4NIXA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) orthorhombic form, zinc-bound
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
GGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGHTKSSGTSHPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKKSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 221
sequence length 221
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA02
5AF9H 4JMYA 2VIOA 2OC7A 1SI5H 1F5RA 1C2JA 1TX7A 3BTHE 3V0XA 1K1JA 2TGTA 1QFKH 3SGQE 1LPGB 3BG4C 2C93B 2V3HH 2WYJA 2QC2A 1VGCB 4ZHMU 1DXPA 3F9EA 4YTAA 5EQQA 4GVUA 1CSOE 4NWLA 4X2XA 3KIDU 5HM2A 3PROA 3VB3A 1GDUA 3SGAE 4B76A 1D9IA 2BD4A 2FODA 1O3AA 2SGEE 1AE5A 3GDVA 2P59A 5F8XA 1CHOF 2A7CA 1AUTC 1S82A 3B9FH 1W14U 2PKSB 3PWBA 4AFZA 1C5ZB 1UTMA 1GBFA 3EAJA 1SGNE 1NPMA 4ZXXH 4KTUA 5JBCS 2ESTE 3HKIB 1TOCB 1UTKA 2VWLA 1V2WT 1UTQA 2C8ZB 3GCOA 4AB9A 1S6HA 3BEFB 1D3QB 1GI6A 1C5WB 1AI8H 1XVOA 1Y3XA 1GBHA 2ZU4A 2VGCC 4A5TS 1P3EA 2JH5D 2ODQA 1GJCB 3LGYA 2GT7A 1GBLA 1DFPA 2FOAA 1D3DB 1G9IE 3UREA 4AORA 2BYAX 3MYWA 3RC6A 1VR1H 1YP9A 1GHBF 1HJAB 2SGPE 1O0DH 1BJVA 1W2KH 4K69A 4ZKNU 2BD3A 1KY9A 2VU8E 1O31A 3LGVA 4GHTA 1ZSJA 2VINA 2C8WB 4BXSA 1C2DA 1P05A 4X8UH 4R8TB 1O3HA 2J4IA 2Z3DA 3VGCB 3O8CA 1L1JA 2QF3A 3LPRA 2W3IA 1C5YB 2GCTC 3GCHC 1F92A 2NU4E 1SHYA 3B23B 4MDSA 2TGDA 1C5PA 3PTNA 1YPGH 1VCPA 3VPKA 2JH0D 3A7WA 2PUXB 4WXVA 1P09A 1G3BA 1TABE 4WJG2 1BHXF 4YLQH 1SL3A 3KQEA 3A86A 2WPJS 3BTEE 4U30A 5DG6A 1P2IA 2UUYA 2GGVB 3T25A 1BZXE 1EPTC 2ZDKA 1TMTH 4B2CA 2A4QA 1H9HE 5E2PA 3KHVA 1C9PA 2XBWA 4A7IB 2D8WA 2Y6TA 1HAIH 1INCA 1SG8B 4CRAA 1C5MD 3P17H 1FXYA 1ARCA 3LH1A 3URCA 1SGFG 1CA0C 1AVXA 3MH6A 3ATKA 1TNHA 2GV6A 4BAKB 4SGAE 4X8VH 1DLKB 4NZQA 1FUJA 2ZDNA 3GOVB 1THRH 4NA9H 1AFEH 5GIBA 1GCDA 2PFEA 1MZDA 2QAAA 5EOKA 2Y7ZA 2FPZA 3GYLB 1MAXA 2TGPZ 2ZGCA 2BZ6H 1IQFA 2CN0H 1W13U 2YOLA 1OXGA 2FI3E 2F9OA 3MNSA 1AB9B 1SLXB 3MU4A 2G52A 1V2UT 2HNTC 4D9QA 3BEIB 2DE9A 2O8MA 4UEHH 4I8HA 3CENA 2VIVA 3RDZA 4Y6DA 1GMCG 3F68H 1CT4E 5GXPA 2GVFA 1THPB 3A85A 1V2KT 5DP4A 1TRMA 3R3GB 3U1IB 3ZYEA 1W0ZU 3STJA 1DUAA 2ZGBH 2ZTZA 1HAHH 3OU0A 4DVAU 2GCTB 2BDHA 2ANMH 1C2EA 3BTQE 2P3UB 2VVVA 2R9PA 1J9CH 1NS3A 2P8OB 3AASA 4CRBA 1SGQE 1F0TA 2R2WU 1SFQB 1P0SH 3SV9A 2AIPA 1FV9A 2BHGA 4RKOB 1S81A 3BF6H 1YLDA 3MNXA 3LGWA 1BRAA 2HNTF 2HWLB 1NRQH 1QRZA 1TONA 3GCNA 2XCFA 1GBIA 1GBKA 1KTSB 1O36A 1GI5A 5A2MH 2ZPQA 4JK5A 1O3CA 1TNJA 2FM2A 4NZLA 3SU2A 3LJOA 1F2SE 2XTTB 2ZU1A 2QCYA 4UDWH 5JBBS 2F9VA 2XC0A 3E8LA 1RGQA 2CHAC 3E6PH 1GHYH 1P9UA 2XBYA 4FUJA 1JMOH 2A5KA 2HVXA 1WQSA 4ISIH 1P57B 2ZHWH 2GMTC 2Y80A 3SZNA 1NESE 3A82A 2J34A 1BMAA 2ZHQH 5GDSH 5AFYH 3F9FA 1CT0E 3MFJA 1TNLA 2VIWA 4MLFB 2ZTYA 4NIWA 1RJXB 1O39A 1C5TA 2ZU3A 1K21H 3M61U 1O30A 1EJAA 1JRTA 1G32B 1UO6A 3OSYA 5J4SA 5LPRA 1YCPK 1VCQA 1TB6H 1MTSA 1QR3E 4Y8YA 4U2WA 1A0JA 1F0RA 3TITA 1SQAA 1WV7H 1G36A 1HPGA 4XE4A 1LDTT 1QIXB 1TNGA 1GJ7B 3DT0H 1J14A 3T5FH 2ZFSA 2PTNA 2AGGX 4IMZA 3MH5A 4TYDA 3FAOA 3GDUA 3UNRA 1YKTA 3VXEH 3BTGE 1KXCA 2AMPA 1GI9B 1MU8B 2ALVA 3UNQA 4Z6AH 4M7GA 2AYWA 3EE0B 3URDA 1QBVH 2FS8A 1HAVB 3NKKA 1XUGA 5C5OA 2BY5X 4Y76A 2PKSC 3I78A 3V3MA 1C9TA 1HV7A 1EASA 3OY5U 7GCHG 3BG8A 4WVPE 3HGPA 4AFUA 1CT2E 5EW2H 3UNSA 1ZLRA 2Z94A 2P3FH 4WWYA 1IQJA 4Y71A 2F83A 5DP8A 2RCEA 3V13A 1MKWK 4K5ZA 5BPEA 3MI4A 5T6DA 1IQIA 2BD7A 4ABJA 1LQEA 4Q80A 1S84A 5A0AE 3T2NA 3FP7E 5LPEA 1P06A 1HAXB 4X2WA 1H1BA 3M7UA 3ENSB 1KXAA 1PPGE 6CHAB 3L3TA 5FX5A 5FPSA 1QTFA 1ZHPA 2W26A 2ZF0H 1BBRK 1EUFA 1Z71A 2W7SA 1HYLA 1C2IA 1O2SA 1A0HB 3KN2A 1V2OT 1FIZA 7ESTE 3KL6A 1N1LA 2Z9IA 3KQCA 4ABEA 6GCHF 3DHKH 3P8GA 3ZVGA 2AERH 2Y7XA 3LKWA 3SU5A 1V2QT 1E34B 4O3UA 4F4OC 1BQYA 1LHCH 3A7XA 1C1VH 4ABAA 1C1QA 1SB1H 1OYTH 1SGEE 2NU2E 5E0HA 4IMQA 2FO9A 1MAYA 1NRNH 1YC0A 2PHBA 2BDIA 3SNBA 1GGDB 2WYGA 1BITA 1WAYB 3R0FA 1SOTA 1ORFA 2BDGA 3MNCA 4E06H 2ZTXA 1O5CB 2BQ7B 4MTBA 2THFB 3HKJB 4Y0ZE 1E35B 1PYTC 4YOIA 3MH4A 1FY5A 1O3JA 3BTWE 3M3TA 4FUCA 1GJ6A 2FX4A 3SUFA 3U69H 5A0BA 2G00A 1UHBB 1IQKA 1WU1A 3HPTB 3PLBA 4AGJA 1XUHA 3ZYDA 2W7UA 1TPAE 2R3UA 4XBBA 1E36B 1YCPM 7KMEH 1LTOA 2V3OH 2OP9A 4AB8A 1TALA 1TGTA 3SI3H 4I31A 1DLEA 1C1UH 3RXOA 1GJ5H 2WPMS 3SJIA 2G55A 1CQQA 5ESBA 1UTJA 1XUJA 3PB1E 2AGEX 3P8OA 1PYTD 2GV7A 3F9HA 1BMNH 3BEUA 2PKAB 2ZPRA 3SHAH 4ASHA 4ZKOU 2R0KA 1Z8RA 1QCPA 1TQ0B 2C4FH 4JYTA 4RN6A 1TBQH 1OP0A 3E3TA 3EDXB 1O2LA 2WPIS 2ZCLP 3M5OA 1QRWA 1GBCA 2VVUA 3UOUA 4ABHA 1IQGA 1JXPA 8GCHF 2BZAA 1BTWA 3LT3A 1ZTJA 2QN5T 3MU5A 3TIUA 1IQNA 1DSTA 4FUEA 3AW1A 5T3HA 2OD3B 3E0NB 4I7YH 5DO4H 1O2NA 1PQ7A 4IC6A 1A3EH 3RXTA 1P01A 1K1IA 3M5MA 4FU7A 4WMEA 3E16B 1P3CA 1TRYA 3KCGH 1QQ4A 1C4Y2 4X2YA 1ZHRA 1P8VC 2JH6D 4YM9A 1GVLA 4MQAA 3BTDE 3RXPA 3RXBA 1W0YH 4CRGA 4O9VA 1UTNA 1MTVA 1OP8A 2ZZUH 2SGDE 1JRSA 4AOQA 2BY7X 2FESH 3BIVH 4MNYA 1IAUA 4WY3A 1C5XB 2VB0A 1UCYE 5DP9A 6GCHG 1ETTH 1ELCA 2P8OC 1GI2A 3E90B 2Y5GA 3NUMA 1RD3B 4SGBE 3SI4H 5JBAS 1CGHA 2H5CA 1SR5C 4UFGH 1ESTA 2NU3E 4ABDA 4FU9A 1IHSH 2BD8A 1Z8GA 3K65B 1L1NA 2OXSA 2B0FA 2WV4A 3O8DA 3IWMA 1T32A 2GMTB 3GCHB 1A3BH 1IOEA 1P2KA 2ODYB 4DGJA 