3OY6U

The crystal structure of upa complex with peptide inhibitor mh036 at ph4.6
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy6U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy6U01
2ZP0H 1C5QA 2WPIS 1UTQA 1WBGB 2V3OH 1Y3XA 2W3IA 5EQSA 2A4OA 4BNRA 4JZEH 1CVWH 1S83A 1O2TA 4B74A 3DT0H 3RMNH 1HAXB 4X2XA 1DX5M 4NWKA 1GHWH 4I33A 1CGIE 1LVBA 3STJA 3RXDA 2GKVE 1YPGH 1O30A 4O03A 2OC7A 2J2UA 4HZHA 4WVPE 3U1JB 2O8MA 1GI3A 2QY0B 1NZQH 2AIPA 4VGCC 1P2MA 4YOJA 2W26A 4FUCA 4ZHMU 2CHAC 1CSOE 1QJ1B 1TMBH 1AUTC 2ZFFH 3ATWA 5EODA 5LPRA 2ZEBA 5BPEA 2ZFPH 1X7AC 2SGFE 3AAUA 2UUYA 3ODDA 4NA7A 4Y0ZE 4Q7XA 1XUFA 2BLVA 1TWXB 1SL3A 4OS6A 1YM0A 3ZVDA 2XTTB 4Y7AA 2CF8H 4MPUA 4O9VA 1C1WH 1GI2A 2VU8E 3UOPA 4NSYA 1A61H 4YM9A 3BEFB 1PPFE 1GBMA 1C1TA 1O35A 2FOHA 5EW1H 3RXSA 7LPRA 2BMGB 4H6SB 1YCPM 2IPHA 1SLWB 2PUQH 1DY8A 3O8DA 1O33A 1UCYK 2BQ6B 3SJIA 1GJ4H 1KXAA 2VGCB 2BD2A 2TPIZ 1BDAA 5EPYA 1FNIA 1FXYA 1EASA 1P2IA 1S0QA 2VIVA 2A7HA 2EI6A 1GL1A 2XRCA 3UIRA 2ZHQH 1L4DA 2F9UA 3WY8A 1V2PT 2XCNA 1LPZB 2R2MB 3RXVA 1NFYA 1RTKA 1F0SA 1C2MA 2BZ6H 3SU2A 2IOTA 2JH6D 2ZWLH 1GBCA 1G32B 5K7RA 1LQDB 1RIWB 3DUXH 3FANA 2PSYA 2YNAA 1K1JA 4THNH 3FZZA 1OYTH 3E16B 4KKDA 1PQ8A 3B23B 1CGJE 1UVPA 1JXPA 1BBRK 4NA8A 2JH0D 1HAIH 3P92A 1LO6A 1O2NA 5K0HA 2Z3DA 3Q3XA 1O3GA 1Y3UA 3RM2H 2BD9A 2GV7A 2ZGJA 1XXDA 5GIBA 4AN7A 1MZDA 3MU4A 1CBWC 2Y5GA 1KXCA 1MKXK 2ZGBH 1K1OA 1YPLH 3T25A 1CE5A 1U6QA 3KQDA 1C1UH 3KL6A 1SGYE 1LHFH 3KHVA 3ZZ6A 4BAMB 2FXRA 1TGNA 1HV7A 5CHAC 3SNAA 1PJPA 3RLWH 4CRAA 3OSYA 3GDUA 2UUJB 3L33A 4YLUA 5DP3A 1BTPA 4D9QA 1F2SE 4YESB 3ZVAA 1Q2WA 1GBKA 1TAWA 1UVSH 1DVAH 3VXFH 1E37B 1O3CA 2J4IA 1KLIH 2H5CA 3MO6A 2AH4X 3BTHE 3UOUA 2A5KA 2HGTH 1MU6B 1ZMJA 1GBIA 3ENSB 1ABIH 2CGAA 4A1TA 5EU8A 5FBIA 2BHGA 3M7QA 2JETB 3PV4A 1SI5H 1DPOA 2BDHA 5C1XA 2GP9B 9LPRA 1O3JA 2KAIA 2Z3EA 1AFQB 3LGIA 4DIIH 1G3BA 1BBRE 1ZLRA 1O3IA 1QL9A 3O8BA 1K1LA 1YLCA 1W10U 3DD2H 2PGBB 1IQGA 4IC5A 3U8OH 4Y8XA 1J9CH 1KTTB 2FP7B 1GDNA 4IC6A 1UTJA 1KDQB 3M5NA 3M3TA 2RA3A 1S6HA 2ULLA 1C5PA 2O8UA 1MZAA 2ZKSA 3ATLA 2C8ZB 4O3TA 3CP7A 2FX6A 3SU6A 1A5HA 1G2LA 5I46H 2BD3A 1TIOA 3E8LA 4TPIZ 3QWCH 1C1QA 3MU8A 1GJDB 5SGAE 1G9IE 3MO3A 2VNTA 3PLPA 4DT7B 3M5OA 5ABWA 2J95A 1H8IH 1PQAA 4WY3A 1A46H 3ODFA 4NIVA 2PWXA 2RA0A 2ZQ2A 1SGNE 1AZZA 1DUEA 4ZKOU 3ZVCA 1HAOH 1LHGH 1FY1A 3EE0B 3ZZ8A 3TGKE 1DITH 1O3AA 5HM9A 1C9PA 2H9EH 3FZDA 3KQBA 1W7XH 2OP9A 1MKWK 1CA8B 3P70B 1EAUA 1P2OA 4INKA 2FESH 5TCCA 5JBCS 2ZU4A 2WPLS 3GCHC 3NKKA 1AHTH 2V3HH 1O2UA 3M7TA 2FO9A 2QA9E 3E0NB 1FIZA 5AHGH 4IMQA 3ATMA 3T62A 1O5BB 1SGDE 3M35A 2ANMH 3PMHB 1A5IA 2DE8A 1Z6EA 3E91A 1ANDA 1C2LA 1GBFA 3SHAH 2YOLA 1RS0A 1TPAE 2D2DA 1UK4A 4X8SH 5J4SA 2C93B 3SQEE 1G3DA 2GCTB 1LQEA 1DICA 1HJ8A 3AW0A 2AMDA 3ZVGA 6LPRA 1TFXA 3HATH 3PTNA 1O0DH 2LPRA 1CHGA 1GBTA 1KXEA 3GCNA 3OU0A 3QUMP 1PPBH 4CRGA 1V2KT 1K9OE 1KXFA 1NESE 4RSPA 3T28A 1PQ7A 4NA9H 3LKWA 1TPSA 5E0GA 2H9TH 1CA0C 3UQVA 1FAXA 1K1MA 4MNXA 3RXBA 1Y5BT 3S9CA 1IQJA 3IG6B 1XM1A 1GL0E 2Q6DA 2OD3B 1PPHE 1SPJA 1VCPA 1UVUH 3E6PH 3CS7A 3TVJB 1MCVA 2F9PA 4FVDA 4NIWA 4I8LA 5F8TA 4LZ1H 1GMDF 2BOHB 1GPZA 1SGRE 3BTKE 1P10A 4E06H 1ZRKA 1T8OA 1XMNB 2ZHEH 2M5TA 1O3BA 3BN9A 4J1YA 4MNVA 5JB9S 1AN1E 1CT4E 2Z9LA 1GHAG 1ABJH 1GI9B 1O2GH 2VJ1A 1EZUC 1BBRH 2ZPRA 1O5CB 1E34B 3MU1A 2ZHWH 4X2WA 2CHAB 4ZKSU 4O3UA 4X2VA 1ZOMA 4BAOB 2IJOB 1ZSJA 3UPEA 5GPIB 5C2ZA 2GZ9A 1OWHA 1EPTB 3AW1A 3S0NA 1P3EA 4KP0A 4ABBA 3VB5A 2OINA 3PROA 3URDA 3Q3YA 2R2WU 3NK8A 5DPAA 2EC9H 1YPKH 2P3UB 1O34A 8GCHF 1AO5A 1EQ9A 4WH8A 1C1NA 1YGCH 4AFSA 1YBWA 3F1SB 3I78A 2AS9A 4VGCB 3PWBA 1P3CA 1WYKA 2FLRH 4XSKU 3B8JA 2W7SA 5A0AE 1D3TB 3UFAA 4WMDA 1UVOA 1YP9A 2LNCA 1O3MA 3LIWA 2P8OB 1MQ6A 4UFEH 2BY8X 1J15A 1TPPA 1QBNA 4ASHA 2VINA 1TBQH 1AMHA 2G5NA 2FX4A 4Y0YE 3RXGA 2WUBA 3EA7A 4GHTA 4CRDA 3RXLA 3SGAE 2I6QA 1NS3A 3KCGH 1O3NA 1ELEE 1NRSH 2XNIA 4INHA 1GJCB 1LVYA 3ZV8A 4BAQB 1V2TT 1YYY1 4U32A 1O5FH 2VIOA 1IAUA 1ZZZA 2GTBA 1HXFH 2HALA 4GAWA 1ZYOA 5FX6A 2H6MA 4Q7ZA 2Z9KA 1S5SA 2WPMS 4OS5A 2B7DH 2CN0H 1LCYA 1E35B 3SOSA 2J94A 3LC3A 4D7FA 1W14U 2BLOA 3PYHA 1HLTH 2H1UA 3RU4T 1QA0A 3BTDE 1W3CA 3A88A 3ITIA 3PB1E 1NRRH 4AG2A 3ZZ3A 1TOMH 3VB3A 5JBTA 1BITA 1T4VH 4DCDA 2G4UA 2GCHG 1L0ZA 2ZZUH 3U8TH 1OPHB 1ZRBA 1FPCH 1N8OB 1J14A 2F83A 2XW9A 1MKXH 1FJSA 2DE9A 3M5MA 1KTSB 2V0BA 2XWBI 3NWUA 1GBJA 1VGCB 1GBBA 2VWLA 5GXPA 1OP8A 1QQ4A 5A0BA 3RXCA 1GMCG 1JIMA 1OYQA 4ZXXH 1TNGA 1HCGA 5E0JA 1FIWA 3EAJA 2VWNA 2P3FH 2A5AA 1EAIA 1CT0E 3TJUA 2XWAA 3T5FH 5DP9A 4ZKRU 3MO9A 4IW4E 1CT2E 2FS8A 3GY6A 4X6OA 2PR3A 5F8XA 1XKAC 2FODA 2JETC 3A7XA 3V3MA 3R3GB 4AG1A 1GG6C 2WPHS 3W95A 4ESTE 1ESBA 5T3HA 1RRKA 1EB2A 4FUGA 1GBHA 1YF4A 8LPRA 1GJ5H 2NWNA 2OUAA 1SGFG 2BVXH 3EDXB 2D26C 2NU3E 1ELVA 1DXPA 4H42U 1O2WA 4OGYA 1FLEE 1B0EA 1LVMA 4WXIA 2D8WA 2C4FH 2ZHFH 1C5TA 1DUAA 2ZC9H 1SLUB 2ILNA 3A8DA 2NU1E 1O2YA 1UMAH 2O8WA 1D3PB 1GI7B 1H9HE 1P05A 1H9LB 5DJ7A 3BIUH 1GCTB 1GG6B 2SGEE 3GICB 1QGFA 5DGJA 5DP7A 1AQ7A 1KY9A 1O2OA 2OBQA 5DP4A 3LGUA 5LPEA 2PW8H 3PLBA 1W11U 3PMJA 1P09A 3MYWA 