4NIXA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) orthorhombic form, zinc-bound
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
221
structure length
221
Chain Sequence
GGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGHTKSSGTSHPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKKSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 59
structure length 221
sequence length 221
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nixA02
1WTGH 1DUEA 1EATA 2FXRA 3R0FA 2SGAA 3QZQA 3FANA 1F2SE 1O3AA 4KKDA 1DLEA 1V2TT 1V2KT 2BLWA 3MU4A 3SHCH 1O2RA 1BTXA 3U9AH 2FYQA 5F03A 3SUGA 1QQUA 4DOQA 4B2BA 4JZ1A 2QGRA 1P09A 1SLXB 1RD3B 1MTUA 2BX3A 1QQ4A 4Z6AH 1CBWC 1TMUH 2B8OH 2XBXA 5C20A 2Q6DA 1TPSA 1PPHE 4ABGA 5AFYH 3S0NA 1A61H 3VEQB 2EI6A 5CMXH 5C67A 3S9BA 3V12A 4JYTA 2BDIA 2FM2A 2P3TB 1WTHD 3K2UA 2GGVB 1E36B 3E91A 3T25A 3A7VA 1HNEE 1E34B 1VJAU 5AFZH 5T6FA 4X1QU 2FOEA 4OS2A 1F5RA 2Z9KA 5EG4A 2BY7X 1F0SA 3QX5H 4B75A 1N6XA 1O3OA 3U1IB 2ZECA 2ZDKA 3GY5A 1GI9B 3BTGE 1K1LA 3ZVGA 3U98H 4E06H 1G32B 4CHAC 2QN5T 3MNSA 4ZMAH 3RP2A 2C3SA 1O3HA 2WV5A 1QJ1B 1AKSA 4JK5A 3O8CA 1G3EA 1AGJA 2ZNKH 1DITH 4I32A 4CRDA 3SU4A 5A09A 3SI3H 1O3CA 2XYAA 1AB9C 3SN8A 1RFNA 1P9SA 1ZGVA 4CRFA 3SNAA 2ZFQH 2FMJA 4Y6DA 4DVAU 2V0BA 2P3UB 1C5TA 2VWNA 1VZQH 3O8DA 3SV8A 1GI2A 2THFB 4UFFH 1K22H 4WXIA 1AFEH 1ABIH 1K1NA 4XDEA 4CRCA 3MOCA 1O2UA 1CA0C 2P8OC 2SGDE 3SO3A 3EAJA 4XOJA 4ZHMU 2STAE 3KIDU 1TGNA 2VINA 1FJSA 3T26A 1TRYA 4E7RG 1O2PA 1SGIB 1LVBA 3QO6A 5FPYA 1TNHA 1C2JA 5DP8A 4R0IA 1L1NA 3EDXB 1G3CA 4INLA 4XFQA 3GDUA 4H6TA 4O9VA 3CS0A 3RXLA 1S5SA 3RM2H 4FUEA 2DE8A 3ZVEA 1O2TA 1NFXA 1W0ZU 1GMCF 3ZVAA 2ZFPH 4GVUA 4Q80A 2CF8H 2OP9A 3FP6E 2KAIA 3NUMA 3PROA 1OSSA 1VGCC 1TFXA 3F68H 5G4BA 1PPGE 1GMCG 3TPIZ 5DP5A 2ZPRA 4FU9A 1CT2E 3DFLA 1Z71A 4M7GA 3LGWA 3MU0A 5LGOA 2ZCKP 3FP8E 3STJA 1SG8B 1P2NA 4GHQA 3MTYA 1TALA 2PSYA 4TY6A 3DHKH 1Z8JB 1H4WA 1K28D 1CA8B 2BXUH 2ZQ2A 4BAKB 1D6RA 3NXPA 2VVUA 3MNBA 3SJOA 1O5BB 4Y0ZE 1V2MT 4E7NA 1ZPCA 1IOEA 2ZU2A 1CT0E 4JZDH 1SGPE 2WUBA 2F9BH 1P2QA 1HGTH 2QXIA 8GCHG 1DE7H 3F1SB 2Y6TA 1K1PA 3PLBA 1O39A 5FHTA 2ALPA 1PPBH 3P8OA 1KXCA 1O3LA 1ZHPA 2AS9A 4BNRA 1BTUA 2A45B 2O8LA 1QR3E 4YM9A 2EC9H 1GHBF 3PMAB 2FX4A 1GBDA 1B0FA 2NU1E 1JRTA 3GDSA 5TCCA 1IQKA 1GJ4H 2A5KA 1OYTH 1TGCA 1VCPA 2BD8A 3FAOA 1CBWB 1YKTA 2QYIA 1SOZA 2C90B 4X1SU 1KXDA 1SFQB 1DWEH 1UVSH 2GT7A 4BAHB 5E2PA 1Q3XA 1QCPA 4Z0KA 1C2HA 3KEEA 5EXNA 1HJ9A 4LXBH 3LJOA 2G8TA 5JYIA 5IDKA 1OKXA 4GCHF 2ALVA 1YLDA 4IN1A 1H9IE 4MNXA 1Z7KA 1NRQH 3GYLB 2G5NA 1S82A 4YT7H 3EA8A 4FU7A 1RTFB 1MKXK 6LPRA 1TGTA 3V7TA 1EX3A 3GCTG 3M35A 1YCPM 4IGDA 1FIWA 4K69A 3P17H 1IQLA 4MPVA 2ZPSA 1ELFA 5K0HA 1GDQA 1ZR0A 3PLPA 1V6DA 2VH6A 3NK8A 4TWWA 2ZKSA 4Y0YE 5L2YH 3BEUA 1YPGH 3SUDA 3SU6A 1BTPA 1KXEA 2SNWA 4NIXA 1S6HA 5ABWA 2BVXH 1GBAA 1GHAG 5LPFA 1EOJA 5HYOA 3TGKE 1C5RA 2ZP0H 2JH5D 2GV7A 2FOMB 2QA9E 1O2YA 1S83A 1O5EH 3MU8A 1J9CH 1T4VH 1AD8H 2ILNA 4DIHH 3SU3A 1SLVB 1YPHE 2RDLA 1QURH 1THSH 3GDVA 3T62A 3D65E 1IAUA 3JZ1B 3M5LA 1FY8E 1P57B 3STIA 3TIUA 1GJ5H 1SOTA 3SGAE 4ABDA 1XUJA 6GCHF 1FPHH 1HXFH 1GBTA 3PMBB 4ZKOU 2P16A 3B23B 3T5FH 1AI8H 2BLQA 1ZJKA 1MD8A 1OS8A 4AN7A 1D3DB 4NZQA 1GBJA 1ZGIA 5EOKA 1F5KU 2H5CA 2VGCC 2W7SA 2XTTB 1X7AC 1O2JA 1Z6EA 2VB0A 1P3CA 1OYQA 3EQ0H 3AW1A 5EQRA 2FDAA 3LC5A 2UWPA 4UEHH 3VXEH 2RA3A 5DP6A 1BBRE 5CHAC 1SGFG 1Y3WA 2ZTZA 2ZFTA 1UK4A 4ABFA 3RXSA 1ELEE 3VB4A 4JZFH 4R8TB 3RM0H 4DY7B 1JOUB 2HVXA 3S7KB 4YTAA 4AYVB 1LMWB 2ZHWH 2K1QA 1ZOMA 2BMGB 3M5OA 1ELTA 1LVOA 1K2I1 1OWKA 4MPXA 5EQQA 1WQVH 1WAYB 1D4PB 1LHEH 1TX7A 2ODYB 1D3PB 2ANKH 1LDTT 1CQQA 1YCPK 4AFQA 2G5VA 3RXUA 1RIWC 2F3CE 2ZFFH 3RDZA 1LTOA 1W0YH 3W94A 1WCZA 4AZ2B 3ZYEA 3S69A 3PTBA 3U8RH 3LOXA 1UJ1A 1VJ9U 5IYTA 4X1NU 1QRWA 1K1MA 1HB0B 1QNJA 1QB1A 4AYYB 1GBCA 1M9UA 1O2SA 2PW8H 3SNEA 1EKBB 1GBEA 1GBHA 2VIWA 1FQ3A 1BMLA 2PKSC 4U32A 3UOUA 2BD2A 2P3FH 3TK6A 2Z3EA 1FY1A 3BSQA 2XBYA 2FOHA 1HIAB 4GCHG 2CJIA 2A4QA 3I77A 3M61U 3V0XA 2ODPA 1O0DH 3E0PB 3A8DA 4I33A 4Y7BA 1NS3A 1PJPA 1TA6A 4XBCA 3SBKA 1P05A 1ZHRA 3FZDA 2A7CA 4SGAE 2O9QA 2Z6BD 4HTCH 1GI5A 3TGIE 1XUGA 1IQIA 4X8VH 1C5QA 2BHGA 4B76A 3LU9B 2HALA 4YO9A 3BEIB 2ANYA 4H6SB 4I8LA 1NM6A 2G4UA 1CHOF 2ZHEH 3LH1A 4AG2A 4D9QA 2P94A 1G37A 3RMMH 1SGEE 1VITH 1THRH 1YPMH 4MTBA 2QXJA 1FIZA 3VB7A 1LVMA 4X6PA 2JETB 2AYWA 2ZHFH 1GI3A 3BIUH 4AFSA 5C1YA 5K7RA 1NZQH 2FTLE 3F9FA 4FVDA 1BRBE 1CGHA 1DSTA 6CHAB 2XBWA 9LPRA 2PKAA 1ANEA 1HCGA 1QBOA 1V2QT 4F49A 5J4QA 3BG4C 1SC8U 3QGNB 2Y81A 1S85A 5JBAS 1DICA 4RKOB 3M36A 5F8TA 1JIMA 3MU5A 6GCHG 4BTIB 1C1VH 4HI3A 1FDPA 4X2YA 1V2LT 3D62A 2JH0D 1C1SA 2OBQA 1W8BH 2EI7A 3RXTA 2R3YA 1ETRH 1LPZB 1AN1E 1EB1H 1GHAF 3BTKE 2FEQH 1NU7B 3HK6B 3OY5U 5EU8A 5ESTE 1Y3UA 2IPHA 1JWTA 1XUIA 7GCHF 4WMFA 1XKBC 2W26A 3EA7A 1C5ZB 2Q6FA 2PWXA 3LPRA 1C4V2 2FOAA 1BJVA 1MBMA 1UVUH 2GX4A 1UCYK 2FI3E 5EPNA 1GDNA 5DPAA 3ZZCA 1S0QA 2PLXA 1UTPA 1ZYOA 5FPTA 5AVDA 4WWYA 4I8HA 1RGQA 4LK4A 1TAWA 1T8OA 1HV7A 1UCYE 2AMQA 5EXLA 2A7HA 4AG1A 1FLEE 2BQWB 1SQTA 3MNXA 5JB9S 2F9VA 5EQSA 3RXGA 3SGQE 3SNBA 