1NU9A 3A84A 4CRFA 2G4TA 3S0NA 2CHAB 2FWWA 3SV6A 2A4OA 3KQBA 2AIQA 3SORA 4KTCA 1ABIH 2ZC9H 2A32A 3A8DA 1SGIB 3EQ0H 2SGFE 2SNWA 1XKBC 3SJ8A 5GJ4B 5JBTA 2PTCE 2XRCA 2XWAA 1OWKA 3C1KA 1QGFA 2Q6GA 3S7HB 1HJ8A 1QA0A 1QL7A 3M5NA 3QGJA 1T4UH 2ZGXH 6ESTA 1IQMA 1O2KA 5F8TA 5JDUB 2D1JA 5DPAA 4A6LA 5E2OA 4I33A 3ZZAA 2AH4X 1EATA 3Q3YA 3SU1A 1AIXH 3HGNA 1GJBB 3ZZCA 3U8OH 1YPLH 2PSYA 2P3TB 3ZZ6A 1C1RA 1ZGIA 2O8WA 3D62A 5GCHF 1N8OC 1RTFB 3UIRA 1AHTH 2FOFA 4JZEH 4LZ1H 4YOJA 1CBWC 1GHBG 1CVWH 2FX6A 2JKHA 1GL0E 2AMDA 3TGIE 1VITH 1X7AC 3U98H 1LO6A 3QZQA 4Y79A 2PV9B 4OS7A 4DT7B 1QURH 3ZZ5A 1LHGH 4RSPA 1CGJE 3T27A 2GZ8A 3ZVFA 1CBWB 3ATIA 4H4FA 5B6OA 3OYPA 1DSUA 4WH6A 1EQ9A 2FYQA 5AHGH 3SUGA 2BD2A 2FOBA 1HAVA 3AAUA 1BB0B 2GZ9A 4BOHA 1XUIA 4GLYA 1SFIA 2F9NA 1NT1A 1Y8TA 3M5LA 1TPPA 1ANCA 1MCTA 2OQ5A 3UR6A 1GG6C 2VNTA 3MWIU 2R0LA 2BOKA 4ABBA 5K0HA 1NRSH 2QYIA 2ZKSA 3A88A 1QBOA 3KNXA 2OBQA 1TOMH 4HTCH 2NU0E 2ZDMA 4B74A 2Q6FA 3TH3H 5TJXA 4CHAB 1SQTA 1XM1A 4NWKA 3FANA 4FUIA 1FY3A 1ZPCA 1C1NA 3QZRA 1EX3A 2SNVA 3C27B 1XKAC 4KGAA 2ZEBA 1K28D 1UK3A 2QF0A 4KP0A 1Y3WA 2BVXH 5EGMA 4I8KA 1TBRH 3A89A 3P92A 8ESTE 1MD7A 3CP7A 5C20A 5I46H 3ZV9A 4F49A 1OOKB 2J38A 3SU3A 1TWXB 2OLGA 1UTLM 1OP2A 3NWUA 4JCNA 4K3JA 4AGKA 3SO3A 4A1XA 3LH3A 3P70B 1VGCC 1N8OB 2AMQA 2BDCA 3UY9A 1GHZA 8GCHG 1YPHC 3T26A 2R3YA 4NIXA 1YBWA 1QNJA 2A4GA 4JYVH 3RU4E 1QY6A 1O3LA 1DS2E 3M7QA 3QUMP 3RXKA 1MKXK 3DD2H 2STBE 4GAWA 1YF4A 4UFEH 1BT7A 1G3DA 4DIIH 2Z7FE 2QXHA 2EA3A 1GCTB 1UK4A 7LPRA 3SJKA 1EAXA 2Z9KA 3F1SB 1O3KA 1DUEA 1AD8H 1O5FH 2C3SA 2F91A 1S5SA 1ELAA 1P2NA 2HGTH 3ODFA 1MBQA 1O2MA 1V3XA 1A0LA 3RMNH 3SNEA 4AYVB 4O3TA 1EJNA 2FOHA 2P16A 1TGBA 1BCUH 4R0IA 1UVOA 3A7VA 3NXPA 2ZFPH 2FDAA 2Q1JA 1UJ1A 2SFAA 1TYNA 5FX6A 1KLTA 2ZWLH 4UONA 2XC5A 1DDJA 1SGFA 4K1EA 3TJOA 1JIMA 1Y3VA 2ZDLA 1PPEE 1G37A 1HBTH 1F0UA 4LK4A 5DP5A 9ESTA 2F9UA 2F3CE 4Y8XA 1HJ9A 2PGQB 1OPHB 4J2YB 1W3CA 1K22H 1QA7A 2VH6A 3A7ZA 4J1YA 1ELDE 1HCGA 4X8TH 1C4V2 1IQEA 4NG9H 3VFEA 4ZMAH 2K1QA 3D23A 4WMFA 2ZG0H 1O2RA 4FUGA 4K1TA 4AZ2B 1Z8JB 4XDEA 4A1TA 5JPMH 1OWEA 1BTUA 3PMHB 1O2VA 3TU7H 1O35A 2B5TB 1FLEE 1O2IA 1PJPA 3W95A 2H9TH 3S9BA 1P03A 3F9GA 3MNBA 3RXEA 3E91A 4CRDA 4CBNA 2ZQ1A 1GJDB 1ELFA 1BUIA 1ZRKA 1A4WH 1F5KU 2TPIZ 3RUOA 2GCHG 1OWJA 1NFXA 1O5EH 1EAWA 1GCTC 4O03A 1FI8A 5EG4A 2QIQA 1O2QA 1TLDA 2BOHB 2EI7A 2OCVB 3A87A 4I8JA 1P04A 1GVKB 1UTPA 5DKMA 1LVOA 1ELGA 4ESTE 2HPPH 1OWHA 4MPUA 1UHBA 3RXIA 4FUFA 2BLVA 1H9IE 3AVZA 2ZIQH 1C2FA 3SU0A 2H9EH 1FY1A 2Y5HA 5IDKA 1KIGH 1FONA 3TJUA 3FP6E 3TH4H 1BTZA 3RMLH 2D2DA 1DITH 3RXQA 3A8BA 2OTVA 1N6XA 2VWNA 4I32A 1GMDF 1TNKA 4OS1A 1Q2WA 1QB1A 1EB1H 2ZCKP 1AMHA 1DWEH 3UTUH 1CE5A 1ID5H 3OTJE 4MNVA 3S9CA 2UUFB 1KXDA 2OC0A 1C2LA 1O5GH 1BA8B 1G2MA 1O2GH 2TBSA 5FPTA 1CU1A 1NO9H 5JB8S 1P11E 3TNTA 2O8TA 4AG2A 2M5TA 2HRVA 1FQ3A 5J4QA 1QB6A 4VGCC 1K1LA 2NWNA 1OSSA 1ZPBA 1BTPA 3ZZBA 1KLIH 1PPBH 1EAIA 1HB0B 3N7OA 1V2RT 1XUFA 1YGCH 1EOJA 3S9AA 3U9AH 3ATMA 3EYDA 3RM2H 5A8YA 3MHWU 2XBVA 4OS6A 3PWCA 2DUCA 3B8JA 3QN7A 1C5OH 1HAOH 1HDTH 1HAZB 3SQHE 1GI8B 1UK2A 3TGKE 1QJ6B 3T28A 5EXLA 3T62A 1G3EA 2EC9H 1AN1E 4LXBH 1MD8A 3ZV8A 1RXPA 2H2ZA 1HAPH 1D3TB 3FP8E 1GDQA 1AWFH 2ZQ2A 5C3NA 4Y10E 2BDYA 2GDEH 4DCDA 1O5BB 1V2TT 1GMCF 3UFAA 3BV9B 5C5NA 2PW8H 4INKA 4JZFH 3MTYA 1BTXA 3GY4A 3MMGA 1E0FD 4X1NU 2ZFQH 4NA7A 3DUXH 1P10A 4WMDA 4FUDA 3RXJA 4Q7XA 1K2I1 1A5IA 2FLBH 1O32A 4HI3A 1T7CA 4UD9H 1AGJA 4TY7A 1V6DA 4XFQA 3ZZ7A 1ABJH 4CREA 2ZHEH 4BAQB 1NU7B 3WY8A 4JZIA 3TJNA 2Z6BD 1TIOA 1DXWA 1BRBE 2WPKS 1P2QA 5DP6A 1ANBA 2QXGA 2OINA 4TWYA 1C2GA 1NM6A 5HMAA 2ZHDA 3IITA 3Q76A 3RXGA 4X1SU 3M7TA 3MO3A 1GBBA 3TGJE 1ZTKA 1AKSA 2Q6DA 1L4DA 2HOBA 1BIOA 1ARBA 4K2YA 3NPSA 4ISHH 2A0QB 1TX8A 3MU0A 1O3DA 1DY9A 1EPTB 2J9NA 1M9UA 3VXFH 1SBWA 2XXLA 1Y5BT 2BQWB 2H1UA 1O2UA 2UUJB 2ZU5A 2A45B 3S69A 1GHXH 5BRRE 1GBAA 1TBZH 1C1MA 1THSH 1W7XH 3RXAA 5F6MA 1Y59T 2W3KA 1BTHH 1L2EA 1KTTB 1SGRE 4KELA 2XWBI 1A2CH 1ZMLA 1O38A 3TJVA 1V2NT 2ANWA 4IS5A 1WTHD 3RXMA 2IN2A 3SUEA 2QXIA 3RU4T 1C5RA 3NCLA 1GI7B 1YPJH 4CR5A 1CO7E 4ZH8A 4B1TA 2P94A 1XXDA 3SW2B 1P2MA 4X6PA 3UUZA 1NC6A 2ZFTA 3F6UH 1HJAC 3UQOA 3VB7A 1Y3UA 4GHQA 2RA0A 4H6SB 2J2UA 2B7DH 3G01A 3SV8A 1CGIE 4GCHF 4OS4A 1SLVB 4B2BA 1T8LA 5HGGA 1DT2A 4XSKU 2WUCA 1PQAA 1Z1JA 1Y3YA 2TGAA 1ZGVA 1O33A 2CF8H 4RKJB 1FAKH 5FCRA 2UWOA 4A1VA 3K6YA 4IGDA 3OY6U 2ASUB 1RIWC 3RXDA 3PTBA 1KXBA 1BMMH 1OWDA 3KEEA 4AN7A 1ZJKA 2BX3A 2V35A 2QA9E 2WPHS 3FVFB 4BNRA 1TQ7B 3Q3KA 3FFGA 1MQ5A 5HM9A 5G4BA 1KXEA 4HZHA 3I77A 1DOJA 1MTUA 5EXNA 3M35A 1F0SA 2AS9A 2XYAA 1C1TA 1O2WA 1SC8U 1U6QA 1YYY1 3PM3A 4IBLH 3TH2H 1PPCE 4D7GA 2EEKA 1RTLA 1TPOA 1BMLA 1ELVA 3ZZ4A 5GCHG 3VGCC 1SGCA 1MH0A 4WF8A 5TCCA 4AG1A 1UTOA 3ATWA 1GI0A 2WV5A 3GISB 3QO6A 1GMDG 2ZFFH 1JWTA 1FN6A 3RU4D 1BHXB 3BTME 1HRTH 1GHVH 1ZTLA 5IYTA 1MCVA 4CBOA 3SU4A 3ODDA 1NFWA 1C1WH 2FYRA 1EAUA 1FN8A 1LVYA 2H5DA 2OUAA 1BJUA 2ZECA 1CA0B 4BTIB 5K7RA 1O37A 4INLA 1SOZA 1E38B 4BAHB 4DOQA 4IC5A 5A8XA 9LPRA 3A8AA 2UWPA 4GUXA 1SGTA 3AW0A 1NROH 3SOSA 5H4IB 2CV3A 4TY6A 4X1QU 2JETB 2BY6X 4A92A 