4NIXA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) orthorhombic form, zinc-bound
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
b'GGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGHTKSSGTSHPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKKSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 59
structure length 221
sequence length 221
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA02
4ASHA 1C5QA 1AFQC 1ANEA 3T5FH 1K1JA 2QCYA 3GDSA 5LPEA 1MTUA 1YPHC 3E3TA 1KTSB 1C2IA 1JWTA 1V2MT 2FPZA 1UVTH 1O5DH 1PPEE 5IYTA 3BTFE 1BITA 3M35A 4JZIA 2H1UA 4D76A 1CBWB 1C1SA 1BZXE 2P93A 4Q7XA 4BTTB 3GCHB 3BTWE 1UVUH 2V6NA 1SR5C 3RM2H 3SORA 1ZLRA 3TH2H 4GHQA 2B8OH 2R0KA 1HRTH 1Y5UT 4AOQA 1VITH 3DA9B 3ZYEA 4UONA 3LGUA 1MAYA 3ZZ8A 3UOPA 2FOAA 3SJOA 1QB9A 2ZCHP 1NT1A 1TALA 4X6MA 4U2WA 1O3EA 4E06H 1O2XA 2M5TA 3VPKA 3TLOA 1A0JA 2VB0A 2ZTXA 4K69A 2J9NA 1ACBE 1DSTA 1G36A 1Y8TA 3SGAE 1OWKA 1IAUA 1RTLA 4MNWA 3HPTB 2YOLA 1ZSJA 3RMMH 3E6PH 3QGNB 1C1PA 4CBNA 4JMYA 4Y8YA 5FHTA 3A84A 1D3TB 1Y3UA 2W5EA 4CRDA 2QAAA 1BTPA 2P3TB 1AWHB 2EEKA 2J38A 1HXEH 1NFXA 4MG3A 3NKKA 5JBTA 1XUFA 3LGIA 1TAWA 4IGDA 3RXKA 4THNH 1C5VA 2OQ5A 2A2QH 1QL7A 1HIAA 1O2LA 4NWKA 1GDNA 2HRVA 3ZZ4A 3C27B 3SU1A 3VB6A 4CBOA 1O30A 4MNVA 1GBAA 3A7VA 3RXUA 3M7UA 4BANB 1A4WH 5FX5A 4ABJA 2A2XH 1QGFA 3BTKE 2FS9A 2OUAA 1LHCH 1O3OA 2BLVA 1GBLA 4HI3A 4IN1A 3V0XA 3EYDA 5EQQA 3ZZCA 1SC8U 2GV7A 1TPOA 4JK5A 2XBVA 3Q3XA 8KME2 3W95A 1O2ZA 2FESH 1ZSLA 3BG4C 3GDVA 1TWXB 1BIOA 2VWNA 5FPTA 2OXSA 1QQUA 1IQFA 1AN1E 1MUEB 1T8MA 2AYWA 2ZHWH 1V2PT 1S5SA 1HLTH 1QHRB 2FMJA 2J95A 4NA8A 4Y8XA 2PWXA 3LPRA 1QA7A 2G4TA 4HTCH 1H1BA 4INLA 2BVXH 1A7SA 3BG8A 3DHKH 1JMOH 1VR1H 1XUIA 2G52A 5A0CA 1E35B 2ZTYA 1HAIH 3SHCH 3SUGA 1TNHA 3SNDA 3A87A 1KSNA 1C1OA 1E37B 3KQDA 3U8OH 1DLKB 4OS7A 1SGDE 4ISIH 1FN6A 1KY9A 4Q7YA 4NIVA 2ZG0H 4NA9H 3RC5A 1PYTD 5J4QA 1NM6A 2P94A 2ANYA 1EXFA 4TY6A 1V2ST 1ZMNA 1C5YB 1G2LA 1HJ9A 2BQ6B 3UIRA 1J14A 1JIMA 2BD8A 2OC0A 1THRH 1TQ0B 1OYTH 1NS3A 1QTFA 1FAXA 1MTWA 3MYWA 2XYAA 3RUOA 4WVPE 1NZQH 1N8OC 2JH5D 1O34A 2P8OC 5JB9S 1FPHH 3OU0A 1AE8H 3RXSA 3GCTG 4VGCC 1G3CA 1UHBA 2HLCA 2VGCB 1O5AB 1XXDA 1RXPA 6LPRA 2VWMA 3MH6A 3RXIA 2AGIX 1SGYE 1VGCB 2A5KA 3OYPA 3SI3H 3VGCB 1O3BA 4Y10E 3UPEA 1AB9B 1QY6A 1YCPK 1ELVA 5HXFA 1V6DA 2BOKA 3M5NA 1AHTH 1EX3A 1KDQA 2CHAC 3SI4H 3LONA 4GVUA 2NU2E 2G5VA 1QURH 1MQ6A 1T4UH 2OC7A 4AB9A 3EGKH 4UFEH 1AMHA 1O2QA 3P8GA 1FLEE 2Y7XA 3H5CB 1ETSH 4Y6DA 4Q80A 1P10A 2SFAA 1EASA 4YZUA 2GGVB 3PO1B 4WWYA 3TNSA 1C1VH 2Y82A 1UTOA 4HZHA 1GGDC 5CMXH 1BRUP 4ZHAA 1QJ1B 5DGJA 4IW4E 3A8AA 1IQEA 3N7OA 5FBEA 1HCGA 1H9IE 2HNTE 2Z9KA 3ZVAA 1CHGA 3SQHE 2ZFQH 3SO3A 3DFJA 1P2NA 3RP2A 2QXJA 1EAWA 3RXGA 2STAE 1UK3A 1P2JA 1TA6A 1F0UA 7ESTE 1IQHA 3MU4A 4I8GA 1TIOA 3RDZA 2P16A 4B75A 1N6YA 2XXLA 2CF8H 3ATKA 4ISOA 4OS4A 1O3HA 2JH6D 2ZCLP 4MDSA 1UVOA 1A3EH 1SL3A 1T8OA 3ATMA 2W7UA 1ELGA 3QGJA 5ESTE 4X1RU 1ZYOA 1L4DA 3NZIA 3VB5A 1GJBB 1VITG 2A0QB 4TWWA 1WTGH 2AMQA 2F9UA 1BHXF 2GZ8A 1O38A 3P95A 1GJ7B 3O8CA 1XX9A 1M9UA 2ZU5A 4HFPB 4B71A 1F0RA 2O8LA 3VB4A 1NFWA 2GCTC 5EQRA 1OYQA 1HFDA 3PLKA 2A7CA 1LO6A 2ZKSA 1FI8A 4IMQA 4O9VA 1L4ZA 3VEQB 4NGAH 1HAXB 2A4OA 3PMBB 1V2JT 3PMAB 3UR9A 2VIOA 1CA0B 3SJ8A 3GY4A 3M3SA 1GBEA 4BNRA 1NRQH 1O2NA 4IBLH 5E0HA 4IN2A 1C9TA 3BIVH 5GXPA 1YPGH 5HM2A 1C5LH 1K1IA 1K9OE 1O3KA 6GCHF 2VVUA 1DANH 2GDDA 4FUFA 4ZKRU 4I31A 3KHVA 2PUXB 1KLIH 3LU9B 3STJA 4GUXA 1INCA 4AFZA 1CE5A 4OS1A 3V13A 1Y59T 1DDJA 2VIPA 1FY5A 4R0IA 2GT7A 1WQSA 3GY2A 1TBQH 1EJMA 1HBTH 1HJAB 2Q6DA 4O03A 3MOCA 3GOVB 3M7TA 3LH3A 1Q31A 2A32A 1P2KA 2ZFSA 5ETXA 1IQMA 1CO7E 2VVCA 3MU0A 3QLPH 1E38B 1QR3E 1SGCA 1EQ9A 1O2YA 2BVRH 4YM9A 1GVKB 3PV4A 1A0HB 4X1NU 1GHWH 3TH3H 1BDAA 1QNJA 3UNRA 1DSUA 1X7AC 1GCTC 3LC5A 3MNSA 3RMLH 1P09A 1HPGA 3HGNA 1RTKA 5DK1A 2ZI2H 2Y81A 2ANKH 4Z0KA 4LXBH 5FPSA 3T27A 1P02A 2ZC9H 4WH8A 1FY1A 4MPVA 1YLDA 4AGJA 2STBE 1P3EA 4U30A 5J4SA 4K1TA 1SOTA 1KIGH 2W7SA 2GV6A 5DP4A 3F9EA 3GCOA 3A82A 1O3GA 3QWCH 4MNYA 1H9LB 1GG6C 2A1DB 4D9RA 3TJUA 1GJCB 1V2LT 1W13U 2WYGA 5FPYA 1VJAU 4UFGH 1TRNA 2A45B 3TITA 4JZEH 1SGFA 1GMHF 1G3BA 3FP7E 1WYKA 4DURA 1DPOA 4I8JA 1JRSA 1TGBA 3SUDA 3AVZA 2Z6BD 4MLFB 2ZGXH 2UUKB 2XBYA 2AGGX 2FTMA 5L30H 4WMEA 2JETC 4D7GA 2HWLB 2K1QA 5EOKA 4K8YA 2FM2A 3UNSA 4XFQA 4KTCA 5DJ7A 3BSQA 1DWCH 1FZZA 3PM3A 1T7CA 3LIWA 1QJ7B 2D1JA 3AAVA 3LJOA 3BTDE 2EC9H 4OS5A 2FOFA 1HDTH 3T28A 1VCQA 3RU4E 1OSSA 1N6XA 2WUBA 1GBBA 3DUXH 4Y79A 1KXEA 5TJXA 1IQGA 3MMGA 1TX7A 1O2SA 2J34A 3K2UA 1QB1A 2DUCA 5FCKA 1HXFH 1GI0A 4FUEA 3BF6H 2XC4A 5HGGA 1F2SE 1CT4E 1OP0A 1DWDH 1ZPCA 2OC8A 1PFXC 2Y5FA 3ZVDA 4GCHF 1G32B 1IHSH 1PPFE 1XKAC 2F9VA 1ABIH 3U8RH 1O3NA 3RXEA 1GBCA 2GMTC 3T62A 1KXAA 2ZGCA 1GJ9B 3SGBE 4RKOB 1HUTH 4F4OC 1TMBH 5PTPA 5GJ4B 2FX4A 1ZSKA 2ZA5A 4FUDA 1O2KA 3BIUH 1FN8A 1FY4A 2FIRH 1UTPA 2FS8A 2G5NA 3PLPA 4JZDH 2RDLA 3LC3A 3ZVCA 2ZWLH 3BTHE 3ZVGA 1AUTC 1MKWK 3D23A 1SB1H 1C2JA 5EGMA 3FAOA 5DG6A 5GPIB 1MU6B 1P11E 1DY9A 2FLRH 1J17T 1LPGB 4DGJA 1Y3XA 1UTJA 1UTNA 4KTSA 3MFJA 3TU7H 2FOCA 2GCHG 3UQOA 