3RXOA 1TNIA 3SW2B 3RXCA 1SHYA 1TX6A 2A31A 3N7OA 2XC5A 3AAUA 8ESTE 3ATKA 1WUNH 5ESBA 1MTNB 1NN6A 1SR5C 1FXYA 1CO7E 5C5OA 3F9EA 3VB5A 1GHYH 1HAHH 3QZRA 8GCHF 3PB1E 1DS2E 3KQDA 2SGFE 1NPMA 3UUZA 1C5PA 2CHAB 2YNAA 2D1JA 4MG3A 2PTNA 1UTMA 3SNDA 3BTME 3TLOA 4GLYA 1GHBG 1QIXB 2VU8E 3K6ZA 1GBFA 1E37B 1F0TA 3HGPA 1BT7A 4AGKA 2IN2A 4H42U 1GG6C 3VFEA 2A2XH 2QXGA 3PMHB 2EI8A 1G3DA 2FOBA 2ZCLP 3JZ2B 1DDJA 2OINA 1GWAA 4OS1A 5FBIA 5C1UA 4Y8ZA 2M5TA 3EGKH 4IW4E 1GMDG 1W14U 2VVVA 3M5MA 2HRVA 3QN7A 2BDYA 1UCYH 2OC0A 1P3EA 3RLWH 3T27A 4YLQH 1S84A 3P8FA 2I6QA 5I46H 1ESTA 1MTNC 2WPJS 1YC0A 2PFEA 2BLVA 1GI7B 1BIOA 2HNTF 3FVFB 1BITA 3F6UH 1C5SA 2SNVA 4AOQA 3PWCA 2QV1A 1EP6A 1O37A 2Q1JA 2CXVA 1ZTKA 4UD9H 1C5OH 1T4UH 1J8AA 4CREA 1O2KA 4AX9H 3S7HB 1O3DA 2P93A 1K1JA 1O36A 1LKBA 4MPWA 1O2LA 3NPSA 2RG3A 4CBNA 2FESH 1V2WT 1BB0B 2ANWA 1C2IA 3RXJA 1UK3A 4X6MA 1DSUA 4JYUH 4BANB 4Q7XA 3ZZDA 3UNSA 2VWOA 1PYTD 1HRTH 1QA0A 2C8YB 3MH4A 3BTTE 2QAAA 1TNLA 1H9HE 2VH0A 3IG6B 1V2OT 2C8WB 4ZHAA 3CS7A 3RC4A 1RTKA 3OY6U 3DFJA 1V2NT 1XUHA 2ZGXH 1NC6A 2NWNA 1CHOG 1GVKB 4AORA 3SJ9A 1JIRA 4ABAA 2BY9X 2RA0A 2ZQ1A 4J1YA 1O5CB 4K3JA 3PV4A 1OPHB 4ISHH 5CHAB 3SUFA 2C8XB 4GSOA 1NESE 2VIDA 2GZ8A 2WPKS 2ZFRH 4ZROA 1C5VA 2A0QB 4YZUA 3UFAA 2HGTH 1QL8A 3OU0A 3ZVBA 5DG6A 3LJJA 4FU8A 3SV2H 3RXRA 1FMGA 4NG9H 1F92A 3RXPA 2VJ1A 4TPIZ 2Y5GA 1HAPH 1MKWH 4NSVA 2HNTC 3P92A 1A3BH 3OTJE 1AUJA 3RU4E 4O97A 2R3UA 1CHGA 1GG6B 2AGEX 3TNTA 5A8ZA 3UREA 2FLRH 2OBOA 3BF6H 1O2IA 1ZRKA 2GCTC 1Q2WA 4E05H 1BHXF 4ZKSU 1GHWH 2OUAA 1OOKB 4ISLA 2UUFB 2H9EH 3MH5A 3ZZ3A 1DPOA 2VGCB 1GPZA 3M7TA 1OP2A 1ZSLA 3RXEA 3ESTA 2TGTA 4AB8A 1SGFA 3P6ZB 2C4FH 4B1TA 3PMJA 1W13U 3U1JB 2R2WU 1E0FD 1DVAH 1WQSA 2OC7A 4Y10E 1AVXA 2JKHA 5E0JA 4RN6A 4BXWA 2A4OA 3SHAH 1DLKB 2GZ7A 1INCA 1A0JA 2AH4X 2FS8A 2ZDLA 1A2CH 2WYGA 3ELAH 1EJNA 4DGJA 1BA8B 2Q6GA 1CU1A 1UTNA 1Y3XA 3E1XB 4MLFB 1O35A 4B2CA 3QUMP 2W3IA 1EAXA 3S9AA 1DXWA 2OXSA 2A1DB 5B6OA 1BTHH 1ELDE 2BM2A 4FVBA 3TGJE 2XC0A 5A0BA 2ASUB 1BRCE 1FZZA 5DJ7A 5DP4A 1C1MA 3MU1A 4B73A 3RU4D 4BTTB 3K9XB 1PQ5A 3ZV8A 1GJ8B 4X2VA 3D49H 1EPTB 1BMAA 2CF9H 2GP9B 1MU6B 1SLWB 1TLDA 2AIPA 1NRSH 1CGIE 1W7GH 1ZTJA 3PO1B 1NO9H 4A7IB 2R2MB 3ITIA 3BEFB 2NU3E 2O8WA 1J15A 1KSNA 4NSYA 1GL1A 1KIGH 2PR3A 3P8NA 4AGJA 3GCOA 3A8CA 2YOLA 1TRMA 1GL0E 3TU7H 2ZGHA 4FUGA 2A5IA 2QF3A 3A80A 4VGCB 3VB3A 2D8WA 2OTVA 1QHRB 4OS7A 1EPTC 3SQHE 1KDQA 4WJG2 3FZZA 2BD7A 3ZYDA 1AE5A 1F0RA 1V2ST 2J92A 4IC6A 3MH7A 3GY7A 2ZFSA 3SV9A 1TQ0B 2ZU3A 1G9IE 1GGDB 3ATWA 2J95A 3GCNA 1BRUP 5GCHF 4RSPA 1H8DH 2G52A 1GMHG 1QTFA 1FV9A 3VPKA 1P8VC 1TGSZ 3BTQE 4Y79A 3NKKA 2XXLA 1LHGH 1TBRH 4BOHA 2A32A 1PQ7A 1FNIA 3GOVB 1DFPA 1V3XA 2XWAA 2Y5FA 3SJ8A 1MU8B 3RLYH 2BY5X 1YYY1 4OGXA 1FI8A 1YPKH 2FLBH 2O8TA 4CBOA 2TPIZ 2G81E 2Z9GA 3MNCA 1LVYA 2BQ7B 2BD4A 4Q7YA 2WPLS 3BTHE 4HZHA 3V3MA 4NFEA 3GY2A 1GI8B 3E16B 1XUFA 5AF9H 5DP9A 1QA7A 1TONA 1C1WH 1UHBB 1EZQA 2FWWA 3A81A 1C1RA 1A3EH 5GXPA 2ZZUH 2Z9JA 1Z8IB 1C1UH 3QK1A 2PUXB 3VGCB 4IS5A 1O2HA 2SGQE 2PKAB 5C5NA 1ARCA 1EZSC 2FOFA 4GAWA 1VGCB 2FTMA 4X1RU 3RXVA 1C1QA 1RRKA 4NGAH 1O5FH 1SQOA 4KTUA 2WPMS 3ATIA 1GI1A 1CSOE 5TJXA 1TIOA 1SPJA 1P01A 5DGJA 3E8LA 4YOJA 1V2UT 1O32A 2G4TA 4X8SH 1F5LA 2H9TH 1ZPZA 3LC3A 1GJAB 1DX5M 1DOJA 5T6GA 2WUCA 1PPCE 3F9GA 3TK9A 1HIAA 2UWOA 1AWHB 1P04A 1LQEA 2EA3A 2XCNA 1C5LH 1GGDC 2J2UA 1TOCB 1TX8A 1G2LA 1ANBA 1P0SH 1J16A 1XUKA 1KLTA 1OXGA 2AGIX 4NCYA 2AFQB 2GCHG 1Y5AT 1ID5H 4K1TA 4DG4A 1ZMNA 4CR5A 1ELGA 2AIQA 5GIBA 5EW1H 1N8OC 1SGNE 2PUQH 1BJUA 1QRXA 1NRRH 1VCWA 4ISNA 1O3MA 3LONA 3SNCA 3GCHB 1UTQA 1UTKA 2DUCA 2BB4A 1QBNA 4UFDH 3KN2A 1E35B 3A7TA 1C2LA 2G51A 1HPGA 1T8NA 4F4OC 1BTWA 1D6WA 2V6NA 1UK2A 3A88A 1YLCA 3SUEA 1C5UA 1C1OA 4UFGH 2CV3A 1XVMA 1K1IA 3PO1C 4FUBA 1Q31A 1UHBA 3Q76A 1EXFA 3RXFA 2QXHA 1LPGB 2HLCA 2IOTA 3WY8A 1D3QB 1YM0A 4A1TA 1TPPA 2WV4A 4OS4A 4Y8YA 1EASA 4IMZA 1QFKH 1SGQE 1Z6JH 4BAMB 5FCRA 2LPRA 1O2OA 1GVZA 1TPOA 1JRSA 3MFJA 2FOCA 3R3GB 1JXPA 5JBBS 1IQHA 4ZXYH 5FAHA 1LPKB 3ZZAA 1YGCH 1GI4A 3A85A 5HM9A 2A2QH 4ISIH 1EQ9A 2YNBA 4KELA 4ABBA 4Y11E 3ZZBA 2B7DH 3KQBA 1C2DA 1AWFH 1GJ9B 1HJAC 1WBGB 1C5MD 5HM2A 1P02A 1BOQA 1T8MA 3HK3B 1ZLRA 3HKIB 2GDEH 1BMNH 2Y82A 2AERH 1ZPBA 1GMDF 1C9TA 1KDQB 4WMEA 4UFEH 3BN9A 1S81A 2DE9A 2GTBA 3BTWE 1O2NA 3DA9B 3SJIA 5C3NA 2ZIQH 1TE0A 2NU4E 3BG8A 3CP7A 1MBQA 1MD7A 3VB6A 5H4IB 1EOLA 1MTVA 3ENSB 1MTWA 1AO5A 1NRPH 2GCTB 4K8BA 5CE1A 4LZ4B 2HPPH 2ZF0H 3RXMA 2TGDA 1OX1A 2CGAA 1GBKA 1UO6A 5JDUB 3UR6A 1ZTLA 1TYNA 4YESB 4Y71A 3TH3H 3SI4H 4SGBE 5F8ZA 2CN0H 2TIOA 3MO9A 4A5TS 3QWCH 2Z94A 3SORA 4WF8A 4ZH8A 2QIQA 4X2XA 1ELAA 4NZLA 4FUFA 4ESTE 2PGQB 3UPEA 1BTZA 2UUJB 1DUAA 4TY7A 1VITG 1D9IA 5T6DA 1A0LA 1QBVH 5BPEA 1OWEA 3B9FH 2G55A 3NZIA 2F9UA 1KTSB 1AFQB 4H4FA 2GVFA 3SU5A 5C1XA 1O3PB 2ZDAH 1HLTH 3TH2H 3QLPH 1FONA 4WMDA 1NROH 2VWLA 2FODA 2NU2E 4I8GA 2ZU1A 1Z8GA 1L2EA 1O5GH 5EODA 2W7UA 1FY5A 1WU1A 1TB6H 4GPGA 2FZZA 1W11U 5HGGA 1O3FA 2FO9A 3O8RA 3Q00A 1EJAA 2OCVB 1LHFH 3NWUA 1OP8A 3PTNA 5A0CA 3LDXH 4D76A 1CA0B 2B0FA 2ZA5A 1CE5A 1VR1H 3ZZ5A 1C9PA 1ELBA 1S6FA 1GHZA 