3OY6U

The crystal structure of upa complex with peptide inhibitor mh036 at ph4.6
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy6U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oy6U01
4GHTA 4B2BA 3FFGA 1BUIA 1QTFA 1OYQA 1XUKA 1A3BH 2FZZA 2LPRA 3U8RH 1G32B 1G2LA 1QURH 1TGNA 3Q77A 2H5CA 2R2MB 1T4UH 1K1OA 4AB9A 2BD4A 3OY5U 1GI2A 4ABIA 1C4Y2 1HAVA 4I8GA 4CRCA 3URDA 4X8TH 1LPKB 2JKHA 1K21H 3SU6A 3HKIB 1V6DA 4X1NU 1WU1A 1UCYE 1GJCB 2FWWA 1C5XB 3SV6A 1XUJA 2P3UB 3TNSA 1AB9C 5FCRA 1UTNA 2Q1JA 1PQ8A 2Z9GA 1P2QA 4A1TA 1UTOA 4MG3A 1SC8U 1MTNC 1YLCA 4AYVB 1UMAH 4YTAA 1SMFE 1JRTA 2J4IA 3VGCC 3SGBE 2VH0A 1S0QA 1O2NA 1GCTC 1V2UT 1G3CA 2A4OA 1CBWB 2Z3DA 1OWKA 3GYMA 2D1JA 7KMEH 2UUFB 1DE7H 2FOMB 2GGVB 2ZPSA 3DHKH 1GJ8B 2H9TH 3ATWA 1V3XA 3SV9A 1AI8H 1KTTB 1TABE 3W95A 5C20A 3RMNH 1C5UA 1O5EH 1ZRKA 1QQ4A 4HGCA 4B2AA 2ZG0H 2BOKA 3MNSA 3ODDA 1SGNE 4FUIA 4MNWA 3A8BA 5FCKA 4X2WA 2EI6A 3DD2H 2XWBI 1GDQA 3BTWE 3ATMA 4ISIH 3TGKE 3HGPA 4ZHMU 2BHGA 2THFB 1T8NA 2ZGXH 2QIQA 1TPPA 1SG8B 3SJIA 3HATH 4CRAA 2A4GA 2FOAA 3NCLA 2QCYA 4UEHH 1PPEE 2DE9A 1VCQA 3N7OA 3D65E 1UTMA 2DUCA 1G3BA 2GCTB 4TPYA 3RDZA 2BD3A 2ZDVH 1ESTA 3MMGA 5EW2H 3PMBB 1XVOA 2LNCA 1DWDH 1IQHA 1CT2E 1G9IE 1HAXB 2FI4E 3NK8A 1Y3WA 3ZVGA 2A4QA 1BBRH 1PQ7A 3EA9A 3UIRA 3SNBA 2B7DH 3Q3XA 2AERH 3M36A 2FS9A 1AGJA 4UONA 2JH0D 1YF4A 1MZAA 2BY6X 2R2WU 3S7KB 1FPCH 3B8JA 2OQUA 5JYIA 4DG4A 1MQ5A 1OWHA 1HJAB 1HBTH 2H9HA 1BHXF 2IPHA 3SJ8A 2VIPA 4MPUA 1O30A 5DJ7A 1S82A 3GY7A 5I46H 2OCVB 3T28A 1FN6A 3ZVBA 1RFNA 4LZ1H 5C5NA 1TOCB 1LHEH 2SGPE 1PPFE 1LDTT 4PROA 4X6OA 4OS2A 3KHVA 3PV4A 1IQFA 2STBE 1MD7A 5A0BA 3P6ZB 4K60A 3RXIA 1IQJA 2VGCB 2Y5HA 1TPSA 3BTTE 1INCA 1LVBA 1RXPA 3SHCH 5TCCA 3T5FH 4YT6H 4BAKB 4ABGA 3RXVA 2BZAA 1KLTA 5G4BA 4Y8ZA 5EOKA 4IC5A 3MFJA 2NU4E 4AFQA 2TBSA 2ZEBA 3DFJA 1EAUA 3LGUA 1C9TA 3OSYA 4ABEA 1LVOA 4XBBA 1XUGA 3BTFE 3P95A 4ISLA 1D6WA 5EPNA 1ANCA 4GLYA 2PUQH 1V2LT 3MH6A 5HMAA 3RXPA 1ZR0A 1FY4A 2ZCHP 4NCYA 3F68H 3TU7H 5PTPA 1E36B 5F03A 5LPEA 3B23B 1AUTC 5FX5A 1J16A 4DGJA 2BQ6B 3CS0A 4KP0A 1QB1A 3D49H 1GJDB 4M7GA 1FQ3A 3HK3B 1KXCA 2BVXH 1GHBF 4DT7B 1TNGA 4DY7B 1CT4E 3M5NA 3E91A 2PR3A 1DFPA 2O9QA 3BTQE 3GCNA 1T8OA 3ZYDA 1MKXK 1LHFH 4F49A 4X1QU 1T31A 3L3TA 4BXWA 1O31A 4CREA 3SU1A 1ETTH 3QX5H 1HGTH 1K28D 2A2QH 1HJ9A 1YCPK 2ILNA 3S7HB 1DUAA 2SGDE 3A80A 2F9VA 4ZXYH 5E8EH 3ZZ6A 4GVUA 2PSYA 2BXUH 4Y11E 1ELGA 2XC5A 1NU7B 3SNDA 1G30B 4WXVA 3VFEA 4LOYH 5T3HA 1GPZA 4MVNA 5EQQA 3FZDA 1GGDB 5DP6A 4XBDA 4YOGA 1QBVH 1DDJA 5GIBA 1VITH 3E90B 3SV7A 1NO9H 2Y5GA 1NRNH 3W94A 2EA3A 3GY6A 2AMQA 1E0FD 3OYPA 1L0ZA 1GVZA 1GI1A 1L1NA 2H2ZA 3S9BA 1EZQA 1CU1A 3AAUA 1O3OA 1XXDA 4IGDA 4CBOA 3A84A 1TPOA 3SJOA 3MU0A 2ANWA 2QGRA 3RMOH 1J15A 1TGTA 3ZZBA 4VGCC 3O8RA 3M5OA 2BOHB 1OKXA 4SGAE 3UOUA 1UCYH 1XUFA 1F0UA 1UTKA 3V7TA 7GCHF 1BTYA 1YLDA 2BLOA 1AO5A 4X6PA 3UNRA 1NN6A 2XWAA 1GBDA 3GY3A 3UY9A 3ZZCA 1WOFA 2F9OA 3P8GA 2Y7ZA 1ZTKA 3PLPA 1DVAH 1E37B 3FZZA 3LONA 2RG3A 2AMPA 1F2SE 1FXYA 2ZFFH 1GJ5H 2C90B 4FUCA 2IJOB 4X2XA 3M61U 1HAIH 2Y6TA 1CA0B 4U01A 2BY9X 4INKA 1A0HB 1O3NA 3UREA 3ZVCA 3M37A 2ODPA 1BTHH 3LC5A 3U69H 3ZZ4A 1BDAA 4ABFA 3FANA 1T8LA 1C1SA 3GDUA 3PLKA 3C1KA 1GBKA 4WY3A 2VIDA 4QT8C 3U9AH 1F92A 3MU5A 1L4ZA 3P8NA 5HM9A 3GYLB 3JZ1B 1GI8B 2XRCA 2ZGCA 3RU4D 2P59A 1PFXC 2QY0B 2PGBB 2VH6A 3RXRA 5A2MH 4JK6A 4Y8XA 1QBNA 1Z6EA 4AOQA 2Z3EA 1DY9A 1HAVB 3RP2A 3SUEA 1BMAA 4B76A 3GCTG 1GJBB 1QJ6B 3OTJE 4E05H 2VIQA 1MAXA 1GMDF 1O32A 1TX6A 1UK4A 3QGJA 3RXGA 2ZP0H 4K1TA 3L6PA 4IBLH 3ZVDA 4WMDA 1V2WT 1G3EA 3DUXH 3GCHB 1ANBA 4D7GA 4BTTB 4ZKOU 1WTGH 4FU8A 1O3BA 1AHTH 1ZPCA 1GVLA 3S69A 1BOQA 2G81E 1HAZB 1YP9A 1TBQH 3LJOA 9ESTA 1C2HA 1RIWB 1EZXC 2CHAC 1O2KA 3ATIA 1C5WB 2P8OC 3SGQE 2GKVE 1A5HA 1RTFB 1ARCA 1QIXB 2Z3CA 3RLYH 5C2ZA 5HXFA 1IAUA 3TLOA 1AB9B 2BDGA 1WYKA 2C3SA 1CT0E 1O3PB 3ZVAA 1O2VA 1ZSKA 1A2CH 1GI9B 1GHZA 3GY4A 3SNAA 1NFYA 1AVWA 1F0RA 1TRYA 1O2JA 4E7NA 2EI7A 5JPMH 2XCFA 1BRCE 1F7ZA 3AW1A 1OSSA 2FX6A 1NT1A 1OX1A 2FOBA 2R9PA 1C5NH 1GVKB 2FESH 3F9EA 1OWIA 4X8SH 1ORFA 3BIUH 3VB3A 2JETC 4CH8B 2PKAA 4WMFA 1CO7E 2ZFSA 2ZWLH 1ZHMA 1PQ5A 2P95A 4ABDA 4BTIB 1A1RA 1KXBA 1HYLA 1ZLRA 1W0ZU 1Y5UT 1ZZZA 1SGQE 4Q2KA 4I7YH 1ESAA 1IOEA 1C2DA 1V2KT 4YZUA 1OWEA 2ZU1A 3LOXA 1GHAG 4CRDA 4JCNA 5C67A 2J2UA 5TJXA 3U98H 5GJ4B 5GWZA 3RXKA 3ITIA 2FPZA 2SGFE 2F9BH 3KQBA 1P11E 1K1MA 4XFQA 1S85A 4B74A 3LT3A 4FUBA 3TK9A 1XKAC 3UQOA 2WPLS 2GCHF 3AAVA 3M5MA 2K1QA 2PKSB 1BMLA 3LKWA 2B5TB 2ZECA 1EXFA 5AFYH 4TWYA 3PTBA 8KME2 1Z6JH 4ABJA 1O33A 3G01A 4CHAC 2ZDNA 3MH7A 3BSQA 1C1UH 1SQOA 1X7AC 3ENSB 4IMQA 3TK5A 3T27A 1N8OC 5DPAA 4KTUA 5GXPA 2VVCA 1CA8B 1O35A 2O8TA 5AFZH 2BDCA 1A7SA 4ISOA 2TRMA 1O38A 1ZOMA 1SLVB 3CS7A 4K3JA 4MPVA 1TBZH 3GDVA 1ELEE 1PYTC 2OP9A 2ZI2H 1TFXA 1IQKA 3ELAH 2BD5A 1DY8A 1O3JA 1JWTA 3GCOA 3QN7A 2AGGX 1BTPA 1O3MA 3SO3A 1V2ST 3K2UA 2OTVA 3V3MA 1H8DH 1KXEA 1VGCC 1ZSLA 4JZ1A 4KGAA 9LPRA 1W8BH 3GY5A 1C1PA 3ATKA 4Y0YE 4ZROA 5C3NA 3CENA 1P3CA 4FUFA 1TMTH 6LPRA 3BV9B 3LGIA 1NPMA 1IQLA 2OD3B 4O3UA 1GHVH 3MNBA 