1SMFE 3SNDA 1SVPA 3SGBE 4X6MA 4UE7H 1G2LA 1O3BA 1ETSH 4Q7YA 2WPLS 3OX7U 2R2MB 1PPZA 3RC5A 3FZDA 4OGXA 1QJ7B 1TNIA 3W94A 1J15A 1MKXH 3LC3A 4ZROA 2QY0B 3A81A 5AFZH 4D9RA 2B9LA 1QL9A 5GPIB 4YESB 3D49H 3MO9A 2C8YB 3LONA 1MTNC 1LMWB 1YM0A 3TLOA 3A7YA 2BB4A 3EA8A 1PPHE 5CMXH 3QX5H 2LPRA 4QT8C 2UWLA 1CHOG 4WXIA 1MUEB 3ZZ9A 8LPRA 1YPKH 5I25A 1E37B 1A1RA 3MO6A 3LU9B 1XVMA 1C5LH 4U32A 5EU8A 1KDQA 4XBCA 2A7HA 4MNXA 3PLKA 3UOPA 5GWZA 3QGNB 3BTFE 1FDPA 2GD4B 1QB9A 1O5AB 2V6NA 1T8NA 2ODPA 2FLRH 5T6GA 1AFQB 3QLPH 2G8TA 2A7JA 5PTPA 1FY4A 2ILNA 5L30H 3LDXH 4JK6A 1BDAA 3PMAB 4X8SH 4Y7AA 4AFQA 3FZZA 1W10U 5C67A 3SJ9A 2XC4A 1ELEE 2H9HA 3P8NA 1WCZA 3LGIA 3TVJB 3STIA 5FHTA 1LQDB 2FI4E 2ZDVH 3V12A 5L6NH 3IG6B 1ZYOA 3UWJH 2Z9LA 2A1DB 1OX1A 3BTKE 1MTWA 3TK6A 1YPMH 4OS5A 2BXTH 3BIUH 1TA2A 3RP2A 1O2XA 1W12U 3ZVAA 1T4VH 4ZHLU 3Q00A 2XW9A 1GPZA 3SU6A 4THNH 1FJSA 5C1UA 4GCHG 1AVWA 2FEQH 4E7RG 2FTMA 4FXGH 1Z8IB 4MG3A 5FCKA 4NCYA 5T6FA 2DE8A 1HNEE 1NRPH 2ZA5A 1TGSZ 1P12E 1AQ7A 5LPFA 2F9BH 2A31A 1HUTH 2FTLE 3UR9A 1LHEH 1QRXA 4Q7ZA 2I6SA 3P8FA 3QK1A 3RXRA 3SQEE 1NY22 3M36A 1TAWA 1QBNA 2VIQA 2G81E 1ANDA 3K6ZA 1ACBE 4TPIZ 1GBDA 1S6FA 3MOCA 3PV4A 1GBJA 2Z9GA 2P95A 1ESAA 3RXLA 3ZZ8A 2KAIB 2IOTA 1ZJDA 1SQOA 1Y5UT 2V0BA 3PO1C 1WQVH 4X6NA 4ABGA 2ZDAH 4ABFA 4Q2KA 1AKSB 2D26C 5EXMA 4BANB 1BRUP 1PFXC 2ULLA 1L0ZA 1Y5AT 2BDBA 2ZGJA 3GICB 2FMJA 5L2ZH 2FI5E 1ELTA 2PUQH 1C4U2 2OQUA 2XCNA 1BOQA 5A0CA 5FAHA 5F03A 2IPHA 4ISLA 5FXLA 4ZKRU 1FAXA 1YCPH 2G5VA 2ZFRH 2Z3CA 1EZQA 1FZZA 3RC4A 3U8RH 6CHAC 1O2OA 1O3IA 3Q3XA 3UQVA 1RRKA 2A5IA 1TRNA 1C1SA 1MTNB 1TE0A 1P2OA 3LGUA 1ZPZA 1KYNA 3RLYH 2TRMA 2EI8A 2OBOA 3QTVH 4DW2U 1RS0A 1OYQA 1NZQH 1W11U 3BN9A 4AYYB 1ESBA 1CHGA 5C1XA 3KF2A 4BTUB 1GHAF 2QV1A 3GY6A 4E7NA 1WTGH 4LZ4B 1EKBB 2ZP0H 4U01A 1D3PB 4WH8A 1GI4A 1S83A 3DFLA 3RMOH 3TNSA 1H8DH 4E05H 4ZKSU 1O2HA 1WUNH 3ZVBA 5HYOA 4Y0YE 1S0RA 1GMHF 3MU1A 2RDLA 2Z9JA 2FOGA 4TPYA 4K8YA 1SGPE 3EA7A 5TCAA 1O2YA 1TFXA 3SV7A 2FIRH 3O8RA 4I8LA 3GYMA 3RLWH 2G4UA 2XBXA 2J95A 3RM0H 2Y5FA 3K2UA 3ZVCA 2GZ7A 1H8IH 1S0QA 4ZXYH 1HIAB 3Q77A 4ISNA 1BRCE 5C1YA 4NSVA 1QL8A 2PKAA 1K1NA 3I29A 1AE8H 1XX9A 2SGQE 1GBTA 1RFNA 3M3VA 3BSQA 1C1OA 1DPOA 1OS8A 1HFDA 1TGCA 3ZZ3A 1DICA 4Z0KA 1HAYB 3KGPA 5ESTE 1ZSLA 3ZVDA 1HLTH 1UVUH 3ATLA 3M3SA 1TGNA 1Z7KA 3HATH 1GMHG 4UFFH 4TWWA 4X1PU 4GPGA 3GY5A 5EPYA 4DIHH 4D76A 4HFPB 1A5GH 3UPEA 1PQ8A 2A5AA 5AVDA 5JB9S 2ZGHA 3RXCA 2GCHF 1CA8B 1SLUB 1YPEH 3SNCA 4PROA 1F7ZA 1H9LB 1FNIA 3TPIZ 1C5VA 1FPHH 5EW1H 3ESTA 3RXHA 4BXWA 4X0WU 3LIWA 1AB9C 2VWOA 4KKDA 1C2HA 4YT6H 1K1OA 1BBRE 5DK1A 1GBEA 4ZHAA 1HXEH 1AZ8A 1UVTH 3GCTG 5A09A 1T31A 1EZSC 1GG6B 4YZUA 3RXUA 2O9QA 4IN2A 1AFQC 3A80A 1LKBA 1MKWH 2WUBA 1GI1A 1C5UA 1UVPA 4D8NA 1NFUA 2PGBB 1J17T 1T8OA 3VEQB 2VGCB 1DM4B 4CH2B 4XOJA 2PWXA 1DWBH 3LOXA 3JZ2B 1D4PB 2P93A 2STAE 4YT7H 3QWCH 1KXFA 2PLXA 1SLWB 1GHWH 2FXRA 1MU6B 3PYHA 2PR3A 1O5DH 5CHAC 1LCYA 1C5SA 3RXFA 1G3CA 2HALA 2C90B 3VB4A 3GDSA 2O8LA 2ANYA 2F9PA 1XUKA 4H6TA 2J94A 3RXSA 2SGAA 1EZXC 1TX6A 1K1MA 1RIWB 1H4WA 3H5CB 1O3EA 4X1RU 5C2ZA 4FVBA 1O34A 2JETC 1VCWA 2I6QA 1GJAB 1V2LT 2UUKB 2A4RA 2Y82A 3GY7A 5LGOA 4YOGA 2NU1E 4MVNA 1AO5A 1ZZZA 1C5QA 2BDAA 8KME2 5JYIA 4K60A 4HGCA 2HPQH 4INHA 1IQLA 4ZUHA 1C5NH 4CRCA 1O3GA 2CGAA 1MQ6A 1WOFA 2BTCE 1MZAA 1GWAA 4ABIA 3PMJA 1W8BH 2ANKH 4IN1A 5F8ZA 2BM2A 4NFFA 4JZDH 1QQUA 5ETXA 1QJ1B 5E0JA 2BX4A 3LC5A 2BMGB 3PMBB 1K9OE 3CS7A 1LKAA 1OKXA 2B8OH 1HIAA 1TMUH 1EJMA 4X6OA 1C2MA 1L1GA 1LHDH 3AAVA 2FOCA 4BTTB 4I8GA 2PSXA 2CXVA 4MNWA 1PPFE 1B5GH 1DANH 1DY8A 4JZ1A 3SHCH 4FVDA 1SGDE 2C8XB 1P2JA 2BQ6B 2GKVE 2TIOA 2FOMB 1A46H 3MU8A 4JYUH 5EODA 2VVCA 1GHAG 1GJ8B 2FS9A 1UCYK 5CHAB 4NA8A 2QGRA 3HK3B 1HXFH 4IW4E 4CR9A 1EZUC 5L2YH 1N6YA 3L33A 5EPNA 4D7FA 2FP7B 2BLWA 3ZVEA 2RA3A 1SPJA 4DURA 2BD9A 5ABWA 3BG4B 3V7TA 4K8BA 1LPZB 4YLUA 2Z3EA 1FPCH 5SGAE 3BTTE 1V2VT 4AX9H 3D65E 1O3MA 1Z6EA 3EGKH 6LPRA 2ZCHP 1O2JA 1ZSKA 1SSXA 4B75A 2ZNKH 3KQDA 1NFYA 1KLJH 1P02A 5DP3A 1HAGE 4B73A 4MPXA 1O2PA 4DJZB 3E1XB 3SNAA 1VITG 1OWIA 1ZRBA 1BBRH 2ZPSA 4DG4A 1VITF 1UMAH 2AGIX 1O3PB 2ZHFH 1PQ5A 1EP5A 2VWMA 1GJ9B 1GVZA 5E8EH 3U1JB 3QTOH 1DX5M 2BLOA 1EP6A 5FBIA 5LH8A 3K9XB 2BLQA 2GP9B 1EOLA 3LGTA 4NIVA 1WSSH 1NRRH 1HGTH 1Z6JH 1W7GH 1GDNA 1MBMA 1YPHE 1AUJA 1O3NA 1RTKA 1FIWA 1GBMA 3VB6A 2CJIA 3EA9A 2LNCA 1Q31A 1AWHB 4H42U 3QDZB 2O8UA 3CS0A 3SN8A 2GDDA 1V2ST 3TK5A 1SGYE 1DWDH 4NSYA 1XXFA 2H6MA 4BAMB 4NGAH 2GT8A 1GJ4H 3T29A 2Y81A 4Y7BA 2GTBA 2A2XH 4X2VA 2HLCA 2GX4A 3MH7A 4ISOA 2FZZA 3DFJA 1VJAU 1A5HA 3P95A 3RMMH 4LOYH 1DWCH 4KTSA 1LVBA 1C1PA 5A8ZA 3VB5A 2VH0A 1AZZA 1MMJN 2CMYA 3GY3A 3DA9B 1O3OA 1UCYH 7GCHF 2BY9X 2RG3A 1VJ9U 2ZU2A 3HK6B 1LHFH 2J92A 1BTYA 1LPKB 3GY8A 1A7SA 2AEIH 4B71A 1GI3A 3H7OA 1FMGA 1TPSA 5EQRA 1DVAH 4VGCB 1ELBA 4MPVA 4BAOB 4K1SA 1YLCA 1B0EA 2OC8A 5FPYA 2BY8X 1C2KA 1FY8E 4FUHA 1NN6A 3GY2A 1JBUH 3LJJA 4GSOA 2VIDA 5EQSA 2W5EA 3A7TA 2BVSH 4CH8B 2QXJA 3ITIA 1DE7H 3P6ZB 1EB2A 1Z1IA 3E0PB 4Y8ZA 3SBKA 1J8AA 1ANEA 1JOUB 4OGYA 3O8BA 4AFSA 2OC1A 3PLPA 3ELAH 4FUBA 1QHRB 1GL1A 1L4ZA 4XBDA 2KAIA 1O2TA 4DY7B 2VIPA 1SHHB 1WBGB 5DJ7A 5E0GA 1F5LA 3SV2H 2G5NA 2XNIA 4B2AA 4ZAEA 3NK8A 1XMNB 5DP7A 1EXFA 2BVRH 3TK9A 2YNAA 3RXVA 1AVGH 3L6PA 1ETRH 1B7XB 1KDQB 3NZIA 2BD5A 2BXUH 2ZI2H 5HXFA 1TMBH 1P9SA 1Q3XA 2G51A 1A61H 3M37A 1B0FA 1K1PA 2ZO3H 4FU8A 1V2JT 5DGJA 1EPTA 1V2MT 3GCTF 4Y11E 3H7TA 2FOEA 2A2QH 3U8TH 1AY6H 4NIYA 1JIRA 1UVSH 1LVMA 4YO9A 4UFDH 2IJOB 2CF9H 3UWIA 2WINI 1ZHMA 1IHTH 4CHAC 2AFQB 5FBEA 2YNBA 2HNTE 1VZQH 4OS2A 4O97A 1GGDC 1NTPA 1J16A 1AU8A 5CE1A 3A83A 2ALPA 3SJOA 4NFEA 1O2ZA 1D6WA 1WYKA 1ZR0A 1ZOMA 1ZMJA 1IQHA 3SUDA 3A8CA 2VJ1A 3PO1B 2EI6A 1V2PT 3JZ1B 1TA6A 1D6RA 1ZMNA 1S85A 1G30B 3ZZDA 4MPWA 1O3FA 1T8MA 3S7KB 1KSNA