4XFQA 4B2CA 4CH2B 4ZUHA 2XCFA 4OS4A 4OGXA 3D62A 1P2KA 1DS2E 2AEIH 4ZKNU 1V2UT 1RD3B 3BTFE 1FN6A 4A1XA 1E36B 1YLDA 3PM3A 5J4QA 4JMYA 3QX5H 1L1NA 1GCDA 3GY7A 1UTPA 1NU7B 2BDBA 1GHZA 4MPWA 1GHBG 1BUIA 3LJOA 1GVKB 1TBRH 5DKMA 3ZVFA 1K1PA 1N6YA 3VXEH 1C2JA 1EB1H 4Z0KA 1AVXA 4I8HA 4CR5A 1L1GA 4AX9H 3MFJA 1UTMA 5F03A 1T31A 1ARCA 2Y6TA 3STIA 4TY6A 5ETXA 1DWDH 1P8VC 4UD9H 4FXGH 1C2KA 4CBNA 1JMOH 2G4TA 1Y3WA 3UUZA 3TGIE 1O3DA 1ZPCA 1MCTA 5FCRA 1SQTA 3M36A 2BDGA 2FOBA 3GOVB 1SHYA 1QL8A 1P57B 5E2PA 3ZZCA 2HNTE 2A4QA 4WH6A 1MH0A 3UNQA 3BEUA 2Z3CA 2UWOA 1KDQA 1NU9A 2AGGX 3A87A 4MPXA 3RC4A 2BLQA 1B0FA 1C5RA 3SNEA 4I8KA 1ZHPA 3HK3B 3F68H 2OQUA 1DWEH 5EGMA 2VH6A 1Y3YA 1W8BH 1ETSH 1VZQH 1GWAA 1ELCA 1JBUH 2WUCA 1TNHA 2G5VA 2WV4A 3LGYA 1HXEH 2FLBH 1LKAA 2O9QA 4Y79A 3LGWA 1MAYA 2ZDLA 4J2YB 1CO7E 1T32A 1S85A 1C5OH 1O31A 1GHXH 3QN7A 2ZTXA 3CENA 5GWZA 3A8AA 1BTUA 3UTUH 1FZZA 2H2ZA 4K1EA 1AKSB 1ZHRA 3ELAH 1QB6A 3DFJA 1W7GH 3RDZA 4A5TS 5L2ZH 2TIOA 2G52A 4HGCA 1C5SA 2SFAA 4FUJA 4ZXYH 1H4WA 1O3OA 1GJBB 2H9HA 2Q6FA 4D9RA 4CH8B 5IDKA 1QHRB 1BMNH 3CS0A 3PMAB 1GBAA 3SJ8A 1FQ3A 1ELTA 1NRNH 3K6ZA 3RMLH 4MPVA 1GMHF 3VGCC 3BTGE 2WYGA 5ESTE 1D3DB 2UUKB 4DJZB 5EQQA 1GJAB 9ESTA 3LU9B 3O8RA 5DP8A 1P02A 2GZ7A 3ZZAA 1Y3VA 2FI5E 3F9GA 4FUIA 3VFEA 4BANB 2BOKA 8KME2 5LH8A 3BTEE 2BDIA 1HAPH 4DW2U 2F9OA 4XBBA 1TRMA 1KYNA 2OBOA 3M37A 1V2WT 2EEKA 1O5AB 1XUIA 1TLDA 4JZ1A 1HFDA 1GBDA 2CMYA 2ZDAH 1DWCH 2STBE 2FOEA 2WPJS 1RFNA 1Z1JA 3MH5A 3P8GA 1E0FD 1EJNA 2QXJA 3H7TA 1UHBA 2Z9IA 3MMGA 4BTTB 4XE4A 4FUBA 3SNDA 1Z8GA 1THSH 3MNSA 5HMAA 3RXTA 3P8FA 3ZZDA 3RUOA 1WQVH 1HPGA 2ZQ1A 1C5VA 2F9BH 1NROH 3QTVH 1QNJA 1TOCB 1RXPA 3FP7E 2ZU1A 1ZSKA 1GJ9B 2XBXA 3FAOA 1OP0A 1DLKB 1MD7A 1DOJA 1EAWA 1OKXA 1F0UA 1O39A 2VWMA 1HJAB 1THPB 1ZGVA 3E3TA 4ABHA 4Y8YA 4K1SA 2ZI2H 4Y10E 1AVGH 3JZ2B 4X1RU 7ESTE 4GLYA 1XUKA 3OX7U 1G37A 1MU8B 5DK1A 1QFKH 1A3EH 1IHSH 1HUTH 2O8TA 3FVFB 1DM4B 3KQEA 2V6NA 2DUCA 1V3XA 1F5RA 4ABDA 2GT7A 1MTWA 3BTTE 2EI7A 3ZZ5A 1TGCA 4K5ZA 1V2OT 1AB9B 4CRFA 2SNVA 3L3TA 2ANYA 5GDSH 4K2YA 1AVWA 3RP2A 4UFGH 5AFZH 1D3QB 3MH6A 3N7OA 3P6ZB 3H5CB 1HAVA 2ZNKH 4WF8A 3BTME 1TONA 1TNKA 1P11E 3UY9A 1O3FA 2ZG0H 3SBKA 1RTLA 1GI0A 2VIQA 3EYDA 1QJ6B 2VIDA 3BEIB 2Z9GA 1TA2A 3EA9A 3SUEA 4ISHH 3LGTA 4MVNA 1L2EA 3SO3A 7GCHF 3BTQE 1HAHH 1V2RT 1TRYA 3QZQA 1GJ7B 2FOAA 4TYDA 3S9AA 1GBEA 1O2VA 4ABAA 5C5NA 3EA8A 1ESTA 5HM2A 1C1MA 3B9FH 3ZZ9A 1SGCA 3BIVH 2ZTYA 1YC0A 3VB7A 2XBWA 1T8MA 1NPMA 1ZHMA 2BX4A 1C5NH 1BTXA 6ESTA 5I25A 3RXOA 3M7UA 1GJ6A 1Z71A 1JRSA 4X1NU 4B75A 3URCA 1BHXF 3SI3H 1O2PA 1PPZA 3LPRA 4D8NA 4E05H 5FCKA 4UFDH 1P06A 2ZGXH 1FMGA 1BQYA 4HI3A 1NTPA 3Q3KA 1BIOA 2Z7FE 4BAKB 5DG6A 1ORFA 2Y7XA 2GMTC 2VVCA 4ZHLU 4B2AA 1GDUA 1A1RA 2ZFTA 3V7TA 3A8BA 4XOJA 4DGJA 1K2I1 3PO1C 3OYPA 1C5UA 2A4RA 2BYAX 2J38A 3S69A 2C3SA 3NUMA 4MDSA 5F8ZA 1M9UA 5T6DA 3T26A 4DOQA 3MWIU 1P2JA 1JIRA 4Y71A 1G36A 3RU4E 4ISOA 2P93A 3A7TA 1Z8RA 2HVXA 2A2QH 2W5EA 1FI8A 2FI3E 1WOFA 2GD4B 2V35A 1OWDA 3T29A 1F5KU 1O2HA 1SGIB 3TIUA 5GJ4B 1OP2A 1HAYB 2OC8A 4ZHAA 3A81A 5T6GA 2C8WB 2JKHA 1QBOA 1BJUA 4ABEA 3H7OA 1ZSLA 3HK6B 2ANKH 2OC0A 2P8OC 3V12A 4YTAA 1RIWC 5HGGA 1GMHG 2QIQA 3RXFA 1T4UH 1JOUB 2G8TA 2NU2E 2FS9A 1C5MD 1DLEA 1MTVA 3BTWE 1TGTA 1TGBA 4FUDA 4DY7B 4O97A 1XVMA 5FAHA 4F4OC 2PHBA 1UCYH 5IYTA 1V6DA 4K8BA 1IQHA 1C1OA 3NPSA 4YT6H 4Q2KA 4UE7H 2ZGCA 3SJ9A 2ODYB 2PFEA 2J9NA 3SUDA 4MNWA 2HOBA 4LXBH 1C2IA 3O8CA 1IOEA 1DSUA 1SOTA 3ATIA 4ZH8A 1DXWA 1P03A 3A7WA 4CRCA 3W94A 1SLVB 1FY3A 3SJKA 1MD8A 2XC4A 3BG4C 1CGHA 1HGTH 5C3NA 1Z7KA 2EI8A 2GVFA 1C9TA 2BDYA 1WTHD 3UNSA 4JZFH 1TNIA 2P95A 4NSVA 5GCHG 2ASUB 1Y5UT 3ZYDA 3NZIA 2ZDMA 4ISLA 3GY2A 1V2MT 3Q76A 2AFQB 4Y8ZA 4U30A 1FUJA 1DSTA 5H4IB 3T2NA 1UCYE 1YCPH 3ZZ7A 4X2YA 4X8UH 3HGPA 2HRVA 4NZQA 4AZ2B 3TJNA 3P8OA 3K65B 1BTYA 1IQKA 1Z8IB 4K3JA 2Y81A 1KXDA 3VGCB 1VR1H 1AFQC 1A0JA 1J16A 2PKAB 2CF9H 1MBQA 1LTOA 3QGJA 1NY22 2P16A 4IS5A 3DFLA 1SVPA 2GGVB 5A8XA 4TWWA 1AE8H 4Y7BA 3SU1A 2J34A 1GI8B 3RXMA 1UTNA 1O2XA 1BMMH 2PKSB 3F9FA 3SNCA 4DVAU 1C2FA 1BMLA 4GHQA 3S7KB 1AUJA 4XDEA 1CHOG 3QTOH 4K60A 2THFB 1ELAA 3K2UA 1KIGH 1MMJN 1SQOA 1C1PA 3C27B 3KNXA 2FOCA 2GX4A 2AIQA 1EZQA 4I7YH 1C4Y2 3A8CA 3D65E 4IBLH 2ZECA 2GT8A 1GGDC 1JRTA 2ZGHA 2UWLA 3AASA 4UDWH 1ID5H 1F5LA 4FUFA 1P2QA 3QK1A 2QXIA 1BA8B 4YZUA 1AB9C 5A8YA 2G55A 1K21H 1GJ8B 3PLKA 2ZDNA 1Y8TA 4X6NA 2AMPA 5FX5A 2BX3A 3LOXA 2ZIQH 3GCHB 3RMOH 1BHXB 4JCNA 2Z94A 3HPTB 2ZCHP 3TPIZ 2FZZA 4OS2A 2OTVA 3A84A 3U9AH 3VPKA 1QL7A 5EOKA 1A0HB 3TNTA 1TNLA 3SORA 3ZV9A 2BDCA 1Y5AT 1DE7H 1ZMNA 1AFEH 2UUFB 1VITF 2Y7ZA 3BG8A 1BT7A 3OY5U 4SGBE 1LPGB 4K69A 2OCVB 1SGPE 1QY6A 3LONA 4ABGA 1W13U 1ELFA 3SV9A 4WJG2 1BRUP 3P95A 1DWBH 3LDXH 1AZ8A 3RXHA 3RXQA 3FP8E 2WV5A 2SGQE 1EJAA 1SFIA 3AVZA 1ANBA 1BRCE 4BOHA 1ZPBA 1Z6JH 2PKAA 4JK5A 3I29A 1TYNA 3GDSA 3UQOA 1BB0B 4H6TA 2PV9B 4TWYA 4IGDA 1MKWH 1L1JA 1GVZA 2PTNA 4GCHG 1WU1A 2BB4A 1HYLA 2ZFRH 5A0CA 1ACBE 5L6NH 1NFUA 1HRTH 1MAXA 1Q31A 2STAE 1BRAA 2PUXB 4BXSA 4I8JA 4DURA 1SSXA 2FTLE 3K9XB 2QN5T 1XUGA 2EA3A 