4FUBA

Crystal structure of the urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fubA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fubA01
2VWNA 4HTCH 2ULLA 1HNEE 4OS5A 3RXQA 3SU4A 1FLEE 1O3JA 1UVUH 1ELFA 1UVTH 3BTFE 1JRTA 1O33A 1UVOA 2A7CA 3OU0A 6LPRA 1GHAG 1DOJA 4LZ1H 1TNGA 1KLTA 1MAYA 1AVGH 1EJAA 3RMMH 1Z6EA 3HKJB 3QO6A 2NU4E 2OBQA 4ABFA 2CXVA 4TY6A 2PGBB 2ZHEH 3Q3YA 1ZSJA 4X2WA 3EE0B 2VVCA 1F2SE 2J34A 2ODPA 4I8GA 3TLOA 5A0CA 1XVMA 1BBRK 2WPMS 4X6MA 1GI8B 1EJNA 1GCTC 5AFYH 1P3CA 1OWIA 2FLBH 1ZTLA 4BAOB 1LTOA 1W14U 2GZ8A 3PMAB 5EU8A 1DUAA 3LJJA 4AOQA 3KHVA 3P8GA 1RTFB 3A84A 4NG9H 1KY9A 1YPHE 2VNTA 4TWYA 1KXEA 1LDTT 3TITA 4QT8C 4D9RA 1C2GA 3A83A 5C5OA 1THPB 1BIOA 1Q2WA 1KIGH 2Z9LA 3KQEA 2WPKS 1GJAB 1BITA 1W11U 1SVPA 3KQDA 3U1JB 3AAUA 3NKKA 1RGQA 1P2KA 2RA3A 3MFJA 1C5RA 2GVFA 3DHKH 5C1YA 3SZNA 1ELDE 3SNEA 4FVDA 4NGAH 4ZXXH 3H7OA 2ALPA 4JCNA 2C93B 4DY7B 4OGXA 1ELVA 5H4IB 4Y7AA 1PYTC 2SGPE 3QZRA 4ABIA 3T25A 5FHTA 4YLQH 3VB5A 2J92A 2BXTH 5L30H 5JB9S 5A0BA 3RXJA 2XWAA 2QGRA 2B0FA 1C2HA 1HRTH 1UTOA 4BTTB 1AKSA 1MCTA 4GVUA 1IOEA 1FY1A 2H2ZA 3KN2A 1JIRA 1MZAA 1N1LA 1GGDB 2ILNA 1OWKA 4ZHMU 4DW2U 1ZLRA 1C4U2 3GY8A 5EPYA 4JZ1A 1TABE 2XCNA 1TNIA 4LOYH 2A32A 5J4SA 3NPSA 4DT7B 1VITF 1EOLA 1GBAA 1GMHG 1C5QA 2GDDA 2A31A 1HAOH 1QURH 3SJKA 2Y82A 1RS0A 1DE7H 2VH0A 4YT7H 3OYPA 4DIHH 3KL6A 1CT2E 2A1DB 1DXWA 1F0UA 1NO9H 1C9TA 3M5OA 2Z94A 1NRQH 1DPOA 3D65E 3BEFB 3PO1B 3GY7A 3MH6A 4BNRA 3ATKA 1WYKA 2WUCA 2D26C 4DIIH 2FP7B 1E34B 1TMUH 3MYWA 1JBUH 2H9EH 4THNH 4CRCA 1PPBH 1L1GA 4BTUB 2UUJB 3BF6H 4BAQB 2A7HA 5I46H 4Q80A 4OS6A 2BQ7B 2BHGA 2OBOA 3GY3A 1J17T 4KTCA 5EPNA 1Z1IA 1ZGIA 2AEIH 2Z7FE 3EGKH 5TCCA 2BLVA 1TRYA 3A8BA 5T6FA 2PTNA 3M61U 1E37B 4ABJA 1YCPH 1P01A 1NU7B 2CMYA 1OP2A 1A0JA 2FX6A 2OC7A 1GHWH 3BG4C 1BRCE 2ZHDA 3SJIA 1TRNA 2F9VA 2QY0B 2ZGHA 4TWWA 1OWHA 1V2LT 2HNTE 2VINA 3BN9A 2EI6A 1FDPA 2O9QA 2BDBA 1J8AA 2OQUA 5LPRA 2OUAA 2HNTF 1GBIA 3ZZ9A 3A8DA 2ZTXA 1TGNA 4LXBH 1TGCA 1SC8U 2G81E 3UR6A 4B2BA 1Y5UT 3ZYDA 4YOJA 1GHVH 1CBWC 2M5TA 1AKSB 2W26A 2CV3A 4KELA 1KTSB 1XUKA 1L0ZA 1P09A 1XXFA 2SNVA 3D49H 3M35A 4A1XA 4I33A 4O3TA 1TPAE 4KP0A 4MQAA 4PROA 1XUFA 2BD8A 4Q7XA 2F9PA 4B75A 3ZZAA 4YO9A 1SQTA 3MNBA 3MU8A 4AB8A 1AO5A 1FJSA 1O2WA 3M7UA 1DWEH 1O2UA 1Z6JH 1QTFA 2ZPQA 3S0NA 3EA9A 4UFGH 3SV7A 1HXEH 1BTPA 1O39A 2AMDA 1ESTA 4JYTA 4Z0KA 3SQEE 1N6YA 2GZ7A 3SJ8A 1RIWB 3V12A 4WY3A 3F6UH 4ZHAA 5GPIB 1CT0E 2ZWLH 2G8TA 1HAGE 5GIBA 4I32A 1C1VH 3A82A 4DJZB 3D62A 2ZP0H 1VJ9U 3O8CA 3MHWU 5LGOA 3LC3A 1X7AC 4H6TA 4CREA 3BTQE 5C5NA 1ELCA 1TMBH 1GVLA 3S69A 3ZVFA 1KYNA 2HRVA 3OY5U 5JBCS 1SGNE 4YT6H 4X8VH 1XMNB 5DP5A 1FMGA 1ZMNA 1SGRE 2WYGA 1AWFH 5FCKA 4H42U 5EXNA 2BY5X 2TGPZ 1PPHE 5A2MH 1HAXB 2R0KA 4MPXA 2A5AA 4I8JA 1PQ7A 1G36A 3SV8A 2G4TA 2G5NA 3SV6A 1ABJH 1EPTA 2FOAA 2KAIA 2BY7X 4F4OC 1XUHA 1W3CA 3BIUH 5JBBS 5EW2H 1ZHRA 4MG3A 1CA0B 3GY2A 4NZQA 4TPYA 1GJCB 4K5ZA 2NU1E 2C90B 1DLEA 1P05A 2GX4A 1GI3A 3A89A 4RSPA 3IWMA 1O2MA 2TGTA 1RIWC 1T4VH 3NCLA 4AX9H 2ZIQH 3GY5A 1A46H 4HFPB 1YC0A 4KTSA 2PV9B 1EAIA 2SGQE 1TWXB 2P8OC 4XDEA 2G4UA 3UREA 2GCTB 3RXMA 2ZTZA 3UWJH 1DANH 1GJ6A 2WPLS 2OCVB 4BAKB 1KXAA 1O2TA 1ZPBA 1O5AB 1G30B 1PPFE 5JPMH 1GI5A 2WPJS 3ZVGA 4GUXA 1ETSH 1BDAA 1S6FA 5ESBA 1VCPA 1FQ3A 1P0SH 3LH1A 2VGCB 4K1EA 3TNTA 2BD9A 4LK4A 4X2VA 1CQQA 1O32A 1SB1H 1EASA 1GJ5H 2ZHWH 4CH8B 5K7RA 1YLCA 3A7TA 3EYDA 2PKAA 3BEIB 3ATLA 1C1SA 1AU8A 4IGDA 4LZ4B 2J94A 1UMAH 1RRKA 1ZTKA 1ZMJA 3LC5A 1PPGE 3ZZ6A 1TX8A 2SGAA 3TIUA 2B7DH 1O5CB 2NU3E 1SFIA 1OX1A 1GVZA 2BQ6B 2R9PA 4FVBA 1FUJA 1TGBA 3EQ0H 1OPHB 2FOCA 1ANEA 2BMGB 2A4GA 3K6YA 2ZCLP 3KNXA 3RXLA 3P6ZB 1ZPCA 2FXRA 1MMJN 1TOCB 1GBKA 3SU3A 3VB4A 1A2CH 5DO4H 2ZQ2A 7GCHF 2XBWA 1C2EA 1BTWA 4CR9A 2WUBA 3NXPA 3PLPA 4HZHA 5FXLA 1TBQH 1EPTB 1Z8RA 3TK5A 2KAIB 1MQ5A 1P2NA 1O3DA 2VIVA 1DFPA 3RXDA 2HWLB 2TGDA 1P03A 1TNKA 2C8XB 1O31A 1ANDA 3SORA 1EZSC 4Y76A 1LVYA 2HPPH 2VIOA 4X8SH 3SUEA 1LPGB 2YOLA 3TJOA 1SPJA 2ANKH 1SSXA 1WOFA 2C8WB 1ZGVA 3RM2H 3RXOA 3UFAA 3ITIA 1XUIA 1B5GH 1W0YH 2ZFQH 1ACBE 5JBTA 2VIPA 4VGCC 1P9SA 1UO6A 5DP4A 3OSYA 2VJ1A 4Y8ZA 3N7OA 3GCTG 5GXPA 2FYQA 4ISNA 2ZHQH 1S84A 1EAUA 3RDZA 2Y7XA 1A61H 1WCZA 1QRWA 1T31A 2BY9X 1EB2A 2VVVA 3ATWA 1OP0A 1GJ8B 4B71A 1C2FA 4AZ2B 3O8DA 4JZIA 1HFDA 2V6NA 3HATH 5K0HA 3P92A 2BB4A 3SJ9A 2ANMH 1TPSA 4MNYA 5J4QA 3QLPH 2AGIX 2Z3EA 2Y5GA 9LPRA 2ZNKH 1ORFA 3QTVH 1K9OE 1YBWA 2IPHA 2VU8E 4ASHA 1SHHB 1YCPK 4CHAC 2PKAB 4Y8YA 4ZKNU 1K1OA 1XKBC 1EPTC 3EAJA 1QY6A 3RXFA 1O2HA 1ZSKA 2FEQH 1HLTH 5F8TA 1TPOA 1TYNA 4FUBA 2ZU2A 5E0GA 1SL3A 1Z8GA 5FX6A 3P95A 1G32B 1SGEE 3VGCC 3SN8A 1BMMH 3Q00A 1MKWH 2HALA 2F91A 1O2RA 3A7VA 2YNAA 3GYMA 5BPEA 1VCQA 3MU5A 4A7IB 1ZSLA 5TCAA 4OS7A 2TGAA 3TH3H 1A0LA 4UFEH 1AB9B 2BVSH 4FUDA 3SNDA 1HAZB 1FXYA 3EDXB 1PJPA 4WMFA 2QAAA 2JKHA 1AFQB 1NTPA 1GVKB 1LO6A 5FBEA 4NFEA 2WYJA 3UUZA 3F9EA 3UNSA 3BTDE 1WBGB 2K1QA 1UK2A 4ZMAH 1AZZA 1ZMLA 1LQDB 1NRSH 1C5ZB 4ZUHA 3FAOA 1H9IE 1BZXE 3DFLA 1C5WB 3RM0H 3SJOA 1FZZA 3L6PA 4MPWA 2QF3A 2OD3B 3SGBE 1JWTA 1T7CA 