2Z9JA 2B8OH 1FY1A 2OC7A 4JMYA 1GJ7B 1MKWK 2BDHA 2Z9IA 2V6NA 3GY8A 3SHAH 1EPTB 3T26A 1XX9A 1HUTH 1NM6A 1O2XA 2J92A 2BDIA 2GZ9A 1TE0A 1F0SA 2GMTC 1FI8A 5F8TA 4WJG2 1CVWH 4BNRA 2J95A 2VB0A 1DICA 1QR3E 1UTLM 5FBEA 3NZIA 1QB9A 1H4WA 1L1GA 1DLKB 2ZQ2A 5AHGH 1P01A 1QBOA 1MBQA 3GICB 1ID5H 3SI3H 1H1BA 2FIRH 2VNTA 3A7TA 1W7XH 4H6TA 1KDQA 1TNJA 3C27B 1UO6A 5LGOA 3HGNA 2W7SA 2R0LA 1L2EA 2ZQ1A 2BDAA 2GT8A 3PO1B 5L6NH 1OOKB 1HAYB 3I29A 2RCEA 5TCAA 3A83A 1OPHB 2H1UA 1QL7A 1F5LA 2O8MA 1C1VH 1PJPA 7LPRA 2ZZUH 1Y8TA 2HVXA 4GPGA 1UVPA 5F8XA 1NZQH 1W12U 1C1NA 1TA6A 5FHTA 2A45B 2RA3A 2BD8A 5A0CA 2FLRH 2G52A 1NY22 1HRTH 1QGFA 3PWBA 3UOPA 2ZDAH 3SGAE 4K1SA 2QN5T 1BTZA 4YLQH 1H9LB 5CHAC 3ZVEA 2VVUA 2VJ1A 3ESTA 1CGIE 4MQAA 1HFDA 2P3FH 1TNIA 2Y7XA 4A6LA 2ALPA 1KIGH 2V3HH 3F9FA 2ANMH 3GISB 2CJIA 1MBMA 1FJSA 5EODA 3MI4A 1EB1H 3TITA 3ZV8A 2NU0E 4FXGH 1ACBE 2FOGA 4Q7ZA 4AFUA 4DW2U 2G00A 5ETXA 1CSOE 1VZQH 2VU8E 1AUJA 4MNYA 1CE5A 4BTUB 1GHWH 1TB6H 4WWYA 1XXFA 1HV7A 4I8KA 1FN8A 1SBWA 1VJ9U 3MHWU 1V2JT 5GCHF 4NG9H 4Y10E 2ODQA 4ESTE 3ZZDA 4RKOB 2BLWA 1BA8B 3MU1A 1HAPH 1AKSA 1V2MT 4X1RU 3T25A 1OWJA 4X6MA 2FTLE 2B0FA 2SNWA 1V2TT 5A8ZA 2WPHS 2FDAA 3RXTA 4A5TS 4TY6A 4AX9H 1ZSJA 2IOTA 1YC0A 5FAHA 4YLUA 1GBIA 1YPKH 1BMNH 2OC0A 1NFXA 1RJXB 1SI5H 1TRMA 2F9PA 2TPIZ 5DP3A 5DG6A 1E35B 3RXJA 4RKJB 1O2RA 3OU0A 1AVGH 3MU4A 2ZFPH 4Y0ZE 3A7ZA 2FEQH 2HOBA 4GCHF 3ODFA 3ZZ5A 1BRUP 1RGQA 2WYJA 1LQDB 4ZXXH 4CRGA 2H9EH 5ABWA 8GCHF 2RA0A 4NIXA 1EP5A 1DS2E 3EE0B 4NIVA 4OGXA 2BYAX 2ZHQH 3EA8A 1V2PT 4AGKA 3F6UH 3E3TA 4TPIZ 4A92A 1YYY1 1FIWA 3RXSA 4AFZA 2GP9B 1YKTA 1AQ7A 1AWFH 1HLTH 2FOHA 2Y81A 2Q6GA 2HLCA 2HNTF 1Z8IB 3MTYA 3A87A 1OYTH 4A1XA 1KXDA 2STAE 3TH3H 2PV9B 4LXBH 4X8UH 2PUXB 1UTQA 1NROH 2FP7B 4I8HA 1DX5M 2R3YA 1MTUA 3LPRA 2UUYA 2QA9E 3R0FA 4WVPE 2G5NA 4Y7AA 1YCPM 1S84A 3L33A 2XBWA 3PLBA 5T6FA 4ZKRU 3OX7U 1ABIH 1C5RA 1FY3A 3TIUA 3OY6U 4FUGA 4A7IB 1EATA 2PKAB 2GV6A 4ABHA 1Y5AT 2XC0A 3JZ2B 3FVFB 1SGTA 1GI0A 1P2OA 1BJUA 2P8OB 2QXGA 3TJUA 1AE5A 2XC4A 4O9VA 2A7JA 3VB4A 3ZZ7A 6GCHF 2UWOA 2FX4A 3TGJE 2Y5FA 2G8TA 2PTCE 1EAXA 2HRVA 4Y6DA 1JOUB 3U1JB 1SLWB 2XBYA 1PPZA 4TYDA 3ZZ9A 3RU4T 1DWBH 1SB1H 2C4FH 1SGRE 1UK2A 1P05A 1FONA 3BN9A 1DLEA 1KXAA 1TBRH 3SU4A 4XE4A 1AZ8A 1CBWC 3A7VA 1QA7A 5A09A 3TJNA 1SQAA 1C5MD 5LPRA 5EU8A 8GCHG 1BTWA 2W26A 2ZPRA 2A1DB 1TMUH 3U8OH 1OP8A 4A1VA 2AFQB 2GZ7A 5CMXH 1NESE 8ESTE 5EXNA 2D8WA 3B9FH 1HB0B 2GDDA 5J4QA 4NZLA 2YNAA 3RXAA 2ESTE 1EOLA 3M3TA 1AZZA 1P03A 4DOQA 1KXFA 1GI5A 3M7UA 1O5GH 2FOCA 1AU8A 1N1LA 3RUOA 1O3FA 1MAYA 2B9LA 3RU4E 1H9IE 1DXPA 3SV2H 4AG1A 1O39A 4I8LA 2BVRH 4NA7A 4GSOA 1ZTJA 1TGCA 1K1JA 1E34B 1O0DH 4D9RA 4NWKA 5JB8S 5DP4A 5FBIA 2A31A 4UFEH 1YM0A 4ZKNU 3R3GB 1EAIA 1DWEH 1LKAA 1K1LA 3EYDA 2ZHEH 4GHQA 1GBHA 2HPPH 4X0WU 1Z8JB 3M35A 1GHBG 4IN1A 1G36A 2GCTC 2PFEA 2WPIS 3M3SA 4X1PU 3LGVA 4FUEA 1GBBA 4NWLA 3SU5A 2ZGBH 1O5FH 1Z8GA 4GUXA 1LHGH 4I8JA 1OP0A 1J14A 1DSTA 2ZIQH 6GCHG 1O3GA 1ETSH 2RDLA 3ATLA 2ZGHA 1BHXB 4HI3A 4K5ZA 1H8IH 1MKXH 2ODYB 4BOHA 1T7CA 1IQMA 3IITA 1O3LA 1HJAC 1UTPA 1YCPH 1O3IA 3FP7E 1LVYA 3LGYA 1O5DH 1ELVA 1D3PB 2C8XB 1A5IA 3FP6E 1T8MA 1MCTA 2A0QB 1O2HA 2TIOA 1O2WA 3UNSA 1C2KA 1JIMA 4I31A 2Q6FA 2A5IA 2BVSH 2XW9A 4LK4A 3SI4H 2AYWA 1FLEE 1Y3UA 2BX4A 3ZZ3A 2BLVA 1C1QA 2F9NA 2FMJA 2VGCC 5C1YA 1VGCB 1G37A 1CGJE 1BQYA 1S83A 1QJ7B 1YPMH 3HK6B 1A0JA 1MTVA 4FVBA 1C1RA 3S9AA 1TWXB 2FOFA 2PTNA 1P2MA 3KNXA 6CHAC 2M5TA 1BITA 1SGEE 2ZDMA 1FIZA 1SFQB 3NUMA 4YOIA 2OC1A 1DUEA 1LQEA 1DANH 1A3EH 1LPGB 1P9SA 1BRBE 4NA9H 2ZU5A 1Q31A 2AS9A 2A5AA 2HWLB 1SOTA 7GCHG 4HZHA 4ZKSU 2BM2A 4O03A 4R8TB 2Z6BD 3RXMA 5C1UA 4OS4A 3H5CB 1O5AB 3KN2A 2J94A 2GZ8A 1XMNB 1TQ7B 4IW4E 5CE1A 1EJNA 3PB1E 1IQGA 3PMAB 1SR5C 1VJAU 4FUJA 2ZHWH 1ANEA 1LHCH 1M9UA 1NRQH 4MPWA 2W7UA 3RC4A 2VIWA 4ZAEA 1H9HE 4MLFB 5JBTA 4KKDA 2V3OH 1FNIA 1C2IA 3RMMH 5ESTE 1WSSH 1ZRBA 2TGPZ 1HPGA 1EJAA 5DP5A 1MTNB 3V12A 3QUMP 1AD8H 1IQNA 1TOMH 3T62A 2HNTE 3P8FA 1IHSH 1C1WH 4I32A 2Y82A 1JXPA 3VGCB 5L30H 1D3DB 2J38A 3MO9A 1EASA 3IWMA 1DITH 1GCTB 1P8VC 3BTME 3QGNB 1AE8H 1TX8A 4IMZA 3TH4H 5IYTA 4Q7XA 3RXUA 3BTEE 2WPJS 1YPGH 3EA7A 4H6SB 3BG8A 1C2GA 5C1XA 5FPYA 4X2YA 1TPAE 4BAQB 1C5VA 3E6PH 1QRWA 5JDUB 1O2LA 3HKJB 3FAOA 3A7XA 2XYAA 2WINI 1GBTA 3SUFA 4INHA 4FU9A 4ZH8A 3M5LA 1W10U 4X6NA 1P06A 1AKSB 3DT0H 4B75A 3VEQB 3VXEH 1SVPA 4BANB 5DK1A 3VPKA 1K1PA 1P2IA 1GMDG 4ABBA 1K1IA 1C2JA 4BAOB 2IN2A 3A82A 2I6SA 3P92A 1BRAA 1LPZB 3RXLA 2QV1A 3RXOA 1PYTD 2FXRA 3HPTB 1A61H 1BCUH 1TGBA 1VR1H 3NKKA 3O8DA 1QNJA 1K22H 1GMCF 1XM1A 3MH4A 4WMEA 1QRZA 3KCGH 3V13A 3RXQA 1C5TA 1GMHF 1LKBA 1TRNA 2WPKS 5JB9S 1W11U 4B2CA 4THNH 1O3AA 3TNTA 1LO6A 1W2KH 3P70B 1EKBB 2OXSA 4OS1A 1W0YH 4NFEA 1EQ9A 2ZTYA 1V2OT 1OXGA 1B7XB 3ZYEA 2HPQH 1C5ZB 1C2FA 2V0BA 1EAWA 1NU9A 2FYQA 2Y80A 4CBNA 3SJ9A 2GX4A 1V2RT 4OGYA 1SGYE 2C8WB 2GDEH 1O2TA 4K69A 5JBAS 2Q6DA 1C5OH 3M3VA 5HGGA 4HTCH 1GHXH 2CF9H 1Y3YA 1YPHE 1O34A 3H7OA 4H4FA 1PPGE 2W3IA 3K9XB 1QCPA 3RLWH 2AGIX 4B1TA 2BQ7B 1ZMJA 1KLJH 2G55A 4CR5A 1MU8B 3LU9B 2NWNA 3CP7A 2AEIH 