chains in the Genus database with same CATH superfamily
5AF9H 3N7EA 4JMYA 2VIOA 2OC7A 1SI5H 1F5RA 1C2JA 1TX7A 3BTHE 3V0XA 1K1JA 2TGTA 1QFKH 3SGQE 1LPGB 3BG4C 2C93B 2V3HH 2WYJA 2QC2A 5C94A 1VGCB 4ZHMU 1DXPA 3F9EA 4YTAA 5EQQA 4GVUA 1CSOE 4NWLA 4X2XA 3KIDU 3OEHD 5HM2A 3PROA 3VB3A 1GDUA 3SGAE 4B76A 1D9IA 2BD4A 2FODA 1O3AA 2SGEE 1AE5A 3GDVA 2P59A 5F8XA 1CHOF 2A7CA 1AUTC 3OE7D 1S82A 3B9FH 1W14U 2PKSB 3PWBA 4AFZA 1C5ZB 1UTMA 1GBFA 3EAJA 1SGNE 1NPMA 4ZXXH 4KTUA 5JBCS 2ESTE 3HKIB 1TOCB 1UTKA 2VWLA 1V2WT 1UTQA 2C8ZB 3GCOA 4AB9A 1KMHB 1S6HA 3BEFB 1D3QB 1GI6A 1C5WB 1AI8H 1XVOA 2HVYB 1Y3XA 1GBHA 3F0PA 2ZU4A 2VGCC 4A5TS 1P3EA 2JH5D 2ODQA 1GJCB 3LGYA 2GT7A 1GBLA 1DFPA 2FOAA 1D3DB 1G9IE 3UREA 2F43B 4AORA 2BYAX 3MYWA 3RC6A 1VR1H 1YP9A 1GHBF 1HJAB 2SGPE 1O0DH 5C0TA 1BJVA 1W2KH 4K69A 4ZKNU 2BD3A 1KY9A 2VU8E 1O31A 3LGVA 4GHTA 1ZSJA 2JIZD 2C8WB 2VINA 4BXSA 1C2DA 1P05A 4X8UH 4R8TB 1O3HA 2J4IA 2Z3DA 3VGCB 3O8CA 1L1JA 2QF3A 3LPRA 2W3IA 1C5YB 2GCTC 3GCHC 1F92A 2NU4E 1SHYA 3B23B 4MDSA 2TGDA 1C5PA 3PTNA 1YPGH 1VCPA 3VPKA 2JH0D 3A7WA 2PUXB 4WXVA 1P09A 1G3BA 1TABE 4WJG2 1BHXF 4YLQH 1SL3A 3KQEA 3A86A 1H8HD 2WPJS 3BTEE 4U30A 5DG6A 1P2IA 2IPQX 2UUYA 2GGVB 3T25A 1BZXE 1EPTC 2ZDKA 1TMTH 4B2CA 2A4QA 1H9HE 5E2PA 3KHVA 1C9PA 2XBWA 4A7IB 2D8WA 2Y6TA 1HAIH 1INCA 1SG8B 4CRAA 1C5MD 3P17H 1FXYA 1ARCA 3LH1A 3URCA 1SGFG 1CA0C 1AVXA 3MH6A 3ATKA 1TNHA 2GV6A 4BAKB 4SGAE 4X8VH 1DLKB 4NZQA 1FUJA 2ZDNA 3GOVB 1THRH 4NA9H 1AFEH 5GIBA 1GCDA 2PFEA 1MZDA 2QAAA 5EOKA 2Y7ZA 2FPZA 3GYLB 1MAXA 2TGPZ 2ZGCA 2BZ6H 1IQFA 2CN0H 1W13U 2YOLA 1OXGA 2FI3E 2F9OA 3MNSA 1AB9B 1SLXB 3MU4A 2G52A 1V2UT 2HNTC 3DSGA 3BEIB 2DE9A 2O8MA 4UEHH 4D9QA 3NRLA 4I8HA 3CENA 2VIVA 3RDZA 4Y6DA 1GMCG 3F68H 1CT4E 5GXPA 2GVFA 1THPB 3A85A 1V2KT 5DP4A 1TRMA 3R3GB 3U1IB 3ZYEA 1W0ZU 3STJA 1DUAA 2ZGBH 2ZTZA 1HAHH 3OU0A 4DVAU 2GCTB 2BDHA 2ANMH 1C2EA 3BTQE 2P3UB 1J9CH 2R9PA 1NS3A 2P8OB 2VVVA 3AASA 4CRBA 1SGQE 1F0TA 2R2WU 1SFQB 1P0SH 2YMSC 3SV9A 2AIPA 1FV9A 2BHGA 4RKOB 1S81A 3BF6H 1YLDA 3MNXA 3LGWA 1BRAA 4TT3D 2HNTF 2HWLB 1NRQH 1QRZA 1TONA 3GCNA 2XCFA 1GBIA 1GBKA 1KTSB 1O36A 1GI5A 2OK5A 5A2MH 2ZPQA 3W1EA 4JK5A 1O3CA 1TNJA 2FM2A 4NZLA 3SU2A 3LJOA 1F2SE 2XTTB 1NBME 2ZU1A 2QCYA 4UDWH 5JBBS 2F9VA 2XC0A 3E8LA 4F48B 1RGQA 2CHAC 3E6PH 1GHYH 1P9UA 2XBYA 4FUJA 1JMOH 2A5KA 2HVXA 1WQSA 2HLDD 4ISIH 1P57B 2ZHWH 2GMTC 2Y80A 3SZNA 1NESE 3A82A 5B6LA 2J34A 1BMAA 2ZHQH 5GDSH 5AFYH 3F9FA 1CT0E 3MFJA 1TNLA 2VIWA 4MLFB 2JDID 2ZTYA 4NIWA 1RJXB 1O39A 1C5TA 3DCLA 2ZU3A 1K21H 2EY4C 3M61U 1O30A 1EJAA 1JRTA 1G32B 1UO6A 3OSYA 5J4SA 5LPRA 1YCPK 1VCQA 1TB6H 1MTSA 1QR3E 4Y8YA 4U2WA 1A0JA 1F0RA 3TITA 1SQAA 1WV7H 1G36A 1HPGA 4XE4A 1LDTT 1QIXB 1TNGA 1GJ7B 3DT0H 1J14A 4FETA 2J98A 3T5FH 2ZFSA 2PTNA 2AGGX 4IMZA 3MH5A 4TYDA 3FAOA 3GDUA 3UNRA 1YKTA 3VXEH 3BTGE 1KXCA 2AMPA 1GI9B 1MU8B 2ALVA 3UNQA 4Z6AH 4M7GA 4RT0A 2AYWA 3EE0B 3URDA 1QBVH 2FS8A 1HAVB 3NKKA 1XUGA 5C5OA 2BY5X 4Y76A 2PKSC 3I78A 3V3MA 1C9TA 3FO8D 1HV7A 1EASA 3OY5U 7GCHG 3BG8A 4WVPE 3HGPA 4AFUA 1CT2E 5HKKD 5EW2H 3UNSA 1ZLRA 2Z94A 2P3FH 4WWYA 1IQJA 4Y71A 2F83A 5DP8A 2RCEA 3V13A 1MKWK 4K5ZA 5BPEA 3MI4A 5T6DA 1IQIA 2BD7A 4ABJA 1LQEA 4Z1MD 4Q80A 1S84A 5A0AE 3T2NA 3FP7E 5LPEA 1P06A 1HAXB 4X2WA 1H1BA 3M7UA 3ENSB 4ASUD 1KXAA 1PPGE 6CHAB 3L3TA 5FX5A 5FPSA 1QTFA 1ZHPA 2W26A 2ZF0H 1BBRK 1EUFA 1Z71A 2W7SA 1HYLA 1C2IA 1O2SA 1A0HB 3KN2A 1V2OT 1FIZA 7ESTE 3KL6A 1N1LA 2Z9IA 3KQCA 4ABEA 6GCHF 3DHKH 3P8GA 3ZVGA 2AERH 2Y7XA 3LKWA 5IK2D 2WV9A 3SU5A 1V2QT 1E34B 4O3UA 4F4OC 1BQYA 1LHCH 3A7XA 1C1VH 4ABAA 1C1QA 1SB1H 1OYTH 1SGEE 2NU2E 5E0HA 4IMQA 2FO9A 1MAYA 1NRNH 1YC0A 2PHBA 2BDIA 3SNBA 1GGDB 2WYGA 1BITA 1WAYB 3R0FA 1SOTA 1ORFA 2BDGA 3MNCA 4E06H 2ZTXA 1O5CB 2BQ7B 4MTBA 2THFB 3HKJB 4Y0ZE 1E35B 1PYTC 4YOIA 3MH4A 1FY5A 1O3JA 2KCYA 3BTWE 3M3TA 4FUCA 5T1VA 1GJ6A 2FX4A 2KFWA 3SUFA 3U69H 5A0BA 2G00A 1UHBB 1IQKA 1WU1A 3HPTB 3PLBA 4AGJA 1XUHA 3ZYDA 2W7UA 1TPAE 2R3UA 4XBBA 1E36B 1YCPM 7KMEH 1LTOA 2V3OH 2OP9A 4AB8A 1TALA 1TGTA 3SI3H 4I31A 1DLEA 1C1UH 3RXOA 1GJ5H 2WPMS 3SJIA 2G55A 1CQQA 5ESBA 1UTJA 1XUJA 3PB1E 2AGEX 3P8OA 1PYTD 2GV7A 3F9HA 1BMNH 3BEUA 2PKAB 2ZPRA 3SHAH 4ASHA 4ZKOU 2R0KA 1Z8RA 1QCPA 1TQ0B 2AHME 2C4FH 4JYTA 2WPDD 4RN6A 1TBQH 1OP0A 3E3TA 3EDXB 1O2LA 2WPIS 2ZCLP 3M5OA 1QRWA 1GBCA 2VVUA 3UOUA 4ABHA 1IQGA 1JXPA 8GCHF 2BZAA 1BTWA 3LT3A 3OEED 1ZTJA 2QN5T 3MU5A 3TIUA 1IQNA 1DSTA 4FUEA 