4Z6AH 2FO9A 1EZUC 1V3XA 1EX3A 1OXGA 4NSYA 1T8LA 2EI8A 3T26A 5BRRE 1GBDA 4JK5A 2CHAC 2J2UA 3QN7A 2D2DA 1PFXC 4F49A 3A88A 1YGCH 1O2YA 2R2MB 3E8LA 2OC8A 1CGJE 3RXEA 1W12U 1S5SA 2C3SA 3MWIU 5GCHG 4AB9A 4X1QU 4B1TA 2GGVB 1EXFA 1FY8E 3E1XB 5EXMA 1BCUH 2UWLA 5AHGH 1AB9C 1DUEA 3RXKA 3UOUA 2AIQA 3VB6A 1AFQC 2B9LA 2BX4A 2DUCA 3RC4A 4I31A 1BHXB 3F9HA 5E8EH 2W3IA 2FS9A 2JETB 4DG4A 1NFXA 4DGJA 3S9BA 1FN8A 2ZFTA 2O8UA 3T5FH 4CBOA 2GKVE 1O3CA 3LGWA 3G01A 4ABDA 5C2ZA 3M5LA 1GMCF 4J1YA 1S6HA 1F92A 2J38A 1NRPH 1Z71A 1S81A 4UEHH 4OS4A 3VXFH 1DSUA 4AYYB 1TQ0B 2QV1A 4B76A 1OS8A 1T8OA 4I8KA 1LHDH 1KSNA 4CRDA 1C1OA 4XFQA 1V2WT 1BMNH 2NU0E 1WAYB 2VH6A 1BTZA 2A4QA 2BDAA 2VIQA 2HVXA 1W8BH 2A4RA 2V35A 1EAXA 1AFEH 5E2OA 3P8FA 2XW9A 2ZGCA 2PFEA 1TONA 4GLYA 1GG6B 1O2VA 2AMQA 5AVDA 1F5KU 1GI1A 3T29A 2FOFA 1S85A 3K9XB 1GHBF 5DGJA 1O2KA 3JZ2B 4RKJB 1QJ6B 2J95A 1GPZA 3A86A 1DWDH 3PMHB 6ESTA 1T8NA 3M7QA 1CSOE 4Y6DA 2SGFE 4D7FA 1C5VA 2BVRH 3BTHE 1AIXH 2ZU5A 4CRGA 1GBBA 4Y7BA 2BZAA 4NIXA 1GBJA 3RXAA 1O3EA 1O2JA 1O2NA 1GMDF 5HM2A 4NA9H 2FOHA 2QXHA 3O8BA 2VWLA 1GCDA 4X1PU 3A7YA 1CVWH 2BDIA 3IG6B 3ZV8A 1HV7A 1JIMA 1WU1A 2BVXH 2BX3A 2ZO3H 1L2EA 1B0FA 4X2YA 1SLWB 1EOJA 1HIAA 3E0PB 4CH2B 1HAPH 1GG6C 1V2VT 2GCHG 4OGYA 3V7TA 3BTWE 1L1NA 2FOBA 3E90B 4ABAA 2FX4A 2OC0A 1O3GA 8LPRA 2PW8H 4GCHF 1P2JA 2ZC9H 5FPTA 3SO3A 2P16A 1THSH 2F9UA 4I7YH 4KGAA 2Q6DA 1EATA 5IYTA 1TE0A 4OS1A 1GI4A 1SI5H 3U8RH 2I6QA 1YM0A 5L6NH 3RUOA 1O5BB 2FZZA 1P02A 5DP3A 1ABIH 2OC1A 4ABGA 1C5OH 1EJMA 1TAWA 3CS0A 4NWKA 4YLUA 3PWBA 1BTUA 5G4BA 3A8CA 1SG8B 3E0NB 3BTTE 1BBRE 4GHTA 2AMPA 1GHAF 1E38B 1BA8B 4A92A 1SLXB 2XRCA 5DKMA 5EQRA 3P8NA 4ABEA 5EGMA 4NA8A 4X6NA 4XBCA 2GP9B 2Q6FA 4UDWH 3ESTA 1C1WH 4WWYA 1MKWK 1EZQA 1IQMA 4KTUA 1GI6A 1RTLA 3FP6E 1GGDC 3E3TA 3SOSA 1GL0E 3C27B 4AG1A 3ZVBA 1WTGH 6GCHG 3MU1A 1P2OA 1Z8JB 3GCHB 2R0LA 1D3DB 1UCYH 1AMHA 5AF9H 2G52A 5IDKA 2FI5E 1BMAA 3FFGA 1SFQB 1N8OB 1RD3B 1BJVA 1TALA 1MTSA 1V2PT 3F9FA 1A5IA 1QB6A 4WH6A 4WVPE 3LPRA 3UWIA 4X8TH 5F8ZA 4XBBA 3KIDU 1OWEA 3PO1C 1LCYA 2FDAA 2CN0H 1BOQA 1QL9A 1HIAB 1AQ7A 1UJ1A 3S9AA 2WV4A 3RXUA 7KMEH 1IHSH 4UFDH 2BOKA 5DP8A 4J2YB 3GDUA 1O3PB 3SGAE 1TPPA 4DCDA 5DJ7A 3SU1A 2BTCE 2FWWA 3CP7A 1NROH 4ISLA 4FU8A 3RC5A 2XBXA 2Z9GA 3RXGA 1F7ZA 3LONA 4HGCA 3MH4A 1O3BA 2YNBA 5HXFA 3MNCA 4JYVH 8GCHG 7LPRA 1UTQA 1SOTA 2Y6TA 4Q7YA 1ETTH 5EQSA 3RU4T 1W7GH 1LMWB 1O3KA 1SMFE 1UHBA 3TK9A 3TGIE 4A6LA 2XNIA 1C1UH 2ZFFH 5EOKA 1O34A 4BAHB 4U01A 1O2ZA 1P2IA 1YPKH 1OOKB 3DT0H 4AFUA 2R3YA 1VZQH 4Y0ZE 1GMHF 4RKOB 3KQBA 3GCHC 2TRMA 4AG2A 4D76A 1D6RA 1QIXB 3LT3A 1N8OC 1K1IA 5T6GA 4GPGA 4K1TA 3ZZ8A 1AE5A 3H5CB 1C2DA 2XCFA 3TU7H 4GSOA 3VB3A 1Y59T 7GCHG 3SHCH 3HPTB 4K8BA 3ELAH 3SU2A 1OWDA 1VR1H 2TIOA 1UVPA 1V2OT 1V2JT 1V2QT 2V0BA 1F0SA 1TNHA 1C1NA 1C5LH 1L1JA 1UTMA 4ZH8A 4E05H 1FV9A 4GAWA 1SGFA 5F03A 1TBZH 1O3OA 2H5CA 2A2QH 2BD3A 3A85A 5A09A 3BIVH 2ZDLA 1IQKA 3QZQA 4TYDA 1P3EA 5A0AE 2ZDNA 3P17H 1D3QB 1JXPA 3UTUH 1C2KA 3M36A 3I29A 2AFQB 3NUMA 1YLDA 4BAMB 1QJ1B 2P3FH 3RP2A 2BDCA 3OTJE 1AZ8A 1TB6H 2UUFB 2PGQB 9ESTA 2EEKA 2W3KA 4IBLH 2FMJA 4Q2KA 1XUGA 4K8YA 1ETRH 2I6SA 1VITH 1TGTA 3MU0A 1A1RA 2NU2E 3U98H 5JB8S 4WXIA 2VIWA 1WQVH 1O5FH 4WF8A 1UHBB 1J15A 3TJUA 1YKTA 1AUTC 3U8TH 1ID5H 1ZZZA 4JK6A 1AVXA 1QCPA 2ZU4A 3GICB 3BTGE 1ARCA 3PV4A 1O36A 2O8MA 3SV2H 4U30A 2DE9A 1SQAA 1GBMA 3TH4H 2ZA5A 1MZDA 1OP8A 2IJOB 2W7UA 3E6PH 1ZJKA 2A4OA 1QHRB 4X1SU 2GDEH 3QX5H 2FYRA 5ABWA 1CA0C 1E36B 1O2PA 4IN1A 1MD7A 2A5KA 3MNXA 3RU4E 8KME2 4AFQA 1XUJA 1O5DH 2LNCA 2QN5T 1Y3XA 4HI3A 1SBWA 2PSXA 4JZDH 1Y8TA 3GYLB 1P8VC 1MKXH 3CENA 2H6MA 1CT4E 2GCTC 4Y79A 3DD2H 3B23B 4XOJA 2FODA 3RXHA 4E06H 2FTMA 5DP6A 1A5GH 1NFYA 1SGYE 5C1XA 3KQCA 1HCGA 2ZFPH 3DFJA 4NIWA 1C1PA 3PLKA 3Q76A 1VGCB 1CHOG 2VGCC 3SGQE 2OLGA 2ZDVH 4BXWA 2ZF0H 2VIDA 5T6DA 3GCNA 3T28A 3F1SB 2JH0D 3ZZ7A 1C5PA 1LQEA 3LGIA 4AGKA 3ODDA 1MTWA 5SGAE 1A7SA 2B8OH 1W0ZU 4WH8A 4MTBA 1YPHC 1ELGA 2A7JA 4ZXYH 2RCEA 1O5GH 1TA6A 2GZ9A 1QRZA 2FOEA 3URDA 3IITA 2HOBA 3ZZ5A 2IOTA 1O37A 1IHTH 2AGGX 1HAVA 4OS2A 1ELTA 1QGFA 3ZVAA 1O2SA 2SFAA 2AGEX 1G2MA 2SNWA 1EKBB 1O38A 1DT2A 4NFFA 5DK1A 1C1MA 1C5MD 2P94A 2Z3CA 3SW2B 1KLIH 1QJ7B 3PROA 1OWJA 1MU8B 4O97A 2AERH 3SUFA 2OP9A 1J9CH 2P3UB 3U9AH 1M9UA 1TX7A 3FP7E 1SGIB 1YPMH 4NIVA 4MNVA 1Z8IB 3URCA 3UQVA 4MNWA 1O5EH 1UCYK 3GY6A 3K6ZA 1GBCA 3LOXA 1LVBA 2BDHA 2BY6X 5HYOA 1TIOA 1VGCC 3A87A 4CRAA 3HK6B 1MCVA 5DG6A 1YPGH 1DX5M 2ZTYA 1PPEE 1NN6A 1GI7B 1RTKA 2F9BH 3DUXH 1QNJA 3RXRA 1QBOA 3RMLH 4GHQA 1O2OA 1TQ7B 2VVUA 4ZKSU 2BYAX 5PTPA 3UNQA 3FANA 1B7XB 4MLFB 4IW4E 1K1JA 2FI4E 3RXBA 2C4FH 2PKSB 3RLWH 2ZDMA 1C5XB 3SNCA 1W10U 1BUIA 3SNBA 3SUDA 1GBTA 1FPCH 2OINA 3S7KB 5HM9A 1A0HB 3MTYA 1F0RA 3V0XA 2V3OH 1YYY1 2ALVA 1NS3A 1HDTH 2F83A 3KEEA 3LIWA 1K28D 1MQ6A 5EXLA 3W94A 1ZTJA 2ZPSA 3NWUA 2BD5A 2AIPA 1TOMH 4NWLA 3SU6A 1TBRH 2BLQA 3LKWA 4UD9H 1NRRH 2G55A 5L2ZH 1GBHA 4JZEH 1HAVB 3ZVCA 4ISIH 5LPEA 1SGDE 3CS7A 3FZZA 1SGQE 4E7NA 5CE1A 3F68H 4TPIZ 3ZYEA 4BANB 2Z3DA 3UY9A 2HNTC 4FUFA 1K1LA 4CRFA 