2WPIS 1MTSA 1O2XA 1KXAA 1O38A 4D9RA 5FBEA 1PFXC 4NIWA 2HPQH 2LNCA 2BD5A 1O5DH 2BOHB 2BXTH 1N1LA 4ZKRU 4ISOA 5C2ZA 1EZXC 1SGDE 1W3CA 2SGEE 1A0HB 3E6PH 5J4SA 4Y7AA 4XBBA 1WSSH 1C5XB 1EP5A 1EPTA 4LOYH 4CRAA 1MZAA 1KLJH 3LIWA 3QTOH 3TH4H 3A83A 1GJDB 5E0HA 3RXDA 3VGCC 1DWCH 2VWMA 3HATH 5EGMA 1C1TA 3URDA 1YPJH 1ZMLA 2BVRH 1TQ7B 1V2JT 2BDAA 2SFAA 1YCPH 3ZZ9A 3ZVDA 3AW0A 1EAWA 1PPFE 4X6OA 3A8BA 1QJ6B 2CHAC 1SFIA 2PGBB 1V2VT 3Q77A 3L3TA 2ZI2H 3ZZ6A 4X0WU 2C8ZB 3NCLA 2ZEBA 4LZ1H 1QRZA 1QL7A 1NU9A 4K2YA 5L2ZH 1HAIH 4D8NA 1QB9A 2B9LA 1A5GH 8LPRA 1ETSH 2ZDMA 1V2PT 1GCDA 5AHGH 2J4IA 7KMEH 2H6MA 3EYDA 1GCTC 1SI5H 3KGPA 1P2IA 4FUJA 3UR9A 1CT4E 1ZJDA 3BV9B 3LH3A 4MQAA 1O3EA 1BBRK 1HAVA 1EUFA 1L4DA 2VVCA 4AFZA 2F9NA 4XBDA 2W3KA 1DY8A 1LCYA 4MPUA 1Y59T 1K21H 7GCHG 4IMQA 1TMTH 3RXKA 3FFGA 2TGAA 4ASHA 2BDCA 1OWIA 4NFFA 3UIRA 3MH6A 2GDDA 1HXEH 2GD4B 3GCHC 4A1XA 2ZHQH 1V2RT 4NIVA 2F91A 4XE4A 1O2GH 2EEKA 4X8TH 1AE8H 1K1OA 4TPYA 2ZGCA 3TNSA 1A5IA 1HAGE 1O2QA 2UUYA 1UTOA 1DT2A 3C27B 1NY22 3ODFA 4I8JA 1SVPA 3T28A 1PPZA 3I29A 5F8XA 1H8IH 2TGPZ 5EPYA 1KXFA 1B5GH 1IHSH 3E90B 3GY3A 1FAKH 1JMOH 5DP3A 1TOMH 3EA9A 3RXBA 4HGCA 1MUEB 3ZVFA 1AMHA 1GCTB 5ETXA 3KF2A 4WVPE 2GKVE 3DT0H 2R0LA 1SGCA 1OWHA 1P06A 2O8UA 4YOIA 2PHBA 1XX9A 1FAXA 5GWZA 1MQ6A 1TMBH 5FCKA 2H9HA 1SHHB 2BLOA 3SOSA 1YPHC 1L1GA 3LGUA 1YPEH 2OQ5A 3RXAA 1PPEE 3SV6A 4B74A 2QC2A 1T31A 1BHXB 2ZU4A 1TWXB 3PLKA 4Y8XA 1TABE 2A7JA 4MNWA 1T7CA 1W12U 2HWLB 2Z9LA 5DP7A 5F6MA 4JK6A 4OS5A 3Q3XA 1MKXH 3VXFH 4ABEA 3RC6A 1GDUA 2D26C 3D23A 1O3IA 4ABIA 3UWJH 2ODQA 3HGNA 2ULLA 1G30B 5E8EH 3W95A 8KME2 3K65B 2VIQA 1IQFA 2FI5E 1QB6A 1AKSB 1GJBB 3TJVA 4I7YH 1T8LA 2F9PA 3K6YA 4JMYA 3GISB 2XNIA 4IN2A 2HNTE 1FN6A 2H5DA 1A1RA 3RMNH 1FPCH 4NA7A 3M7UA 5HMAA 4OS6A 5FXLA 1SGYE 1NFWA 4QT8C 1KTTB 2CMYA 1NFYA 2H2ZA 4YOGA 2GCHF 4K1SA 4K60A 4DURA 1ANCA 2PTCE 2A4RA 3P95A 2AMPA 1LHCH 1SQAA 1A46H 1XVOA 1LKAA 2BY8X 2FP7B 2FPZA 1GMHF 5DO4H 1P2OA 5DK1A 1MKWK 1GVLA 4WH6A 4BAQB 3AVZA 5GDSH 3A82A 2ZO3H 3TITA 1P11E 5JBCS 2OC8A 2FYRA 2J9NA 1PQAA 2GMTB 5A2MH 4UDWH 1BQYA 5A0AE 1GHVH 4THNH 3ATMA 1JBUH 1O3BA 1ZRBA 4X8UH 1NRNH 3LKWA 3KHVA 1TPAE 2BTCE 3A8AA 1RTLA 1ZSKA 2BDBA 3DUXH 2GZ9A 4U01A 1TBZH 3A84A 3S9CA 3LGYA 1ACBE 1DM4B 2Z3DA 3ZZ8A 5E0GA 1AB9B 2WPHS 1NFUA 1BUIA 4Q2KA 3ATLA 1C4Y2 1KXBA 4K8YA 5GPIB 2BOKA 1RJXB 3F9HA 2TBSA 2FX6A 1H9LB 1PYTC 2J34A 1IQEA 3UNRA 4IC5A 2BY6X 3P70B 4NWLA 1O2VA 3KQCA 3QTVH 2FOGA 5PTPA 1Y3VA 1GJ7B 1HAZB 3EE0B 1C2FA 2BX4A 2AGGX 3Q3KA 2AEIH 1HYLA 3BTDE 1ZMJA 1AUTC 3A87A 4DIIH 4X2WA 1ZZZA 2ZDNA 2BZ6H 2ZGJA 2QF0A 2UUKB 3GICB 4BAOB 2XRCA 1QGFA 5LH8A 3P8GA 4ZKNU 1XKAC 1IQGA 4DW2U 3RU4T 1EAIA 2I6SA 1YPLH 1H1BA 1AHTH 1YF4A 1Y5BT 5FX5A 5I25A 3V13A 1WYKA 4UE7H 1HAOH 2BDGA 2WYJA 3BTEE 1SB1H 3CENA 3RUOA 3UNQA 3MWIU 4MDSA 1C1NA 1P10A 3L6PA 1VCQA 1A4WH 4B2AA 2XBVA 1W2KH 4JYVH 1C5WB 4ZUHA 3SV7A 1C2MA 1C5NH 1NTPA 5BRRE 4Q7ZA 4TYDA 1GBLA 5TCAA 2P95A 1SMFE 2WINI 1UVOA 2VIPA 5SGAE 2BQ6B 1Y3YA 3H7OA 3M7QA 2IJOB 4ZXXH 3GYMA 2F83A 3OSYA 1L4ZA 1AZ8A 3SU0A 3PYHA 2OLGA 3URCA 3PM3A 2ZTYA 1P2MA 3HPTB 3E0NB 3BIVH 2J38A 1HFDA 2XWBI 3HKJB 1C5YB 1N8OB 1TRNA 1AVGH 3IWMA 3OX7U 1MZDA 1SGRE 1THPB 2QY0B 3QDZB 3TVJB 1MQ5A 2GMTC 1LHDH 4ABHA 3RMLH 1B7XB 2ZG0H 4KGAA 1Z8RA 3M3SA 3UQVA 2BVSH 1P2JA 4DT7B 1O2WA 1K9OE 2GV6A 1KLIH 1J17T 1GBMA 1O3KA 5GCHG 2FS9A 4CRGA 4Y76A 2VNTA 1XXFA 2HOBA 2BZAA 4CRBA 2STBE 1ZSJA 3SQEE 2Y7ZA 1P2KA 4ZAEA 1BMMH 3ZZ7A 1ELVA 3RC5A 2R0KA 3G01A 1C2KA 4PROA 5E2OA 2C93B 3ODDA 3M3TA 3SGBE 4UONA 2Z3CA 5JPMH 3GY6A 1C2GA 1UTLM 3MHWU 1RXPA 3A7WA 3BTFE 4U30A 2R9PA 4WY3A 4WXVA 5JBTA 1QY6A 3M3VA 1E38B 1YBWA 4INHA 6CHAC 4XSKU 3MYWA 4DJZB 1FN8A 4O03A 1W10U 4CH2B 1TBQH 2Y5HA 2Z9IA 4MNYA 3BG4B 1FY4A 1O33A 4INKA 1FY3A 1O2MA 1DY9A 1O34A 5A8YA 2JETC 1C4U2 4O3TA 2BD9A 5LPRA 3U69H 3A7YA 1ANDA 2ZU5A 3LGIA 4KTSA 2JH6D 1MH0A 4X6NA 4D7FA 3SU1A 1UVTH 2SGPE 3B8JA 1ESBA 1AY6H 2TRMA 4BXSA 1XXDA 2G00A 1IHTH 1LO6A 1TA2A 1S0RA 1UVPA 1ETTH 6ESTA 2P59A 1XMNB 1ARBA 1AZZA 3RXIA 1C2EA 3MI4A 1IQJA 1HJAB 2OC1A 1T32A 4WH8A 1MCVA 2XC4A 3A89A 7LPRA 4BTUB 3TJUA 1O5AB 4CH8B 1BBRH 1OWDA 2ZTXA 4AB9A 1HJ8A 3FP7E 1NT1A 1TGBA 3Q3YA 4ZHLU 1TNGA 5L6NH 1MCTA 5GJ4B 3TK5A 3SJKA 4YLUA 4KP0A 1GJ6A 1OP0A 1L0ZA 3ZV9A 1O31A 3UQOA 1N6YA 4GHTA 4B71A 2ANMH 1Y5UT 5FX6A 3DD2H 5L30H 3QGJA 2W5EA 2J94A 4JZEH 1F0UA 1TNKA 3KNXA 1O30A 3LT3A 3C1KA 1HAVB 2V35A 2ZHDA 3T2NA 2XW9A 4D7GA 1Z1IA 3AASA 1GJCB 3KQEA 3LGVA 3SZNA 1HAXB 2GT8A 1RS0A 1A7SA 3A7XA 2ZCHP 1O3JA 4FXGH 4TWYA 5FPSA 1TNJA 4FUIA 3H7TA 1DXPA 2ZWLH 9ESTA 1Z1JA 4O3UA 4J2YB 2ESTE 4NA9H 1BDAA 1MAYA 1G36A 3TJNA 1GI6A 1UTJA 1WV7H 2Y80A 3PWBA 1AFQC 4U2WA 1SSXA 4I31A 1WOFA 3RXQA 1GBBA 3GCTF 1AU8A 3RMOH 1EB2A 4NWKA 1QL9A 4CR9A 3U8TH 2H1UA 2VIOA 7ESTE 1A5HA 3ZVCA 3ZZ4A 4A1VA 3AAVA 1DWDH 1HAYB 1SLUB 1FUJA 3OYPA 2B5TB 1BRAA 3A86A 4ABJA 3U8OH 5JB8S 3MMGA 3H5CB 1SL3A 1HBTH 4CHAB 2PV9B 2XCFA 4IBLH 1O3NA 1CVWH 3UOPA 1ABJH 1P9UA 1OWJA 1ELCA 1O3GA 1BTYA 1P12E 2F9OA 1DWBH 1QJ7B 3KL6A 1CGJE 1EAUA 2RCEA 3GY8A 3MO6A 3L33A 2ZPQA 2PSXA 2KAIB 3TJOA 2ZDVH 4A6LA 1C1PA 2ZGBH 2NU0E 3GY4A 1IQMA 1AIXH 5EW2H 1SGTA 4I8KA 4MVNA 1GBIA 1BZXE 2V3OH 3O8BA 3M5NA 2A4GA 4MNVA 1ZHMA 1YP9A 1P03A 4FUCA 2BD3A 5DKMA 1GHXH 1KYNA 2D2DA 4A92A 2OQUA 1AVWA 5LPEA 2ZC9H 4DCDA 1AQ7A 1EZUC 3I78A 2OD3B 1VITF 3MO3A 1XM1A 3IITA 4JZIA 2Y7XA 1IQNA 2PKSB 2UWLA 2BDHA 2BYAX 1L1JA 4AFUA 3RXHA 1W7XH 3SU2A 4JCNA 3M37A 2FI4E 1ORFA 1SBWA 1Y8TA 4FUDA 3KCGH 1U6QA 4X1PU 4KTCA 2A5AA 4GUXA 4NA8A 2O8MA 3UWIA 3T29A 1RIWB 1BCUH 2FIRH 1G2MA 1KY9A 1MAXA 3LGTA 4HFPB 4FUHA 4NIYA 3UY9A 2P8OB 1ESAA 3UTUH 3A7ZA 2QCYA 1DANH 1LQDB 1GI0A 1EJMA 4RKJB 5A8XA 1B0EA 4K5ZA 2AMDA 4VGCC 1D3TB 1MMJN 1G3BA 1O2ZA 2VIVA 5EXMA 4OGYA 4K1EA 1HDTH 1UMAH 3E3TA 1F7ZA 5HXFA 2Z7FE 4YT6H 2V3HH 1HUTH 1J14A 1PQ8A 5T3HA
