 4ZXXH 3SV9A 4D7GA 4KGAA 2BXUH 4AB8A 3U98H 4X1PU 2BLOA 1BBRK 3H5CB 2BDBA 3RU4E 4K69A 1F0RA 3UQOA 2J98B 3KL6A 3UNSA 3P17H 2R0LA 1O35A 4ABBA 4F4OC 3M35A 1THRH 2FX6A 1KTTB 3RLYH 1C1VH 3SW2B 1AN1E 3LH1A 1T8LA 1BOQA 3GY6A 4FUHA 1AU8A 1MMJN 3KYFA 4ISOA 5AVDA 1DXPA 1KLIH 1L2EA 3FOAA 2FTMA 1HB0B 3EE0B 1YPKH 3RXPA 4ZUHA 5A0CA 3EA7A 1GHXH 2WHXA 5TJXA 4NCYA 2ZFPH 3GS9A 5E2OA 2FP7B 1BRBE 3DFLA 1O3OA 4MDSA 3ZZ8A 3VXFH 4JYVH 2GV7A 1TNHA 1SGTA 1F0UA 4I32A 2GCHG 4DVAU 2J34A 1BMFD 1EB2A 2XBVA 4OGXA 1O3FA 2YOLA 3U1JB 1FLEE 1NBMD 1EAXA 3BN9A 2Y5GA 3GY7A 4JZEH 4FU7A 1ZMLA 3FVFB 4VGCC 3TITA 3P92A 2BY6X 1O2YA 1BMMH 4UONA 4UD9H 3URCA 1VITG 3OFND 4I33A 4U01A 3MH4A 2BX3A 5EJZA 1IQFA 5DP3A 1J9CH 1K28D 2I6SA 3KQDA 4IN2A 5C1UA 4DT7B 3LDXH 1BTWA 1UHBB 1ZMNA 2A2QH 1H8ED 1FUJA 3JZ1B 1DLEA 3U9AH 2ZHDA 1RFNA 1LVYA 1SFQB 3DSOA 3QTOH 2ZDVH 1TMBH 3MYWA 1GBKA 2PKSC 4INHA 1CE5A 1ESBA 1KXBA 1MKWH 2UUJB 1SGRE 2VINA 4IMZA 1UTNA 2EI6A 5E2PA 3DSPA 1S83A 1OOKB 1BCUH 5FPSA 2BYAX 3RLWH 4CRBA 1XUHA 4CRFA 4X2XA 4NA8A 2Z9KA 1WXRA 3PYHA 2VVUA 3SQEE 1SGIB 1O2XA 4MPWA 3CS7A 1BMLA 1GI3A 1KXDA 1GHWH 4FU8A 1NO9H 2SNVA 2FS9A 2ZDNA 4RKOB 1YC0A 2ZDKA 5DPAA 4GSOA 2PP6A 1YF4A 1O5BB 2C90B 3MNSA 4YT7H 4UFGH 4ZKNU 2BD5A 1QNJA 1G2MA 1DUAA 5HKKD 5CDFE 4MLFB 3FAOA 3K9XB 2JH5D 1EFRD 3ZIAD 3HPTB 1G30B 2PW8H 1WAYB 2G5VA 4IMQA 1WBGB 1NRPH 1QFKH 5AHGH 3LKWA 2XCFA 1H8HD 3RXVA 3ZZAA 3HGNA 1TGNA 3I78A 3S9CA 1FY8E 2WV4A 2BY9X 3H7TA 4JK6A 2PHBA 2HLCA 4I8KA 3NXPA 4AORA 2UWOA 2WUCA 5EW2H 3KEEA 2M5TA 2FX4A 2VJ1A 4Y6DA 4MPUA 1NFXA 1TIOA 1A1RA 2QIQA 4IN1A 2GMTC 1QBOA 2W3IA 4TT3D 1M9UA 3SNDA 2J94A 1AUTC 1EB1H 4MPXA 1MD7A 1GGDC 2QF3A 1LDTT 3O8RA 1O3KA 1HXEH 3LC3A 4RT1A 2ZDLA 3SGQE 4Z1MD 3RC5A 4TY7A 2XC0A 2H2ZA 2SGPE 5DK1A 2B9LA 5ABWA 1NRRH 4P00A 2FYRA 1C9PA 2XCNA 3QK1A 3LJOA 4TPYA 4B2BA 1O2JA 1UMAH 1O2PA 2ZG0H 3HK3B 3RXRA 3KQEA 1G37A 4YLUA 1ELGA 3RXBA 2QGRA 1LVMA 4OS2A 1FXYA 1MZDA 1SFIA 1GBDA 3SQHE 1WTGH 3FP6E 2FESH 5JDUB 2PSYA 3T2NA 1SHYA 2NU1E 1DT2A 2GD4B 1C4U2 2ZZUH 3GDSA 2SGFE 1SL3A 1SQAA 2BMGB 4BAHB 1GJBB 1EUFA 1MBQA 1ZOMA 3WWBA 1CO7E 4AFUA 3VEQB 1FY1A 2ZFTA 3KQBA 3PV5A 2Y5FA 1SHHB 3F0PA 1BBRE 1TNKA 1A5HA 4IC6A 4AYYB 5DP4A 1MKWK 3MU5A 1IQGA 2FOGA 3ZVDA 5C20A 3SU0A 4KELA 2VBCA 2ZHQH 3TNTA 3BEIB 2W3KA 3P95A 1QL8A 4ABFA 1BRAA 3IG6B 4NIYA 5E0GA 5EXMA 