4ISHH 3PYHA 1S6HA 3SQHE 4AG2A 2FM2A 4ZHLU 1P12E 2P3TB 2R3UA 1SHHB 2HNTC 4FUHA 4AZ2B 2GVFA 1O2QA 1NRSH 4I33A 4CH2B 4KTSA 1GBAA 1NRRH 2ZNKH 3UR9A 1A5GH 2UWPA 1C1TA 1UHBA 1RD3B 2CN0H 2A7HA 3Q3YA 5J4SA 1JMOH 3Q76A 3RXFA 2UWLA 3BEIB 3PWCA 5E2OA 3BEUA 2BMGB 4WXIA 4ISNA 2D2DA 3GCHC 1AIXH 1C5PA 3QK1A 1CQQA 1QQUA 1W14U 3U8TH 1NS3A 1GMCG 1FV9A 3SJKA 2O8LA 1GMHG 1HAGE 2AGEX 4BAHB 1BBRK 1Y3VA 2NU3E 3SU0A 1O3DA 1RIWC 4E06H 5BRRE 4YT7H 2GCHG 4ABAA 3MYWA 1EX3A 3RXCA 3QTVH 1SGFG 1GDNA 2BDBA 2Z9KA 3A7YA 3M7TA 2FS8A 3WY8A 1UVTH 4D8NA 2CMYA 1FZZA 4U2WA 3GOVB 4Q7YA 1BB0B 1E38B 1O2UA 2WPMS 4IN2A 4XSKU 3QDZB 2W3KA 5E0JA 3MOCA 5DGJA 2BD9A 2Z9LA 4YM9A 3BTHE 2G4TA 1ZHPA 2R0KA 2C93B 1O2PA 2ZGJA 3VB6A 1GHYH 1P2NA 2OINA 5A8XA 3Q3KA 2GT7A 2H5DA 1DPOA 1FUJA 1GG6C 3AW0A 5ESBA 5C5OA 1ELTA 1VCWA 2VWMA 4XDEA 1GJ6A 3QZQA 4R0IA 5E2PA 2ZFRH 4ASHA 2VWNA 3LGTA 2OBQA 3E0NB 1JRSA 2BDYA 1TIOA 3MO6A 5B6OA 4OS7A 1TNLA 3O8CA 3K6ZA 1HIAA 5H4IB 1V2VT 1ZPZA 2EC9H 2XCNA 1Y5BT 1BJVA 2F83A 4UDWH 3QZRA 2QXHA 1C2MA 3TVJB 2VINA 5L2YH 3RXEA 4H42U 4AORA 5T6DA 4CRFA 1B0FA 2A7CA 1YPHC 2PHBA 1DM4B 4VGCB 5GDSH 2J9NA 2A4RA 2FLBH 2WV5A 1EB2A 1KLIH 1D3QB 1C1OA 1GCDA 3EDXB 1MMJN 1GI6A 3Q00A 4DVAU 1FDPA 2XNIA 1AY6H 1TX7A 3UQVA 2FI3E 4JYUH 2PGQB 1ELAA 1MKWH 2XBXA 2A32A 3RC5A 1EZSC 1J17T 2VWOA 2D26C 5FX6A 1NFUA 2SGQE 1U6QA 3KIDU 4YOJA 1SLXB 4ZHAA 2BB4A 1LMWB 4JZDH 1P10A 1ELCA 3D62A 5LPFA 3EGKH 4NIWA 2WYGA 4K1EA 1WQVH 2WUCA 2G51A 5SGAE 3P17H 1QFKH 3SNEA 3K65B 5FXLA 4KELA 1AFQC 3GDSA 2PKSC 2QAAA 1Y59T 1DSUA 1QL8A 3SZNA 3UR6A 2W5EA 4AFSA 1JBUH 1GJ4H 4Q80A 4Y71A 3QO6A 3E16B 1BTUA 2SGAA 4AB8A 1GI4A 3MH5A 3SUDA 1PPHE 1ZPBA 1FAKH 1PQAA 2XTTB 2ZU3A 3NWUA 3LIWA 4RN6A 5HM2A 4MPXA 1PPCE 1C2LA 5A8YA 1AWHB 2ZDKA 5E0GA 4X1SU 1OP2A 2BX3A 1P9UA 1D9IA 4WH6A 3KQDA 1HXEH 1TA2A 2BLQA 4DJZB 2FOEA 3ZZ8A 2ZTZA 3M7QA 4K8BA 1O2IA 4UE7H 1O2ZA 4FUDA 1UCYK 4WF8A 6CHAB 1IQIA 1MCVA 1P2KA 1C5YB 2ZCKP 3A88A 3VB7A 1AFEH 1TLDA 3LH1A 3MNXA 1HJ8A 4X2VA 2QXIA 4TWWA 1Z7KA 2OC8A 4UFFH 3BG4C 5GPIB 2Z7FE 1EPTC 3A8CA 1GWAA 2QYIA 1SHYA 1RS0A 2ZU4A 1K1NA 1C4U2 3A85A 1RRKA 3A7WA 1HCGA 2CHAB 3O8BA 4UD9H 2C8YB 2BTCE 2GD4B 5GCHG 3KF2A 4BAMB 2QXJA 1C5QA 2YNBA 1TAWA 2KAIA 1EZUC 3DA9B 3SU2A 3TGIE 2A5KA 3I77A 2BY5X 2PSXA 3MO3A 3QWCH 4SGBE 4NIYA 3RMLH 1GBJA 2VIVA 4O97A 3RM2H 4JYTA 4AYYB 4TY7A 2HALA 1LTOA 3GY2A 2OBOA 1ELDE 3PO1C 4GCHG 2YOLA 4NSYA 1SL3A 1ESBA 1WAYB 1Q3XA 1ZJKA 1ZMLA 2ZA5A 4U30A 1EPTA 1KTSB 4ZUHA 1O3KA 5BPEA 2JETB 1N6YA 1FMGA 2NU2E 5DKMA 1ZHRA 4HFPB 1W7GH 2HGTH 1YPLH 2BQWB 1QRXA 1GDUA 1HAOH 4Y79A 1D6RA 1LVMA 1FAXA 5EQSA 5EGMA 5JBBS 4B71A 1SSXA 1HAHH 3GCTF 1EJMA 4J1YA 4K8YA 5DP9A 4CR9A 2WUBA 5AVDA 1QL9A 4JK5A 3E8LA 5EW1H 1WBGB 1P57B 3F1SB 3PMJA 3A81A 1ZGIA 4DIIH 1K9OE 2VWLA 5EG4A 1DT2A 3TH2H 2H6MA 2BY8X 4NFFA 3P8OA 3PM3A 1UVUH 1OWDA 2FO9A 1A4WH 2TGDA 2FYRA 3T2NA 3UUZA 4Y8YA 1TQ0B 4GAWA 1G2MA 1HXFH 2Z94A 3STIA 3MNCA 1THPB 3QLPH 1P09A 1QHRB 1O3CA 4MNVA 5EPYA 1KSNA 1XUIA 2J34A 2ZU2A 3UNQA 1O3HA 3STJA 3SN8A 1O5CB 2P94A 2PW8H 5FPSA 4DURA 1D3TB 1Z71A 4NA8A 1NFWA 1O2OA 2ZF0H 1C5LH 1C5SA 1UHBB 1L4DA 1SLUB 3A8DA 4CHAB 3AASA 4WH8A 7ESTE 3KGPA 1BTXA 1VITF 2PWXA 2ZO3H 2C8ZB 2GV7A 1ABJH 1N8OB 2GTBA 1BMMH 2BD7A 4IC6A 2ALVA 5DP7A 1WCZA 2TGTA 1RTLA 1O2SA 5LH8A 1IQEA 1O2MA 3LH3A 2JH5D 1OS8A 4YO9A 1TONA 3MWIU 2DE8A 1Z8RA 3SV8A 2AH4X 4Z0KA 4MDSA 1TGSZ 1O36A 2F9UA 4UFGH 4JYVH 2UUJB 1TALA 2AIPA 2CV3A 4FU7A 2SNVA 3SBKA 1P04A 1XKBC 3I78A 1LCYA 3A89A 1AN1E 1J8AA 4BXSA 3UPEA 4AN7A 3TPIZ 2AMDA 1YGCH 1SOZA 3RXBA 1ELBA 1SGFA 3K6YA 3T29A 2FODA 1CGHA 5K0HA 2AIQA 1EP6A 3QTOH 2WV4A 1K2I1 1KDQB 1MUEB 3NXPA 1MTWA 1C9PA 1ZMNA 4K2YA 3F9GA 2ZTXA 8LPRA 2ANYA 2SGEE 3SNCA 2BXTH 5L2ZH 2ZHFH 1UVSH 2FTMA 1G3DA 3NPSA 1BZXE 3BEFB 1P3EA 5DO4H 2GMTB 3SORA 2XBVA 1O5BB 1FY8E 3SW2B 1UVOA 1GHAF 5EXLA 1ZYOA 2OUAA 3UTUH 3MU8A 5F6MA 1ZTLA 1GBCA 1P0SH 4UFDH 2ANKH 3H7TA 1TYNA 4D76A 1P2JA 1SPJA 1L1JA 2G4UA 1ETRH 3ZV9A 1P02A 2SFAA 4O3TA 2A2XH 1HIAB 1NRPH 1B0EA 3RM0H 3V0XA 5EQRA 1C2EA 3PMHB 1SQTA 4OS5A 5K7RA 1WTHD 1S6FA 4MNXA 5HYOA 4Y7BA 1F5KU 1DXWA 1SGDE 1THRH 2JH6D 1MQ6A 2F91A 2NU1E 3UWIA 2CF8H 4NGAH 4MTBA 1RTKA 1KY9A 1NTPA 1MU6B 1THSH 5FPTA 1LHDH 2QF0A 3D23A 1UTJA 3SUGA 3BF6H 4U32A 4F4OC 1O37A 1VITG 3U1IB 1S5SA 4IS5A 1CHOF 4JZFH 2UUKB 1T4VH 1V2QT 4DIHH 3SQEE 2ULLA 1SGIB 1YBWA 4J2YB 5IDKA 2V35A 2BD2A 4KTCA 1GG6B 2O8WA 3VB5A 1GGDC 1O2GH 2QF3A 1FPHH 1BBRE 1SGPE 1WV7H 1GBEA 3LJJA 1B5GH 5EXMA 1HNEE 1XVMA 3F9HA 5T6GA 3PTNA 3BTDE 2ZPQA 5CHAB 4E7RG 1BT7A 5E0HA 1C4V2 3TJOA 4DCDA 4LZ4B 1Z1IA 1GI7B 2F3CE 1SGCA 4Z6AH 3LC3A 2FI5E 3LDXH 3SU3A 1IHTH 3E0PB 4NSVA 5F8ZA 1F0TA 3S9CA 3KQCA 1D4PB 1AMHA 3RC6A 1AVXA 1ARBA 1Y3XA 3ZZAA 2BY7X 3KQEA 4D9QA 3IG6B 3E1XB 2I6QA 3VXFH 4INLA 2EI8A 1GL1A 2ZHDA 1EUFA 1J9CH 4JZIA 4ZMAH 1FY5A 1CHGA 2ZC9H 1GI3A 1T32A 3UFAA 1MTSA 1UJ1A 2TGAA 4RSPA 2CXVA 1HDTH 1C1MA 3UWJH 1GJAB 1MH0A 1ZJDA 1GBMA 5JBCS 1Z1JA 3BTGE 4CRBA 3PROA 1CA0C 1TNHA 2G5VA 2VVVA 2ASUB 3BIVH 1AFQB 4FVDA 1O3EA 1A46H 3TJVA 3A86A 5I25A 2ZDLA 1UK3A 4XBCA 1GBFA 1MZDA 4AGJA 1GL0E 1BIOA 2CGAA 2OLGA 1QY6A 3SOSA 3TK6A 3LGWA 2ZKSA 1QB6A 2PLXA 3KL6A 1YPEH 3RXHA 4D7FA 1CHOG 3BTKE 1JIRA 1WQSA 2QC2A 1QA0A 1TMBH 4X8VH 1S81A 1MD8A 1VCPA 3S0NA 4XOJA 2P16A 2O8UA 1DOJA 1GBLA 2ZFQH 1A0LA 2KAIB 5DP8A 3RXDA 5AF9H 3DFLA 2P93A 4NZQA 1O2YA 1PPBH 1Q2WA 3AVZA 1N6XA 3EQ0H 2VIOA 3KEEA 4OS6A 1YPJH 2BZ6H 5A0AE 1V2NT 1S0RA 1TNKA 1WUNH 1F5RA 1ZGVA 1NC6A 3URCA 4YESB 1SFIA 1ELFA 1XUHA 4JZEH 1ANDA 3A8AA 2EEKA 2XXLA 1W13U 2ZFTA 1QJ1B 3FP8E 1EOJA 1GJ9B 3EAJA 4Y76A 3ZVFA 2OQ5A 4B73A 2ZCLP 6ESTA 1W3CA 3BG4B 1KYNA 1DWCH
