4NIXA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) orthorhombic form, zinc-bound
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
GGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGHTKSSGTSHPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKKSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
total genus 59
structure length 221
sequence length 221
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA02
1HXFH 2NU3E 1O2GH 1D9IA 3GOVB 1TOCB 1XVMA 2Y5HA 4UEHH 1KLTA 3P8FA 3OSYA 2PWXA 1E36B 1ETTH 1KTSB 2B7DH 1T31A 1SGCA 1XUGA 2Z9KA 3VGCC 1GPZA 3BEFB 2HRVA 1GJ8B 6GCHF 4UDWH 1ZHPA 4X1QU 1O5CB 1W0ZU 3R3GB 4X2YA 3FP6E 2ZTXA 3O8CA 1A46H 5A8XA 1GWAA 1P2IA 3GY7A 1WTGH 4KTSA 1S83A 4Y8XA 1DITH 1J8AA 2R2MB 3HKJB 1HAVB 4ABDA 3F9HA 4I8HA 4BTUB 2F9UA 1GG6C 2GCTC 1N6YA 1ZMLA 2V0BA 3MNBA 2SGDE 4BNRA 4ISNA 1SGFG 4ZAEA 1SQAA 1YPEH 2BDIA 1BRBE 4LZ4B 4X0WU 4Y71A 1K21H 1P2NA 3E90B 1GJ4H 3RU4D 2NWNA 3LDXH 1C5XB 2JH6D 4ABFA 4WMDA 1C9PA 4CRFA 5IYTA 1QJ6B 1FPHH 1BTPA 2GCHF 1SGYE 1LHDH 2XC0A 4NSVA 4DIHH 1UVTH 1PFXC 3SU6A 3O8DA 3RU4T 4YM9A 1JRTA 1PYTC 4XBBA 3MNSA 3SJ9A 1QA7A 1NFXA 1ARCA 3ITIA 3M7UA 2WUBA 5T3HA 3A8AA 4A1TA 5EQSA 3SJIA 3BIVH 3MNCA 3SV9A 1V2PT 1QNJA 3I29A 4Q80A 1K1OA 1SGRE 2TGTA 4X8SH 3SHAH 2BD5A 1LQDB 4YOIA 2I6QA 1GJCB 4FUEA 4ISOA 2SNVA 1ABJH 5EQRA 4ISLA 2BQ6B 1C5YB 1SGQE 3P8NA 2QYIA 2A5AA 3BEIB 5JDUB 1CHGA 1G37A 1A3BH 1UVPA 4J1YA 1K9OE 1GCTB 1XUHA 4AN7A 3ZV8A 1FLEE 1QFKH 5CHAC 3KGPA 1O2NA 4I7YH 1AY6H 2TGAA 4O97A 3MNXA 2ODYB 2XXLA 2FOBA 2C8XB 1NRPH 3L6PA 4TY7A 4WWYA 3MU5A 3K2UA 4BANB 4IMZA 1Y3WA 1O2UA 1G3CA 3A8BA 4XBCA 4Q7ZA 4NIWA 4I8KA 1IAUA 1WTHD 4MNYA 1W10U 1T8NA 1SFIA 1LPGB 1L1GA 5AF9H 4H4FA 3RXMA 1FN6A 3ZVFA 1W11U 1EKBB 1X7AC 1BRUP 2P59A 4NFFA 1GI2A 1ZGVA 3PLPA 3ZYEA 1DS2E 3SI4H 1JOUB 4CR9A 2DE9A 4WMFA 3ZZ7A 1TRMA 2XCNA 1YBWA 2R0KA 2QIQA 4GUXA 1EZUC 2H5CA 1SPJA 1PQ7A 4GLYA 2BD9A 3VB4A 4B1TA 4ZXXH 2ANWA 3IG6B 2H1UA 1KXDA 1PJPA 2GKVE 1UMAH 3SUGA 1P05A 3ZZDA 4AB9A 1RTFB 2H2ZA 2HNTF 4B74A 1EB1H 2FS9A 1NY22 2ZHEH 1GI6A 2TPIZ 3TVJB 1AHTH 1NM6A 1FNIA 1XXDA 1W12U 2HPPH 2ZU4A 1BIOA 5FHTA 4X6NA 1LKBA 3T29A 2FX4A 2A4RA 1FJSA 4F49A 3TH2H 1C5WB 1UCYK 1W13U 2OP9A 4AORA 3MWIU 5AVDA 2P93A 5JBBS 1GHXH 2WYGA 4OS5A 1GHBG 1YCPM 2M5TA 1IOEA 2YNBA 3M5NA 5K7RA 3LU9B 3DFJA 4ZKNU 3V3MA 5A8YA 2F9OA 2AH4X 2UWPA 2P8OB 1SQTA 2QF3A 1C1WH 3HK6B 1EZXC 4BOHA 1TAWA 4D9RA 2AIQA 1BBRK 3QZRA 5GJ4B 4NZLA 1C1UH 3ZZ6A 3UQOA 2F9VA 1HAVA 1EAXA 2P94A 3K65B 2J94A 1CA8B 2LPRA 2TGPZ 1FY8E 2NU4E 3EGKH 5GWZA 1O5DH 1YC0A 1AZ8A 4TPIZ 5E0HA 2ZPSA 4AYYB 1O3KA 1TRYA 4A1VA 3KN2A 5JBCS 1MAYA 1ZZZA 1IQJA 3E8LA 4GHQA 3K9XB 5L30H 4OS1A 1BITA 5DKMA 3F9GA 4WMEA 3SN8A 2RG3A 3P8GA 5T6GA 1HAYB 4E06H 1YCPH 1YLDA 4NGAH 2VJ1A 1ZTLA 1QRWA 1Y5AT 2G81E 1D6WA 3T26A 1IQNA 1KXFA 1BB0B 1FY3A 2C3SA 1EAIA 2OQ5A 2FTLE 4X2WA 4DCDA 1HBTH 4CRCA 1ESBA 2ZA5A 4UONA 1P9UA 1MMJN 1UTLM 1F5LA 2A5IA 1MTWA 2XBYA 3LGUA 5JB9S 2VIDA 3LC3A 2VGCB 2O8MA 1FAXA 1OOKB 1W7GH 3GY3A 2R9PA 3PROA 3RXIA 4NWLA 1O2WA 3PO1C 4YT6H 2W3IA 2VB0A 1AD8H 3E3TA 8GCHG 3IITA 2CJIA 3W95A 1H9LB 2RA3A 3SV2H 1JIRA 1LO6A 1AB9C 2O8UA 1THPB 3Q76A 2JKHA 2QXHA 1O34A 1KSNA 1P3EA 1SLWB 3UR9A 2G4TA 5A0BA 1O2JA 4DJZB 4JMYA 2AS9A 4Y7AA 5LGOA 1P57B 4SGAE 1HUTH 1F2SE 3U8RH 1O2YA 4MQAA 3LIWA 1VJ9U 2FO9A 2XCFA 5JPMH 1MTUA 2ZDAH 1GHAG 4GAWA 4Q7YA 5EGMA 1UO6A 1LHCH 1DM4B 1W0YH 2TBSA 3FFGA 5EW1H 4TYDA 1O5BB 5ESTE 1LHGH 5E0GA 5EG4A 2PHBA 2C8WB 1OWJA 1YPGH 1G36A 1GBCA 2EEKA 3UWIA 5JYIA 5I46H 2PSYA 4X6MA 2FOCA 3M35A 5HM9A 4JYTA 3GDSA 1TNHA 2GX4A 1EOLA 3UNQA 3TU7H 2FOHA 4BXWA 2J95A 1O2PA 4OGXA 1LHEH 1C1VH 4U30A 1EPTB 1ABIH 1W2KH 2Y7ZA 4K5ZA 2BDYA 3ZZCA 4AX9H 3CS7A 1KXBA 2Z6BD 1O3MA 1GCDA 4X1SU 4B73A 1N8OB 4K3JA 1BOQA 3OY5U 3L33A 2PKAA 5DK1A 1S81A 1SLUB 1PPGE 1H8DH 4AB8A 1O2TA 2BZAA 1A7SA 1BTWA 3P6ZB 2AERH 3QTOH 4Z6AH 4AZ2B 1DDJA 1DX5M 2BB4A 5C1XA 1ID5H 5L6NH 2Y80A 1QB9A 4X6OA 1CHOF 4Y6DA 1CU1A 1ETSH 1GBBA 4BTTB 1TALA 1T4UH 3TPIZ 1EB2A 3PWCA 2BOHB 4ZKRU 1O2ZA 1XM1A 2H6MA 1T8OA 1J16A 1TWXB 2Z3EA 4E05H 1CT4E 2A4QA 1VJAU 4ZHMU 4CH2B 3SORA 1A5HA 1H9IE 3T28A 3ZV9A 4I32A 4KTUA 4FU7A 2H9EH 1UCYE 1Y8TA 1NU7B 2WPHS 1GBFA 3EQ0H 3TGIE 1XUIA 2PGQB 1Z1JA 1O2KA 3PB1E 1EXFA 2GDDA 4X8TH 1XUJA 3RXSA 5EW2H 4BXSA 4A1XA 2OCVB 4FUJA 1ZHMA 1UTQA 2ANKH 2XBVA 1P03A 2BXTH 4DG4A 3PYHA 1VZQH 5C20A 1QL8A 3Q77A 4BAOB 1IHSH 1GMHF 1GI7B 1TPSA 3BIUH 4DURA 1BBRE 5H4IB 3SZNA 3MO9A 1ORFA 2VIVA 1DICA 4LOYH 5G4BA 1UVSH 3MO6A 2F91A 2G52A 3HK3B 1AN1E 1Y3VA 3A85A 1C2MA 3E1XB 1NZQH 1A61H 1HPGA 2AMQA 3PM3A 1TNJA 3F9FA 2ANYA 3VB3A 1HYLA 3EA9A 1HAZB 1OP2A 2QC2A 2NU1E 1UTPA 3EA7A 3UQVA 1HJ8A 1GI4A 2BDHA 4GHTA 2ZU5A 1NTPA 2OC7A 3SGQE 2I6SA 3LC5A 1MAXA 3LGYA 2VIOA 1LKAA 3SQHE 5EU8A 3U1JB 1FXYA 1SGPE 2OLGA 4MLFB 1GMCG 5C5NA 1NFYA 1GI1A 1V2LT 2VU8E 1PYTD 1S0RA 2HALA 3KQEA 1SG8B 1TE0A 4JYUH 2C8ZB 3GISB 3LGTA 1ZTJA 3TK5A 1AUTC 1GHVH 2BLOA 3KHVA 3KEEA 3ZVBA 1RXPA 1CE5A 4E7RG 1IQMA 3ATIA 1THRH 3GCHB 4Y10E 1P09A 3UR6A 1UTNA 3ZZBA 1FN8A 1LMWB 3AW1A 5L2ZH 2V35A 1BMNH 1OPHB 3BG4B 2B5TB 1CGHA 1PPBH 