chains in the Genus database with same CATH superfamily
1WTGH 1DUEA 1EATA 2FXRA 3R0FA 2SGAA 1UW7A 3QZQA 3FANA 1F2SE 1O3AA 4KKDA 1DLEA 1V2TT 1V2KT 2BLWA 3MU4A 3SHCH 1O2RA 1BTXA 3U9AH 2FYQA 5F03A 3SUGA 1QQUA 3UAIC 3OE7D 4JZ1A 4B2BA 4DOQA 2QGRA 1P09A 2KCYA 1SLXB 1RD3B 1MTUA 2BX3A 1QQ4A 4Z6AH 1CBWC 1TMUH 2B8OH 3CNRA 2XBXA 5C20A 2Q6DA 1TPSA 1PPHE 4ABGA 5AFYH 3S0NA 1A61H 3VEQB 2EI6A 5CMXH 5C67A 3S9BA 3V12A 4JYTA 2BDIA 2FM2A 2P3TB 1WTHD 3K2UA 2GGVB 1E36B 3E91A 3T25A 3A7VA 1HNEE 1E34B 1VJAU 5AFZH 2LP6A 4XRNA 5T6FA 4X1QU 3UB0A 2FOEA 4OS2A 1F5RA 2Z9KA 5EG4A 2BY7X 1F0SA 3QX5H 4B75A 1N6XA 1O3OA 3U1IB 2ZECA 2ZDKA 3GY5A 1GI9B 3BTGE 1K1LA 3ZVGA 3U98H 4E06H 1G32B 4CHAC 2QN5T 3MNSA 4ZMAH 3RP2A 2C3SA 1O3HA 2V3MA 2WV5A 1QJ1B 1AKSA 4JK5A 3O8CA 1G3EA 1AGJA 2ZNKH 1DITH 4I32A 4CRDA 3SU4A 5A09A 3SI3H 1E1QD 1O3CA 2XYAA 1AB9C 3SN8A 1RFNA 1P9SA 1ZGVA 4CRFA 3SNAA 2ZFQH 2FMJA 4Y6DA 4DVAU 2V0BA 2P3UB 1C5TA 2VWNA 1VZQH 3O8DA 3SV8A 1GI2A 2THFB 4UFFH 1K22H 4WXIA 1AFEH 1ABIH 1K1NA 4XDEA 4CRCA 3MOCA 5CHBA 1O2UA 1CA0C 2P8OC 2SGDE 3SO3A 3EAJA 4XOJA 4ZHMU 2STAE 3KIDU 1TGNA 2VINA 1FJSA 3T26A 1TRYA 2QF5A 4E7RG 1O2PA 1SGIB 1LVBA 3QO6A 5FPYA 1TNHA 1C2JA 5DP8A 4R0IA 1L1NA 3EDXB 1G3CA 4INLA 4XFQA 2WV9A 3GDUA 4H6TA 4O9VA 3CS0A 3RXLA 1S5SA 3RM2H 2JDID 4FUEA 2DE8A 3ZVEA 1O2TA 1NFXA 1W0ZU 1GMCF 2L74A 3ZVAA 2ZFPH 4GVUA 4Q80A 2CF8H 2OP9A 3FP6E 2KAIA 3NUMA 3PROA 1OSSA 1VGCC 1TFXA 3F68H 2K0QA 1PPGE 5G4BA 1GMCG 3TPIZ 5DP5A 2ZPRA 4FU9A 1CT2E 3DFLA 1Z71A 4M7GA 3LGWA 3MU0A 5LGOA 2ZCKP 3FP8E 3STJA 1SG8B 1P2NA 4GHQA 2V7QD 3MTYA 1TALA 2IJD1 2PSYA 4TY6A 3DHKH 1Z8JB 1H4WA 1K28D 1CA8B 2BXUH 2ZQ2A 4BAKB 1D6RA 3NXPA 2VVUA 3MNBA 3SJOA 1O5BB 5GNDA 4Y0ZE 1V2MT 4E7NA 1ZPCA 1IOEA 2ZU2A 1CT0E 4JZDH 1SGPE 2F9BH 2WUBA 1P2QA 1HGTH 2QXIA 8GCHG 1DE7H 3F1SB 2Y6TA 1K1PA 3N7DA 3PLBA 1YLNA 1O39A 5FHTA 2ALPA 1PPBH 3P8OA 1KXCA 1O3LA 1ZHPA 2AS9A 4BNRA 1BTUA 2A45B 2O8LA 1QR3E 4YM9A 2EC9H 1GHBF 3PMAB 2FX4A 1GBDA 1B0FA 2NU1E 1JRTA 3GDSA 5TCCA 1IQKA 1GJ4H 1WDIA 1OYTH 2A5KA 1TGCA 1VCPA 2BD8A 3FAOA 1CBWB 1YKTA 2QYIA 1SOZA 2C90B 4X1SU 1KXDA 1SFQB 1DWEH 1UVSH 2GT7A 4M9FA 4BAHB 5E2PA 1Q3XA 3N99A 1QCPA 4Z0KA 1C2HA 3KEEA 5EXNA 1HJ9A 4LXBH 3LJOA 2G8TA 5JYIA 5IDKA 1OKXA 4GCHF 2ALVA 4TT3D 1YLDA 4IN1A 1H9IE 4MNXA 5EJZA 1Z7KA 1NRQH 3GYLB 2G5NA 1S82A 4YT7H 3EA8A 4FU7A 1RTFB 1MKXK 6LPRA 1TGTA 3V7TA 1EX3A 3GCTG 3M35A 1YCPM 4IGDA 1FIWA 4K69A 3P17H 1IQLA 4MPVA 2ZPSA 1ELFA 5K0HA 1GDQA 1ZR0A 3PLPA 1V6DA 2VH6A 3NK8A 2EQNA 2JJ1D 4TWWA 2ZKSA 4Y0YE 5EIYA 5L2YH 3BEUA 3F2FA 1YPGH 3SUDA 3SU6A 1BTPA 1KXEA 5T1VA 2SNWA 4NIXA 1S6HA 5ABWA 2BVXH 1GBAA 1GHAG 5LPFA 1EOJA 5HYOA 3TGKE 1C5RA 2ZP0H 2JH5D 2GV7A 2FOMB 2QA9E 1O2YA 1S83A 1O5EH 3MU8A 1J9CH 1T4VH 1AD8H 2ILNA 4DIHH 3SU3A 1SLVB 1YPHE 2RDLA 1QURH 1THSH 3GDVA 3T62A 3D65E 1IAUA 2WPDD 3JZ1B 1FY8E 1P57B 3M5LA 3STIA 1GJ5H 3TIUA 1SOTA 3SGAE 4ABDA 1XUJA 6GCHF 1FPHH 1HXFH 1GBTA 3PMBB 4ZKOU 2P16A 3B23B 2KCOA 3T5FH 1AI8H 2BLQA 1ZJKA 1MD8A 1OS8A 4AN7A 1D3DB 4NZQA 1GBJA 1ZGIA 5EOKA 1F5KU 2H5CA 3F0OA 2VGCC 2W7SA 2XTTB 5EJ1A 1X7AC 5KECA 1O2JA 1Z6EA 3F0PA 2VB0A 1P3CA 1OYQA 3EQ0H 3AW1A 5EQRA 4P00A 2FDAA 3LC5A 2UWPA 4RT0A 4UEHH 3VXEH 2RA3A 5DP6A 1BBRE 5CHAC 1SGFG 1Y3WA 2ZTZA 2ZFTA 1UK4A 4ABFA 3RXSA 1ELEE 3FN8A 3VB4A 4JZFH 4R8TB 3RM0H 4DY7B 1JOUB 2HVXA 3S7KB 4YTAA 4AYVB 1LMWB 2ZHWH 2K1QA 1ZOMA 2BMGB 3M5OA 1ELTA 5KEDA 1LVOA 1K2I1 1OWKA 4MPXA 4I86A 5EQQA 1WQVH 3F3BA 1WAYB 1D4PB 1LHEH 1TX7A 2ODYB 1D3PB 2ANKH 1LDTT 1CQQA 1YCPK 4AFQA 2G5VA 3RXUA 1RIWC 2F3CE 3OAAD 2ZFFH 3RDZA 1LTOA 1W0YH 3W94A 1WCZA 4AZ2B 3ZYEA 3S69A 3PTBA 3U8RH 3LOXA 1UJ1A 1VJ9U 5IYTA 4X1NU 1QRWA 1K1MA 2YMSC 1HB0B 1QNJA 1QB1A 4AYYB 1GBCA 1M9UA 1O2SA 2PW8H 3SNEA 1EKBB 1GBEA 1GBHA 2VIWA 1FQ3A 1BMLA 2PKSC 4U32A 3UOUA 2BD2A 2P3FH 3TK6A 2Z3EA 1FY1A 3BSQA 2XBYA 2FOHA 1HIAB 4GCHG 2CJIA 2A4QA 3I77A 3M61U 3V0XA 2ODPA 2XNDD 1O0DH 3E0PB 3A8DA 4I33A 4Y7BA 1NS3A 1PJPA 1TA6A 4XBCA 3SBKA 1P05A 1ZHRA 3FZDA 2HVYB 2A7CA 4SGAE 2O9QA 2Z6BD 4HTCH 1GI5A 3TGIE 1XUGA 1IQIA 3DSOA 4X8VH 1C5QA 2BHGA 4B76A 3LU9B 2HALA 4YO9A 3BEIB 2ANYA 4H6SB 4I8LA 1NM6A 2G4UA 1CHOF 2ZHEH 3LH1A 4AG2A 4D9QA 2P94A 1G37A 3RMMH 3PV2A 1SGEE 1VITH 1THRH 1YPMH 4MTBA 2QXJA 1FIZA 3VB7A 1LVMA 4X6PA 2JETB 2AYWA 2ZHFH 1GI3A 3BIUH 4AFSA 5C1YA 5K7RA 1NZQH 2FTLE 3F9FA 4FVDA 1BRBE 1CGHA 1DSTA 6CHAB 2XBWA 3PV5A 9LPRA 2PKAA 1ANEA 