4FUBA

Crystal structure of the urokinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 58
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fubA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fubA01
5DP6A 2I6SA 3SNCA 4NZQA 1GMCF 1ETSH 1W7XH 2HPQH 3KHVA 1FY8E 2A7HA 3A82A 4Q7YA 1HAOH 4WJG2 1JIRA 4NZLA 1QA7A 4LZ1H 3KGPA 3SZNA 1BMLA 4X8SH 1VCWA 2UUKB 2BDAA 2DE9A 8GCHG 1O35A 1T31A 1K28D 3GCHB 2ZI2H 3FP7E 3GCOA 1O3EA 3MI4A 1AQ7A 1C1VH 2BM2A 1TE0A 2VB0A 1TNLA 1LKBA 1SC8U 5SGAE 1KXFA 1LVOA 2DE8A 3BTKE 5GCHF 3RLWH 2C3SA 1QB6A 2PUQH 1EOLA 2BY9X 2FI5E 3MO9A 4AB8A 3KF2A 5EU8A 2AS9A 1MZAA 4DCDA 5DP5A 3T5FH 5FBEA 5LPEA 5JYIA 4A1TA 2FYQA 6CHAB 1SGIB 5DP7A 3QO6A 7LPRA 1S81A 1BBRE 4SGBE 4ZKSU 4A5TS 1LVMA 2ZC9H 3UNRA 3WY8A 1YPLH 1RTLA 1DX5M 1GL1A 3QTVH 3EAJA 1CBWC 1QL9A 3B23B 5DPAA 2XC4A 4JMYA 4OS1A 4X1PU 1FLEE 2ZDMA 3A7TA 1K22H 1ZLRA 3SU0A 2ALVA 1V2VT 1INCA 2Y7XA 1B7XB 3TK9A 2CJIA 3ZZBA 1EPTA 2GVFA 2Z9GA 1ZPBA 1SLXB 2FX6A 2ZGBH 3E16B 1ZOMA 2ANKH 4NFFA 4OS7A 1OOKB 1HIAA 1IQJA 3A8BA 4MPXA 1C2LA 3CS7A 1YF4A 1TRYA 2QIQA 1ELGA 2F83A 3RXQA 2TBSA 1TPAE 3RXEA 2ZA5A 1TX7A 3QWCH 2FOBA 2OC1A 1P05A 3AAUA 3GY6A 2UWOA 3MU1A 4Q7XA 3QX5H 4XBCA 2XCNA 3MNSA 4F49A 1OXGA 4ABEA 1JRSA 3FANA 8ESTE 3FVFB 1ZTKA 2BD7A 5CHAB 1TMUH 1HAVA 4ZXYH 1GHYH 2C8ZB 4DOQA 2V0BA 4ZHMU 1WAYB 3EGKH 3SORA 1O3NA 3A7YA 1O3JA 3GCTG 3N7OA 2PUXB 1PPBH 1J14A 4JZFH 5DK1A 5AHGH 1MBMA 1TBRH 2WYJA 5HGGA 3T27A 3KQBA 4AYYB 4D8NA 1HAZB 2ZTXA 4ABJA 1QB9A 2P3FH 2A31A 3A7ZA 3T28A 2GZ9A 1WTHD 3PTBA 1C1SA 1V2WT 2TGTA 1C5LH 2VWNA 5CHAC 2VJ1A 2XRCA 2Y7ZA 2CV3A 4NWKA 4YZUA 3DT0H 1O3DA 5EPYA 1ZHRA 1GMDG 1HB0B 1BDAA 2PR3A 3SO3A 1RFNA 1TQ0B 2WV5A 2W7SA 1FN6A 5C1UA 1BMNH 2GDEH 3GY5A 1HAXB 2ZU5A 1V2NT 4ZHLU 1BTXA 1P12E 3LPRA 5AFYH 1TRMA 1L1NA 2TGDA 1DOJA 5FCRA 2VIOA 3RXFA 3E0PB 3PYHA 3LGTA 4WWYA 2AIQA 1BTWA 2BY8X 1T8MA 3S9BA 3TVJB 2GDDA 2BVRH 3EA9A 1MKXH 2G5VA 3KNXA 2UUJB 4X2YA 1LKAA 3V3MA 2RA0A 2G55A 1VITG 1IOEA 3D23A 2BY5X 3ZZ7A 1GBDA 1O0DH 1RS0A 1TNIA 2OBQA 2OINA 2FOAA 4R0IA 1G9IE 3SV6A 1P8VC 1PQ5A 1O31A 5ESTE 4WVPE 1GJCB 1AD8H 3SU5A 2A32A 1DUAA 4ABGA 4TY7A 3HATH 1V2KT 4K3JA 3QUMP 1EB2A 2QXGA 3RXDA 1LPKB 1DANH 1IQMA 4IC6A 1DE7H 3SHCH 1BTPA 2G81E 1BTHH 4AYVB 3MNBA 2PW8H 1C2GA 3TITA 4UFGH 1A0JA 1FAKH 3TJOA 1CVWH 4LZ4B 1ID5H 8GCHF 1SGDE 3QDZB 1KDQB 4AFQA 2OC7A 2B5TB 1OWJA 3LONA 2AMDA 2H6MA 3GDSA 2GMTB 1C2KA 2OD3B 2GT7A 1O2YA 2ZPSA 3Q77A 4WMDA 2FS9A 1THPB 4Y71A 1QBVH 1TALA 3F9FA 2V6NA 2A4QA 2HALA 2F3CE 1GJ7B 4IN2A 4NA7A 1BBRH 1V2LT 2VIPA 3SQEE 2TGAA 2GCHF 1GBFA 4J1YA 3SV2H 4CH2B 1LPZB 1HLTH 3PROA 4GHTA 