2HNTC 1PPGE 3TH3H 1RJXB 1BTHH 1HIAB 4LK4A 3TH2H 1PYTD 4AYYB 3UNRA 1QQUA 3U98H 3MU0A 1YPEH 1O2SA 3E0PB 4PROA 1DT2A 1Y59T 1CHOF 1EXFA 3BG4B 4X6PA 1DDJA 2G51A 4MLFB 1AU8A 2K1QA 2SNWA 2SGAA 1XVOA 4FUHA 6CHAC 2IN2A 1ETTH 1O3LA 1P04A 1K1NA 2A7JA 2ZU5A 2A32A 3PTBA 3KQCA 3ATKA 4KELA 2W7UA 3I77A 1HJ9A 1LMWB 1NC6A 2XBVA 1UTLM 1MQ5A 5FPYA 4JZDH 5FBEA 1SG8B 4K1TA 6CHAB 1D6RA 3U69H 2JH5D 2BQWB 2VWOA 5C5OA 1C2DA 4YT7H 2BVRH 1YKTA 5C1UA 3V0XA 1N1LA 2FOFA 3RXKA 1WQSA 3ZZ4A 4WMEA 2FOMB 1G3EA 1W0ZU 3U1IB 1UK3A 2CXVA 3QDZB 1HJAC 5AF9H 3QO6A 3SN8A 2BD4A 1O2MA 2A1DB 1O3HA 1J8AA 4Q7YA 3MH7A 4TY7A 1TPOA 1V2QT 2ZU3A 3SV6A 2PGQB 3TK9A 2FWWA 3UWIA 2J92A 2ZA5A 5G4BA 2Z9JA 5FXLA 1P0SH 5EXMA 1AWFH 1GDQA 4X8TH 3IWMA 4FUEA 3RXAA 5L2YH 1O3KA 3LC5A 1GI4A 4MNYA 1O2QA 1TBZH 1W0YH 2BDAA 4M7GA 1C2HA 1UJ1A 2VVVA 5JYIA 4A1VA 5HXFA 4R0IA 3UR9A 3M61U 1PYTC 2FTMA 4IN2A 3VB4A 1G30B 2A0QB 2P94A 1O32A 1OWIA 3SZNA 5LPFA 1ETRH 1SFQB 2P3TB 1BOQA 2ZPSA 2YNBA 4XBCA 1N6XA 1K22H 2GDEH 1GHVH 2QGRA 1NFWA 2XC5A 1ZR0A 1LKBA 4CHAC 1YPHC 2XXLA 3RXPA 3Q77A 3G01A 3PMBB 4D7GA 3IITA 5JDUB 3A85A 4GCHF 2QXGA 2QCYA 2BY9X 1A2CH 2HPQH 5ESBA 1O2JA 5CMXH 4A7IB 3HGNA 1OSSA 1QB9A 3LT3A 5C20A 1V2NT 1SR5C 1VJAU 5E8EH 1MTSA 1AE5A 1FDPA 4NCYA 3K6YA 1V2ST 2CV3A 3GCTG 3SU5A 2C8XB 1TQ7B 1E38B 2ZFSA 4YOGA 4B73A 4WMFA 4Y11E 4MQAA 1A3BH 3LH3A 2RCEA 1GHBF 4FVBA 4AYVB 4UFFH 3RC5A 2OC1A 4JZIA 5E0HA 1AY6H 3S7HB 2B5TB 3LJJA 3AAVA 4NG9H 1EZXC 5EXNA 3UREA 1TMTH 1LVOA 1SHHB 2Y82A 3DA9B 3TH4H 4A92A 2PKSC 4CR9A 4AFZA 1O2IA 1CA0B 4AFQA 1AKSA 3A80A 2B8OH 2ODQA 2BLWA 4AORA 1B7XB 1BRBE 2B9LA 2BQ7B 1WTGH 2PSXA 1TX6A 1ELDE 4KTSA 1HDTH 1EJMA 1WCZA 1NN6A 4GPGA 4NWLA 3HKJB 2TGPZ 2W3KA 1QB1A 3GDVA 4H4FA 1VJ9U 4BXWA 3SGBE 1GMDG 1P9UA 4NGAH 1MUEB 3ZVEA 2FI4E 4NZLA 5HYOA 2A5IA 2HWLB 1PQ5A 1TRNA 4ZAEA 1VCWA 4Z6AH 1YCPK 1TGSZ 2OLGA 3R0FA 1T7CA 1YPJH 1QR3E 2ESTE 2GCHF 2VH0A 1SOZA 1FY4A 3ESTA 1FY5A 1D9IA 1EOLA 4GVUA 1O2RA 4NIXA 3RXRA 5L30H 3TITA 4TPYA 1KXBA 1SGEE 2BTCE 1MTUA 2Y80A 3U8RH 1F0TA 2RG3A 5EG4A 1IQLA 1H8DH 3GY8A 1LHEH 5TCAA 1B5GH 1HBTH 3BF6H 4AB8A 3PO1B 3GCTF 3RXUA 2BD5A 2P59A 3SI4H 1QRXA 2R9PA 4ABIA 4NFFA 1O5GH 1XX9A 3TJVA 2WINI 2GMTB 2ALPA 3NCLA 5FPTA 2Y5FA 4FU8A 4UONA 1INCA 3RXIA 1ZMLA 3A7VA 5GCHF 2FIRH 2GCTC 1UTOA 3TNSA 1NRPH 1SC8U 4RKOB 1TA6A 2FPZA 1O38A 1ZGIA 2G00A 4GUXA 1KLJH 3M5LA 4HTCH 2VVUA 3TK5A 1C5YB 1IQNA 2H5DA 1S82A 5JBBS 4MG3A 3RC6A 1MTNC 2R3YA 4X1SU 1ARBA 3TK6A 4X8VH 4YLQH 5EPNA 4WWYA 1T8NA 1ZTJA 4E7RG 3JZ1B 4R8TB 3V13A 4ABFA 1C1SA 2GDDA 3SJOA 1EPTC 4CREA 3RU4D 4FU7A 1CBWB 3A82A 5CE1A 3P17H 4I8GA 3GY4A 4BTIB 4DG4A 1OXGA 4WXVA 5EQRA 3BV9B 5DP5A 2BXTH 2AGEX 1T8LA 1WAYB 2TBSA 2AMQA 1ESAA 5BRRE 1DFPA 1H1BA 1D6WA 2KAIB 4BTUB 8ESTE 5JBAS 4Q80A 4HFPB 2QF3A 1BMAA 1EOJA 4E7NA 2C90B 3SUFA 3EGKH 2GV6A 1QRZA 1C2GA 4X1PU 3ZVBA 4KTUA 6GCHF 4SGAE 2F9NA 3KGPA 2GZ8A 3MI4A 4ZROA 2BXUH 1ELBA 3RXEA 3MU5A 3T27A 1J17T 2G81E 4U01A 3Q00A 1O3EA 4JK6A 1EX3A 2FDAA 2C8YB 3SHCH 2BZAA 1GCTC 1FONA 1UHBB 2HLCA 1SLXB 2A4GA 3GYMA 4ZMAH 3NXPA 5B6OA 4D76A 1XUHA 1UVTH 2Q1JA 3MNBA 4RN6A 2WPKS 1BCUH 3RM0H 1WUNH 1NRQH 3E1XB 5EXLA 1A5GH 1OWKA 2CJIA 2BD8A 1ZJKA 2Q6GA 3TLOA 1N8OC 1SB1H 3MOCA 1RGQA 3ZZBA 1SMFE 5DP6A 5E2OA 3E90B 1NFXA 1XXFA 1V2LT 1HNEE 3SQHE 1TE0A 1EZSC 2BD7A 1OOKB 1VITH 3OY6U 1TALA 1QBVH 3SU0A 4K8YA 4X0WU 2PTCE 1WSSH 2QC2A 2AERH 1KSNA 3P8NA 1NT1A 2OQ5A 5AVDA 4AOQA 1S81A 1O5EH 1IQFA 1OWJA 1P9SA 1PPEE 1C4U2 2FYQA 2O8LA 1QURH 3QGNB 4LZ4B 1OWEA 1IQEA 4KGAA 1G3CA 1AI8H 5F6MA 1CU1A 2VGCC 5A8ZA 3VB6A 4JYTA 1C5ZB 1G2MA 4B2BA 4CHAB 1BJVA 1O2KA 1PPCE 1O2LA 1W12U 3KF2A 1TABE 2ZHDA 1AD8H 2HNTF 1SQAA 3GY5A 1LHCH 1GI6A 6GCHG 4I32A 1UTKA 3KIDU 3FP6E 1GI1A 2BY6X 3A89A 1BZXE 1QTFA 2TGDA 2I6SA 1C5WB 3MNCA 1F92A 1VCQA 2NU0E 1HAVB 1ZJDA 3F9EA 1C5XB 2AGIX 1ZPZA 3SU3A 4RKJB 3L6PA 3SV2H 1GBLA 4BAHB 1THRH 1TNJA 1MTNB 2Y5HA 3QZRA 1SGFA 3ZYEA 1BTZA 1P2NA 1MBMA 2ZTZA 3SNBA 3MTYA 2OXSA 1TX7A 4FU9A 5TJXA 1KLTA 1GMCF 2B0FA 1FY8E 4MTBA 2Z6BD 3GCOA 2BVSH 1ANEA 4Y6DA 2R0KA 4JYUH 3TU7H 3F6UH 2FYRA 2SGPE 2UWPA 2RDLA 1ANCA 4NIYA 4B1TA 1S6FA 4IMZA 1EAXA 2QAAA 2D1JA 3DHKH 3M3SA 1O5DH 3PWCA 3RMMH 5CHAB 4LOYH 5FPSA 3C1KA 2BY7X 1ZTLA 2ZFQH 1C2EA 4Y76A 1WV7H 4AFUA 3EQ0H 2ZO3H 1C4V2 3KEEA 1Q3XA 2FM2A 5PTPA 2ODPA 3M3VA 2A31A 3D49H 7KMEH 5LGOA 1IHTH 1C1RA 1Z1IA 3KN2A 1TB6H 1Z8JB 3HKIB 1LPKB 4YOIA 5JPMH 1GI5A 1HIAA 2ZCKP 3QLPH 2VIPA 3A83A 1EP6A 4JYVH 1EP5A 1BTWA 1P01A 5EW2H 1EKBB 1DANH 2R0LA 2QF0A 1OX1A 3F9HA 3VEQB 4GSOA 1FPHH 4AGJA 1S84A 3FFGA 2QXHA 1VGCC 2ZF0H 1V2VT 1QJ7B 2HPPH 1F7ZA 1GGDB 4ISIH 2QYIA 1GVLA 2NU4E 2AYWA 4B71A 2FOGA 4DIHH 4XBDA 1C1VH 3BSQA 2ZDKA 1H9IE 2VIWA 4INLA 1QCPA 1ZTKA 2XBYA 4AB9A 1LHDH 4ABJA 3MNXA 2WYJA 5A09A 4NFEA 1DY9A 1YPHE 1JWTA 2TGAA 2A7CA 1FN8A 1S0RA 3LGVA 1NM6A 3SU4A 4YO9A 1AIXH 2F9VA 2TGTA 5C67A 4KTCA 1UK2A 3SUGA 4A6LA 2PLXA 3TJOA 5DO4H 1LDTT 1O2ZA 5A2MH 5AFYH 2F91A 1V2JT 8GCHG 4X1QU 3A86A 1RTFB 2BM2A 1XKBC 5JB8S 1IQMA 1O36A 1EATA 3GYLB 1ELGA 2ZPQA 4OS1A 1A0LA 4ISNA 1SBWA 1F0RA 3RLYH 1PFXC 1O37A 1EUFA 2XYAA 1QA7A 3GY3A 1FAKH 2F3CE 2ALVA 3TGJE 4F49A 7GCHG 3D23A 2ANWA 1QRWA 1XUJA 3RXJA 1C5LH 1TMUH 3LH1A 1GHAF 4X6MA 4UEHH 1D4PB 1FV9A 4QT8C 1HB0B 1K28D 5C1YA 1A4WH 1IQIA 1VITG 2FMJA 5T6FA 3SV7A 4CRBA 1GHYH 1TX8A 1HAGE 1OS8A 1QIXB 1K1IA 2BY5X 2FEQH 1W2KH 1CQQA 2A2XH 3A7ZA 3A7YA 3GISB 2SGDE 2QV1A 4OS7A 1A7SA 2R3UA 1L4ZA 2A45B 2XC0A 1AGJA 1O3PB 4CBOA 3MH4A 3MHWU 1YPMH 1TQ0B 2ZU2A 3S9BA 5FHTA 4AGKA 1HAZB 3OTJE 1NO9H 4B76A 3SV8A 1AWHB 3UWJH 2VB0A 1P12E 4I31A 4IN1A 1SGTA 2ZCLP 3SW2B 1SGQE 2TRMA 4U2WA 2ZDVH 3UR6A 1UO6A 1EPTA 3SGQE