1HCGA 1QBOA 1V2QT 4F49A 5J4QA 3BG4C 2QF4A 1SC8U 3QGNB 2Y81A 1S85A 5JBAS 1DICA 4RKOB 3M36A 5F8TA 1JIMA 3MU5A 6GCHG 4BTIB 1C1VH 4HI3A 1FDPA 3H09A 4X2YA 1V2LT 3D62A 2JH0D 1C1SA 2OBQA 1W8BH 2EI7A 3RXTA 2R3YA 1ETRH 1LPZB 1AN1E 1EB1H 1GHAF 3BTKE 2FEQH 1NU7B 3HK6B 3OY5U 5EU8A 5ESTE 1Y3UA 2IPHA 1JWTA 2W6ID 1XUIA 7GCHF 4WMFA 1XKBC 2W26A 3EA7A 1C5ZB 2Q6FA 2PWXA 3LPRA 1C4V2 2FOAA 1BJVA 1MBMA 1UVUH 2GX4A 1UCYK 2FI3E 5EPNA 4ASUD 1GDNA 5DPAA 3ZZCA 1S0QA 2PLXA 1UTPA 1ZYOA 5FPTA 5AVDA 4WWYA 4I8HA 1RGQA 4LK4A 1TAWA 4RT1A 1T8OA 1HV7A 1UCYE 2AMQA 5EXLA 2A7HA 4AG1A 5C0UA 1FLEE 5EJLA 2BQWB 1SQTA 3MNXA 1EFRD 5JB9S 2F9VA 5EQSA 3RXGA 3SGQE 3SNBA 3RXOA 1TNIA 3SW2B 3RXCA 1SHYA 1TX6A 2A31A 3N7OA 2XC5A 3AAUA 8ESTE 3ATKA 1WUNH 5ESBA 1MTNB 1NN6A 1SR5C 4OM9A 1FXYA 1CO7E 5C5OA 4F55A 3F9EA 3VB5A 1GHYH 1HAHH 3QZRA 8GCHF 2JIZD 3PB1E 1KMHB 1DS2E 3KQDA 2SGFE 1NPMA 3UUZA 1C5PA 2CHAB 2YNAA 2D1JA 4MG3A 2KFWA 2PTNA 1UTMA 3SNDA 3BTME 3TLOA 4GLYA 1GHBG 3OFND 1QIXB 2VU8E 1VKYA 3K6ZA 1GBFA 1E37B 1F0TA 3HGPA 1BT7A 4AGKA 2IN2A 4H42U 1GG6C 3VFEA 2A2XH 2PP6A 2QXGA 3PMHB 2EI8A 1G3DA 2FOBA 2ZCLP 3JZ2B 1DDJA 2OINA 1GWAA 4OS1A 5B6LA 5FBIA 5C1UA 4Y8ZA 2M5TA 1K0HA 3EGKH 4IW4E 1GMDG 1W14U 2VVVA 3M5MA 2HRVA 3QN7A 2BDYA 1UCYH 2OC0A 1P3EA 3RLWH 3T27A 4YLQH 1S84A 3P8FA 2I6QA 5I46H 1ESTA 1MTNC 2WPJS 1YC0A 2PFEA 2BLVA 1GI7B 1BIOA 2HNTF 3FVFB 1BITA 3F6UH 1C5SA 2SNVA 4AOQA 3PWCA 2QV1A 1EP6A 1O37A 2Q1JA 2CXVA 1ZTKA 4UD9H 1C5OH 1T4UH 1J8AA 4CREA 1O2KA 4AX9H 3S7HB 1O3DA 2P93A 1K1JA 1O36A 1LKBA 4MPWA 1O2LA 4FETA 3NPSA 2RG3A 4CBNA 2FESH 1V2WT 1BB0B 2ANWA 1C2IA 3RXJA 1UK3A 4X6MA 1DSUA 4JYUH 4BANB 4Q7XA 3ZZDA 3UNSA 2VWOA 2EY4C 1PYTD 1HRTH 1QA0A 2C8YB 3MH4A 3BTTE 2QAAA 1TNLA 1H9HE 2VH0A 3IG6B 1V2OT 2C8WB 4ZHAA 3CS7A 3RC4A 1RTKA 3OY6U 3DFJA 1V2NT 1XUHA 2ZGXH 1NC6A 2NWNA 1CHOG 1GVKB 4AORA 3SJ9A 1JIRA 4ABAA 2BY9X 2RA0A 2ZQ1A 4J1YA 1O5CB 4K3JA 1H8HD 3PV4A 1OPHB 4ISHH 5CHAB 3SUFA 2C8XB 4GSOA 1NESE 2VIDA 4XD7D 2GZ8A 2WPKS 2ZFRH 4ZROA 1C5VA 2A0QB 4YZUA 3UFAA 2AHME 2HGTH 1QL8A 3OU0A 3ZVBA 5DG6A 3LJJA 4FU8A 3SV2H 3RXRA 1FMGA 5DSFA 4NG9H 1F92A 3RXPA 2VJ1A 4TPIZ 2Y5GA 1HAPH 1MKWH 4NSVA 2HNTC 3P92A 1A3BH 3OTJE 1AUJA 3RU4E 4O97A 2R3UA 1CHGA 1GG6B 2AGEX 3TNTA 5A8ZA 3UREA 2FLRH 2OBOA 3BF6H 1O2IA 1ZRKA 2GCTC 1Q2WA 4E05H 1BHXF 4ZKSU 1GHWH 2OUAA 1OOKB 4ISLA 2UUFB 2H9EH 3MH5A 3ZZ3A 1DPOA 2VGCB 1GPZA 3M7TA 1OP2A 1ZSLA 3RXEA 3ESTA 2TGTA 4AB8A 1SGFA 3P6ZB 2C4FH 4B1TA 3PMJA 1W13U 3U1JB 2R2WU 1E0FD 1DVAH 1WQSA 2OC7A 4Y10E 1AVXA 2JKHA 5E0JA 4RN6A 4BXWA 2A4OA 3SHAH 1DLKB 2GZ7A 1INCA 1A0JA 2AH4X 2FS8A 2ZDLA 1A2CH 2WYGA 3ELAH 1EJNA 4DGJA 1BA8B 2Q6GA 1CU1A 1UTNA 1SKYE 3WWFA 1Y3XA 3E1XB 4MLFB 1O35A 4B2CA 3QUMP 2W3IA 1EAXA 5HIZA 3S9AA 1DXWA 2OXSA 2A1DB 5B6OA 1BTHH 1ELDE 2BM2A 4FVBA 3TGJE 2XC0A 1S6LA 2ASUB 5A0BA 1BRCE 1FZZA 5DJ7A 5DP4A 2J97A 1C1MA 3MU1A 4B73A 3RU4D 4BTTB 3K9XB 1PQ5A 3ZV8A 1GJ8B 3KYFA 4X2VA 3D49H 1COWD 1EPTB 1BMAA 2CF9H 2GP9B 1MU6B 1SLWB 1TLDA 2AIPA 1NRSH 1CGIE 1W7GH 1ZTJA 3PO1B 1NO9H 2YMSD 2R2MB 4A7IB 3ITIA 3BEFB 2NU3E 2O8WA 1J15A 1KSNA 4NSYA 1GL1A 1KIGH 2PR3A 3P8NA 4AGJA 3GCOA 3A8CA 2YOLA 1TRMA 1GL0E 3TU7H 2ZGHA 4FUGA 2A5IA 2QF3A 3A80A 4VGCB 3VB3A 2D8WA 2OTVA 1QHRB 4OS7A 1EPTC 3SQHE 1KDQA 4WJG2 3FZZA 2BD7A 3ZYDA 1AE5A 3W1EA 1F0RA 1V2ST 2J92A 4IC6A 3MH7A 2W6JD 2ZFSA 3GS9A 3GY7A 3DCLA 3SV9A 1TQ0B 2ZU3A 1G9IE 1GGDB 3ATWA 2J95A 3GCNA 1BRUP 5GCHF 4RSPA 1H8DH 2G52A 1GMHG 1QTFA 1FV9A 3VPKA 1P8VC 1TGSZ 3BTQE 4Y79A 3NKKA 2XXLA 1LHGH 1TBRH 4BOHA 2A32A 1PQ7A 1FNIA 2KX4A 3GOVB 1DFPA 1V3XA 2XWAA 2Y5FA 3SJ8A 1MU8B 3RLYH 3FKSD 2BY5X 1YYY1 4OGXA 1FI8A 1YPKH 2FLBH 2O8TA 4CBOA 2TPIZ 2G81E 2Z9GA 3MNCA 1LVYA 2BQ7B 2BD4A 4Q7YA 2WPLS 3BTHE 4HZHA 3V3MA 4NFEA 3GY2A 1GI8B 3E16B 1XUFA 5AF9H 5DP9A 1QA7A 1TONA 3OTPA 1C1WH 1UHBB 3OEHD 1EZQA 2FWWA 3A81A 2J98A 1C1RA 1A3EH 5GXPA 2ZZUH 2Z9JA 1Z8IB 1C1UH 3QK1A 2PUXB 3VGCB 4IS5A 1O2HA 2SGQE 2PKAB 5C5NA 2GJGA 1ARCA 1EZSC 2FOFA 4GAWA 1VGCB 2FTMA 4X1RU 3RXVA 1C1QA 1RRKA 4NGAH 5F53A 1O5FH 1SQOA 3U28C 4KTUA 2WPMS 3ATIA 1GI1A 1CSOE 5TJXA 1TIOA 1SPJA 1P01A 5DGJA 3DSPA 3E8LA 4YOJA 1V2UT 1O32A 2G4TA 4X8SH 1F5LA 2H9TH 3VG8A 2K8IA 1ZPZA 3LC3A 1GJAB 1DX5M 1DOJA 5T6GA 1SQRA 2WUCA 1PPCE 3F9GA 3TK9A 1HIAA 1YY3A 2UWOA 1AWHB 1P04A 1LQEA 2EA3A 2XCNA 1C5LH 1GGDC 2J2UA 1TOCB 1TX8A 1G2LA 1ANBA 1P0SH 1J16A 1XUKA 1KLTA 1OXGA 2AGIX 4NCYA 2AFQB 2GCHG 1Y5AT 1ID5H 4K1TA 4DG4A 1ZMNA 4CR5A 1ELGA 2AIQA 5GIBA 5EW1H 1N8OC 1SGNE 2PUQH 4Q63A 4DT4A 1BJUA 1QRXA 1NRRH 1VCWA 4ISNA 5C17A 1O3MA 3LONA 2KR7A 3SNCA 3GCHB 3PRBA 2RFKC 1UTQA 1UTKA 2DUCA 2BB4A 1QBNA 4UFDH 3KN2A 1E35B 3A7TA 1C2LA 2LELA 2G51A 1HPGA 1T8NA 4F4OC 1BTWA 1D6WA 2V6NA 1UK2A 3A88A 1YLCA 3SUEA 1C5UA 1C1OA 4UFGH 2CV3A 1XVMA 1K1IA 3PO1C 4FUBA 1Q31A 1UHBA 5IK2D 3Q76A 1EXFA 3RXFA 2QXHA 1LPGB 2HLCA 2IOTA 3WY8A 1D3QB 1YM0A 4A1TA 1TPPA 2WV4A 4OS4A 4Y8YA 1EASA 4F48B 4IMZA 1QFKH 1SGQE 1Z6JH 4BAMB 5FCRA 2LPRA 1O2OA 1GVZA 1TPOA 1JRSA 3MFJA 2FOCA 3R3GB 1JXPA 5JBBS 1IQHA 4ZXYH 5C0TA 5FAHA 1LPKB 3ZZAA 1YGCH 1GI4A 3A85A 5HM9A 2A2QH 4ISIH 1EQ9A 2YNBA 4KELA 4ABBA 4Y11E 3ZZBA 2B7DH 3KQBA 