1AI8H 4ZROA 2CF9H 1NO9H 2AFQB 3SU5A 1XUKA 3U9AH 1JXPA 1HAZB 1YCPH 4YESB 4TY7A 1B0FA 5DP3A 1F7ZA 1GWAA 3I77A 5AHGH 1QRXA 5FX6A 3OSYA 3A81A 1W3CA 4JYTA 3AW1A 1YYY1 1O3JA 5HM9A 3SNAA 2B9LA 4MPUA 1KXBA 1DFPA 3KEEA 1FPCH 4I8LA 2UUJB 3QZQA 2ZDAH 1GHYH 2WPLS 4X1QU 4X2YA 2ZFTA 1AU8A 3IG6B 4XOJA 3MU8A 2PTCE 1Z8JB 3S9BA 5A8YA 2SGDE 2EI8A 3PWBA 3S9CA 5C67A 1UVPA 3BV9B 3TH4H 4K8BA 3O8RA 2PGQB 3RXHA 2QXIA 5F8TA 2ASUB 1GHAF 2TRMA 2FZZA 4B1TA 4MTBA 3V3MA 1Z71A 3FZZA 3ZZ7A 3TPIZ 3HATH 2BY8X 1O2PA 1V2OT 5IDKA 2Z7FE 4ZXYH 1Z8RA 3GY7A 4DG4A 2BLOA 1PPGE 3NK8A 3BEIB 4RSPA 1EB1H 2HVXA 4ZKSU 1ZHPA 3R3GB 4ABGA 1F92A 1C2EA 1BRCE 2V35A 1O33A 1UK2A 3ESTA 1QFKH 1VCPA 5AFZH 1LQDB 2AGEX 4RN6A 4A7IB 5K7RA 4ZMAH 3FZDA 2ZU3A 1FJSA 1HGTH 1GMDG 4F49A 1GJ5H 4OGYA 3RXMA 4A5TS 2HNTF 5EXNA 2TBSA 1BA8B 2YNAA 3JZ1B 3KGPA 4O97A 3RC4A 1BMLA 1TRYA 4YOGA 1C5PA 3SJIA 4FUIA 2VH0A 3RXTA 4AYYB 5C1XA 5EXMA 2G4UA 1V2QT 3A7TA 3S7HB 1DXWA 1G9IE 1AVXA 1AQ7A 1TNIA 4X0WU 4I33A 1NESE 4CH2B 2TGPZ 1ZZZA 1C1MA 1T31A 1BMMH 5DP8A 1SSXA 1D3DB 3NXPA 3MH4A 2PR3A 3UY9A 5ABWA 1K2I1 3FFGA 4AG2A 1SQAA 3FP6E 4I8HA 2PSYA 3GY5A 3NCLA 1CHOG 2C8ZB 1Y5AT 2WV4A 5A0AE 3L33A 3RXVA 3SBKA 2OQUA 5GCHF 5CHAB 2BXTH 1IQKA 1CVWH 1ORFA 2ZGJA 4UE7H 3M37A 3RLWH 2ZTZA 3T2NA 2EI7A 1ZJKA 4KP0A 5L2YH 1W0ZU 4GLYA 4DIHH 2THFB 1AZZA 1C2DA 2QF0A 3U98H 4NG9H 1EP5A 4BAQB 4UFFH 1CBWC 3UQVA 3M5OA 4J2YB 2UWLA 3TK6A 4M7GA 3GCHC 1IOEA 2LNCA 1W10U 4X6NA 1BMAA 2Z94A 4O3TA 1FDPA 1BCUH 4MVNA 3Q77A 2HALA 3SGQE 3RC6A 5JBAS 1EUFA 1G2MA 1CSOE 3GYLB 2BVSH 2VIDA 1MZAA 1GI9B 3U69H 4FUJA 2A4GA 3MNBA 2OINA 1EOJA 1D3PB 4NSVA 4FU9A 4R8TB 2Z3CA 3LGTA 1S84A 4NWLA 2ZQ1A 5GIBA 1ELDE 1TLDA 5FBIA 2BLQA 1J15A 2QF3A 4K1EA 2F9OA 1ANBA 1TA2A 3RXOA 3GCNA 3DFLA 2G8TA 4TWYA 5DPAA 2A31A 4E7NA 1T8NA 4ABFA 1AIXH 3TVJB 1K1OA 1OX1A 2J4IA 3LKWA 1S0QA 4NSYA 2V3HH 3ATLA 4JYUH 2O8TA 2ALPA 3MWIU 1TNKA 3QTVH 1RIWB 3QX5H 1O2VA 1WAYB 4NFFA 1GI1A 2H5CA 2ZDNA 1XMNB 2P3UB 3L6PA 1IHTH 1K22H 1C2HA 3SV7A 2H5DA 1YM0A 3F6UH 1YGCH 3AASA 1SLWB 3TJOA 2ZDLA 2G55A 4I32A 1C1WH 1GMCF 7GCHF 2ZDMA 1LQEA 1IQIA 3JZ2B 4WY3A 3DT0H 3A83A 3Q3YA 3M5LA 1CA8B 2GDEH 2H9HA 2J94A 1C5SA 4B73A 4MPWA 3E1XB 4X2VA 3BTQE 2FODA 3P6ZB 3K65B 3UWIA 2AERH 1P9UA 2QXGA 2ZQ2A 1C9PA 3RXFA 6CHAB 1W8BH 5EU8A 3ZV8A 1V2TT 5C2ZA 1LMWB 2BQWB 1AFEH 2F9BH 2VIVA 1HAPH 4GCHG 1KLJH 1RGQA 2BDIA 3P8OA 2ANWA 4ZKNU 1MKWH 3A80A 1W2KH 2FO9A 2ALVA 1UVSH 4KGAA 2A5AA 2WPHS 3G01A 3ZZ6A 3T26A 4PROA 4JK6A 1DXPA 3A8CA 1Q2WA 1V2NT 3FP8E 1KXCA 4A92A 1G30B 1QBVH 2AIQA 4INKA 3SJ9A 3V7TA 1ZMLA 1ANDA 1EPTB 1O3MA 1ABJH 3QUMP 3UNQA 2PKAB 3C1KA 5EQSA 4ZHMU 3QN7A 5JBBS 3TJNA 4DVAU 1S85A 1C2FA 3RXQA 3GYMA 4E7RG 1ZPBA 3MNXA 2FXRA 3IITA 2BDAA 2H6MA 1EJNA 1YPJH 2SGQE 3A88A 2VGCC 5T6FA 4OGXA 1WOFA 4ZXXH 1D4PB 6ESTA 3PYHA 1VGCC 1MTNB 4NFEA 1FQ3A 1SGQE 3VGCC 3GICB 4NA7A 1EZSC 1ETRH 1AB9C 1Y5BT 1TPSA 2Z3DA 3ELAH 1K1PA 2ZGBH 1DICA 1KYNA 3RU4T 1G3DA 2C8XB 3E0NB 1O2MA 1LHEH 1XXFA 3BEFB 3ENSB 4ABEA 3GY3A 1QL8A 3KN2A 1HV7A 3MI4A 1WTHD 3SZNA 4OS2A 1GHBG 1O2TA 2VIWA 3PO1C 3TNTA 4YTAA 2Z9LA 4ZAEA 1LPZB 5B6OA 1XKBC 3QK1A 1SBWA 4WXVA 1ZGIA 3URDA 5A09A 4A6LA 3A85A 2NU0E 4RKJB 1A46H 1UCYK 1L2EA 3SNEA 2Y5GA 3QDZB 3SW2B 4INHA 2QGRA 5GWZA 4GHTA 5JDUB 2GKVE 4CR9A 1SHHB 2BDCA 2TPIZ 1S82A 1GL1A 1YCPM 2A5IA 1AVGH 5DKMA 2IPHA 1WUNH 3STIA 1V2KT 4CHAB 5LPRA 1LKAA 4K2YA 4D9QA 5A0BA 1A2CH 1YP9A 3SU2A 2Q1JA 1O3CA 2LPRA 2ZCKP 1GHZA 1TMUH 5JBCS 1OWJA 2A4RA 4NZLA 1ESAA 2TGAA 1HAGE 4AYVB 4X8VH 3EA8A 1GI4A 5E2PA 4AN7A 4H4FA 1T32A 2UWPA 2W3KA 1EATA 4BTIB 1DUAA 2V3OH 1NY22 1WSSH 2HNTC 2ZFRH 5H4IB 2GTBA 2VVVA 2EI6A 2AH4X 2C4FH 3E0PB 1JOUB 4X8UH 5C5OA 5DO4H 3SN8A 2BD7A 4LZ4B 1NPMA 1PPHE 2ZU1A 3SU0A 1SVPA 2AEIH 2PGBB 3UREA 1MTVA 3SUFA 1CA0C 4U01A 1ELAA 1S83A 2KAIB 3M3TA 3VB3A 1GI5A 1TABE 3E8LA 1C1QA 3NWUA 4LK4A 2SNVA 1A5HA 2BQ7B 3MO6A 2WYJA 3ITIA 1BQYA 3W94A 4Z6AH 2PLXA 1O2JA 1SLXB 2OC1A 3H7TA 2WPMS 4XSKU 1W11U 2HPQH 1WQVH 1KTTB 2GP9B 4YOIA 2B0FA 3GCTF 1D6WA 1SHYA 3A7XA 4CH8B 2BX3A 2GZ9A 1NRSH 1V2VT 1FMGA 3SNCA 4Y0ZE 5T6GA 4FU8A 1HB0B 4WH6A 2G00A 4JZFH 1HJAC 4U32A 1XUHA 3LT3A 1SG8B 1WU1A 3A7ZA 4ABBA 1Y3YA 4X8SH 1EAIA 3KF2A 2H2ZA 2BMGB 5E8EH 1RFNA 1C5ZB 2RA3A 2W26A 3S0NA 3ZYDA 1MQ5A 1GI2A 2VJ1A 2TGTA 2ZHFH 4ISHH 4B2AA 2ZIQH 4Y11E 1YPHE 1Y3WA 4DCDA 3PWCA 2PHBA 3HK3B 1QA0A 2XTTB 1C5UA 1TBRH 1O2IA 5FXLA 3A86A 5JYIA 1O5BB 1DUEA 1BMNH 4WMDA 1GL0E 4XBDA 3SNBA 4FVBA 5BRRE 1NU9A 3MHWU 4FU7A 4UEHH 2BDYA 3PTNA 1S0RA 1TRMA 1OKXA 4Y7AA 3S69A 2XC0A 2Z9IA 1K1MA 2GVFA 3SU6A 1C5MD 3RXJA 3VXFH 4CRAA 1DS2E 1MD7A 1SMFE 1FXYA 1EPTA 2P95A 1YPMH 5CE1A 2W3IA 4DOQA 2PKAA 2ZDKA 4XE4A 3RXAA 2PTNA 3F1SB 2XNIA 1AFQB 5I46H 2ZGHA 1BTZA 1IQLA 1C2LA 1GVLA 1SGPE 3SV8A 2VNTA 1PQAA 1MBMA 1GDQA 1C4Y2 3KL6A 1C2GA 1UO6A 1W7XH 2J2UA 4K3JA 2C90B 3ATWA 2ZECA 1DLEA 1EZUC 4B2BA 1NTPA 3RXLA 3HKIB 1C1UH 1GJ6A 1QRWA 2WV5A 1C5XB 2VIQA 1C4V2 3MH7A 4FUHA 2OBOA 1VITF 1FAKH 3D62A 1BT7A 1MH0A 1B0EA 1NU7B 1O3DA 1THSH 1FIWA 2ZU4A 2VH6A 2RG3A 1P2MA 5T3HA 3UFAA 4AB8A 2BY6X 3EAJA 4X1SU 3SQEE 3M5MA 3ATIA 5F8ZA 3M7QA 1ZTJA 2FI4E 3KNXA 