chains in the Genus database with same CATH superfamily
2ZP0H 1C5QA 2WPIS 1UTQA 1WBGB 2V3OH 1Y3XA 2W3IA 5EQSA 2A4OA 4BNRA 4JZEH 1CVWH 1S83A 1O2TA 4B74A 3DT0H 3RMNH 1HAXB 4X2XA 1DX5M 4NWKA 1GHWH 4I33A 1CGIE 1LVBA 3STJA 3RXDA 2GKVE 1YPGH 1O30A 2F4LA 3KYGA 4O03A 2OC7A 2J2UA 4HZHA 4WVPE 3U1JB 2O8MA 1GI3A 2QY0B 1NZQH 2AIPA 4VGCC 1P2MA 4YOJA 3NRLA 3OEHD 1E1QD 2W26A 4FUCA 4ZHMU 2CHAC 1CSOE 1QJ1B 1TMBH 1AUTC 2ZFFH 3ATWA 5EODA 5LPRA 2ZEBA 5BPEA 2ZFPH 1X7AC 2SGFE 3AAUA 2UUYA 3ODDA 4NA7A 1E79D 4Y0ZE 4Q7XA 1XUFA 4B6EA 2BLVA 1TWXB 1SL3A 4OS6A 1YM0A 3ZVDA 2XTTB 4Y7AA 2CF8H 4MPUA 4O9VA 1C1WH 1GI2A 2VU8E 3UOPA 4NSYA 1A61H 4YM9A 3BEFB 1PPFE 1GBMA 1C1TA 1O35A 2FOHA 5EW1H 3RXSA 7LPRA 2BMGB 4H6SB 1YCPM 2IPHA 5GNDA 1SLWB 2PUQH 1DY8A 3O8DA 1O33A 1UCYK 2BQ6B 3SJIA 1GJ4H 1KXAA 2VGCB 2BD2A 2TPIZ 1BDAA 5EPYA 1FNIA 1FXYA 1EASA 1P2IA 1S0QA 2VIVA 2A7HA 2EI6A 5EJ1A 1GL1A 2XRCA 3UIRA 2ZHQH 1L4DA 2F9UA 3WY8A 1V2PT 2XCNA 1LPZB 2R2MB 3RXVA 1NFYA 1RTKA 1F0SA 1C2MA 2BZ6H 3SU2A 2IOTA 2JH6D 2ZWLH 4ACAA 1GBCA 1G32B 5K7RA 1E1RD 1LQDB 1RIWB 3DUXH 3FANA 2PSYA 2YNAA 1K1JA 4THNH 3FZZA 1OYTH 3E16B 4KKDA 1PQ8A 3B23B 1CGJE 1UVPA 1JXPA 1BBRK 4NA8A 2JH0D 1HAIH 3P92A 1LO6A 1O2NA 5K0HA 3DSPA 2Z3DA 3Q3XA 1O3GA 1Y3UA 3RM2H 2BD9A 2GV7A 2ZGJA 1XXDA 5GIBA 4AN7A 4Z1MD 1MZDA 3MU4A 1CBWC 2Y5GA 1KXCA 1MKXK 4B6FA 2ZGBH 1K1OA 1YPLH 3T25A 1CE5A 1U6QA 3KQDA 1C1UH 3KL6A 1SGYE 1LHFH 3KHVA 3ZZ6A 4BAMB 2FXRA 1TGNA 1HV7A 5CHAC 3SNAA 1PJPA 3RLWH 4CRAA 3OSYA 3GDUA 2UUJB 3L33A 4YLUA 5DP3A 1BTPA 4D9QA 1F2SE 4YESB 3ZVAA 1Q2WA 1GBKA 1TAWA 1UVSH 3WW7A 1DVAH 3VXFH 1E37B 1O3CA 2J4IA 1KLIH 2H5CA 3MO6A 2AH4X 3BTHE 3UOUA 2A5KA 2HGTH 2IJD1 1MU6B 1ZMJA 1GBIA 3ENSB 1ABIH 2CGAA 4A1TA 5EU8A 2JJ2D 4Q4LA 5FBIA 2BHGA 3M7QA 2JETB 3PV4A 1SI5H 1DPOA 2BDHA 5C1XA 2GP9B 9LPRA 1O3JA 2KAIA 2Z3EA 1AFQB 3LGIA 4DIIH 1G3BA 1BBRE 1ZLRA 1O3IA 1QL9A 3O8BA 1K1LA 2KM0A 1YLCA 1W10U 3DD2H 2PGBB 1IQGA 4IC5A 3U8OH 4Y8XA 1J9CH 1KTTB 2FP7B 1GDNA 2KCYA 4IC6A 1UTJA 1KDQB 3M5NA 3M3TA 2RA3A 1S6HA 2ULLA 1C5PA 2O8UA 1MZAA 2ZKSA 3ATLA 2C8ZB 4O3TA 3CP7A 2FX6A 3SU6A 1A5HA 1G2LA 5I46H 2BD3A 1TIOA 3E8LA 4TPIZ 3QWCH 1C1QA 3MU8A 1GJDB 5SGAE 1G9IE 3MO3A 2VNTA 3PLPA 4DT7B 3M5OA 5ABWA 5B6LA 2J95A 1H8IH 1PQAA 4WY3A 1A46H 3ODFA 4NIVA 2PWXA 4FETA 2RA0A 2ZQ2A 4P02A 1SGNE 1AZZA 1DUEA 4M9FA 4ZKOU 3ZVCA 1HAOH 1LHGH 1FY1A 3EE0B 3ZZ8A 3TGKE 1DITH 1O3AA 5HM9A 1C9PA 2H9EH 3FZDA 3KQBA 1W7XH 2OP9A 1MKWK 1CA8B 3P70B 1EAUA 1P2OA 4INKA 2FESH 5TCCA 5JBCS 2ZU4A 2WPLS 3GCHC 3NKKA 3UAIC 1AHTH 2V3HH 1O2UA 3M7TA 2FO9A 2QA9E 3UB0A 3E0NB 1FIZA 5AHGH 4IMQA 3ATMA 3T62A 4F55A 1O5BB 1SGDE 3M35A 2ANMH 3PMHB 1A5IA 2DE8A 1Z6EA 3E91A 3FN8A 1ANDA 1C2LA 1GBFA 3SHAH 2YOLA 1RS0A 1TPAE 2D2DA 1UK4A 4X8SH 5J4SA 2C93B 3SQEE 1G3DA 2GCTB 2OK5A 1LQEA 1DICA 1HJ8A 3AW0A 2AMDA 3ZVGA 6LPRA 1TFXA 3HATH 3PTNA 1O0DH 2LPRA 1CHGA 1GBTA 1KXEA 3GCNA 3OU0A 3QUMP 1PPBH 4CRGA 5DSFA 2WZQA 1V2KT 1K9OE 1KXFA 1NESE 4RSPA 3T28A 1PQ7A 4NA9H 3LKWA 1TPSA 5E0GA 2H9TH 1CA0C 3UQVA 1FAXA 1K1MA 4MNXA 3RXBA 1Y5BT 3S9CA 1IQJA 3IG6B 1XM1A 1GL0E 2Q6DA 2OD3B 1PPHE 1SPJA 1VCPA 1UVUH 3E6PH 3CS7A 3TVJB 2EY4C 1MCVA 2F9PA 4FVDA 4NIWA 4I8LA 5DN6D 5F8TA 5KECA 4LZ1H 1GMDF 2BOHB 1GPZA 1BMFD 1SGRE 3BTKE 1P10A 4E06H 1ZRKA 1T8OA 1XMNB 2ZHEH 2M5TA 1QZ8A 1O3BA 3BN9A 4J1YA 4MNVA 5JB9S 1AN1E 1CT4E 4I86A 2Z9LA 1GHAG 1ABJH 1GI9B 1O2GH 3OFND 2VJ1A 1EZUC 1BBRH 2ZPRA 1O5CB 1E34B 3MU1A 2ZHWH 3PV5A 4X2WA 2CHAB 4ZKSU 4O3UA 4X2VA 1ZOMA 4BAOB 2IJOB 1ZSJA 3UPEA 5GPIB 5C2ZA 2GZ9A 1OWHA 1EPTB 3AW1A 3S0NA 1P3EA 4KP0A 4ABBA 3VB5A 2OINA 3PROA 3URDA 3Q3YA 2R2WU 3NK8A 5DPAA 2EC9H 1YPKH 2P3UB 1O34A 8GCHF 1AO5A 1EQ9A 4WH8A 1C1NA 1YGCH 4AFSA 1YBWA 3F1SB 1S6LA 3I78A 2AS9A 4VGCB 3PWBA 1P3CA 1WYKA 2FLRH 4XSKU 3B8JA 2W7SA 5A0AE 1D3TB 3UFAA 4WMDA 1UVOA 1YP9A 2LNCA 1O3MA 3LIWA 2P8OB 1MQ6A 4UFEH 2BY8X 1J15A 1TPPA 1QBNA 4ASHA 2VINA 1TBQH 1AMHA 2G5NA 2FX4A 4Y0YE 3RXGA 2WUBA 3EA7A 4GHTA 4CRDA 3RXLA 3SGAE 1VKYA 2I6QA 1NS3A 3KCGH 1O3NA 1ELEE 1NRSH 2XNIA 2W6JD 1GJCB 4INHA 1LVYA 3ZV8A 4BAQB 1V2TT 3PV2A 1W0KD 1YYY1 4U32A 3DSOA 1O5FH 2VIOA 1IAUA 1ZZZA 2GTBA 1HXFH 2HALA 4GAWA 1ZYOA 2J97A 5FX6A 2W6ID 2H6MA 4Q7ZA 2Z9KA 1S5SA 2WPMS 4OS5A 2B7DH 2CN0H 1LCYA 1E35B 3SOSA 2J94A 3LC3A 4D7FA 1W14U 2BLOA 3PYHA 1HLTH 2H1UA 3RU4T 1QA0A 3BTDE 1W3CA 3A88A 3ITIA 5FL7D 3PB1E 1NRRH 4AG2A 3ZZ3A 1TOMH 3VB3A 5JBTA 1BITA 1T4VH 4DCDA 2G4UA 2GCHG 3MQKC 1L0ZA 2ZZUH 3U8TH 1OPHB 3AK5A 1ZRBA 1FPCH 1N8OB 1J14A 2F83A 1WXRA 2XW9A 1MKXH 1FJSA 3FO8D 2DE9A 3M5MA 