2GP9B 1GHAF 2BD8A 3K2UA 3RMOH 1LHFH 5E2OA 1V2RT 2PV9B 2A4RA 1GI1A 4QT8C 1G2MA 3EE0B 1KXBA 1FPCH 4BAMB 4ZH8A 2O9QA 4B71A 1AVGH 1SGPE 3ATIA 1CGJE 1TGBA 3LJJA 4RKOB 1DS2E 3ZVGA 1DM4B 2W3IA 4I7YH 7ESTE 4JZEH 4FVDA 2VIDA 4OGXA 2BDGA 3F9HA 4K1TA 4AOQA 4B2AA 1NFUA 1M9UA 2SGFE 1YKTA 2P8OB 3SBKA 3FZZA 1XUHA 2F9NA 1E35B 2PHBA 1DLKB 2R3UA 4CRDA 1SGRE 4R8TB 1GI8B 3PO1C 1Y5AT 3SN8A 1GJ5H 1ETRH 2H9EH 1N6YA 4AN7A 1CO7E 2TRMA 1W0YH 3PLPA 1VJ9U 2Z94A 4H6SB 2CF8H 1UVTH 2G5NA 1SGQE 3MTYA 4IMZA 1MU8B 1AUTC 1OWIA 1C5ZB 1GMCG 2EA3A 4BAHB 2GZ8A 3U9AH 3SJKA 3CS0A 1DXWA 3S7KB 1D3DB 3RXSA 4O03A 1HCGA 1EJAA 3A84A 1UO6A 2FDAA 5A8XA 3PLBA 8LPRA 3B9FH 3SV9A 4JYTA 3VB5A 2K1QA 3SJOA 2R9PA 1BA8B 2ZDKA 5EXLA 1ZYOA 1GHZA 5C1YA 1E36B 4ABIA 4X6MA 1IQFA 1P04A 1ABJH 4HFPB 2BLOA 1HAGE 1E0FD 2OXSA 5C1XA 1GBEA 2QA9E 2CHAB 3ZZAA 1SHYA 1P09A 2QXIA 2F9UA 4RN6A 5GCHG 3EA7A 5FBIA 4X2WA 1O3IA 3GY7A 3I77A 4CBNA 4ZKOU 1Y3XA 4CRAA 1ELDE 4WH8A 3LC3A 5A0AE 1EAIA 1UTOA 1O2TA 5E2PA 2ZCKP 4INHA 2ANWA 3W95A 4CRBA 6LPRA 2JKHA 1AHTH 4GAWA 4IC5A 5PTPA 3PMBB 4XBDA 1GGDB 1UVOA 1QJ6B 1MTUA 1Z7KA 1NRRH 1QRZA 2V3OH 3SQHE 3O8CA 1CA0B 4UONA 5AF9H 2FPZA 2R0KA 5L30H 2XBWA 1QQ4A 2PSXA 2FOFA 1X7AC 2FWWA 3TH3H 2CHAC 4UFEH 1Q2WA 3A88A 1KDQA 4DG4A 1HJ9A 2VWLA 1TX6A 1OWKA 3RDZA 1L0ZA 1DWBH 1OX1A 1Y3YA 3T26A 3GY4A 2BD3A 4Y7AA 1TPOA 4I8GA 3QN7A 2B7DH 2PTNA 5E0HA 1GVZA 1P03A 2WPMS 4FUCA 4SGAE 1K1LA 1DWDH 5K7RA 1SFIA 1O2GH 3NCLA 1HYLA 2ZDAH 2J4IA 2ESTE 1CA0C 4GPGA 2JETB 3SJ9A 2GD4B 3ZZ9A 2ZHWH 3L6PA 3W94A 1C2FA 1ZTLA 3SGQE 1SVPA 1MTNB 5BPEA 1G3BA 4J2YB 2PKSB 1SGFA 1MAYA 3RMLH 3ZVBA 3LGWA 5F6MA 2AEIH 3NXPA 4YESB 1BRUP 2J9NA 2KAIB 3S9AA 4BTIB 2VNTA 3QLPH 1DLEA 2JH0D 4AG2A 5FPSA 3NK8A 3H5CB 3SUDA 2AMQA 1GDNA 1O2XA 2VWMA 1G36A 2Z6BD 1ESTA 1YPGH 3SV7A 4Y8XA 1GVLA 2A7CA 1K1NA 1NC6A 3LT3A 1AFQB 4YTAA 1NROH 2FMJA 3UNQA 3DD2H 2NWNA 1MTNC 1F5RA 2SGQE 2XC0A 1C1UH 1TOCB 2BB4A 3TLOA 2JH6D 1LQDB 3SNEA 1C2IA 1RIWC 4D76A 1B0FA 1O3PB 2AH4X 3MU5A 1D6WA 3R3GB 1O5BB 4KELA 3RMMH 3VB6A 1EKBB 5EQRA 1MTSA 1OP8A 1SGNE 1UK3A 2HRVA 2C93B 4NIXA 3ZZ6A 4BANB 4FU9A 3VB7A 5DP4A 2BD2A 5JBTA 3K9XB 1MU6B 3GYMA 3FAOA 1TPSA 1EATA 4CRGA 2HGTH 5FX5A 2Z9JA 5DP9A 1O5EH 1CT4E 1SL3A 2UUFB 2ZIQH 2P59A 3L33A 5LH8A 1Z8GA 1ARCA 4D9RA 8KME2 4M7GA 4ZROA 1TA2A 1PPEE 1NT1A 1QL8A 1L1GA 4NIYA 3M7TA 5EXMA 3MNXA 1RD3B 1GJ6A 2BZAA 1JRTA 2Y6TA 2ODYB 2WPJS 1ZTJA 1NU7B 2ZGXH 2BDCA 4NSYA 4X8VH 5J4SA 2J95A 4INKA 2Q1JA 1MZDA 1EOJA 1SPJA 5H4IB 3STIA 1GI4A 4X2XA 1GBLA 1NO9H 3PMJA 4BXWA 4JK5A 5G4BA 4WXIA 2YNAA 2IN2A 4ZUHA 4Z6AH 2A0QB 2ZEBA 1XKBC 2EEKA 4B74A 3AASA 1ELBA 