1O2WA 2GT8A 3TGJE 4AFSA 3O8BA 2R9PA 1K21H 2R0LA 3P17H 4AORA 2FWWA 1BHXB 2F9NA 1O2OA 1O2RA 1LVOA 2BY5X 1ARBA 1PJPA 1UHBB 2BY9X 2BD4A 1MKXK 1NROH 2Z3EA 3MTYA 1GDUA 1D6RA 1UTMA 4CRCA 1BTUA 2XBXA 5JPMH 2BDBA 3B8JA 1O3FA 1XUGA 5A8XA 2Y80A 1UTQA 3IWMA 5HMAA 3UR6A 2Z9JA 1SGTA 4X6PA 1UK4A 3Q76A 8LPRA 2ILNA 1B5GH 1EAXA 3EE0B 4DY7B 1ANCA 1JBUH 1FV9A 1SQOA 4O3UA 1EKBB 1OWHA 1DWBH 1TQ7B 1O5CB 1BTWA 2C8WB 2FOHA 3ZZ3A 2IN2A 3SHAH 3SU4A 2BZAA 1TE0A 5HYOA 2I6SA 2DE8A 2WPJS 1ESTA 1O37A 3P92A 1VZQH 3I29A 2FI5E 3BTGE 1O2GH 2F91A 5A8ZA 2CV3A 3OTJE 3BG4B 1G37A 1YBWA 4KTUA 5FAHA 8GCHF 2ZEBA 3E16B 2ZHDA 1EAUA 2AMPA 3TGIE 2WINI 2ZP0H 4A1VA 2VWOA 1PPZA 2FOMB 1TGNA 3SOSA 4FVDA 1OP8A 1A3BH 4IS5A 3S7KB 4YLUA 2KAIA 2FP7B 1KXFA 1YPLH 1DX5M 1MMJN 5F6MA 3NPSA 2ZPQA 4Y7BA 2ZFPH 3V12A 1GJ8B 2ZZUH 3HGPA 5AVDA 1BB0B 5F8XA 3PROA 2FOBA 1GI6A 5LGOA 3FVFB 1BBRK 1QCPA 4JCNA 1DE7H 3TGKE 1J9CH 2BD3A 5EODA 2Y6TA 1P2QA 2BD9A 2BTCE 1HJ8A 1UCYH 1UJ1A 1W14U 1K1NA 1GBDA 2OCVB 2QY0B 3F68H 1O5EH 1ZRBA 3BTTE 2Y7ZA 1AY6H 1ZJDA 4X2WA 2IOTA 2A7HA 1GHXH 3PTBA 1EJAA 1AKSB 3A7WA 1C1NA 4GSOA 5LH8A 3URCA 2AIPA 1W12U 3FANA 3SJKA 1TOMH 1XVMA 6GCHG 3KQBA 2GD4B 1Y3VA 1N8OB 2P8OB 4Y76A 2XWBI 3SV2H 4A1XA 1QB6A 3MU1A 4VGCB 3A8BA 4DJZB 5BPEA 1K1LA 1RD3B 2DE9A 5LPFA 1PPBH 1C5TA 4H6SB 1TOCB 1RTFB 1O3IA 3ZZDA 3DD2H 2I6QA 1DWEH 3TK5A 4ESTE 1GBJA 2NU3E 3E90B 3M61U 4UD9H 2JKHA 4YT7H 1QBNA 2VU8E 1AO5A 2AMDA 2C8YB 1ETTH 1GBTA 4DW2U 4AX9H 1O3AA 1RRKA 1YLCA 2CHAB 2FTLE 2ZU2A 1GBIA 4ZH8A 4MPXA 4ABIA 4WMFA 1LVYA 1MTSA 1C5OH 5EPNA 1SQTA 1TGCA 3LGYA 3UUZA 1SLUB 1O39A 1GI8B 3SV6A 5L6NH 1L1NA 1GGDB 1ZTLA 2VINA 2BD2A 2F83A 3VFEA 7LPRA 1OWEA 1L0ZA 1O5GH 4K1SA 2BD5A 2XRCA 3SV9A 1O36A 1SGRE 1GI7B 2FLBH 3K6YA 4H42U 2ZPSA 4X6OA 2SGAA 2XCFA 3H7OA 2SNWA 1S6FA 4A1TA 1QBOA 3EA7A 4Q2KA 2FI3E 1CT0E 2GCHF 1FUJA 1GMHG 1F5LA 2ZNKH 1A0LA 2Y5HA 3L3TA 3R0FA 5CHAC 1S6HA 4KKDA 1D9IA 3ZZBA 3D49H 5FCRA 1ESBA 1P57B 5SGAE 1Z6EA 3VXEH 1TYNA 1P04A 3ZVFA 2G81E 1YC0A 1LHGH 3T29A 3CS0A 1SFQB 4YT6H 2OTVA 1UCYE 3TIUA 4K60A 3Q3KA 1LKBA 5TCCA 4BOHA 4X2XA 1BRAA 5AFYH 4IMZA 1F0SA 2ZFFH 3A89A 2QIQA 3LGVA 4JZ1A 4CRGA 1Z1JA 3LH1A 1O3LA 3QTOH 3F9FA 1QL9A 2O8MA 5L2ZH 1BTXA 4NCYA 4TPYA 2GCTB 1PQ7A 3OY6U 4FUCA 1PQ5A 2OBQA 1GJAB 1GJ4H 2PSXA 1GBHA 3ZV9A 2QC2A 1YPEH 2H9TH 3K6ZA 1NRRH 4CRFA 1C2MA 1FY8E 2EA3A 3PMJA 1H9HE 2G51A 1GPZA 5DP7A 1Z8GA 1SI5H 5I25A 3ZVBA 2CJIA 1LTOA 4MNXA 1DT2A 3WY8A 1BTHH 3AAUA 1ELTA 1TFXA 1TPAE 2IJOB 4BAHB 4Y71A 1GCDA 1TONA 5E2OA 1WCZA 4YOJA 1C5WB 3KQCA 1N1LA 1V2UT 3LJJA 2ZHEH 1CGJE 2SGPE 2SGFE 2BDGA 3PB1E 4FUGA 5C20A 2WPIS 4BTUB 1V2RT 1J16A 1V2WT 1H8IH 1Z8IB 1O3PB 1NN6A 1BRBE 4X1PU 1HAVB 2D2DA 1TMTH 3T25A 1H4WA 1L1GA 3ZZ5A 4AG1A 2ULLA 1SGEE 3UTUH 1ELBA 1TB6H 1RIWC 2FX6A 2O8UA 2WUCA 3MH5A 1BTYA 1E34B 5C1UA 3TK9A 1C4U2 1TX8A 3ZZ9A 3RXDA 1JRTA 4CR5A 2AS9A 1A61H 1KLTA 1GMDF 1WV7H 1FONA 2P3FH 3ZZAA 1SGFG 3GDUA 3K9XB 1GCTB 1A5GH 1P2OA 4ISLA 1RS0A 3A8DA 1YKTA 1GVZA 1MCTA 3AW0A 1ZR0A 3ODDA 1O2HA 2XW9A 1CU1A 3PLBA 1UTKA 2RCEA 3GY8A 1MKXH 1TX6A 1P9SA 2UWOA 2XWAA 2A7JA 4UDWH 1TGTA 2PFEA 1MBQA 3ZVEA 1UMAH 1ZPZA 3HKJB 2GX4A 1AWFH 1GI3A 2GZ7A 1AKSA 2VWLA 2YNBA 1C1RA 1EB2A 5TCAA 6CHAC 1CHOF 2R3YA 1SGNE 1GG6B 5E0JA 5EG4A 1NRNH 1YPKH 4NIYA 2CN0H 1XVOA 4IC5A 1F0TA 4FUBA 4NIXA 1PYTC 1O0DH 2ZDVH 3RXBA 2WPKS 5F03A 1LPKB 1BOQA 1HAYB 4I7YH 3KQEA 1DM4B 4ABDA 2BLWA 3LOXA 2F3CE 1DOJA 1D3QB 1P01A 1ZRKA 2JETB 4TPIZ 4YO9A 1BJVA 1GHAG 4B76A 4I8KA 1NC6A 4BAKB 4ZKOU 3PMHB 1B7XB 4QT8C 9LPRA 1EPTC 1P2IA 2BM2A 2FDAA 1OP2A 1E0FD 1FNIA 1FY3A 2R2WU 1LCYA 1OXGA 1F5RA 1OOKB 2B5TB 1C1TA 1Z7KA 1O35A 2ESTE 1TNLA 4DIIH 1P0SH 1TGSZ 2QN5T 3B23B 1CQQA 4BAOB 3TJVA 3P8FA 1HAOH 3HK6B 2OLGA 1OPHB 2HGTH 1MTNC 1U6QA 1BJUA 1OWIA 2XBWA 3KCGH 1WBGB 4NIWA 5C3NA 4LOYH 2ZF0H 2BHGA 3LDXH 5C1YA 3UWJH 1ZHMA 1BBRH 1CT2E 4OS6A 1O2UA 2ZHQH 8GCHG 4Y0YE 4XBBA 1AUJA 2TIOA 5EW1H 2JH0D 2C93B 2D26C 4H6TA 2GMTB 1MD8A 4WXIA 1ELFA 1TPPA 4XDEA 4BXSA 2BDHA 1P05A 1L1JA 1V3XA 9ESTA 1S81A 1ZGVA 1ZOMA 3LGWA 3F9GA 4J1YA 1TNJA 2NU1E 5C5NA 4D7FA 4CRBA 1C2KA 2BYAX 2FOGA 2BOHB 4B74A 3CP7A 4DT7B 1ELEE 1DVAH 3EA9A 1DITH 3RM0H 3RU4D 3U8TH 1NRPH 4SGBE 3OY5U 1Q3XA 5A2MH 1EZXC 1LHFH 1VJ9U 3M36A 5G4BA 2FOEA 3MU5A 1EP6A 2CXVA 3E91A 1QRZA 5T6DA 5GCHG 1J8AA 2R2MB 1MU8B 5DP9A 4CHAC 2R3UA 1EOLA 1GBKA 4Q7ZA 1GHVH 4CREA 3MO9A 3CENA 1P03A 3ODFA 2H9EH 1HIAB 1O5FH 3CS7A 1LDTT 1ID5H 1DY8A 1SPJA 1SLVB 3EQ0H 3RXRA 1MAXA 4JYVH 4K5ZA 3QO6A 1ZHRA 4AFQA 3Q00A 1PQ8A 4TYDA 2HPPH 2OP9A 2A4QA 3UOUA 1THPB 2CGAA 2Z9GA 1T4VH 3BTME 3I78A 1O31A 1A1RA 1AGJA 4AGKA 1LVBA 2NWNA 1AE5A 2FYRA 5DP6A 1ELCA 3F9HA 2SGEE 3RXPA 2PKSB 8ESTE 3SUEA 1ZMJA 1P8VC 1P06A 1BUIA 1GBMA 1E36B 2BZ6H 1OS8A 1T8LA 2OD3B 2BXUH 1AZ8A 4ABHA 4BXWA 3S9AA 1CGIE 1QIXB 3BN9A 3M3VA 1HAVA 1GBFA 3EDXB 3VB7A 2O9QA 2Q6FA 1EZQA 2PUQH 5EW2H 4HGCA 1MZDA 2PV9B 2CMYA 1PPCE 2HOBA 3RLYH 1LVMA 4LZ1H 1W7GH 2UUYA 1QJ6B 3GY6A 3NUMA 1ARCA 4YLQH 1CGHA 5JB8S 1SGIB 2BX4A 1HNEE 5AF9H 3D65E 1ZTKA 1BBRE 1OWDA 3RMNH 1K28D 1P12E 2PW8H 1XUJA 1P3CA 7KMEH 2B7DH 2UUFB 2P59A 1G3EA 2ZPRA 3BTEE 4ZUHA 1IQJA 1QQ4A 1YF4A 5E0GA 2QYIA 4GPGA 1IQNA 1VCWA 1MCVA 3A7YA 1H8DH 3MO3A 1Z1IA 2QXHA 1TNGA 4WJG2 2F9PA 3P70B 4ABAA 4AZ2B 2FEQH 1JIRA 1Z6JH 1SOZA 1HAHH 1C5RA 5EPYA 1XM1A 3GISB 4BAMB 4SGAE 3KIDU 4B2CA 4Y8ZA 4FXGH 4ISNA 1RJXB 2BY7X 2ODQA 2O8WA 4KELA 2ODPA 1TBZH 1C5NH 2J92A 2C3SA 4AFUA 5K0HA 4NZQA 1A5IA 2BB4A 1AVWA 3BEUA 1GMCG 1W0YH 7GCHG 1SFIA 3RXCA 1GHBF 1NFYA 2ZO3H 5DP5A 4E05H 2Q6GA 2FYQA 2TGDA 3O8DA 2D8WA 4MQAA 5GDSH 2QV1A 1GJDB 3RMOH 2PKSC 2XC5A 2RA0A 4GAWA 3OX7U 1LHDH 3U1IB 3B9FH 1AD8H 2QA9E 4D8NA 1O32A 4WF8A 1HYLA 3U1JB 1FIZA 1UTLM 2NU4E 2ODYB 4XBCA 5ESBA 4ZHLU 3MNCA 4UFDH 1KXDA 3SU3A 5EXLA 3P8NA 1KDQB 3QZRA 1F5KU 4X8TH 2ANMH 4IC6A 2XCNA 2V0BA 1NFUA