chains in the Genus database with same CATH superfamily
4GHTA 5C17A 4B2BA 3FFGA 1BUIA 1QTFA 1OYQA 1XUKA 1A3BH 2FZZA 2LPRA 3U8RH 1G32B 1G2LA 1QURH 1TGNA 3Q77A 2H5CA 2R2MB 1T4UH 1K1OA 4AB9A 2BD4A 3OY5U 1GI2A 4ABIA 1C4Y2 1HAVA 4I8GA 4CRCA 3URDA 4X8TH 1LPKB 2JKHA 1K21H 3SU6A 4ACAA 3HKIB 1V6DA 4X1NU 1WU1A 1UCYE 1GJCB 2FWWA 1C5XB 3SV6A 1XUJA 2P3UB 3TNSA 1AB9C 5FCRA 1UTNA 2Q1JA 1PQ8A 2Z9GA 1P2QA 4A1TA 5KECA 1UTOA 4MG3A 2KCOA 1SC8U 1MTNC 1YLCA 4AYVB 1UMAH 4YTAA 1SMFE 1JRTA 2J4IA 3VGCC 3SGBE 5DN6D 2VH0A 1S0QA 1O2NA 1GCTC 1V2UT 1G3CA 2A4OA 5HIYA 1CBWB 5KGOA 2Z3DA 1OWKA 3GYMA 2D1JA 7KMEH 2UUFB 1DE7H 2FOMB 2GGVB 2ZPSA 3DSGA 3DHKH 1GJ8B 2H9TH 3ATWA 1V3XA 3SV9A 1AI8H 1KTTB 1TABE 3W95A 5C20A 3RMNH 1C5UA 1O5EH 1ZRKA 1QQ4A 4HGCA 4B2AA 2ZG0H 2BOKA 3MNSA 3ODDA 1SGNE 4FUIA 4MNWA 3A8BA 5FCKA 4X2WA 2EI6A 3DD2H 2YMSB 2XWBI 1GDQA 3BTWE 3ATMA 3SZEA 4ISIH 3TGKE 3HGPA 4ZHMU 2BHGA 2THFB 1T8NA 2ZGXH 2QIQA 1TPPA 1SG8B 3SJIA 3HATH 4CRAA 2A4GA 2FOAA 3NCLA 2QF5A 2QCYA 4XD7D 4UEHH 5B6LA 1PPEE 2DE9A 1VCQA 3N7OA 3D65E 1UTMA 1COWD 2DUCA 1G3BA 2GCTB 4TPYA 3RDZA 2BD3A 2ZDVH 1ESTA 3MMGA 5EW2H 3PMBB 1XVOA 2LNCA 1DWDH 1IQHA 1CT2E 1G9IE 1HAXB 2FI4E 3NK8A 1Y3WA 3ZVGA 2A4QA 1BBRH 1PQ7A 3EA9A 3UIRA 3SNBA 2B7DH 3Q3XA 2AERH 3M36A 2FS9A 1AGJA 4UONA 2JH0D 1YF4A 1MZAA 2BY6X 2R2WU 3S7KB 1FPCH 3B8JA 3FN8A 2OQUA 5JYIA 4DG4A 1MQ5A 1OWHA 1HJAB 1HBTH 2H9HA 1BHXF 2IPHA 3SJ8A 2VIPA 4MPUA 1O30A 2KFWA 5DJ7A 1S82A 3GY7A 5I46H 2OCVB 3T28A 1FN6A 3ZVBA 1RFNA 4LZ1H 5C5NA 1TOCB 1LHEH 2SGPE 1PPFE 2GJGA 1LDTT 4PROA 4X6OA 4OS2A 3KHVA 3PV4A 1IQFA 2STBE 1MD7A 5A0BA 3P6ZB 2KCAA 4K60A 1IQJA 2VGCB 2Y5HA 3RXIA 1TPSA 3BTTE 1INCA 1LVBA 1RXPA 3SHCH 5TCCA 3T5FH 1YWUA 4YT6H 4BAKB 4ABGA 3RXVA 2BZAA 3OE7D 4RI0A 1W0JD 2J98A 1KLTA 5G4BA 4Y8ZA 5EOKA 4IC5A 3MFJA 2NU4E 4AFQA 1EFRD 2TBSA 2ZEBA 3DFJA 1EAUA 1SKYE 3LGUA 1C9TA 3OSYA 4ABEA 1LVOA 4XBBA 1XUGA 3BTFE 3P95A 4ISLA 1D6WA 5EPNA 2JDID 1ANCA 3F0PA 4GLYA 2PUQH 1V2LT 3MH6A 5HMAA 3RXPA 1ZR0A 1FY4A 2ZCHP 4NCYA 3F68H 4ACBA 3TU7H 5PTPA 1E36B 5F03A 5LPEA 3B23B 1AUTC 5FX5A 1J16A 4DGJA 2BQ6B 3CS0A 4KP0A 2YMSD 1QB1A 3D49H 1GJDB 4M7GA 1FQ3A 3HK3B 1KXCA 2BVXH 1GHBF 4DT7B 1TNGA 4DY7B 1CT4E 3M5NA 3E91A 2PR3A 1DFPA 2O9QA 3BTQE 3GCNA 1T8OA 3ZYDA 1MKXK 1LHFH 4F49A 4X1QU 1T31A 3L3TA 4BXWA 1O31A 4CREA 3SU1A 1ETTH 3QX5H 1HGTH 1K28D 2A2QH 1HJ9A 1YCPK 2ILNA 3S7HB 1DUAA 2SGDE 3A80A 2F9VA 4ZXYH 5E8EH 3F2HA 3ZZ6A 4GVUA 2PSYA 2BXUH 4Y11E 1ELGA 2XC5A 1NU7B 3SNDA 1G30B 4M9FA 4WXVA 3VFEA 4LOYH 5T3HA 1GPZA 4MVNA 5EQQA 3FZDA 1GGDB 5DP6A 4XBDA 4YOGA 1QBVH 1DDJA 5GIBA 1VITH 3E90B 3SV7A 1NO9H 2Y5GA 1NRNH 3W94A 2EA3A 1MABB 3GY6A 2AMQA 1E0FD 3OYPA 1L0ZA 1GVZA 1GI1A 1L1NA 2H2ZA 3S9BA 1EZQA 1CU1A 3AAUA 1O3OA 1XXDA 4IGDA 4CBOA 3A84A 1TPOA 3SJOA 3MU0A 2ANWA 2QGRA 3RMOH 1J15A 1TGTA 3ZZBA 4VGCC 3O8RA 3M5OA 2BOHB 1OKXA 4SGAE 3KYFA 3UOUA 1UCYH 1XUFA 5T1VA 1F0UA 1UTKA 3V7TA 7GCHF 1BTYA 1YLDA 2BLOA 1AO5A 4X6PA 3UNRA 1NN6A 2XWAA 1GBDA 3GY3A 3UY9A 3ZZCA 1WOFA 2F9OA 3P8GA 2Y7ZA 1ZTKA 3PLPA 1DVAH 5KEDA 1E37B 3FZZA 3LONA 2RG3A 2AMPA 1F2SE 1FXYA 2ZFFH 1GJ5H 2C90B 4FUCA 2IJOB 4X2XA 3M61U 1HAIH 2Y6TA 1CA0B 4U01A 2BY9X 3N7DA 4INKA 1A0HB 1O3NA 3UREA 3ZVCA 3M37A 2ODPA 1BTHH 3LC5A 3U69H 3ZZ4A 1BDAA 4ABFA 3FANA 1T8LA 1C1SA 3GDUA 3PLKA 3C1KA 1GBKA 4WY3A 2VIDA 4QT8C 3U9AH 1F92A 3MU5A 1L4ZA 3P8NA 5HM9A 3GYLB 3JZ1B 1GI8B 2XRCA 2ZGCA 3RU4D 2P59A 1PFXC 2QY0B 2PGBB 2VH6A 3RXRA 5A2MH 4JK6A 4Y8XA 1QBNA 1Z6EA 4AOQA 2Z3EA 1DY9A 1HAVB 3RP2A 3SUEA 1BMAA 4B76A 3GCTG 1GJBB 1WDIA 1QJ6B 3OTJE 4E05H 2VIQA 1MAXA 1GMDF 1O32A 1TX6A 1UK4A 3QGJA 3RXGA 2ZP0H 4K1TA 3L6PA 4IBLH 3ZVDA 4WMDA 1V2WT 1G3EA 3DUXH 3GCHB 1ANBA 4D7GA 4BTTB 3AK5A 4ZKOU 1WTGH 4FU8A 1O3BA 1AHTH 1ZPCA 1GVLA 3S69A 1BOQA 2G81E 2V3MA 1HAZB 1YP9A 1TBQH 3LJOA 9ESTA 1C2HA 1RIWB 2AHME 1EZXC 2CHAC 1O2KA 3ATIA 1C5WB 2P8OC 3SGQE 2GKVE 3F2FA 1A5HA 1RTFB 1ARCA 1QIXB 2Z3CA 3RLYH 5C2ZA 5HXFA 1IAUA 3TLOA 1AB9B 2BDGA 1WYKA 1BMFD 2C3SA 1CT0E 1O3PB 3ZVAA 1O2VA 1ZSKA 4F48B 1A2CH 1GI9B 1GHZA 3GY4A 3SNAA 1NFYA 1AVWA 1F0RA 1TRYA 1O2JA 4E7NA 2EI7A 5JPMH 2XCFA 1YLNA 1BRCE 1F7ZA 3AW1A 1OSSA 2FX6A 1NT1A 1OX1A 2FOBA 2R9PA 1C5NH 1GVKB 2FESH 3F9EA 1OWIA 2KM0A 4X8SH 1ORFA 3BIUH 4ZCNA 3VB3A 2JETC 4CH8B 2PKAA 4WMFA 1CO7E 2ZFSA 2ZWLH 1ZHMA 1PQ5A 2P95A 4ABDA 4BTIB 1A1RA 1KXBA 1HYLA 1ZLRA 1W0ZU 1Y5UT 1ZZZA 1SGQE 4Q2KA 4I7YH 1ESAA 1IOEA 1C2DA 1V2KT 4YZUA 1OWEA 2ZU1A 3LOXA 1GHAG 4CRDA 4JCNA 5C67A 2J2UA 5TJXA 3U98H 2F43B 5GJ4B 5GWZA 3RXKA 3ITIA 2FPZA 2SGFE 2F9BH 