1QB6A 5EXNA 1D3TB 1XM1A 1LHFH 1S5SA 4BTTB 1WSSH 2ZCLP 2G5NA 4ZHAA 2F83A 1XKAC 2FWWA 1FN8A 1LHDH 2Y5HA 1UTPA 1GVKB 5J4SA 3T26A 1UVSH 2WZQA 2G81E 1P04A 4MTBA 4THNH 3RU4T 2BQ6B 4A1TA 1YPHE 1NFWA 2O8MA 2ZPQA 4K60A 1DVAH 1ZPZA 1UTKA 2HGTH 1QTFA 5B6OA 1OX1A 3VG8A 1B0EA 2WYGA 2EI8A 3SOSA 1OHHD 2D2DA 1ETSH 1MH0A 4AC9A 1K1IA 1C2KA 2NU4E 3VXEH 1THPB 4UDWH 6ESTA 4FUBA 1WDIA 2F9VA 3GDUA 1RTFB 3HGPA 4AOQA 4WH6A 1OP8A 3VB4A 1ZPBA 4E7RG 4F49A 2CF8H 3GYMA 3PWCA 4GUXA 1HAOH 1L1NA 5FPYA 1C1QA 2BY5X 2BD7A 2JH6D 1BHXF 1PYTC 1CBWB 2JDID 2ALPA 4XRNA 3F9HA 1TNIA 2P3FH 1HFDA 3GISB 3SI4H 1FIWA 2IJD1 2KX4A 4A5TS 3ODFA 2ZP0H 3ZVFA 2R3YA 2ZTZA 1C2DA 1CHGA 2FLBH 2L6OA 2P16A 1WV7H 1KXFA 3SV8A 2ZEBA 5EQRA 4DCDA 3E1XB 1YLCA 2FOMB 1WCZA 3MNXA 9LPRA 1D6RA 2C3SA 1BHXB 1G2LA 4GVUA 1OWJA 1V2OT 3D23A 3T62A 1XXFA 1ELTA 2EA3A 5FPTA 2VGCC 4OS4A 2A31A 4MQAA 4D76A 1LMWB 2CMYA 2ANYA 4X8SH 3V13A 3GCOA 1NC6A 1IHTH 1O2TA 1T8NA 1OYTH 2PGBB 2HPQH 5A0AE 5FX5A 1AWHB 1E1QD 2VIWA 1ZMJA 2OQUA 1ZLRA 5AFYH 4D8NA 1J8AA 3M5OA 3DFJA 1KMHB 1LVOA 1MTUA 3ATIA 2W7SA 1YWUA 3FANA 2ZA5A 1C1WH 3F68H 3NRLA 1GI2A 3UNRA 1L4ZA 1MD8A 5C1XA 1QBNA 1C2EA 3KCGH 3U8TH 3UREA 5JBTA 4JYUH 1AFEH 1C5UA 1OKXA 3ESTA 1T31A 4WVPE 2RCEA 3MH6A 2PKAA 3BTKE 5ESTE 1VGCC 4MNWA 4X1SU 1G3EA 4WF8A 3A7ZA 1SPJA 4AFZA 4JK5A 3EQ0H 3TIUA 4ZHLU 1B0FA 1NFYA 1RTLA 5KECA 1O3HA 2GX4A 1YYY1 2KAIA 3K65B 1GHBF 3DSGA 1GBEA 3RXAA 2V3HH 1Y3UA 1EP6A 3LGYA 3E90B 1V2LT 5T3HA 2ZHWH 1AGJA 1O3DA 1UK2A 2TPIZ 2C8XB 3GY5A 1N6YA 3SV2H 1Z6EA 3A7WA 1TE0A 1HAYB 4CRCA 2AS9A 3VPKA 2PWXA 2Z6BD 1SGNE 3JZ2B 1AWFH 4WMEA 5C0UA 3OTPA 1H8IH 1PPCE 3VGCC 1F0SA 1Z8JB 5HYOA 4NWKA 1KY9A 2OUAA 1QL9A 1G3BA 3A7YA 1FPHH 2ODQA 1SSXA 1QB1A 5L30H 4X2YA 1GI9B 5EODA 3KHVA 1HAHH 3LGWA 8KME2 1OXGA 4LZ4B 2DE8A 1BT7A 1YP9A 3HATH 3K6ZA 4I8LA 1X7AC 2AMQA 2BVRH 1WQSA 5F8TA 1W13U 1P2JA 4K3JA 4YO9A 4ISIH 3MFJA 1GJ5H 1GHAG 1JIRA 3MH7A 4OS7A 5ESBA 3ZZ6A 1YCPM 1GMHG 2A1DB 4WXIA 5TCCA 3RXSA 2OD3B 4HI3A 3M36A 1F92A 4ASHA 1DPOA 3TK5A 2F9BH 4DJZB 1AB9B 3Q3XA 1ANDA 1NBME 4IS5A 2FI3E 3SV6A 1C2IA 2O8LA 1P2OA 3A83A 2BOHB 1ZSJA 4BAMB 2OCVB 3BEUA 1TBZH 1YCPH 2BX4A 2P59A 2XTTB 1DY8A 2ZU1A 2EQNA 3OY5U 3QUMP 4K5ZA 1FN6A 3SUFA 1AHTH 1W8BH 2ZGCA 3BTHE 2QF5A 1C5SA 2O8WA 1SGQE 2D8WA 3MNCA 5A09A 2XW9A 4GAWA 1ZGIA 1FDPA 1HXFH 1XUIA 1A2CH 