1C2DA 1AWFH 1GJ9B 1E79D 1HJAC 1WBGB 1C5MD 5HM2A 1P02A 1BOQA 1T8MA 3HK3B 1ZLRA 3HKIB 2GDEH 1BMNH 2Y82A 2AERH 1ZPBA 1GMDF 1C9TA 1KDQB 4WMEA 4UFEH 3BN9A 1S81A 2DE9A 2GTBA 3BTWE 1O2NA 3DA9B 3SJIA 5C3NA 2ZIQH 1TE0A 2KCPA 2NU4E 3BG8A 3CP7A 1MBQA 1MD7A 3VB6A 5H4IB 1EOLA 1MTVA 3ENSB 1MTWA 1AO5A 1NRPH 2GCTB 4K8BA 5CE1A 4LZ4B 2HPPH 2ZF0H 3RXMA 2TGDA 1OX1A 2CK3D 2CGAA 1GBKA 1UO6A 5JDUB 3UR6A 1ZTLA 1TYNA 4YESB 4Y71A 3TH3H 3SI4H 4SGBE 5F8ZA 2CN0H 2TIOA 3MO9A 4A5TS 3QWCH 2Z94A 3SORA 4WF8A 4ZH8A 2QIQA 4X2XA 1ELAA 4NZLA 4FUFA 4ESTE 2PGQB 3UPEA 3ZIAD 1BTZA 2UUJB 1DUAA 4TY7A 1VITG 1D9IA 5T6DA 1A0LA 1QBVH 5BPEA 1OWEA 3B9FH 2G55A 3NZIA 2F9UA 1KTSB 1AFQB 4H4FA 2GVFA 3SU5A 5C1XA 1O3PB 2ZDAH 1HLTH 3TH2H 1W0KD 3QLPH 1FONA 4WMDA 1NROH 2VWLA 2FODA 2NU2E 4I8GA 2ZU1A 1Z8GA 1L2EA 1O5GH 5EODA 2W7UA 1FY5A 1WU1A 1TB6H 4GPGA 2FZZA 1W11U 5HGGA 1O3FA 2FO9A 3O8RA 3Q00A 1EJAA 3DSGA 2OCVB 1H8ED 1LHFH 3NWUA 1OP8A 3PTNA 5A0CA 3LDXH 4D76A 1CA0B 2B0FA 2ZA5A 1CE5A 1VR1H 3ZZ5A 1C9PA 1ELBA 1S6FA 1GHZA 2WPIS 1MTSA 1O2XA 1KXAA 1O38A 4D9RA 5FBEA 1PFXC 4NIWA 2HPQH 2LNCA 2BD5A 1O5DH 2BOHB 5HIYA 2BXTH 1N1LA 4ZKRU 4ISOA 5C2ZA 1EZXC 1SGDE 1W3CA 2SGEE 1A0HB 3E6PH 5J4SA 4Y7AA 4XBBA 1WSSH 1C5XB 1EP5A 1EPTA 4LOYH 4CRAA 1MZAA 1KLJH 3LIWA 3QTOH 4P02A 3TH4H 3A83A 1GJDB 5E0HA 3RXDA 3VGCC 1DWCH 3SYJA 2VWMA 3HATH 5EGMA 1C1TA 3URDA 1YPJH 1ZMLA 2BVRH 1TQ7B 1V2JT 2BDAA 2SFAA 2WHXA 1YCPH 3ZZ9A 3ZVDA 3AW0A 1EAWA 1PPFE 4X6OA 3A8BA 1QJ6B 2CHAC 1SFIA 2PGBB 1V2VT 3Q77A 3L3TA 2ZI2H 3ZZ6A 4X0WU 2C8ZB 3NCLA 2ZEBA 4LZ1H 1QRZA 1QZ8A 1QL7A 1NU9A 4K2YA 5L2ZH 1HAIH 4D8NA 1QB9A 2B9LA 1A5GH 4RI0A 8LPRA 1ETSH 2ZDMA 1V2PT 1GCDA 5AHGH 2J4IA 7KMEH 2H6MA 3EYDA 1GCTC 1SI5H 3KGPA 1P2IA 3F2HA 4FUJA 4B6FA 3UR9A 1CT4E 1ZJDA 3BV9B 3LH3A 4MQAA 1O3EA 1BBRK 1HAVA 1EUFA 1L4DA 2VVCA 4AFZA 2F9NA 4XBDA 2W3KA 1DY8A 1LCYA 4MPUA 1Y59T 1K21H 7GCHG 4IMQA 1TMTH 3RXKA 3FFGA 2TGAA 4ASHA 2BDCA 1OWIA 4NFFA 3UIRA 3MH6A 2GDDA 1HXEH 2GD4B 3GCHC 4A1XA 2ZHQH 1V2RT 1BMFD 4NIVA 2F91A 4XE4A 1O2GH 2EEKA 4X8TH 1AE8H 1K1OA 4TPYA 2ZGCA 3TNSA 1A5IA 1HAGE 1O2QA 2UUYA 1UTOA 1DT2A 3C27B 1NY22 3ODFA 4I8JA 1SVPA 3T28A 1PPZA 3I29A 5F8XA 1H8IH 2TGPZ 5EPYA 1KXFA 1B5GH 1IHSH 3E90B 3GY3A 1FAKH 1JMOH 5DP3A 1TOMH 3EA9A 2J98B 3RXBA 4HGCA 1MUEB 3ZVFA 1AMHA 1GCTB 5ETXA 3KF2A 4WVPE 2GKVE 3DT0H 2J5UA 2R0LA 1SGCA 1OWHA 1P06A 2O8UA 4YOIA 2PHBA 1XX9A 1FAXA 5GWZA 1MQ6A 1TMBH 5FCKA 2H9HA 1SHHB 2BLOA 3SOSA 1YPHC 1L1GA 3LGUA 1YPEH 2OQ5A 3RXAA 1PPEE 3SV6A 4B74A 2QC2A 5KGOA 1T31A 1BHXB 2ZU4A 1TWXB 3PLKA 4Y8XA 1TABE 2A7JA 4MNWA 1T7CA 1W12U 2HWLB 2Z9LA 5DP7A 1MABB 4JK6A 4OS5A 5F6MA 3Q3XA 1MKXH 3VXFH 4ABEA 3RC6A 1GDUA 2D26C 3D23A 1O3IA 4ABIA 3UWJH 2ODQA 3HGNA 1NBMD 2ULLA 1G30B 5E8EH 3W95A 8KME2 3K65B 2VIQA 1IQFA 2FI5E 1QB6A 1AKSB 1GJBB 3TJVA 4I7YH 1T8LA 2F9PA 3K6YA 4JMYA 3GISB 2XNIA 4IN2A 2HNTE 1FN6A 2H5DA 1A1RA 3RMNH 1FPCH 4NA7A 3M7UA 5HMAA 2WSSD 4OS6A 5FXLA 1SGYE 4AC9A 1NFWA 1WXRA 4QT8C 1KTTB 2CMYA 1NFYA 2H2ZA 4YOGA 2GCHF 4K1SA 3F2GA 4K60A 3KYGA 1ANCA 4DURA 2PTCE 2A4RA 3P95A 2AMPA 1LHCH 2RDEA 1SQAA 1A46H 1XVOA 1LKAA 2BY8X 2FP7B 2FPZA 1GMHF 5DO4H 1P2OA 2KCAA 5DK1A 1MKWK 2M2AA 1GVLA 4WH6A 4BAQB 3AVZA 5GDSH 3A82A 3WW7A 2ZO3H 3TITA 3FOAA 1P11E 5JBCS 2XOKD 2OC8A 2FYRA 2J9NA 1PQAA 2GMTB 5A2MH 4UDWH 1BQYA 5A0AE 1GHVH 4THNH 3ATMA 1JBUH 1O3BA 1ZRBA 4X8UH 1NRNH 3LKWA 5HKKD 3KHVA 1TPAE 2BTCE 1YWUA 3A8AA 1RTLA 1ZSKA 2BDBA 3DUXH 3PRDA 2GZ9A 4U01A 1TBZH 3A84A 3S9CA 3LGYA 1ACBE 1DM4B 2Z3DA 3ZZ8A 5E0GA 1AB9B 2WPHS 1NFUA 2KM0A 1BUIA 4Q2KA 3ATLA 3WWBA 1C4Y2 1KXBA 4K8YA 5GPIB 2BOKA 1RJXB 3F9HA 2TBSA 2FX6A 1H9LB 1PYTC 2J34A 1IQEA 3UNRA 4IC5A 2BY6X 3P70B 4NWLA 1O2VA 3KQCA 3QTVH 2FOGA 5PTPA 1Y3VA 1GJ7B 1HAZB 3EE0B 1C2FA 2BX4A 2AGGX 3Q3KA 2AEIH 1HYLA 3BTDE 1ZMJA 1AUTC 3A87A 4DIIH 4X2WA 1ZZZA 2ZDNA 2BZ6H 2ZGJA 2QF0A 2UUKB 3GICB 4BAOB 2XRCA 1QGFA 5LH8A 3P8GA 4ZKNU 1XKAC 1IQGA 4DW2U 3RU4T 1EAIA 2I6SA 1YPLH 1H1BA 1AHTH 1YF4A 2VBCA 1Y5BT 5FX5A 5I25A 3V13A 1WYKA 4UE7H 1HAOH 2BDGA 2WYJA 3BTEE 1SB1H 3CENA 3RUOA 3UNQA 3MWIU 4MDSA 1C1NA 1P10A 3NRLA 3L6PA 1VCQA 1A4WH 4B2AA 2XBVA 1W2KH 4JYVH 1C5WB 4ZUHA 3SV7A 1C2MA 1C5NH 1NTPA 5BRRE 4Q7ZA 4TYDA 1GBLA 5TCAA 2P95A 1SMFE 2WINI 1UVOA 2VIPA 3AK5A 5SGAE 2BQ6B 1Y3YA 3H7OA 3M7QA 2IJOB 4ZXXH 3GYMA 2F83A 3OSYA 1L4ZA 1AZ8A 3SU0A 3PYHA 3FO8D 2OLGA 3URCA 3PM3A 2ZTYA 1P2MA 5DN6D 3HPTB 3E0NB 3BIVH 2J38A 1HFDA 1W0JD 2XWBI 3HKJB 1C5YB 1N8OB 1TRNA 1AVGH 3IWMA 3OX7U 1MZDA 1SGRE 1THPB 2QY0B 3QDZB 3TVJB 1MQ5A 2GMTC 1LHDH 4ABHA 3RMLH 2WZQA 1B7XB 2ZG0H 4KGAA 1Z8RA 3M3SA 3UQVA 2BVSH 1P2JA 4DT7B 1O2WA 1K9OE 2GV6A 2OK5A 1KLIH 1J17T 1GBMA 1O3KA 5GCHG 2FS9A 4TSFD 4CRGA 4Y76A 2VNTA 1XXFA 2HOBA 2BZAA 4CRBA 2STBE 1ZSJA 2HLDD 3SQEE 2Y7ZA 1P2KA 4ZAEA 1BMMH 3ZZ7A 1ELVA 2F43B 3RC5A 2R0KA 3G01A 1C2KA 4PROA 5E2OA 2C93B 3ODDA 3M3TA 3SGBE 4UONA 2Z3CA 4ACBA 5JPMH 3GY6A 1C2GA 1UTLM 3MHWU 1RXPA 3A7WA 3BTFE 4U30A 2R9PA 4WY3A 4WXVA 5JBTA 1QY6A 3M3VA 1E38B 1YBWA 4INHA 6CHAC 4XSKU 3SZEA 3MYWA 4DJZB 1FN8A 4O03A 1W10U 4CH2B 1TBQH 2Y5HA 2Z9IA 4MNYA 3BG4B 1FY4A 1O33A 4INKA 1FY3A 1O2MA 4HG6A 1DY9A 1O34A 