3KQBA 1P11E 1K1MA 4XFQA 1S85A 3H09A 4B74A 3LT3A 4FUBA 4P00A 3TK9A 1XKAC 3UQOA 2WPLS 2GCHF 3AAVA 3M5MA 2K1QA 2PKSB 1BMLA 3LKWA 2B5TB 2ZECA 1EXFA 5AFYH 4TWYA 3PTBA 8KME2 1Z6JH 4ABJA 1O33A 3G01A 4CHAC 2ZDNA 3MH7A 3BSQA 1C1UH 1SQOA 1X7AC 3ENSB 4IMQA 3TK5A 3OAAD 3T27A 1N8OC 5DPAA 4KTUA 5GXPA 2VVCA 1CA8B 1O35A 2O8TA 5AFZH 2BDCA 1A7SA 4ISOA 2TRMA 1O38A 1ZOMA 1VKYA 1SLVB 3CS7A 4K3JA 4MPVA 1TBZH 3GDVA 1ELEE 1PYTC 2OP9A 2ZI2H 1TFXA 1IQKA 3ELAH 2EY4C 2BD5A 1DY8A 1O3JA 1JWTA 3GCOA 3QN7A 2AGGX 1BTPA 1O3MA 3SO3A 1V2ST 3K2UA 2OTVA 3V3MA 1H8DH 1KXEA 1VGCC 1ZSLA 4JZ1A 4KGAA 9LPRA 1W8BH 3GY5A 1C1PA 3ATKA 4Y0YE 4ZROA 5C3NA 3CENA 1P3CA 4FUFA 1TMTH 6LPRA 3BV9B 3LGIA 1NPMA 1IQLA 2OD3B 4O3UA 1GHVH 3MNBA 2Z9JA 2B8OH 1FY1A 2OC7A 4JMYA 1GJ7B 1MKWK 2BDHA 2Z9IA 2V6NA 3GY8A 3SHAH 1EPTB 3T26A 1XX9A 1HUTH 1NM6A 2J5UA 1O2XA 2J92A 3GS9A 2BDIA 2GZ9A 1TE0A 1F0SA 2GMTC 1FI8A 5F8TA 4WJG2 1CVWH 4BNRA 2J95A 2VB0A 1DICA 1QR3E 1UTLM 5FBEA 3NZIA 1QB9A 1H4WA 1L1GA 1DLKB 2ZQ2A 5AHGH 1P01A 1QBOA 1MBQA 3GICB 1ID5H 3SI3H 1H1BA 2FIRH 2VNTA 3A7TA 3NRLA 1W7XH 4H6TA 1KDQA 1TNJA 3C27B 1UO6A 5LGOA 3HGNA 3KYGA 2W7SA 2R0LA 1L2EA 2ZQ1A 2BDAA 2GT8A 3PO1B 5L6NH 1OOKB 1HAYB 3I29A 2RCEA 5TCAA 3A83A 1OPHB 2H1UA 1QL7A 3FOAA 1F5LA 2O8MA 1C1VH 1PJPA 7LPRA 2ZZUH 1Y8TA 2HVXA 4GPGA 1UVPA 5F8XA 1NZQH 1W12U 1C1NA 1TA6A 5FHTA 2A45B 2RA3A 2BD8A 5A0CA 2FLRH 2G52A 1NY22 1S6LA 1HRTH 1QGFA 3PWBA 3UOPA 2ZDAH 3SGAE 4K1SA 2QN5T 1BTZA 4YLQH 1H9LB 5CHAC 3ZVEA 2VVUA 2VJ1A 3ESTA 1CGIE 4MQAA 1HFDA 2P3FH 1TNIA 2Y7XA 4A6LA 2ALPA 1KIGH 2V3HH 3F9FA 2ANMH 3GISB 2CJIA 1MBMA 1FJSA 5EODA 3MI4A 1EB1H 3TITA 1OHHD 5DSFA 3ZV8A 2NU0E 4FXGH 1ACBE 2FOGA 4Q7ZA 4AFUA 4DW2U 2G00A 2KR7A 5ETXA 1CSOE 1VZQH 2VU8E 1AUJA 4MNYA 1CE5A 4BTUB 1GHWH 1TB6H 4WWYA 2LP6A 1XXFA 1HV7A 4I8KA 1FN8A 1SBWA 1VJ9U 3MHWU 1V2JT 5GCHF 3DSOA 4NG9H 2ODQA 4Y10E 5EJZA 4ESTE 3ZZDA 4RKOB 2BLWA 1BA8B 3MU1A 1HAPH 1AKSA 1V2MT 4X1RU 3T25A 1OWJA 4X6MA 2FTLE 2B0FA 2SNWA 1V2TT 5A8ZA 2WPHS 2FDAA 3RXTA 4A5TS 4TY6A 4AX9H 1ZSJA 2IOTA 1YC0A 5FAHA 4YLUA 1GBIA 1YPKH 1BMNH 2OC0A 1NFXA 1RJXB 1SI5H 1TRMA 4OM9A 2F9PA 2TPIZ 5DP3A 5DG6A 1E35B 3RXJA 4RKJB 1O2RA 3OU0A 1AVGH 3MU4A 2ZFPH 4Y0ZE 3A7ZA 2FEQH 2HOBA 4GCHF 3ODFA 3ZZ5A 1BRUP 1RGQA 2WYJA 2JJ1D 1LQDB 4TSFD 4ZXXH 4CRGA 2H9EH 5ABWA 8GCHF 2RA0A 1H8ED 4NIXA 1EP5A 1DS2E 3EE0B 4NIVA 4OGXA 2BYAX 2ZHQH 3EA8A 1V2PT 4AGKA 3F6UH 3E3TA 4TPIZ 4A92A 1YYY1 3KQ5A 1FIWA 3RXSA 4AFZA 2GP9B 1YKTA 1AQ7A 1AWFH 1HLTH 2FOHA 2Y81A 2Q6GA 2HLCA 2HNTF 1Z8IB 3MTYA 3A87A 1OYTH 3F3BA 1KXDA 4A1XA 2STAE 3TH3H 3UB0A 2PV9B 4LXBH 4X8UH 2PUXB 1UTQA 1NROH 2FP7B 4I8HA 1DX5M 2R3YA 1MTUA 3LPRA 2UUYA 3ZIAD 2QA9E 3R0FA 4WVPE 2G5NA 4Y7AA 1YCPM 1S84A 2LELA 2XBWA 3L33A 3PLBA 5T6FA 4ZKRU 3OX7U 1ABIH 1C5RA 1FY3A 3TIUA 3OY6U 4FUGA 4A7IB 1EATA 2PKAB 2GV6A 4ABHA 1Y5AT 2XC0A 3JZ2B 3FVFB 1SGTA 1GI0A 1P2OA 1BJUA 1E79D 2P8OB 2QXGA 3TJUA 1AE5A 2XC4A 4O9VA 2A7JA 3VB4A 3ZZ7A 6GCHF 2UWOA 2FX4A 3TGJE 2Y5FA 2G8TA 2PTCE 1EAXA 2HRVA 4Y6DA 1JOUB 3U1JB 2K8IA 1SLWB 2XBYA 1PPZA 4TYDA 3ZZ9A 3RU4T 1DWBH 1SB1H 2C4FH 1SGRE 1UK2A 1P05A 1FONA 3BN9A 1DLEA 1KXAA 1TBRH 3SU4A 4XE4A 1AZ8A 1CBWC 3A7VA 1QA7A 5A09A 3TJNA 1SQAA 1C5MD 5LPRA 5EU8A 8GCHG 1BTWA 2W26A 2ZPRA 2A1DB 1TMUH 3U8OH 1OP8A 4A1VA 2AFQB 2GZ7A 4Z1MD 5CMXH 1NESE 8ESTE 5EXNA 2D8WA 3B9FH 1HB0B 2GDDA 5J4QA 4NZLA 2YNAA 3RXAA 2ESTE 1EOLA 3M3TA 1AZZA 1P03A 4DOQA 1KXFA 1GI5A 2YMSC 4RT1A 3M7UA 1O5GH 2FOCA 3WWFA 1AU8A 1N1LA 3RUOA 1O3FA 1MAYA 3F0OA 2B9LA 3RU4E 2J97A 5C0UA 5IK2D 1H9IE 1DXPA 3SV2H 4AG1A 1O39A 4I8LA 2BVRH 4NA7A 4GSOA 1ZTJA 1TGCA 1K1JA 1E34B 1O0DH 4D9RA 4NWKA 5JB8S 5DP4A 5FBIA 2A31A 4B6FA 4UFEH 1YM0A 4ZKNU 3R3GB 1EAIA 1DWEH 1LKAA 1K1LA 4F55A 2XOKD 2ZHEH 3EYDA 4GHQA 1GBHA 2WSSD 2HPPH 4X0WU 1Z8JB 3M35A 1GHBG 3N7EA 4IN1A 1G36A 2VBCA 2GCTC 2PFEA 2WPIS 3M3SA 4X1PU 3LGVA 4FUEA 1GBBA 2KCPA 4NWLA 3SU5A 2ZGBH 1O5FH 1Z8GA 4GUXA 1LHGH 4I8JA 1OP0A 1J14A 1DSTA 2ZIQH 6GCHG 1O3GA 1ETSH 2RDLA 3ATLA 2ZGHA 1BHXB 4HI3A 4K5ZA 4FETA 1H8IH 1MKXH 1YY3A 2ODYB 4BOHA 1T7CA 1IQMA 3IITA 1O3LA 1HJAC 1UTPA 1YCPH 1O3IA 3FP7E 1LVYA 3LGYA 1O5DH 1ELVA 1D3PB 2C8XB 1A5IA 3FP6E 1T8MA 1MCTA 2KX4A 4Q63A 2A0QB 5CHBA 1O2HA 2TIOA 1O2WA 3UNSA 1C2KA 1JIMA 4I31A 2Q6FA 2A5IA 2BVSH 2XW9A 4LK4A 3SI4H 2AYWA 1FLEE 1Y3UA 2BX4A 3ZZ3A 2BLVA 1C1QA 2F9NA 2FMJA 2VGCC 5C1YA 1VGCB 1G37A 1CGJE 1BQYA 1S83A 1QJ7B 1YPMH 3HK6B 1A0JA 1MTVA 4FVBA 1C1RA 3S9AA 1TWXB 2FOFA 2PTNA 1P2MA 3KNXA 6CHAC 2M5TA 1BITA 1SGEE 2ZDMA 2RFKC 1FIZA 1SFQB 3NUMA 4YOIA 2OC1A 1DUEA 1LQEA 1DANH 1A3EH 1LPGB 2CK3D 1P9SA 1BRBE 4NA9H 2ZU5A 1Q31A 2AS9A 2A5AA 2HWLB 1SOTA 7GCHG 4HZHA 4ZKSU 2BM2A 4O03A 4R8TB 2Z6BD 3RXMA 5C1UA 4OS4A 3H5CB 1O5AB 3KN2A 2J94A 2GZ8A 1XMNB 3U28C 1TQ7B 4IW4E 5CE1A 1EJNA 3PB1E 1IQGA 3PMAB 1SR5C 1VJAU 4FUJA 2ZHWH 1ANEA 1LHCH 1M9UA 1NRQH 4MPWA 2W7UA 3RC4A 2VIWA 4ZAEA 1H9HE 4MLFB 5JBTA 4KKDA 2V3OH 1FNIA 1C2IA 3RMMH 5ESTE 1WSSH 1ZRBA 2TGPZ 1HPGA 1EJAA 5DP5A 1MTNB 3V12A 3QUMP 1AD8H 1IQNA 1TOMH 3T62A 2HNTE 3P8FA 1IHSH 1C1WH 4I32A 2Y82A 1JXPA 3VGCB 5L30H 1D3DB 2J38A 3MO9A 1EASA 