5C67A 1QY6A 3RXDA 2GGVB 1YPLH 4O03A 1W0YH 4B71A 1K2I1 4INLA 3UB0A 1IOEA 1BA8B 2WPMS 8ESTE 2BDCA 1BIOA 1FI8A 8GCHF 3PTNA 2J98A 4FUFA 3N7DA 1TRYA 1VKYA 2EI7A 3SBKA 5DO4H 1SVPA 2A5AA 1VITH 2QF0A 3SUGA 1EX3A 1AKSA 2CV3A 2H5CA 3QWCH 2C8YB 1ANCA 2FMJA 2Q6GA 1MTWA 1TGTA 2ZTYA 3SNCA 1GBBA 5DGJA 2GJGA 3MTYA 1ETTH 1K22H 2NWNA 1OWIA 1DX5M 3SJ8A 1QQUA 1MU8B 2BLWA 3BG4B 5CHAB 5FCRA 3NKKA 3SU2A 1EPTA 3UIRA 3U8OH 2PUXB 1GI6A 1IQMA 3LPRA 1C5LH 1MAXA 1D3QB 2FYQA 2ZHFH 1OWDA 1ZJKA 3M61U 1MTVA 3MU0A 1XXDA 8LPRA 5LH8A 1C2HA 1C5YB 1Y3XA 6CHAC 1OPHB 1CGIE 4GCHG 5A8XA 2P8OB 2PTCE 4MG3A 1O2VA 1FIZA 1DWDH 4O97A 1C5VA 2XXLA 3LJJA 2BD9A 2AHME 4WJG2 5HIYA 3S7HB 4AZ2B 1C2GA 4K1SA 1ZSKA 3ZYEA 1HAVB 3ZVEA 4FU9A 3AK5A 1O5DH 1RD3B 3SGAE 1BTYA 3EYDA 5EW1H 1Y3YA 1BTXA 1LKAA 4ZXYH 4QT8C 2SGQE 2BD3A 3AW0A 4MPVA 2BD2A 5GCHF 5FBIA 1O2RA 5L2YH 1C1OA 1ELEE 1O3MA 2ODPA 1AFQB 2Y80A 3A89A 1QCPA 2ZGXH 1TOCB 4Y8YA 5F8XA 2W7UA 2OTVA 4RT0A 3M37A 1GJAB 1W0ZU 1TA6A 3LU9B 1TB6H 4TYDA 1VJ9U 1AVWA 2AMPA 5FL7D 1ZZZA 4M9FA 4CBNA 4Y7BA 2H9EH 1UK4A 4Y8ZA 1SQOA 4Y11E 1YCPK 3E0PB 2GZ7A 4JZ1A 4Y0ZE 1N8OB 3A8BA 2XBXA 1ELCA 2A4OA 3OYPA 4LOYH 1YLDA 5A0BA 3A82A 4FETA 3UUZA 2P3UB 3VB7A 3ZVBA 3VB3A 3ZVCA 1QR3E 2JIZD 4Y0YE 2A32A 3TJVA 4ACBA 1DWEH 1GJDB 1SLUB 3M5MA 4O3TA 4BXSA 1KDQA 2BVSH 2QY0B 1O2IA 3ITIA 1RXPA 1KXAA 3OX7U 1BTPA 4BAOB 4D7FA 1SGYE 1GMDG 1UW7A 3RXUA 3D65E 1FPCH 1C5RA 3SI3H 3SN8A 1ZHRA 5E0JA 1O3JA 2GCTB 3M7UA 3ZZ5A 1P0SH 2ILNA 3ATWA 3BTGE 1MAYA 4ZAEA 3ZVGA 2Z94A 2OC1A 4DOQA 1TWXB 2C8ZB 3FN8A 2AGGX 4JZIA 1GMCG 1BTZA 3GCNA 3N7OA 3PROA 1OS8A 2WPKS 1Z8RA 2ZIQH 1P57B 3NWUA 1JRSA 1EAIA 1SGCA 1AMHA 1LKBA 3A80A 5EQSA 3QGJA 3F3BA 4UE7H 3KQCA 4ABIA 2GZ8A 4OS5A 3SJOA 4AFSA 4CR9A 1Z6JH 5EJ1A 5JB9S 1GDNA 3PV2A 5LPEA 2Q6FA 3SORA 1NT1A 1OWKA 3PO1B 2A7JA 1GG6B 4TWYA 3K6YA 1O3CA 2FOAA 1A0LA 1SLXB 2TGTA 3BTWE 1PPBH 1CQQA 1O3EA 5F53A 1O2UA 2XC5A 5F6MA 1AVGH 1CGJE 4LZ1H 1NPMA 4O3UA 4D9RA 2BDAA 3SYJA 1CT4E 1DICA 2HOBA 1W2KH 3M3SA 1TNJA 1DITH 3DCLA 3TJOA 3DHKH 2BLQA 2FEQH 2O8UA 2WPHS 4A1XA 2Q1JA 3B9FH 5LPRA 2CF9H 2WV5A 3RXGA 3OSYA 3TK6A 2BZ6H 2GT8A 3FP8E 2V3MA 2EEKA 3TH4H 4SGBE 1TYNA 2ZFQH 4K8BA 1GBLA 4NGAH 2HVYB 1J17T 1EAWA 3MI4A 1L0ZA 2JJ1D 3N99A 2FODA 1O2NA 1MCTA 3TNSA 4X1QU 1T4VH 7KMEH 4BAQB 1BTHH 3MHWU 1GDQA 2TGPZ 4E05H 1EZSC 2KFWA 3BV9B 