chains in the Genus database with same CATH superfamily
4ASHA 1C5QA 1AFQC 1ANEA 3T5FH 1K1JA 2QCYA 3GDSA 5LPEA 1MTUA 1YPHC 3E3TA 1KTSB 1C2IA 1JWTA 1V2MT 2FPZA 1UVTH 1O5DH 1PPEE 5IYTA 3BTFE 1BITA 3KYGA 3M35A 4JZIA 2H1UA 4D76A 1CBWB 1C1SA 1BZXE 2P93A 4Q7XA 4BTTB 3GCHB 3BTWE 4ASUD 1UVUH 2V6NA 1SR5C 3RM2H 3SORA 1ZLRA 3TH2H 4GHQA 2B8OH 2R0KA 1HRTH 1Y5UT 4AOQA 1VITH 3DA9B 3ZYEA 4UONA 3LGUA 1MAYA 1SKYE 3ZZ8A 4F55A 3UOPA 2FOAA 2J98A 3SJOA 1QB9A 2ZCHP 1NT1A 1TALA 4X6MA 4U2WA 1O3EA 4E06H 1O2XA 2M5TA 3VPKA 3TLOA 1A0JA 2VB0A 2ZTXA 4K69A 2J9NA 1ACBE 1DSTA 1G36A 1Y8TA 3SGAE 1OWKA 1IAUA 1RTLA 4MNWA 3HPTB 2YOLA 1ZSJA 3RMMH 3E6PH 3QGNB 1C1PA 2JIZD 4CBNA 4JMYA 4Y8YA 5FHTA 3A84A 1D3TB 1Y3UA 2W5EA 4CRDA 2QAAA 1BTPA 2P3TB 1AWHB 2EEKA 2J38A 1HXEH 1NFXA 4MG3A 3NKKA 5JBTA 1XUFA 3LGIA 1TAWA 4IGDA 3RXKA 4THNH 1C5VA 2OQ5A 2A2QH 1QL7A 5C0UA 1HIAA 1O2LA 4NWKA 1GDNA 2HRVA 3UAIC 3C27B 3ZZ4A 3SU1A 3VB6A 4CBOA 4XRNA 1O30A 1MABB 4MNVA 1GBAA 3A7VA 2F43B 3RXUA 3M7UA 4BANB 1A4WH 5FX5A 4ABJA 2A2XH 1QGFA 3BTKE 2FS9A 2OUAA 1LHCH 1O3OA 2BLVA 3OEHD 1GBLA 4HI3A 4IN1A 3V0XA 3EYDA 5EQQA 3ZZCA 1SC8U 2GV7A 1TPOA 4JK5A 2XBVA 3Q3XA 8KME2 3W95A 1O2ZA 2FESH 1ZSLA 3BG4C 3GDVA 1TWXB 1BIOA 2VWNA 5FPTA 1H8ED 2OXSA 1QQUA 1IQFA 1AN1E 4ZCNA 1MUEB 1T8MA 3WWBA 2AYWA 2ZHWH 1V2PT 1S5SA 1HLTH 1QHRB 2FMJA 2J95A 4NA8A 4Y8XA 2PWXA 5FL7D 3LPRA 1QA7A 2G4TA 4HTCH 1H1BA 4INLA 2BVXH 1A7SA 3BG8A 5F53A 3DHKH 1JMOH 1VR1H 1XUIA 2G52A 5A0CA 1E35B 2ZTYA 1HAIH 3SHCH 3SUGA 3KYFA 1TNHA 3SNDA 3A87A 1KSNA 1C1OA 1E37B 3KQDA 3U8OH 1DLKB 4OS7A 1SGDE 4ISIH 1FN6A 1KY9A 4Q7YA 4NIVA 2ZG0H 4NA9H 3RC5A 1PYTD 5J4QA 1NM6A 2P94A 2ANYA 1EXFA 4TY6A 1V2ST 1ZMNA 1C5YB 1G2LA 1HJ9A 2BQ6B 3UIRA 1J14A 1JIMA 2BD8A 2OC0A 1THRH 1TQ0B 1OYTH 1NS3A 1QTFA 1FAXA 1MTWA 3MYWA 2LP6A 2XYAA 3RUOA 4WVPE 1NZQH 1N8OC 2JH5D 1O34A 2P8OC 5JB9S 1FPHH 3OU0A 1AE8H 3RXSA 3GCTG 4VGCC 1G3CA 1UHBA 2HLCA 2VGCB 1O5AB 1XXDA 1RXPA 6LPRA 2VWMA 3MH6A 2QE7D 3RXIA 2AGIX 1SGYE 1VGCB 2A5KA 3OYPA 1W0KD 3SI3H 3VGCB 1O3BA 4Y10E 3UPEA 1AB9B 1QY6A 1YCPK 1ELVA 5HXFA 1V6DA 2LELA 2BOKA 3M5NA 1AHTH 5DSFA 1EX3A 1KDQA 2CHAC 3SI4H 3LONA 4GVUA 2NU2E 2G5VA 1QURH 4B6FA 1MQ6A 1T4UH 2OC7A 4AB9A 3EGKH 4UFEH 1AMHA 1O2QA 3P8GA 1FLEE 2Y7XA 3H5CB 1ETSH 4Y6DA 4Q80A 1P10A 2SFAA 1EASA 4YZUA 2GGVB 3PO1B 4WWYA 3TNSA 1C1VH 2Y82A 3H09A 1UTOA 4HZHA 1GGDC 5CMXH 1BRUP 4ZHAA 1QJ1B 5DGJA 4IW4E 3A8AA 1IQEA 3N7OA 5FBEA 1HCGA 1H9IE 2HNTE 2Z9KA 3ZVAA 1CHGA 3SQHE 2ZFQH 3SO3A 3DFJA 1P2NA 3RP2A 2QXJA 1EAWA 3RXGA 1S6LA 2STAE 1UK3A 1P2JA 1TA6A 2KCAA 1F0UA 3FOAA 7ESTE 3PRBA 1IQHA 3MU4A 4I8GA 1TIOA 3EE7A 3RDZA 2P16A 4B75A 1N6YA 2XXLA 2CF8H 3ATKA 3PRDA 4ISOA 4OS4A 1O3HA 2JH6D 2ZCLP 4MDSA 1UVOA 1A3EH 1SL3A 1T8OA 3ATMA 2W7UA 2VBCA 1ELGA 3QGJA 5ESTE 4X1RU 3VG8A 1ZYOA 5C94A 1L4DA 3NZIA 3VB5A 1OHHD 1GJBB 1VITG 2A0QB 4TWWA 1WTGH 2AMQA 2F9UA 1BHXF 2GZ8A 1O38A 2WPDD 3P95A 1GJ7B 3O8CA 1XX9A 1M9UA 2ZU5A 4HFPB 4B71A 1F0RA 2O8LA 3VB4A 1NFWA 2GCTC 5EQRA 1OYQA 1HFDA 3PLKA 2A7CA 1LO6A 2ZKSA 1FI8A 4IMQA 4O9VA 1L4ZA 3VEQB 4NGAH 1HAXB 2A4OA 3PMBB 1V2JT 3PMAB 3UR9A 2VIOA 1CA0B 3SJ8A 3GY4A 3M3SA 1GBEA 4BNRA 1NRQH 1O2NA 4IBLH 5E0HA 4IN2A 1C9TA 3BIVH 5GXPA 1YPGH 2KX4A 5HM2A 4I86A 1C5LH 1K1IA 3F0OA 1K9OE 1O3KA 6GCHF 2VVUA 1DANH 2GDDA 4FUFA 2JJ1D 4ZKRU 4I31A 3KHVA 2WZQA 2PUXB 1KLIH 3LU9B 3STJA 4GUXA 1INCA 4AFZA 1CE5A 4M9FA 4OS1A 3V13A 1Y59T 1DDJA 2VIPA 1FY5A 4R0IA 2GT7A 1WQSA 3GY2A 1TBQH 1EJMA 1HBTH 1HJAB 2Q6DA 4O03A 3MOCA 3GOVB 3M7TA 3LH3A 1Q31A 2A32A 1P2KA 2ZFSA 5ETXA 1IQMA 1CO7E 2VVCA 3MU0A 3N7DA 3QLPH 1E38B 1QR3E 1SGCA 1EQ9A 1O2YA 2BVRH 4YM9A 1GVKB 3PV4A 1A0HB 4X1NU 1GHWH 3TH3H 1BDAA 1QNJA 3UNRA 1DSUA 1W0JD 1X7AC 3F0PA 1GCTC 3LC5A 1WDIA 3MNSA 3RMLH 1P09A 1HPGA 3HGNA 1RTKA 5DK1A 2ZI2H 2Y81A 2ANKH 4Z0KA 3F2HA 2IPQX 4LXBH 5FPSA 3AK5A 3T27A 1P02A 2ZC9H 4WH8A 1FY1A 4MPVA 1YLDA 4AGJA 2STBE 1P3EA 4U30A 5J4SA 4K1TA 1SOTA 1KIGH 2W7SA 2GV6A 5DP4A 3F9EA 3GCOA 3A82A 1O3GA 3QWCH 4MNYA 1H9LB 1GG6C 2A1DB 4D9RA 3TJUA 1GJCB 1V2LT 1W13U 2WYGA 5FPYA 1VJAU 4UFGH 1TRNA 2A45B 5EJLA 3TITA 4JZEH 1SGFA 1GMHF 1G3BA 3FP7E 1WYKA 4DURA 4FOUC 1DPOA 4I8JA 1JRSA 1TGBA 3SUDA 3AVZA 2Z6BD 4MLFB 2ZGXH 2UUKB 2XBYA 2AGGX 2FTMA 5L30H 4WMEA 2JETC 4D7GA 2HWLB 2K1QA 5EOKA 4K8YA 2FM2A 3UNSA 4XFQA 4KTCA 5DJ7A 3BSQA 1DWCH 1FZZA 3PM3A 1T7CA 3LIWA 1QJ7B 2D1JA 3AAVA 3LJOA 3BTDE 2EC9H 4OS5A 2FOFA 1HDTH 3T28A 1QZ8A 1VCQA 