3LT3A 4JK6A 4MPWA 3RXUA 3FANA 4BTIB 2FESH 1PPZA 3RXLA 1O3FA 3QLPH 1BTUA 1VCPA 2OINA 3AAUA 4UFFH 3EE0B 1QTFA 2OBOA 3EAJA 4TY6A 1A1RA 3SU4A 2A5KA 5TCCA 2EI8A 3GY8A 1THSH 1VCQA 4MNXA 3VB5A 1C5QA 3M5LA 4FUBA 2F9PA 3HGNA 1ZGIA 1UCYH 5HXFA 1EPTA 1TGTA 3TJUA 1C5VA 5DP3A 4DT7B 4Y7BA 1NESE 1Z8RA 2ZF0H 4IBLH 4XSKU 4I8JA 4BAHB 1TA6A 3TGJE 3M3TA 2SGQE 3PV4A 3RXQA 1C1MA 3D65E 1CSOE 3V0XA 1RGQA 1CBWB 2BYAX 3PMJA 1C1OA 1BBRH 4THNH 3SO3A 1TABE 1O0DH 1HXEH 3A83A 1O2RA 1TQ7B 4NG9H 4OS4A 2GCHG 5I25A 5EXLA 1TB6H 2BD7A 3ZZ5A 1IQLA 1TNLA 1O3EA 2XW9A 1PQ8A 3MHWU 1GL0E 3AASA 3SU0A 1DFPA 2Z3CA 1FPCH 1GBHA 1D3TB 5A0CA 1GBIA 1MKXK 1PPCE 4JZ1A 3P95A 3VXEH 2C4FH 3BEUA 4OS6A 2ZIQH 3M5MA 4YZUA 1GJAB 1EZSC 2BD2A 1P04A 2ZG0H 4D7FA 2NU0E 1O2MA 3BTKE 2VWMA 7GCHF 2VH6A 1Q2WA 3UFAA 4DVAU 1SGDE 1QJ7B 3UPEA 4NWKA 2ZCKP 1RIWC 3RM0H 1FIWA 1A5IA 1NS3A 3ZVEA 1Z71A 1SOTA 2FIRH 3VB7A 1OWEA 1O2QA 3ATLA 1TOMH 2AGIX 2CHAB 2ZFTA 3KF2A 3QDZB 2PTCE 1ZSLA 2ZGHA 1Y3YA 1IQGA 4I31A 1MTNC 1YPKH 2QA9E 2ZU1A 4CREA 3SBKA 4WF8A 3E0PB 2FM2A 5LPFA 2ZECA 1MZAA 2W3KA 1MBMA 1EASA 1BDAA 1C2EA 4UD9H 1C1NA 2UWOA 3T62A 3M61U 4BAMB 4B2CA 4YO9A 2GMTB 1F0TA 3TITA 1RD3B 2A4OA 2QXGA 4FUFA 1CO7E 3Q3XA 1DUEA 1C5ZB 5A2MH 1HRTH 3ENSB 3A7XA 1P02A 3SNCA 2ZCLP 1ELAA 4ESTE 1WU1A 1FI8A 4X8UH 1B0EA 1ZYOA 2H9HA 1OXGA 3ZZAA 3RM2H 1PQ5A 3V13A 1GI0A 2XC5A 3ZVCA 2R3UA 3M36A 5E2PA 1TNGA 1GI9B 2B9LA 2FX6A 5DO4H 1DWCH 1C9TA 2JETB 5FPYA 1O37A 1EJAA 3SUFA 4Y8ZA 2G00A 1GMDF 3UIRA 3A89A 2GVFA 1P2JA 5EQQA 1YPMH 2FI5E 2P95A 6CHAB 2PUXB 1SOZA 1TRNA 2BLQA 3SGAE 1Z8JB 3GYLB 1BMMH 5ESBA 1HAHH 2CF9H 1TBRH 1Z6EA 2P3FH 1C2DA 1GG6B 2W26A 3IWMA 1O5FH 4HTCH 1S6FA 2HWLB 3DUXH 1QHRB 1P0SH 4RN6A 1KIGH 1OP0A 2EC9H 3TJOA 3RXTA 1EP5A 1O2HA 2Q1JA 1L1NA 1UK4A 4ZHAA 4MPUA 2FOEA 1C5LH 2YOLA 1NFUA 2O8LA 1BQYA 1HAGE 1TPOA 1O39A 3U1IB 3DD2H 1DY8A 1N6XA 3KNXA 2Z7FE 5J4QA 4JZIA 1PPHE 5BRRE 3ODDA 3FVFB 1OWKA 1P2OA 2FEQH 3PTBA 3SUEA 2OQUA 3A80A 6ESTA 4RKOB 1EUFA 2ZNKH 1JXPA 3CENA 4X1PU 2EA3A 1S0QA 1P11E 1EAUA 3NKKA 2VINA 1SC8U 2XYAA 2FOGA 1GBLA 5T6DA 1GBJA 1NU9A 4NFEA 4MDSA 2ALVA 1AKSA 4ZKOU 1BMLA 1SB1H 1YKTA 3SHCH 3LKWA 4DOQA 2P8OC 4IN1A 1DE7H 4KELA 4MTBA 5EPYA 5DP6A 4Z0KA 1O3AA 4NIXA 4ZUHA 1AIXH 2PKAB 1FY4A 2ZZUH 4FUHA 1Z8GA 1TGSZ 1DY9A 1C5UA 3PLKA 2AYWA 4AFUA 2BLWA 5K0HA 2FI3E 2ZQ1A 2PTNA 1QY6A 5F8ZA 3EDXB 5FX5A 1QB1A 2BDCA 4MPXA 3RLWH 3E0NB 2UUYA 1CA0C 4XE4A 4FUDA 1FDPA 3U69H 2W5EA 4A92A 2J4IA 1L4ZA 2R2WU 1SLXB 3A7VA 3KL6A 1XUKA 1JMOH 5ABWA 1QBNA 3SI3H 1KXAA 3SJKA 1J15A 2C93B 1P9SA 1GL1A 1DXWA 1AE8H 1NRRH 2GTBA 3GCTG 4O03A 1WAYB 2Y82A 2HGTH 2J34A 2GDEH 5AFZH 2BXUH 3KQBA 1K1LA 3ATMA 1YM0A 1P3CA 2K1QA 1UTKA 2VIPA 4ABIA 5T6FA 1GBDA 1BTHH 4WXVA 5TCAA 4KTCA 1YLCA 1DWEH 1AVXA 2BDAA 4ZMAH 9ESTA 1K22H 1J9CH 1GDUA 1W7XH 1C2GA 2VWOA 3P17H 3W94A 5C2ZA 3K6YA 3E16B 1XMNB 4K8YA 3VFEA 1H9HE 3MOCA 1HCGA 1C4V2 1Z8IB 2ZEBA 2HOBA 2C8YB 1O2SA 4NSYA 1O5GH 2ZHWH 1ZRKA 2GD4B 1BHXF 1Y5BT 1T7CA 1TFXA 3NK8A 4TWWA 1ZOMA 1RS0A 2V6NA 3S9BA 3M3VA 3NCLA 4Y76A 1YF4A 4MPVA 3BTDE 1A2CH 4VGCC 5HYOA 1OYTH 2V3OH 3R0FA 4IC5A 6LPRA 3MYWA 2V3HH 4Q2KA 1QR3E 1Q31A 1D3QB 3DA9B 2TRMA 2WV4A 1C5SA 1DSTA 1MZDA 2GV6A 5DPAA 3U8TH 3QTVH 2FTMA 1AUJA 1QJ1B 4XFQA 3GDUA 3VPKA 3N7OA 3ZVAA 1KLJH 3BTHE 1GHBF 1JIMA 1HNEE 1N8OC 5A0AE 1TA2A 2JH0D 4O3TA 4XOJA 4FVBA 1MTSA 1O30A 1WSSH 5SGAE 1OWIA 2Q6FA 2RDLA 2ZP0H 4CBNA 1ELCA 4D76A 5L2YH 2FLRH 1V2OT 1VITG 3TH4H 3RMNH 1TPAE 2AMDA 1W8BH 2XWAA 1GGDB 3RXCA 2G4UA 3A7ZA 1HB0B 5FPTA 1Z7KA 2A31A 1QL9A 2H5DA 2PKSB 2CV3A 5DP4A 2ZDLA 1E38B 1AMHA 3UNSA 3D62A 2VWNA 3SW2B 1BJVA 4J2YB 4UFDH 3FZZA 1ELEE 3H7TA 1A0JA 2BVSH 1TGNA 3OY6U 3STIA 1MKXH 4SGBE 3SU5A 4FU8A 5DGJA 3QK1A 1XXFA 4DIIH 2OC8A 2BX3A 1SGTA 1EX3A 1GMHG 3RXGA 3A7YA 4GCHF 5E2OA 4K1SA 3ZZ9A 2Y6TA 4AG2A 3RC6A 2F83A 3BTFE 1M9UA 1ARBA 1O3HA 3A84A 2GV7A 1EQ9A 4F4OC 2XC4A 1UK2A 3VXFH 1MQ5A 1NN6A 4YLQH 3RLYH 2WPLS 2Z9JA 5FAHA 5GCHG 1DT2A 4IS5A 1ZMJA 1JRSA 1C5NH 1GJ7B 2ZPRA 1FZZA 4UFGH 1MH0A 2FPZA 2G8TA 2CMYA 4LK4A 1IQEA 1NRSH 4DGJA 2QY0B 8GCHF 2AEIH 5JBTA 2IPHA 3S69A 1AFEH 1T4VH 8KME2 2EI7A 3G01A 4U01A 1J17T 3PTNA 3A81A 3UWJH 3D49H 1NRQH 2TIOA 2OXSA 4ZROA 1YYY1 1O5AB 1TX8A 1CGIE 1HAPH 1GJDB 1UHBA 1AWHB 3RMOH 1WV7H 2SGPE 1GHAF 1HJAB 2BQWB 3M37A 1FUJA 1MBQA 1F5KU 2FOMB 1IQKA 1DWBH 1VITH 5F8TA 2QCYA 3H5CB 4QT8C 5EPNA 4INHA 3SV7A 1CVWH 1G2MA 1AVWA 1Y5UT 1SL3A 4O9VA 1P2KA 1ZSKA 1G3EA 2UUFB 1C2LA 3V12A 4ZH8A 2A4GA 2AGEX 2THFB 2ZCHP 5F03A 2SGAA 2XTTB 1L0ZA 3BTGE 1L2EA 3ODFA 2HVXA 1SLVB 3MH6A 3A8CA 1V2QT 2XBXA 1ANBA 4K2YA 1LVMA 1TIOA 1ELDE 2FOAA 3GICB 2OBQA 3QGNB 5A8ZA 1N1LA 5FPSA 2PV9B 5J4SA 1NT1A 3T5FH 1HIAA 2WPIS 2Q6GA 1VGCC 1TX7A 3UTUH 1G3DA 2BLVA 3RDZA 1WOFA 1V2ST 2BY8X 3P92A 2NU2E 2VVUA 4X2XA 2BMGB 4AYVB 3UOUA 1ZTKA 1O38A 1P8VC 2FYQA 2BM2A 4I8GA 4HZHA 1QBOA 1GBEA 1YPJH 1BTXA 1DUAA 1QA0A 1O2OA 3A7TA 3BG8A 1O35A 2O8WA 1LDTT 3UUZA 2Y81A 3FP8E 1ACBE 4YT7H 4BAKB 2O8TA 1O36A 1IQIA 3BV9B 2BVRH 3GY5A 1GHYH 2BD3A 1TNKA 1EJMA 5E8EH 5HMAA 4A6LA 1AFQC 4DY7B 1K1PA 3TNSA 5AFYH 3OYPA 1FMGA 2ZHQH 6GCHG 5GXPA 1Z1IA 1BHXB 4X2VA 