4B74A 2Y7XA 4ASUD 5KEDA 2BD8A 2F43B 1SI5H 4DGJA 1CBWC 3QZQA 3SHCH 1GHZA 1SC8U 4H4FA 4OS6A 3SUEA 1TABE 3RXMA 5HM2A 1DWBH 5C3NA 2CK3D 4XFQA 4KP0A 4HGCA 2A45B 1GHYH 2R2WU 3GCTG 1Y59T 3QN7A 4NA9H 3S9BA 2JETB 5IYTA 2BDYA 6GCHG 1OSSA 3M5LA 1HIAB 3P8GA 4NZQA 1A61H 2EC9H 2FDAA 2ZNKH 1PPHE 1A0HB 2NU0E 4AFQA 1TPPA 1Y8TA 3STJA 2OC0A 4CH8B 2XWAA 1V2ST 5L2ZH 1SB1H 4FUIA 1E35B 2FO9A 1MTNB 1QJ1B 2HNTF 2ZGJA 2R3UA 3RP2A 4YOGA 1EJNA 3PMHB 2XC4A 4X6MA 2CGAA 3ZYDA 1RIWB 1HAXB 4ESTE 1FONA 2F91A 4A7IB 1TPOA 4FUCA 1UVTH 5GDSH 3C1KA 4X6PA 2J2UA 3DD2H 2WUBA 2VH0A 1ZHPA 4ACAA 1AZ8A 1P01A 1T8MA 1CHOF 2ESTE 2C4FH 3QLPH 2VVVA 1C2MA 4J2YB 4WWYA 3ODDA 1XMNB 5T6FA 3Q3KA 5K0HA 2ALVA 1QJ6B 3MO9A 1LQDB 4ZH8A 2LP6A 3RMNH 1TNGA 1EATA 3MU4A 1Q2WA 1XUJA 2PTNA 3UOUA 2ODYB 5T1VA 1D9IA 1BTUA 1GI4A 1N1LA 1WOFA 1SGDE 4DT4A 2LELA 3V3MA 1EQ9A 4Q2KA 1RS0A 2A7HA 2QA9E 1F5LA 1O3NA 1WTHD 1PPGE 1GHAF 2QN5T 1O5GH 2ZGBH 3BTME 1P2IA 3B8JA 4Z6AH 4B6FA 5JB8S 2BB4A 2W6JD 1GVZA 4ABEA 1K1PA 1YM0A 4A6LA 1ZRBA 4HTCH 1OP2A 2JJ2D 3PM3A 1P06A 3PRDA 1S84A 4AG1A 3PMAB 4U30A 2SNWA 3L6PA 3QTVH 3RM2H 4I7YH 1P11E 5HXFA 1TA2A 1P8VC 3P8FA 2Y7ZA 2Z9JA 5I46H 4HZHA 1S81A 2J95A 4IC5A 4TPIZ 4X8VH 1ZTLA 1K1LA 2VWLA 3T25A 3TGKE 1INCA 1NRQH 4BTUB 1QIXB 4WY3A 2FLRH 1E79D 2ZFSA 3KNXA 2H9TH 1TGSZ 4UEHH 3G01A 4I8JA 1QJ7B 1HGTH 5KGOA 1BQYA 2SFAA 4H6SB 1O39A 1W7XH 1P12E 2YNBA 2WPLS 2VU8E 3RXOA 5BRRE 2FOFA 3MU8A 2Z7FE 1SMFE 1TX6A 3LGTA 3Q3YA 3UWIA 2TIOA 1NS3A 2ZHEH 2IPQX 1YPHC 3UFAA 1T8OA 2A4RA 4JZFH 3V12A 1FV9A 2PSXA 1GJCB 3T29A 1QL7A 4FXGH 2Z9LA 1RRKA 4TSFD 1EOJA 5C5OA 5EJLA 1P10A 4Z0KA 1P2NA 4RSPA 1ELDE 2GMTB 4NIWA 2FXRA 3UWJH 1P9UA 2H1UA 3FZDA 3UY9A 1IQNA 3HK6B 1ANEA 1GCDA 4R0IA 1SBWA 3FO8D 3U69H 3EA9A 3NZIA 2BTCE 3TPIZ 1DXWA 2EY4C 1AB9C 4KKDA 2CHAB 1O3BA 1ID5H 1O0DH 1NROH 5TCAA 1GJ9B 1D4PB 3Q00A 2ANKH 3BG8A 1UK3A 2ZU2A 3MQKC 4GCHF 2A4QA 1TONA 2J97A 1AD8H 4DY7B 2ZFFH 3A8CA 1UTQA 1HAIH 1TX8A 2KCYA 2YMSD 3M3VA 4GHQA 1UCYH 4AYVB 1W0JD 3M7TA 3LC5A 1WYKA 4ZROA 2DUCA 7GCHG 2R2MB 1K0HA 3TVJB 1DE7H 1ZSLA 2YMSB 4ZKOU 4MVNA 3RXQA 1IQEA 3KQ5A 2BVXH 4FVDA 1C5MD 2WPJS 1ESAA 1ANBA 3SNAA 4ZMAH 3F2HA 3UR9A 1A7SA 1C1NA 1SLWB 2QV1A 2HWLB 3BSQA 1V6DA 3BIUH 2VIVA 5DP9A 1BITA 2XBWA 2QXHA 1EZXC 1NY22 2GDDA 1MU6B 1C1SA 1KYNA 3P6ZB 1Z1IA 4X0WU 3N7EA 4YXWD 3RUOA 3OE7D 1O33A 