1IQGA 1V2ST 3PMBB 3GCTF 3P8OA 3P70B 4SGAE 1S0QA 4IMQA 1H8IH 3STIA 1MAXA 5F6MA 1XKAC 4AFZA 5AFZH 1MUEB 2PKSC 1O3LA 3UIRA 4ABHA 1C5SA 3Q3XA 2ZU3A 1GI0A 3ZZDA 3KGPA 1D6WA 5B6OA 3B9FH 1S82A 1ZRKA 3AW1A 2GV7A 2ZZUH 1SGFG 1QL7A 1G37A 2XTTB 5F8XA 2R2WU 4DOQA 1KTTB 2F3CE 3I78A 1PQ8A 5FCRA 3M37A 1DWBH 2R3UA 5CHAB 1VITG 3MNSA 4K3JA 1J16A 1TRMA 1LHEH 4RN6A 2BXUH 1IQEA 1O3FA 1CHGA 3NZIA 1UK3A 2RA0A 1CA8B 1C1QA 1ZR0A 3LGYA 4IC5A 2Z9IA 1AUJA 2BLWA 2TBSA 3MO9A 1FY5A 4FUIA 3WY8A 3MO3A 2BDYA 4INHA 4AFSA 1LKAA 1MBQA 3QK1A 3QGJA 1GBLA 3SUGA 3BSQA 1TMTH 3BTKE 1F5RA 2GT8A 1C2JA 1NU9A 4IS5A 2Y5HA 4YESB 5L2YH 1PPCE 5FPSA 2PTCE 4K69A 1QRXA 4UFFH 7ESTE 1WUNH 3PWCA 1ZRBA 4X1RU 1HBTH 1H9HE 1QA7A 1H8DH 3QTOH 2ZDAH 2H9TH 2P95A 1DY8A 1FNIA 1SQOA 2JETC 4FUJA 1GDQA 1TGSZ 1QBVH 1GDNA 4WMEA 5LPFA 1CE5A 5CHAC 1TX6A 4O9VA 2OQ5A 1P12E 2WV5A 1Q3XA 2QCYA 1ARBA 1HB0B 1H4WA 1MKXK 1QL8A 1YPEH 5T3HA 2FI3E 1DSTA 1NFWA 4CRBA 1HJAB 3LH3A 1H9LB 2UUYA 2G51A 4YOGA 1HPGA 1AVWA 1E35B 1YCPM 2ANYA 1V2RT 2AYWA 1EP5A 1L4ZA 1GDUA 1MU6B 5GCHF 3HKIB 1PYTD 1O3MA 2ZHFH 3M5NA 1DVAH 3U8OH 4H4FA 1C9PA 3ZZBA 2VWMA 1XVOA 3O8RA 3M3SA 2WPHS 1Y3VA 2A0QB 2ASUB 4DURA 2BOHB 5EG4A 3RLYH 2HLCA 2F9OA 4Y10E 1FAXA 1O3NA 2ZPRA 1IQJA 2FM2A 2JH6D 1Y5AT 3BG4B 5C3NA 1QQ4A 3F9GA 3UQOA 4YOIA 1Y3UA 1GBEA 3ZVEA 5JDUB 2QXIA 2Z9JA 1O3AA 5E0HA 5GWZA 1SLUB 1UTLM 4D9QA 2AH4X 5A8ZA 3L3TA 1W7XH 4B2CA 1UTNA 3VFEA 1G3DA 1D3PB 3GY4A 3TVJB 1P2MA 1ZJDA 3B8JA 1CBWB 3Q3KA 1P06A 3RU4D 3TGJE 1MTUA 1DDJA 1NM6A 1QBNA 1NFUA 1G9IE 1YP9A 1GJ4H 3C1KA 3ZZCA 1THRH 3RXCA 1HJAC 1C5UA 1HAIH 1KLJH 1KXCA 3GDSA 3UPEA 5EW1H 3AVZA 3SU0A 1V6DA 1O35A 2A5IA 1AE8H 1BB0B 1BRUP 1DWCH 2QF0A 2Q6GA 4I8LA 2BY8X 1G3CA 1O2IA 4YZUA 2ZKSA 1EP6A 1DM4B 1ESAA 1LVOA 2PR3A 2FESH 3MOCA 2QA9E 1D4PB 4K60A 2ZU1A 1Z7KA 4FU9A 1AHTH 1DS2E 3PM3A 1FAKH 5ETXA 2C8YB 1QA0A 1ZYOA 1LVMA 4I8HA 1A5HA 1W2KH 3R3GB 2H9HA 2ZFRH 3A7WA 1CO7E 4X0WU 2PSYA 1UVSH 1TNJA 2QC2A 2ODYB 1IQFA 1GBFA 1SGCA 4JMYA 2ZGBH 2ZCHP 1BTXA 1JRSA 1WSSH 2LPRA 3HGPA 4E7RG 1B0EA 3R0FA 2XC0A 3TK6A 4NCYA 1TLDA 3V13A 1VJAU 3ATIA 1BT7A 1UTJA 1BRAA 3OX7U 4X1NU 4BTIB 1C1RA 1SOZA 1QR3E 2HPQH 4FXGH 2OXSA 1C4V2 3TJVA 2XWBI 1FONA 5C20A 3W95A 4JZFH 3LU9B 1LHGH 4IN2A 4Y11E 1AI8H 1G3EA 1KXFA 1LHCH 1C2LA 1A3BH 2FOMB 2FOGA 2BZ6H 2GCHF 4ZKRU 1QQUA 2ESTE 4BXSA 1P11E 2F9NA 2XXLA 2P93A 2ZI2H 2IN2A 2FS8A 3PMJA 3PLBA 1OYTH 3RXVA 1AGJA 1V2KT 4AN7A 1HJ9A 3M5MA 2ZGXH 1YF4A 5A8YA 1IAUA 3AAVA 3AW0A 1DXPA 4X2XA 5FPYA 3LGTA 2J4IA 2XBVA 4MDSA 1A4WH 3ZVDA 1LHFH 5HGGA 1TFXA 2O8LA 1O2QA 2WPIS 3A80A 3MO6A 3T62A 4UONA 2P8OB 5EQQA 4A5TS 3MH7A 3TNSA 1KDQA 2UWPA 2GD4B 1MBMA 2BD2A 1V2UT 2SGEE 1GJ9B 2EA3A 2Z9KA 3BTEE 5GJ4B 5FAHA 3BEUA 4K2YA 1RFNA 5I25A 2Y80A 1OSSA 3D23A 4MNXA 1VCWA 3MI4A 1ELBA 1TNLA 3HK3B 5E2PA 1EQ9A 2VB0A 1CU1A 1C4Y2 2TPIZ 1K1MA 2QYIA 3RXSA 1EUFA 4AYVB 3FP8E 1XXDA 2RDLA 1P10A 1V2TT 1P2QA 1Y3YA 4MPUA 5JBAS 3U69H 4O3UA 1BMLA 1O2XA 1BHXF 3VPKA 2HGTH 3RMOH 3ZV9A 1G2LA 2DE8A 2AS9A 3SU5A 4FUEA 1NZQH 6GCHF 2J9NA 1PPZA 3PYHA 3QWCH 4A1VA 1P04A 3VB7A 1ANBA 2BLOA 2BDGA 4FU7A 1AWHB 1HYLA 2PHBA 2ANWA 1HAHH 2PUXB 5DP9A 1WTHD 2STAE 2A45B 3DA9B 1OKXA 1Y5BT 4H6SB 1O2LA 3MMGA 3SI4H 1AD8H 3QUMP 5TJXA 1QFKH 4B2AA 1ZHPA 2CF9H 4WXVA 1O0DH 4XE4A 1UTKA 3SNAA 5CMXH 3K2UA 2SGDE 1MTVA 2WINI 1SLVB 1F5LA 4YTAA 2A2XH 1CGIE 1MTNB 5FX5A 1DICA 5ESTE 1HAYB 4AORA 8GCHF 2GTBA 1D3TB 1TA2A 4FUHA 1EB1H 3GCOA 1SR5C 2CJIA 1BBRH 3S9CA 1YPJH 1JOUB 2H5DA 1Q31A 2FPZA 2OTVA 3BTME 4VGCB 6CHAB 1HXFH 2ZQ1A 4A1TA 4D7GA 2PWXA 1IQHA 5HMAA 3FVFB 4O03A 4ISOA 5GDSH 1ZOMA 2QXJA 1KDQB 4U2WA 3LDXH 1FIZA 3A81A 4INLA 3RMNH 1GWAA 4WJG2 4SGBE 3LGVA 2B5TB 3ZZ4A 4Y0YE 1S0RA 2UUKB 3SI3H 1BQYA 3EA7A 3JZ1B 4R0IA 1IQLA 3I77A 4ABBA 1C5NH 3K65B 1V2MT 1IQIA 1FY4A 2BD7A 2ODQA 2XBYA 3VXEH 4Q7ZA 2QIQA 5FBIA 2FIRH 4X6OA 3KCGH 4NZLA 2QXGA 3T27A 3TGKE 3RXPA 3L33A 1QB1A 1JMOH 4CHAB 2D8WA 1SHYA 3VEQB 1P57B 1GI2A 3KF2A 4X8UH 5EODA 1XX9A 1BJUA 4MVNA 1K2I1 3LGUA 3H7TA 3AASA 3VGCB 1PQ5A 3SHAH 1O3HA 3RC6A 5E0JA 1ZPZA 4Y8XA 1GJDB 2Z6BD 1MTNC 2D1JA 3GISB 1HUTH 1WV7H 2ZECA 2GT7A 3ENSB 1E0FD 1Z1JA 1K21H 1PQAA 4BOHA 1SGPE 1G3BA 4X6PA 1EAWA 6CHAC 2PLXA 1SGTA 3MU4A 2C8ZB 2ZEBA 1QB9A 1LPKB 3QGNB 2V3HH 4DVAU 2BM2A 1C5YB 3OY6U 1N6XA 1NC6A 4FUGA 3SQHE 4CBNA 1RXPA 1NY22 4WMDA 2Y81A 2ZG0H 4MPVA 2EI7A 1FY3A 2ZDKA 1W13U 3FZDA 3TJNA 3NK8A 3LJOA 1GMCG 1J14A 1FIWA 1FI8A 1F0TA 5C67A 1MH0A 2Y5FA 3HGNA 2FLRH 3T2NA 1U6QA 4ZKOU 3STJA 1K1PA 2CHAB 1AY6H 1NPMA 4JYUH 3TH2H 3UNRA 4TY7A 3QDZB 4XSKU 2Y7ZA 1K1NA 2P59A 3EA8A 4AGJA 1P9UA 4ESTE 1ELEE 4IMZA 1NT1A 1K22H 1WQSA 2Q1JA 4NA7A 3PTBA 4Y71A 2GV6A 3TPIZ 4NSVA 2THFB 1GJ7B 1IQNA 1V2NT 3E16B 2PUQH 3V3MA 2XC4A 1L4DA 1O30A 2EC9H 1S83A 3PB1E 4YM9A 1AN1E 3SV9A 2RG3A 1GHBG 5A8XA 1LKBA 1XM1A 3A8AA 3E91A 3M3TA 3M7TA 4IC6A 2CGAA 3SBKA 2JH5D 8ESTE 3A7XA 2ZFSA 5DPAA 5LH8A 1T4UH 2O8TA 1ESBA 3Q77A 1BTHH 1DY9A 2W5EA 4U32A 2GMTB 2VWOA 1KXBA 1ELAA 4CR5A 1RJXB 1CHOF 2CF8H 4NIYA 5DP7A 1BTYA 1LPZB 4R8TB 2ZCKP 1GHZA 2FTLE 3A7ZA 1GMDG 3ATMA 1A3EH 2G00A 1O2GH 4KKDA 4ZHLU 3RXIA 1O3IA 1HGTH 4UE7H 1DLKB 3UOPA 3M3VA 2H1UA 3BV9B 4B74A 1CGHA 3S7HB 1GHYH 3MH5A 1FN6A 1T32A 1NRNH 1BRBE 2STBE 4INKA 1FPHH 1UCYE 1UTPA 1GHXH 3BG8A 3U1IB 3GDVA 1EZXC 1UK4A 2W7SA 3RXTA 5JYIA 1GCTB 1D9IA 1HJ8A 2XC5A 1YPLH 2UWOA 2G5VA 4GCHG 4XBDA 1GI9B 1INCA 2BD4A 1H1BA 4D8NA 1GJBB 2P3TB 1KXDA 4ZAEA 3PTNA 1C2MA 1C2IA 1ANCA 3ZZ3A 1T8MA 4M7GA 1NESE 1Y3WA 1MD8A 1C5TA 2BQWB 3ODFA 4B73A 2ZGJA 1GL1A 1DITH 4K1SA 4ISHH 2O8WA 1ZHMA 2NWNA 3GOVB 1C1TA 1OYQA 2GMTC 4FUCA 5C1UA 4ZROA 2XYAA 3UR9A