3RU4E 1OSSA 1N6XA 2WUBA 1GBBA 3DUXH 4Y79A 1KXEA 5TJXA 1IQGA 3N7EA 2WSSD 3MMGA 1TX7A 1O2SA 2AHME 2J34A 3K2UA 1E79D 1QB1A 2DUCA 5FCKA 1HXFH 1GI0A 4FUEA 3BF6H 2XC4A 5HGGA 1F2SE 1CT4E 1OP0A 1DWDH 1ZPCA 2OC8A 1PFXC 2Y5FA 3ZVDA 4GCHF 1G32B 1IHSH 1PPFE 1XKAC 2F9VA 1ABIH 3U8RH 1O3NA 3RXEA 1GBCA 2GMTC 3T62A 1KXAA 2ZGCA 1GJ9B 3SGBE 4RKOB 1HUTH 3F3BA 4F4OC 1TMBH 5PTPA 5GJ4B 2FX4A 1ZSKA 2ZA5A 4FUDA 1O2KA 3BIUH 1FN8A 1FY4A 2FIRH 1UTPA 2FS8A 2G5NA 3PLPA 2EY4C 4JZDH 2RDLA 3LC3A 3ZVCA 2ZWLH 3BTHE 3ZVGA 1AUTC 1MKWK 3D23A 1SB1H 2CK3D 1C2JA 5EGMA 3FAOA 5DG6A 5GPIB 1MU6B 1P11E 1DY9A 2FLRH 1J17T 1LPGB 4DGJA 1E1RD 1Y3XA 1UTJA 1UTNA 4KTSA 3MFJA 3TU7H 2FOCA 2GCHG 3UQOA 1AI8H 4ZROA 2CF9H 1NO9H 2AFQB 3SU5A 1XUKA 3U9AH 1JXPA 1HAZB 1YCPH 3CNRA 4YESB 4TY7A 1B0FA 5DP3A 1F7ZA 1GWAA 3I77A 1YWUA 5AHGH 1QRXA 5FX6A 3OSYA 3A81A 1W3CA 4JYTA 3AW1A 1YYY1 1O3JA 2V3MA 5HM9A 3SNAA 2B9LA 4MPUA 1KXBA 1DFPA 3KEEA 1FPCH 4I8LA 2UUJB 3QZQA 2ZDAH 1GHYH 2WPLS 4X1QU 4X2YA 2ZFTA 1AU8A 3IG6B 3DSGA 4XOJA 3MU8A 2PTCE 1Z8JB 3S9BA 5A8YA 2SGDE 2EI8A 3PWBA 3S9CA 5C67A 1UVPA 3BV9B 3TH4H 4K8BA 3O8RA 2PGQB 3RXHA 2QXIA 5F8TA 2ASUB 1GHAF 2TRMA 2FZZA 1NBMD 4B1TA 4MTBA 3V3MA 1Z71A 3FZZA 3ZZ7A 3DSPA 3TPIZ 3HATH 2BY8X 3SZEA 1O2PA 1V2OT 2YMSB 5IDKA 2Z7FE 4ZXYH 1Z8RA 3GY7A 3KQ5A 4DG4A 2BLOA 1PPGE 3NK8A 1WXRA 3BEIB 4RSPA 1EB1H 2HVXA 4ZKSU 1ZHPA 2F4LA 3R3GB 1F92A 4ABGA 1C2EA 1BRCE 2V35A 1O33A 1H8HD 1UK2A 3ESTA 1QFKH 1VCPA 5AFZH 1LQDB 2AGEX 4RN6A 5KEDA 4A7IB 5K7RA 4ZMAH 3FZDA 2ZU3A 1FJSA 1HGTH 1GMDG 4F49A 1GJ5H 4OGYA 3RXMA 4A5TS 2HNTF 5EXNA 2TBSA 1BA8B 2YNAA 3JZ1B 3KGPA 4O97A 3RC4A 4XD7D 1BMLA 1TRYA 4YOGA 1C5PA 3SJIA 4FUIA 2VH0A 3RXTA 4AYYB 5C1XA 5EXMA 2G4UA 1V2QT 3A7TA 3S7HB 1DXWA 2XNDD 1G9IE 1AVXA 1AQ7A 1TNIA 4X0WU 4I33A 1NESE 4CH2B 2TGPZ 1ZZZA 1C1MA 1T31A 1BMMH 5HKKD 3MQKC 5DP8A 1SSXA 1D3DB 3NXPA 3MH4A 2PR3A 3UY9A 5ABWA 1K2I1 3FFGA 4AG2A 1SQAA 3FP6E 4I8HA 3UB0A 2PSYA 3GY5A 3NCLA 1CHOG 2C8ZB 1Y5AT 2WV4A 5A0AE 3L33A 3RXVA 3SBKA 2OQUA 5GCHF 5CHAB 2BXTH 1IQKA 1CVWH 1ORFA 2ZGJA 4UE7H 3M37A 3RLWH 2ZTZA 3T2NA 1YY3A 2EI7A 1ZJKA 4KP0A 5L2YH 1W0ZU 4GLYA 4DIHH 2K8IA 2THFB 4TT3D 1AZZA 1C2DA 2QF0A 3U98H 4NG9H 2YMSC 1EP5A 2WV9A 4BAQB 4UFFH 1CBWC 3UQVA 3M5OA 4J2YB 2UWLA 3TK6A 4M7GA 3GCHC 1IOEA 2LNCA 1W10U 4X6NA 1BMAA 2Z94A 4O3TA 1FDPA 1BCUH 4MVNA 3Q77A 2HALA 3SGQE 3RC6A 5JBAS 4AC9A 1EUFA 1G2MA 1UW7A 1CSOE 5HIZA 3GYLB 2BVSH 2VIDA 1MZAA 1GI9B 3U69H 4FUJA 2A4GA 3MNBA 2OINA 2JJ2D 1EOJA 1D3PB 4NSVA 4FU9A 3SYJA 4R8TB 2Z3CA 3LGTA 1S84A 4NWLA 2ZQ1A 5GIBA 1ELDE 1TLDA 5FBIA 2BLQA 1J15A 2QF3A 4K1EA 2F9OA 1ANBA 1TA2A 3PV2A 3RXOA 3GCNA 3DFLA 2G8TA 4TWYA 5DPAA 2A31A 4E7NA 3DCLA 1T8NA 4ABFA 1AIXH 3TVJB 1K1OA 1OX1A 2J4IA 3LKWA 1S0QA 4NSYA 3N99A 2V3HH 3ATLA 4JYUH 2O8TA 2ALPA 3MWIU 1TNKA 3QTVH 1RIWB 3QX5H 1O2VA 1WAYB 4NFFA 1GI1A 2H5CA 2ZDNA 1XMNB 2P3UB 3L6PA 1IHTH 1K22H 1C2HA 1E1QD 3SV7A 2H5DA 1YM0A 3F6UH 1YGCH 3AASA 1SLWB 3TJOA 2ZDLA 2G55A 4I32A 1C1WH 1GMCF 7GCHF 2ZDMA 1LQEA 1IQIA 3JZ2B 4WY3A 3DT0H 3A83A 3Q3YA 3M5LA 1CA8B 2GDEH 2H9HA 2J94A 1C5SA 4B73A 4MPWA 3E1XB 4X2VA 3BTQE 2FODA 3P6ZB 4F48B 3K65B 3UWIA 2AERH 1P9UA 2QXGA 2ZQ2A 1C9PA 3RXFA 6CHAB 1W8BH 5EU8A 3ZV8A 1V2TT 5C2ZA 1LMWB 2BQWB 1AFEH 2F9BH 2VIVA 1HAPH 4GCHG 2RFKC 1KLJH 1RGQA 2BDIA 3P8OA 2ANWA 4ZKNU 1MKWH 3A80A 1W2KH 2FO9A 3DSOA 2ALVA 1UVSH 4KGAA 2A5AA 2WPHS 3G01A 3ZZ6A 3T26A 4PROA 4JK6A 1DXPA 3A8CA 1Q2WA 1V2NT 3FP8E 1KXCA 4A92A 1G30B 1QBVH 2AIQA 4INKA 3SJ9A 3V7TA 1ZMLA 2HLDD 3OE7D 3ZIAD 1ANDA 1EPTB 1O3MA 1ABJH 3QUMP 3UNQA 2GJGA 2PKAB 3C1KA 5EQSA 4ZHMU 3QN7A 5JBBS 3TJNA 4DVAU 1S85A 1C2FA 3RXQA 3GYMA 4E7RG 1ZPBA 3MNXA 2FXRA 3IITA 2BDAA 2H6MA 1EJNA 1YPJH 2SGQE 3A88A 2VGCC 5T6FA 4OGXA 1WOFA 4ZXXH 1D4PB 6ESTA 3PYHA 1VGCC 1MTNB 4NFEA 1FQ3A 1SGQE 3VGCC 3GICB 4NA7A 1EZSC 1ETRH 1AB9C 1Y5BT 1TPSA 2Z3DA 3ELAH 1K1PA 2ZGBH 1DICA 1KYNA 5T1VA 3RU4T 1G3DA 2C8XB 3E0NB 1O2MA 1LHEH 1XXFA 3BEFB 3ENSB 4ABEA 3GY3A 1QL8A 3KN2A 1HV7A 3MI4A 1WTHD 3SZNA 4OS2A 1GHBG 1O2TA 2VIWA 3PO1C 3TNTA 4YTAA 2Z9LA 4ZAEA 1LPZB 5B6OA 1XKBC 3QK1A 1SBWA 4WXVA 1ZGIA 3URDA 2EQNA 5A09A 4A6LA 3A85A 2NU0E 4RKJB 5EJZA 1A46H 1UCYK 1L2EA 3SNEA 2Y5GA 3QDZB 2K0QA 3SW2B 4INHA 2QGRA 5GWZA 4GHTA 5JDUB 2GKVE 4CR9A 1SHHB 2BDCA 2TPIZ 1S82A 1GL1A 1YCPM 2A5IA 1AVGH 5DKMA 2IPHA 1WUNH 3STIA 1V2KT 4CHAB 5LPRA 1LKAA 4K2YA 4D9QA 5A0BA 1A2CH 1YP9A 3SU2A 2Q1JA 1O3CA 2LPRA 2ZCKP 1GHZA 1TMUH 5JBCS 1OWJA 2A4RA 4NZLA 1ESAA 2TGAA 1HAGE 4AYVB 4DT4A 4X8VH 3EA8A 1GI4A 5E2PA 4AN7A 4H4FA 1T32A 2UWPA 2W3KA 1EATA 4BTIB 1DUAA 1FX0B 2V3OH 1NY22 1WSSH 2HNTC 2ZFRH 5H4IB 2GTBA 2VVVA 1K0HA 2EI6A 2AH4X 2C4FH 3E0PB 1JOUB 4X8UH 5C5OA 5DO4H 3SN8A 2BD7A 4P02A 4LZ4B 1NPMA 1PPHE 4Q63A 2ZU1A 3SU0A 1SVPA 2AEIH 2PGBB 3UREA 1MTVA 3SUFA 1CA0C 4U01A 1ELAA 1S83A 2KAIB 3M3TA 3VB3A 1GI5A 1TABE 3E8LA 1C1QA 3NWUA 4LK4A 2SNVA 1A5HA 2BQ7B 3MO6A 2WYJA 3ITIA 1BQYA 2PP6A 3W94A 4Z6AH 2PLXA 1O2JA 1SLXB 2OC1A 3H7TA 2WPMS 4XSKU 1W11U 2HPQH 1WQVH 1KTTB 2GP9B 4YOIA 2B0FA 3GCTF 1D6WA 1SHYA 3A7XA 4CH8B 2BX3A 4TSFD 2GZ9A 1NRSH 1V2VT 1FMGA 3SNCA 4Y0ZE 5T6GA 4FU8A 1HB0B 4WH6A 