3FFGA 4K2YA 4UFEH 1GL0E 5JBCS 2VIOA 3FKSD 1O2WA 3U28C 4F48B 3F2FA 4NIVA 4INKA 5EQQA 1MQ5A 3BG4C 1ZJDA 1UTJA 5CHAC 4ABJA 1W11U 2A0QB 2AYWA 1C5TA 3TU7H 4B76A 2FOEA 1QHRB 1QGFA 4FUGA 2VIQA 3A85A 4GHTA 1C5WB 4XD7D 3EAJA 1QB9A 3L3TA 4AG2A 4ZKSU 4B6EA 1C2JA 1EP5A 2IN2A 3OAAD 2PUQH 1TPSA 5EGMA 1SG8B 1F5KU 1EZUC 3SJ9A 1HJAB 2GCHF 2A5KA 3A87A 2HLDD 5GWZA 1GBMA 4JMYA 3O8BA 3SNBA 2AERH 4CRDA 1Z1JA 2P8OC 2ZTXA 3F9GA 1OWEA 1IQIA 4YOJA 1DOJA 1HNEE 1YPEH 3LOXA 2PFEA 4BANB 1A46H 2AGEX 4ZCNA 2G00A 1HAGE 4FOUC 1TBRH 2CXVA 2UUKB 1DY9A 1VITF 3SV7A 1K9OE 1LPKB 5CMXH 4CRGA 2KCOA 1AIXH 4IW4E 4U2WA 3AAUA 1LPZB 2TGDA 3P8NA 3SU1A 1TNLA 5IDKA 3SU3A 3ZVAA 5JBAS 1ZYOA 2FM2A 2B0FA 1PPZA 1TOMH 3E8LA 3LONA 1AFQC 2F9PA 1Q31A 4ABAA 1TRNA 1ARCA 2PKAB 4AGKA 1K1MA 2H9HA 1V2RT 3BEFB 1UVPA 2A4GA 3S9AA 3Q76A 1BDAA 3DA9B 5GXPA 4XBDA 1S85A 1TBQH 2BY8X 2RA3A 1TRMA 3LIWA 1NN6A 4RKJB 1GVLA 1V2UT 5DP6A 2KAIB 1YGCH 4UFFH 4ISLA 1SGFA 1O34A 2XNDD 2KCPA 1P03A 5EPYA 1L4DA 2QC2A 4XBCA 4DURA 1KLJH 1A5IA 1UCYK 1HRTH 2I6QA 3ZV9A 3RC6A 1FNIA 3SU4A 5DP7A 4AN7A 2AIPA 5EOKA 1GJ6A 2QXJA 3F9FA 3RXHA 3ATLA 1YPJH 1UJ1A 3QX5H 1C5NH 2ZI2H 2FS8A 4Q63A 5AF9H 1HLTH 4I8HA 2G55A 3SO3A 1PQ8A 4ABDA 2B7DH 1FQ3A 1B5GH 4MNYA 1CT0E 4Q80A 1Z7KA 2Z3DA 3GY4A 2GCTC 5FAHA 2V6NA 3M3TA 1V2JT 1BMNH 2A2XH 1ZRKA 1ELAA 4D9QA 1DFPA
chains in the Genus database with same CATH topology
2NU2E 1RTKA 2Z9GA 1PPFE 1W3CA 3F9EA 1TQ7B 1THSH 3E6PH 3UTUH 2GTBA 1DM4B 1CA8B 1RJXB 4HFPB 4CH2B 1Z8GA 1P3CA 1KXCA 2FOCA 4CHAB 3SU6A 1QA7A 1T4UH 6GCHF 1ELVA 2AGIX 3M5NA 3PO1C 3RXEA 5J4QA 3VB6A 1V2QT 2XNIA 1C5ZB 1XUKA 1BRUP 3R0FA 1OP0A 2JH0D 1T32A 4B2AA 5BPEA 3UQVA 1AE5A 2BQWB 1IQKA 3LH3A 5DP5A 4CRAA 3F1SB 4B1TA 1O2KA 3MWIU 2PGQB 1ZTJA 3GY3A 5GJ4B 2Y81A 1W14U 3LT3A 3I77A 1U6QA 1P09A 3A88A 4X6OA 1P2QA 4FUDA 3RXKA 1UHBA 2Z3EA 3E0NB 4YESB 5T6GA 2HALA 3VB5A 1CU1A 3O8CA 2GP9B 2FZZA 1S6FA 5HGGA 4WMDA 4TWWA 2VVCA 4UFDH 1GPZA 3STIA 3CENA 1AY6H 6LPRA 1ABJH 1TGBA 5I25A 1IQLA 1BZXE 1PQ5A 5A2MH 3RM0H 3QO6A 4X2WA 1C1TA 1O2SA 3E91A 4K8YA 2ZQ1A 1PPEE 2UUFB 4XSKU 1BJVA 5FBEA 2RA0A 1WUNH 2UWLA 1AKSB 5H4IB 3TJNA 1SGPE 2J92A 3RMMH 3SZNA 1ELFA 1O30A 1TFXA 4LK4A 1GCTB 1Y5BT 1ZHMA 2OC8A 3ELAH 3D49H 3V0XA 1AZZA 4YLQH 2ZC9H 3ZZBA 1XVMA 3EA8A 1GHBG 2JETC 1EPTB 1GI8B 3GCHB 1P02A 3BTDE 3MMGA 4IGDA 1GBHA 