chains in the Genus database with same CATH superfamily
2VWNA 3U28C 4HTCH 2ULLA 1HNEE 4OS5A 3RXQA 3OEHD 3SU4A 1FLEE 1O3JA 1UVUH 1ELFA 1UVTH 3BTFE 1JRTA 1O33A 1UVOA 2A7CA 3OU0A 6LPRA 1W0JD 1GHAG 1DOJA 4LZ1H 1TNGA 1KLTA 1MAYA 1AVGH 1EJAA 3RMMH 1Z6EA 3HKJB 3QO6A 2NU4E 2OBQA 4ABFA 2CXVA 4TY6A 2PGBB 2ZHEH 3Q3YA 1ZSJA 4X2WA 3EE0B 2VVCA 1F2SE 2J34A 2ODPA 4I8GA 3TLOA 5A0CA 1XVMA 1BBRK 2WPMS 4X6MA 1GI8B 1EJNA 1GCTC 5AFYH 1P3CA 1OWIA 2FLBH 1ZTLA 4BAOB 1LTOA 1W14U 2GZ8A 3PMAB 5EU8A 1DUAA 3LJJA 4AOQA 3KHVA 3P8GA 1RTFB 3A84A 4NG9H 1KY9A 1YPHE 2VNTA 4TWYA 1KXEA 1LDTT 3TITA 4QT8C 4D9RA 1C2GA 3A83A 5C5OA 1THPB 1BIOA 1Q2WA 1KIGH 2Z9LA 3KQEA 2WPKS 1GJAB 1BITA 1W11U 1SVPA 3KQDA 3U1JB 3AAUA 3NKKA 1RGQA 1P2KA 2RA3A 3MFJA 1C5RA 2GVFA 3DHKH 5C1YA 3SZNA 1ELDE 2GJGA 4FVDA 4NGAH 4ZXXH 3SNEA 3H7OA 2ALPA 4JCNA 2C93B 4DY7B 2KX4A 4OGXA 1ELVA 5H4IB 4Y7AA 1PYTC 2SGPE 3QZRA 4ABIA 3T25A 5FHTA 4YLQH 3VB5A 2J92A 2BXTH 5L30H 5JB9S 5A0BA 3RXJA 2XWAA 2QGRA 2B0FA 1C2HA 1HRTH 1UTOA 4BTTB 1AKSA 1MCTA 4GVUA 1IOEA 1FY1A 2H2ZA 3KN2A 1JIRA 1MZAA 1N1LA 1GGDB 2ILNA 1OWKA 4ZHMU 4DW2U 1ZLRA 1C4U2 3GY8A 5EPYA 4JZ1A 1TABE 2KR7A 2XCNA 1TNIA 4LOYH 2A32A 5J4SA 3NPSA 4DT7B 1VITF 1EOLA 1GBAA 1GMHG 1C5QA 2GDDA 2A31A 3F3BA 1QURH 1HAOH 3SJKA 2Y82A 1RS0A 1DE7H 2VH0A 3SYJA 4YT7H 3OYPA 5C17A 3KL6A 4DIHH 1CT2E 2A1DB 1DXWA 1F0UA 1NO9H 1H8ED 1C9TA 3M5OA 2Z94A 1NRQH 1DPOA 3D65E 3BEFB 3PO1B 3GY7A 3MH6A 4BNRA 3ATKA 1WYKA 2WUCA 2D26C 4DIIH 2FP7B 1E34B 2RFKC 1TMUH 3MYWA 1JBUH 2H9EH 4THNH 4CRCA 1PPBH 1L1GA 4BTUB 2WSSD 2UUJB 3BF6H 4BAQB 2A7HA 5I46H 4Q80A 4OS6A 2BQ7B 2BHGA 2OBOA 3GY3A 1J17T 4KTCA 5EPNA 1UW7A 1Z1IA 1ZGIA 2AEIH 2Z7FE 3EGKH 5TCCA 2BLVA 1TRYA 3A8BA 5T6FA 2PTNA 4F55A 3M61U 1E37B 4ABJA 1YCPH 1P01A 1NU7B 2CMYA 1OP2A 1A0JA 2FX6A 2OC7A 1GHWH 2V3MA 1BRCE 2ZHDA 3BG4C 1TRNA 2F9VA 3SJIA 2QY0B 2ZGHA 4TWWA 1OWHA 1V2LT 2HNTE 2VINA 3BN9A 2EI6A 1FDPA 2O9QA 2BDBA 1J8AA 2OQUA 4ACBA 5LPRA 2OUAA 2HNTF 1GBIA 3ZZ9A 3A8DA 2ZTXA 1TGNA 4LXBH 1TGCA 1SC8U 2G81E 3UR6A 4B2BA 1Y5UT 3ZYDA 4YOJA 1GHVH 1CBWC 2M5TA 1AKSB 2W26A 2CV3A 4KELA 1KTSB 1XUKA 1L0ZA 1P09A 1XXFA 2SNVA 3D49H 3M35A 4A1XA 4I33A 4O3TA 1TPAE 4KP0A 4MQAA 4PROA 2KCPA 1XUFA 2BD8A 4Q7XA 2F9PA 4B75A 3ZZAA 4YO9A 1SQTA 3MNBA 3MU8A 4AB8A 1AO5A 1FJSA 1O2WA 3M7UA 1DWEH 1O2UA 1Z6JH 1QTFA 2ZPQA 3S0NA 3EA9A 4UFGH 3SV7A 1HXEH 4TT3D 1BTPA 1O39A 2AMDA 1ESTA 4JYTA 4Z0KA 3SQEE 1N6YA 2GZ7A 3SJ8A 1RIWB 3V12A 4WY3A 3F6UH 4ZHAA 2OK5A 5GPIB 1CT0E 2ZWLH 2G8TA 1HAGE 5GIBA 4I32A 1C1VH 3A82A 4DJZB 3D62A 2ZP0H 1VJ9U 3O8CA 3MHWU 5LGOA 3LC3A 1X7AC 4H6TA 4CREA 3BTQE 5C5NA 1ELCA 1TMBH 1GVLA 3S69A 3ZVFA 1KYNA 2HRVA 3OY5U 5JBCS 1SGNE 4YT6H 4X8VH 5T1VA 1XMNB 5DP5A 1FMGA 1ZMNA 1SGRE 2WYGA 1AWFH 5FCKA 4H42U 5EXNA 2BY5X 2TGPZ 1PPHE 5A2MH 1HAXB 2R0KA 4MPXA 2A5AA 4I8JA 1PQ7A 1G36A 3SV8A 2G4TA 2G5NA 3SV6A 1ABJH 1EPTA 2FOAA 2KAIA 2BY7X 4F4OC 1XUHA 1W3CA 3BIUH 5JBBS 5EW2H 1ZHRA 4MG3A 1CA0B 3GY2A 4NZQA 4TPYA 1GJCB 4K5ZA 2NU1E 2C90B 1DLEA 1P05A 3PRBA 2GX4A 1GI3A 3A89A 4RSPA 3IWMA 1O2MA 2TGTA 1RIWC 1T4VH 3NCLA 4AX9H 2ZIQH 3GY5A 1A46H 4HFPB 1YC0A 4KTSA 2PV9B 1EAIA 2SGQE 1TWXB 3EE7A 2P8OC 4XDEA 2G4UA 3UREA 2GCTB 3RXMA 2ZTZA 3UWJH 1DANH 1GJ6A 2WPLS 2OCVB 4BAKB 1KXAA 2XOKD 1O2TA 1ZPBA 1O5AB 1G30B 5EJZA 1PPFE 5JPMH 1GI5A 2WPJS 3ZVGA 4GUXA 1ETSH 1BDAA 1S6FA 5ESBA 1VCPA 1FQ3A 1P0SH 3SZEA 3LH1A 2VGCB 4K1EA 3TNTA 2BD9A 4LK4A 4X2VA 1CQQA 2LP6A 1O32A 1SB1H 1EASA 5FL7D 5HIZA 1GJ5H 3ZIAD 2ZHWH 4CH8B 3FOAA 5K7RA 1YLCA 3A7TA 4ACAA 3EYDA 2PKAA 3BEIB 3ATLA 1C1SA 1AU8A 4IGDA 4LZ4B 2J94A 1UMAH 1RRKA 1ZTKA 1ZMJA 3LC5A 1PPGE 3ZZ6A 1TX8A 2SGAA 3TIUA 2B7DH 1O5CB 2NU3E 1SFIA 1OX1A 1GVZA 2BQ6B 2R9PA 4FVBA 1FUJA 1TGBA 3EQ0H 1OPHB 2FOCA 1ANEA 2BMGB 2A4GA 3K6YA 2ZCLP 3KNXA 2AHME 3P6ZB 1ZPCA 2FXRA 3RXLA 1MMJN 1TOCB 1GBKA 3SU3A 3VB4A 1A2CH 5DO4H 2ZQ2A 7GCHF 1VKYA 2XBWA 1C2EA 1BTWA 4CR9A 2WUBA 3NXPA 3PLPA 4HZHA 5FXLA 2RDEA 1TBQH 1EPTB 1Z8RA 3TK5A 2KAIB 4RT1A 1MQ5A 4FOUC 1P2NA 1O3DA 2VIVA 1DFPA 3RXDA 2HWLB 2TGDA 1P03A 1TNKA 2C8XB 1O31A 1ANDA 3SORA 1EZSC 4Y76A 1LVYA 2HPPH 2VIOA 4X8SH 3SUEA 1LPGB 2YOLA 3TJOA 1SPJA 2ANKH 1SSXA 1WOFA 2C8WB 1ZGVA 3RM2H 3RXOA 3UFAA 3ITIA 1XUIA 1B5GH 1W0YH 2ZFQH 1ACBE 5JBTA 2VIPA 4VGCC 1P9SA 1UO6A 5DP4A 4ZCNA 3OSYA 2VJ1A 4Y8ZA 4Z1MD 3N7OA 3GCTG 5GXPA 2FYQA 4ISNA 2ZHQH 1S84A 1EAUA 3RDZA 2Y7XA 1A61H 1WCZA 1QRWA 1T31A 2BY9X 1EB2A 2VVVA 3ATWA 1OP0A 1GJ8B 4B71A 1C2FA 4AZ2B 3O8DA 4JZIA 1HFDA 2V6NA 3HATH 5K0HA 3P92A 2BB4A 3SJ9A 2ANMH 1TPSA 4MNYA 5J4QA 3QLPH 2AGIX 2Z3EA 2Y5GA 9LPRA 2ZNKH 1ORFA 