2G00A 4JZFH 1HJAC 4U32A 1XUHA 3LT3A 1SG8B 1WU1A 3A7ZA 4ABBA 1Y3YA 4X8SH 1EAIA 3KF2A 2H2ZA 2BMGB 5E8EH 1RFNA 1C5ZB 2RA3A 2W26A 3S0NA 3WWFA 3ZYDA 3WW7A 1MQ5A 1GI2A 2VJ1A 2TGTA 2ZHFH 4ISHH 4B2AA 3OFND 2ZIQH 4Y11E 1YPHE 1Y3WA 4DCDA 3PWCA 2PHBA 3HK3B 1QA0A 2XTTB 1C5UA 1TBRH 1O2IA 5FXLA 3A86A 5JYIA 1O5BB 1DUEA 1BMNH 4WMDA 1GL0E 4XBDA 3SNBA 4FVBA 5BRRE 1NU9A 3MHWU 4FU7A 4UEHH 2BDYA 4RT0A 3PTNA 1S0RA 1TRMA 1OKXA 4Y7AA 3S69A 2XC0A 2Z9IA 1K1MA 2GVFA 3SU6A 2OK5A 1C5MD 3RXJA 3VXFH 4CRAA 1DS2E 1MD7A 3FKSD 1SMFE 1FXYA 1EPTA 2P95A 1YPMH 5CE1A 2W3IA 4DOQA 2PKAA 2ZDKA 4XE4A 3RXAA 5CDFE 2PTNA 3OTPA 3F1SB 2XNIA 1AFQB 5I46H 2ZGHA 1BTZA 1IQLA 1C2LA 1GVLA 1SGPE 3SV8A 2VNTA 1PQAA 1MBMA 2L6OA 1GDQA 1C4Y2 3KL6A 1C2GA 1UO6A 1W7XH 2J2UA 2WHXA 4K3JA 2C90B 3ATWA 2ZECA 1DLEA 1EZUC 4B2BA 1NTPA 3RXLA 3HKIB 1C1UH 1GJ6A 1QRWA 2WV5A 1C5XB 2VIQA 1C4V2 3MH7A 4FUHA 2YMSD 2OBOA 1VITF 1FAKH 3D62A 1BT7A 1MH0A 1B0EA 1NU7B 1O3DA 1THSH 1FIWA 2ZU4A 2VH6A 2RG3A 1P2MA 5T3HA 3UFAA 4AB8A 2BY6X 3EAJA 4X1SU 2QF4A 3SQEE 3M5MA 3ATIA 5F8ZA 3M7QA 1ZTJA 2FI4E 3KNXA 1O2WA 2GT8A 3TGJE 4AFSA 3O8BA 2R9PA 1K21H 2R0LA 3P17H 4AORA 2FWWA 1BHXB 2F9NA 1O2OA 1O2RA 1LVOA 2BY5X 1ARBA 1PJPA 1UHBB 2BY9X 2KCYA 2BD4A 1MKXK 1NROH 2Z3EA 3MTYA 1GDUA 1D6RA 1UTMA 4CRCA 1BTUA 2XBXA 5JPMH 2BDBA 3B8JA 1O3FA 1XUGA 2J97A 5A8XA 2Y80A 1UTQA 3IWMA 5HMAA 3UR6A 5EIYA 2Z9JA 1SGTA 4X6PA 1UK4A 3Q76A 8LPRA 2ILNA 1B5GH 1EAXA 3EE0B 4DY7B 1ANCA 1JBUH 1FV9A 1SQOA 4O3UA 1EKBB 1OWHA 1YLNA 1DWBH 1TQ7B 1O5CB 1BTWA 2C8WB 2FOHA 5DN6D 3ZZ3A 2IN2A 3SHAH 3SU4A 2BZAA 4OM9A 1TE0A 5HYOA 2I6SA 2DE8A 2WPJS 2KR7A 1ESTA 1O37A 3P92A 1VZQH 3I29A 2FI5E 3BTGE 1O2GH 2F91A 5A8ZA 1NBME 2CV3A 3OTJE 3BG4B 2J5UA 1G37A 1YBWA 4KTUA 5FAHA 8GCHF 2ZEBA 3E16B 2ZHDA 1EAUA 2AMPA 3TGIE 2WINI 2ZP0H 4A1VA 2VWOA 1PPZA 2FOMB 1EFRD 1TGNA 3SOSA 4FVDA 1OP8A 1A3BH 4IS5A 3S7KB 4YLUA 2KAIA 2FP7B 1KXFA 1YPLH 1DX5M 1MMJN 5F6MA 3NPSA 2ZPQA 4Y7BA 2ZFPH 3V12A 1GJ8B 2ZZUH 3HGPA 5AVDA 1BB0B 5F8XA 3PROA 2FOBA 1GI6A 5LGOA 3FVFB 1BBRK 1QCPA 4JCNA 1DE7H 3TGKE 1J9CH 2BD3A 5EODA 2Y6TA 1P2QA 2BD9A 2BTCE 1HJ8A 1UCYH 1UJ1A 1W14U 1K1NA 1GBDA 2OCVB 2QY0B 3F68H 1O5EH 2HVYB 1ZRBA 3BTTE 2Y7ZA 1AY6H 1ZJDA 4X2WA 1COWD 2IOTA 2KZ4A 2A7HA 1GHXH 3PTBA 1EJAA 1AKSB 3A7WA 1C1NA 4GSOA 5LH8A 3URCA 2AIPA 1W12U 3FANA 3SJKA 1TOMH 1XVMA 6GCHG 2XOKD 3KQBA 2GD4B 1Y3VA 1N8OB 2P8OB 4Y76A 2W6JD 2XWBI 3SV2H 4A1XA 1QB6A 3MU1A 4VGCB 3A8BA 4DJZB 5BPEA 1K1LA 1RD3B 2DE9A 5LPFA 1PPBH 1C5TA 4H6SB 1TOCB 1RTFB 1O3IA 3ZZDA 4B6EA 3DD2H 2I6QA 1DWEH 3W1EA 3TK5A 4ESTE 1GBJA 2NU3E 3GS9A 5EJ1A 3E90B 3M61U 4UD9H 2JKHA 4YT7H 1QBNA 2VU8E 1AO5A 2AMDA 2C8YB 1ETTH 1GBTA 4DW2U 4AX9H 1O3AA 1RRKA 1YLCA 2CHAB 2FTLE 2ZU2A 1GBIA 4ZH8A 5GNDA 3F2GA 4MPXA 4ABIA 4WMFA 1LVYA 2L74A 1MTSA 1C5OH 5EPNA 1SQTA 1TGCA 3LGYA 3UUZA 1SLUB 1O39A 1GI8B 3SV6A 5L6NH 1L1NA 1GGDB 1ZTLA 2VINA 2BD2A 2F83A 3VFEA 7LPRA 1OWEA 1L0ZA 1O5GH 4K1SA 2BD5A 4FETA 2XRCA 3SV9A 1O36A 1SGRE 1GI7B 2FLBH 3K6YA 4H42U 3F2FA 2ZPSA 4X6OA 2SGAA 2XCFA 3H7OA 2SNWA 1S6FA 4A1TA 1QBOA 3EA7A 4Q2KA 2FI3E 1CT0E 2GCHF 1FUJA 1GMHG 1F5LA 2ZNKH 1A0LA 2Y5HA 3L3TA 3R0FA 5CHAC 1S6HA 4KKDA 1D9IA 3ZZBA 3D49H 5FCRA 1ESBA 1P57B 5SGAE 1Z6EA 3VXEH 1TYNA 1P04A 3ZVFA 2G81E 1YC0A 1LHGH 3T29A 3CS0A 1SFQB 4YT6H 2OTVA 1UCYE 3TIUA 4K60A 3Q3KA 1LKBA 5TCCA 4BOHA 4X2XA 1BRAA 5AFYH 4IMZA 1F0SA 2ZFFH 3A89A 2QIQA 3LGVA 4JZ1A 4CRGA 1Z1JA 2JDID 3LH1A 1O3LA 3QTOH 2RDEA 3NRLA 3F9FA 1QL9A 2O8MA 5L2ZH 1BTXA 4NCYA 4TPYA 2GCTB 1PQ7A 3OY6U 4FUCA 1PQ5A 2OBQA 1GJAB 1GJ4H 2PSXA 1GBHA 3ZV9A 2QC2A 1YPEH 2H9TH 3K6ZA 1NRRH 4CRFA 1C2MA 1FY8E 2EA3A 3PMJA 1H9HE 2G51A 1GPZA 5DP7A 1Z8GA 1SI5H 5I25A 3ZVBA 2CJIA 1LTOA 4MNXA 1DT2A 3WY8A 1BTHH 2W6ID 3AAUA 1ELTA 1TFXA 5B6LA 1TPAE 2IJOB 4BAHB 4Y71A 1GCDA 1TONA 5E2OA 1WCZA 4YOJA 1C5WB 3KQCA 1N1LA 1V2UT 5CHBA 3LJJA 3OAAD 2KCPA 1CGJE 2SGPE 2SGFE 2BDGA 2ZHEH 3PB1E 4FUGA 5C20A 4ACBA 2WPIS 4BTUB 1V2RT 1J16A 1V2WT 1H8IH 1Z8IB 1O3PB 1NN6A 1BRBE 4X1PU 1HAVB 2D2DA 1TMTH 3T25A 1H4WA 1L1GA 2V7QD 3ZZ5A 4AG1A 2ULLA 3FN8A 1SGEE 3UTUH 1ELBA 1TB6H 1RIWC 2FX6A 2O8UA 2WUCA 3MH5A 1BTYA 1E34B 5C1UA 3TK9A 1C4U2 1TX8A 3ZZ9A 3RXDA 1JRTA 4CR5A 2AS9A 1A61H 1KLTA 1GMDF 1WV7H 1FONA 2P3FH 3PV5A 3ZZAA 1SGFG 3GDUA 3K9XB 1GCTB 1A5GH 1P2OA 4ISLA 1RS0A 3A8DA 1YKTA 1GVZA 1MCTA 3AW0A 1ZR0A 2QF5A 3ODDA 1VKYA 1O2HA 2XW9A 1CU1A 3PLBA 1UTKA 2RCEA 3GY8A 1MKXH 1TX6A 1P9SA 2UWOA 5KECA 2XWAA 2KM0A 2A7JA 4UDWH 1TGTA 2PFEA 1MBQA 3ZVEA 1UMAH 1ZPZA 3HKJB 2GX4A 5IK2D 1AWFH 1GI3A 2GZ7A 1AKSA 2VWLA 2YNBA 1C1RA 1EB2A 5TCAA 6CHAC 1CHOF 2R3YA 1SGNE 1GG6B 5E0JA 5EG4A 1NRNH 1YPKH 4NIYA 2CN0H 1XVOA 4IC5A 1F0TA 4FUBA 4NIXA 1PYTC 1O0DH 2ZDVH 3RXBA 2WPKS 5F03A 1LPKB 1BOQA 1HAYB 1SQRA 4I7YH 3KQEA 1DM4B 4ABDA 2BLWA 3LOXA 2F3CE 1DOJA 1D3QB 1P01A 1ZRKA 2JETB 4TPIZ 4YO9A 2M2AA 1BJVA 1GHAG 4B76A 4I8KA 1NC6A 4BAKB 4ZKOU 3PMHB 1B7XB 4QT8C 9LPRA 1EPTC 1P2IA 2BM2A 2FDAA 1OP2A 1E0FD 1FNIA 1FY3A 2R2WU 1LCYA 1OXGA 1F5RA 1OOKB 2B5TB 1C1TA 1Z7KA 1O35A 2ESTE 1TNLA 4DIIH 1P0SH 1TGSZ 2QN5T 3B23B 1CQQA 4BAOB 3TJVA 3P8FA 1HAOH 3HK6B 2OLGA 1OPHB 2HGTH 1MTNC 