2ZPQA 4H42U 1VITH 1F0RA 3O8BA 2Q6FA 2XC5A 3PTNA 2GV6A 1P2IA 1O2UA 6GCHF 2ALPA 2FOEA 5EOKA 1ZRKA 3C27B 5A2MH 2W26A 4CH8B 3Q3XA 1UVPA 1TNHA 3A80A 3SJIA 5F8XA 2XTTB 2V3HH 1AZZA 3ZYEA 2O8TA 4UE7H 2XCFA 3DFLA 1HAYB 4FUGA 1CBWB 1ELAA 1JXPA 4OS4A 5DP8A 1KIGH 1NESE 1P3EA 1QR3E 3AAVA 1ACBE 1H9HE 2FOGA 3SNBA 3ZV9A 4UFDH 1ZZZA 3U1JB 2ZP0H 1AI8H 4LOYH 1HFDA 2GGVB 1C1NA 3C1KA 1QTFA 1O30A 1MQ5A 3RUOA 1K1MA 2Y81A 2ZCHP 2GCHG 5ESBA 4ISOA 1K1OA 3RU4D 1J17T 3ELAH 2OP9A 4GSOA 1XVOA 1Z1IA 1GHAG 5T6DA 1ZJKA 4HI3A 4CHAC 4DY7B 1KXEA 1YPHC 1ANCA 3M5MA 1CU1A 2D1JA 3A85A 1EZXC 1EAXA 1WQVH 1ZHPA 5JBAS 2KAIA 1P2JA 1K1JA 1Y3VA 4LK4A 4NWLA 2Z3DA 1A5HA 1ETTH 1XUIA 2NU1E 1O2QA 3PWBA 2BQ6B 1FPHH 1O5CB 3M3SA 1O3OA 4DVAU 1GBHA 1F92A 5E0JA 1EASA 1O39A 2RCEA 2WUCA 4DW2U 1BRBE 1T7CA 4ZXXH 2GZ7A 3KEEA 2H9TH 2PKAB 4UD9H 4NGAH 5E0GA 2GV7A 4X1QU 4WMEA 1FY4A 3RXJA 4I33A 3A83A 4AB9A 3PWCA 2BOHB 1SLUB 3BV9B 2QXJA 1P11E 2NU4E 1TB6H 1GBTA 1SHHB 2Z9LA 3BSQA 4NG9H 1ZSKA 1C2MA 5L2YH 1C1MA 3ZVEA 1NS3A 1PJPA 1XUKA 4B2BA 2F9BH 1V6DA 2OC8A 2D26C 3BTDE 3TU7H 1MKWH 2YOLA 2Z3CA 3PM3A 4CRFA 1AE5A 1XXFA 2PLXA 1FIWA 4RKJB 4Y10E 1DUEA 3ESTA 2B9LA 1DWEH 3A8AA 1BQYA 2O8LA 2FP7B 1G32B 2W3KA 1UTNA 3VB4A 1TFXA 5CE1A 1GJ9B 3P70B 1QNJA 1AKSA 3UWIA 1QBOA 1F0SA 3BIVH 4NFEA 3ATMA 4XFQA 3DHKH 1ZJDA 1TNKA 1GBBA 1TAWA 1Y3WA 3G01A 3GYLB 3SU3A 4DJZB 1ESAA 3O8RA 1SG8B 4JZDH 3KQCA 4CRCA 3P8FA 4KGAA 1OYTH 3JZ1B 5FXLA 3FP8E 5BRRE 1QQUA 3UIRA 4KTCA 2Y80A 3BTFE 1FY5A 1WBGB 4AGKA 3ZVDA 3VXFH 2P3TB 3A89A 2WUBA 1KTTB 5GIBA 1KSNA 1Y59T 3QZRA 4X6OA 2BVSH 3ITIA 2BVXH 4GCHF 2H1UA 1T4VH 2OTVA 1SQAA 2C4FH 2AFQB 3RXTA 1O2OA 2OQ5A 3GY3A 1TWXB 4AORA 2BX4A 3A8DA 4XSKU 1TIOA 3SJ8A 3BTHE 4YT7H 3ZYDA 1TPPA 4NCYA 1DY8A 1HV7A 2BZ6H 2SGAA 3UQVA 3BN9A 4TYDA 4AZ2B 1P0SH 1F7ZA 1K1IA 4MTBA 1TGCA 1VZQH 4JYUH 1WOFA 1QY6A 1J9CH 3QTOH 1LDTT 1O34A 3E90B 4ISHH 4DIHH 3E0NB 2ZFSA 1F0UA 7GCHF 2GKVE 4RSPA 1GDUA 1NTPA 2WPLS 4MPVA 1CA8B 1GJBB 3MH4A 1OS8A 1FAXA 1GJ4H 1GL0E 3E8LA 5T3HA 1W8BH 1BT7A 3Q3YA 2FOHA 1MCTA 1GBMA 4AFSA 1L4DA 1CHGA 2PSYA 3UNSA 1BB0B 1UHBB 1MBQA 2A5IA 1Q31A 2ZG0H 2ZKSA 1W3CA 2XYAA 3P92A 2PKAA 1MD8A 3E3TA 2HNTE 3ZZ5A 3UQOA 1GJDB 4ISNA 3ATKA 1OWHA 3SI4H 2BY7X 5TJXA 4TPIZ 1UCYK 1Z6JH 4A7IB 4B2CA 1UK4A 1BTYA 1PQAA 1FN8A 1JWTA 3DFJA 2P95A 3SGBE 1O2KA 1GCTC 1LVBA 2SNWA 4FUFA 2QN5T 1RGQA 4JZ1A 3M37A 4TPYA 3IWMA 3K6YA 3ODDA 1EP5A 1BJVA 3PO1B 1G3EA 3TNTA 4BTUB 2QY0B 5LGOA 3RXGA 2D2DA 1HNEE 1PPGE 3RC5A 1FJSA 1VJAU 1O3CA 2F9PA 3MMGA 1SB1H 1DSTA 2BYAX 1ESBA 1G30B 2HNTC 5FPYA 1Z8IB 1UTKA 1SQTA 5T6FA 2BD5A 1SGEE 3M35A 1Y5BT 1O5AB 5CMXH 