3QTVH 1K9OE 1YBWA 2IPHA 2VU8E 4ASHA 1SHHB 1YCPK 4CHAC 2PKAB 4Y8YA 4ZKNU 1K1OA 1XKBC 1EPTC 3EAJA 1E79D 3CNRA 1QY6A 3RXFA 1O2HA 1ZSKA 2FEQH 1HLTH 5F8TA 1TPOA 1TYNA 4FUBA 2ZU2A 5E0GA 1SL3A 1Z8GA 5FX6A 3P95A 1G32B 1SGEE 3VGCC 3SN8A 1BMMH 3Q00A 1MKWH 2HALA 2F91A 1O2RA 3W1EA 3A7VA 2YNAA 4XRNA 3GYMA 5BPEA 1VCQA 3MU5A 4A7IB 1ZSLA 5TCAA 4OS7A 2JJ1D 2TGAA 3TH3H 1A0LA 4UFEH 1AB9B 2BVSH 4FUDA 3SNDA 1HAZB 1FXYA 3EDXB 1PJPA 4WMFA 2QAAA 2JKHA 3PV5A 1AFQB 1NTPA 1GVKB 1LO6A 5FBEA 4NFEA 2WYJA 3UUZA 3F9EA 3UNSA 3BTDE 1WBGB 2K1QA 1UK2A 4ZMAH 1AZZA 1ZMLA 1LQDB 1NRSH 1C5ZB 4ZUHA 3FAOA 1H9IE 1BZXE 3DFLA 1C5WB 3RM0H 3SJOA 1FZZA 3L6PA 4MPWA 2QF3A 2OD3B 3SGBE 1JWTA 1T7CA 4Z6AH 2FO9A 1EZUC 1V3XA 1EX3A 1OXGA 4NSYA 1T8LA 5CHBA 2EI8A 3T26A 5BRRE 1WXRA 1GBDA 4JK5A 2CHAC 2J2UA 3QN7A 2D2DA 1QZ8A 1PFXC 4F49A 3A88A 1YGCH 1O2YA 2R2MB 3E8LA 2OC8A 1CGJE 3RXEA 1W12U 1S5SA 2C3SA 3MWIU 5GCHG 4AB9A 4X1QU 4B1TA 2GGVB 1EXFA 2HLDD 1FY8E 2QE7D 3E1XB 3AK5A 5EXMA 1BCUH 2UWLA 5AHGH 1AB9C 3KYGA 1DUEA 3RXKA 3UOUA 2AIQA 3VB6A 1AFQC 2B9LA 2BX4A 2DUCA 3RC4A 4I31A 1BHXB 3F9HA 5E8EH 2W3IA 2FS9A 2JETB 5HIYA 4DG4A 1NFXA 5B6LA 4DGJA 3S9BA 1FN8A 2ZFTA 2O8UA 3T5FH 4CBOA 2GKVE 1O3CA 3LGWA 3G01A 4ABDA 5C2ZA 3M5LA 1GMCF 4J1YA 1S6HA 1F92A 2J38A 1NRPH 1Z71A 1S81A 3DSGA 4UEHH 4OS4A 3VXFH 2JDID 1DSUA 4AYYB 1TQ0B 2QV1A 4B76A 1OS8A 1T8OA 4I8KA 1LHDH 1KSNA 4CRDA 1C1OA 4XFQA 1V2WT 1BMNH 2NU0E 1WAYB 2VH6A 1BTZA 2A4QA 2BDAA 2VIQA 2HVXA 1W8BH 2A4RA 2V35A 1EAXA 1AFEH 5E2OA 3P8FA 2XW9A 2ZGCA 2PFEA 1TONA 4GLYA 1GG6B 1O2VA 2AMQA 5AVDA 1F5KU 1GI1A 3T29A 2FOFA 1S85A 3K9XB 1GHBF 5DGJA 5DN6D 1O2KA 3JZ2B 4RKJB 1QJ6B 2J95A 1GPZA 3A86A 1DWDH 3PMHB 6ESTA 1T8NA 4HG6A 3N7DA 3M7QA 1CSOE 4Y6DA 2SGFE 4D7FA 1C5VA 2BVRH 3BTHE 1AIXH 2QF5A 2ZU5A 4CRGA 1GBBA 4Y7BA 2BZAA 4NIXA 1GBJA 3RXAA 1O3EA 1O2JA 1O2NA 1GMDF 2L6OA 3FN8A 5HM2A 4NA9H 2FOHA 3KQ5A 2QXHA 3O8BA 2VWLA 1GCDA 4X1PU 3A7YA 1CVWH 2BDIA 3IG6B 3ZV8A 1HV7A 1JIMA 1WU1A 2BVXH 2BX3A 2ZO3H 1L2EA 1B0FA 4X2YA 1SLWB 1EOJA 1HIAA 3E0PB 2J97A 4CH2B 1BMFD 1HAPH 1GG6C 1V2VT 2GCHG 4OGYA 3V7TA 3BTWE 1L1NA 2FOBA 3E90B 2WHXA 4ABAA 2FX4A 2OC0A 1O3GA 8LPRA 2PW8H 4GCHF 1P2JA 2ZC9H 5FPTA 3SO3A 2P16A 1THSH 2F9UA 3F2HA 4I7YH 4KGAA 2Q6DA 1EATA 5IYTA 1TE0A 4OS1A 3GS9A 1GI4A 1SI5H 3U8RH 2I6QA 1YM0A 5L6NH 3RUOA 1O5BB 2FZZA 1P02A 4Q63A 5DP3A 1ABIH 2OC1A 4ABGA 1C5OH 1EFRD 5EIYA 1EJMA 1TAWA 3CS0A 4NWKA 4YLUA 3PWBA 1BTUA 5G4BA 3A8CA 1SG8B 3E0NB 3BTTE 1BBRE 4GHTA 2AMPA 1GHAF 1E38B 1BA8B 4A92A 1SLXB 2XRCA 5DKMA 5EQRA 3P8NA 4ABEA 5EGMA 4NA8A 4X6NA 4XBCA 2GP9B 2Q6FA 4UDWH 3ESTA 1C1WH 4WWYA 1MKWK 1EZQA 1IQMA 4KTUA 1GI6A 1RTLA 3FP6E 1GGDC 3E3TA 3SOSA 1GL0E 3C27B 4AG1A 3ZVBA 2VBCA 1WTGH 6GCHG 3MU1A 1P2OA 1Z8JB 3GCHB 2R0LA 1D3DB 1UCYH 1AMHA 5AF9H 2G52A 5IDKA 2FI5E 1BMAA 3FFGA 1SFQB 1N8OB 1RD3B 1BJVA 1TALA 1MTSA 1V2PT 3F9FA 1A5IA 1QB6A 4WH6A 4WVPE 3LPRA 3UWIA 4X8TH 5F8ZA 4XBBA 3KIDU 1OWEA 3PO1C 1LCYA 2FDAA 2CN0H 1BOQA 1QL9A 1HIAB 1AQ7A 1UJ1A 3S9AA 2WV4A 3RXUA 7KMEH 1IHSH 4UFDH 2BOKA 5DP8A 4J2YB 3GDUA 1O3PB 3SGAE 1TPPA 4DCDA 5DJ7A 3SU1A 2BTCE 2FWWA 3CP7A 1NROH 4ISLA 4FU8A 2EY4C 3RC5A 2XBXA 2Z9GA 3RXGA 1F7ZA 3LONA 4HGCA 3MH4A 1O3BA 2YNBA 5HXFA 4XD7D 1H8HD 3MNCA 4JYVH 8GCHG 7LPRA 1UTQA 1SOTA 2Y6TA 4Q7YA 1ETTH 5EQSA 3RU4T 1W7GH 1LMWB 1O3KA 1SMFE 1UHBA 3TK9A 3F0OA 3TGIE 4A6LA 2XNIA 1C1UH 2ZFFH 5EOKA 1O34A 4BAHB 4U01A 1O2ZA 1P2IA 3WWFA 1YPKH 1OOKB 2KCOA 3DT0H 4AFUA 2R3YA 1VZQH 4Y0ZE 1GMHF 4RKOB 3KQBA 3GCHC 2TRMA 4AG2A 4D76A 1D6RA 1QIXB 3LT3A 4Q4LA 1N8OC 1K1IA 5T6GA 4GPGA 4K1TA 3ZZ8A 1AE5A 3H5CB 1C2DA 2XCFA 3TU7H 4GSOA 3VB3A 1Y59T 7GCHG 3SHCH 3HPTB 4K8BA 3ELAH 4YXWD 3SU2A 1OWDA 1VR1H 2TIOA 1UVPA 1V2OT 1V2JT 1V2QT 2V0BA 1F0SA 1TNHA 1C1NA 1C5LH 1L1JA 1UTMA 4ZH8A 4E05H 1FV9A 5IK2D 1NBME 4GAWA 1SGFA 5F03A 1TBZH 1O3OA 2H5CA 1SKYE 2A2QH 2BD3A 3A85A 5A09A 2M2AA 3BIVH 2ZDLA 1IQKA 3QZQA 4TYDA 2YMSD 1P3EA 5A0AE 2ZDNA 3P17H 1D3QB 1JXPA 3UTUH 1C2KA 3OTPA 3M36A 3I29A 2AFQB 3NUMA 1YLDA 4BAMB 1QJ1B 2P3FH 3RP2A 2BDCA 3OTJE 1AZ8A 1TB6H 2UUFB 2PGQB 9ESTA 2EEKA 2JJ2D 5KGOA 2W3KA 2J5UA 4IBLH 2FMJA 4Q2KA 4FETA 1XUGA 4K8YA 1ETRH 2I6SA 1VITH 1TGTA 3MU0A 1A1RA 2NU2E 1COWD 3U98H 5JB8S 4WXIA 2VIWA 1WQVH 1O5FH 2QF4A 4WF8A 1UHBB 1J15A 3TJUA 1YKTA 1AUTC 3U8TH 5EJ1A 1ID5H 1ZZZA 2KZ4A 4JK6A 1AVXA 1QCPA 2ZU4A 3GICB 3BTGE 1ARCA 3PV4A 1O36A 2O8MA 3SV2H 4U30A 2DE9A 1SQAA 1GBMA 3TH4H 2ZA5A 1MZDA 1OP8A 2IJOB 2W7UA 3E6PH 1ZJKA 2A4OA 1QHRB 4X1SU 2W6JD 2GDEH 3QX5H 2FYRA 3NRLA 5ABWA 4OM9A 1CA0C 1E36B 1O2PA 4IN1A 1MD7A 2A5KA 3MNXA 3RU4E 8KME2 4AFQA 1XUJA 1O5DH 2LNCA 2QN5T 1Y3XA 4HI3A 1SBWA 4P00A 2PSXA 4JZDH 1Y8TA 3GYLB 1P8VC 1MKXH 1OHHD 3CENA 2H6MA 1CT4E 2GCTC 4Y79A 3DD2H 3B23B 4XOJA 2FODA 3RXHA 4E06H 5EJLA 2FTMA 5CDFE 5DP6A 1A5GH 1NFYA 1SGYE 1SQRA 5C1XA 3KQCA 1HCGA 2ZFPH 3DFJA 4NIWA 1C1PA 3PLKA 3Q76A 1VGCB 1CHOG 2VGCC 3SGQE 2F43B 2OLGA 2ZDVH 4BXWA 2ZF0H 2VIDA 5DSFA 5T6DA 3GCNA 3T28A 3F1SB 2JH0D 3ZZ7A 1C5PA 1LQEA 3LGIA 4AGKA 3ODDA 1MTWA 5SGAE 1A7SA 2B8OH 1W0ZU 4WH8A 4MTBA 1YPHC 1ELGA 2A7JA 4ZXYH 2RCEA 3OE7D 