5AHGH 2ZKSA 3UNRA 4TPYA 2J38A 2ZGCA 2ZDNA 4UFEH 1DLKB 2JH5D 1WQVH 2Z9LA 1D3PB 4K69A 1KY9A 5A09A 2KAIA 4ABGA 1ELTA 3A87A 3NWUA 3FP7E 1QQUA 1K1JA 1C1TA 3O8BA 4X8VH 1AI8H 1IQHA 3RU4E 1ZPCA 2VIWA 3MU1A 2ZPQA 3QWCH 2GT8A 5DP5A 1BUIA 1D3DB 3O8RA 1GHZA 2GZ7A 3QUMP 1V2TT 3FZDA 1W3CA 3PMAB 2C90B 2B8OH 1DXPA 4WXIA 1D6RA 1NFWA 2BD8A 1AKSB 4DW2U 9LPRA 1HFDA 1K1IA 1YPHC 3S0NA 3F1SB 2BHGA 5GIBA 2ZQ2A 1OYQA 4HI3A 4ZHLU 1GBKA 4B75A 2CHAC 3SQEE 1ESAA 1V2JT 3M5OA 3TJVA 1GI3A 3ZZ3A 3QN7A 4ZXYH 1T8LA 1C5MD 4TWYA 5EXNA 3SV6A 4IGDA 1AE5A 5LPRA 1IHTH 2F9BH 3LGVA 1SHYA 2PW8H 2DUCA 1NO9H 1WQSA 1E35B 1HAIH 2HPQH 3RXBA 1ZSJA 2GMTC 2FS8A 1DVAH 3RXVA 1SGFA 3TJNA 1B5GH 1BMAA 2BY7X 7LPRA 1FONA 4OGYA 1OWHA 3QX5H 2QXIA 3U8OH 1ZHRA 3JZ2B 1C5OH 1GMDG 1Q3XA 1DSUA 1O5EH 4GPGA 1G32B 3UY9A 1SFQB 1UK3A 2ODPA 4AGJA 1WBGB 2F3CE 2GZ9A 1BJUA 1BTYA 2WUCA 3BF6H 4MNWA 3TK9A 2J2UA 2JETC 1ELBA 5FX6A 1ELFA 1MQ6A 4CHAB 1U6QA 3ZYDA 1QBVH 1QGFA 2ZFPH 4HFPB 1IQFA 6CHAC 2R0LA 1UJ1A 1GCTC 4ZKSU 1TPPA 2XBWA 3RMLH 3ESTA 7KMEH 1KTTB 3MU8A 4YESB 1C5PA 1XKAC 3LJJA 4Y8YA 2ODQA 1O32A 2HNTE 3NPSA 2QXJA 1O2XA 3SOSA 5DP7A 3LPRA 4D7GA 3RP2A 2WINI 3P8OA 4NIVA 4LXBH 2BQ7B 2BDBA 3MFJA 1C1QA 1L4DA 1A5GH 3B8JA 3MTYA 4IMQA 1SQOA 2RA0A 2ZFFH 4X6PA 3VGCB 3F9EA 4XDEA 1O3IA 1SMFE 4Y79A 2PR3A 1O3DA 1S84A 2ZHFH 3T27A 4D8NA 5DP9A 1RIWB 3MH4A 4KGAA 1CT0E 5ETXA 2ZDMA 2J9NA 4OS2A 4PROA 5DP8A 2Z9GA 5GDSH 5CMXH 1SI5H 1MTNB 2GCTB 1P10A 2WPKS 2GP9B 5E0JA 1OP8A 1QRXA 1XKBC 7ESTE 3SNEA 2Y7XA 3MH5A 1C2IA 2FOFA 4YOGA 1TGCA 3RXOA 2ZGJA 3ELAH 1SGNE 3RXKA 3M3SA 1O2VA 2ZI2H 2BY9X 2BZ6H 1BCUH 1ANDA 1YGCH 4CR5A 2A7CA 1V2RT 1S6HA 1UTOA 2O9QA 1C1RA 3BSQA 1QRZA 1AGJA 4FUGA 2HLCA 4JCNA 1QQ4A 2P16A 1LHFH 4NZQA 3LJOA 1AQ7A 3SJOA 3AW0A 3CP7A 3SNBA 4H6SB 1QB6A 3ZZ4A 4IW4E 1O3CA 1V3XA 1RTLA 3RXAA 2Z3DA 1HJ9A 4H42U 1C4U2 1CGJE 1TNIA 3GCNA 4YOJA 3KCGH 1V6DA 1GVZA 3T2NA 4RSPA 2A1DB 2F9NA 2SFAA 4IN2A 3URCA 2ZHDA 1FAKH 2QAAA 1E0FD 3C1KA 3PMBB 1K2I1 1MU6B 3RXEA 3GY6A 1S82A 1B0FA 1DPOA 1RRKA 1G3BA 4Q7XA 3QZQA 2FZZA 3D23A 1ZJKA 1NROH 3P70B 4MNVA 4D9QA 4B2AA 4X1NU 5FBIA 5CHAB 3ZZ8A 1V2VT 1P12E 1V2MT 4ISIH 4JZEH 4ABJA 1LCYA 1DANH 5CE1A 3OU0A 3TH3H 3TLOA 2STAE 1H4WA 2VWLA 1MKWK 1OS8A 3BTME 3LGIA 2H9TH 2BX4A 4AOQA 5C1UA 1F0RA 3M7QA 2ZGBH 4MVNA 2A7JA 2UUKB 3F6UH 3S9CA 1C1SA 2YNAA 4WH8A 3S7KB 1G9IE 1P06A 3RXPA 4B71A 2STBE 1JBUH 2WPJS 1BZXE 3BN9A 1Y3UA 1MUEB 2VGCC 2Y5GA 1O33A 1UHBB 3U9AH 4FUCA 5BPEA 1TLDA 2FDAA 1OKXA 1QL7A 2ZDVH 2CN0H 2G5VA 2AGGX 2ZGXH 4YTAA 1GHWH 3HATH 1XUFA 2ZO3H 1TYNA 2QV1A 2W7UA 4HGCA 5JB8S 1HAXB 2Y5FA 2VIQA 1TONA 1MCTA 2ZWLH 1KXCA 4A5TS 4CRAA 4O3UA 1VCWA 2FODA 5C5OA 3SJ8A 2PLXA 4RKJB 1EOJA 2BY6X 3DT0H 2FLBH 3Q3YA 4U2WA 1O3NA 2TGDA 1H1BA 3HGPA 2PSXA 4I33A 2Q6DA 3S9AA 1W14U 1SBWA 2PGBB 3A8DA 1BT7A 2FYRA 1YPHE 4ABEA 1C2HA 2A7HA 4AFZA 1DLEA 3BTEE 1BRAA 1TMUH 1UTMA 1O2LA 1GGDC 1VR1H 3MMGA 4WH6A 1WYKA 1EZQA 4GCHG 1V2KT 1HIAB 2PKSC 1AVGH 1CA0B 4B76A 1MTVA 2OUAA 1V2UT 3SGBE 4AG1A 1FV9A 1B7XB 1E34B 1GJ5H 4ABAA 2ZFSA 2OC0A 3I78A 1C2KA 3HKIB 1ELGA 4YLUA 3BTQE 2BDGA 1ELVA 1T8MA 1XX9A 2UUJB 1TBQH 1EAWA 4CRDA 1ZPZA 1EPTC 1A0LA 2AIPA 4X1RU 3I77A 1CHOG 4INLA 1ETRH 1ZMNA 3GDVA 1V2NT 1O2IA 2P3UB 4MG3A 1GBTA 2EI6A 1PQAA 4U32A 1O3OA 1V2WT 2XWBI 2SGFE 3RUOA 2VNTA 1S85A 2ZU2A 3CS0A 1O3JA 3RXDA 3GCTF 4NA8A 1L1JA 1O3GA 3LONA 4AFSA 1GDQA 1FY5A 1K28D 1ZPBA 4UE7H 1C5TA 4FXGH 3DFLA 1GI8B 1NC6A 5F8XA 2D2DA 1NRNH 3EA8A 1F0SA 1TMTH 2ZTYA 1C4Y2 5HM2A 3TGKE 3RC5A 3KIDU 3SNAA 2DE8A 2KAIB 2G51A 1OSSA 3PWBA 3SNDA 1F5RA 3KQDA 3RXRA 1PPEE 1E37B 1QCPA 3A82A 3BTTE 1F7ZA 1WCZA 3MU0A 2OC1A 1DOJA 1TQ0B 1TMBH 3RC4A 3KQCA 1MD7A 4FU9A 1KLIH 3PO1B 3OX7U 4VGCB 2D26C 1HV7A 3PMHB 1S5SA 2BY5X 2IOTA 2GT7A 1BA8B 1FY1A 1Y59T 1CQQA 2ANMH 2SGEE 5C67A 1HJAC 1C2FA 1AB9B 1GJBB 3FAOA 2IN2A 4Y0YE 2CF8H 3Q00A 4GVUA 3SU2A 3RXHA 1Z6JH 1AZZA 3K6ZA 1OWDA 2HNTC 4CH8B 1P2MA 3M7TA 4WJG2 1GBMA 3E6PH 3Q3KA 3H7OA 1KDQB 3DHKH 4LZ1H 5FXLA 5F6MA 1G30B 1YPLH 1P2QA 1EJNA 2CXVA 3WY8A 4BAQB 3A88A 3TNTA 5FCRA 4A7IB 3F68H 5GPIB 5FCKA 3AAVA 1YP9A 3B9FH 2Z9IA 1C2JA 3EYDA 1TX6A 2OTVA 2VVVA 1TGBA 4OS7A 3URDA 5DG6A 1KYNA 1A3EH 2B0FA 1O3PB 2J92A 2ZTZA 1GDNA 2PUQH 4NIYA 2BD4A 2BVXH 2QN5T 2W7SA 1SHHB 1GVLA 1RJXB 3SUDA 3T25A 1LPKB 1T32A 1C1PA 1O31A 2Z94A 3STJA 3TK6A 4R0IA 3JZ1B 1VITF 4KP0A 3ATKA 2R3YA 4JYVH 1ANCA 2VVCA 2XRCA 1GJ6A 2OD3B 3MI4A 1LVOA 2IJOB 3S7HB 1H8IH 1ZJDA 1EATA 3A7WA 3RXFA 3QGJA 5FBEA 3GCHC 2P3TB 3ATWA 1FQ3A 2FP7B 3MH7A 2A0QB 2FWWA 1GJ9B 3BG4C 2QGRA 4Y11E 3SV8A 3B23B 5TJXA 4M7GA 1RTKA 1DWDH 1WUNH 1GVKB 1HLTH 5EOKA 4ASHA 1QIXB 5IDKA 2XNIA 3GCOA 4E7NA 3E91A 1AO5A 4CRBA 4NA9H 2UWLA 1UTJA 4Y0ZE 4WVPE 8ESTE 1AWFH 3RMMH 1QURH 2FMJA 3QO6A 2RCEA 4INKA 5GCHF 3LH3A 1PPFE 1SR5C 2WPMS 4ISHH 4WY3A 5JBAS 2AFQB 4JZDH 2GGVB 3SU3A 1ZR0A 2ZFQH 1SGEE 2GZ8A 2QF0A 1GBAA 3HPTB 2WV5A 2AMPA 5EXMA 1O3LA 1F0UA 1O3BA 2G55A 1BTZA 4I8LA 4CBOA 1HAOH 3GY4A 1LVYA 1CBWC 4XBDA 2ASUB 3UREA 1HGTH 1ESTA 5LPEA 4NCYA 5C1YA 3GY2A 4GSOA 2D1JA 2D8WA 3PLBA 1SSXA 1ZRBA 1OX1A 2ZC9H 3V7TA 3VB6A 1AU8A 1G2LA 1HDTH 1YCPK 4K60A 1F92A 3ZVGA 3ZVDA 7GCHG 4JZFH 3SU1A 2ESTE 3NZIA 1JWTA 1LQEA 2ILNA 2A2XH 4K8BA 1UVUH 4B2BA 4ABHA 3MU4A 3RXJA 2CGAA 1XVOA 1D4PB 1VGCB 4IC6A 4FVDA 2ZU3A 3A86A 4H6TA 4K1EA 4KKDA 1FIZA 4AFQA 5B6OA 4CRGA 1UVOA 2LNCA 2PFEA 3LH1A 1MKWH 3BTWE 3LOXA 3GYMA 3AVZA 5EODA 1P01A 1K1NA 4NA7A 1MD8A 8LPRA 3TIUA 4ABBA 2WYJA 1EP6A 1A0HB 2A32A 2A2QH 2FI4E 1LTOA 1MU8B 3LGWA 1Y3XA 2VH0A 1LVBA 2ALPA 1INCA 2A45B 1TBZH 2G5NA 1KDQA 1CT2E 3UOPA 4FUIA 5HGGA 1SGIB 1KXEA 1C5RA 2BTCE 1SVPA 4JK5A 2ULLA 1A4WH 4R8TB 1GMCF 5DJ7A 4CHAC 5LH8A 5PTPA 5C3NA 1ZLRA 2FXRA 3U98H 3NUMA 1AFQB 2SNWA 4K1TA 1BRCE 2ZDKA 2ZFRH 1J14A 3VEQB 1GI5A 4AGKA 1RFNA 3OTJE 1ANEA 1LPZB 2BOKA 1MCVA 3C27B 3L3TA 3NXPA 1K1MA 1NPMA 3MO3A