2EI7A 5L2ZH 3RU4E 1C5YB 2A1DB 3DUXH 3TGJE 3OU0A 2DUCA 2ZQ2A 4Q2KA 3U8RH 4I8JA 3P8GA 1T32A 3PV4A 2ANMH 4JK6A 4HZHA 4BOHA 3S69A 2ZECA 1S84A 1O3AA 2HOBA 2F9OA 1O5DH 3HKIB 1EQ9A 4KKDA 4HTCH 2WPIS 3E1XB 4WH6A 3OSYA 5L6NH 1L4ZA 2RG3A 1IQEA 2SGEE 3TGIE 2HNTF 4WMFA 1F0TA 3RXCA 1HBTH 1V2MT 2ODQA 1DITH 4JZIA 3UOUA 2WINI 2FOMB 5EW2H 1Q3XA 1SQOA 2HVXA 3MOCA 1VGCB 2QGRA 2Q6GA 1FMGA 1TOMH 4TWYA 1Z8JB 4MNWA 3URDA 4MPWA 6GCHG 3GY2A 4MNYA 1K9OE 5C67A 3VPKA 3RXRA 1A0HB 1AMHA 1O3LA 3MWIU 1C9PA 3U8TH 1BITA 3MFJA 4A1XA 2J92A 3MHWU 2F91A 2WPKS 1KXDA 1MTVA 4PROA 3M7QA 2BHGA 3SU6A 1LVYA 3KQEA 1A61H 1H8DH 3MNCA 1N1LA 1AZ8A 2AYWA 2H9HA 1DVAH 3V7TA 1C5WB 3BEFB 1O37A 1ABIH 1GHBF 1KYNA 1VGCC 2ZPRA 2ZU4A 3BTEE 1NZQH 3VGCB 1BHXB 1NFYA 2PTCE 1A7SA 4ZKRU 1O2NA 5DO4H 5A09A 1MAXA 4CR9A 2FLBH 1O36A 2FX4A 1C5SA 2WYGA 3A8CA 2QC2A 2ZF0H 2P93A 3SU2A 3UWJH 3LGIA 2GCTB 2AGIX 4VGCC 4YOGA 1O2HA 1O32A 2A2XH 1UHBA 1S6FA 5B6OA 4FUBA 1EZSC 4B73A 2FS8A 1LHGH 2OLGA 1C1TA 1SI5H 1W2KH 2UWPA 2Y5GA 4IGDA 3FP6E 2PFEA 2ZFRH 1C5VA 2OC0A 1RRKA 3VGCC 2I6QA 5GXPA 2Z9KA 1T8NA 1YPKH 1W7GH 2VVCA 3ZZDA 1HJ8A 1PQ8A 4HGCA 2BDBA 2G4UA 3RM2H 3M5LA 3F9GA 2ODPA 2ZO3H 3TH4H 1QBNA 1AY6H 1E38B 1KY9A 3I29A 3ODFA 2XBVA 1C1PA 3O8DA 2GCTC 3ZZ4A 3K65B 2FESH 1G3CA 3Q3KA 1BRCE 3LDXH 1BZXE 3KL6A 2VIQA 3NZIA 5FHTA 1UTLM 1BIOA 2J34A 5HM9A 1LO6A 1N8OC 1HRTH 2ZTYA 1RIWB 1YP9A 1ANDA 1ZR0A 1AU8A 1OYQA 1BHXF 4A1VA 1D3TB 1C5TA 5GDSH 3LH3A 2Y82A 4XBBA 1XM1A 1KLIH 1Y3UA 3HK6B 3BIUH 1O3FA 3P95A 3E91A 3LKWA 4Y7BA 1TYNA 4O3TA 9LPRA 3FFGA 3LOXA 4ZAEA 3VEQB 1T8LA 5AVDA 5C5NA 1AO5A 1THRH 2BDHA 5C3NA 1FV9A 5LPFA 1BTUA 1TABE 5GWZA 1QFKH 1VCPA 2R2WU 1HAIH 1TNGA 1F5LA 3RXKA 1PPHE 2W5EA 1ZSJA 1CGIE 3ZZ8A 3STJA 1FQ3A 2A7JA 1W14U 3TH2H 1XXDA 4IBLH 4AX9H 4U30A 4U01A 2BLQA 3OY6U 5I25A 3Q00A 2QF0A 1O2WA 2O8UA 2ZHQH 1BJUA 5HYOA 1MKWK 3A86A 2VVVA 3MYWA 1EPTB 2FO9A 3BEUA 5J4QA 4ZHAA 1THSH 3GDVA 4O3UA 3ZZ3A 3SOSA 2VIVA 4GCHG 1V2JT 1LHCH 1HIAB 4YO9A 3A81A 2XNIA 1FDPA 1C5MD 4U32A 4FUEA 1P9SA 2HLCA 1V2PT 3ATLA 2QF3A 3DA9B 2PGBB 2BDYA 3IITA 4FVBA 1TQ7B 3F68H 2BD4A 1SOZA 4ABAA 2G52A 1IQIA 1O2SA 1MQ6A 1YC0A 2A45B 2JH5D 5ETXA 1EPTC 3CP7A 1B0EA 1EJNA 2ANYA 1NRSH 3UUZA 3M5NA 3RXIA 3RXBA 1FZZA 1HAVB 2ZU3A 1ELEE 1P02A 7GCHG 3HGNA 1TLDA 1AB9C 1T8OA 2ZHFH 4X2VA 1P3CA 1NPMA 2R2MB 2FYRA 2BLWA 2C90B 4X6NA 1IQKA 2PGQB 3MH5A 2VH6A 3TK6A 2BQWB 1YPJH 2A5AA 4BTTB 1H8IH 1SLVB 1DFPA 1C5QA 1O5GH 1TRNA 3OX7U 3RXMA 2CMYA 1CHOF 1OP2A 2R3YA 1TBZH 1ELCA 4NIVA 1C5NH 1YPHE 4IMQA 1TA6A 4INLA 1O38A 1GBAA 4E7RG 3JZ2B 1P01A 3SNAA 4CHAB 3P6ZB 1FY1A 4YLUA 2AGGX 1C4U2 1OKXA 