3U1IB 1GJ7B 3ENSB 3QGNB 1JMOH 2ZWLH 4X1RU 3LGIA 3BIVH 2HNTE 4AB9A 1LQEA 2QYIA 3S0NA 4NWLA 2HPPH 1O31A 3BTFE 1MTNC 3TH3H 2GT7A 2OP9A 1BUIA 1A0JA 2WINI 1J15A 1V2KT 1A3EH 1W10U 3A7XA 1RIWC 3I29A 2VWNA 1CA0B 1EASA 1QBVH 1EZQA 1A3BH 3IWMA 1DUEA 5A8ZA 3L33A 3LGUA 1ZGVA 4ABGA 2P3TB 1Q3XA 3NCLA 1N6XA 3T5FH 2QXIA 1GWAA 1EXFA 1SOZA 3GYLB 4DIHH 1A4WH 2LNCA 2A5IA 1Y5AT 1S0RA 1D3DB 1HUTH 1PFXC 1L1GA 2HNTC 5F8ZA 2BZAA 2P94A 2YNAA 1QRZA 1SR5C 3OTJE 2PLXA 1EJAA 2XRCA 3TH2H 7ESTE 3T27A 3S69A 1KTSB 1HIAA 4E7NA 3WY8A 1VCPA 3PV4A 3TGJE 2FOHA 5EXLA 5LPFA 3A8DA 3PMBB 1HCGA 1NZQH 3QZRA 4NA7A 5GPIB 1KXEA 4SGAE 2Z9IA 1TLDA 5F03A 5CE1A 1DLKB 1HDTH 3V7TA 2OC7A 3PLPA 3S7KB 6CHAB 2ZU5A 3BTTE 3U8RH 4X8TH 1O2GH 4XDEA 1TMTH 4Q7YA 1O5CB 3BF6H 1HYLA 3BTEE 1FY5A 2V0BA 2O9QA 3C27B 3M7QA 1F7ZA 1E0FD 1UCYE 3F6UH 3QDZB 2G4TA 2ZDAH 1UTMA 2D1JA 3SJKA 1YKTA 1O3LA 1JXPA 4U32A 2G8TA 1NESE 3A7VA 3MOCA 1F0TA 4AGJA 3PWBA 3P8OA 8GCHG 2PR3A 4WH8A 4Q7XA 1GI0A 1KDQB 4BTIB 1D6WA 2OBQA 1RGQA 2SGDE 7GCHF 1P3EA 3RXTA 2ASUB 5JPMH 1BRCE 1IHSH 1LHCH 2HVXA 4ISHH 2OQ5A 4Y71A 4NFFA 1JRTA 1BMAA 1DDJA 5AFZH 4AX9H 1GBJA 1FY3A 1SGFG 1AO5A 2BD4A 1CVWH 2XYAA 2FIRH 1ARBA 2G52A 3UNQA 3RU4D 4KTSA 1Y3WA 3LGVA 1YPMH 4I31A 2Y6TA 2CJIA 4Y7AA 4XBBA 1EKBB 3AASA 1L1JA 5C5NA 4Y79A 5E8EH 2LPRA 1DWCH 2ZCKP 3CS0A 3OU0A 4YT6H 2ZPSA 4H42U 2CHAC 2OLGA 2BDGA 3GY8A 2F9UA 3B23B 1E34B 1CGHA 1LO6A 4X8UH 4FUJA 2A7CA 4DG4A 2STAE 3D62A 4VGCB 4Q7ZA 2O8TA 3UR6A 1QRWA 2BXTH 2P95A 1ORFA 3AVZA 2OINA 3HKJB 4Y10E 1FMGA 4ZKRU 1T7CA 2CN0H 3GDVA 1H9HE 5LGOA 1Y3VA 3ATKA 1P9SA 3HKIB 1O37A 4R8TB 5G4BA 1O3GA 1O5FH 2RDLA 5GCHG 2W26A 1LVBA 1MKXH 3E16B 4B2CA 2PKSB 4FVBA 2AH4X 4WMFA 1MTSA 3RXCA 1IAUA 1YPGH 3PB1E 5EPNA 5DG6A 3H7OA 2ANWA 2Q6DA 1E36B 1GMHF 2W5EA 4B75A 2ZFRH 1FAXA 3FP7E 1GJ8B 3AAVA 3RXIA 3IITA 2IPHA 3PLBA 4NSVA 4Y76A 1AUJA 1ZR0A 1KSNA 3DT0H 1UVUH 1LCYA 2BOKA 3RC4A 1O2QA 1XX9A 3OY6U 2ZO3H 1VJAU 3A8AA 3FZZA 1AI8H 1C1RA 2VWOA 1SLVB 2DE9A 2FPZA 2IJOB 1HJAC 5DP8A 1S0QA 2RG3A 1C2FA 4A1VA 3ZZ4A 1TQ0B 1XKBC 4JYTA 1DSUA 1KLTA 1S82A 2GVFA 1V2TT 1TALA 1D3PB 5JBBS 2OXSA 2BLVA 2V35A 4NZLA 5EG4A 4BXWA 1H1BA 1O3PB 1ESTA 1O2OA 4MNXA 3A84A 1O5EH 4ZHMU 4J1YA 3AW1A 5E0HA 1P2KA 4NSYA 4I8GA 1MZAA 2J38A 2ZCHP 2AIQA 2SGAA 2PV9B 1ACBE 1NU7B 2IOTA 3TGIE 2ZPRA 3NK8A 2GZ9A 4KTCA 3RDZA 