3IWMA 1DITH 1GCTB 1P8VC 3BTME 1K0HA 3QGNB 1AE8H 1TX8A 4IMZA 3TH4H 5IYTA 4Q7XA 3RXUA 3BTEE 2WPJS 1YPGH 3EA7A 4H6SB 3BG8A 1C2GA 5C1XA 5FPYA 4X2YA 1TPAE 4BAQB 1C5VA 3E6PH 1QRWA 5JDUB 1O2LA 3HKJB 3FAOA 2HLDD 3A7XA 2XYAA 2WINI 1GBTA 3SUFA 2XNDD 4INHA 4FU9A 4ZH8A 3UAIC 3M5LA 1W10U 4X6NA 1P06A 1AKSB 3DT0H 4B75A 2JIZD 3VEQB 1SVPA 3VXEH 4BANB 5DK1A 1WXRA 3VPKA 1K1PA 1P2IA 1GMDG 4ABBA 1K1IA 1C2JA 4BAOB 2IN2A 3A82A 2I6SA 3P92A 5HIZA 1BRAA 1LPZB 3RXLA 2QV1A 3WW7A 3RXOA 1PYTD 2FXRA 3HPTB 1A61H 1BCUH 1TGBA 1VR1H 3NKKA 3O8DA 1QNJA 1K22H 1GMCF 1XM1A 3MH4A 4WMEA 1QRZA 3KCGH 3V13A 3RXQA 1C5TA 4TT3D 1GMHF 3FO8D 1LKBA 1TRNA 2WPKS 5JB9S 1W11U 4B2CA 4THNH 1O3AA 4B6EA 3TNTA 1LO6A 1W2KH 3P70B 1EKBB 2J98B 2OXSA 4OS1A 1W0YH 4NFEA 2PP6A 1EQ9A 2ZTYA 1V2OT 1OXGA 1B7XB 3ZYEA 2HPQH 1C5ZB 1C2FA 2V0BA 3DCLA 1EAWA 1NU9A 2FYQA 2Y80A 4CBNA 3SJ9A 2GX4A 1V2RT 4OGYA 1SGYE 2C8WB 2F4LA 2GDEH 1O2TA 4K69A 5JBAS 2Q6DA 1C5OH 3M3VA 5HGGA 4HTCH 1GHXH 2CF9H 1Y3YA 1YPHE 1O34A 3H7OA 4H4FA 1PPGE 2W3IA 3K9XB 3WWBA 1QCPA 3RLWH 2AGIX 4B1TA 2BQ7B 1ZMJA 1KLJH 2G55A 4CR5A 1MU8B 3LU9B 2NWNA 3CP7A 2WPDD 2AEIH 4ISHH 3PYHA 1S6HA 3SQHE 4AG2A 2FM2A 4ZHLU 1P12E 2P3TB 2R3UA 1SHHB 2HNTC 4FUHA 4AZ2B 2GVFA 1O2QA 5C0TA 1NRSH 3MQKC 4I33A 4CH2B 4KTSA 1GBAA 1NRRH 2ZNKH 3UR9A 1A5GH 2UWPA 1C1TA 1UHBA 1RD3B 2CN0H 2A7HA 3Q3YA 5J4SA 1JMOH 3Q76A 3RXFA 2UWLA 3BEIB 3PWCA 5E2OA 3BEUA 2BMGB 4WXIA 4ISNA 2D2DA 3GCHC 1AIXH 1C5PA 3QK1A 1CQQA 1QQUA 1UW7A 1W14U 3U8TH 1NS3A 4YXWD 1GMCG 1FV9A 3SJKA 2O8LA 1GMHG 1HAGE 2AGEX 4BAHB 1BBRK 1Y3VA 2NU3E 3SU0A 1O3DA 1RIWC 4E06H 5BRRE 4YT7H 2GCHG 4ABAA 3MYWA 1EX3A 3RXCA 3QTVH 1SGFG 1GDNA 2BDBA 2Z9KA 3A7YA 3M7TA 2FS8A 3WY8A 1UVTH 4D8NA 2CMYA 1FZZA 4U2WA 3GOVB 4Q7YA 1BB0B 1E38B 3SYJA 1O2UA 2WPMS 4IN2A 4XSKU 3QDZB 2W3KA 5E0JA 3OEED 3MOCA 5DGJA 2BD9A 2Z9LA 4YM9A 3BTHE 2G4TA 1ZHPA 2R0KA 2C93B 1O2PA 2ZGJA 3VB6A 1GHYH 1P2NA 2OINA 5A8XA 3Q3KA 2GT7A 2H5DA 1DPOA 1FUJA 1GG6C 3AW0A 5ESBA 5C5OA 1ELTA 1VCWA 2VWMA 4XDEA 1GJ6A 3QZQA 4R0IA 2L6OA 5E2PA 2ZFRH 1H8HD 4ASHA 2VWNA 3LGTA 2OBQA 3E0NB 1JRSA 2BDYA 1TIOA 3MO6A 5B6OA 4OS7A 1TNLA 3O8CA 3K6ZA 1HIAA 5H4IB 1V2VT 1ZPZA 1E1RD 2EC9H 2XCNA 1Y5BT 1BJVA 2F83A 2JJ2D 3QZRA 4UDWH 2QXHA 1C2MA 3TVJB 2VINA 5L2YH 2KZ4A 2W6ID 5GNDA 4H42U 3RXEA 4AORA 5T6DA 4CRFA 1B0FA 2A7CA 1YPHC 2PHBA 1DM4B 4VGCB 5GDSH 2J9NA 2A4RA 2FLBH 2WV5A 1EB2A 1KLIH 1D3QB 1C1OA 1GCDA 3EDXB 1MMJN 1GI6A 3Q00A 4DVAU 3OTPA 1FDPA 2XNIA 1AY6H 4Q4LA 1TX7A 3UQVA 2FI3E 4JYUH 2PGQB 1ELAA 1MKWH 2QF4A 2XBXA 2A32A 3RC5A 1EZSC 1J17T 2VWOA 2D26C 5FX6A 1NFUA 2SGQE 1U6QA 3KIDU 4YOJA 1SLXB 4ZHAA 2BB4A 1LMWB 4JZDH 1P10A 1ELCA 3D62A 5LPFA 3EGKH 4NIWA 2WYGA 2L74A 3EE7A 4K1EA 1WQVH 2WUCA 2G51A 5SGAE 3P17H 1QFKH 3SNEA 3K65B 5FXLA 4KELA 1AFQC 3GDSA 2PKSC 2QAAA 1Y59T 1DSUA 1QL8A 3SZNA 3UR6A 2W5EA 4AFSA 1JBUH 1GJ4H 4Q80A 4Y71A 3QO6A 3E16B 1BTUA 2SGAA 4AB8A 1GI4A 3MH5A 3SUDA 1PPHE 1ZPBA 1FAKH 1PQAA 2XTTB 2ZU3A 3NWUA 3LIWA 4RN6A 5HM2A 4MPXA 1PPCE 2W6JD 1C2LA 5A8YA 1AWHB 1NBME 3N99A 2ZDKA 5E0GA 4X1SU 1OP2A 2BX3A 1P9UA 1D9IA 4WH6A 3KQDA 1HXEH 1TA2A 4FOUC 1E1QD 2BLQA 2WZQA 4DJZB 2FOEA 3ZZ8A 2ZTZA 3M7QA 4K8BA 1O2IA 4UE7H 1O2ZA 4FUDA 1UCYK 4WF8A 6CHAB 1IQIA 1MCVA 1P2KA 1C5YB 2ZCKP 3A88A 3VB7A 1AFEH 1TLDA 3LH1A 3MNXA 1HJ8A 4X2VA 2KCYA 2QXIA 4TWWA 1Z7KA 2OC8A 4UFFH 3BG4C 5GPIB 2Z7FE 1EPTC 3A8CA 1GWAA 2QYIA 1SHYA 1RS0A 2ZU4A 1K1NA 1C4U2 3A85A 1RRKA 3A7WA 1HCGA 2CHAB 2RDEA 3O8BA 4UD9H 1NBMD 2C8YB 2BTCE 2IPQX 2GD4B 5GCHG 3KF2A 4BAMB 2QXJA 1C5QA 2YNBA 1TAWA 5EIYA 2KAIA 1EZUC 3DA9B 3SU2A 3TGIE 2A5KA 3I77A 2BY5X 2PSXA 3MO3A 3QWCH 4SGBE 4NIYA 3RMLH 1GBJA 2VIVA 4O97A 3RM2H 4DT4A 2V7QD 4JYTA 1W0KD 4AYYB 4TY7A 2HALA 1LTOA 3GY2A 2OBOA 1QZ8A 1ELDE 3PO1C 4GCHG 2YOLA 4NSYA 1SL3A 1ESBA 1WAYB 1Q3XA 1ZJKA 1ZMLA 2ZA5A 4U30A 1EPTA 1KTSB 4ZUHA 1O3KA 5BPEA 2JETB 1N6YA 1FMGA 2NU2E 5DKMA 1ZHRA 4HFPB 3VG8A 1W7GH 2HGTH 1YPLH 2BQWB 1QRXA 1GDUA 1HAOH 4Y79A 1D6RA 1LVMA 1FAXA 3OEHD 5EQSA 2K0QA 5EGMA 5JBBS 4B71A 1SSXA 1HAHH 3GCTF 1EJMA 4J1YA 4K8YA 5DP9A 4CR9A 2WUBA 2OK5A 5AVDA 1QL9A 4ASUD 4JK5A 3E8LA 5EW1H 1WBGB 1P57B 3F1SB 3PMJA 3A81A 1ZGIA 4DIIH 1K9OE 2VWLA 5EG4A 1DT2A 3TH2H 2H6MA 1SQRA 2BY8X 4NFFA 3P8OA 3PM3A 1UVUH 1OWDA 2FO9A 1A4WH 2TGDA 2FYRA 3T2NA 3UUZA 4Y8YA 1TQ0B 4GAWA 1G2MA 1HXFH 2Z94A 3STIA 3MNCA 1THPB 3QLPH 1P09A 1QHRB 1O3CA 4MNVA 5EPYA 1KSNA 1XUIA 2J34A 2ZU2A 3UNQA 1O3HA 4RT0A 3SN8A 3STJA 1O5CB 2P94A 2PW8H 5FPSA 4XRNA 4DURA 1D3TB 1Z71A 4NA8A 1NFWA 1O2OA 2ZF0H 1C5LH 1C5SA 1UHBB 1L4DA 1SLUB 3A8DA 4CHAB 3AASA 4WH8A 3FKSD 7ESTE 3KGPA 1BTXA 1VITF 2PWXA 2ZO3H 2C8ZB 2GV7A 1ABJH 1N8OB 2GTBA 1BMMH 2BD7A 4IC6A 2ALVA 5DP7A 1WCZA 2TGTA 1RTLA 1O2SA 5LH8A 1IQEA 1O2MA 3LH3A 2JH5D 5HKKD 1OS8A 4YO9A 1TONA 3MWIU 2DE8A 1Z8RA 3SV8A 2AH4X 4Z0KA 4MDSA 1TGSZ 1O36A 2F9UA 4UFGH 4JYVH 2UUJB 1TALA 2AIPA 2CV3A 4FU7A 2SNVA 3SBKA 1P04A 1XKBC 3I78A 1LCYA 3A89A 1AN1E 1J8AA 4BXSA 3UPEA 4AN7A 3TPIZ 2AMDA 1YGCH 1SOZA 3RXBA 1ELBA 1SGFA 3K6YA 3T29A 2FODA 1CGHA 5K0HA 2AIQA 1EP6A 3QTOH 2WV4A 1K2I1 1KDQB 5CDFE 1MUEB 3NXPA 1MTWA 1C9PA 