1WV7H 1A3EH 1Z1JA 1TMBH 2XBXA 4AG1A 1LQEA 3MU8A 3BG8A 1MKXK 2C8XB 2TGPZ 4ASHA 1IHSH 1EB1H 2M5TA 2ZDLA 1GHXH 3T62A 2Y5HA 4MLFB 2P3UB 1AGJA 1FONA 1GI6A 1EAUA 4WF8A 1A2CH 1ZMNA 4Y0YE 5A0BA 2RDLA 1K2I1 3M3TA 3SI3H 4I32A 1HDTH 1QRXA 2SGDE 3QGJA 3UTUH 1C5UA 1QJ1B 4K69A 1H9LB 2VU8E 3EYDA 5C5OA 3UY9A 4IW4E 5F8TA 1TX8A 2W7UA 4Y11E 1UK2A 1V2UT 1XUFA 4D7FA 5DP3A 2CN0H 1PYTC 2EI6A 1D3QB 3A7XA 1A0LA 1C5PA 3SV8A 2ZZUH 1LHEH 3UFAA 1GBCA 2BMGB 3M5OA 1QHRB 2ZNKH 5EQQA 1P2NA 4CBOA 3V12A 4Y0ZE 1Y5UT 5F8ZA 4FUJA 5EG4A 2ZWLH 3Q76A 3GCHC 3UREA 1NRPH 4O97A 1H9IE 4CREA 1HXFH 4MG3A 2J2UA 1A4WH 1C4Y2 2NU3E 1TGTA 1UMAH 1EUFA 2G51A 3PB1E 3ZVFA 2SFAA 2WV4A 1D9IA 3RXAA 3GCNA 1FI8A 2WPHS 3HGPA 1BBRK 1OWEA 1YPEH 4OS5A 3GY8A 1D3PB 5EW1H 1DPOA 4OS2A 3VB3A 6CHAC 7KMEH 1KLJH 3SU1A 5IDKA 2H5DA 4THNH 4X0WU 4YM9A 1G37A 3SU4A 1YPMH 1FXYA 1ZHMA 1AWFH 4TWWA 3OYPA 1AN1E 3TGKE 2ZU1A 2VWOA 3LC5A 4Y8ZA 5DKMA 1BMAA 1UTQA 3BEIB 1WSSH 1SGCA 4K8YA 4MPUA 1G2LA 2FTLE 1S0QA 3F6UH 2FM2A 4X6PA 3PMHB 4Q80A 2V35A 5JB9S 1O33A 4ABBA 1YCPM 2THFB 5K0HA 1HXEH 3RXLA 1WCZA 2AIPA 3SW2B 4ABDA 2ZFFH 1SLWB 2FI4E 2Z7FE 2J94A 2NU0E 1GHBG 1P2QA 1IQGA 1W0ZU 1LHDH 2FEQH 3RXPA 1VCQA 2XXLA 3T29A 2TPIZ 1ZGIA 1JMOH 2P94A 3SUGA 4D7GA 1SGFG 4H4FA 2QAAA 2FOCA 3TJNA 1YCPH 1WUNH 1NRNH 3TJVA 4MNVA 4Y6DA 1A5IA 1A3BH 1SR5C 1ELFA 1BUIA 1N6XA 1C1RA 1J15A 1IQNA 1O2RA 3LU9B 2XWAA 1PFXC 2A5KA 1WYKA 2Q6DA 3GICB 5GPIB 3P8OA 3MO3A 9ESTA 3UR6A 1FIZA 1AWHB 4F4OC 1GVKB 1UJ1A 2STAE 2FIRH 5C2ZA 1F2SE 1GMHF 1SFQB 1EX3A 4FXGH 1O2LA 1DSUA 2B0FA 3VXEH 1UTJA 4B75A 2ZDVH 5F03A 1BOQA 2VIWA 1W11U 1LPGB 2QYIA 4O9VA 1Z8RA 4YOJA 3RXOA 1TNJA 3P17H 2IOTA 3LIWA 2BXUH 1O5FH 1PPCE 5EGMA 3BTGE 1Y8TA 4FUDA 1JIMA 1V2ST 3A7VA 3UOPA 3QGNB 1W13U 3V0XA 4FU8A 1QGFA 2BY6X 3RXHA 1P9UA 3U98H 1TGNA 2ZGCA 3A87A 5FX6A 2BLVA 3FZDA 1V2TT 1YLCA 5ABWA 2FODA 1XX9A 2VGCB 1RTFB 1AVXA 1GCTB 1UCYE 2XWBI 2R0LA 1HJAB 2OBOA 4JYVH 2P16A 4BNRA 1NN6A 4BXSA 3BTQE 3NUMA 1D6RA 4DGJA 3RXVA 1QURH 3U69H 2VVUA 3S9CA 3MH7A 1B5GH 2ULLA 1ELVA 3LGVA 1S85A 1T4UH 1WTGH 1Z6EA 2YNBA 2ZFPH 3T2NA 1ZMJA 5JPMH 1WU1A 3F1SB 3H7OA 2Y5FA 4AGJA 1GHVH 4Q7ZA 1IQLA 1GDQA 2Z3EA 2FTMA 5A0CA 1C5OH 1BTZA 1NFWA 1CT0E 1P57B 5EXNA 4KP0A 3IG6B 1XKAC 1O3BA 1J16A 2CGAA 2VGCC 2O8MA 2A2QH 1S83A 1O2JA 4UEHH 1GBIA 5TCAA 1IHTH 4FUIA 4XDEA 4WXVA 1HPGA 2BQ7B 1PPFE 1C4V2 3T25A 1NY22 4I8LA 4MDSA 1HJAC 1YGCH 1JOUB 3D49H 1S6HA 1HUTH 1EAWA 1C1QA 3BF6H 1QCPA 1O2IA 3HPTB 5DJ7A 4B1TA 1MTWA 3LGUA 3M7UA 4BAOB 1BRAA 2O8WA 1C9TA 3GDUA 3RC4A 1HAHH 2GT8A 2Z9IA 5C20A 1QJ7B 1XUJA 1ORFA 4K1SA 1AFEH 3SHAH 1O3MA 1H4WA 1L1JA 1P2OA 