1KTSB 2V0BA 2XWBI 3NWUA 1GBJA 1VGCB 1GBBA 2VWLA 5GXPA 1OP8A 1QQ4A 5A0BA 3RXCA 1WDIA 1GMCG 1JIMA 1OYQA 4ZXXH 1TNGA 1HCGA 5E0JA 1FIWA 3EAJA 2VWNA 2P3FH 2A5AA 1EAIA 1CT0E 3TJUA 2XWAA 3T5FH 5DP9A 4ZKRU 3MO9A 4IW4E 1CT2E 1H8ED 2FS8A 3GY6A 4X6OA 2PR3A 5F8XA 1XKAC 2FODA 2JETC 3A7XA 3V3MA 3R3GB 4AG1A 1GG6C 2WPHS 3W95A 4ESTE 1ESBA 5T3HA 1RRKA 1EB2A 4FUGA 1GBHA 1YF4A 8LPRA 1GJ5H 2NWNA 2OUAA 1SGFG 2BVXH 3EDXB 2D26C 2NU3E 1ELVA 1DXPA 4H42U 1O2WA 4OGYA 1FLEE 1B0EA 1KMHB 1LVMA 4WXIA 2D8WA 2V7QD 2C4FH 2ZHFH 1C5TA 1DUAA 2ZC9H 3VG8A 1SLUB 2ILNA 3A8DA 2NU1E 1O2YA 1UMAH 2O8WA 1D3PB 1GI7B 1H9HE 1P05A 1H9LB 5DJ7A 3BIUH 2YMSC 1GCTB 1GG6B 2SGEE 5EJLA 3GICB 1QGFA 5DGJA 5DP7A 1AQ7A 1KY9A 1O2OA 2KFWA 2OBQA 3LGUA 5DP4A 5LPEA 2PW8H 3PLBA 2KX4A 1W11U 3PMJA 1P09A 3OEED 3MYWA 4XFQA 4B2CA 4CH2B 4ZUHA 2XCFA 4OS4A 4OGXA 3D62A 4TT3D 4XD7D 1P2KA 1DS2E 2AEIH 4ZKNU 1COWD 1V2UT 1RD3B 3BTFE 1FN6A 4A1XA 1E36B 2K8IA 1YLDA 3PM3A 5HKKD 5C0TA 5J4QA 4JMYA 3QX5H 1L1NA 1GCDA 3GY7A 1UTPA 1NU7B 2BDBA 1GHZA 4MPWA 1GHBG 1BUIA 3LJOA 1GVKB 1TBRH 5DKMA 3ZVFA 1K1PA 1N6YA 3VXEH 1C2JA 1EB1H 4Z0KA 1AVXA 4I8HA 4CR5A 1L1GA 4AX9H 3MFJA 1UTMA 5F03A 1T31A 1ARCA 2Y6TA 3N7EA 3STIA 4TY6A 3OE7D 1DWDH 1P8VC 4UD9H 5ETXA 4FXGH 1C2KA 4CBNA 1JMOH 2G4TA 1Y3WA 3UUZA 3TGIE 1O3DA 3WWFA 1ZPCA 1MCTA 5FCRA 1SQTA 3M36A 2BDGA 2FOBA 3GOVB 1SHYA 1QL8A 1P57B 5E2PA 3ZZCA 2HNTE 2A4QA 4WH6A 1MH0A 3UNQA 3BEUA 2Z3CA 2UWOA 1KDQA 1NU9A 2AGGX 3A87A 4MPXA 3RC4A 2BLQA 1B0FA 1C5RA 3SNEA 4I8KA 1ZHPA 3HK3B 3F68H 2OQUA 1DWEH 5EGMA 2QF4A 2VH6A 1Y3YA 1W8BH 2J98B 1ETSH 1VZQH 1GWAA 1ELCA 2J98A 1JBUH 2WUCA 1TNHA 2G5VA 2WV4A 3LGYA 1HXEH 2FLBH 1LKAA 2O9QA 4Y79A 3LGWA 1MAYA 2ZDLA 4J2YB 1CO7E 1T32A 1S85A 1C5OH 1O31A 1GHXH 3QN7A 2ZTXA 3CENA 5GWZA 3A8AA 1BTUA 3UTUH 1FZZA 2H2ZA 4K1EA 1AKSB 1ZHRA 3ELAH 1QB6A 3DFJA 1W7GH 2M2AA 3RDZA 4A5TS 5L2ZH 2TIOA 2G52A 4HGCA 1C5SA 3DSGA 2SFAA 4ASUD 4FUJA 4ZXYH 1H4WA 1O3OA 1GJBB 2H9HA 2Q6FA 4D9RA 4CH8B 5IDKA 1QHRB 1BMNH 2WPDD 3CS0A 3PMAB 1GBAA 3SJ8A 1FQ3A 1ELTA 1NRNH 3K6ZA 3RMLH 4MPVA 1GMHF 3VGCC 3BTGE 2WYGA 5ESTE 1D3DB 2UUKB 4DJZB 5EQQA 1GJAB 9ESTA 3LU9B 3O8RA 5DP8A 1P02A 4RT0A 2GZ7A 3ZZAA 1Y3VA 2FI5E 3F9GA 4FUIA 3VFEA 2AHME 4BANB 2BOKA 8KME2 5LH8A 3BTEE 2BDIA 1HAPH 4DW2U 2F9OA 4RT1A 4XBBA 1TRMA 2LP6A 1KYNA 2OBOA 3M37A 1V2WT 2EEKA 1O5AB 1XUIA 1TLDA 4JZ1A 1HFDA 1GBDA 2WV9A 2CMYA 2ZDAH 1DWCH 2STBE 2FOEA 2WPJS 1RFNA 1Z1JA 3MH5A 3P8GA 1E0FD 1EJNA 2QXJA 3H7TA 1UHBA 2Z9IA 3MMGA 4BTTB 4XE4A 4FUBA 3SNDA 1Z8GA 1THSH 3MNSA 3OAAD 5HMAA 3RXTA 3P8FA 3ZZDA 3RUOA 1WQVH 1HPGA 2ZQ1A 1C5VA 2F9BH 1NROH 3QTVH 1QNJA 1TOCB 1RXPA 3FP7E 2ZU1A 4OM9A 1ZSKA 1GJ9B 2XBXA 3FAOA 4YXWD 1OP0A 1DLKB 1MD7A 1DOJA 1EAWA 1OKXA 1F0UA 1O39A 2VWMA 1HJAB 1THPB 1ZGVA 3E3TA 4ABHA 4Y8YA 4K1SA 2ZI2H 4Y10E 1AVGH 3JZ2B 4X1RU 7ESTE 4GLYA 1XUKA 3OX7U 1G37A 1MU8B 5DK1A 1QFKH 1A3EH 1IHSH 1HUTH 2O8TA 3FVFB 1DM4B 3KQEA 2V6NA 2DUCA 1V3XA 1F5RA 4ABDA 2GT7A 1MTWA 3BTTE 2EI7A 3ZZ5A 1TGCA 4K5ZA 1V2OT 1AB9B 4CRFA 2SNVA 3L3TA 2ANYA 5GDSH 4K2YA 1AVWA 3RP2A 4UFGH 5AFZH 1D3QB 3MH6A 3N7OA 3P6ZB 3H5CB 2HLDD 1HAVA 2ZNKH 4WF8A 3BTME 1TONA 1TNKA 1P11E 3UY9A 2J5UA 1O3FA 2ZG0H 3SBKA 1RTLA 1GI0A 2VIQA 3EYDA 2IPQX 1QJ6B 2VIDA 3BEIB 2Z9GA 1TA2A 3EA9A 3SUEA 4ISHH 3LGTA 4MVNA 1L2EA 3SO3A 7GCHF 3BTQE 1HAHH 1V2RT 1TRYA 3QZQA 1GJ7B 2FOAA 4TYDA 1YY3A 3S9AA 3F2HA 1GBEA 1O2VA 4ABAA 5C5NA 3EA8A 1ESTA 3PRDA 5HM2A 1C1MA 4HG6A 3B9FH 2KZ4A 1SGCA 3ZZ9A 3BIVH 2ZTYA 1YC0A 3VB7A 2GJGA 2XBWA 1T8MA 1NPMA 1ZHMA 2BX4A 1C5NH 1BTXA 6ESTA 5I25A 3RXOA 3M7UA 1GJ6A 1Z71A 1JRSA 4X1NU 4B75A 3URCA 1BHXF 5EJZA 3SI3H 1O2PA 1PPZA 3LPRA 4D8NA 4E05H 5FCKA 4UFDH 1P06A 2ZGXH 1FMGA 1BQYA 2JJ1D 1NTPA 2KR7A 4HI3A 5T1VA 3Q3KA 1BIOA 2Z7FE 4BAKB 5DG6A 1ORFA 2Y7XA 2GMTC 2VVCA 4ZHLU 4B2AA 1GDUA 1A1RA 2ZFTA 3V7TA 3A8BA 1NBME 4XOJA 4DGJA 1K2I1 3PO1C 3OYPA 1K0HA 1C5UA 2A4RA 2BYAX 2J38A 3S69A 2C3SA 3NUMA 4MDSA 5F8ZA 1M9UA 5T6DA 3T26A 4DOQA 3MWIU 1P2JA 1JIRA 4Y71A 1G36A 3RU4E 4ISOA 2P93A 3A7TA 1Z8RA 2HVXA 2A2QH 2W5EA 1FI8A 2FI3E 1WOFA 2GD4B 2RDEA 3U28C 2V35A 1OWDA 3T29A 1F5KU 1O2HA 1SGIB 3TIUA 5GJ4B 1OP2A 1HAYB 2OC8A 2YMSD 4ZHAA 3A81A 5T6GA 2C8WB 2JKHA 1QBOA 1BJUA 4ABEA 3H7OA 1ZSLA 3HK6B 2ANKH 2OC0A 2P8OC 3V12A 4YTAA 1RIWC 3FOAA 5HGGA 1GMHG 2QIQA 3RXFA 1T4UH 1JOUB 2G8TA 2NU2E 2FS9A 1C5MD 1DLEA 1MTVA 3BTWE 1TGTA 1MABB 1TGBA 4FUDA 3WWBA 4DY7B 4O97A 1XVMA 5FAHA 4F4OC 2PHBA 1UCYH 5IYTA 1V6DA 4K8BA 1IQHA 1C1OA 3NPSA 4YT6H 4Q2KA 4UE7H 2ZGCA 3SJ9A 2QE7D 2ODYB 2PFEA 2J9NA 3SUDA 4MNWA 2HOBA 4LXBH 1C2IA 3O8CA 1IOEA 1DSUA 1SOTA 3ATIA 4ZH8A 1DXWA 1P03A 3A7WA 4CRCA 3W94A 1SLVB 1FY3A 3SJKA 1MD8A 2XC4A 3PRBA 1NBMD 3BG4C 1CGHA 1HGTH 5C3NA 1Z7KA 2EI8A 2GVFA 1C9TA 2BDYA 1WTHD 5CHBA 4JZFH 3UNSA 1TNIA 2P95A 4NSVA 5GCHG 2ASUB 1Y5UT 3ZYDA 3NZIA 2ZDMA 4ISLA 3GY2A 1V2MT 3Q76A 2AFQB 4Y8ZA 4U30A 1FUJA 1DSTA 5H4IB 3T2NA 1UCYE 1YCPH 3ZZ7A 4X2YA 4X8UH 3HGPA 2HRVA 4NZQA 4AZ2B 3TJNA 3P8OA 3K65B 1BTYA 1IQKA 1Z8IB 4K3JA 2Y81A 1KXDA 3VGCB 1VR1H 1AFQC 1A0JA 1J16A 2PKAB 2CF9H 1SKYE 1MBQA 5C17A 1LTOA 3QGJA 1NY22 2P16A 4IS5A 