1ZMNA 4K2YA 5EJ1A 3F9GA 5EJLA 2ZTXA 8LPRA 2ANYA 2SGEE 3SNCA 2BXTH 5L2ZH 2ZHFH 1UVSH 2FTMA 1G3DA 3NPSA 1BZXE 3BEFB 1P3EA 5DO4H 2GMTB 3SORA 2XBVA 1O5BB 1FY8E 3SW2B 1UVOA 1GHAF 5EXLA 1ZYOA 2OUAA 3UTUH 3MU8A 5F6MA 1ZTLA 5FL7D 1GBCA 1P0SH 4UFDH 2ANKH 3PV2A 3H7TA 1TYNA 4D76A 1P2JA 1SPJA 1L1JA 2G4UA 1ETRH 3ZV9A 1P02A 2SFAA 4O3TA 4P02A 2A2XH 1HIAB 1NRPH 1B0EA 5F53A 3PRDA 3RM0H 3V0XA 5EQRA 1C2EA 3PMHB 1SQTA 4OS5A 5K7RA 1WTHD 1S6FA 4MNXA 5HYOA 3PRBA 4Y7BA 3PV5A 1F5KU 1DXWA 1KMHB 1SGDE 1THRH 2JH6D 1MQ6A 2F91A 2NU1E 3UWIA 2CF8H 4NGAH 4MTBA 1RTKA 3F2GA 1KY9A 1NTPA 2QE7D 1MU6B 1THSH 2HVYB 5FPTA 1LHDH 2QF0A 3D23A 1UTJA 3SUGA 3BF6H 4U32A 4F4OC 1O37A 1VITG 3U1IB 1S5SA 4IS5A 1CHOF 4JZFH 2UUKB 1T4VH 1V2QT 4DIHH 3SQEE 2ULLA 1SGIB 1YBWA 4J2YB 5IDKA 2V35A 2BD2A 4KTCA 1GG6B 2O8WA 3VB5A 1GGDC 1O2GH 2QF3A 1FPHH 1BBRE 1SGPE 1WV7H 1GBEA 3LJJA 1B5GH 5EXMA 1HNEE 1XVMA 3F9HA 5T6GA 3PTNA 3BTDE 2ZPQA 5CHAB 4E7RG 1BT7A 5E0HA 1C4V2 3TJOA 4DCDA 4LZ4B 1Z1IA 1GI7B 2F3CE 1SGCA 4Z6AH 3LC3A 1FX0B 2FI5E 3LDXH 3SU3A 1IHTH 3E0PB 4NSVA 5F8ZA 1F0TA 3S9CA 3KQCA 1D4PB 1AMHA 3RC6A 1AVXA 1ARBA 1Y3XA 5C94A 3ZZAA 2BY7X 3KQEA 4D9QA 3IG6B 3E1XB 2I6QA 3VXFH 4INLA 3DSPA 2EI8A 1GL1A 2ZHDA 1EUFA 1J9CH 4JZIA 4ZMAH 4AC9A 1FY5A 1CHGA 2ZC9H 4HG6A 1GI3A 1T32A 3UFAA 1MTSA 1UJ1A 2TGAA 4RSPA 2CXVA 1HDTH 1C1MA 3UWJH 1GJAB 1MH0A 1ZJDA 1GBMA 3W1EA 5JBCS 1Z1JA 3BTGE 4CRBA 3PROA 1CA0C 1TNHA 2G5VA 2VVVA 2ASUB 3BIVH 1AFQB 4FVDA 1O3EA 1A46H 3TJVA 3A86A 5I25A 2ZDLA 1UK3A 4XBCA 1GBFA 1MZDA 4AGJA 1GL0E 1BIOA 2CGAA 2OLGA 1QY6A 3SOSA 3TK6A 3LGWA 2ZKSA 1QB6A 4I86A 2PLXA 3KL6A 1YPEH 3RXHA 4D7FA 1CHOG 3BTKE 1JIRA 1WQSA 2QC2A 1QA0A 1TMBH 4X8VH 1S81A 2EQNA 1MD8A 1VCPA 3S0NA 4XOJA 2P16A 2O8UA 1DOJA 3CNRA 2IJD1 1GBLA 2ZFQH 1A0LA 2KAIB 5DP8A 3RXDA 5AF9H 3DFLA 2P93A 4NZQA 1O2YA 1PPBH 1Q2WA 3AVZA 1N6XA 3EQ0H 2VIOA 3KEEA 4OS6A 1YPJH 2BZ6H 5A0AE 1V2NT 1S0RA 1TNKA 1WUNH 1F5RA 2WV9A 1ZGVA 1NC6A 3URCA 4YESB 1SFIA 1ELFA 1XUHA 4JZEH 3OFND 1ANDA 3A8AA 2EEKA 2WHXA 2XXLA 1W13U 2ZFTA 1QJ1B 3FP8E 1EOJA 1GJ9B 3EAJA 4Y76A 3ZVFA 2OQ5A 4B73A 2ZCLP 6ESTA 1W3CA 3BG4B 1KYNA 2M2AA 1DWCH
chains in the Genus database with same CATH topology
4GHTA 4B2BA 3FFGA 1BUIA 1QTFA 1OYQA 1XUKA 1A3BH 2FZZA 2LPRA 3U8RH 1G32B 1G2LA 1QURH 1TGNA 3Q77A 2H5CA 2R2MB 1T4UH 1K1OA 4AB9A 2BD4A 3OY5U 1GI2A 4ABIA 1C4Y2 1HAVA 4I8GA 4CRCA 3URDA 4X8TH 1LPKB 2JKHA 1K21H 3SU6A 3HKIB 1V6DA 4X1NU 1WU1A 1UCYE 1GJCB 2FWWA 1C5XB 3SV6A 1XUJA 2P3UB 3TNSA 1AB9C 5FCRA 1UTNA 2Q1JA 1PQ8A 2Z9GA 1P2QA 4A1TA 1UTOA 4MG3A 1SC8U 1MTNC 1YLCA 4AYVB 1UMAH 4YTAA 1SMFE 1JRTA 2J4IA 3VGCC 3SGBE 2VH0A 1S0QA 1O2NA 1GCTC 1V2UT 1G3CA 2A4OA 1CBWB 2Z3DA 1OWKA 3GYMA 2D1JA 7KMEH 2UUFB 1DE7H 2FOMB 2GGVB 2ZPSA 3DHKH 1GJ8B 2H9TH 3ATWA 1V3XA 3SV9A 1AI8H 1KTTB 1TABE 3W95A 5C20A 3RMNH 1C5UA 1O5EH 1ZRKA 1QQ4A 4HGCA 4B2AA 2ZG0H 2BOKA 3MNSA 3ODDA 1SGNE 4FUIA 4MNWA 3A8BA 5FCKA 4X2WA 2EI6A 3DD2H 2XWBI 1GDQA 3BTWE 3ATMA 4ISIH 3TGKE 3HGPA 4ZHMU 2BHGA 2THFB 1T8NA 2ZGXH 2QIQA 1TPPA 1SG8B 3SJIA 3HATH 4CRAA 2A4GA 2FOAA 3NCLA 2QCYA 4UEHH 1PPEE 2DE9A 1VCQA 3N7OA 3D65E 1UTMA 2DUCA 1G3BA 2GCTB 4TPYA 3RDZA 2BD3A 2ZDVH 1ESTA 3MMGA 5EW2H 3PMBB 1XVOA 2LNCA 1DWDH 1IQHA 1CT2E 1G9IE 1HAXB 2FI4E 3NK8A 1Y3WA 3ZVGA 2A4QA 1BBRH 1PQ7A 3EA9A 3UIRA 3SNBA 2B7DH 3Q3XA 2AERH 3M36A 2FS9A 1AGJA 4UONA 2JH0D 1YF4A 1MZAA 2BY6X 2R2WU 3S7KB 1FPCH 3B8JA 2OQUA 5JYIA 4DG4A 1MQ5A 1OWHA 1HJAB 1HBTH 2H9HA 1BHXF 2IPHA 3SJ8A 2VIPA 4MPUA 1O30A 5DJ7A 1S82A 3GY7A 5I46H 2OCVB 3T28A 1FN6A 3ZVBA 1RFNA 4LZ1H 5C5NA 1TOCB 1LHEH 2SGPE 1PPFE 1LDTT 4PROA 4X6OA 4OS2A 3KHVA 3PV4A 1IQFA 2STBE 1MD7A 5A0BA 3P6ZB 4K60A 3RXIA 1IQJA 2VGCB 2Y5HA 1TPSA 3BTTE 1INCA 1LVBA 1RXPA 3SHCH 5TCCA 3T5FH 4YT6H 4BAKB 4ABGA 3RXVA 2BZAA 1KLTA 5G4BA 4Y8ZA 5EOKA 4IC5A 3MFJA 2NU4E 4AFQA 2TBSA 2ZEBA 3DFJA 1EAUA 3LGUA 1C9TA 3OSYA 4ABEA 1LVOA 4XBBA 1XUGA 3BTFE 3P95A 4ISLA 1D6WA 5EPNA 1ANCA 4GLYA 2PUQH 1V2LT 3MH6A 5HMAA 3RXPA 1ZR0A 1FY4A 2ZCHP 4NCYA 3F68H 3TU7H 5PTPA 1E36B 5F03A 5LPEA 3B23B 1AUTC 5FX5A 1J16A 4DGJA 2BQ6B 3CS0A 4KP0A 1QB1A 3D49H 1GJDB 4M7GA 1FQ3A 3HK3B 1KXCA 2BVXH 1GHBF 4DT7B 1TNGA 4DY7B 1CT4E 3M5NA 3E91A 2PR3A 1DFPA 2O9QA 3BTQE 3GCNA 1T8OA 3ZYDA 1MKXK 1LHFH 4F49A 4X1QU 1T31A 3L3TA 4BXWA 1O31A 4CREA 3SU1A 1ETTH 3QX5H 1HGTH 1K28D 2A2QH 1HJ9A 1YCPK 2ILNA 3S7HB 1DUAA 2SGDE 3A80A 2F9VA 4ZXYH 5E8EH 3ZZ6A 4GVUA 2PSYA 2BXUH 4Y11E 1ELGA 2XC5A 1NU7B 3SNDA 1G30B 4WXVA 3VFEA 4LOYH 5T3HA 1GPZA 4MVNA 5EQQA 3FZDA 1GGDB 5DP6A 4XBDA 4YOGA 1QBVH 1DDJA 5GIBA 1VITH 3E90B 3SV7A 1NO9H 2Y5GA 1NRNH 3W94A 2EA3A 3GY6A 2AMQA 1E0FD 3OYPA 1L0ZA 1GVZA 1GI1A 1L1NA 2H2ZA 3S9BA 1EZQA 1CU1A 3AAUA 1O3OA 1XXDA 4IGDA 4CBOA 3A84A 1TPOA 3SJOA 3MU0A 2ANWA 2QGRA 3RMOH 1J15A 1TGTA 3ZZBA 4VGCC 3O8RA 3M5OA 2BOHB 1OKXA 4SGAE 3UOUA 1UCYH 1XUFA 1F0UA 1UTKA 3V7TA 7GCHF 1BTYA 1YLDA 2BLOA 1AO5A 4X6PA 3UNRA 1NN6A 2XWAA 1GBDA 3GY3A 3UY9A 3ZZCA 1WOFA 2F9OA 3P8GA 2Y7ZA 1ZTKA 3PLPA 1DVAH 1E37B 3FZZA 3LONA 2RG3A 2AMPA 1F2SE 1FXYA 2ZFFH 1GJ5H 2C90B 4FUCA 2IJOB 4X2XA 3M61U 1HAIH 2Y6TA 1CA0B 