4GLYA 2SGPE 2QXHA 1GI0A 3TK5A 3P8NA 1TONA 2BD9A 2CXVA 2OUAA 2GMTC 2ZDNA 3RXUA 2STBE 1U6QA 1PYTD 4I31A 1O2VA 3PLKA 4MVNA 2ASUB 4B76A 2OQUA 1GJ8B 1GBJA 1CE5A 1ARBA 1ZGVA 1FUJA 1ANEA 3EDXB 4H6TA 4KTUA 1RXPA 4ABFA 1SOTA 3S7HB 4NSVA 3GOVB 1D4PB 4ISIH 1SBWA 3S0NA 1J8AA 3GISB 1LMWB 5FAHA 4Y79A 1HAPH 1UVUH 3MH6A 1CHOG 4BAQB 3NWUA 1A1RA 2NU2E 1NU9A 5EPNA 1L2EA 3H7TA 1ZPZA 1IAUA 1G3DA 2ZU2A 2VINA 3I78A 1O2MA 3B8JA 3QK1A 4FU7A 2BX3A 3AVZA 1A5GH 1LCYA 5IYTA 5JDUB 4ISLA 2P8OC 4OGYA 3UR9A 1ZMLA 4VGCB 1W10U 3RMNH 4YOIA 1ZRBA 3ENSB 1GHWH 1C2HA 3LH1A 1CSOE 2D8WA 4CR5A 5LPRA 4MNXA 1NFXA 1PPZA 2A4GA 5HXFA 3TNSA 3EQ0H 1KTSB 3ZVCA 1OWDA 1Z71A 4ZMAH 1CT2E 2B8OH 5FPTA 3GCTF 3V13A 1XUGA 4NIWA 2GX4A 3MU4A 3RM0H 3ZVAA 1MH0A 1C1OA 1QA0A 1GG6B 1NRQH 4FUHA 3BTWE 1NM6A 4KTSA 1BCUH 1SGTA 2BXTH 4GUXA 2UUYA 4K5ZA 1C2EA 1YLDA 2ILNA 5EODA 1KXCA 3BG4B 1S0RA 2EI8A 1S5SA 1S82A 3URCA 3M36A 1K21H 2IJOB 1GCDA 1MCVA 1W12U 2ZFTA 1TMTH 3LJOA 1UTMA 1N8OB 2QCYA 4Y76A 1JBUH 1O2PA 1TBQH 3F9EA 3U8OH 2G8TA 2C8YB 4ABHA 1V2OT 1C5XB 2VH0A 4XOJA 4DIIH 4OS6A 2FI3E 1GMDF 3NPSA 1GBKA 3RP2A 3AW0A 1DDJA 4K1EA 3BTME 1GG6C 1KXAA 2ZQ1A 3SNDA 2QV1A 4E05H 3KN2A 5JB8S 1GPZA 4NA9H 2BDIA 3L3TA 1YYY1 3UPEA 2OCVB 1DT2A 1C2JA 1ZPCA 1P06A 3BG4C 6ESTA 3CENA 1C1WH 2FZZA 2AERH 4X1NU 1F5KU 4UFFH 4DT7B 3KCGH 4GHQA 2A4OA 5E8EH 3ZV8A 1UCYH 1GI7B 2LNCA 1O3HA 1RJXB 1EXFA 4E7NA 1GGDC 2ZCLP 2EC9H 2H2ZA 5A8ZA 1GI9B 4LXBH 1VITF 4JCNA 3E6PH 3HKJB 1FY3A 4A92A 4Z0KA 4DURA 4D9QA 1CQQA 2C8WB 3RC6A 2BOKA 4UDWH 1KLTA 2FLRH 4ZKNU 2G4TA 5JBCS 2ZFQH 4K60A 1MD7A 5JBBS 5T6GA 1FNIA 2CF9H 2BTCE 2XBYA 5AFZH 1QB1A 3VFEA 5DG6A 2ZGHA 4X8UH 1BMMH 1P2KA 1DY9A 1P10A 4K2YA 1P2MA 1K1PA 2F9VA 4GVUA 1DWCH 4YLQH 3RU4T 3SGAE 4E06H 3KIDU 5DGJA 4X1SU 4Y8YA 3K6ZA 2JETC 3LGYA 4I8HA 2ZHEH 1PQ7A 1V3XA 2TIOA 1O2ZA 2PWXA 2ZHDA 2XW9A 3EA8A 3PMAB 2PKSC 1TGSZ 1CGHA 1GJAB 1O3KA 3RLYH 1UTPA 1LTOA 1RTKA 2G00A 3ATWA 3OTJE 5EQSA 1XVMA 4AFUA 1AB9B 1EZQA 1O3GA 1A46H 4NA8A 1ELTA 2IPHA 3MU0A 1EJMA 1EP6A 2LPRA 4X1RU 3SUFA 4I8KA 2FXRA 1QL7A 4XE4A 1OP0A 4IN1A 1H1BA 1GMHG 1AIXH 1C2DA 1E34B 1QRWA 3MO6A 3HK3B 1ANBA 3TIUA 3TPIZ 1ZSLA 1UVSH 1IQHA 4TY6A 4YT6H 1EZUC 1C5RA 1GWAA 4AFZA 4MQAA 1AUJA 1QIXB 3OY5U 4BAKB 1AFQC 2J38A 1MMJN 1AVWA 1OPHB 1SSXA 4X8TH 1MUEB 5HM2A 3AW1A 3SUEA 1WQSA 3KQDA 3QZQA 1E37B 1SMFE 1YCPK 1DXPA 2H5CA 2HWLB 2RA3A 4U2WA 3BTTE 2ZTZA 1AKSB 2ZGJA 3U1IB 3R0FA 5A8YA 2HPPH 1SGYE 3M3VA 2AMPA 5HMAA 5FCKA 2AGEX 1V2QT 1DICA 1YBWA 3ZZCA 5TCCA 1XMNB 3NKKA 1VR1H 1GI3A 3M61U 2GTBA 4IS5A 4ESTE 5GJ4B 4A6LA 4K8BA 2SNVA 4WY3A 1AE8H 1OSSA 3A7WA 1HGTH 2UWLA 3TJUA 1GI2A 5I46H 1YM0A 3D65E 3D62A 1GI5A