3DFLA 1SVPA 2GGVB 5A8XA 4TWWA 1AE8H 4Y7BA 3SU1A 2J34A 1GI8B 3RXMA 1UTNA 1O2XA 1BMMH 2CK3D 2PKSB 3F9FA 3SNCA 2RFKC 4DVAU 1C2FA 1BMLA 4GHQA 3S7KB 1AUJA 4XDEA 1CHOG 3QTOH 4K60A 2THFB 1ELAA 3K2UA 1KIGH 1MMJN 1SQOA 1C1PA 3C27B 3KNXA 2FOCA 2GX4A 2AIQA 1EZQA 4I7YH 1C4Y2 3A8CA 3D65E 4IBLH 2ZECA 2GT8A 1GGDC 1JRTA 2ZGHA 2UWLA 3AASA 4UDWH 1ID5H 1F5LA 4FUFA 1P2QA 3QK1A 2QXIA 1BA8B 4YZUA 1AB9C 5A8YA 2G55A 1K21H 1GJ8B 3PLKA 2ZDNA 1Y8TA 3N99A 4X6NA 2AMPA 5FX5A 2VBCA 2BX3A 3LOXA 2ZIQH 2F43B 3GCHB 3RMOH 1BHXB 4JCNA 2Z94A 3HPTB 2ZCHP 3TPIZ 2FZZA 2XNDD 2OTVA 3A84A 4OS2A 3U9AH 3VPKA 1QL7A 5EOKA 1A0HB 3TNTA 1TNLA 3SORA 3ZV9A 2BDCA 1Y5AT 1DE7H 1ZMNA 1AFEH 2UUFB 1VITF 2Y7ZA 3BG8A 1BT7A 3OY5U 4SGBE 1LPGB 4K69A 2OCVB 1SGPE 1QY6A 3LONA 4ABGA 2JDID 1W13U 1ELFA 3SV9A 4WJG2 1BRUP 3P95A 1DWBH 3LDXH 1AZ8A 3RXHA 3RXQA 3FP8E 2WV5A 2SGQE 1EJAA 1SFIA 3AVZA 1ANBA 1BRCE 4BOHA 1ZPBA 1Z6JH 2PKAA 4JK5A 3I29A 4P00A 1TYNA 3GDSA 3UQOA 1BB0B 4H6TA 2PV9B 4TWYA 4Q63A 4IGDA 1MKWH 1L1JA 1GVZA 2PTNA 4GCHG 1WU1A 2BB4A 1HYLA 2ZFRH 5A0CA 1ACBE 5L6NH 1NFUA 1HRTH 1MAXA 1Q31A 2STAE 1BRAA 2PUXB 4BXSA 4I8JA 4DURA 1SSXA 1EFRD 2FTLE 3K9XB 2QN5T 1XUGA 2EA3A 2HNTC 1PPGE 3TH3H 1RJXB 1BTHH 1HIAB 4LK4A 3TH2H 1PYTD 4AYYB 3UNRA 1QQUA 3U98H 3MU0A 1YPEH 1O2SA 3E0PB 4PROA 1DT2A 1Y59T 1CHOF 1EXFA 3BG4B 4X6PA 1DDJA 2G51A 4MLFB 1AU8A 2K1QA 2SNWA 2SGAA 1XVOA 4FUHA 3OTPA 6CHAC 2IN2A 1ETTH 1O3LA 1P04A 1K1NA 2PP6A 2A7JA 2ZU5A 2A32A 3PTBA 3KQCA 3ATKA 4KELA 2W7UA 3I77A 1HJ9A 1LMWB 1NC6A 2XBVA 1UTLM 1MQ5A 5FPYA 4JZDH 5FBEA 1SG8B 4K1TA 6CHAB 1W0JD 1D6RA 3U69H 2JH5D 2BQWB 2VWOA 5C5OA 1C2DA 4YT7H 2BVRH 1YKTA 5C1UA 3V0XA 1N1LA 2FOFA 3RXKA 1WQSA 3ZZ4A 4WMEA 2FOMB 1G3EA 1W0ZU 3U1IB 2HVYB 1UK3A 2CXVA 3QDZB 1HJAC 5AF9H 3QO6A 3SN8A 2BD4A 1O2MA 2A1DB 1O3HA 1J8AA 4Q7YA 3MH7A 3KQ5A 4TY7A 1TPOA 1V2QT 2ZU3A 3SV6A 2PGQB 3TK9A 2FWWA 3UWIA 2J92A 2ZA5A 5G4BA 3W1EA 2Z9JA 3FKSD 5FXLA 1P0SH 5EXMA 1AWFH 1GDQA 4X8TH 3IWMA 4FUEA 3RXAA 5L2YH 1O3KA 3LC5A 1GI4A 4MNYA 1O2QA 1TBZH 1W0YH 2BDAA 4M7GA 2JIZD 1C2HA 1UJ1A 2VVVA 5JYIA 4A1VA 5HXFA 4R0IA 3UR9A 3M61U 1PYTC 2FTMA 4IN2A 3VB4A 1G30B 2A0QB 2XOKD 2P94A 1O32A 1OWIA 3SZNA 5LPFA 1ETRH 1SFQB 2P3TB 1BOQA 2ZPSA 2YNBA 4XBCA 1N6XA 1K22H 2GDEH 1GHVH 2QGRA 1NFWA 2XC5A 1ZR0A 1LKBA 4CHAC 1YPHC 2XXLA 3GS9A 3RXPA 3Q77A 3G01A 3PMBB 4D7GA 3IITA 5JDUB 3A85A 4GCHF 2QXGA 2QCYA 2BY9X 1A2CH 2HPQH 5ESBA 1O2JA 5CMXH 4A7IB 3HGNA 1OSSA 1QB9A 3LT3A 5C20A 1V2NT 1SR5C 3F3BA 1VJAU 5E8EH 1MTSA 1AE5A 1FDPA 4NCYA 3K6YA 1V2ST 2CV3A 3GCTG 3SU5A 2C8XB 1TQ7B 1E38B 2ZFSA 4YOGA 4B73A 4WMFA 4Y11E 4MQAA 1A3BH 3LH3A 2RCEA 1GHBF 4FVBA 1UW7A 4AYVB 4UFFH 3RC5A 2OC1A 4JZIA 5E0HA 1AY6H 3S7HB 2B5TB 3LJJA 3AAVA 4NG9H 1EZXC 5EXNA 3UREA 1TMTH 5KEDA 1LVOA 1SHHB 2Y82A 3DA9B 3TH4H 4A92A 2PKSC 4CR9A 4AFZA 1O2IA 1CA0B 4AFQA 1AKSA 3A80A 3F0PA 2B8OH 4FOUC 2ODQA 2BLWA 4AORA 1B7XB 1BRBE 2B9LA 2BQ7B 1WTGH 2PSXA 1TX6A 1ELDE 3F0OA 4KTSA 1HDTH 1EJMA 1WCZA 1NN6A 5KGOA 3F2FA 4GPGA 4NWLA 3HKJB 2TGPZ 2W3KA 1QB1A 3GDVA 4H4FA 1VJ9U 4BXWA 3SGBE 1GMDG 1P9UA 4NGAH 1MUEB 3ZVEA 2FI4E 4NZLA 5HYOA 2A5IA 2HWLB 1PQ5A 1TRNA 3N7DA 4ZAEA 1VCWA 5F53A 4Z6AH 3SYJA 1YCPK 1TGSZ 2OLGA 3R0FA 3F2GA 1T7CA 1YPJH 1QR3E 2ESTE 2GCHF 2VH0A 1SOZA 1FY4A 3ESTA 1FY5A 1D9IA 1EOLA 4GVUA 1O2RA 4NIXA 3RXRA 5L30H 3TITA 4TPYA 1KXBA 1SGEE 2BTCE 1MTUA 2Y80A 3U8RH 1F0TA 2RG3A 5EG4A 1IQLA 1H8DH 3GY8A 1LHEH 5TCAA 1B5GH 1HBTH 3BF6H 4AB8A 3DCLA 3PO1B 3GCTF 3RXUA 2BD5A 2P59A 3SI4H 1QRXA 1FX0B 2R9PA 4ABIA 4NFFA 1O5GH 1XX9A 3TJVA 2WINI 2GMTB 2ALPA 3NCLA 5FPTA 2Y5FA 4FU8A 4UONA 1INCA 3RXIA 1ZMLA 3A7VA 5GCHF 2FIRH 2GCTC 1UTOA 3TNSA 1NRPH 1SC8U 4RKOB 1TA6A 3KYFA 2FPZA 1O38A 1ZGIA 2G00A 4GUXA 1KLJH 3M5LA 4HTCH 2VVUA 3TK5A 1C5YB 1IQNA 2H5DA 1S82A 5JBBS 4MG3A 3RC6A 1MTNC 2R3YA 4X1SU 1ARBA 3TK6A 4X8VH 4YLQH 5EPNA 4WWYA 1T8NA 1ZTJA 4E7RG 3JZ1B 4R8TB 3V13A 4ABFA 3H09A 1C1SA 2GDDA 3SJOA 1EPTC 4CREA 3RU4D 4FU7A 1CBWB 3EE7A 3A82A 5CE1A 3P17H 4I8GA 3GY4A 2L6OA 4BTIB 4F48B 4DG4A 1OXGA 4WXVA 5EQRA 3BV9B 5DP5A 2BXTH 2AGEX 1T8LA 1WAYB 2TBSA 2AMQA 1ESAA 5BRRE 1DFPA 2K0QA 1H1BA 1D6WA 2KAIB 4BTUB 8ESTE 5JBAS 4Q80A 4HFPB 2QF3A 1BMAA 1EOJA 4E7NA 2C90B 4XRNA 3SUFA 3EGKH 2GV6A 1QRZA 1C2GA 4X1PU 3ZVBA 4KTUA 6GCHF 4SGAE 2F9NA 3KGPA 2L74A 2GZ8A 1YLNA 3MI4A 4ZROA 2BXUH 1ELBA 3RXEA 3MU5A 3T27A 1J17T 2G81E 4U01A 4RI0A 3Q00A 1O3EA 4JK6A 1EX3A 2FDAA 2C8YB 3SHCH 2BZAA 1GCTC 1FONA 1UHBB 2HLCA 1SLXB 2A4GA 4AC9A 3GYMA 4ZMAH 3NXPA 5B6OA 4D76A 1XUHA 1UVTH 2Q1JA 3MNBA 4RN6A 2WPKS 1BCUH 3RM0H 1WUNH 1NRQH 3E1XB 5EXLA 1A5GH 1OWKA 2CJIA 2BD8A 1ZJKA 2Q6GA 3TLOA 1N8OC 1SB1H 3MOCA 1RGQA 3ZZBA 1SMFE 5DP6A 5E2OA 3E90B 1NFXA 1XXFA 1V2LT 1HNEE 3SQHE 1TE0A 1EZSC 2BD7A 1OOKB 1VITH 3OY6U 1TALA 1QBVH 3SU0A 4K8YA 1OHHD 4X0WU 2PTCE 1WSSH 2QC2A 2AERH 1KSNA 3P8NA 1NT1A 2OQ5A 5AVDA 4AOQA 1S81A 1O5EH 1IQFA 1OWJA 1P9SA 2V3MA 1PPEE 1C4U2 2FYQA 2O8LA 1QURH 3QGNB 4LZ4B 1OWEA 1IQEA 4KGAA 1G3CA 1AI8H 5F6MA 1CU1A 2VGCC 5A8ZA 3VB6A 4JYTA 1C5ZB 1G2MA 4B2BA 4CHAB 1BJVA 1O2KA 3CNRA 4ACBA 2QF5A 1PPCE 1O2LA 1W12U 3KF2A 1TABE 