1O5GH 1TA6A 2GZ9A 1QRZA 2FOEA 3URDA 3IITA 2HOBA 3ZZ5A 2IOTA 1O37A 1IHTH 2AGGX 1HAVA 4OS2A 1ELTA 1QGFA 3ZVAA 1O2SA 2SFAA 2AGEX 1G2MA 2SNWA 1EKBB 1O38A 1DT2A 4NFFA 5DK1A 1C1MA 1C5MD 2P94A 2Z3CA 4I86A 3SW2B 1KLIH 1QJ7B 3PROA 1OWJA 1MU8B 4O97A 3OFND 2AERH 3SUFA 2OP9A 1J9CH 2P3UB 3U9AH 1M9UA 1TX7A 3FP7E 1SGIB 1YPMH 4NIVA 4MNVA 1Z8IB 3URCA 3UQVA 4MNWA 1O5EH 1UCYK 3GY6A 3K6ZA 1GBCA 3LOXA 1LVBA 2BDHA 2BY6X 5HYOA 5GNDA 5HKKD 1TIOA 1VGCC 3A87A 4CRAA 3HK6B 1MCVA 5DG6A 1YPGH 1DX5M 2ZTYA 1PPEE 1NN6A 1GI7B 1RTKA 2F9BH 3DUXH 1QNJA 3RXRA 1QBOA 3RMLH 4GHQA 1O2OA 1TQ7B 2VVUA 4ZKSU 2BYAX 5PTPA 3UNQA 3FANA 1B7XB 4MLFB 4IW4E 1K1JA 2FI4E 3RXBA 2C4FH 2PKSB 3RLWH 2ZDMA 1C5XB 3SNCA 1W10U 1BUIA 3SNBA 3SUDA 1GBTA 1FPCH 2OINA 3S7KB 5HM9A 1A0HB 3MTYA 1F0RA 3V0XA 2V3OH 1YYY1 2ALVA 1NS3A 1HDTH 2F83A 2WPDD 3KEEA 3LIWA 1K28D 1MQ6A 5EXLA 3W94A 1ZTJA 2ZPSA 3NWUA 3PRDA 2BD5A 3OAAD 2AIPA 1TOMH 4NWLA 3SU6A 1TBRH 2BLQA 3LKWA 4UD9H 1NRRH 2G55A 5L2ZH 2LELA 2KM0A 1GBHA 4JZEH 1HAVB 3ZVCA 4ISIH 5LPEA 1SGDE 3CS7A 3FZZA 1SGQE 4E7NA 5CE1A 3F68H 4TPIZ 3ZYEA 4BANB 2Z3DA 3UY9A 2HNTC 1YWUA 4FUFA 1K1LA 4CRFA 1IQGA 1V2ST 3N99A 3PMBB 3GCTF 3P8OA 3P70B 4SGAE 1S0QA 4IMQA 1H8IH 3STIA 1MAXA 5F6MA 4B6FA 1XKAC 4AFZA 3F2GA 5AFZH 1MUEB 2PKSC 3F2FA 1O3LA 3WWBA 3UIRA 4ABHA 1C5SA 3Q3XA 2ZU3A 1GI0A 3ZZDA 3KGPA 1D6WA 5B6OA 3B9FH 1S82A 1ZRKA 3AW1A 2GV7A 2ZZUH 1SGFG 1QL7A 1G37A 2XTTB 5F8XA 2R2WU 4DOQA 1KTTB 2F3CE 3I78A 1PQ8A 5FCRA 3M37A 1DWBH 2R3UA 5CHAB 1VITG 3MNSA 4K3JA 1J16A 1TRMA 1LHEH 4RN6A 2BXUH 1IQEA 1O3FA 1CHGA 3NZIA 1UK3A 2RA0A 1CA8B 1C1QA 1ZR0A 3LGYA 4IC5A 2Z9IA 1AUJA 2BLWA 2TBSA 3MO9A 1FY5A 4FUIA 3WY8A 3F0PA 3MO3A 2BDYA 2KCAA 4INHA 2IJD1 4AFSA 1LKAA 1MBQA 3QK1A 3QGJA 1GBLA 3SUGA 3BSQA 1TMTH 3BTKE 1F5RA 2GT8A 1C2JA 1NU9A 4IS5A 2Y5HA 4YESB 4ASUD 5L2YH 1PPCE 5FPSA 2PTCE 3DCLA 4K69A 1QRXA 4UFFH 7ESTE 1WUNH 3PWCA 1ZRBA 4X1RU 1HBTH 1H9HE 1QA7A 1H8DH 3QTOH 2ZDAH 2H9TH 2P95A 1DY8A 1FNIA 1W0KD 1SQOA 2JETC 4FUJA 1GDQA 1TGSZ 1QBVH 1GDNA 4TSFD 4WMEA 5LPFA 1CE5A 1NBMD 1KMHB 5CHAC 1TX6A 4O9VA 2OQ5A 1P12E 2WV5A 1Q3XA 2QCYA 1ARBA 1HB0B 1H4WA 1MKXK 1QL8A 1YPEH 5T3HA 2HVYB 2FI3E 1DSTA 1NFWA 3N7EA 4CRBA 1HJAB 3LH3A 1H9LB 2UUYA 2G51A 4YOGA 1HPGA 1AVWA 1E35B 1YCPM 2ANYA 1V2RT 2AYWA 1EP5A 1L4ZA 1GDUA 1MU6B 5GCHF 3HKIB 1PYTD 4B6EA 1O3MA 2ZHFH 3M5NA 1DVAH 3U8OH 4H4FA 1MABB 1C9PA 3ZZBA 2VWMA 1XVOA 3O8RA 3M3SA 2WPHS 1Y3VA 2A0QB 2ASUB 4DURA 2BOHB 5EG4A 3RLYH 2HLCA 2F9OA 4Y10E 1FAXA 1O3NA 2K8IA 3PV2A 2ZPRA 1IQJA 2FM2A 2JH6D 2PP6A 1Y5AT 3BG4B 5C3NA 1QQ4A 3F9GA 3UQOA 4YOIA 1Y3UA 1GBEA 3ZVEA 5JDUB 2QXIA 2Z9JA 1O3AA 5E0HA 5GWZA 1SLUB 1UTLM 4D9QA 2AH4X 5A8ZA 3L3TA 1W7XH 4B2CA 1UTNA 3VFEA 1G3DA 1D3PB 3GY4A 3TVJB 1P2MA 1ZJDA 3B8JA 1CBWB 3Q3KA 1P06A 3RU4D 3TGJE 1MTUA 1DDJA 1NM6A 1QBNA 1NFUA 1G9IE 1YP9A 1GJ4H 3C1KA 3ZZCA 1THRH 3RXCA 1HJAC 1C5UA 1HAIH 1KLJH 1KXCA 3GDSA 3UPEA 5EW1H 3AVZA 3SU0A 1V6DA 1O35A 2A5IA 2IPQX 1AE8H 1K0HA 1BB0B 1BRUP 1DWCH 2QF0A 2Q6GA 2L74A 4I8LA 2W6ID 2BY8X 1G3CA 1O2IA 4YZUA 2ZKSA 1EP6A 1DM4B 1ESAA 1LVOA 2PR3A 3OEED 2FESH 3MOCA 2QA9E 1D4PB 4K60A 2ZU1A 1Z7KA 4FU9A 1AHTH 1DS2E 3PM3A 1FAKH 5ETXA 2C8YB 1QA0A 1ZYOA 1LVMA 4I8HA 1A5HA 1W2KH 3R3GB 2H9HA 2ZFRH 4P02A 3A7WA 1CO7E 4X0WU 2PSYA 1UVSH 1TNJA 2QC2A 2ODYB 1IQFA 1GBFA 1SGCA 4JMYA 2ZGBH 2ZCHP 2KFWA 1BTXA 1JRSA 1WSSH 2LPRA 3HGPA 4E7RG 1B0EA 3R0FA 2XC0A 3TK6A 4NCYA 5KECA 1TLDA 1YLNA 3V13A 1VJAU 3ATIA 1BT7A 3VG8A 1UTJA 2J98A 1BRAA 1E1QD 3OX7U 4X1NU 4BTIB 1C1RA 1SOZA 1QR3E 2HPQH 4FXGH 2OXSA 1C4V2 3TJVA 2XWBI 2V7QD 1FONA 5C20A 3KYFA 3W95A 2YMSB 4JZFH 3LU9B 1LHGH 4IN2A 4Y11E 1AI8H 1G3EA 1KXFA 1LHCH 1C2LA 1A3BH 2FOMB 2FOGA 2BZ6H 2GCHF 4ZKRU 1QQUA 2ESTE 4BXSA 1P11E 2F9NA 2XXLA 2P93A 2ZI2H 2IN2A 2FS8A 3PMJA 3PLBA 1OYTH 2F4LA 3RXVA 1AGJA 1V2KT 4AN7A 5KEDA 1HJ9A 3M5MA 2ZGXH 1YF4A 5A8YA 1IAUA 3AAVA 3AW0A 2K0QA 1DXPA 4X2XA 5FPYA 3LGTA 2J4IA 2XBVA 4MDSA 1A4WH 3ZVDA 1LHFH 5HGGA 1TFXA 2O8LA 1O2QA 2WPIS 3A80A 3MO6A 3T62A 4UONA 2P8OB 5EQQA 4A5TS 3MH7A 3TNSA 1KDQA 2UWPA 2GD4B 1MBMA 2BD2A 1V2UT 2SGEE 1GJ9B 2EA3A 2Z9KA 3BTEE 5GJ4B 5FAHA 3BEUA 4K2YA 1RFNA 5I25A 2Y80A 1OSSA 3D23A 4MNXA 1VCWA 3MI4A 1ELBA 1TNLA 3HK3B 5E2PA 1EQ9A 2VB0A 1CU1A 1C4Y2 2TPIZ 1K1MA 2QYIA 3RXSA 1EUFA 2YMSC 4AYVB 3FP8E 1XXDA 3WW7A 2RDLA 1P10A 1V2TT 1P2QA 1Y3YA 4MPUA 5JBAS 3U69H 4O3UA 1BMLA 1O2XA 1BHXF 3VPKA 4M9FA 2HGTH 3RMOH 3ZV9A 1G2LA 2DE8A 2AS9A 3SU5A 4FUEA 1NZQH 6GCHF 2J9NA 1PPZA 3PYHA 2J98B 3QWCH 4A1VA 1P04A 3VB7A 1ANBA 2BLOA 2BDGA 4FU7A 1AWHB 1HYLA 2PHBA 2ANWA 1HAHH 2PUXB 5DP9A 1WTHD 2STAE 2A45B 3DA9B 1OKXA 1Y5BT 4H6SB 1O2LA 3MMGA 3SI4H 1AD8H 3QUMP 5TJXA 1QFKH 4B2AA 1ZHPA 2CF9H 4WXVA 1O0DH 4XE4A 1UTKA 3SNAA 5CMXH 3K2UA 2SGDE 1MTVA 2WINI 1SLVB 1F5LA 4YTAA 2A2XH 1CGIE 1MTNB 5FX5A 1DICA 5ESTE 1HAYB 5F53A 4AORA 8GCHF 2GTBA 1D3TB 1TA2A 4AC9A 4FUHA 1EB1H 1YY3A 3GCOA 1SR5C 2CJIA 1BBRH 3S9CA 1YPJH 1JOUB 2H5DA 1Q31A 2FPZA 2OTVA 3BTME 4VGCB 6CHAB 1HXFH 2ZQ1A 4A1TA 4D7GA 2PWXA 1IQHA 3DSOA 5HMAA 3FVFB 4O03A 4ISOA 5GDSH 1ZOMA 2QXJA 1KDQB 4U2WA 3LDXH 1FIZA 3A81A 4INLA 