chains in the Genus database with same CATH superfamily
1HXFH 2NU3E 1O2GH 1D9IA 3GOVB 1TOCB 1XVMA 2Y5HA 4UEHH 1KLTA 3P8FA 3OSYA 2PWXA 4I86A 1E36B 1ETTH 2W6ID 1KTSB 2B7DH 1T31A 1SGCA 1XUGA 2Z9KA 5HIYA 3VGCC 1GPZA 3BEFB 2HRVA 1GJ8B 6GCHF 4UDWH 1ZHPA 4X1QU 1O5CB 1W0ZU 3R3GB 4X2YA 3FP6E 5C17A 2ZTXA 3O8CA 1A46H 2J97A 5A8XA 1GWAA 1P2IA 3GY7A 1WTGH 4KTSA 1S83A 4Y8XA 1DITH 1J8AA 2R2MB 3HKJB 1HAVB 5C0TA 4ABDA 3F9HA 4I8HA 4BTUB 2F9UA 1GG6C 1H8HD 2GCTC 3PV2A 1N6YA 1ZMLA 2V0BA 3MNBA 2SGDE 4BNRA 4ISNA 1SGFG 4ZAEA 1SQAA 1YPEH 2BDIA 1BRBE 4LZ4B 4X0WU 4Y71A 1K21H 1P2NA 3E90B 1GJ4H 3RU4D 2NWNA 3LDXH 1C5XB 2JH6D 4ABFA 4WMDA 1C9PA 4CRFA 5IYTA 1QJ6B 1FPHH 1BTPA 2GCHF 1SGYE 1LHDH 2XC0A 4NSVA 4DIHH 1UVTH 4RT1A 1PFXC 3SU6A 3O8DA 3RU4T 4YM9A 1JRTA 1PYTC 4XBBA 3MNSA 1YY3A 3SJ9A 1QA7A 1NFXA 1ARCA 3ITIA 3M7UA 2WUBA 5T3HA 3A8AA 4A1TA 5EQSA 3SJIA 3BIVH 3MNCA 3SV9A 1V2PT 1QNJA 3I29A 4Q80A 1K1OA 1SGRE 2TGTA 4X8SH 3SHAH 3OTPA 2BD5A 1LQDB 4YOIA 2I6QA 4TSFD 1GJCB 4FUEA 4ISOA 2SNVA 1ABJH 5EQRA 2KFWA 4ISLA 2BQ6B 1C5YB 2PP6A 1SGQE 3P8NA 2QYIA 2A5AA 3BEIB 5JDUB 1CHGA 1G37A 1A3BH 1UVPA 4J1YA 1K9OE 1GCTB 1XUHA 4AN7A 3ZV8A 1FLEE 1SKYE 1QFKH 5CHAC 3KGPA 1O2NA 4I7YH 1AY6H 2TGAA 4O97A 3MNXA 2ODYB 2HLDD 2XXLA 2FOBA 2C8XB 1NRPH 3L6PA 4TY7A 4WWYA 3MU5A 3K2UA 4BANB 4IMZA 1Y3WA 1O2UA 3KQ5A 1G3CA 3A8BA 4XBCA 4Q7ZA 3F0PA 4NIWA 4I8KA 1IAUA 1WTHD 4MNYA 1W10U 1T8NA 1SFIA 1LPGB 1L1GA 5AF9H 4H4FA 3RXMA 1FN6A 3ZVFA 1W11U 1EKBB 1X7AC 1BRUP 2P59A 4NFFA 1GI2A 1ZGVA 3PLPA 3ZYEA 1DS2E 3SI4H 1JOUB 3PRBA 4CR9A 2DE9A 4WMFA 3ZZ7A 1TRMA 2XCNA 1YBWA 5EJZA 2R0KA 2QIQA 4GUXA 1EZUC 2H5CA 1SPJA 1PQ7A 4GLYA 2BD9A 3VB4A 4B1TA 4ZXXH 2ANWA 3IG6B 2H1UA 1KXDA 1PJPA 2GKVE 1UMAH 3SUGA 2RFKC 1P05A 3ZZDA 4AB9A 1RTFB 2H2ZA 2HNTF 4B74A 1EB1H 2FS9A 1NY22 2ZHEH 1GI6A 2TPIZ 3TVJB 1AHTH 2JJ2D 1NM6A 1FNIA 1XXDA 1W12U 2HPPH 2ZU4A 1BIOA 5HKKD 5FHTA 4X6NA 4P02A 1LKBA 3T29A 2FX4A 2A4RA 1FJSA 4F49A 3TH2H 1C5WB 1UCYK 1W13U 2OP9A 4ACAA 4AORA 3MWIU 5AVDA 2P93A 5JBBS 1GHXH 2WYGA 4OS5A 1GHBG 1YCPM 2M5TA 1IOEA 2YNBA 3M5NA 5K7RA 3LU9B 3DFJA 4ZKNU 3V3MA 5A8YA 2F9OA 2AH4X 2UWPA 2P8OB 1SQTA 2QF3A 1C1WH 3HK6B 1EZXC 4BOHA 1TAWA 4D9RA 2AIQA 4HG6A 1BBRK 3QZRA 5GJ4B 4NZLA 1C1UH 3ZZ6A 3UQOA 2F9VA 1HAVA 1EAXA 2P94A 3K65B 2J94A 1CA8B 2LPRA 2TGPZ 1FY8E 2NU4E 3EGKH 5GWZA 1O5DH 1YC0A 1AZ8A 4TPIZ 5E0HA 2ZPSA 4AYYB 1O3KA 1TRYA 4A1VA 3KN2A 5JBCS 1MAYA 1ZZZA 1IQJA 3E8LA 4GHQA 3K9XB 5L30H 4OS1A 1BITA 5DKMA 3F9GA 4WMEA 3SN8A 4ZCNA 2RG3A 3P8GA 5T6GA 1HAYB 4E06H 1YCPH 1YLDA 4NGAH 5C0UA 2VJ1A 4RT0A 1ZTLA 1QRWA 1Y5AT 2G81E 1D6WA 3T26A 1IQNA 1KXFA 1BB0B 1FY3A 2C3SA 1EAIA 2OQ5A 2FTLE 4X2WA 4DCDA 1HBTH 4CRCA 1ESBA 2ZA5A 4UONA 1P9UA 1MMJN 1UTLM 1F5LA 2A5IA 1MTWA 2XBYA 3LGUA 5JB9S 2VIDA 3LC3A 2VGCB 5CDFE 1OHHD 2O8MA 1FAXA 1OOKB 1W7GH 3GY3A 2R9PA 3PROA 3RXIA 4NWLA 1O2WA 3PO1C 4YT6H 2W3IA 2VB0A 1AD8H 3E3TA 8GCHG 3IITA 2CJIA 3W95A 1H9LB 2RA3A 3SV2H 1JIRA 1LO6A 1AB9C 2O8UA 1THPB 3Q76A 2JKHA 2QXHA 1O34A 1KSNA 1P3EA 3F0OA 1SLWB 3UR9A 2G4TA 5A0BA 1O2JA 4DJZB 4JMYA 2AS9A 4Y7AA 5LGOA 1P57B 4SGAE 1HUTH 1F2SE 3U8RH 1O2YA 4MQAA 3LIWA 1VJ9U 2FO9A 2XCFA 5JPMH 4YXWD 1MTUA 2QE7D 2ZDAH 1GHAG 4GAWA 4Q7YA 5EGMA 1UO6A 1LHCH 1DM4B 1W0YH 2TBSA 3FFGA 1H8ED 5EW1H 4TYDA 1O5BB 5ESTE 1LHGH 5E0GA 5EG4A 2PHBA 2C8WB 1OWJA 1SQRA 1YPGH 1G36A 1GBCA 2EEKA 3UWIA 5JYIA 5I46H 2PSYA 4X6MA 1KMHB 2FOCA 3M35A 5HM9A 4JYTA 3GDSA 1TNHA 2GX4A 1EOLA 3UNQA 3TU7H 2FOHA 4BXWA 2J95A 1O2PA 4OGXA 1LHEH 1C1VH 4U30A 1EPTB 1ABIH 1W2KH 2Y7ZA 4K5ZA 2BDYA 3ZZCA 4AX9H 3CS7A 1KXBA 2Z6BD 2LP6A 4DT4A 1O3MA 1GCDA 3W1EA 4X1SU 4B73A 1N8OB 4K3JA 2J98B 2WV9A 1BOQA 3OY5U 3L33A 2PKAA 5DK1A 1S81A 1SLUB 1PPGE 1H8DH 4AB8A 1O2TA 2BZAA 1A7SA 1BTWA 3P6ZB 2AERH 3QTOH 4Z6AH 4AZ2B 1DDJA 1DX5M 2BB4A 1W0JD 1ID5H 3CNRA 3OEED 2V3MA 2Y80A 5C1XA 1QB9A 4X6OA 1CHOF 5L6NH 4Y6DA 1CU1A 1ETSH 1GBBA 4BTTB 1TALA 1T4UH 3TPIZ 1EB2A 2WHXA 3PWCA 2BOHB 4ZKRU 1O2ZA 3GS9A 3SZEA 1XM1A 2H6MA 1T8OA 1J16A 1TWXB 2Z3EA 4E05H 1CT4E 2A4QA 1VJAU 4ZHMU 4CH2B 3SORA 1A5HA 1H9IE 3T28A 3ZV9A 4I32A 4KTUA 4FU7A 2H9EH 1UCYE 1Y8TA 1NU7B 2WPHS 1GBFA 3EQ0H 3TGIE 1XUIA 2PGQB 1Z1JA 1O2KA 3PB1E 1EXFA 2GDDA 4X8TH 1XUJA 3RXSA 5EW2H 4BXSA 5CHBA 4A1XA 2OCVB 4FUJA 1ZHMA 1UTQA 2ANKH 2XBVA 1P03A 2BXTH 4DG4A 3PYHA 2WPDD 1VZQH 5C20A 1QL8A 3Q77A 4TT3D 4BAOB 1IHSH 1GMHF 1GI7B 1TPSA 4ACBA 3BIUH 4DURA 1BBRE 5H4IB 2L74A 3SZNA 