3AW1A 5T3HA 2OD3B 3E0NB 4I7YH 5DO4H 1O2NA 1PQ7A 4IC6A 1A3EH 3RXTA 1P01A 1K1IA 3M5MA 4FU7A 4WMEA 3E16B 1P3CA 1TRYA 3KCGH 1QQ4A 1C4Y2 4X2YA 1ZHRA 1P8VC 2JH6D 4YM9A 1GVLA 4MQAA 3BTDE 3RXPA 3RXBA 1W0YH 4CRGA 4O9VA 1UTNA 1MTVA 1OP8A 2ZZUH 2SGDE 4YXWD 1JRSA 4AOQA 2BY7X 2FESH 3BIVH 4MNYA 1IAUA 4WY3A 1C5XB 2VB0A 1UCYE 5DP9A 6GCHG 1ETTH 1ELCA 2P8OC 1GI2A 3E90B 2Y5GA 3NUMA 1RD3B 4SGBE 3SI4H 5JBAS 1CGHA 2H5CA 1SR5C 4UFGH 1ESTA 2NU3E 4ABDA 2KX4A 4FU9A 1H8ED 1IHSH 2BD8A 1Z8GA 3K65B 1L1NA 2OXSA 2B0FA 2WV4A 3O8DA 3IWMA 5CDFE 1T32A 2XOKD 2GMTB 3GCHB 1K0HA 3WWFA 1A3BH 1IOEA 1P2KA 4XRNA 2ODYB 4DGJA 1NU9A 3A84A 4CRFA 2G4TA 3S0NA 2CHAB 2FWWA 3SV6A 2A4OA 3KQBA 2AIQA 3SORA 4KTCA 1ABIH 2ZC9H 2A32A 3A8DA 2V7QD 1SGIB 3EQ0H 2SGFE 2SNWA 1XKBC 3SJ8A 5GJ4B 5JBTA 2PTCE 2XRCA 2XWAA 1OWKA 3C1KA 1QGFA 2Q6GA 3S7HB 1HJ8A 1QA0A 2K0QA 1QL7A 3M5NA 3QGJA 1T4UH 2ZGXH 6ESTA 1IQMA 1O2KA 5F8TA 4DT4A 2D1JA 5JDUB 5DPAA 4A6LA 5E2OA 4I33A 3ZZAA 2AH4X 1EATA 3Q3YA 3SU1A 1AIXH 3HGNA 1GJBB 3ZZCA 3U8OH 1YPLH 2PSYA 2P3TB 5KGOA 3ZZ6A 1C1RA 1ZGIA 2O8WA 3D62A 5GCHF 1N8OC 1RTFB 3UIRA 1AHTH 2FOFA 4JZEH 4LZ1H 4YOJA 1CBWC 1GHBG 1CVWH 2FX6A 2JKHA 1GL0E 2AMDA 1S6LA 3TGIE 1VITH 1X7AC 3U98H 1LO6A 3QZQA 4Y79A 2K8IA 2PV9B 4OS7A 4DT7B 1QURH 3ZZ5A 2GJGA 1LHGH 4RSPA 1CGJE 3T27A 2GZ8A 3ZVFA 1CBWB 3ATIA 1YY3A 4H4FA 5B6OA 3OYPA 1DSUA 2QE7D 4WH6A 1EQ9A 2FYQA 5AHGH 3SUGA 2BD2A 3PV2A 2FOBA 1HAVA 3AAUA 1BB0B 2GZ9A 4BOHA 2W6ID 1XUIA 4GLYA 1SFIA 2F9NA 1NT1A 1Y8TA 3M5LA 1TPPA 1W0KD 5EJLA 1ANCA 1MCTA 2OQ5A 3UR6A 1GG6C 2VNTA 3MWIU 2R0LA 2BOKA 4ABBA 5K0HA 1NRSH 2QYIA 2WZQA 2ZKSA 3A88A 1QBOA 3KNXA 3F3BA 2OBQA 1TOMH 4HTCH 2NU0E 2YMSB 2ZDMA 2Q6FA 3TH3H 4B74A 5TJXA 2QF5A 1SQTA 1XM1A 4NWKA 3FANA 4CHAB 4FUIA 1FY3A 1ZPCA 1C1NA 3QZRA 1EX3A 2SNVA 3C27B 4ACBA 1XKAC 4KGAA 2ZEBA 1K28D 1UK3A 2QF0A 4KP0A 1Y3WA 3KQ5A 2BVXH 5EGMA 4I8KA 1TBRH 2LELA 3A89A 4P00A 2KZ4A 3P92A 8ESTE 1MD7A 3CP7A 5C20A 5I46H 3ZV9A 4F49A 1OOKB 2J38A 3SU3A 1TWXB 2OLGA 1UTLM 2J97A 1OP2A 3NWUA 4JCNA 4K3JA 4AGKA 3SO3A 4A1XA 3LH3A 3P70B 1VGCC 1N8OB 2AMQA 2BDCA 4AC9A 3UY9A 1GHZA 8GCHG 1YPHC 3T26A 2R3YA 4NIXA 1YBWA 1QNJA 2A4GA 4JYVH 3RU4E 1QY6A 1O3LA 1DS2E 3M7QA 3QUMP 3RXKA 1MKXK 3DD2H 2STBE 4GAWA 1YF4A 4UFEH 5KECA 1BT7A 1G3DA 4DIIH 2Z7FE 2QXHA 2EA3A 3SYJA 1GCTB 1UK4A 3PRBA 7LPRA 3SJKA 1EAXA 2Z9KA 3F1SB 1O3KA 1DUEA 1AD8H 1O5FH 2C3SA 2F91A 1S5SA 1ELAA 1P2NA 2HGTH 3ODFA 2M2AA 1MBQA 1O2MA 1V3XA 1A0LA 3RMNH 3SNEA 4AYVB 4O3TA 1EJNA 2FOHA 2P16A 2RFKC 1TGBA 1BCUH 4R0IA 1UVOA 3A7VA 3OAAD 3NXPA 2ZFPH 2FDAA 2Q1JA 1UJ1A 2SFAA 1TYNA 5FX6A 1KLTA 1OHHD 2ZWLH 4UONA 2XC5A 1DDJA 1SGFA 4K1EA 3TJOA 1JIMA 1VKYA 1Y3VA 2ZDLA 1PPEE 1G37A 1HBTH 1F0UA 4LK4A 5DP5A 9ESTA 2F9UA 2F3CE 4Y8XA 1HJ9A 2PGQB 1OPHB 4J2YB 1W3CA 1K22H 1QA7A 2VH6A 3A7ZA 4J1YA 1ELDE 1HCGA 4X8TH 1C4V2 1IQEA 4NG9H 3VFEA 4ZMAH 2K1QA 3D23A 4WMFA 2ZG0H 1O2RA 4FUGA 4I86A 4K1TA 4AZ2B 1Z8JB 4XDEA 4A1TA 5JPMH 3KYGA 1OWEA 1BTUA 3PMHB 1O2VA 3TU7H 1O35A 2B5TB 1FLEE 1O2IA 1PJPA 2J98B 3W95A 2H9TH 3S9BA 1P03A 3F9GA 3MNBA 3RXEA 3E91A 4CRDA 4CBNA 2ZQ1A 1GJDB 1ELFA 1BUIA 1ZRKA 1A4WH 1F5KU 2TPIZ 2VBCA 3RUOA 2GCHG 1OWJA 1NFXA 1O5EH 1EAWA 1GCTC 1YWUA 4O03A 1FI8A 5EG4A 2QIQA 1O2QA 1TLDA 2BOHB 2EI7A 2OCVB 3A87A 4I8JA 1P04A 1GVKB 1UTPA 5DKMA 1LVOA 1ELGA 4ESTE 2HPPH 1OWHA 4MPUA 1UHBA 3RXIA 4FUFA 2BLVA 1H9IE 3AVZA 1BMFD 2ZIQH 1C2FA 3SU0A 2H9EH 1FY1A 2Y5HA 4M9FA 5IDKA 1KIGH 1FONA 3TJUA 3FP6E 3TH4H 1BTZA 3RMLH 2D2DA 1DITH 3RXQA 3A8BA 2OTVA 1N6XA 2KCAA 2VWNA 4I32A 1GMDF 1TNKA 4OS1A 1Q2WA 1QB1A 1EB1H 2ZCKP 1AMHA 1DWEH 3UTUH 1CE5A 1ID5H 3OTJE 4MNVA 3S9CA 2UUFB 1KXDA 2OC0A 1C2LA 1O5GH 1BA8B 3FOAA 3AK5A 1G2MA 1O2GH 2TBSA 2JJ1D 3F2FA 5FPTA 1CU1A 1NO9H 5JB8S 1P11E 3TNTA 2O8TA 4AG2A 2M5TA 2HRVA 1FQ3A 5J4QA 1QB6A 4VGCC 1K1LA 2NWNA 1OSSA 1ZPBA 1BTPA 2QF4A 3ZZBA 1KLIH 1PPBH 1EAIA 1HB0B 3N7OA 1V2RT 1XUFA 1YGCH 3F2GA 1EOJA 3S9AA 3U9AH 3ATMA 3PRDA 3EYDA 3RM2H 5A8YA 3MHWU 2XBVA 4OS6A 3PWCA 2DUCA 3B8JA 3QN7A 1C5OH 1HAOH 1HDTH 1HAZB 3SQHE 1GI8B 5KEDA 1UK2A 3TGKE 1WXRA 1QJ6B 3T28A 2WHXA 5EXLA 3T62A 1G3EA 2EC9H 1AN1E 4LXBH 1MD8A 3ZV8A 1RXPA 2H2ZA 1HAPH 1D3TB 5C0UA 3FP8E 1GDQA 1AWFH 2ZQ2A 5C3NA 4Y10E 2BDYA 2GDEH 4DCDA 1O5BB 1V2TT 1GMCF 3UFAA 5FL7D 3BV9B 5C5NA 2PW8H 4INKA 4JZFH 3MTYA 1BTXA 3GY4A 3MMGA 1E0FD 4X1NU 2ZFQH 4NA7A 3DUXH 1P10A 3F2HA 4WMDA 4FUDA 3RXJA 4Q7XA 1K2I1 1A5IA 2FLBH 1O32A 4HI3A 1T7CA 4UD9H 1AGJA 4TY7A 1V6DA 4XFQA 3ZZ7A 1ABJH 4CREA 2ZHEH 4BAQB 1NU7B 3WY8A 5EIYA 4JZIA 4Q63A 3TJNA 2Z6BD 1TIOA 2W6JD 1DXWA 1BRBE 2WPKS 1P2QA 5DP6A 1ANBA 2QXGA 2OINA 4TWYA 1C2GA 1NM6A 5HMAA 2ZHDA 2L6OA 4Q4LA 3IITA 3Q76A 3RXGA 4X1SU 3M7TA 3MO3A 1GBBA 3TGJE 1ZTKA 1AKSA 2Q6DA 2YMSD 1L4DA 2HOBA 1BIOA 1ARBA 2IJD1 3NPSA 4K2YA 4ISHH 2A0QB 1TX8A 3MU0A 1O3DA 1DY9A 1EPTB 2J9NA 1M9UA 3VXFH 1SBWA 2XXLA 1Y5BT 2BQWB 2H1UA 1O2UA 2UUJB 2ZU5A 2A45B 3S69A 1GHXH 5BRRE 1GBAA 1TBZH 1C1MA 1THSH 1W7XH 3RXAA 5F6MA 1Y59T 2W3KA 1BTHH 1L2EA 3KYFA 1KTTB 1SGRE 4KELA 2XWBI 1A2CH 1ZMLA 1O38A 1UW7A 3TJVA 1V2NT 2ANWA 4IS5A 1WTHD 3RXMA 2IN2A 3SUEA 2QXIA 3RU4T 4RT1A 3UB0A 1C5RA 3NCLA 