3RMNH 1GWAA 4WJG2 4SGBE 3LGVA 1E1RD 2B5TB 3ZZ4A 4Y0YE 1S0RA 2UUKB 3SI3H 1BQYA 3EA7A 3JZ1B 4R0IA 1IQLA 3I77A 4ABBA 1C5NH 3K65B 1V2MT 1IQIA 1FY4A 3H09A 2BD7A 2ODQA 2XBYA 3VXEH 4Q7ZA 2QIQA 5FBIA 2FIRH 4X6OA 3KCGH 4NZLA 2QXGA 3T27A 3TGKE 3RXPA 3L33A 1QB1A 1JMOH 4CHAB 2D8WA 1SHYA 3VEQB 1P57B 1GI2A 3KF2A 4X8UH 5EODA 1XX9A 1BJUA 4MVNA 1K2I1 3LGUA 3H7TA 3AASA 3UB0A 3VGCB 2KCYA 1PQ5A 3SHAH 1O3HA 3RC6A 5E0JA 1ZPZA 4Y8XA 1GJDB 2Z6BD 1MTNC 2D1JA 3GISB 1HUTH 1WV7H 2ZECA 2GT7A 3UAIC 3ENSB 1E0FD 1Z1JA 1K21H 1PQAA 4BOHA 1SGPE 1G3BA 4X6PA 1EAWA 6CHAC 2PLXA 1SGTA 3MU4A 2C8ZB 2ZEBA 1QB9A 1LPKB 3QGNB 2V3HH 5C94A 4DVAU 2WV9A 2BM2A 1C5YB 3OY6U 1N6XA 1NC6A 4FUGA 3SQHE 4CBNA 1RXPA 1NY22 4WMDA 2Y81A 2ZG0H 4MPVA 3FKSD 2EI7A 1FY3A 2EQNA 2ZDKA 1W13U 3FZDA 3TJNA 3NK8A 3LJOA 1GMCG 1J14A 1FIWA 1FI8A 1F0TA 5C67A 1MH0A 2Y5FA 3HGNA 2FLRH 5C0TA 3T2NA 1U6QA 4ZKOU 3STJA 1K1PA 2CHAB 1AY6H 1NPMA 4JYUH 3DSPA 3TH2H 3UNRA 4TY7A 3QDZB 2JIZD 4XSKU 2Y7ZA 1K1NA 2P59A 3EA8A 4AGJA 1P9UA 4ESTE 1ELEE 4IMZA 1NT1A 1K22H 1WQSA 2Q1JA 4NA7A 3PTBA 4Y71A 2GV6A 3TPIZ 4NSVA 2THFB 1GJ7B 1IQNA 1V2NT 3E16B 2PUQH 3V3MA 2XC4A 1L4DA 1O30A 2EC9H 1S83A 3FO8D 3PB1E 4YM9A 1AN1E 3SV9A 2RG3A 1GHBG 2WZQA 1LKBA 1XM1A 3A8AA 3E91A 3M3TA 3M7TA 4IC6A 2CGAA 5A8XA 4F48B 3SBKA 2JH5D 8ESTE 3A7XA 2ZFSA 5DPAA 5LH8A 1T4UH 4RI0A 2O8TA 1ESBA 3Q77A 4DT4A 1BTHH 1DY9A 2W5EA 4U32A 2GMTB 2VWOA 1KXBA 1ELAA 4CR5A 1RJXB 1CHOF 2CF8H 4NIYA 5DP7A 1BTYA 1LPZB 4R8TB 2ZCKP 1GHZA 2FTLE 3A7ZA 1GMDG 3ATMA 1A3EH 2G00A 1O2GH 4KKDA 2XNDD 4ZHLU 3RXIA 1O3IA 1HGTH 1WDIA 4UE7H 1DLKB 3UOPA 3M3VA 2H1UA 3BV9B 4B74A 1CGHA 3S7HB 1GHYH 3MH5A 5C0UA 1FN6A 1FX0B 1T32A 1NRNH 1BRBE 2STBE 4INKA 1FPHH 1UCYE 1UTPA 1GHXH 3BG8A 3U1IB 3GDVA 4RT0A 1EZXC 1UK4A 2W7SA 3RXTA 5JYIA 1GCTB 1D9IA 1HJ8A 2CK3D 2XC5A 1YPLH 2UWOA 2G5VA 4GCHG 4XBDA 1GI9B 1INCA 2BD4A 1H1BA 4D8NA 1GJBB 2P3TB 1KXDA 4ZAEA 3PTNA 1C2MA 1C2IA 1ANCA 3ZZ3A 1S6LA 3MQKC 1T8MA 4M7GA 1NESE 1Y3WA 1MD8A 1C5TA 2BQWB 3ODFA 4B73A 2ZGJA 1GL1A 1DITH 4K1SA 4ISHH 2O8WA 1ZHMA 2NWNA 3GOVB 1C1TA 1OYQA 2GMTC 4FUCA 5C1UA 4ZROA 2XYAA 3UR9A
chains in the Genus database with same CATH topology
2VWNA 4HTCH 2ULLA 1HNEE 4OS5A 3RXQA 3SU4A 1FLEE 1O3JA 1UVUH 1ELFA 1UVTH 3BTFE 1JRTA 1O33A 1UVOA 2A7CA 3OU0A 6LPRA 1GHAG 1DOJA 4LZ1H 1TNGA 1KLTA 1MAYA 1AVGH 1EJAA 3RMMH 1Z6EA 3HKJB 3QO6A 2NU4E 2OBQA 4ABFA 2CXVA 4TY6A 2PGBB 2ZHEH 3Q3YA 1ZSJA 4X2WA 3EE0B 2VVCA 1F2SE 2J34A 2ODPA 4I8GA 3TLOA 5A0CA 1XVMA 1BBRK 2WPMS 4X6MA 1GI8B 1EJNA 1GCTC 5AFYH 1P3CA 1OWIA 2FLBH 1ZTLA 4BAOB 1LTOA 1W14U 2GZ8A 3PMAB 5EU8A 1DUAA 3LJJA 4AOQA 3KHVA 3P8GA 1RTFB 3A84A 4NG9H 1KY9A 1YPHE 2VNTA 4TWYA 1KXEA 1LDTT 3TITA 4QT8C 4D9RA 1C2GA 3A83A 5C5OA 1THPB 1BIOA 1Q2WA 1KIGH 2Z9LA 3KQEA 2WPKS 1GJAB 1BITA 1W11U 1SVPA 3KQDA 3U1JB 3AAUA 3NKKA 1RGQA 1P2KA 2RA3A 3MFJA 1C5RA 2GVFA 3DHKH 5C1YA 3SZNA 1ELDE 3SNEA 4FVDA 4NGAH 4ZXXH 3H7OA 2ALPA 4JCNA 2C93B 4DY7B 4OGXA 1ELVA 5H4IB 4Y7AA 1PYTC 2SGPE 3QZRA 4ABIA 3T25A 5FHTA 4YLQH 3VB5A 2J92A 2BXTH 5L30H 5JB9S 5A0BA 3RXJA 2XWAA 2QGRA 2B0FA 1C2HA 1HRTH 1UTOA 4BTTB 1AKSA 1MCTA 4GVUA 1IOEA 1FY1A 2H2ZA 3KN2A 1JIRA 1MZAA 1N1LA 1GGDB 2ILNA 1OWKA 4ZHMU 4DW2U 1ZLRA 1C4U2 3GY8A 5EPYA 4JZ1A 1TABE 2XCNA 1TNIA 4LOYH 2A32A 5J4SA 3NPSA 4DT7B 1VITF 1EOLA 1GBAA 1GMHG 1C5QA 2GDDA 2A31A 1HAOH 1QURH 3SJKA 2Y82A 1RS0A 1DE7H 2VH0A 4YT7H 3OYPA 4DIHH 3KL6A 1CT2E 2A1DB 1DXWA 1F0UA 1NO9H 1C9TA 3M5OA 2Z94A 1NRQH 1DPOA 3D65E 3BEFB 3PO1B 3GY7A 3MH6A 4BNRA 3ATKA 1WYKA 2WUCA 2D26C 4DIIH 2FP7B 1E34B 1TMUH 3MYWA 1JBUH 2H9EH 4THNH 4CRCA 1PPBH 1L1GA 4BTUB 2UUJB 3BF6H 4BAQB 2A7HA 5I46H 4Q80A 4OS6A 2BQ7B 2BHGA 2OBOA 3GY3A 1J17T 4KTCA 5EPNA 1Z1IA 1ZGIA 2AEIH 2Z7FE 3EGKH 5TCCA 2BLVA 1TRYA 3A8BA 5T6FA 2PTNA 3M61U 1E37B 4ABJA 1YCPH 1P01A 1NU7B 2CMYA 1OP2A 1A0JA 2FX6A 2OC7A 1GHWH 3BG4C 1BRCE 2ZHDA 3SJIA 1TRNA 2F9VA 2QY0B 2ZGHA 4TWWA 1OWHA 1V2LT 2HNTE 2VINA 3BN9A 2EI6A 1FDPA 2O9QA 2BDBA 1J8AA 2OQUA 5LPRA 2OUAA 2HNTF 1GBIA 3ZZ9A 3A8DA 2ZTXA 1TGNA 4LXBH 1TGCA 1SC8U 2G81E 3UR6A 4B2BA 1Y5UT 3ZYDA 4YOJA 1GHVH 1CBWC 2M5TA 1AKSB 2W26A 2CV3A 4KELA 1KTSB 1XUKA 1L0ZA 1P09A 1XXFA 2SNVA 3D49H 3M35A 4A1XA 4I33A 4O3TA 1TPAE 4KP0A 4MQAA 4PROA 1XUFA 2BD8A 4Q7XA 2F9PA 4B75A 3ZZAA 4YO9A 1SQTA 3MNBA 3MU8A 4AB8A 1AO5A 1FJSA 1O2WA 3M7UA 1DWEH 1O2UA 1Z6JH 1QTFA 2ZPQA 3S0NA 3EA9A 4UFGH 3SV7A 1HXEH 1BTPA 1O39A 2AMDA 1ESTA 4JYTA 4Z0KA 3SQEE 1N6YA 2GZ7A 3SJ8A 1RIWB 3V12A 4WY3A 3F6UH 4ZHAA 5GPIB 1CT0E 2ZWLH 2G8TA 1HAGE 5GIBA 4I32A 1C1VH 3A82A 4DJZB 3D62A 2ZP0H 1VJ9U 3O8CA 3MHWU 5LGOA 3LC3A 1X7AC 4H6TA 4CREA 3BTQE 5C5NA 1ELCA 1TMBH 1GVLA 3S69A 3ZVFA 1KYNA 2HRVA 3OY5U 5JBCS 1SGNE 4YT6H 4X8VH 1XMNB 5DP5A 1FMGA 1ZMNA 1SGRE 2WYGA 1AWFH 5FCKA 4H42U 5EXNA 2BY5X 2TGPZ 1PPHE 5A2MH 1HAXB 2R0KA 4MPXA 2A5AA 4I8JA 1PQ7A 1G36A 3SV8A 2G4TA 2G5NA 3SV6A 1ABJH 1EPTA 2FOAA 2KAIA 2BY7X 4F4OC 1XUHA 1W3CA 3BIUH 5JBBS 5EW2H 1ZHRA 4MG3A 1CA0B 3GY2A 4NZQA 4TPYA 1GJCB 4K5ZA 2NU1E 2C90B 1DLEA 1P05A 2GX4A 1GI3A 3A89A 4RSPA 3IWMA 1O2MA 2TGTA 1RIWC 1T4VH 3NCLA 4AX9H 2ZIQH 3GY5A 