3MO9A 1ORFA 2VIVA 1DICA 2RDEA 4LOYH 5G4BA 1UVSH 3MO6A 2F91A 2G52A 3HK3B 1AN1E 1Y3VA 3A85A 1C2MA 3E1XB 1NZQH 1A61H 1HPGA 2AMQA 3PM3A 1TNJA 3F9FA 2ANYA 3OEHD 1HYLA 3EA9A 3VB3A 1HAZB 1OP2A 2QC2A 2NU1E 1UTPA 3EA7A 3UQVA 1HJ8A 1GI4A 2BDHA 4GHTA 2ZU5A 1NTPA 2OC7A 3SGQE 2I6SA 3LC5A 1MAXA 3LGYA 2VIOA 1LKAA 3SQHE 5EU8A 5B6LA 1FXYA 1SGPE 2OLGA 3U1JB 4MLFB 1GMCG 2IJD1 5C5NA 1NFYA 1GI1A 1V2LT 2WZQA 2VU8E 1PYTD 1S0RA 2HALA 3KQEA 1SG8B 1TE0A 4JYUH 2C8ZB 3GISB 3LGTA 1ZTJA 3TK5A 1AUTC 1GHVH 2BLOA 3KHVA 3KEEA 3ZVBA 1RXPA 1CE5A 4E7RG 1IQMA 3ATIA 1THRH 3GCHB 4Y10E 1P09A 3UR6A 1UTNA 3ZZBA 1FN8A 1LMWB 3AW1A 5L2ZH 2V35A 1BMNH 1OPHB 3BG4B 2B5TB 1CGHA 1PPBH 3LT3A 4JK6A 4MPWA 3RXUA 3FANA 4BTIB 2L6OA 2FESH 1PPZA 3DSGA 3RXLA 1O3FA 3QLPH 1BTUA 1VCPA 2OINA 3AAUA 4UFFH 3EE0B 1QTFA 2OBOA 3EAJA 4TY6A 1A1RA 3SU4A 2A5KA 5TCCA 2EI8A 3GY8A 1THSH 1VCQA 4MNXA 3VB5A 1C5QA 3M5LA 3F3BA 4FUBA 2F9PA 3WWBA 3HGNA 1ZGIA 1UCYH 5HXFA 1EPTA 4OM9A 1TGTA 3TJUA 1C5VA 5DP3A 4DT7B 4Y7BA 1NESE 1Z8RA 2ZF0H 4IBLH 4XSKU 2J5UA 4I8JA 4BAHB 1TA6A 3TGJE 2J98A 3M3TA 2SGQE 3PV4A 3RXQA 1C1MA 3D65E 1CSOE 3V0XA 1RGQA 1CBWB 2BYAX 3PMJA 1C1OA 1UW7A 1BBRH 4THNH 3SO3A 1TABE 1O0DH 1HXEH 3A83A 1O2RA 1TQ7B 4NG9H 4OS4A 2GCHG 5I25A 5EXLA 1TB6H 2BD7A 3ZZ5A 1IQLA 1TNLA 1O3EA 2XW9A 1PQ8A 3MHWU 1GL0E 3AASA 3SU0A 1DFPA 2Z3CA 1FPCH 1GBHA 1D3TB 5A0CA 1GBIA 1MKXK 1PPCE 4JZ1A 3P95A 3VXEH 2C4FH 3BEUA 4OS6A 2ZIQH 3M5MA 4YZUA 1GJAB 1EZSC 2BD2A 1P04A 2ZG0H 4D7FA 2NU0E 1O2MA 3BTKE 2VWMA 7GCHF 3OE7D 2VH6A 1Q2WA 3UFAA 4DVAU 1SGDE 1QJ7B 3UPEA 4NWKA 2ZCKP 1RIWC 3RM0H 1FIWA 1A5IA 1NS3A 3ZVEA 1Z71A 1SOTA 2FIRH 3VB7A 1OWEA 1O2QA 3ATLA 3F2GA 4F48B 3H09A 1TOMH 2AGIX 2CHAB 2ZFTA 3KF2A 3QDZB 2PTCE 1ZSLA 2ZGHA 1Y3YA 1IQGA 5IK2D 4I31A 1MTNC 1YPKH 2QA9E 2ZU1A 4CREA 3SBKA 4WF8A 1W0KD 3E0PB 2FM2A 5LPFA 2ZECA 1MZAA 2W3KA 1MBMA 1EASA 1BDAA 1C2EA 4UD9H 1C1NA 2UWOA 3T62A 3M61U 4BAMB 4B2CA 4YO9A 2GMTB 1F0TA 3TITA 3WW7A 2OK5A 1RD3B 2A4OA 2QXGA 4FUFA 2KR7A 1CO7E 3Q3XA 1DUEA 1C5ZB 5A2MH 1HRTH 3UB0A 3ENSB 3A7XA 1P02A 3SNCA 2ZCLP 1ELAA 4ESTE 1WU1A 4FETA 1FI8A 3U28C 4X8UH 1B0EA 1ZYOA 2H9HA 1OXGA 3ZZAA 3RM2H 1PQ5A 3N7DA 3V13A 1GI0A 2XC5A 3ZVCA 2R3UA 3M36A 5E2PA 1TNGA 1GI9B 2B9LA 2FX6A 5DO4H 1DWCH 1C9TA 2JETB 5FPYA 1O37A 1EJAA 3SUFA 2EQNA 3OAAD 4Y8ZA 2G00A 1GMDF 3UIRA 3A89A 2GVFA 1P2JA 5EQQA 5EIYA 1YPMH 2FI5E 2P95A 6CHAB 2PUXB 1SOZA 1TRNA 2BLQA 2JJ1D 3SGAE 1Z8JB 3GYLB 1BMMH 5ESBA 2AHME 1HAHH 2CF9H 1TBRH 1Z6EA 2P3FH 1C2DA 1GG6B 2W26A 3IWMA 3WWFA 1O5FH 4HTCH 1S6FA 2HWLB 3DUXH 1QHRB 1P0SH 4RN6A 1KIGH 1OP0A 2EC9H 3TJOA 3RXTA 1EP5A 1O2HA 2Q1JA 1L1NA 1UK4A 4ZHAA 4MPUA 2FOEA 1C5LH 2YOLA 1NFUA 1BQYA 1HAGE 1TPOA 2O8LA 1O39A 3U1IB 3DD2H 1DY8A 1N6XA 3KNXA 2Z7FE 5J4QA 4JZIA 1PPHE 5BRRE 3ODDA 3FVFB 1OWKA 1P2OA 2FEQH 3DSOA 3PTBA 3SUEA 2OQUA 3A80A 6ESTA 4RKOB 1EUFA 2ZNKH 1JXPA 3CENA 4X1PU 2EA3A 1S0QA 1P11E 1EAUA 3NKKA 2VINA 1SC8U 2XYAA 2FOGA 1GBLA 5T6DA 2KCOA 1GBJA 1NU9A 4NFEA 4MDSA 2ALVA 1AKSA 4ZKOU 1BMLA 1SB1H 1FX0B 1YKTA 3SHCH 3LKWA 4DOQA 2P8OC 4IN1A 1DE7H 2GJGA 4KELA 4MTBA 5EPYA 5DP6A 4Z0KA 1O3AA 2W6JD 4NIXA 4ZUHA 1AIXH 2PKAB 1FY4A 2ZZUH 4FUHA 1Z8GA 1K0HA 1TGSZ 1DY9A 1C5UA 3PLKA 2AYWA 4AFUA 2BLWA 5K0HA 2FI3E 1EFRD 2ZQ1A 2PTNA 1QY6A 5F8ZA 3EDXB 5FX5A 1QB1A 2BDCA 4MPXA 3RLWH 3E0NB 2UUYA 1CA0C 4XE4A 4FUDA 1FDPA 3U69H 2W5EA 4A92A 2J4IA 1L4ZA 2R2WU 1SLXB 3A7VA 3KL6A 1XUKA 1JMOH 5ABWA 1QBNA 3SI3H 1MABB 1KXAA 3SJKA 1J15A 2C93B 1P9SA 1GL1A 1DXWA 1AE8H 1NRRH 2GTBA 3GCTG 4O03A 1WAYB 2Y82A 2HGTH 2J34A 2GDEH 5AFZH 2BXUH 3KQBA 1K1LA 3ATMA 1YM0A 1P3CA 2K1QA 1UTKA 2VIPA 4ABIA 5T6FA 1GBDA 1BTHH 2KM0A 4WXVA 5TCAA 4KTCA 1YLCA 1DWEH 1AVXA 2BDAA 4ZMAH 9ESTA 1K22H 1J9CH 1GDUA 1W7XH 1C2GA 2VWOA 3P17H 5DSFA 3W94A 5C2ZA 3K6YA 3E16B 1XMNB 4K8YA 3VFEA 1H9HE 3MOCA 1HCGA 1C4V2 1Z8IB 2ZEBA 2HOBA 2C8YB 1O2SA 4NSYA 1O5GH 2ZHWH 1ZRKA 2GD4B 1BHXF 1Y5BT 1T7CA 1TFXA 3NK8A 4TWWA 1ZOMA 1RS0A 2V6NA 3S9BA 3EE7A 3M3VA 3NCLA 4Y76A 1YF4A 4MPVA 3BTDE 1A2CH 4VGCC 5HYOA 1OYTH 3N7EA 2V3OH 3R0FA 4IC5A 6LPRA 3MYWA 2V3HH 4Q2KA 1QR3E 5T1VA 1Q31A 1D3QB 3DA9B 2TRMA 2WV4A 4F55A 1C5SA 1DSTA 1MZDA 2GV6A 5DPAA 3U8TH 3QTVH 2FTMA 1AUJA 1QJ1B 4XFQA 1E79D 3GDUA 3VPKA 3N7OA 3ZVAA 1KLJH 3BTHE 1GHBF 1JIMA 1HNEE 1N8OC 5A0AE 1TA2A 2JH0D 4O3TA 4XOJA 4FVBA 1MTSA 1O30A 1WSSH 2IPQX 5SGAE 1OWIA 2Q6FA 2RDLA 2ZP0H 4CBNA 1ELCA 4D76A 5L2YH 2FLRH 1V2OT 1VITG 3TH4H 3RMNH 1TPAE 2AMDA 1W8BH 2XWAA 1GGDB 3RXCA 2G4UA 3A7ZA 1HB0B 5FPTA 1Z7KA 2A31A 1QL9A 2H5DA 2PKSB 2CV3A 5DP4A 2ZDLA 1E38B 1AMHA 3UNSA 3D62A 2VWNA 3DSPA 3SW2B 1BJVA 4J2YB 4UFDH 2KCAA 3FZZA 1ELEE 3H7TA 1A0JA 2BVSH 1TGNA 3OY6U 3STIA 1MKXH 4SGBE 3SU5A 4FU8A 5DGJA 3QK1A 1XXFA 4DIIH 2OC8A 2BX3A 1SGTA 1EX3A 1GMHG 3RXGA 3A7YA 4GCHF 5E2OA 4K1SA 3ZZ9A 2Y6TA 4AG2A 3RC6A 2F83A 3BTFE 1M9UA 1ARBA 1O3HA 3A84A 2GV7A 1EQ9A 4F4OC 2XC4A 1UK2A 3VXFH 1MQ5A 1NN6A 4YLQH 3RLYH 2WPLS 2Z9JA 5FAHA 5GCHG 1DT2A 2XNDD 4IS5A 1ZMJA 1JRSA 1C5NH 1S6LA 1GJ7B 2ZPRA 1FZZA 4UFGH 1MH0A 2FPZA 2G8TA 2CMYA 4LK4A 1IQEA 1NRSH 4DGJA 2QY0B 8GCHF 2AEIH 3DCLA 5JBTA 2IPHA 3S69A 1AFEH 1T4VH 8KME2 2EI7A 3G01A 