2ZHDA 1AD8H 2HNTF 1SQAA 1SQRA 3GY5A 1LHCH 1GI6A 6GCHG 4I32A 1UTKA 3KIDU 3SZEA 3FP6E 2KCPA 1GI1A 2BY6X 3A89A 1BZXE 1QTFA 2TGDA 2I6SA 1C5WB 3MNCA 2EQNA 1F92A 1VCQA 2NU0E 1HAVB 1ZJDA 3F9EA 1C5XB 2AGIX 1ZPZA 3SU3A 5EIYA 4RKJB 5IK2D 3L6PA 3SV2H 1GBLA 5C0UA 4BAHB 4TSFD 1THRH 1TNJA 1MTNB 2Y5HA 3QZRA 2YMSB 1SGFA 3ZYEA 1BTZA 1P2NA 1MBMA 4DT4A 2ZTZA 3SNBA 3MTYA 2OXSA 1TX7A 4FU9A 5TJXA 1KLTA 4ZCNA 1GMCF 2B0FA 1FY8E 4MTBA 2Z6BD 3GCOA 2BVSH 1ANEA 4Y6DA 2R0KA 4JYUH 3TU7H 3F6UH 2FYRA 2SGPE 2UWPA 2RDLA 1ANCA 4NIYA 4B1TA 1S6FA 4IMZA 1EAXA 2QAAA 2D1JA 3DHKH 3M3SA 1O5DH 3PWCA 3RMMH 5CHAB 4LOYH 5FPSA 3C1KA 2BY7X 2KCAA 2WSSD 1ZTLA 2ZFQH 1C2EA 4Y76A 1WV7H 4AFUA 3EQ0H 2ZO3H 1C4V2 5HIZA 3KEEA 1Q3XA 2FM2A 5PTPA 2ODPA 3M3VA 2A31A 3D49H 7KMEH 5LGOA 1IHTH 1C1RA 1Z1IA 3KN2A 1TB6H 1Z8JB 3HKIB 1LPKB 4YOIA 5JPMH 1GI5A 1HIAA 2ZCKP 3QLPH 2VIPA 3A83A 1EP6A 4JYVH 3ZIAD 1EP5A 1BTWA 1P01A 5EW2H 1H8HD 1EKBB 1DANH 2R0LA 1YWUA 2QF0A 1OX1A 3F9HA 3VEQB 4GSOA 1FPHH 4AGJA 1S84A 3FFGA 2QXHA 1VGCC 2WHXA 2ZF0H 1V2VT 1QJ7B 2HPPH 1F7ZA 1GGDB 4ISIH 2QYIA 1GVLA 2NU4E 2AYWA 4B71A 2FOGA 4DIHH 4XBDA 1C1VH 3BSQA 2ZDKA 1H9IE 2VIWA 4INLA 1QCPA 1ZTKA 2XBYA 4AB9A 1LHDH 4ABJA 3MNXA 2WYJA 5A09A 4NFEA 1DY9A 1YPHE 1JWTA 2TGAA 2A7CA 1FN8A 1S0RA 3LGVA 1NM6A 3SU4A 4YO9A 1AIXH 2F9VA 2TGTA 5C67A 4KTCA 1UK2A 5HIYA 3SUGA 4A6LA 2PLXA 3TJOA 5DO4H 1LDTT 1O2ZA 5A2MH 5AFYH 2F91A 1V2JT 8GCHG 4X1QU 3A86A 1RTFB 2BM2A 1XKBC 5JB8S 1IQMA 1O36A 1EATA 3GYLB 1ELGA 2ZPQA 4OS1A 1A0LA 4ISNA 1SBWA 1F0RA 3RLYH 1PFXC 1O37A 1EUFA 2XYAA 1QA7A 3GY3A 1FAKH 2F3CE 2ALVA 3TGJE 4F49A 7GCHG 3D23A 2ANWA 2KCOA 1QRWA 1XUJA 3RXJA 1C5LH 1TMUH 3LH1A 1GHAF 4X6MA 4UEHH 2LELA 1D4PB 1FV9A 4QT8C 1HB0B 1K28D 5CDFE 5C1YA 1A4WH 1IQIA 1VITG 2FMJA 5T6FA 3SV7A 4CRBA 1GHYH 1TX8A 1HAGE 1OS8A 1QIXB 1K1IA 2BY5X 2FEQH 1W2KH 1CQQA 2A2XH 3A7ZA 3A7YA 3GISB 2SGDE 2QV1A 4OS7A 1A7SA 2R3UA 1L4ZA 2A45B 2XC0A 1AGJA 1O3PB 4CBOA 3MH4A 3MHWU 1YPMH 1TQ0B 2ZU2A 3S9BA 5FHTA 4AGKA 1HAZB 3OTJE 1NO9H 4B76A 3SV8A 1AWHB 3UWJH 2VB0A 1P12E 4I31A 4IN1A 1SGTA 2ZCLP 3SW2B 1SGQE 2TRMA 5C94A 4U2WA 2ZDVH 3UR6A 1UO6A 1EPTA 3SGQE
chains in the Genus database with same CATH topology
2ZP0H 1C5QA 2WPIS 1UTQA 1WBGB 2V3OH 1Y3XA 2W3IA 5EQSA 2A4OA 4BNRA 4JZEH 1CVWH 1S83A 1O2TA 4B74A 3DT0H 3RMNH 1HAXB 4X2XA 1DX5M 4NWKA 1GHWH 4I33A 1CGIE 1LVBA 3STJA 3RXDA 2GKVE 1YPGH 1O30A 4O03A 2OC7A 2J2UA 4HZHA 4WVPE 3U1JB 2O8MA 1GI3A 2QY0B 1NZQH 2AIPA 4VGCC 1P2MA 4YOJA 2W26A 4FUCA 4ZHMU 2CHAC 1CSOE 1QJ1B 1TMBH 1AUTC 2ZFFH 3ATWA 5EODA 5LPRA 2ZEBA 5BPEA 2ZFPH 1X7AC 2SGFE 3AAUA 2UUYA 3ODDA 4NA7A 4Y0ZE 4Q7XA 1XUFA 2BLVA 1TWXB 1SL3A 4OS6A 1YM0A 3ZVDA 2XTTB 4Y7AA 2CF8H 4MPUA 4O9VA 1C1WH 1GI2A 2VU8E 3UOPA 4NSYA 1A61H 4YM9A 3BEFB 1PPFE 1GBMA 1C1TA 1O35A 2FOHA 5EW1H 3RXSA 7LPRA 2BMGB 4H6SB 1YCPM 2IPHA 1SLWB 2PUQH 1DY8A 3O8DA 1O33A 1UCYK 2BQ6B 3SJIA 1GJ4H 1KXAA 2VGCB 2BD2A 2TPIZ 1BDAA 5EPYA 1FNIA 1FXYA 1EASA 1P2IA 1S0QA 2VIVA 2A7HA 2EI6A 1GL1A 2XRCA 3UIRA 2ZHQH 1L4DA 2F9UA 3WY8A 1V2PT 2XCNA 1LPZB 2R2MB 3RXVA 1NFYA 1RTKA 1F0SA 1C2MA 2BZ6H 3SU2A 2IOTA 2JH6D 2ZWLH 1GBCA 1G32B 5K7RA 1LQDB 1RIWB 3DUXH 3FANA 2PSYA 2YNAA 1K1JA 4THNH 3FZZA 1OYTH 3E16B 4KKDA 1PQ8A 3B23B 1CGJE 1UVPA 1JXPA 1BBRK 4NA8A 2JH0D 1HAIH 3P92A 1LO6A 1O2NA 5K0HA 2Z3DA 3Q3XA 1O3GA 1Y3UA 3RM2H 2BD9A 2GV7A 2ZGJA 1XXDA 5GIBA 4AN7A 1MZDA 3MU4A 1CBWC 2Y5GA 1KXCA 1MKXK 2ZGBH 1K1OA 1YPLH 3T25A 1CE5A 1U6QA 3KQDA 1C1UH 3KL6A 1SGYE 1LHFH 3KHVA 3ZZ6A 4BAMB 2FXRA 1TGNA 1HV7A 5CHAC 3SNAA 1PJPA 3RLWH 4CRAA 3OSYA 3GDUA 2UUJB 3L33A 4YLUA 5DP3A 1BTPA 4D9QA 1F2SE 4YESB 3ZVAA 1Q2WA 1GBKA 1TAWA 1UVSH 1DVAH 3VXFH 1E37B 1O3CA 2J4IA 1KLIH 2H5CA 3MO6A 2AH4X 3BTHE 3UOUA 2A5KA 2HGTH 1MU6B 1ZMJA 1GBIA 3ENSB 1ABIH 2CGAA 4A1TA 5EU8A 5FBIA 2BHGA 3M7QA 2JETB 3PV4A 1SI5H 1DPOA 2BDHA 5C1XA 2GP9B 9LPRA 1O3JA 2KAIA 2Z3EA 1AFQB 3LGIA 4DIIH 1G3BA 1BBRE 1ZLRA 1O3IA 1QL9A 3O8BA 1K1LA 1YLCA 1W10U 3DD2H 2PGBB 1IQGA 4IC5A 3U8OH 4Y8XA 1J9CH 1KTTB 2FP7B 1GDNA 4IC6A 1UTJA 1KDQB 3M5NA 3M3TA 2RA3A 1S6HA 2ULLA 1C5PA 2O8UA 1MZAA 2ZKSA 3ATLA 2C8ZB 4O3TA 3CP7A 2FX6A 3SU6A 1A5HA 1G2LA 5I46H 2BD3A 1TIOA 3E8LA 4TPIZ 3QWCH 1C1QA 3MU8A 1GJDB 5SGAE 1G9IE 3MO3A 2VNTA 3PLPA 4DT7B 3M5OA 5ABWA 2J95A 1H8IH 1PQAA 4WY3A 1A46H 3ODFA 4NIVA 2PWXA 2RA0A 2ZQ2A 1SGNE 1AZZA 1DUEA 4ZKOU 3ZVCA 1HAOH 1LHGH 1FY1A 3EE0B 3ZZ8A 3TGKE 1DITH 1O3AA 5HM9A 1C9PA 2H9EH 3FZDA 3KQBA 1W7XH 2OP9A 1MKWK 1CA8B 3P70B 1EAUA 1P2OA 4INKA 2FESH 5TCCA 5JBCS 2ZU4A 2WPLS 3GCHC 3NKKA 1AHTH 2V3HH 1O2UA 3M7TA 2FO9A 2QA9E 3E0NB 1FIZA 5AHGH 4IMQA 3ATMA 3T62A 1O5BB 1SGDE 3M35A 2ANMH 3PMHB 1A5IA 2DE8A 1Z6EA 3E91A 1ANDA 1C2LA 1GBFA 3SHAH 2YOLA 1RS0A 1TPAE 2D2DA 1UK4A 4X8SH 5J4SA 2C93B 3SQEE 1G3DA 2GCTB 1LQEA 1DICA 1HJ8A 3AW0A 2AMDA 3ZVGA 6LPRA 1TFXA 3HATH 3PTNA 1O0DH 2LPRA 1CHGA 1GBTA 1KXEA 3GCNA 3OU0A 3QUMP 1PPBH 4CRGA 1V2KT 1K9OE 1KXFA 1NESE 4RSPA 3T28A 1PQ7A 4NA9H 3LKWA 1TPSA 5E0GA 2H9TH 1CA0C 3UQVA 1FAXA 1K1MA 4MNXA 3RXBA 1Y5BT 3S9CA 1IQJA 3IG6B 1XM1A 1GL0E 2Q6DA 2OD3B 1PPHE 1SPJA 1VCPA 1UVUH 3E6PH 3CS7A 