5A8YA 2JETC 1C4U2 4O3TA 2BD9A 5LPRA 3U69H 3A7YA 1ANDA 2ZU5A 3LGIA 4KTSA 2JH6D 1MH0A 4X6NA 3OEED 4D7FA 3SU1A 1UVTH 2SGPE 3B8JA 1ESBA 1AY6H 2TRMA 4BXSA 1XXDA 1FX0B 2G00A 1IHTH 1LO6A 1TA2A 1S0RA 1UVPA 1ETTH 6ESTA 2P59A 1XMNB 2IPQX 1ARBA 1AZZA 3RXIA 1C2EA 3MI4A 1IQJA 1HJAB 2OC1A 1T32A 4WH8A 1MCVA 2XC4A 3A89A 7LPRA 4BTUB 3TJUA 1O5AB 4CH8B 1BBRH 1OWDA 2ZTXA 4AB9A 1HJ8A 3FP7E 1NT1A 1TGBA 3Q3YA 4ZHLU 1TNGA 5L6NH 1MCTA 5GJ4B 3TK5A 3SJKA 2KZ4A 4YLUA 4KP0A 1GJ6A 1OP0A 1L0ZA 3ZV9A 1O31A 3UQOA 5FL7D 4ACAA 1N6YA 4GHTA 4B71A 2ANMH 4Q4LA 1Y5UT 5FX6A 3DD2H 5L30H 3QGJA 2W5EA 2YMSB 2J94A 4JZEH 1F0UA 1TNKA 3KNXA 1O30A 3LT3A 3C1KA 1HAVB 2V35A 2ZHDA 3T2NA 2XW9A 4D7GA 1Z1IA 3AASA 1GJCB 3KQEA 3LGVA 3SZNA 1HAXB 2GT8A 1RS0A 1A7SA 1NBME 3A7XA 2ZCHP 1O3JA 4FXGH 4TWYA 5FPSA 1TNJA 4FUIA 3H7TA 1DXPA 2ZWLH 4FOUC 2F4LA 9ESTA 1Z1JA 4O3UA 4J2YB 2ESTE 4NA9H 1BDAA 1MAYA 1G36A 3TJNA 1GI6A 1UTJA 1WV7H 2Y80A 3PWBA 1AFQC 1OHHD 4U2WA 1SSXA 4I31A 1WOFA 3RXQA 1GBBA 3GCTF 1AU8A 3RMOH 4YXWD 3N7EA 1EB2A 4NWKA 1QL9A 4CR9A 3U8TH 2H1UA 2VIOA 7ESTE 1A5HA 3ZVCA 3ZZ4A 4A1VA 3AAVA 1DWDH 1HAYB 1SLUB 1FUJA 3OYPA 2B5TB 1BRAA 3A86A 4ABJA 3U8OH 5JB8S 3MMGA 2QE7D 3H5CB 5CDFE 1SL3A 1HBTH 4CHAB 2PV9B 2XCFA 4IBLH 1O3NA 1CVWH 3UOPA 1ABJH 1E1RD 1P9UA 1OWJA 1ELCA 1O3GA 1BTYA 1P12E 2F9OA 1DWBH 1QJ7B 2JJ2D 3KL6A 1CGJE 1EAUA 2RCEA 3GY8A 3MO6A 3L33A 2ZPQA 2PSXA 2KAIB 3TJOA 2ZDVH 4A6LA 1C1PA 2ZGBH 2NU0E 3GY4A 1IQMA 1AIXH 5EW2H 1SGTA 4I8KA 4MVNA 1GBIA 3MQKC 1BZXE 2L6OA 2V3OH 3O8BA 3M5NA 2A4GA 4MNVA 1ZHMA 1YP9A 1P03A 4FUCA 2BD3A 5DKMA 1GHXH 1KYNA 2D2DA 4A92A 2OQUA 1AVWA 5LPEA 2ZC9H 4DCDA 1AQ7A 1EZUC 3I78A 2OD3B 1VITF 3MO3A 1XM1A 3IITA 3KQ5A 4JZIA 2Y7XA 1IQNA 2PKSB 2UWLA 2BDHA 2BYAX 1L1JA 4AFUA 3RXHA 1W7XH 3SU2A 4JCNA 3M37A 2FI4E 1ORFA 1SBWA 1Y8TA 4Z1MD 4FUDA 3KCGH 1U6QA 4X1PU 4KTCA 2A5AA 4GUXA 4NA8A 2O8MA 3UWIA 3T29A 4B6EA 5C94A 1RIWB 1BCUH 2FIRH 1G2MA 1KY9A 1MAXA 3LGTA 4HFPB 4FUHA 4NIYA 3UY9A 2P8OB 1ESAA 3UTUH 3A7ZA 2QCYA 1DANH 1LQDB 3EE7A 1GI0A 1EJMA 4RKJB 5A8XA 1B0EA 4K5ZA 2AMDA 4VGCC 1D3TB 1MMJN 1G3BA 1O2ZA 2VIVA 5EXMA 4OGYA 4K1EA 1HDTH 1UMAH 3E3TA 1F7ZA 5HXFA 2Z7FE 4YT6H 2V3HH 4ZCNA 1HUTH 1J14A 1PQ8A 5T3HA
chains in the Genus database with same CATH topology
1WTGH 1DUEA 1EATA 2FXRA 3R0FA 2SGAA 3QZQA 3FANA 1F2SE 1O3AA 4KKDA 1DLEA 1V2TT 1V2KT 2BLWA 3MU4A 3SHCH 1O2RA 1BTXA 3U9AH 2FYQA 5F03A 3SUGA 1QQUA 4DOQA 4B2BA 4JZ1A 2QGRA 1P09A 1SLXB 1RD3B 1MTUA 2BX3A 1QQ4A 4Z6AH 1CBWC 1TMUH 2B8OH 2XBXA 5C20A 2Q6DA 1TPSA 1PPHE 4ABGA 5AFYH 3S0NA 1A61H 3VEQB 2EI6A 5CMXH 5C67A 3S9BA 3V12A 4JYTA 2BDIA 2FM2A 2P3TB 1WTHD 3K2UA 2GGVB 1E36B 3E91A 3T25A 3A7VA 1HNEE 1E34B 1VJAU 5AFZH 5T6FA 4X1QU 2FOEA 4OS2A 1F5RA 2Z9KA 5EG4A 2BY7X 1F0SA 3QX5H 4B75A 1N6XA 1O3OA 3U1IB 2ZECA 2ZDKA 3GY5A 1GI9B 3BTGE 1K1LA 3ZVGA 3U98H 4E06H 1G32B 4CHAC 2QN5T 3MNSA 4ZMAH 3RP2A 2C3SA 1O3HA 2WV5A 1QJ1B 1AKSA 4JK5A 3O8CA 1G3EA 1AGJA 2ZNKH 1DITH 4I32A 4CRDA 3SU4A 5A09A 3SI3H 1O3CA 2XYAA 1AB9C 3SN8A 1RFNA 1P9SA 1ZGVA 4CRFA 3SNAA 2ZFQH 2FMJA 4Y6DA 4DVAU 2V0BA 2P3UB 1C5TA 2VWNA 1VZQH 3O8DA 3SV8A 1GI2A 2THFB 4UFFH 1K22H 4WXIA 1AFEH 1ABIH 1K1NA 4XDEA 4CRCA 3MOCA 1O2UA 1CA0C 2P8OC 2SGDE 3SO3A 3EAJA 4XOJA 4ZHMU 2STAE 3KIDU 1TGNA 2VINA 1FJSA 3T26A 1TRYA 4E7RG 1O2PA 1SGIB 1LVBA 3QO6A 5FPYA 1TNHA 1C2JA 5DP8A 4R0IA 1L1NA 3EDXB 1G3CA 4INLA 4XFQA 3GDUA 4H6TA 4O9VA 3CS0A 3RXLA 1S5SA 3RM2H 4FUEA 2DE8A 3ZVEA 1O2TA 1NFXA 1W0ZU 1GMCF 3ZVAA 2ZFPH 4GVUA 4Q80A 2CF8H 2OP9A 3FP6E 2KAIA 3NUMA 3PROA 1OSSA 1VGCC 1TFXA 3F68H 5G4BA 1PPGE 1GMCG 3TPIZ 5DP5A 2ZPRA 4FU9A 1CT2E 3DFLA 1Z71A 4M7GA 3LGWA 3MU0A 5LGOA 2ZCKP 3FP8E 3STJA 1SG8B 1P2NA 4GHQA 3MTYA 1TALA 2PSYA 4TY6A 3DHKH 1Z8JB 1H4WA 1K28D 1CA8B 2BXUH 2ZQ2A 4BAKB 1D6RA 3NXPA 2VVUA 3MNBA 3SJOA 1O5BB 4Y0ZE 1V2MT 4E7NA 1ZPCA 1IOEA 2ZU2A 1CT0E 4JZDH 1SGPE 2WUBA 2F9BH 1P2QA 1HGTH 2QXIA 8GCHG 1DE7H 3F1SB 2Y6TA 1K1PA 3PLBA 1O39A 5FHTA 2ALPA 1PPBH 3P8OA 1KXCA 1O3LA 1ZHPA 2AS9A 4BNRA 1BTUA 2A45B 2O8LA 1QR3E 4YM9A 2EC9H 1GHBF 3PMAB 2FX4A 1GBDA 1B0FA 2NU1E 1JRTA 3GDSA 5TCCA 1IQKA 1GJ4H 2A5KA 1OYTH 1TGCA 1VCPA 2BD8A 3FAOA 1CBWB 1YKTA 2QYIA 1SOZA 2C90B 4X1SU 1KXDA 1SFQB 1DWEH 1UVSH 2GT7A 4BAHB 5E2PA 1Q3XA 1QCPA 4Z0KA 1C2HA 3KEEA 5EXNA 1HJ9A 4LXBH 3LJOA 2G8TA 5JYIA 5IDKA 1OKXA 4GCHF 2ALVA 1YLDA 4IN1A 1H9IE 4MNXA 1Z7KA 1NRQH 3GYLB 2G5NA 1S82A 4YT7H 3EA8A 4FU7A 1RTFB 1MKXK 6LPRA 1TGTA 3V7TA 1EX3A 3GCTG 3M35A 1YCPM 4IGDA 1FIWA 4K69A 3P17H 1IQLA 4MPVA 2ZPSA 1ELFA 5K0HA 1GDQA 1ZR0A 3PLPA 1V6DA 2VH6A 3NK8A 4TWWA 2ZKSA 4Y0YE 5L2YH 3BEUA 1YPGH 3SUDA 3SU6A 1BTPA 1KXEA 2SNWA 4NIXA 1S6HA 5ABWA 2BVXH 1GBAA 1GHAG 5LPFA 1EOJA 5HYOA 3TGKE 1C5RA 2ZP0H 2JH5D 2GV7A 2FOMB 2QA9E 1O2YA 1S83A 1O5EH 3MU8A 1J9CH 1T4VH 1AD8H 2ILNA 4DIHH 3SU3A 1SLVB 1YPHE 2RDLA 1QURH 1THSH 3GDVA 3T62A 3D65E 1IAUA 3JZ1B 3M5LA 1FY8E 1P57B 3STIA 3TIUA 1GJ5H 1SOTA 3SGAE 4ABDA 1XUJA 6GCHF 1FPHH 1HXFH 1GBTA 3PMBB 4ZKOU 2P16A 3B23B 3T5FH 1AI8H 2BLQA 1ZJKA 1MD8A 1OS8A 4AN7A 1D3DB 4NZQA 1GBJA 1ZGIA 5EOKA 1F5KU 2H5CA 2VGCC 2W7SA 2XTTB 1X7AC 1O2JA 1Z6EA 2VB0A 1P3CA 1OYQA 3EQ0H 3AW1A 