1GI7B 1YPJH 4CR5A 1CO7E 4ZH8A 2XNDD 4B1TA 2P94A 1XXDA 3SW2B 1P2MA 4X6PA 3UUZA 1NC6A 2ZFTA 3F6UH 1HJAC 3UQOA 3VB7A 2EQNA 1Y3UA 4GHQA 2RA0A 4H6SB 2J2UA 2B7DH 3G01A 3SV8A 1CGIE 4GCHF 4OS4A 1SLVB 4B2BA 1T8LA 5HGGA 1DT2A 4XSKU 2WUCA 1PQAA 1Z1JA 1Y3YA 2TGAA 1ZGVA 1O33A 2CF8H 4RKJB 1FAKH 5FCRA 2UWOA 4A1VA 3K6YA 4IGDA 3OY6U 2ASUB 1RIWC 3RXDA 3PTBA 1KXBA 1BMMH 1OWDA 3KEEA 4AN7A 1ZJKA 2BX3A 2V35A 2QA9E 2WPHS 1YLNA 3FVFB 4BNRA 1TQ7B 3Q3KA 3FFGA 1MQ5A 1MABB 5HM9A 5G4BA 1KXEA 4HZHA 3I77A 1DOJA 1MTUA 5EXNA 3M35A 1F0SA 2AS9A 2XYAA 1C1TA 1O2WA 1SC8U 1U6QA 3VG8A 2WSSD 1YYY1 3PM3A 5GNDA 4IBLH 3TH2H 1PPCE 4D7GA 1WDIA 2CK3D 2EEKA 1RTLA 1TPOA 1BMLA 1ELVA 3ZZ4A 5GCHG 3VGCC 1SGCA 1MH0A 4WF8A 5TCCA 4AG1A 1UTOA 1FX0B 3ATWA 1GI0A 2WV5A 3GISB 3QO6A 1GMDG 2ZFFH 1JWTA 1FN6A 3RU4D 1BHXB 3BTME 1HRTH 1QZ8A 1GHVH 1ZTLA 5IYTA 3F0OA 1MCVA 4CBOA 3SU4A 3ODDA 1NFWA 1C1WH 2FYRA 1EAUA 1FN8A 1LVYA 2H5DA 2OUAA 1BJUA 2ZECA 1CA0B 4BTIB 5K7RA 1O37A 4INLA 1SOZA 1E38B 4BAHB 4DOQA 4IC5A 5A8XA 9LPRA 3A8AA 2UWPA 4GUXA 1SGTA 3AW0A 1NROH 3SOSA 5H4IB 2CV3A 4TY6A 4X1QU 2JETB 2BY6X 4RI0A 4A92A 1SMFE 3SNDA 5DN6D 1SVPA 3SGBE 4X6MA 4UE7H 1G2LA 1O3BA 1ETSH 4Q7YA 2WPLS 3OX7U 2R2MB 3SZEA 1PPZA 3RC5A 3FZDA 4OGXA 1QJ7B 1TNIA 3GS9A 3W94A 1J15A 1MKXH 3LC3A 4ZROA 2QY0B 3A81A 5AFZH 4D9RA 2B9LA 1QL9A 5GPIB 4YESB 3D49H 3MO9A 2C8YB 3LONA 1MTNC 1LMWB 5HIZA 1YM0A 3TLOA 3A7YA 2BB4A 3EA8A 1PPHE 5CMXH 3QX5H 2LPRA 4QT8C 2UWLA 1CHOG 4WXIA 1MUEB 3ZZ9A 8LPRA 1YPKH 5I25A 1E37B 4B6EA 1A1RA 3MO6A 3LU9B 1XVMA 1C5LH 4U32A 5EU8A 1KDQA 4XBCA 2A7HA 4MNXA 3PLKA 3UOPA 5GWZA 3QGNB 3BTFE 1FDPA 5DSFA 2GD4B 1QB9A 1O5AB 2V6NA 1T8NA 2ODPA 2FLRH 5T6GA 1AFQB 3QLPH 2G8TA 2A7JA 5PTPA 1FY4A 2ILNA 5L30H 3LDXH 4JK6A 1BDAA 3PMAB 4X8SH 4Y7AA 4AFQA 3FZZA 1W10U 5C67A 3SJ9A 2XC4A 1ELEE 2H9HA 3P8NA 1WCZA 3LGIA 3TVJB 3STIA 5FHTA 1LQDB 2FI4E 2ZDVH 3V12A 5L6NH 3IG6B 1ZYOA 3UWJH 2RDEA 2A1DB 1OX1A 2Z9LA 3BTKE 1MTWA 3TK6A 1YPMH 4OS5A 2BXTH 3BIUH 1TA2A 3RP2A 1O2XA 1W12U 3ZVAA 1T4VH 4ZHLU 3Q00A 2XW9A 1GPZA 3SU6A 4THNH 1FJSA 5C17A 5C1UA 4GCHG 1AVWA 2FEQH 3ZIAD 4E7RG 2FTMA 4FXGH 1Z8IB 4MG3A 5FCKA 4NCYA 5T6FA 2DE8A 1HNEE 1NRPH 2ZA5A 1TGSZ 1P12E 1AQ7A 5LPFA 2F9BH 2A31A 1HUTH 2FTLE 3UR9A 1LHEH 1QRXA 4Q7ZA 2I6SA 3N7DA 3P8FA 3QK1A 3RXRA 3SQEE 1NY22 3M36A 1TAWA 1QBNA 2VIQA 2G81E 1ANDA 3K6ZA 1ACBE 4TPIZ 1GBDA 1S6FA 3MOCA 3PV4A 1GBJA 2Z9GA 2P95A 1ESAA 3RXLA 3ZZ8A 2KAIB 2IOTA 1ZJDA 1SQOA 1Y5UT 2V0BA 3PO1C 1WQVH 4X6NA 4ABGA 2ZDAH 4ABFA 4Q2KA 1AKSB 2D26C 5EXMA 4BANB 1BRUP 5EJZA 1PFXC 2ULLA 1L0ZA 1Y5AT 2BDBA 2ZGJA 3GICB 2FMJA 5L2ZH 2FI5E 1ELTA 2PUQH 1C4U2 2OQUA 2XCNA 1SKYE 1BOQA 5A0CA 5FAHA 5F03A 2IPHA 4ISLA 5FXLA 4ZKRU 1FAXA 2KCOA 1YCPH 2G5VA 3FKSD 2ZFRH 2Z3CA 1EZQA 1FZZA 3RC4A 3U8RH 6CHAC 1O2OA 1O3IA 3Q3XA 3UQVA 1RRKA 2A5IA 1TRNA 1C1SA 1MTNB 1TE0A 1P2OA 3LGUA 1ZPZA 1E1RD 1KYNA 3RLYH 2TRMA 2EI8A 2OBOA 3QTVH 4DW2U 1RS0A 1OYQA 3U28C 1NZQH 1W11U 3BN9A 4AYYB 1ESBA 1CHGA 5C1XA 3KF2A 4BTUB 1GHAF 2QV1A 3GY6A 4E7NA 1WTGH 4LZ4B 1EKBB 2ZP0H 4U01A 1D3PB 4WH8A 1GI4A 1S83A 3DFLA 3RMOH 3TNSA 1H8DH 4E05H 4ZKSU 1O2HA 1WUNH 3ZVBA 5HYOA 4Y0YE 1S0RA 1GMHF 3MU1A 2RDLA 2KR7A 2Z9JA 2FOGA 4TPYA 4K8YA 1SGPE 3EA7A 5TCAA 1O2YA 1TFXA 3SV7A 2FIRH 3CNRA 3O8RA 4I8LA 3GYMA 3RLWH 2G4UA 2XBXA 2J95A 3RM0H 2Y5FA 3K2UA 4F55A 3ZVCA 2GZ7A 1H8IH 1S0QA 4ZXYH 1HIAB 3Q77A 4ISNA 1BRCE 5C1YA 4NSVA 1QL8A 2PKAA 1K1NA 3I29A 1AE8H 5EJ1A 1XX9A 2SGQE 1GBTA 1RFNA 3M3VA 3BSQA 1C1OA 1DPOA 1OS8A 1HFDA 4XD7D 1TGCA 4TSFD 3ZZ3A 4ACAA 1DICA 4Z0KA 1HAYB 3KGPA 5ESTE 1ZSLA 3ZVDA 1HLTH 1UVUH 3ATLA 3M3SA 1TGNA 1Z7KA 3HATH 1GMHG 4UFFH 4TWWA 4X1PU 4GPGA 3GY5A 5EPYA 4DIHH 4D76A 4HFPB 1A5GH 3UPEA 1PQ8A 2A5AA 5AVDA 5JB9S 2ZGHA 3WW7A 3RXCA 2GCHF 1CA8B 1SLUB 1YPEH 3SNCA 4PROA 1F7ZA 1H9LB 1FNIA 3TPIZ 1C5VA 1FPHH 5EW1H 3ESTA 3RXHA 4BXWA 4X0WU 3LIWA 3DSOA 1AB9C 2VWOA 4KKDA 1C2HA 4YT6H 1K1OA 1BBRE 5DK1A 1GBEA 4ZHAA 1HXEH 1AZ8A 1UVTH 3GCTG 5A09A 4HG6A 1T31A 1EZSC 1GG6B 2LP6A 4YZUA 3RXUA 2O9QA 4IN2A 1AFQC 3A80A 1LKBA 1MKWH 2WUBA 1GI1A 1C5UA 1UVPA 3N99A 4D8NA 1NFUA 2PGBB 1J17T 1T8OA 3VEQB 2VGCB 1DM4B 4CH2B 4XOJA 2PWXA 1DWBH 3LOXA 1EFRD 3DSPA 3JZ2B 1D4PB 2P93A 2STAE 4YT7H 3QWCH 1KXFA 2PLXA 1SLWB 1E1QD 1GHWH 2FXRA 1MU6B 3PYHA 2PR3A 1O5DH 5CHAC 1LCYA 1C5SA 3RXFA 1G3CA 2HALA 2C90B 3VB4A 3MQKC 3GDSA 2O8LA 2ANYA 5F53A 2F9PA 1XUKA 4H6TA 2J94A 3RXSA 2SGAA 1EZXC 1TX6A 1K1MA 1RIWB 1H4WA 3H5CB 1O3EA 4X1RU 5C2ZA 4FVBA 1O34A 2JETC 1VCWA 2I6QA 1GJAB 1V2LT 2UUKB 2A4RA 2Y82A 3GY7A 5LGOA 4YOGA 2NU1E 4MVNA 1AO5A 1ZZZA 1C5QA 2BDAA 8KME2 5JYIA 4K60A 4HGCA 2HPQH 4INHA 1IQLA 4ZUHA 1C5NH 4CRCA 1O3GA 2CGAA 1MQ6A 1WOFA 2BTCE 2KM0A 1MZAA 1GWAA 4ABIA 3PMJA 2V3MA 1W8BH 2ANKH 4IN1A 5F8ZA 2BM2A 4NFFA 4JZDH 1QQUA 5ETXA 1QJ1B 5E0JA 2BX4A 3LC5A 2BMGB 3PMBB 1K9OE 3CS7A 1LKAA 1OKXA 2B8OH 1HIAA 1TMUH 1EJMA 4X6OA 1C2MA 1L1GA 1LHDH 3AAVA 2FOCA 4BTTB 4I8GA 2PSXA 2CXVA 4MNWA 1PPFE 1B5GH 1DANH 1DY8A 4JZ1A 3FN8A 3SHCH 1SQRA 1SGDE 4FVDA 2C8XB 1P2JA 2BQ6B 2GKVE 2TIOA 2FOMB 1A46H 3MU8A 4JYUH 5EODA 2VVCA 1GHAG 1GJ8B 2FS9A 3UAIC 1UCYK 4FOUC 4NA8A 5CHAB 2QGRA 3HK3B 