1A46H 4HFPB 1YC0A 4KTSA 2PV9B 1EAIA 2SGQE 1TWXB 2P8OC 4XDEA 2G4UA 3UREA 2GCTB 3RXMA 2ZTZA 3UWJH 1DANH 1GJ6A 2WPLS 2OCVB 4BAKB 1KXAA 1O2TA 1ZPBA 1O5AB 1G30B 1PPFE 5JPMH 1GI5A 2WPJS 3ZVGA 4GUXA 1ETSH 1BDAA 1S6FA 5ESBA 1VCPA 1FQ3A 1P0SH 3LH1A 2VGCB 4K1EA 3TNTA 2BD9A 4LK4A 4X2VA 1CQQA 1O32A 1SB1H 1EASA 1GJ5H 2ZHWH 4CH8B 5K7RA 1YLCA 3A7TA 3EYDA 2PKAA 3BEIB 3ATLA 1C1SA 1AU8A 4IGDA 4LZ4B 2J94A 1UMAH 1RRKA 1ZTKA 1ZMJA 3LC5A 1PPGE 3ZZ6A 1TX8A 2SGAA 3TIUA 2B7DH 1O5CB 2NU3E 1SFIA 1OX1A 1GVZA 2BQ6B 2R9PA 4FVBA 1FUJA 1TGBA 3EQ0H 1OPHB 2FOCA 1ANEA 2BMGB 2A4GA 3K6YA 2ZCLP 3KNXA 3RXLA 3P6ZB 1ZPCA 2FXRA 1MMJN 1TOCB 1GBKA 3SU3A 3VB4A 1A2CH 5DO4H 2ZQ2A 7GCHF 2XBWA 1C2EA 1BTWA 4CR9A 2WUBA 3NXPA 3PLPA 4HZHA 5FXLA 1TBQH 1EPTB 1Z8RA 3TK5A 2KAIB 1MQ5A 1P2NA 1O3DA 2VIVA 1DFPA 3RXDA 2HWLB 2TGDA 1P03A 1TNKA 2C8XB 1O31A 1ANDA 3SORA 1EZSC 4Y76A 1LVYA 2HPPH 2VIOA 4X8SH 3SUEA 1LPGB 2YOLA 3TJOA 1SPJA 2ANKH 1SSXA 1WOFA 2C8WB 1ZGVA 3RM2H 3RXOA 3UFAA 3ITIA 1XUIA 1B5GH 1W0YH 2ZFQH 1ACBE 5JBTA 2VIPA 4VGCC 1P9SA 1UO6A 5DP4A 3OSYA 2VJ1A 4Y8ZA 3N7OA 3GCTG 5GXPA 2FYQA 4ISNA 2ZHQH 1S84A 1EAUA 3RDZA 2Y7XA 1A61H 1WCZA 1QRWA 1T31A 2BY9X 1EB2A 2VVVA 3ATWA 1OP0A 1GJ8B 4B71A 1C2FA 4AZ2B 3O8DA 4JZIA 1HFDA 2V6NA 3HATH 5K0HA 3P92A 2BB4A 3SJ9A 2ANMH 1TPSA 4MNYA 5J4QA 3QLPH 2AGIX 2Z3EA 2Y5GA 9LPRA 2ZNKH 1ORFA 3QTVH 1K9OE 1YBWA 2IPHA 2VU8E 4ASHA 1SHHB 1YCPK 4CHAC 2PKAB 4Y8YA 4ZKNU 1K1OA 1XKBC 1EPTC 3EAJA 1QY6A 3RXFA 1O2HA 1ZSKA 2FEQH 1HLTH 5F8TA 1TPOA 1TYNA 4FUBA 2ZU2A 5E0GA 1SL3A 1Z8GA 5FX6A 3P95A 1G32B 1SGEE 3VGCC 3SN8A 1BMMH 3Q00A 1MKWH 2HALA 2F91A 1O2RA 3A7VA 2YNAA 3GYMA 5BPEA 1VCQA 3MU5A 4A7IB 1ZSLA 5TCAA 4OS7A 2TGAA 3TH3H 1A0LA 4UFEH 1AB9B 2BVSH 4FUDA 3SNDA 1HAZB 1FXYA 3EDXB 1PJPA 4WMFA 2QAAA 2JKHA 1AFQB 1NTPA 1GVKB 1LO6A 5FBEA 4NFEA 2WYJA 3UUZA 3F9EA 3UNSA 3BTDE 1WBGB 2K1QA 1UK2A 4ZMAH 1AZZA 1ZMLA 1LQDB 1NRSH 1C5ZB 4ZUHA 3FAOA 1H9IE 1BZXE 3DFLA 1C5WB 3RM0H 3SJOA 1FZZA 3L6PA 4MPWA 2QF3A 2OD3B 3SGBE 1JWTA 1T7CA 4Z6AH 2FO9A 1EZUC 1V3XA 1EX3A 1OXGA 4NSYA 1T8LA 2EI8A 3T26A 5BRRE 1GBDA 4JK5A 2CHAC 2J2UA 3QN7A 2D2DA 1PFXC 4F49A 3A88A 1YGCH 1O2YA 2R2MB 3E8LA 2OC8A 1CGJE 3RXEA 1W12U 1S5SA 2C3SA 3MWIU 5GCHG 4AB9A 4X1QU 4B1TA 2GGVB 1EXFA 1FY8E 3E1XB 5EXMA 1BCUH 2UWLA 5AHGH 1AB9C 1DUEA 3RXKA 3UOUA 2AIQA 3VB6A 1AFQC 2B9LA 2BX4A 2DUCA 3RC4A 4I31A 1BHXB 3F9HA 5E8EH 2W3IA 2FS9A 2JETB 4DG4A 1NFXA 4DGJA 3S9BA 1FN8A 2ZFTA 2O8UA 3T5FH 4CBOA 2GKVE 1O3CA 3LGWA 3G01A 4ABDA 5C2ZA 3M5LA 1GMCF 4J1YA 1S6HA 1F92A 2J38A 1NRPH 1Z71A 1S81A 4UEHH 4OS4A 3VXFH 1DSUA 4AYYB 1TQ0B 2QV1A 4B76A 1OS8A 1T8OA 4I8KA 1LHDH 1KSNA 4CRDA 1C1OA 4XFQA 1V2WT 1BMNH 2NU0E 1WAYB 2VH6A 1BTZA 2A4QA 2BDAA 2VIQA 2HVXA 1W8BH 2A4RA 2V35A 1EAXA 1AFEH 5E2OA 3P8FA 2XW9A 2ZGCA 2PFEA 1TONA 4GLYA 1GG6B 1O2VA 2AMQA 5AVDA 1F5KU 1GI1A 3T29A 2FOFA 1S85A 3K9XB 1GHBF 5DGJA 1O2KA 3JZ2B 4RKJB 1QJ6B 2J95A 1GPZA 3A86A 1DWDH 3PMHB 6ESTA 1T8NA 3M7QA 1CSOE 4Y6DA 2SGFE 4D7FA 1C5VA 2BVRH 3BTHE 1AIXH 2ZU5A 4CRGA 1GBBA 4Y7BA 2BZAA 4NIXA 1GBJA 3RXAA 1O3EA 1O2JA 1O2NA 1GMDF 5HM2A 4NA9H 2FOHA 2QXHA 3O8BA 2VWLA 1GCDA 4X1PU 3A7YA 1CVWH 2BDIA 3IG6B 3ZV8A 1HV7A 1JIMA 1WU1A 2BVXH 2BX3A 2ZO3H 1L2EA 1B0FA 4X2YA 1SLWB 1EOJA 1HIAA 3E0PB 4CH2B 1HAPH 1GG6C 1V2VT 2GCHG 4OGYA 3V7TA 3BTWE 1L1NA 2FOBA 3E90B 4ABAA 2FX4A 2OC0A 1O3GA 8LPRA 2PW8H 4GCHF 1P2JA 2ZC9H 5FPTA 3SO3A 2P16A 1THSH 2F9UA 4I7YH 4KGAA 2Q6DA 1EATA 5IYTA 1TE0A 4OS1A 1GI4A 1SI5H 3U8RH 2I6QA 1YM0A 5L6NH 3RUOA 1O5BB 2FZZA 1P02A 5DP3A 1ABIH 2OC1A 4ABGA 1C5OH 1EJMA 1TAWA 3CS0A 4NWKA 4YLUA 3PWBA 1BTUA 5G4BA 3A8CA 1SG8B 3E0NB 3BTTE 1BBRE 4GHTA 2AMPA 1GHAF 1E38B 1BA8B 4A92A 1SLXB 2XRCA 5DKMA 5EQRA 3P8NA 4ABEA 5EGMA 4NA8A 4X6NA 4XBCA 2GP9B 2Q6FA 4UDWH 3ESTA 1C1WH 4WWYA 1MKWK 1EZQA 1IQMA 4KTUA 1GI6A 1RTLA 3FP6E 1GGDC 3E3TA 3SOSA 1GL0E 3C27B 4AG1A 3ZVBA 1WTGH 6GCHG 3MU1A 1P2OA 1Z8JB 3GCHB 2R0LA 1D3DB 1UCYH 1AMHA 5AF9H 2G52A 5IDKA 2FI5E 1BMAA 3FFGA 1SFQB 1N8OB 1RD3B 1BJVA 1TALA 1MTSA 1V2PT 3F9FA 1A5IA 1QB6A 4WH6A 4WVPE 3LPRA 3UWIA 4X8TH 5F8ZA 4XBBA 3KIDU 1OWEA 3PO1C 1LCYA 2FDAA 2CN0H 1BOQA 1QL9A 1HIAB 1AQ7A 1UJ1A 3S9AA 2WV4A 3RXUA 7KMEH 1IHSH 4UFDH 2BOKA 5DP8A 4J2YB 3GDUA 1O3PB 3SGAE 1TPPA 4DCDA 5DJ7A 3SU1A 2BTCE 2FWWA 3CP7A 1NROH 4ISLA 4FU8A 3RC5A 2XBXA 2Z9GA 3RXGA 1F7ZA 3LONA 4HGCA 3MH4A 1O3BA 2YNBA 5HXFA 3MNCA 4JYVH 8GCHG 7LPRA 1UTQA 1SOTA 2Y6TA 4Q7YA 1ETTH 5EQSA 3RU4T 1W7GH 1LMWB 1O3KA 1SMFE 1UHBA 3TK9A 3TGIE 4A6LA 2XNIA 1C1UH 2ZFFH 5EOKA 1O34A 4BAHB 4U01A 1O2ZA 1P2IA 1YPKH 1OOKB 3DT0H 4AFUA 2R3YA 1VZQH 4Y0ZE 1GMHF 4RKOB 3KQBA 3GCHC 2TRMA 4AG2A 4D76A 1D6RA 1QIXB 3LT3A 1N8OC 1K1IA 5T6GA 4GPGA 4K1TA 3ZZ8A 1AE5A 3H5CB 1C2DA 2XCFA 3TU7H 4GSOA 3VB3A 1Y59T 7GCHG 3SHCH 3HPTB 4K8BA 3ELAH 3SU2A 1OWDA 1VR1H 2TIOA 1UVPA 1V2OT 1V2JT 1V2QT 2V0BA 1F0SA 1TNHA 1C1NA 1C5LH 1L1JA 1UTMA 4ZH8A 4E05H 1FV9A 4GAWA 1SGFA 5F03A 1TBZH 1O3OA 2H5CA 2A2QH 2BD3A 3A85A 5A09A 3BIVH 2ZDLA 1IQKA 3QZQA 4TYDA 1P3EA 5A0AE 2ZDNA 3P17H 1D3QB 1JXPA 3UTUH 1C2KA 3M36A 3I29A 2AFQB 3NUMA 1YLDA 4BAMB 1QJ1B 2P3FH 3RP2A