chains in the Genus database with same CATH superfamily
5DP6A 2I6SA 3SNCA 4NZQA 1GMCF 1ETSH 1W7XH 2HPQH 3KHVA 1FY8E 2A7HA 3A82A 4Q7YA 1HAOH 4WJG2 1JIRA 4NZLA 1QA7A 4LZ1H 3KGPA 3SZNA 1BMLA 4X8SH 1VCWA 2UUKB 2BDAA 2DE9A 8GCHG 1O35A 1T31A 1K28D 4ACBA 3F0OA 3GCHB 2ZI2H 3FP7E 3GCOA 1O3EA 3MI4A 1AQ7A 1C1VH 2BM2A 1TE0A 2VB0A 1TNLA 1LKBA 1SC8U 5SGAE 1KXFA 1LVOA 2DE8A 3BTKE 5GCHF 3RLWH 2PP6A 2C3SA 1QB6A 2PUQH 1EOLA 2BY9X 2FI5E 3MO9A 4AB8A 3KF2A 5EU8A 2AS9A 1MZAA 2IJD1 4DCDA 5DP5A 3T5FH 5FBEA 5T1VA 5JYIA 5LPEA 4A1TA 2FYQA 6CHAB 1SGIB 5DP7A 3QO6A 7LPRA 1S81A 1BBRE 4SGBE 4ZKSU 4A5TS 1LVMA 2ZC9H 3UNRA 3WY8A 1YPLH 1RTLA 1DX5M 1GL1A 3QTVH 3EAJA 1CBWC 1QL9A 3B23B 5DPAA 2XC4A 4JMYA 4OS1A 4X1PU 1FLEE 2ZDMA 3A7TA 1K22H 1ZLRA 3PRBA 3SU0A 2ALVA 1V2VT 1INCA 2Y7XA 1B7XB 3TK9A 2CJIA 3ZZBA 1EPTA 2GVFA 2Z9GA 1ZPBA 1SLXB 2FX6A 2ZGBH 3E16B 1ZOMA 2ANKH 4NFFA 4OS7A 1OOKB 1HIAA 2V3MA 1IQJA 3A8BA 4MPXA 1C2LA 3CS7A 1YF4A 1TRYA 2QIQA 1ELGA 1NBME 2F83A 3RXQA 2TBSA 1TPAE 3RXEA 2ZA5A 1TX7A 3QWCH 2FOBA 2OC1A 2YMSB 1P05A 3AAUA 3GY6A 2UWOA 3MU1A 4Q7XA 3QX5H 4XBCA 2XCNA 3MNSA 4F49A 1OXGA 5DSFA 4ABEA 1JRSA 2KCAA 3FANA 8ESTE 3FVFB 1ZTKA 2BD7A 5CHAB 1TMUH 1HAVA 4ZXYH 1GHYH 2C8ZB 4DOQA 2V0BA 4ZHMU 1WAYB 3EGKH 3SORA 1O3NA 3A7YA 1O3JA 3GCTG 3N7OA 1YLNA 1PPBH 1J14A 2PUXB 4JZFH 5DK1A 5AHGH 1MBMA 1TBRH 2WYJA 5HGGA 3T27A 3KQBA 4AYYB 4D8NA 1HAZB 2ZTXA 4ABJA 1QB9A 2P3FH 3OAAD 2A31A 3A7ZA 3T28A 2GZ9A 1WTHD 3PTBA 2F43B 1C1SA 1V2WT 2TGTA 1C5LH 2VWNA 5CHAC 2VJ1A 2XRCA 2Y7ZA 2CV3A 4NWKA 4YZUA 3DT0H 1O3DA 5EPYA 1ZHRA 1GMDG 1HB0B 1BDAA 2PR3A 5CHBA 3SO3A 1RFNA 1TQ0B 2WV5A 2W7SA 1FN6A 4HG6A 5C1UA 1BMNH 2GDEH 3GY5A 1HAXB 2ZU5A 1V2NT 4ZHLU 1BTXA 1P12E 3LPRA 5AFYH 1TRMA 1L1NA 2TGDA 1DOJA 5FCRA 2VIOA 3RXFA 3E0PB 3PYHA 3LGTA 4WWYA 2AIQA 1BTWA 2BY8X 1T8MA 3S9BA 3TVJB 2GDDA 2BVRH 3EA9A 1MKXH 4DT4A 2G5VA 3KNXA 2UUJB 4X2YA 1LKAA 3V3MA 1K0HA 2RA0A 2G55A 1VITG 1IOEA 3D23A 2BY5X 3ZZ7A 1GBDA 1O0DH 1RS0A 1TNIA 2OBQA 2OINA 2FOAA 4R0IA 1G9IE 3SV6A 1P8VC 1PQ5A 1O31A 5ESTE 4WVPE 1GJCB 1AD8H 3SU5A 4F48B 2A32A 1DUAA 4ABGA 4TY7A 3HATH 1V2KT 4K3JA 3QUMP 1EB2A 2QXGA 3RXDA 1LPKB 1DANH 1IQMA 4IC6A 1DE7H 3SHCH 1BTPA 2G81E 1BTHH 4AYVB 3MNBA 2PW8H 1C2GA 3TITA 4UFGH 1A0JA 1FAKH 3TJOA 1CVWH 4XRNA 4LZ4B 1ID5H 8GCHF 1SGDE 3QDZB 1KDQB 4AFQA 2OC7A 2B5TB 1OWJA 3LONA 2AMDA 2QF4A 2H6MA 3GDSA 2GMTB 1C2KA 2OD3B 2GT7A 1O2YA 2ZPSA 3Q77A 4WMDA 2FS9A 1THPB 2M2AA 4Y71A 1QBVH 1TALA 3F9FA 2V6NA 2A4QA 2HALA 2F3CE 1GJ7B 4IN2A 4NA7A 1BBRH 1V2LT 2VIPA 3SQEE 3FOAA 2TGAA 2GCHF 1GBFA 4J1YA 3SV2H 4CH2B 1LPZB 