1U6QA 1BJUA 1KMHB 1OWIA 2XBWA 1WBGB 3KCGH 4NIWA 5C3NA 4LOYH 2ZF0H 2BHGA 3LDXH 5C1YA 3UWJH 1ZHMA 1BBRH 1CT2E 4OS6A 1O2UA 2ZHQH 8GCHG 4Y0YE 4XBBA 1AUJA 2TIOA 5EW1H 2JH0D 2C93B 2D26C 4H6TA 2GMTB 1MD8A 4WXIA 1ELFA 1TPPA 4XDEA 4HG6A 4BXSA 2BDHA 1P05A 1L1JA 1V3XA 2J98B 9ESTA 1S81A 2IJD1 1ZGVA 1ZOMA 3LGWA 3F9GA 4J1YA 1TNJA 2NU1E 5C5NA 4D7FA 4CRBA 1C2KA 2BYAX 2FOGA 2BOHB 4B74A 3CP7A 4DT7B 1ELEE 1DVAH 3OEED 3EA9A 1DITH 3RM0H 3RU4D 3U8TH 1NRPH 4SGBE 3OY5U 5C0TA 1Q3XA 4ACAA 5A2MH 1EZXC 1LHFH 1VJ9U 3M36A 5G4BA 2FOEA 3MU5A 1EP6A 2CXVA 3E91A 1QRZA 5T6DA 5GCHG 1J8AA 2R2MB 1MU8B 5DP9A 4CHAC 2R3UA 1EOLA 1GBKA 4Q7ZA 1GHVH 4CREA 3MO9A 3CENA 1P03A 3ODFA 2H9EH 1HIAB 4P00A 1O5FH 5KGOA 3CS7A 1LDTT 1ID5H 1DY8A 1SPJA 1SLVB 3EQ0H 3RXRA 1MAXA 4JYVH 4K5ZA 3QO6A 1ZHRA 4AFQA 3Q00A 1PQ8A 4TYDA 2HPPH 2OP9A 2A4QA 3UOUA 1THPB 2CGAA 2Z9GA 1T4VH 3BTME 3I78A 1O31A 1A1RA 1AGJA 4AGKA 1LVBA 2NWNA 4RT1A 1AE5A 2FYRA 5DP6A 1ELCA 3F9HA 2SGEE 3RXPA 2PKSB 8ESTE 3SUEA 1ZMJA 1P8VC 1P06A 1BUIA 1GBMA 1E36B 2BZ6H 1OS8A 1T8LA 4RI0A 2OD3B 2BXUH 1AZ8A 4ABHA 2KCOA 4Q4LA 4BXWA 3S9AA 1CGIE 1QIXB 3BN9A 3M3VA 1HAVA 1GBFA 3EDXB 3VB7A 2O9QA 2Q6FA 1EZQA 2PUQH 5EW2H 4HGCA 1MZDA 2PV9B 2CMYA 1PPCE 2HOBA 3RLYH 1LVMA 5C17A 4LZ1H 1W7GH 2UUYA 1QJ6B 3GY6A 3NUMA 1ARCA 4YLQH 1CGHA 5JB8S 1SGIB 2BX4A 1HNEE 5AF9H 3D65E 1ZTKA 1BBRE 1OWDA 3RMNH 1K28D 1P12E 2PW8H 1XUJA 1P3CA 7KMEH 2B7DH 2UUFB 2P59A 1G3EA 2ZPRA 3BTEE 4ZUHA 1IQJA 1QQ4A 1YF4A 5E0GA 2QYIA 4GPGA 1IQNA 1VCWA 1MCVA 3A7YA 1H8DH 3MO3A 1Z1IA 2QXHA 1TNGA 4WJG2 3FO8D 2F9PA 3P70B 4ABAA 4AZ2B 3U28C 2FEQH 1JIRA 1Z6JH 1SOZA 1HAHH 1C5RA 5EPYA 1XM1A 3GISB 4BAMB 4SGAE 3KIDU 4B2CA 4Y8ZA 4FXGH 4ISNA 1RJXB 2BY7X 4Z1MD 2ODQA 2O8WA 4KELA 1TBZH 2ODPA 1C5NH 2J92A 1BMFD 2C3SA 4AFUA 5K0HA 4NZQA 1A5IA 2BB4A 1AVWA 3BEUA 1GMCG 1W0YH 7GCHG 1SFIA 3RXCA 1GHBF 1NFYA 2ZO3H 5DP5A 4E05H 2Q6GA 2FYQA 2KFWA 2TGDA 3O8DA 2D8WA 4MQAA 5GDSH 4YXWD 2QV1A 1GJDB 3RMOH 2PKSC 2XC5A 2RA0A 4GAWA 3OX7U 5HIYA 1LHDH 3U1IB 3B9FH 1AD8H 2QA9E 4D8NA 1O32A 4WF8A 1HYLA 3U1JB 1FIZA 1UTLM 2NU4E 2ODYB 4XBCA 5ESBA 4ZHLU 3MNCA 4UFDH 1KXDA 3SU3A 5EXLA 3P8NA 1KDQB 3QZRA 1F5KU 4X8TH 2ANMH 4IC6A 2XCNA 2V0BA 1NFUA
chains in the Genus database with same CATH topology
4ASHA 1C5QA 1AFQC 1ANEA 3T5FH 1K1JA 2QCYA 3GDSA 5LPEA 1MTUA 1YPHC 3E3TA 1KTSB 1C2IA 1JWTA 1V2MT 2FPZA 1UVTH 1O5DH 1PPEE 5IYTA 3BTFE 1BITA 3M35A 4JZIA 2H1UA 4D76A 1CBWB 1C1SA 1BZXE 2P93A 4Q7XA 4BTTB 3GCHB 3BTWE 1UVUH 2V6NA 1SR5C 3RM2H 3SORA 1ZLRA 3TH2H 4GHQA 2B8OH 2R0KA 1HRTH 1Y5UT 4AOQA 1VITH 3DA9B 3ZYEA 4UONA 3LGUA 1MAYA 3ZZ8A 3UOPA 2FOAA 3SJOA 1QB9A 2ZCHP 1NT1A 1TALA 4X6MA 4U2WA 1O3EA 4E06H 1O2XA 2M5TA 3VPKA 3TLOA 1A0JA 2VB0A 2ZTXA 4K69A 2J9NA 1ACBE 1DSTA 1G36A 1Y8TA 3SGAE 1OWKA 1IAUA 1RTLA 4MNWA 3HPTB 2YOLA 1ZSJA 3RMMH 3E6PH 3QGNB 1C1PA 4CBNA 4JMYA 4Y8YA 5FHTA 3A84A 1D3TB 1Y3UA 2W5EA 4CRDA 2QAAA 1BTPA 2P3TB 1AWHB 2EEKA 2J38A 1HXEH 1NFXA 4MG3A 3NKKA 5JBTA 1XUFA 3LGIA 1TAWA 4IGDA 3RXKA 4THNH 1C5VA 2OQ5A 2A2QH 1QL7A 1HIAA 1O2LA 4NWKA 1GDNA 2HRVA 3ZZ4A 3C27B 3SU1A 3VB6A 4CBOA 1O30A 4MNVA 1GBAA 3A7VA 3RXUA 3M7UA 4BANB 1A4WH 5FX5A 4ABJA 2A2XH 1QGFA 3BTKE 2FS9A 2OUAA 1LHCH 1O3OA 2BLVA 1GBLA 4HI3A 4IN1A 3V0XA 3EYDA 5EQQA 3ZZCA 1SC8U 2GV7A 1TPOA 4JK5A 2XBVA 3Q3XA 8KME2 3W95A 1O2ZA 2FESH 1ZSLA 3BG4C 3GDVA 1TWXB 1BIOA 2VWNA 5FPTA 2OXSA 1QQUA 1IQFA 1AN1E 1MUEB 1T8MA 2AYWA 2ZHWH 1V2PT 1S5SA 1HLTH 1QHRB 2FMJA 2J95A 4NA8A 4Y8XA 2PWXA 3LPRA 1QA7A 2G4TA 4HTCH 1H1BA 4INLA 2BVXH 1A7SA 3BG8A 3DHKH 1JMOH 1VR1H 1XUIA 2G52A 5A0CA 1E35B 2ZTYA 1HAIH 3SHCH 3SUGA 1TNHA 3SNDA 3A87A 1KSNA 1C1OA 1E37B 3KQDA 3U8OH 1DLKB 4OS7A 1SGDE 4ISIH 1FN6A 1KY9A 4Q7YA 4NIVA 2ZG0H 4NA9H 3RC5A 1PYTD 5J4QA 1NM6A 2P94A 2ANYA 1EXFA 4TY6A 1V2ST 1ZMNA 1C5YB 1G2LA 1HJ9A 2BQ6B 3UIRA 1J14A 1JIMA 2BD8A 2OC0A 1THRH 1TQ0B 1OYTH 1NS3A 1QTFA 1FAXA 1MTWA 3MYWA 2XYAA 3RUOA 4WVPE 1NZQH 1N8OC 2JH5D 1O34A 2P8OC 5JB9S 1FPHH 3OU0A 1AE8H 3RXSA 3GCTG 4VGCC 1G3CA 1UHBA 2HLCA 2VGCB 1O5AB 1XXDA 1RXPA 6LPRA 2VWMA 3MH6A 3RXIA 2AGIX 1SGYE 1VGCB 2A5KA 3OYPA 3SI3H 3VGCB 1O3BA 4Y10E 3UPEA 1AB9B 1QY6A 1YCPK 1ELVA 5HXFA 1V6DA 2BOKA 3M5NA 1AHTH 1EX3A 1KDQA 2CHAC 3SI4H 3LONA 4GVUA 2NU2E 2G5VA 1QURH 1MQ6A 1T4UH 2OC7A 4AB9A 3EGKH 4UFEH 1AMHA 1O2QA 3P8GA 1FLEE 2Y7XA 3H5CB 1ETSH 4Y6DA 4Q80A 1P10A 2SFAA 1EASA 4YZUA 2GGVB 3PO1B 4WWYA 3TNSA 1C1VH 2Y82A 1UTOA 4HZHA 1GGDC 5CMXH 1BRUP 4ZHAA 1QJ1B 5DGJA 4IW4E 3A8AA 1IQEA 3N7OA 5FBEA 1HCGA 1H9IE 2HNTE 2Z9KA 3ZVAA 1CHGA 3SQHE 2ZFQH 3SO3A 3DFJA 1P2NA 3RP2A 2QXJA 1EAWA 3RXGA 2STAE 1UK3A 1P2JA 1TA6A 1F0UA 7ESTE 1IQHA 3MU4A 4I8GA 1TIOA 3RDZA 2P16A 4B75A 1N6YA 2XXLA 2CF8H 3ATKA 4ISOA 4OS4A 1O3HA 2JH6D 2ZCLP 4MDSA 1UVOA 1A3EH 1SL3A 1T8OA 3ATMA 2W7UA 1ELGA 3QGJA 5ESTE 4X1RU 1ZYOA 1L4DA 3NZIA 3VB5A 1GJBB 1VITG 2A0QB 4TWWA 1WTGH 2AMQA 2F9UA 1BHXF 2GZ8A 1O38A 3P95A 1GJ7B 3O8CA 1XX9A 1M9UA 2ZU5A 4HFPB 4B71A 1F0RA 2O8LA 3VB4A 1NFWA 2GCTC 5EQRA 1OYQA 1HFDA 3PLKA 2A7CA 1LO6A 2ZKSA 1FI8A 4IMQA 4O9VA 1L4ZA 3VEQB 4NGAH 1HAXB 2A4OA 3PMBB 1V2JT 3PMAB 3UR9A 2VIOA 1CA0B 3SJ8A 3GY4A 3M3SA 1GBEA 4BNRA 