3TVJB 1MCVA 2F9PA 4FVDA 4NIWA 4I8LA 5F8TA 4LZ1H 1GMDF 2BOHB 1GPZA 1SGRE 3BTKE 1P10A 4E06H 1ZRKA 1T8OA 1XMNB 2ZHEH 2M5TA 1O3BA 3BN9A 4J1YA 4MNVA 5JB9S 1AN1E 1CT4E 2Z9LA 1GHAG 1ABJH 1GI9B 1O2GH 2VJ1A 1EZUC 1BBRH 2ZPRA 1O5CB 1E34B 3MU1A 2ZHWH 4X2WA 2CHAB 4ZKSU 4O3UA 4X2VA 1ZOMA 4BAOB 2IJOB 1ZSJA 3UPEA 5GPIB 5C2ZA 2GZ9A 1OWHA 1EPTB 3AW1A 3S0NA 1P3EA 4KP0A 4ABBA 3VB5A 2OINA 3PROA 3URDA 3Q3YA 2R2WU 3NK8A 5DPAA 2EC9H 1YPKH 2P3UB 1O34A 8GCHF 1AO5A 1EQ9A 4WH8A 1C1NA 1YGCH 4AFSA 1YBWA 3F1SB 3I78A 2AS9A 4VGCB 3PWBA 1P3CA 1WYKA 2FLRH 4XSKU 3B8JA 2W7SA 5A0AE 1D3TB 3UFAA 4WMDA 1UVOA 1YP9A 2LNCA 1O3MA 3LIWA 2P8OB 1MQ6A 4UFEH 2BY8X 1J15A 1TPPA 1QBNA 4ASHA 2VINA 1TBQH 1AMHA 2G5NA 2FX4A 4Y0YE 3RXGA 2WUBA 3EA7A 4GHTA 4CRDA 3RXLA 3SGAE 2I6QA 1NS3A 3KCGH 1O3NA 1ELEE 1NRSH 2XNIA 4INHA 1GJCB 1LVYA 3ZV8A 4BAQB 1V2TT 1YYY1 4U32A 1O5FH 2VIOA 1IAUA 1ZZZA 2GTBA 1HXFH 2HALA 4GAWA 1ZYOA 5FX6A 2H6MA 4Q7ZA 2Z9KA 1S5SA 2WPMS 4OS5A 2B7DH 2CN0H 1LCYA 1E35B 3SOSA 2J94A 3LC3A 4D7FA 1W14U 2BLOA 3PYHA 1HLTH 2H1UA 3RU4T 1QA0A 3BTDE 1W3CA 3A88A 3ITIA 3PB1E 1NRRH 4AG2A 3ZZ3A 1TOMH 3VB3A 5JBTA 1BITA 1T4VH 4DCDA 2G4UA 2GCHG 1L0ZA 2ZZUH 3U8TH 1OPHB 1ZRBA 1FPCH 1N8OB 1J14A 2F83A 2XW9A 1MKXH 1FJSA 2DE9A 3M5MA 1KTSB 2V0BA 2XWBI 3NWUA 1GBJA 1VGCB 1GBBA 2VWLA 5GXPA 1OP8A 1QQ4A 5A0BA 3RXCA 1GMCG 1JIMA 1OYQA 4ZXXH 1TNGA 1HCGA 5E0JA 1FIWA 3EAJA 2VWNA 2P3FH 2A5AA 1EAIA 1CT0E 3TJUA 2XWAA 3T5FH 5DP9A 4ZKRU 3MO9A 4IW4E 1CT2E 2FS8A 3GY6A 4X6OA 2PR3A 5F8XA 1XKAC 2FODA 2JETC 3A7XA 3V3MA 3R3GB 4AG1A 1GG6C 2WPHS 3W95A 4ESTE 1ESBA 5T3HA 1RRKA 1EB2A 4FUGA 1GBHA 1YF4A 8LPRA 1GJ5H 2NWNA 2OUAA 1SGFG 2BVXH 3EDXB 2D26C 2NU3E 1ELVA 1DXPA 4H42U 1O2WA 4OGYA 1FLEE 1B0EA 1LVMA 4WXIA 2D8WA 2C4FH 2ZHFH 1C5TA 1DUAA 2ZC9H 1SLUB 2ILNA 3A8DA 2NU1E 1O2YA 1UMAH 2O8WA 1D3PB 1GI7B 1H9HE 1P05A 1H9LB 5DJ7A 3BIUH 1GCTB 1GG6B 2SGEE 3GICB 1QGFA 5DGJA 5DP7A 1AQ7A 1KY9A 1O2OA 2OBQA 5DP4A 3LGUA 5LPEA 2PW8H 3PLBA 1W11U 3PMJA 1P09A 3MYWA 4XFQA 4B2CA 4CH2B 4ZUHA 2XCFA 4OS4A 4OGXA 3D62A 1P2KA 1DS2E 2AEIH 4ZKNU 1V2UT 1RD3B 3BTFE 1FN6A 4A1XA 1E36B 1YLDA 3PM3A 5J4QA 4JMYA 3QX5H 1L1NA 1GCDA 3GY7A 1UTPA 1NU7B 2BDBA 1GHZA 4MPWA 1GHBG 1BUIA 3LJOA 1GVKB 1TBRH 5DKMA 3ZVFA 1K1PA 1N6YA 3VXEH 1C2JA 1EB1H 4Z0KA 1AVXA 4I8HA 4CR5A 1L1GA 4AX9H 3MFJA 1UTMA 5F03A 1T31A 1ARCA 2Y6TA 3STIA 4TY6A 5ETXA 1DWDH 1P8VC 4UD9H 4FXGH 1C2KA 4CBNA 1JMOH 2G4TA 1Y3WA 3UUZA 3TGIE 1O3DA 1ZPCA 1MCTA 5FCRA 1SQTA 3M36A 2BDGA 2FOBA 3GOVB 1SHYA 1QL8A 1P57B 5E2PA 3ZZCA 2HNTE 2A4QA 4WH6A 1MH0A 3UNQA 3BEUA 2Z3CA 2UWOA 1KDQA 1NU9A 2AGGX 3A87A 4MPXA 3RC4A 2BLQA 1B0FA 1C5RA 3SNEA 4I8KA 1ZHPA 3HK3B 3F68H 2OQUA 1DWEH 5EGMA 2VH6A 1Y3YA 1W8BH 1ETSH 1VZQH 1GWAA 1ELCA 1JBUH 2WUCA 1TNHA 2G5VA 2WV4A 3LGYA 1HXEH 2FLBH 1LKAA 2O9QA 4Y79A 3LGWA 1MAYA 2ZDLA 4J2YB 1CO7E 1T32A 1S85A 1C5OH 1O31A 1GHXH 3QN7A 2ZTXA 3CENA 5GWZA 3A8AA 1BTUA 3UTUH 1FZZA 2H2ZA 4K1EA 1AKSB 1ZHRA 3ELAH 1QB6A 3DFJA 1W7GH 3RDZA 4A5TS 5L2ZH 2TIOA 2G52A 4HGCA 1C5SA 2SFAA 4FUJA 4ZXYH 1H4WA 1O3OA 1GJBB 2H9HA 2Q6FA 4D9RA 4CH8B 5IDKA 1QHRB 1BMNH 3CS0A 3PMAB 1GBAA 3SJ8A 1FQ3A 1ELTA 1NRNH 3K6ZA 3RMLH 4MPVA 1GMHF 3VGCC 3BTGE 2WYGA 5ESTE 1D3DB 2UUKB 4DJZB 5EQQA 1GJAB 9ESTA 3LU9B 3O8RA 5DP8A 1P02A 2GZ7A 3ZZAA 1Y3VA 2FI5E 3F9GA 4FUIA 3VFEA 4BANB 2BOKA 8KME2 5LH8A 3BTEE 2BDIA 1HAPH 4DW2U 2F9OA 4XBBA 1TRMA 1KYNA 2OBOA 3M37A 1V2WT 2EEKA 1O5AB 1XUIA 1TLDA 4JZ1A 1HFDA 1GBDA 2CMYA 2ZDAH 1DWCH 2STBE 2FOEA 2WPJS 1RFNA 1Z1JA 3MH5A 3P8GA 1E0FD 1EJNA 2QXJA 3H7TA 1UHBA 2Z9IA 3MMGA 4BTTB 4XE4A 4FUBA 3SNDA 1Z8GA 1THSH 3MNSA 5HMAA 3RXTA 3P8FA 3ZZDA 3RUOA 1WQVH 1HPGA 2ZQ1A 1C5VA 2F9BH 1NROH 3QTVH 1QNJA 1TOCB 1RXPA 3FP7E 2ZU1A 1ZSKA 1GJ9B 2XBXA 3FAOA 1OP0A 1DLKB 1MD7A 1DOJA 1EAWA 1OKXA 1F0UA 1O39A 2VWMA 1HJAB 1THPB 1ZGVA 3E3TA 4ABHA 4Y8YA 4K1SA 2ZI2H 4Y10E 1AVGH 3JZ2B 4X1RU 7ESTE 4GLYA 1XUKA 3OX7U 1G37A 1MU8B 5DK1A 1QFKH 1A3EH 1IHSH 1HUTH 2O8TA 3FVFB 1DM4B 3KQEA 2V6NA 2DUCA 1V3XA 1F5RA 4ABDA 2GT7A 1MTWA 3BTTE 2EI7A 3ZZ5A 1TGCA 4K5ZA 1V2OT 1AB9B 4CRFA 2SNVA 3L3TA 2ANYA 5GDSH 4K2YA 1AVWA 3RP2A 4UFGH 5AFZH 1D3QB 3MH6A 3N7OA 3P6ZB 3H5CB 1HAVA 2ZNKH 4WF8A 3BTME 1TONA 1TNKA 1P11E 3UY9A 1O3FA 2ZG0H 3SBKA 1RTLA 1GI0A 2VIQA 3EYDA 1QJ6B 2VIDA 3BEIB 2Z9GA 1TA2A 3EA9A 3SUEA 4ISHH 3LGTA 4MVNA 1L2EA 3SO3A 7GCHF 3BTQE 1HAHH 1V2RT 1TRYA 3QZQA 1GJ7B 2FOAA 4TYDA 3S9AA 1GBEA 1O2VA 4ABAA 5C5NA 3EA8A 1ESTA 5HM2A 1C1MA 3B9FH 3ZZ9A 1SGCA 3BIVH 2ZTYA 1YC0A 3VB7A 2XBWA 1T8MA 1NPMA 1ZHMA 2BX4A 1C5NH 1BTXA 6ESTA 5I25A 3RXOA 3M7UA 1GJ6A 1Z71A 1JRSA 4X1NU 4B75A 3URCA 1BHXF 3SI3H 1O2PA 1PPZA 3LPRA 4D8NA 4E05H 5FCKA 4UFDH 1P06A 2ZGXH 1FMGA 1BQYA 4HI3A 1NTPA 3Q3KA 1BIOA 2Z7FE 4BAKB 5DG6A 1ORFA 2Y7XA 2GMTC 2VVCA 4ZHLU 4B2AA 1GDUA 1A1RA 2ZFTA 3V7TA 3A8BA 4XOJA 4DGJA 1K2I1 3PO1C 3OYPA 1C5UA 2A4RA 2BYAX 2J38A 3S69A 2C3SA 3NUMA 4MDSA 5F8ZA 1M9UA 5T6DA 3T26A 4DOQA 3MWIU 1P2JA 1JIRA 4Y71A 1G36A 3RU4E 4ISOA 2P93A 3A7TA 1Z8RA 2HVXA 2A2QH 2W5EA 1FI8A 2FI3E 1WOFA 2GD4B 2V35A 1OWDA 3T29A 1F5KU 1O2HA 1SGIB 3TIUA 5GJ4B 1OP2A 1HAYB 2OC8A 4ZHAA 3A81A