5EQRA 2FDAA 3LC5A 2UWPA 4UEHH 3VXEH 2RA3A 5DP6A 1BBRE 5CHAC 1SGFG 1Y3WA 2ZTZA 2ZFTA 1UK4A 4ABFA 3RXSA 1ELEE 3VB4A 4JZFH 4R8TB 3RM0H 4DY7B 1JOUB 2HVXA 3S7KB 4YTAA 4AYVB 1LMWB 2ZHWH 2K1QA 1ZOMA 2BMGB 3M5OA 1ELTA 1LVOA 1K2I1 1OWKA 4MPXA 5EQQA 1WQVH 1WAYB 1D4PB 1LHEH 1TX7A 2ODYB 1D3PB 2ANKH 1LDTT 1CQQA 1YCPK 4AFQA 2G5VA 3RXUA 1RIWC 2F3CE 2ZFFH 3RDZA 1LTOA 1W0YH 3W94A 1WCZA 4AZ2B 3ZYEA 3S69A 3PTBA 3U8RH 3LOXA 1UJ1A 1VJ9U 5IYTA 4X1NU 1QRWA 1K1MA 1HB0B 1QNJA 1QB1A 4AYYB 1GBCA 1M9UA 1O2SA 2PW8H 3SNEA 1EKBB 1GBEA 1GBHA 2VIWA 1FQ3A 1BMLA 2PKSC 4U32A 3UOUA 2BD2A 2P3FH 3TK6A 2Z3EA 1FY1A 3BSQA 2XBYA 2FOHA 1HIAB 4GCHG 2CJIA 2A4QA 3I77A 3M61U 3V0XA 2ODPA 1O0DH 3E0PB 3A8DA 4I33A 4Y7BA 1NS3A 1PJPA 1TA6A 4XBCA 3SBKA 1P05A 1ZHRA 3FZDA 2A7CA 4SGAE 2O9QA 2Z6BD 4HTCH 1GI5A 3TGIE 1XUGA 1IQIA 4X8VH 1C5QA 2BHGA 4B76A 3LU9B 2HALA 4YO9A 3BEIB 2ANYA 4H6SB 4I8LA 1NM6A 2G4UA 1CHOF 2ZHEH 3LH1A 4AG2A 4D9QA 2P94A 1G37A 3RMMH 1SGEE 1VITH 1THRH 1YPMH 4MTBA 2QXJA 1FIZA 3VB7A 1LVMA 4X6PA 2JETB 2AYWA 2ZHFH 1GI3A 3BIUH 4AFSA 5C1YA 5K7RA 1NZQH 2FTLE 3F9FA 4FVDA 1BRBE 1CGHA 1DSTA 6CHAB 2XBWA 9LPRA 2PKAA 1ANEA 1HCGA 1QBOA 1V2QT 4F49A 5J4QA 3BG4C 1SC8U 3QGNB 2Y81A 1S85A 5JBAS 1DICA 4RKOB 3M36A 5F8TA 1JIMA 3MU5A 6GCHG 4BTIB 1C1VH 4HI3A 1FDPA 4X2YA 1V2LT 3D62A 2JH0D 1C1SA 2OBQA 1W8BH 2EI7A 3RXTA 2R3YA 1ETRH 1LPZB 1AN1E 1EB1H 1GHAF 3BTKE 2FEQH 1NU7B 3HK6B 3OY5U 5EU8A 5ESTE 1Y3UA 2IPHA 1JWTA 1XUIA 7GCHF 4WMFA 1XKBC 2W26A 3EA7A 1C5ZB 2Q6FA 2PWXA 3LPRA 1C4V2 2FOAA 1BJVA 1MBMA 1UVUH 2GX4A 1UCYK 2FI3E 5EPNA 1GDNA 5DPAA 3ZZCA 1S0QA 2PLXA 1UTPA 1ZYOA 5FPTA 5AVDA 4WWYA 4I8HA 1RGQA 4LK4A 1TAWA 1T8OA 1HV7A 1UCYE 2AMQA 5EXLA 2A7HA 4AG1A 1FLEE 2BQWB 1SQTA 3MNXA 5JB9S 2F9VA 5EQSA 3RXGA 3SGQE 3SNBA 3RXOA 1TNIA 3SW2B 3RXCA 1SHYA 1TX6A 2A31A 3N7OA 2XC5A 3AAUA 8ESTE 3ATKA 1WUNH 5ESBA 1MTNB 1NN6A 1SR5C 1FXYA 1CO7E 5C5OA 3F9EA 3VB5A 1GHYH 1HAHH 3QZRA 8GCHF 3PB1E 1DS2E 3KQDA 2SGFE 1NPMA 3UUZA 1C5PA 2CHAB 2YNAA 2D1JA 4MG3A 2PTNA 1UTMA 3SNDA 3BTME 3TLOA 4GLYA 1GHBG 1QIXB 2VU8E 3K6ZA 1GBFA 1E37B 1F0TA 3HGPA 1BT7A 4AGKA 2IN2A 4H42U 1GG6C 3VFEA 2A2XH 2QXGA 3PMHB 2EI8A 1G3DA 2FOBA 2ZCLP 3JZ2B 1DDJA 2OINA 1GWAA 4OS1A 5FBIA 5C1UA 4Y8ZA 2M5TA 3EGKH 4IW4E 1GMDG 1W14U 2VVVA 3M5MA 2HRVA 3QN7A 2BDYA 1UCYH 2OC0A 1P3EA 3RLWH 3T27A 4YLQH 1S84A 3P8FA 2I6QA 5I46H 1ESTA 1MTNC 2WPJS 1YC0A 2PFEA 2BLVA 1GI7B 1BIOA 2HNTF 3FVFB 1BITA 3F6UH 1C5SA 2SNVA 4AOQA 3PWCA 2QV1A 1EP6A 1O37A 2Q1JA 2CXVA 1ZTKA 4UD9H 1C5OH 1T4UH 1J8AA 4CREA 1O2KA 4AX9H 3S7HB 1O3DA 2P93A 1K1JA 1O36A 1LKBA 4MPWA 1O2LA 3NPSA 2RG3A 4CBNA 2FESH 1V2WT 1BB0B 2ANWA 1C2IA 3RXJA 1UK3A 4X6MA 1DSUA 4JYUH 4BANB 4Q7XA 3ZZDA 3UNSA 2VWOA 1PYTD 1HRTH 1QA0A 2C8YB 3MH4A 3BTTE 2QAAA 1TNLA 1H9HE 2VH0A 3IG6B 1V2OT 2C8WB 4ZHAA 3CS7A 3RC4A 1RTKA 3OY6U 3DFJA 1V2NT 1XUHA 2ZGXH 1NC6A 2NWNA 1CHOG 1GVKB 4AORA 3SJ9A 1JIRA 4ABAA 2BY9X 2RA0A 2ZQ1A 4J1YA 1O5CB 4K3JA 3PV4A 1OPHB 4ISHH 5CHAB 3SUFA 2C8XB 4GSOA 1NESE 2VIDA 2GZ8A 2WPKS 2ZFRH 4ZROA 1C5VA 2A0QB 4YZUA 3UFAA 2HGTH 1QL8A 3OU0A 3ZVBA 5DG6A 3LJJA 4FU8A 3SV2H 3RXRA 1FMGA 4NG9H 1F92A 3RXPA 2VJ1A 4TPIZ 2Y5GA 1HAPH 1MKWH 4NSVA 2HNTC 3P92A 1A3BH 3OTJE 1AUJA 3RU4E 4O97A 2R3UA 1CHGA 1GG6B 2AGEX 3TNTA 5A8ZA 3UREA 2FLRH 2OBOA 3BF6H 1O2IA 1ZRKA 2GCTC 1Q2WA 4E05H 1BHXF 4ZKSU 1GHWH 2OUAA 1OOKB 4ISLA 2UUFB 2H9EH 3MH5A 3ZZ3A 1DPOA 2VGCB 1GPZA 3M7TA 1OP2A 1ZSLA 3RXEA 3ESTA 2TGTA 4AB8A 1SGFA 3P6ZB 2C4FH 4B1TA 3PMJA 1W13U 3U1JB 2R2WU 1E0FD 1DVAH 1WQSA 2OC7A 4Y10E 1AVXA 2JKHA 5E0JA 4RN6A 4BXWA 2A4OA 3SHAH 1DLKB 2GZ7A 1INCA 1A0JA 2AH4X 2FS8A 2ZDLA 1A2CH 2WYGA 3ELAH 1EJNA 4DGJA 1BA8B 2Q6GA 1CU1A 1UTNA 1Y3XA 3E1XB 4MLFB 1O35A 4B2CA 3QUMP 2W3IA 1EAXA 3S9AA 1DXWA 2OXSA 2A1DB 5B6OA 1BTHH 1ELDE 2BM2A 4FVBA 3TGJE 2XC0A 5A0BA 2ASUB 1BRCE 1FZZA 5DJ7A 5DP4A 1C1MA 3MU1A 4B73A 3RU4D 4BTTB 3K9XB 1PQ5A 3ZV8A 1GJ8B 4X2VA 3D49H 1EPTB 1BMAA 2CF9H 2GP9B 1MU6B 1SLWB 1TLDA 2AIPA 1NRSH 1CGIE 1W7GH 1ZTJA 3PO1B 1NO9H 4A7IB 2R2MB 3ITIA 3BEFB 2NU3E 2O8WA 1J15A 1KSNA 4NSYA 1GL1A 1KIGH 2PR3A 3P8NA 4AGJA 3GCOA 3A8CA 2YOLA 1TRMA 1GL0E 3TU7H 2ZGHA 4FUGA 2A5IA 2QF3A 3A80A 4VGCB 3VB3A 2D8WA 2OTVA 1QHRB 4OS7A 1EPTC 3SQHE 1KDQA 4WJG2 3FZZA 2BD7A 3ZYDA 1AE5A 1F0RA 1V2ST 2J92A 4IC6A 3MH7A 3GY7A 2ZFSA 3SV9A 1TQ0B 2ZU3A 1G9IE 1GGDB 3ATWA 2J95A 3GCNA 1BRUP 5GCHF 4RSPA 1H8DH 2G52A 1GMHG 1QTFA 1FV9A 3VPKA 1P8VC 1TGSZ 3BTQE 4Y79A 3NKKA 2XXLA 1LHGH 1TBRH 4BOHA 2A32A 1PQ7A 1FNIA 3GOVB 1DFPA 1V3XA 2XWAA 2Y5FA 3SJ8A 1MU8B 3RLYH 2BY5X 1YYY1 4OGXA 1FI8A 1YPKH 2FLBH 2O8TA 4CBOA 2TPIZ 2G81E 2Z9GA 3MNCA 1LVYA 2BQ7B 2BD4A 4Q7YA 2WPLS 3BTHE 4HZHA 3V3MA 4NFEA 3GY2A 1GI8B 3E16B 1XUFA 5AF9H 5DP9A 1QA7A 1TONA 1C1WH 1UHBB 1EZQA 2FWWA 3A81A 1C1RA 1A3EH 5GXPA 2ZZUH 2Z9JA 1Z8IB 1C1UH 3QK1A 2PUXB 3VGCB 4IS5A 1O2HA 2SGQE 2PKAB 5C5NA 1ARCA 1EZSC 2FOFA 4GAWA 1VGCB 2FTMA 4X1RU 3RXVA 1C1QA 1RRKA 4NGAH 1O5FH 1SQOA 4KTUA 2WPMS 3ATIA 1GI1A 1CSOE 5TJXA 1TIOA 1SPJA 1P01A 5DGJA 3E8LA 4YOJA 1V2UT 1O32A 2G4TA 4X8SH 1F5LA 2H9TH 1ZPZA 3LC3A 1GJAB 1DX5M 1DOJA 5T6GA 2WUCA 1PPCE 3F9GA 3TK9A 1HIAA 2UWOA 1AWHB 1P04A