1NRQH 1O2NA 4IBLH 5E0HA 4IN2A 1C9TA 3BIVH 5GXPA 1YPGH 5HM2A 1C5LH 1K1IA 1K9OE 1O3KA 6GCHF 2VVUA 1DANH 2GDDA 4FUFA 4ZKRU 4I31A 3KHVA 2PUXB 1KLIH 3LU9B 3STJA 4GUXA 1INCA 4AFZA 1CE5A 4OS1A 3V13A 1Y59T 1DDJA 2VIPA 1FY5A 4R0IA 2GT7A 1WQSA 3GY2A 1TBQH 1EJMA 1HBTH 1HJAB 2Q6DA 4O03A 3MOCA 3GOVB 3M7TA 3LH3A 1Q31A 2A32A 1P2KA 2ZFSA 5ETXA 1IQMA 1CO7E 2VVCA 3MU0A 3QLPH 1E38B 1QR3E 1SGCA 1EQ9A 1O2YA 2BVRH 4YM9A 1GVKB 3PV4A 1A0HB 4X1NU 1GHWH 3TH3H 1BDAA 1QNJA 3UNRA 1DSUA 1X7AC 1GCTC 3LC5A 3MNSA 3RMLH 1P09A 1HPGA 3HGNA 1RTKA 5DK1A 2ZI2H 2Y81A 2ANKH 4Z0KA 4LXBH 5FPSA 3T27A 1P02A 2ZC9H 4WH8A 1FY1A 4MPVA 1YLDA 4AGJA 2STBE 1P3EA 4U30A 5J4SA 4K1TA 1SOTA 1KIGH 2W7SA 2GV6A 5DP4A 3F9EA 3GCOA 3A82A 1O3GA 3QWCH 4MNYA 1H9LB 1GG6C 2A1DB 4D9RA 3TJUA 1GJCB 1V2LT 1W13U 2WYGA 5FPYA 1VJAU 4UFGH 1TRNA 2A45B 3TITA 4JZEH 1SGFA 1GMHF 1G3BA 3FP7E 1WYKA 4DURA 1DPOA 4I8JA 1JRSA 1TGBA 3SUDA 3AVZA 2Z6BD 4MLFB 2ZGXH 2UUKB 2XBYA 2AGGX 2FTMA 5L30H 4WMEA 2JETC 4D7GA 2HWLB 2K1QA 5EOKA 4K8YA 2FM2A 3UNSA 4XFQA 4KTCA 5DJ7A 3BSQA 1DWCH 1FZZA 3PM3A 1T7CA 3LIWA 1QJ7B 2D1JA 3AAVA 3LJOA 3BTDE 2EC9H 4OS5A 2FOFA 1HDTH 3T28A 1VCQA 3RU4E 1OSSA 1N6XA 2WUBA 1GBBA 3DUXH 4Y79A 1KXEA 5TJXA 1IQGA 3MMGA 1TX7A 1O2SA 2J34A 3K2UA 1QB1A 2DUCA 5FCKA 1HXFH 1GI0A 4FUEA 3BF6H 2XC4A 5HGGA 1F2SE 1CT4E 1OP0A 1DWDH 1ZPCA 2OC8A 1PFXC 2Y5FA 3ZVDA 4GCHF 1G32B 1IHSH 1PPFE 1XKAC 2F9VA 1ABIH 3U8RH 1O3NA 3RXEA 1GBCA 2GMTC 3T62A 1KXAA 2ZGCA 1GJ9B 3SGBE 4RKOB 1HUTH 4F4OC 1TMBH 5PTPA 5GJ4B 2FX4A 1ZSKA 2ZA5A 4FUDA 1O2KA 3BIUH 1FN8A 1FY4A 2FIRH 1UTPA 2FS8A 2G5NA 3PLPA 4JZDH 2RDLA 3LC3A 3ZVCA 2ZWLH 3BTHE 3ZVGA 1AUTC 1MKWK 3D23A 1SB1H 1C2JA 5EGMA 3FAOA 5DG6A 5GPIB 1MU6B 1P11E 1DY9A 2FLRH 1J17T 1LPGB 4DGJA 1Y3XA 1UTJA 1UTNA 4KTSA 3MFJA 3TU7H 2FOCA 2GCHG 3UQOA 1AI8H 4ZROA 2CF9H 1NO9H 2AFQB 3SU5A 1XUKA 3U9AH 1JXPA 1HAZB 1YCPH 4YESB 4TY7A 1B0FA 5DP3A 1F7ZA 1GWAA 3I77A 5AHGH 1QRXA 5FX6A 3OSYA 3A81A 1W3CA 4JYTA 3AW1A 1YYY1 1O3JA 5HM9A 3SNAA 2B9LA 4MPUA 1KXBA 1DFPA 3KEEA 1FPCH 4I8LA 2UUJB 3QZQA 2ZDAH 1GHYH 2WPLS 4X1QU 4X2YA 2ZFTA 1AU8A 3IG6B 4XOJA 3MU8A 2PTCE 1Z8JB 3S9BA 5A8YA 2SGDE 2EI8A 3PWBA 3S9CA 5C67A 1UVPA 3BV9B 3TH4H 4K8BA 3O8RA 2PGQB 3RXHA 2QXIA 5F8TA 2ASUB 1GHAF 2TRMA 2FZZA 4B1TA 4MTBA 3V3MA 1Z71A 3FZZA 3ZZ7A 3TPIZ 3HATH 2BY8X 1O2PA 1V2OT 5IDKA 2Z7FE 4ZXYH 1Z8RA 3GY7A 4DG4A 2BLOA 1PPGE 3NK8A 3BEIB 4RSPA 1EB1H 2HVXA 4ZKSU 1ZHPA 3R3GB 4ABGA 1F92A 1C2EA 1BRCE 2V35A 1O33A 1UK2A 3ESTA 1QFKH 1VCPA 5AFZH 1LQDB 2AGEX 4RN6A 4A7IB 5K7RA 4ZMAH 3FZDA 2ZU3A 1FJSA 1HGTH 1GMDG 4F49A 1GJ5H 4OGYA 3RXMA 4A5TS 2HNTF 5EXNA 2TBSA 1BA8B 2YNAA 3JZ1B 3KGPA 4O97A 3RC4A 1BMLA 1TRYA 4YOGA 1C5PA 3SJIA 4FUIA 2VH0A 3RXTA 4AYYB 5C1XA 5EXMA 2G4UA 1V2QT 3A7TA 3S7HB 1DXWA 1G9IE 1AVXA 1AQ7A 1TNIA 4X0WU 4I33A 1NESE 4CH2B 2TGPZ 1ZZZA 1C1MA 1T31A 1BMMH 5DP8A 1SSXA 1D3DB 3NXPA 3MH4A 2PR3A 3UY9A 5ABWA 1K2I1 3FFGA 4AG2A 1SQAA 3FP6E 4I8HA 2PSYA 3GY5A 3NCLA 1CHOG 2C8ZB 1Y5AT 2WV4A 5A0AE 3L33A 3RXVA 3SBKA 2OQUA 5GCHF 5CHAB 2BXTH 1IQKA 1CVWH 1ORFA 2ZGJA 4UE7H 3M37A 3RLWH 2ZTZA 3T2NA 2EI7A 1ZJKA 4KP0A 5L2YH 1W0ZU 4GLYA 4DIHH 2THFB 1AZZA 1C2DA 2QF0A 3U98H 4NG9H 1EP5A 4BAQB 4UFFH 1CBWC 3UQVA 3M5OA 4J2YB 2UWLA 3TK6A 4M7GA 3GCHC 1IOEA 2LNCA 1W10U 4X6NA 1BMAA 2Z94A 4O3TA 1FDPA 1BCUH 4MVNA 3Q77A 2HALA 3SGQE 3RC6A 5JBAS 1EUFA 1G2MA 1CSOE 3GYLB 2BVSH 2VIDA 1MZAA 1GI9B 3U69H 4FUJA 2A4GA 3MNBA 2OINA 1EOJA 1D3PB 4NSVA 4FU9A 4R8TB 2Z3CA 3LGTA 1S84A 4NWLA 2ZQ1A 5GIBA 1ELDE 1TLDA 5FBIA 2BLQA 1J15A 2QF3A 4K1EA 2F9OA 1ANBA 1TA2A 3RXOA 3GCNA 3DFLA 2G8TA 4TWYA 5DPAA 2A31A 4E7NA 1T8NA 4ABFA 1AIXH 3TVJB 1K1OA 1OX1A 2J4IA 3LKWA 1S0QA 4NSYA 2V3HH 3ATLA 4JYUH 2O8TA 2ALPA 3MWIU 1TNKA 3QTVH 1RIWB 3QX5H 1O2VA 1WAYB 4NFFA 1GI1A 2H5CA 2ZDNA 1XMNB 2P3UB 3L6PA 1IHTH 1K22H 1C2HA 3SV7A 2H5DA 1YM0A 3F6UH 1YGCH 3AASA 1SLWB 3TJOA 2ZDLA 2G55A 4I32A 1C1WH 1GMCF 7GCHF 2ZDMA 1LQEA 1IQIA 3JZ2B 4WY3A 3DT0H 3A83A 3Q3YA 3M5LA 1CA8B 2GDEH 2H9HA 2J94A 1C5SA 4B73A 4MPWA 3E1XB 4X2VA 3BTQE 2FODA 3P6ZB 3K65B 3UWIA 2AERH 1P9UA 2QXGA 2ZQ2A 1C9PA 3RXFA 6CHAB 1W8BH 5EU8A 3ZV8A 1V2TT 5C2ZA 1LMWB 2BQWB 1AFEH 2F9BH 2VIVA 1HAPH 4GCHG 1KLJH 1RGQA 2BDIA 3P8OA 2ANWA 4ZKNU 1MKWH 3A80A 1W2KH 2FO9A 2ALVA 1UVSH 4KGAA 2A5AA 2WPHS 3G01A 3ZZ6A 3T26A 4PROA 4JK6A 1DXPA 3A8CA 1Q2WA 1V2NT 3FP8E 1KXCA 4A92A 1G30B 1QBVH 2AIQA 4INKA 3SJ9A 3V7TA 1ZMLA 1ANDA 1EPTB 1O3MA 1ABJH 3QUMP 3UNQA 2PKAB 3C1KA 5EQSA 4ZHMU 3QN7A 5JBBS 3TJNA 4DVAU 1S85A 1C2FA 3RXQA 3GYMA 4E7RG 1ZPBA 3MNXA 2FXRA 3IITA 2BDAA 2H6MA 1EJNA 1YPJH 2SGQE 3A88A 2VGCC 5T6FA 4OGXA 1WOFA 4ZXXH 1D4PB 6ESTA 3PYHA 1VGCC 1MTNB 4NFEA 1FQ3A 1SGQE 3VGCC 3GICB 4NA7A 1EZSC 1ETRH 1AB9C 1Y5BT 1TPSA 2Z3DA 3ELAH 1K1PA 2ZGBH 1DICA 1KYNA 3RU4T 1G3DA 2C8XB 3E0NB 1O2MA 1LHEH 1XXFA 3BEFB 3ENSB 4ABEA 3GY3A 1QL8A 3KN2A 1HV7A 3MI4A 1WTHD 3SZNA 4OS2A 1GHBG 1O2TA 2VIWA 3PO1C 3TNTA 4YTAA 2Z9LA 4ZAEA 1LPZB 5B6OA 1XKBC 3QK1A 1SBWA 4WXVA 1ZGIA 3URDA 5A09A 4A6LA 3A85A 2NU0E 4RKJB 1A46H 1UCYK 1L2EA 3SNEA 2Y5GA 3QDZB 3SW2B 4INHA 2QGRA 5GWZA 4GHTA 5JDUB 2GKVE 4CR9A 1SHHB 2BDCA 2TPIZ 1S82A 1GL1<