4U01A 2BY9X 4INKA 1A0HB 1O3NA 3UREA 3ZVCA 3M37A 2ODPA 1BTHH 3LC5A 3U69H 3ZZ4A 1BDAA 4ABFA 3FANA 1T8LA 1C1SA 3GDUA 3PLKA 3C1KA 1GBKA 4WY3A 2VIDA 4QT8C 3U9AH 1F92A 3MU5A 1L4ZA 3P8NA 5HM9A 3GYLB 3JZ1B 1GI8B 2XRCA 2ZGCA 3RU4D 2P59A 1PFXC 2QY0B 2PGBB 2VH6A 3RXRA 5A2MH 4JK6A 4Y8XA 1QBNA 1Z6EA 4AOQA 2Z3EA 1DY9A 1HAVB 3RP2A 3SUEA 1BMAA 4B76A 3GCTG 1GJBB 1QJ6B 3OTJE 4E05H 2VIQA 1MAXA 1GMDF 1O32A 1TX6A 1UK4A 3QGJA 3RXGA 2ZP0H 4K1TA 3L6PA 4IBLH 3ZVDA 4WMDA 1V2WT 1G3EA 3DUXH 3GCHB 1ANBA 4D7GA 4BTTB 4ZKOU 1WTGH 4FU8A 1O3BA 1AHTH 1ZPCA 1GVLA 3S69A 1BOQA 2G81E 1HAZB 1YP9A 1TBQH 3LJOA 9ESTA 1C2HA 1RIWB 1EZXC 2CHAC 1O2KA 3ATIA 1C5WB 2P8OC 3SGQE 2GKVE 1A5HA 1RTFB 1ARCA 1QIXB 2Z3CA 3RLYH 5C2ZA 5HXFA 1IAUA 3TLOA 1AB9B 2BDGA 1WYKA 2C3SA 1CT0E 1O3PB 3ZVAA 1O2VA 1ZSKA 1A2CH 1GI9B 1GHZA 3GY4A 3SNAA 1NFYA 1AVWA 1F0RA 1TRYA 1O2JA 4E7NA 2EI7A 5JPMH 2XCFA 1BRCE 1F7ZA 3AW1A 1OSSA 2FX6A 1NT1A 1OX1A 2FOBA 2R9PA 1C5NH 1GVKB 2FESH 3F9EA 1OWIA 4X8SH 1ORFA 3BIUH 3VB3A 2JETC 4CH8B 2PKAA 4WMFA 1CO7E 2ZFSA 2ZWLH 1ZHMA 1PQ5A 2P95A 4ABDA 4BTIB 1A1RA 1KXBA 1HYLA 1ZLRA 1W0ZU 1Y5UT 1ZZZA 1SGQE 4Q2KA 4I7YH 1ESAA 1IOEA 1C2DA 1V2KT 4YZUA 1OWEA 2ZU1A 3LOXA 1GHAG 4CRDA 4JCNA 5C67A 2J2UA 5TJXA 3U98H 5GJ4B 5GWZA 3RXKA 3ITIA 2FPZA 2SGFE 2F9BH 3KQBA 1P11E 1K1MA 4XFQA 1S85A 4B74A 3LT3A 4FUBA 3TK9A 1XKAC 3UQOA 2WPLS 2GCHF 3AAVA 3M5MA 2K1QA 2PKSB 1BMLA 3LKWA 2B5TB 2ZECA 1EXFA 5AFYH 4TWYA 3PTBA 8KME2 1Z6JH 4ABJA 1O33A 3G01A 4CHAC 2ZDNA 3MH7A 3BSQA 1C1UH 1SQOA 1X7AC 3ENSB 4IMQA 3TK5A 3T27A 1N8OC 5DPAA 4KTUA 5GXPA 2VVCA 1CA8B 1O35A 2O8TA 5AFZH 2BDCA 1A7SA 4ISOA 2TRMA 1O38A 1ZOMA 1SLVB 3CS7A 4K3JA 4MPVA 1TBZH 3GDVA 1ELEE 1PYTC 2OP9A 2ZI2H 1TFXA 1IQKA 3ELAH 2BD5A 1DY8A 1O3JA 1JWTA 3GCOA 3QN7A 2AGGX 1BTPA 1O3MA 3SO3A 1V2ST 3K2UA 2OTVA 3V3MA 1H8DH 1KXEA 1VGCC 1ZSLA 4JZ1A 4KGAA 9LPRA 1W8BH 3GY5A 1C1PA 3ATKA 4Y0YE 4ZROA 5C3NA 3CENA 1P3CA 4FUFA 1TMTH 6LPRA 3BV9B 3LGIA 1NPMA 1IQLA 2OD3B 4O3UA 1GHVH 3MNBA 2Z9JA 2B8OH 1FY1A 2OC7A 4JMYA 1GJ7B 1MKWK 2BDHA 2Z9IA 2V6NA 3GY8A 3SHAH 1EPTB 3T26A 1XX9A 1HUTH 1NM6A 1O2XA 2J92A 2BDIA 2GZ9A 1TE0A 1F0SA 2GMTC 1FI8A 5F8TA 4WJG2 1CVWH 4BNRA 2J95A 2VB0A 1DICA 1QR3E 1UTLM 5FBEA 3NZIA 1QB9A 1H4WA 1L1GA 1DLKB 2ZQ2A 5AHGH 1P01A 1QBOA 1MBQA 3GICB 1ID5H 3SI3H 1H1BA 2FIRH 2VNTA 3A7TA 1W7XH 4H6TA 1KDQA 1TNJA 3C27B 1UO6A 5LGOA 3HGNA 2W7SA 2R0LA 1L2EA 2ZQ1A 2BDAA 2GT8A 3PO1B 5L6NH 1OOKB 1HAYB 3I29A 2RCEA 5TCAA 3A83A 1OPHB 2H1UA 1QL7A 1F5LA 2O8MA 1C1VH 1PJPA 7LPRA 2ZZUH 1Y8TA 2HVXA 4GPGA 1UVPA 5F8XA 1NZQH 1W12U 1C1NA 1TA6A 5FHTA 2A45B 2RA3A 2BD8A 5A0CA 2FLRH 2G52A 1NY22 1HRTH 1QGFA 3PWBA 3UOPA 2ZDAH 3SGAE 4K1SA 2QN5T 1BTZA 4YLQH 1H9LB 5CHAC 3ZVEA 2VVUA 2VJ1A 3ESTA 1CGIE 4MQAA 1HFDA 2P3FH 1TNIA 2Y7XA 4A6LA 2ALPA 1KIGH 2V3HH 3F9FA 2ANMH 3GISB 2CJIA 1MBMA 1FJSA 5EODA 3MI4A 1EB1H 3TITA 3ZV8A 2NU0E 4FXGH 1ACBE 2FOGA 4Q7ZA 4AFUA 4DW2U 2G00A 5ETXA 1CSOE 1VZQH 2VU8E 1AUJA 4MNYA 1CE5A 4BTUB 1GHWH 1TB6H 4WWYA 1XXFA 1HV7A 4I8KA 1FN8A 1SBWA 1VJ9U 3MHWU 1V2JT 5GCHF 4NG9H 4Y10E 2ODQA 4ESTE 3ZZDA 4RKOB 2BLWA 1BA8B 3MU1A 1HAPH 1AKSA 1V2MT 4X1RU 3T25A 1OWJA 4X6MA 2FTLE 2B0FA 2SNWA 1V2TT 5A8ZA 2WPHS 2FDAA 3RXTA 4A5TS 4TY6A 4AX9H 1ZSJA 2IOTA 1YC0A 5FAHA 4YLUA 1GBIA 1YPKH 1BMNH 2OC0A 1NFXA 1RJXB 1SI5H 1TRMA 2F9PA 2TPIZ 5DP3A 5DG6A 1E35B 3RXJA 4RKJB 1O2RA 3OU0A 1AVGH 3MU4A 2ZFPH 4Y0ZE 3A7ZA 2FEQH 2HOBA 4GCHF 3ODFA 3ZZ5A 1BRUP 1RGQA 2WYJA 1LQDB 4ZXXH 4CRGA 2H9EH 5ABWA 8GCHF 2RA0A 4NIXA 1EP5A 1DS2E 3EE0B 4NIVA 4OGXA 2BYAX 2ZHQH 3EA8A 1V2PT 4AGKA 3F6UH 3E3TA 4TPIZ 4A92A 1YYY1 1FIWA 3RXSA 4AFZA 2GP9B 1YKTA 1AQ7A 1AWFH 1HLTH 2FOHA 2Y81A 2Q6GA 2HLCA 2HNTF 1Z8IB 3MTYA 3A87A 1OYTH 4A1XA 1KXDA 2STAE 3TH3H 2PV9B 4LXBH 4X8UH 2PUXB 1UTQA 1NROH 2FP7B 4I8HA 1DX5M 2R3YA 1MTUA 3LPRA 2UUYA 2QA9E 3R0FA 4WVPE 2G5NA 4Y7AA 1YCPM 1S84A 3L33A 2XBWA 3PLBA 5T6FA 4ZKRU 3OX7U 1ABIH 1C5RA 1FY3A 3TIUA 3OY6U 4FUGA 4A7IB 1EATA 2PKAB 2GV6A 4ABHA 1Y5AT 2XC0A 3JZ2B 3FVFB 1SGTA 1GI0A 1P2OA 1BJUA 2P8OB 2QXGA 3TJUA 1AE5A 2XC4A 4O9VA 2A7JA 3VB4A 3ZZ7A 6GCHF 2UWOA 2FX4A 3TGJE 2Y5FA 2G8TA 2PTCE 1EAXA 2HRVA 4Y6DA 1JOUB 3U1JB 1SLWB 2XBYA 1PPZA 4TYDA 3ZZ9A 3RU4T 1DWBH 1SB1H 2C4FH 1SGRE 1UK2A 1P05A 1FONA 3BN9A 1DLEA 1KXAA 1TBRH 3SU4A 4XE4A 1AZ8A 1CBWC 3A7VA 1QA7A 5A09A 3TJNA 1SQAA 1C5MD 5LPRA 5EU8A 8GCHG 1BTWA 2W26A 2ZPRA 2A1DB 1TMUH 3U8OH 1OP8A 4A1VA 2AFQB 2GZ7A 5CMXH 1NESE 8ESTE 5EXNA 2D8WA 3B9FH 1HB0B 2GDDA 5J4QA 4NZLA 2YNAA 3RXAA 2ESTE 1EOLA 3M3TA 1AZZA 1P03A 4DOQA 1KXFA 1GI5A 3M7UA 1O5GH 2FOCA 1AU8A 1N1LA 3RUOA 1O3FA 1MAYA 2B9LA 3RU4E 1H9IE 1DXPA 3SV2H 4AG1A 1O39A 4I8LA 2BVRH 4NA7A 4GSOA 1ZTJA 1TGCA 1K1JA 1E34B 1O0DH 4D9RA 4NWKA 5JB8S 5DP4A 5FBIA 2A31A 4UFEH 1YM0A 4ZKNU 3R3GB 1EAIA 1DWEH 1LKAA 1K1LA 3EYDA 2ZHEH 4GHQA 1GBHA 2HPPH 4X0WU 1Z8JB 3M35A 1GHBG 4IN1A 1G36A 2GCTC 2PFEA 2WPIS 3M3SA 4X1PU 3LGVA 4FUEA 1GBBA 4NWLA 3SU5A 2ZGBH 1O5FH 1Z8GA 4GUXA 1LHGH 4I8JA 1OP0A 1J14A 1DSTA 2ZIQH 6GCHG 1O3GA 1ETSH 2RDLA 3ATLA 2ZGHA 1BHXB 4HI3A 4K5ZA 1H8IH 1MKXH 2ODYB 4BOHA 1T7CA 1IQMA 3IITA 1O3LA 1HJAC 1UTPA