4U01A 1J17T 3PTNA 3A81A 3UWJH 3D49H 1NRQH 2TIOA 2OXSA 4ZROA 1YYY1 1O5AB 1TX8A 1CGIE 1HAPH 1GJDB 1UHBA 1AWHB 3RMOH 1WV7H 2SGPE 1GHAF 1HJAB 2BQWB 3M37A 1FUJA 1MBQA 2FOMB 1F5KU 1IQKA 1DWBH 1VITH 5F8TA 2QCYA 3H5CB 4QT8C 5EPNA 4INHA 3SV7A 1CVWH 1G2MA 1AVWA 1Y5UT 1SL3A 4O9VA 1P2KA 1ZSKA 1G3EA 2UUFB 1C2LA 3V12A 4ZH8A 2A4GA 2AGEX 2THFB 2ZCHP 5F03A 2SGAA 2XTTB 1L0ZA 3BTGE 1L2EA 3ODFA 2HVXA 1SLVB 3MH6A 3A8CA 1V2QT 2XBXA 1ANBA 4K2YA 1LVMA 1TIOA 1ELDE 2FOAA 3GICB 2OBQA 3QGNB 5A8ZA 1N1LA 5FPSA 2PV9B 5J4SA 1NT1A 3T5FH 1HIAA 2WPIS 2Q6GA 1VGCC 1TX7A 3UTUH 1G3DA 2BLVA 3RDZA 1WOFA 1V2ST 2BY8X 3P92A 2NU2E 2VVUA 4X2XA 2BMGB 4AYVB 3UOUA 1ZTKA 1O38A 1P8VC 2FYQA 2BM2A 4I8GA 3UAIC 4HZHA 1QBOA 1GBEA 1YPJH 3FKSD 1BTXA 1DUAA 1QA0A 1O2OA 3A7TA 3BG8A 1O35A 2O8WA 1NBME 1LDTT 3UUZA 2Y81A 3FP8E 1ACBE 4YT7H 4BAKB 2O8TA 1O36A 1IQIA 3BV9B 2BVRH 3GY5A 1GHYH 2BD3A 1TNKA 1EJMA 5E8EH 2YMSC 5C94A 5HMAA 4A6LA 3F2HA 2KCPA 1AFQC 4DY7B 1K1PA 3TNSA 5AFYH 3OYPA 1FMGA 2ZHQH 6GCHG 5GXPA 1Z1IA 1BHXB 4X2VA 5AHGH 2ZKSA 3UNRA 4TPYA 2J38A 2ZGCA 2ZDNA 4UFEH 1DLKB 2JH5D 1WQVH 2Z9LA 1WDIA 1D3PB 4K69A 1KY9A 5A09A 2KAIA 4ABGA 1ELTA 3A87A 3NWUA 3FP7E 1QQUA 1K1JA 4Q63A 1C1TA 3O8BA 4X8VH 1AI8H 1IQHA 3RU4E 1ZPCA 2VIWA 3MU1A 2ZPQA 3QWCH 2GT8A 5DP5A 1BUIA 1D3DB 3O8RA 1GHZA 2GZ7A 3QUMP 1V2TT 3FZDA 1W3CA 3PMAB 2C90B 2B8OH 1DXPA 4WXIA 1D6RA 1NFWA 2BD8A 4M9FA 1AKSB 4DW2U 9LPRA 1HFDA 1K1IA 1YPHC 2XOKD 3S0NA 3F1SB 2BHGA 2V7QD 5GIBA 2ZQ2A 1OYQA 4HI3A 4ZHLU 1GBKA 4B75A 2CHAC 3SQEE 1ESAA 1V2JT 3M5OA 3TJVA 1GI3A 3ZZ3A 3QN7A 4ZXYH 1T8LA 1E1QD 1C5MD 4TWYA 5EXNA 3SV6A 2VBCA 4IGDA 1AE5A 5LPRA 2CK3D 1IHTH 2F9BH 3LGVA 1SHYA 2PW8H 2DUCA 1NO9H 1WQSA 1E35B 1HAIH 2HPQH 3RXBA 1ZSJA 2GMTC 5EJLA 2FS8A 1DVAH 3RXVA 1SGFA 3TJNA 1B5GH 1BMAA 2HVYB 2BY7X 7LPRA 3PRDA 1FONA 4OGYA 1OWHA 3QX5H 2QXIA 3U8OH 1ZHRA 3JZ2B 4B6EA 1C5OH 1GMDG 1Q3XA 1DSUA 1O5EH 3MQKC 4GPGA 1G32B 3UY9A 1SFQB 1UK3A 2ODPA 4AGJA 1WBGB 2F3CE 2GZ9A 1BJUA 1BTYA 4FOUC 2K8IA 2WUCA 3BF6H 1NBMD 4MNWA 3TK9A 1YLNA 2K0QA 2J2UA 2JETC 1ELBA 5FX6A 1ELFA 1MQ6A 4CHAB 1U6QA 3ZYDA 1QBVH 1QGFA 2ZFPH 4HFPB 1IQFA 6CHAC 2R0LA 1UJ1A 1GCTC 4ZKSU 1TPPA 2XBWA 3RMLH 3AK5A 3ESTA 7KMEH 1KTTB 3MU8A 4YESB 1C5PA 1XKAC 3LJJA 4Y8YA 2ODQA 1O32A 2HNTE 3NPSA 2QXJA 1QZ8A 1O2XA 3SOSA 5DP7A 3LPRA 4D7GA 3RP2A 2WINI 3P8OA 4NIVA 4LXBH 2BQ7B 2BDBA 3MFJA 1C1QA 1L4DA 1A5GH 3B8JA 3MTYA 4IMQA 1SQOA 2RA0A 2ZFFH 4X6PA 3VGCB 3F9EA 4XDEA 1O3IA 1SMFE 4Y79A 2PR3A 1O3DA 1S84A 2ZHFH 3T27A 4D8NA 5DP9A 1RIWB 3MH4A 4KGAA 1CT0E 5ETXA 2ZDMA 2J9NA 2LELA 4OS2A 4PROA 5DP8A 2Z9GA 5GDSH 5CMXH 1SI5H 4Q4LA 1MTNB 2GCTB 1P10A 2WPKS 2GP9B 5E0JA 1OP8A 1QRXA 1XKBC 7ESTE 2KZ4A 3SNEA 2Y7XA 3MH5A 1C2IA 2FOFA 4YOGA 1TGCA 3RXOA 2ZGJA 3ELAH 1SGNE 3RXKA 3M3SA 1O2VA 2ZI2H 2BY9X 2BZ6H 1BCUH 1ANDA 1YGCH 5KGOA 4CR5A 2A7CA 1V2RT 1S6HA 1UTOA 2O9QA 1C1RA 3BSQA 1QRZA 1AGJA 4FUGA 2HLCA 4JCNA 1QQ4A 2P16A 1LHFH 4NZQA 3LJOA 1AQ7A 3SJOA 3AW0A 3CP7A 3SNBA 4H6SB 1QB6A 3ZZ4A 4IW4E 1O3CA 1V3XA 1RTLA 3RXAA 2KCYA 2Z3DA 1HJ9A 4H42U 1C4U2 1CGJE 1TNIA 3GCNA 4YOJA 3KCGH 1V6DA 1GVZA 3T2NA 4RSPA 2A1DB 2F9NA 2SFAA 4IN2A 3URCA 2ZHDA 1FAKH 2QAAA 1E0FD 3C1KA 3PMBB 1K2I1 1MU6B 3RXEA 3GY6A 1S82A 5KECA 1B0FA 1DPOA 1RRKA 1G3BA 4Q7XA 3QZQA 2FZZA 3D23A 1ZJKA 1NROH 3KYGA 3P70B 4MNVA 4D9QA 4B2AA 4X1NU 5FBIA 5CHAB 3ZZ8A 1V2VT 1P12E 1V2MT 4ISIH 4JZEH 4ABJA 2JDID 1LCYA 4XRNA 1DANH 5CE1A 3OU0A 3TH3H 3TLOA 2STAE 1H4WA 2VWLA 1MKWK 1OS8A 3BTME 3LGIA 2H9TH 2BX4A 4AOQA 5C1UA 1F0RA 3M7QA 2ZGBH 4MVNA 2A7JA 2UUKB 3F6UH 3S9CA 1C1SA 2YNAA 4WH8A 3S7KB 1G9IE 1P06A 3RXPA 4B71A 2STBE 1JBUH 2WPJS 1BZXE 3BN9A 1Y3UA 1MUEB 2VGCC 2Y5GA 1O33A 1UHBB 3PV5A 3U9AH 4FUCA 5BPEA 1TLDA 2FDAA 1OKXA 1QL7A 2ZDVH 2CN0H 2G5VA 2AGGX 2ZGXH 4YTAA 1GHWH 3HATH 1XUFA 2ZO3H 1TYNA 2QV1A 5DN6D 2W7UA 4HGCA 5JB8S 1HAXB 2Y5FA 2VIQA 1TONA 1MCTA 2ZWLH 1KXCA 4A5TS 4CRAA 4O3UA 1VCWA 2FODA 4ASUD 5C5OA 3SJ8A 2PLXA 4RKJB 1EOJA 2BY6X 3DT0H 2FLBH 3Q3YA 4U2WA 1O3NA 2TGDA 1H1BA 3HGPA 2PSXA 4I33A 2Q6DA 3S9AA 1W14U 1SBWA 2PGBB 3A8DA 1BT7A 2FYRA 4Z1MD 1YPHE 4ABEA 1C2HA 2A7HA 3F2FA 4AFZA 1DLEA 3BTEE 1BRAA 3NRLA 1TMUH 1UTMA 1O2LA 1GGDC 1VR1H 3MMGA 4WH6A 1WYKA 1EZQA 4GCHG 1V2KT 1HIAB 2PKSC 1AVGH 1CA0B 4B76A 1MTVA 2F43B 2OUAA 1V2UT 3SGBE 4AG1A 1FV9A 1B7XB 1E34B 1GJ5H 4ABAA 2ZFSA 2OC0A 3I78A 1C2KA 3HKIB 1ELGA 4YLUA 3BTQE 3ZIAD 2BDGA 1ELVA 1T8MA 1XX9A 2UUJB 1TBQH 1EAWA 4CRDA 4AC9A 4P00A 1ZPZA 1EPTC 1A0LA 2AIPA 4X1RU 3I77A 1CHOG 4INLA 1ETRH 1ZMNA 3GDVA 3FO8D 1V2NT 1O2IA 2P3UB 4MG3A 1GBTA 2EI6A 1PQAA 4U32A 1O3OA 1V2WT 2XWBI 2SGFE 3RUOA 2VNTA 1S85A 2ZU2A 3CS0A 1O3JA 3RXDA 3GCTF 4NA8A 1L1JA 1O3GA 3LONA 4AFSA 1GDQA 1FY5A 1K28D 1ZPBA 2YMSD 4UE7H 1C5TA 4FXGH 3DFLA 2QF4A 1GI8B 1NC6A 5F8XA 2D2DA 1NRNH 3EA8A 1F0SA 1TMTH 2ZTYA 1C4Y2 5HM2A 3TGKE 3RC5A 3KIDU 3SNAA 2DE8A 2KAIB 2G51A 1OSSA 3PWBA 3SNDA 1F5RA 3KQDA 3RXRA 1PPEE 1E37B 1QCPA 3A82A 3BTTE 1F7ZA 1WCZA 3MU0A 2OC1A 1DOJA 1TQ0B 1TMBH 3RC4A 3KQCA 1MD7A 4FU9A 1KLIH 3PO1B 2EY4C 3OX7U 4VGCB 2D26C 1HV7A 3PMHB 1S5SA 2BY5X 2IOTA 2GT7A 1BA8B 1FY1A 1Y59T 1CQQA 1BMFD 2ANMH 2SGEE 5C67A 1HJAC 