1HXFH 4IW4E 4CR9A 1EZUC 5L2YH 1N6YA 3L33A 5EPNA 4D7FA 2FP7B 2BLWA 3ZVEA 2RA3A 1SPJA 4DURA 2BD9A 5ABWA 3BG4B 3V7TA 4K8BA 1LPZB 4YLUA 2Z3EA 1FPCH 5SGAE 3BTTE 1V2VT 4AX9H 3D65E 1O3MA 1Z6EA 3EGKH 6LPRA 2ZCHP 1O2JA 1ZSKA 1SSXA 4B75A 2ZNKH 3KQDA 1NFYA 3EE7A 1KLJH 1P02A 5DP3A 1HAGE 4B73A 4MPXA 1O2PA 4DJZB 3E1XB 3SNAA 1VITG 1OWIA 2KCPA 1ZRBA 1BBRH 3OFND 2ZPSA 4DG4A 1VITF 1UMAH 2AGIX 1O3PB 2ZHFH 1PQ5A 1EP5A 2VWMA 1GJ9B 1GVZA 5E8EH 3U1JB 3QTOH 1NBMD 1DX5M 2BLOA 1EP6A 5FBIA 5LH8A 3K9XB 2F4LA 5CHBA 2BLQA 2GP9B 1EOLA 3LGTA 4NIVA 1WSSH 1NRRH 3WWBA 1HGTH 1Z6JH 1W7GH 1GDNA 1MBMA 1YPHE 1AUJA 1O3NA 1RTKA 1FIWA 1GBMA 3VB6A 2CJIA 3EA9A 2LNCA 1Q31A 4B6FA 1AWHB 4H42U 3QDZB 2O8UA 3CS0A 3SN8A 2GDDA 1V2ST 3TK5A 1SGYE 1DWDH 4NSYA 3PV5A 1XXFA 2H6MA 4BAMB 4NGAH 2GT8A 2L74A 1GJ4H 3T29A 2Y81A 4Y7BA 2GTBA 2A2XH 4X2VA 2HLCA 2GX4A 3MH7A 4ISOA 2FZZA 3DFJA 1VJAU 1A5HA 3P95A 3RMMH 4LOYH 1DWCH 4KTSA 1LVBA 1C1PA 5A8ZA 3VB5A 2VH0A 1AZZA 1MMJN 2CMYA 3GY3A 3DA9B 1O3OA 1UCYH 7GCHF 2BY9X 2RG3A 1VJ9U 2ZU2A 2PP6A 3HK6B 1LHFH 4P02A 2J92A 3H09A 1BTYA 1LPKB 3GY8A 1A7SA 2AEIH 4B71A 1GI3A 3H7OA 1FMGA 1TPSA 5EQRA 1DVAH 4VGCB 1ELBA 4MPVA 4BAOB 4K1SA 1YLCA 1B0EA 2OC8A 5FPYA 2BY8X 1C2KA 1FY8E 4FUHA 1NN6A 3GY2A 1JBUH 5HIYA 3LJJA 4GSOA 2VIDA 5EQSA 2W5EA 3A7TA 2BVSH 4CH8B 1E79D 2QXJA 3ITIA 1DE7H 3P6ZB 1EB2A 1Z1IA 3E0PB 4Y8ZA 3SBKA 1J8AA 1ANEA 1JOUB 4OGYA 3O8BA 4AFSA 2OC1A 3PLPA 3ELAH 4FUBA 1W0JD 1QHRB 1GL1A 1L4ZA 4XBDA 2KAIA 1O2TA 4DY7B 2VIPA 1SHHB 1WBGB 5DJ7A 5E0GA 1F5LA 3SV2H 2G5NA 2XNIA 4B2AA 4ZAEA 2J5UA 3NK8A 1XMNB 5DP7A 1EXFA 2BVRH 3TK9A 2YNAA 3RXVA 1AVGH 3L6PA 1ETRH 1B7XB 1KDQB 3NZIA 2BD5A 2BXUH 2ZI2H 5HXFA 1TMBH 1P9SA 1Q3XA 2G51A 1A61H 3M37A 1COWD 1B0FA 1K1PA 4ZCNA 2ZO3H 4FU8A 1V2JT 5DGJA 1EPTA 1V2MT 3GCTF 4Y11E 3H7TA 2FOEA 2A2QH 4OM9A 3U8TH 1AY6H 4NIYA 1JIRA 1UVSH 1LVMA 4YO9A 4UFDH 2IJOB 2CF9H 3UWIA 2WINI 1ZHMA 1IHTH 4CHAC 2AFQB 5FBEA 2YNBA 2HNTE 1VZQH 4OS2A 3OTPA 4O97A 1GGDC 1NTPA 2JJ2D 1J16A 1AU8A 5CE1A 3A83A 2ALPA 3SJOA 4NFEA 1O2ZA 1D6WA 1WYKA 1ZR0A 1ZOMA 1ZMJA 1IQHA 3SUDA 3A8CA 2VJ1A 3PO1B 2EI6A 1V2PT 3JZ1B 1TA6A 1D6RA 1ZMNA 1S85A 1G30B 3ZZDA 4MPWA 1O3FA 1T8MA 3S7KB 1KSNA
chains in the Genus database with same CATH topology
5AF9H 4JMYA 2VIOA 2OC7A 1SI5H 1F5RA 1C2JA 1TX7A 3BTHE 3V0XA 1K1JA 2TGTA 1QFKH 3SGQE 1LPGB 3BG4C 2C93B 2V3HH 2WYJA 2QC2A 1VGCB 4ZHMU 1DXPA 3F9EA 4YTAA 5EQQA 4GVUA 1CSOE 4NWLA 4X2XA 3KIDU 5HM2A 3PROA 3VB3A 1GDUA 3SGAE 4B76A 1D9IA 2BD4A 2FODA 1O3AA 2SGEE 1AE5A 3GDVA 2P59A 5F8XA 1CHOF 2A7CA 1AUTC 1S82A 3B9FH 1W14U 2PKSB 3PWBA 4AFZA 1C5ZB 1UTMA 1GBFA 3EAJA 1SGNE 1NPMA 4ZXXH 4KTUA 5JBCS 2ESTE 3HKIB 1TOCB 1UTKA 2VWLA 1V2WT 1UTQA 2C8ZB 3GCOA 4AB9A 1S6HA 3BEFB 1D3QB 1GI6A 1C5WB 1AI8H 1XVOA 1Y3XA 1GBHA 2ZU4A 2VGCC 4A5TS 1P3EA 2JH5D 2ODQA 1GJCB 3LGYA 2GT7A 1GBLA 1DFPA 2FOAA 1D3DB 1G9IE 3UREA 4AORA 2BYAX 3MYWA 3RC6A 1VR1H 1YP9A 1GHBF 1HJAB 2SGPE 1O0DH 1BJVA 1W2KH 4K69A 4ZKNU 2BD3A 1KY9A 2VU8E 1O31A 3LGVA 4GHTA 1ZSJA 2VINA 2C8WB 4BXSA 1C2DA 1P05A 4X8UH 4R8TB 1O3HA 2J4IA 2Z3DA 3VGCB 3O8CA 1L1JA 2QF3A 3LPRA 2W3IA 1C5YB 2GCTC 3GCHC 1F92A 2NU4E 1SHYA 3B23B 4MDSA 2TGDA 1C5PA 3PTNA 1YPGH 1VCPA 3VPKA 2JH0D 3A7WA 2PUXB 4WXVA 1P09A 1G3BA 1TABE 4WJG2 1BHXF 4YLQH 1SL3A 3KQEA 3A86A 2WPJS 3BTEE 4U30A 5DG6A 1P2IA 2UUYA 2GGVB 3T25A 1BZXE 1EPTC 2ZDKA 1TMTH 4B2CA 2A4QA 1H9HE 5E2PA 3KHVA 1C9PA 2XBWA 4A7IB 2D8WA 2Y6TA 1HAIH 1INCA 1SG8B 4CRAA 1C5MD 3P17H 1FXYA 1ARCA 3LH1A 3URCA 1SGFG 1CA0C 1AVXA 3MH6A 3ATKA 1TNHA 2GV6A 4BAKB 4SGAE 4X8VH 1DLKB 4NZQA 1FUJA 2ZDNA 3GOVB 1THRH 4NA9H 1AFEH 5GIBA 1GCDA 2PFEA 1MZDA 2QAAA 5EOKA 2Y7ZA 2FPZA 3GYLB 1MAXA 2TGPZ 2ZGCA 2BZ6H 1IQFA 2CN0H 1W13U 2YOLA 1OXGA 2FI3E 2F9OA 3MNSA 1AB9B 1SLXB 3MU4A 2G52A 1V2UT 2HNTC 4D9QA 3BEIB 2DE9A 2O8MA 4UEHH 4I8HA 3CENA 2VIVA 3RDZA 4Y6DA 1GMCG 3F68H 1CT4E 5GXPA 2GVFA 1THPB 3A85A 1V2KT 5DP4A 1TRMA 3R3GB 3U1IB 3ZYEA 1W0ZU 3STJA 1DUAA 2ZGBH 2ZTZA 1HAHH 3OU0A 4DVAU 2GCTB 2BDHA 2ANMH 1C2EA 3BTQE 2P3UB 2VVVA 2R9PA 1J9CH 1NS3A 2P8OB 3AASA 4CRBA 1SGQE 1F0TA 2R2WU 1SFQB 1P0SH 3SV9A 2AIPA 1FV9A 2BHGA 4RKOB 1S81A 3BF6H 1YLDA 3MNXA 3LGWA 1BRAA 2HNTF 2HWLB 1NRQH 1QRZA 1TONA 3GCNA 2XCFA 1GBIA 1GBKA 1KTSB 1O36A 1GI5A 5A2MH 2ZPQA 4JK5A 1O3CA 1TNJA 2FM2A 4NZLA 3SU2A 3LJOA 1F2SE 2XTTB 2ZU1A 2QCYA 4UDWH 5JBBS 2F9VA 2XC0A 3E8LA 1RGQA 2CHAC 3E6PH 1GHYH 1P9UA 2XBYA 4FUJA 1JMOH 2A5KA 2HVXA 1WQSA 4ISIH 1P57B 2ZHWH 2GMTC 2Y80A 3SZNA 1NESE 3A82A 2J34A 1BMAA 2ZHQH 5GDSH 5AFYH 3F9FA 1CT0E 3MFJA 1TNLA 2VIWA 4MLFB 2ZTYA 4NIWA 1RJXB 1O39A 1C5TA 2ZU3A 1K21H 3M61U 1O30A 1EJAA 1JRTA 1G32B 1UO6A 3OSYA 5J4SA 5LPRA 1YCPK 1VCQA 1TB6H 1MTSA 1QR3E 4Y8YA 4U2WA 1A0JA 1F0RA 3TITA 1SQAA 1WV7H 1G36A 1HPGA 4XE4A 1LDTT 1QIXB 1TNGA 1GJ7B 3DT0H 1J14A 3T5FH 2ZFSA 2PTNA 2AGGX 4IMZA 3MH5A 4TYDA 3FAOA 3GDUA 3UNRA 1YKTA 3VXEH 3BTGE 1KXCA 2AMPA 1GI9B 1MU8B 2ALVA 3UNQA 4Z6AH 4M7GA 2AYWA 3EE0B 3URDA 1QBVH 2FS8A 1HAVB 3NKKA 1XUGA 5C5OA 2BY5X 4Y76A 2PKSC 3I78A 3V3MA 1C9TA 1HV7A 1EASA 3OY5U 7GCHG 3BG8A 4WVPE 3HGPA 4AFUA 1CT2E 5EW2H 3UNSA 1ZLRA 2Z94A 2P3FH 4WWYA 1IQJA 