2D26C 1MBMA 1GGDB 1SOTA 1NRNH 1FJSA 4MNVA 4NG9H 2ZU3A 1O2ZA 1V2NT 4YM9A 2ZDMA 4CBOA 3PMJA 1S6HA 3DUXH 3MO6A 2BHGA 1E37B 2P93A 4BAKB 4H6TA 1J14A 5HM9A 2C8WB 5K7RA 1O2MA 2ULLA 5PTPA 3W95A 3ZZDA 1TX7A 1EOLA 1QRXA 1ELBA 2STBE 3A86A 2R9PA 1H9LB 1LHEH 4M7GA 3RXLA 1Z8IB 1DS2E 1GBAA 4WXVA 1BJUA 1DSTA 3RXJA 1FZZA 2C93B 1HBTH 1G3CA 1KIGH 3W94A 3GICB 1C1UH 1JWTA 2ZKSA 2J4IA 2Z3CA 3R3GB 4NIXA 3SU5A 1MKXK 1O38A 3ATMA 4PROA 1GBTA 3BTQE 2ZQ2A 2B8OH 2BDHA 5FHTA 4E06H 9ESTA 2VNTA 4OGYA 3E3TA 3MNBA 2SGEE 1AE8H 1O5AB 1NM6A 1ABIH 1CT2E 4DIIH 1C9TA 1Y5UT 1C5OH 2ZGHA 2V3OH 2GV6A 1AQ7A 5FCKA 1GL1A 1A5GH 1VCQA 4GPGA 1O3AA 1J16A 3A7TA 1WU1A 1W7GH 3SUDA 4XE4A 3GY2A 3SHAH 1UO6A 1XVOA 1P05A 2FTLE 2XBYA 3KF2A 1K21H 1G36A 1W12U 1V2MT 4CHAC 3ZV8A 1XUFA 5FX6A 4K1TA 2ZF0H 3URDA 1VR1H 2WYJA 1C1MA 1C2LA 1NU9A 1UTLM 1C5PA 4A92A 1PQ7A 1GI5A 1OYQA 2AMDA 1CSOE 1DANH 2TRMA 1HJ9A 1VZQH 3K2UA 3PLKA 1PYTD 4YOIA 1XUGA 2BY7X 1FY4A 4NFEA 5ETXA 4K1EA 1GMDF 1AVXA 4O9VA 1CHOG 3UPEA 5DJ7A 2F9OA 3KGPA 1ZPCA 4DW2U 2OBOA 1HPGA 1K1JA 3O8DA 1H9IE 1GMCF 1O2LA 1V3XA 1OWHA 1C5QA 1HAZB 1FAKH 3MO3A 2AFQB 2H6MA 1Z71A 2TGAA 5EU8A 1BBRH 3TK9A 2G4UA 2B5TB 2VB0A 4XOJA 1LHGH 2ZECA 2BM2A 1V2VT 3EDXB 3RXFA 1GI1A 2FI4E 1ETRH 4YTAA 3ZZ9A 2UUYA 2QXGA 1EJMA 1GHVH 3MH5A 3A81A 2AEIH 2K1QA 5JYIA 5C1YA 1VCWA 1QURH 4Y8XA 1N8OC 1GCTC 2QAAA 4FUEA 2VGCB 1JOUB 3Q77A 1UVOA 1IQJA 3RMOH 5SGAE 1JIMA 1V2PT 1E38B 1EPTC 3GCHC 1C4V2 2XWBI 1HAVA 1MQ6A 2R0KA 1GBCA 2HRVA 1P2MA 1G32B 1BB0B 4X1NU 4CREA 4LXBH 4GLYA 4KTUA 2THFB 1O3IA 2F9NA 5FXLA 4ABHA 1YBWA 3ZZCA 1C5XB 2G51A 2J9NA 1K1NA 4CR5A 1GBIA 1C4Y2 1PJPA 1TGCA 1IQHA 2VIDA 2F3CE 3P70B 1GBFA 4BNRA 1CA0C 2BQ7B 7LPRA 2H5DA 1F2SE 1TMUH 4X2VA 2ZU4A 5C2ZA 3NPSA 1VGCB 2FI5E 2FOBA 1B7XB 4OS1A 4IBLH 1O32A 1TAWA 3ZZ3A 1H8DH 1LTOA 1MCVA 1SGEE 3EGKH 2GKVE 3NUMA 5GIBA 1SQTA 2NU3E 1LPGB 3VFEA 3TLOA 4B73A 3SNEA 1GI7B 3UOPA 1H4WA 3GCTF 3ZZ7A 2VIPA 1O2HA 2TBSA 1WQVH 1C1PA 3T28A 1GJ4H 1PQAA 1K1OA 3TJUA 4RN6A 3GOVB 1GDUA 1GG6C 2VH6A 4X6NA 4JZDH 1G9IE 5DKMA 3RMLH 4ISNA 1TPAE 1EAUA 1QA0A 3SGBE 1HJ8A 1NRSH 1F5RA 2GDEH 4YZUA 1ZTKA 5T6DA 3SJIA 4BOHA 2VWMA 2UWPA 1UTOA 3KIDU 3PTBA 2ANMH 5L6NH 2BDIA 4JCNA 3MU1A 5A8YA 3CP7A 2JKHA 1HV7A 1O36A 1QQ4A 4TY6A 1NTPA 1MUEB 3VGCB 1NFUA 1V2WT 2WPIS 2Y82A 1G3DA 1JBUH 3KN2A 5HMAA 2QCYA 1HAPH 4ZXXH 