1C2FA 1AB9B 1GJBB 2M2AA 3FAOA 1VKYA 2IN2A 4Y0YE 2CF8H 3Q00A 4GVUA 3SU2A 3RXHA 1Z6JH 1AZZA 3K6ZA 1OWDA 2HNTC 4CH8B 1P2MA 3M7TA 4WJG2 1GBMA 3E6PH 2F4LA 3Q3KA 3H7OA 1KDQB 3DHKH 4LZ1H 5FXLA 5F6MA 1G30B 1YPLH 1WXRA 1P2QA 1EJNA 2CXVA 3WY8A 4BAQB 3A88A 3TNTA 5FCRA 4A7IB 3F68H 5GPIB 5FCKA 3OFND 3AAVA 1YP9A 3B9FH 4RI0A 2Z9IA 1C2JA 3EYDA 1TX6A 2OTVA 2VVVA 1TGBA 4OS7A 3URDA 5DG6A 1KYNA 1A3EH 2B0FA 1O3PB 2J92A 2ZTZA 1GDNA 2PUQH 4NIYA 2BD4A 2BVXH 2QN5T 2W7SA 1SHHB 1GVLA 1RJXB 3SUDA 3T25A 1LPKB 1T32A 1C1PA 1O31A 2Z94A 3STJA 3TK6A 4R0IA 2WSSD 3JZ1B 1VITF 4KP0A 3ATKA 3KYFA 2R3YA 1YWUA 4JYVH 1ANCA 2VVCA 2XRCA 1GJ6A 2OD3B 3MI4A 1LVOA 2IJOB 3S7HB 1H8IH 1ZJDA 1EATA 3A7WA 3RXFA 5F53A 3QGJA 5FBEA 3GCHC 2P3TB 3ATWA 3VG8A 1FQ3A 2FP7B 3MH7A 2A0QB 2FWWA 1GJ9B 3BG4C 2QGRA 4Y11E 3SV8A 3FOAA 3B23B 5TJXA 4M7GA 1RTKA 1DWDH 1WUNH 1GVKB 1HLTH 5EOKA 4ASHA 1QIXB 5IDKA 2XNIA 3GCOA 4E7NA 3E91A 1AO5A 4CRBA 4NA9H 2UWLA 1UTJA 4Y0ZE 4WVPE 8ESTE 1AWFH 3RMMH 1QURH 2FMJA 3QO6A 2RCEA 4INKA 5GCHF 3LH3A 1PPFE 1SR5C 2WPMS 4ISHH 4WY3A 5JBAS 2AFQB 4JZDH 2GGVB 3SU3A 1ZR0A 2ZFQH 1SGEE 2GZ8A 2QF0A 1GBAA 3HPTB 2WV5A 2AMPA 5EXMA 1O3LA 5KEDA 1F0UA 1O3BA 2G55A 1BTZA 4I8LA 4CBOA 1HAOH 3GY4A 1LVYA 1CBWC 4XBDA 2ASUB 2QF5A 3UREA 1HGTH 1ESTA 5LPEA 4NCYA 5C1YA 3GY2A 4GSOA 2D1JA 5GNDA 2D8WA 3PLBA 1SSXA 1ZRBA 1OX1A 2ZC9H 3V7TA 3VB6A 1AU8A 1G2LA 1HDTH 1YCPK 4K60A 1F92A 3ZVGA 3ZVDA 7GCHG 4JZFH 3SU1A 2ESTE 3NZIA 1JWTA 4XD7D 1LQEA 2ILNA 2A2XH 4K8BA 1UVUH 4B2BA 4ABHA 3MU4A 3RXJA 2CGAA 1XVOA 1D4PB 1VGCB 4IC6A 5HIZA 4FVDA 2ZU3A 3A86A 4H6TA 4K1EA 4KKDA 1FIZA 1E1RD 4AFQA 5B6OA 4CRGA 1UVOA 2LNCA 2PFEA 3LH1A 1MKWH 3BTWE 3LOXA 3GYMA 3AVZA 5EODA 1P01A 1K1NA 4NA7A 1MD8A 8LPRA 3TIUA 4ABBA 2WYJA 1EP6A 1A0HB 2A32A 2A2QH 2FI4E 2JIZD 1LTOA 1MU8B 1COWD 3LGWA 1Y3XA 2VH0A 3SYJA 1LVBA 2ALPA 1INCA 2A45B 1TBZH 2G5NA 1KDQA 1CT2E 3UOPA 4FUIA 5HGGA 1SGIB 1KXEA 1C5RA 2BTCE 1SVPA 4JK5A 5EJ1A 2ULLA 1A4WH 4R8TB 1GMCF 5DJ7A 4CHAC 5LH8A 5PTPA 2YMSB 5C3NA 1ZLRA 2FXRA 3U98H 3N99A 3NUMA 1AFQB 2SNWA 4K1TA 1BRCE 2ZDKA 2ZFRH 1J14A 2KX4A 3VEQB 1GI5A 4B6FA 5FL7D 4AGKA 1RFNA 3OTJE 1ANEA 1LPZB 2BOKA 1MCVA 3C27B 3L3TA 3NXPA 1K1MA 1NPMA 3FN8A 3MO3A
chains in the Genus database with same CATH topology
1HXFH 2NU3E 1O2GH 1D9IA 3GOVB 1TOCB 1XVMA 2Y5HA 4UEHH 1KLTA 3P8FA 3OSYA 2PWXA 1E36B 1ETTH 1KTSB 2B7DH 1T31A 1SGCA 1XUGA 2Z9KA 3VGCC 1GPZA 3BEFB 2HRVA 1GJ8B 6GCHF 4UDWH 1ZHPA 4X1QU 1O5CB 1W0ZU 3R3GB 4X2YA 3FP6E 2ZTXA 3O8CA 1A46H 5A8XA 1GWAA 1P2IA 3GY7A 1WTGH 4KTSA 1S83A 4Y8XA 1DITH 1J8AA 2R2MB 3HKJB 1HAVB 4ABDA 3F9HA 4I8HA 4BTUB 2F9UA 1GG6C 2GCTC 1N6YA 1ZMLA 2V0BA 3MNBA 2SGDE 4BNRA 4ISNA 1SGFG 4ZAEA 1SQAA 1YPEH 2BDIA 1BRBE 4LZ4B 4X0WU 4Y71A 1K21H 1P2NA 3E90B 1GJ4H 3RU4D 2NWNA 3LDXH 1C5XB 2JH6D 4ABFA 4WMDA 1C9PA 4CRFA 5IYTA 1QJ6B 1FPHH 1BTPA 2GCHF 1SGYE 1LHDH 2XC0A 4NSVA 4DIHH 1UVTH 1PFXC 3SU6A 3O8DA 3RU4T 4YM9A 1JRTA 1PYTC 4XBBA 3MNSA 3SJ9A 1QA7A 1NFXA 1ARCA 3ITIA 3M7UA 2WUBA 5T3HA 3A8AA 4A1TA 5EQSA 3SJIA 3BIVH 3MNCA 3SV9A 1V2PT 1QNJA 3I29A 4Q80A 1K1OA 1SGRE 2TGTA 4X8SH 3SHAH 2BD5A 1LQDB 4YOIA 2I6QA 1GJCB 4FUEA 4ISOA 2SNVA 1ABJH 5EQRA 4ISLA 2BQ6B 1C5YB 1SGQE 3P8NA 2QYIA 2A5AA 3BEIB 5JDUB 1CHGA 1G37A 1A3BH 1UVPA 4J1YA 1K9OE 1GCTB 1XUHA 4AN7A 3ZV8A 1FLEE 1QFKH 5CHAC 3KGPA 1O2NA 4I7YH 1AY6H 2TGAA 4O97A 3MNXA 2ODYB 2XXLA 2FOBA 2C8XB 1NRPH 3L6PA 4TY7A 4WWYA 3MU5A 3K2UA 4BANB 4IMZA 1Y3WA 1O2UA 1G3CA 3A8BA 4XBCA 4Q7ZA 4NIWA 4I8KA 1IAUA 1WTHD 4MNYA 1W10U 1T8NA 1SFIA 1LPGB 1L1GA 5AF9H 4H4FA 3RXMA 1FN6A 3ZVFA 1W11U 1EKBB 1X7AC 1BRUP 2P59A 4NFFA 1GI2A 1ZGVA 3PLPA 3ZYEA 1DS2E 3SI4H 1JOUB 4CR9A 2DE9A 4WMFA 3ZZ7A 1TRMA 2XCNA 1YBWA 2R0KA 2QIQA 4GUXA 1EZUC 2H5CA 1SPJA 1PQ7A 4GLYA 2BD9A 3VB4A 4B1TA 4ZXXH 2ANWA 3IG6B 2H1UA 1KXDA 1PJPA 2GKVE 1UMAH 3SUGA 1P05A 3ZZDA 4AB9A 1RTFB 2H2ZA 2HNTF 4B74A 1EB1H 2FS9A 1NY22 2ZHEH 1GI6A 2TPIZ 3TVJB 1AHTH 1NM6A 1FNIA 1XXDA 1W12U 2HPPH 2ZU4A 1BIOA 5FHTA 4X6NA 1LKBA 3T29A 2FX4A 2A4RA 1FJSA 4F49A 3TH2H 1C5WB 1UCYK 1W13U 2OP9A 4AORA 3MWIU 5AVDA 2P93A 5JBBS 1GHXH 2WYGA 4OS5A 1GHBG 1YCPM 2M5TA 1IOEA 2YNBA 3M5NA 5K7RA 3LU9B 3DFJA 4ZKNU 3V3MA 5A8YA 2F9OA 2AH4X 2UWPA 2P8OB 1SQTA 2QF3A 1C1WH 3HK6B 1EZXC 4BOHA 1TAWA 4D9RA 2AIQA 1BBRK 3QZRA 5GJ4B 4NZLA 1C1UH 3ZZ6A 3UQOA 2F9VA 1HAVA 1EAXA 2P94A 3K65B 2J94A 1CA8B 2LPRA 2TGPZ 1FY8E 2NU4E 3EGKH 5GWZA 1O5DH 1YC0A 1AZ8A 4TPIZ 5E0HA 2ZPSA 4AYYB 1O3KA 1TRYA 4A1VA 3KN2A 5JBCS 1MAYA 1ZZZA 1IQJA 3E8LA 4GHQA 3K9XB 5L30H 4OS1A 1BITA 5DKMA 3F9GA 4WMEA 3SN8A 2RG3A 3P8GA 5T6GA 1HAYB 4E06H 1YCPH 1YLDA 4NGAH 2VJ1A 1ZTLA 1QRWA 1Y5AT 2G81E 1D6WA 3T26A 1IQNA 1KXFA 1BB0B 1FY3A 2C3SA 1EAIA 2OQ5A 2FTLE 4X2WA 4DCDA 1HBTH 4CRCA 1ESBA 2ZA5A 4UONA 1P9UA 1MMJN 1UTLM 1F5LA 2A5IA 1MTWA 2XBYA 3LGUA 5JB9S 2VIDA 3LC3A 2VGCB 2O8MA 1FAXA 1OOKB 1W7GH 3GY3A 2R9PA 3PROA 3RXIA 4NWLA 1O2WA 3PO1C 4YT6H 2W3IA 2VB0A 1AD8H 3E3TA 8GCHG 3IITA 2CJIA 3W95A 1H9LB 2RA3A 3SV2H 1JIRA 1LO6A 1AB9C 2O8UA 1THPB 3Q76A 2JKHA 2QXHA 1O34A 1KSNA 1P3EA 1SLWB 3UR9A 2G4TA 5A0BA 1O2JA 4DJZB 4JMYA 2AS9A 4Y7AA 5LGOA 1P57B 4SGAE 1HUTH 1F2SE 3U8RH 