4Y71A 2F83A 5DP8A 2RCEA 3V13A 1MKWK 4K5ZA 5BPEA 3MI4A 5T6DA 1IQIA 2BD7A 4ABJA 1LQEA 4Q80A 1S84A 5A0AE 3T2NA 3FP7E 5LPEA 1P06A 1HAXB 4X2WA 1H1BA 3M7UA 3ENSB 1KXAA 1PPGE 6CHAB 3L3TA 5FX5A 5FPSA 1QTFA 1ZHPA 2W26A 2ZF0H 1BBRK 1EUFA 1Z71A 2W7SA 1HYLA 1C2IA 1O2SA 1A0HB 3KN2A 1V2OT 1FIZA 7ESTE 3KL6A 1N1LA 2Z9IA 3KQCA 4ABEA 6GCHF 3DHKH 3P8GA 3ZVGA 2AERH 2Y7XA 3LKWA 3SU5A 1V2QT 1E34B 4O3UA 4F4OC 1BQYA 1LHCH 3A7XA 1C1VH 4ABAA 1C1QA 1SB1H 1OYTH 1SGEE 2NU2E 5E0HA 4IMQA 2FO9A 1MAYA 1NRNH 1YC0A 2PHBA 2BDIA 3SNBA 1GGDB 2WYGA 1BITA 1WAYB 3R0FA 1SOTA 1ORFA 2BDGA 3MNCA 4E06H 2ZTXA 1O5CB 2BQ7B 4MTBA 2THFB 3HKJB 4Y0ZE 1E35B 1PYTC 4YOIA 3MH4A 1FY5A 1O3JA 3BTWE 3M3TA 4FUCA 1GJ6A 2FX4A 3SUFA 3U69H 5A0BA 2G00A 1UHBB 1IQKA 1WU1A 3HPTB 3PLBA 4AGJA 1XUHA 3ZYDA 2W7UA 1TPAE 2R3UA 4XBBA 1E36B 1YCPM 7KMEH 1LTOA 2V3OH 2OP9A 4AB8A 1TALA 1TGTA 3SI3H 4I31A 1DLEA 1C1UH 3RXOA 1GJ5H 2WPMS 3SJIA 2G55A 1CQQA 5ESBA 1UTJA 1XUJA 3PB1E 2AGEX 3P8OA 1PYTD 2GV7A 3F9HA 1BMNH 3BEUA 2PKAB 2ZPRA 3SHAH 4ASHA 4ZKOU 2R0KA 1Z8RA 1QCPA 1TQ0B 2C4FH 4JYTA 4RN6A 1TBQH 1OP0A 3E3TA 3EDXB 1O2LA 2WPIS 2ZCLP 3M5OA 1QRWA 1GBCA 2VVUA 3UOUA 4ABHA 1IQGA 1JXPA 8GCHF 2BZAA 1BTWA 3LT3A 1ZTJA 2QN5T 3MU5A 3TIUA 1IQNA 1DSTA 4FUEA 3AW1A 5T3HA 2OD3B 3E0NB 4I7YH 5DO4H 1O2NA 1PQ7A 4IC6A 1A3EH 3RXTA 1P01A 1K1IA 3M5MA 4FU7A 4WMEA 3E16B 1P3CA 1TRYA 3KCGH 1QQ4A 1C4Y2 4X2YA 1ZHRA 1P8VC 2JH6D 4YM9A 1GVLA 4MQAA 3BTDE 3RXPA 3RXBA 1W0YH 4CRGA 4O9VA 1UTNA 1MTVA 1OP8A 2ZZUH 2SGDE 1JRSA 4AOQA 2BY7X 2FESH 3BIVH 4MNYA 1IAUA 4WY3A 1C5XB 2VB0A 1UCYE 5DP9A 6GCHG 1ETTH 1ELCA 2P8OC 1GI2A 3E90B 2Y5GA 3NUMA 1RD3B 4SGBE 3SI4H 5JBAS 1CGHA 2H5CA 1SR5C 4UFGH 1ESTA 2NU3E 4ABDA 4FU9A 1IHSH 2BD8A 1Z8GA 3K65B 1L1NA 2OXSA 2B0FA 2WV4A 3O8DA 3IWMA 1T32A 2GMTB 3GCHB 1A3BH 1IOEA 1P2KA 2ODYB 4DGJA 1NU9A 3A84A 4CRFA 2G4TA 3S0NA 2CHAB 2FWWA 3SV6A 2A4OA 3KQBA 2AIQA 3SORA 4KTCA 1ABIH 2ZC9H 2A32A 3A8DA 1SGIB 3EQ0H 2SGFE 2SNWA 1XKBC 3SJ8A 5GJ4B 5JBTA 2PTCE 2XRCA 2XWAA 1OWKA 3C1KA 1QGFA 2Q6GA 3S7HB 1HJ8A 1QA0A 1QL7A 3M5NA 3QGJA 1T4UH 2ZGXH 6ESTA 1IQMA 1O2KA 5F8TA 5JDUB 2D1JA 5DPAA 4A6LA 5E2OA 4I33A 3ZZAA 2AH4X 1EATA 3Q3YA 3SU1A 1AIXH 3HGNA 1GJBB 3ZZCA 3U8OH 1YPLH 2PSYA 2P3TB 3ZZ6A 1C1RA 1ZGIA 2O8WA 3D62A 5GCHF 1N8OC 1RTFB 3UIRA 1AHTH 2FOFA 4JZEH 4LZ1H 4YOJA 1CBWC 1GHBG 1CVWH 2FX6A 2JKHA 1GL0E 2AMDA 3TGIE 1VITH 1X7AC 3U98H 1LO6A 3QZQA 4Y79A 2PV9B 4OS7A 4DT7B 1QURH 3ZZ5A 1LHGH 4RSPA 1CGJE 3T27A 2GZ8A 3ZVFA 1CBWB 3ATIA 4H4FA 5B6OA 3OYPA 1DSUA 4WH6A 1EQ9A 2FYQA 5AHGH 3SUGA 2BD2A 2FOBA 1HAVA 3AAUA 1BB0B 2GZ9A 4BOHA 1XUIA 4GLYA 1SFIA 2F9NA 1NT1A 1Y8TA 3M5LA 1TPPA 1ANCA 1MCTA 2OQ5A 3UR6A 1GG6C 2VNTA 3MWIU 2R0LA 2BOKA 4ABBA 5K0HA 1NRSH 2QYIA 2ZKSA 3A88A 1QBOA 3KNXA 2OBQA 1TOMH 4HTCH 2NU0E 2ZDMA 4B74A 2Q6FA 3TH3H 5TJXA 4CHAB 1SQTA 1XM1A 4NWKA 3FANA 4FUIA 1FY3A 1ZPCA 1C1NA 3QZRA 1EX3A 2SNVA 3C27B 1XKAC 4KGAA 2ZEBA 1K28D 1UK3A 2QF0A 4KP0A 1Y3WA 2BVXH 5EGMA 4I8KA 1TBRH 3A89A 3P92A 8ESTE 1MD7A 3CP7A 5C20A 5I46H 3ZV9A 4F49A 1OOKB 2J38A 3SU3A 1TWXB 2OLGA 1UTLM 1OP2A 3NWUA 4JCNA 4K3JA 4AGKA 3SO3A 4A1XA 3LH3A 3P70B 1VGCC 1N8OB 2AMQA 2BDCA 3UY9A 1GHZA 8GCHG 1YPHC 3T26A 2R3YA 4NIXA 1YBWA 1QNJA 2A4GA 4JYVH 3RU4E 1QY6A 1O3LA 1DS2E 3M7QA 3QUMP 3RXKA 1MKXK 3DD2H 2STBE 4GAWA 1YF4A 4UFEH 1BT7A 1G3DA 4DIIH 2Z7FE 2QXHA 2EA3A 1GCTB 1UK4A 7LPRA 3SJKA 1EAXA 2Z9KA 3F1SB 1O3KA 1DUEA 1AD8H 1O5FH 2C3SA 2F91A 1S5SA 1ELAA 1P2NA 2HGTH 3ODFA 1MBQA 1O2MA 1V3XA 1A0LA 3RMNH 3SNEA 4AYVB 4O3TA 1EJNA 2FOHA 2P16A 1TGBA 1BCUH 4R0IA 1UVOA 3A7VA 3NXPA 2ZFPH 2FDAA 2Q1JA 1UJ1A 2SFAA 1TYNA 5FX6A 1KLTA 2ZWLH 4UONA 2XC5A 1DDJA 1SGFA 4K1EA 3TJOA 1JIMA 1Y3VA 2ZDLA 1PPEE 1G37A 1HBTH 1F0UA 4LK4A 5DP5A 9ESTA 2F9UA 2F3CE 4Y8XA 1HJ9A 2PGQB 1OPHB 4J2YB 1W3CA 1K22H 1QA7A 2VH6A 3A7ZA 4J1YA 1ELDE 1HCGA 4X8TH 1C4V2 1IQEA 4NG9H 3VFEA 4ZMAH 2K1QA 3D23A 4WMFA 2ZG0H 1O2RA 4FUGA 4K1TA 4AZ2B 1Z8JB 4XDEA 4A1TA 5JPMH 1OWEA 1BTUA 3PMHB 1O2VA 3TU7H 1O35A 2B5TB 1FLEE 1O2IA 1PJPA 3W95A 2H9TH 3S9BA 1P03A 3F9GA 3MNBA 3RXEA 3E91A 4CRDA 4CBNA 2ZQ1A 1GJDB 1ELFA 1BUIA 1ZRKA 1A4WH 1F5KU 2TPIZ 3RUOA 2GCHG 1OWJA 1NFXA 1O5EH 1EAWA 1GCTC 4O03A 1FI8A 5EG4A 2QIQA 1O2QA 1TLDA 2BOHB 2EI7A 2OCVB 3A87A 4I8JA 1P04A 1GVKB 1UTPA 5DKMA 1LVOA 1ELGA 4ESTE 2HPPH 1OWHA 4MPUA 1UHBA 3RXIA 4FUFA 2BLVA 1H9IE 3AVZA 2ZIQH 1C2FA 3SU0A 2H9EH 1FY1A 2Y5HA 5IDKA 1KIGH 1FONA 3TJUA 3FP6E 3TH4H 1BTZA 3RMLH 2D2DA 1DITH 3RXQA 3A8BA 2OTVA 1N6XA 2VWNA 4I32A 1GMDF 1TNKA 4OS1A 1Q2WA 1QB1A 1EB1H 2ZCKP 1AMHA 1DWEH 3UTUH 1CE5A 1ID5H 3OTJE 4MNVA 3S9CA 2UUFB 1KXDA 2OC0A 1C2LA 1O5GH 1BA8B 1G2MA 1O2GH 2TBSA 5FPTA 1CU1A 1NO9H 5JB8S 1P11E 3TNTA 2O8TA 4AG2A 2M5TA 2HRVA 1FQ3A 5J4QA 1QB6A 4VGCC 1K1LA 2NWNA 1OSSA 1ZPBA 1BTPA 3ZZBA 1KLIH 1PPBH 1EAIA 1HB0B 3N7OA 1V2RT 1XUFA 1YGCH 1EOJA 3S9AA 3U9AH 3ATMA 3EYDA 3RM2H 5A8YA 3MHWU 2XBVA 4OS6A 3PWCA 2DUCA 3B8JA 3QN7A 1C5OH 1HAOH 1HDTH 1HAZB 3SQHE 1GI8B 1UK2A 3TGKE 1QJ6B 3T28A 5EXLA 3T62A 1G3EA 2EC9H 1AN1E 4LXBH 1MD8A 3ZV8A 1RXPA 2H2ZA 1HAPH 1D3TB 3FP8E 1GDQA 1AWFH 2ZQ2A 5C3NA 4Y10E 2BDYA 2GDEH 4DCDA 1O5BB 1V2TT 1GMCF 3UFAA