3SV9A 4D7GA 4KGAA 2BXUH 4AB8A 3U98H 4X1PU 2BLOA 1BBRK 3H5CB 2BDBA 3RU4E 4K69A 1F0RA 3UQOA 3KL6A 3UNSA 3P17H 2R0LA 1O35A 4ABBA 4F4OC 3M35A 1THRH 2FX6A 1KTTB 3RLYH 1C1VH 3SW2B 1AN1E 3LH1A 1T8LA 1BOQA 3GY6A 4FUHA 1AU8A 1MMJN 4ISOA 5AVDA 1DXPA 1KLIH 1L2EA 2FTMA 1HB0B 3EE0B 1YPKH 3RXPA 4ZUHA 5A0CA 3EA7A 1GHXH 5TJXA 4NCYA 2ZFPH 5E2OA 2FP7B 1BRBE 3DFLA 1O3OA 4MDSA 3ZZ8A 3VXFH 4JYVH 2GV7A 1TNHA 1SGTA 1F0UA 4I32A 2GCHG 4DVAU 2J34A 1EB2A 2XBVA 4OGXA 1O3FA 2YOLA 3U1JB 1FLEE 1EAXA 3BN9A 2Y5GA 3GY7A 4JZEH 4FU7A 1ZMLA 3FVFB 4VGCC 3TITA 3P92A 2BY6X 1O2YA 1BMMH 4UONA 4UD9H 3URCA 1VITG 4I33A 4U01A 3MH4A 2BX3A 1IQFA 5DP3A 1J9CH 1K28D 2I6SA 3KQDA 4IN2A 5C1UA 4DT7B 3LDXH 1BTWA 1UHBB 1ZMNA 2A2QH 1FUJA 3JZ1B 1DLEA 3U9AH 2ZHDA 1RFNA 1LVYA 1SFQB 3QTOH 2ZDVH 1TMBH 3MYWA 1GBKA 2PKSC 4INHA 1CE5A 1ESBA 1KXBA 1MKWH 2UUJB 1SGRE 2VINA 4IMZA 1UTNA 2EI6A 5E2PA 1S83A 1OOKB 1BCUH 5FPSA 2BYAX 3RLWH 4CRBA 1XUHA 4CRFA 4X2XA 4NA8A 2Z9KA 3PYHA 2VVUA 3SQEE 1SGIB 1O2XA 4MPWA 3CS7A 1BMLA 1GI3A 1KXDA 1GHWH 4FU8A 1NO9H 2SNVA 2FS9A 2ZDNA 4RKOB 1YC0A 2ZDKA 5DPAA 4GSOA 1YF4A 1O5BB 2C90B 3MNSA 4YT7H 4UFGH 4ZKNU 2BD5A 1QNJA 1G2MA 1DUAA 4MLFB 3FAOA 3K9XB 2JH5D 3HPTB 1G30B 2PW8H 1WAYB 2G5VA 4IMQA 1WBGB 1NRPH 1QFKH 5AHGH 3LKWA 2XCFA 3RXVA 3ZZAA 3HGNA 1TGNA 3I78A 3S9CA 1FY8E 2WV4A 2BY9X 3H7TA 4JK6A 2PHBA 2HLCA 4I8KA 3NXPA 4AORA 2UWOA 2WUCA 5EW2H 3KEEA 2M5TA 2FX4A 2VJ1A 4Y6DA 4MPUA 1NFXA 1TIOA 1A1RA 2QIQA 4IN1A 2GMTC 1QBOA 2W3IA 3SNDA 1M9UA 2J94A 1AUTC 1EB1H 4MPXA 1MD7A 1GGDC 2QF3A 1LDTT 3O8RA 1O3KA 1HXEH 3LC3A 2ZDLA 3SGQE 3RC5A 4TY7A 2XC0A 2H2ZA 2SGPE 5DK1A 2B9LA 5ABWA 1NRRH 2FYRA 1C9PA 2XCNA 3QK1A 3LJOA 4TPYA 4B2BA 1O2JA 1UMAH 1O2PA 2ZG0H 3HK3B 3RXRA 3KQEA 1G37A 4YLUA 1ELGA 3RXBA 2QGRA 1LVMA 4OS2A 1FXYA 1MZDA 1SFIA 1GBDA 3SQHE 1WTGH 3FP6E 2FESH 5JDUB 2PSYA 3T2NA 1SHYA 2NU1E 1DT2A 2GD4B 1C4U2 2ZZUH 3GDSA 2SGFE 1SL3A 1SQAA 2BMGB 4BAHB 1GJBB 1EUFA 1MBQA 1ZOMA 4AFUA 1CO7E 3VEQB 1FY1A 2ZFTA 3KQBA 2Y5FA 1SHHB 1BBRE 1TNKA 1A5HA 4IC6A 4AYYB 5DP4A 1MKWK 3MU5A 1IQGA 2FOGA 3ZVDA 5C20A 3SU0A 4KELA 2ZHQH 3TNTA 3BEIB 2W3KA 3P95A 1QL8A 4ABFA 1BRAA 3IG6B 4NIYA 5E0GA 5EXMA 1QB6A 5EXNA 1D3TB 1XM1A 1LHFH 1S5SA 4BTTB 1WSSH 2ZCLP 2G5NA 4ZHAA 2F83A 1XKAC 2FWWA 1FN8A 1LHDH 2Y5HA 1UTPA 1GVKB 5J4SA 3T26A 1UVSH 2G81E 1P04A 4MTBA 4THNH 3RU4T 2BQ6B