1O2YA 4MQAA 3LIWA 1VJ9U 2FO9A 2XCFA 5JPMH 1MTUA 2ZDAH 1GHAG 4GAWA 4Q7YA 5EGMA 1UO6A 1LHCH 1DM4B 1W0YH 2TBSA 3FFGA 5EW1H 4TYDA 1O5BB 5ESTE 1LHGH 5E0GA 5EG4A 2PHBA 2C8WB 1OWJA 1YPGH 1G36A 1GBCA 2EEKA 3UWIA 5JYIA 5I46H 2PSYA 4X6MA 2FOCA 3M35A 5HM9A 4JYTA 3GDSA 1TNHA 2GX4A 1EOLA 3UNQA 3TU7H 2FOHA 4BXWA 2J95A 1O2PA 4OGXA 1LHEH 1C1VH 4U30A 1EPTB 1ABIH 1W2KH 2Y7ZA 4K5ZA 2BDYA 3ZZCA 4AX9H 3CS7A 1KXBA 2Z6BD 1O3MA 1GCDA 4X1SU 4B73A 1N8OB 4K3JA 1BOQA 3OY5U 3L33A 2PKAA 5DK1A 1S81A 1SLUB 1PPGE 1H8DH 4AB8A 1O2TA 2BZAA 1A7SA 1BTWA 3P6ZB 2AERH 3QTOH 4Z6AH 4AZ2B 1DDJA 1DX5M 2BB4A 5C1XA 1ID5H 5L6NH 2Y80A 1QB9A 4X6OA 1CHOF 4Y6DA 1CU1A 1ETSH 1GBBA 4BTTB 1TALA 1T4UH 3TPIZ 1EB2A 3PWCA 2BOHB 4ZKRU 1O2ZA 1XM1A 2H6MA 1T8OA 1J16A 1TWXB 2Z3EA 4E05H 1CT4E 2A4QA 1VJAU 4ZHMU 4CH2B 3SORA 1A5HA 1H9IE 3T28A 3ZV9A 4I32A 4KTUA 4FU7A 2H9EH 1UCYE 1Y8TA 1NU7B 2WPHS 1GBFA 3EQ0H 3TGIE 1XUIA 2PGQB 1Z1JA 1O2KA 3PB1E 1EXFA 2GDDA 4X8TH 1XUJA 3RXSA 5EW2H 4BXSA 4A1XA 2OCVB 4FUJA 1ZHMA 1UTQA 2ANKH 2XBVA 1P03A 2BXTH 4DG4A 3PYHA 1VZQH 5C20A 1QL8A 3Q77A 4BAOB 1IHSH 1GMHF 1GI7B 1TPSA 3BIUH 4DURA 1BBRE 5H4IB 3SZNA 3MO9A 1ORFA 2VIVA 1DICA 4LOYH 5G4BA 1UVSH 3MO6A 2F91A 2G52A 3HK3B 1AN1E 1Y3VA 3A85A 1C2MA 3E1XB 1NZQH 1A61H 1HPGA 2AMQA 3PM3A 1TNJA 3F9FA 2ANYA 3VB3A 1HYLA 3EA9A 1HAZB 1OP2A 2QC2A 2NU1E 1UTPA 3EA7A 3UQVA 1HJ8A 1GI4A 2BDHA 4GHTA 2ZU5A 1NTPA 2OC7A 3SGQE 2I6SA 3LC5A 1MAXA 3LGYA 2VIOA 1LKAA 3SQHE 5EU8A 3U1JB 1FXYA 1SGPE 2OLGA 4MLFB 1GMCG 5C5NA 1NFYA 1GI1A 1V2LT 2VU8E 1PYTD 1S0RA 2HALA 3KQEA 1SG8B 1TE0A 4JYUH 2C8ZB 3GISB 3LGTA 1ZTJA 3TK5A 1AUTC 1GHVH 2BLOA 3KHVA 3KEEA 3ZVBA 1RXPA 1CE5A 4E7RG 1IQMA 3ATIA 1THRH 3GCHB 4Y10E 1P09A 3UR6A 1UTNA 3ZZBA 1FN8A 1LMWB 3AW1A 5L2ZH 2V35A 1BMNH 1OPHB 3BG4B 2B5TB 1CGHA 1PPBH 3LT3A 4JK6A 4MPWA 3RXUA 3FANA 4BTIB 2FESH 1PPZA 3RXLA 1O3FA 3QLPH 1BTUA 1VCPA 2OINA 3AAUA 4UFFH 3EE0B 1QTFA 2OBOA 3EAJA 4TY6A 1A1RA 3SU4A 2A5KA 5TCCA 2EI8A 3GY8A 1THSH 1VCQA 4MNXA 3VB5A 1C5QA 3M5LA 4FUBA 2F9PA 3HGNA 1ZGIA 1UCYH 5HXFA 1EPTA 1TGTA 3TJUA 1C5VA 5DP3A 4DT7B 4Y7BA 1NESE 1Z8RA 2ZF0H 4IBLH 4XSKU 4I8JA 4BAHB 1TA6A 3TGJE 3M3TA 2SGQE 3PV4A 3RXQA 1C1MA 3D65E 1CSOE 3V0XA 1RGQA 1CBWB 2BYAX 3PMJA 1C1OA 1BBRH 4THNH 3SO3A 1TABE 1O0DH 1HXEH 3A83A 1O2RA 1TQ7B 4NG9H 4OS4A 2GCHG 5I25A 5EXLA 1TB6H 2BD7A 3ZZ5A 1IQLA 1TNLA 1O3EA 2XW9A 1PQ8A 3MHWU 1GL0E 3AASA 3SU0A 1DFPA 2Z3CA 1FPCH 1GBHA 1D3TB 5A0CA 1GBIA 1MKXK 1PPCE 4JZ1A 3P95A 3VXEH 2C4FH 3BEUA 4OS6A 2ZIQH 3M5MA 4YZUA 1GJAB 1EZSC 2BD2A 1P04A 2ZG0H 4D7FA 2NU0E 1O2MA 3BTKE 2VWMA 7GCHF 2VH6A 1Q2WA 3UFAA 4DVAU 1SGDE 1QJ7B 3UPEA 4NWKA 2ZCKP 1RIWC 3RM0H 1FIWA 1A5IA 1NS3A 3ZVEA 1Z71A 1SOTA 2FIRH 3VB7A 1OWEA 1O2QA 3ATLA 1TOMH 2AGIX 2CHAB 2ZFTA 3KF2A 3QDZB 2PTCE 1ZSLA 2ZGHA 1Y3YA 1IQGA 4I31A 1MTNC 1YPKH 2QA9E 2ZU1A 4CREA 3SBKA 4WF8A 3E0PB 2FM2A 5LPFA 2ZECA 1MZAA 2W3KA 1MBMA 1EASA 1BDAA 1C2EA 4UD9H 1C1NA 2UWOA 3T62A 3M61U 4BAMB 4B2CA 4YO9A 2GMTB 1F0TA 3TITA 1RD3B 2A4OA 2QXGA 4FUFA 1CO7E 3Q3XA 1DUEA 1C5ZB 5A2MH 1HRTH 3ENSB 3A7XA 1P02A 3SNCA 2ZCLP 1ELAA 4ESTE 1WU1A 1FI8A 4X8UH 1B0EA 1ZYOA 2H9HA 1OXGA 3ZZAA 3RM2H 1PQ5A 3V13A 1GI0A 2XC5A 3ZVCA 2R3UA 3M36A 5E2PA 1TNGA 1GI9B 2B9LA 2FX6A 5DO4H 1DWCH 1C9TA 2JETB 5FPYA 1O37A 1EJAA 3SUFA 4Y8ZA 2G00A 1GMDF 3UIRA 3A89A 2GVFA 1P2JA 5EQQA 1YPMH 2FI5E 2P95A 6CHAB 2PUXB 1SOZA 1TRNA 2BLQA 3SGAE 1Z8JB 3GYLB 1BMMH 5ESBA 1HAHH 2CF9H 1TBRH 1Z6EA 2P3FH 1C2DA 1GG6B 2W26A 3IWMA 1O5FH 4HTCH 1S6FA 2HWLB 3DUXH 1QHRB 1P0SH 4RN6A 1KIGH 1OP0A 2EC9H 3TJOA 3RXTA 1EP5A 1O2HA 2Q1JA 1L1NA 1UK4A 4ZHAA 4MPUA 2FOEA 1C5LH 2YOLA 1NFUA 2O8LA 1BQYA 1HAGE 1TPOA 1O39A 3U1IB 3DD2H 1DY8A 1N6XA 3KNXA 2Z7FE 5J4QA 4JZIA 1PPHE 5BRRE 3ODDA 3FVFB 1OWKA 1P2OA 2FEQH 3PTBA 3SUEA 2OQUA 3A80A 6ESTA 4RKOB 1EUFA 2ZNKH 1JXPA 3CENA 4X1PU 2EA3A 1S0QA 1P11E 1EAUA 3NKKA 2VINA 1SC8U 2XYAA 2FOGA 1GBLA 5T6DA 1GBJA 1NU9A 4NFEA 4MDSA 2ALVA 1AKSA 4ZKOU 1BMLA 1SB1H 1YKTA 3SHCH 3LKWA 4DOQA 2P8OC 4IN1A 1DE7H 4KELA 4MTBA 5EPYA 5DP6A 4Z0KA 1O3AA 4NIXA 4ZUHA 1AIXH 2PKAB 1FY4A 2ZZUH 4FUHA 1Z8GA 1TGSZ 1DY9A 1C5UA 3PLKA 2AYWA 4AFUA 2BLWA 5K0HA 2FI3E 2ZQ1A 2PTNA 1QY6A 5F8ZA 3EDXB 5FX5A 1QB1A 2BDCA 4MPXA 3RLWH 3E0NB 2UUYA 1CA0C 4XE4A 4FUDA 1FDPA 3U69H 2W5EA 4A92A 2J4IA 1L4ZA 2R2WU 1SLXB 3A7VA 3KL6A 1XUKA 1JMOH 5ABWA 1QBNA 3SI3H 1KXAA 3SJKA 1J15A 2C93B 1P9SA 1GL1A 1DXWA 1AE8H 1NRRH 2GTBA 3GCTG 4O03A 1WAYB 2Y82A 2HGTH 2J34A 2GDEH 5AFZH 2BXUH 3KQBA 1K1LA 3ATMA 1YM0A 1P3CA 2K1QA 1UTKA 2VIPA 4ABIA 5T6FA 1GBDA 1BTHH 4WXVA 5TCAA 4KTCA 1YLCA 1DWEH 1AVXA 2BDAA 4ZMAH 9ESTA 1K22H 1J9CH 1GDUA 1W7XH 1C2GA 2VWOA 3P17H 3W94A 5C2ZA 3K6YA 3E16B 1XMNB 4K8YA 3VFEA 1H9HE 3MOCA 1HCGA 1C4V2 1Z8IB 2ZEBA 2HOBA 2C8YB 1O2SA 4NSYA 1O5GH 2ZHWH 1ZRKA 2GD4B 1BHXF 1Y5BT 1T7CA 1TFXA 3NK8A 4TWWA 1ZOMA 1RS0A 2V6NA 3S9BA 3M3VA 3NCLA 4Y76A 1YF4A 4MPVA 3BTDE 1A2CH 4VGCC 5HYOA 1OYTH 2V3OH 3R0FA 4IC5A 6LPRA 3MYWA 2V3HH 4Q2KA 1QR3E 1Q31A 1D3QB 3DA9B 2TRMA 2WV4A 1C5SA 1DSTA 1MZDA 2GV6A 5DPAA 3U8TH 3QTVH 2FTMA 1AUJA 1QJ1B 4XFQA 3GDUA 3VPKA 3N7OA 3ZVAA 1KLJH 3BTHE 1GHBF 1JIMA 1HNEE 1N8OC 5A0AE