1HLTH 3PROA 4GHTA 2GP9B 1GHAF 2BD8A 3K2UA 3RMOH 4Z1MD 1LHFH 5E2OA 1V2RT 2PV9B 2A4RA 1GI1A 4QT8C 1G2MA 3EE0B 1KXBA 1FPCH 4BAMB 4ZH8A 2O9QA 4B71A 1AVGH 1SGPE 3ATIA 1CGJE 1TGBA 3LJJA 4RKOB 1DS2E 3ZVGA 1DM4B 2W3IA 4I7YH 7ESTE 4JZEH 4FVDA 3N7EA 2VIDA 4OGXA 2BDGA 3F9HA 4K1TA 4AOQA 4B2AA 1NFUA 1M9UA 2SGFE 1YKTA 2P8OB 3SBKA 3FZZA 1XUHA 2F9NA 1E35B 2PHBA 1DLKB 2XNDD 2R3UA 4CRDA 1SGRE 4R8TB 1SQRA 1GI8B 3PO1C 1Y5AT 3SN8A 1GJ5H 1ETRH 2H9EH 1N6YA 4AN7A 1CO7E 2TRMA 1W0YH 3PLPA 1VJ9U 2Z94A 4H6SB 2CF8H 1UVTH 2G5NA 3N99A 1SGQE 3MTYA 4IMZA 1MU8B 1AUTC 1OWIA 1C5ZB 1GMCG 2EA3A 4BAHB 2GZ8A 3U9AH 3SJKA 3OTPA 3CS0A 1DXWA 3S7KB 1D3DB 3RXSA 4O03A 1HCGA 1EJAA 3A84A 1UO6A 2FDAA 5A8XA 3PLBA 8LPRA 3B9FH 3SV9A 4JYTA 3VB5A 2K1QA 3SJOA 2R9PA 1BA8B 2ZDKA 5EXLA 1ZYOA 1GHZA 5C1YA 5C0UA 1E36B 4ABIA 4X6MA 1IQFA 1P04A 1ABJH 4HFPB 2BLOA 1HAGE 1E0FD 1W0KD 2OXSA 5C1XA 1GBEA 2QA9E 2CHAB 3ZZAA 1SHYA 1P09A 2QXIA 2F9UA 4RN6A 5GCHG 3EA7A 5FBIA 4X2WA 1O3IA 3GY7A 3I77A 4CBNA 4ZKOU 1Y3XA 4CRAA 1ELDE 4WH8A 3LC3A 5A0AE 1EAIA 1UTOA 1O2TA 5E2PA 2ZCKP 4INHA 2ANWA 3W95A 4CRBA 6LPRA 2JKHA 1AHTH 4GAWA 2JJ1D 4IC5A 5PTPA 3PMBB 4XBDA 1GGDB 1UVOA 1QJ6B 1MTUA 1Z7KA 1NRRH 1QRZA 2V3OH 3SQHE 3O8CA 1CA0B 4UONA 5AF9H 2FPZA 2R0KA 5L30H 2XBWA 1QQ4A 3PV2A 2PSXA 2FOFA 1X7AC 2FWWA 3TH3H 2CHAC 4UFEH 1Q2WA 3A88A 1KDQA 4DG4A 5HKKD 1HJ9A 2VWLA 1TX6A 1OWKA 3PRDA 3RDZA 1L0ZA 1DWBH 1OX1A 1Y3YA 3T26A 3SZEA 3GY4A 2BD3A 4Y7AA 1TPOA 4I8GA 3QN7A 2B7DH 2PTNA 5E0HA 1GVZA 1P03A 2WPMS 4FUCA 4SGAE 1K1LA 1DWDH 5K7RA 1SFIA 1O2GH 3NCLA 1HYLA 2ZDAH 2J4IA 2ESTE 1CA0C 4GPGA 2JETB 3SJ9A 2GD4B 3ZZ9A 2ZHWH 3L6PA 5DN6D 3W94A 1C2FA 1ZTLA 2XOKD 3SGQE 1SVPA 1MTNB 5BPEA 1G3BA 4J2YB 2PKSB 1SGFA 1MAYA 3RMLH 3ZVBA 3LGWA 5F6MA 2AEIH 3NXPA 4YESB 1BRUP 2J9NA 2KAIB 3S9AA 4BTIB 2VNTA 3DSPA 3QLPH 1DLEA 2JH0D 4AG2A 5FPSA 3NK8A 3H5CB 3SUDA 2AMQA 3OE7D 1GDNA 3F2GA 1O2XA 2VWMA 1G36A 2Z6BD 1ESTA 1YPGH 3SV7A 4Y8XA 1GVLA 2A7CA 1K1NA 1NC6A 3LT3A 1AFQB 4YTAA 1NROH 2FMJA 5HIZA 3UNQA 3DD2H 2NWNA 1MTNC 1F5RA 2SGQE 2XC0A 1C1UH 1TOCB 2BB4A 3TLOA 2JH6D 1LQDB 3SNEA 1C2IA 1RIWC 4D76A 1B0FA 1O3PB 2AH4X 3MU5A 1D6WA 3R3GB 1O5BB 4KELA 3RMMH 3VB6A 1EKBB 5EQRA 1MTSA 1OP8A 1SGNE 1UK3A 2HRVA 2C93B 4NIXA 3ZZ6A 4BANB 4FU9A 3VB7A 5DP4A 2BD2A 5JBTA 3K9XB 1MU6B 3GYMA 3FAOA 1TPSA 1EATA 4CRGA 2HGTH 5FX5A 2Z9JA 5DP9A 1O5EH 1CT4E 1SL3A 2UUFB 4FOUC 2ZIQH 2P59A 3L33A 5LH8A 1Z8GA 1ARCA 4D9RA 8KME2 4M7GA 4ZROA 1TA2A 1PPEE 1NT1A 4B6FA 1QL8A 1L1GA 4NIYA 3M7TA 5EXMA 3MNXA 1RD3B 1GJ6A 2BZAA 1JRTA 2Y6TA 2ODYB 2WPJS 1ZTJA 1NU7B 2ZGXH 2BDCA 4NSYA 4X8VH 5J4SA 2J95A 4INKA 2Q1JA 1MZDA 1EOJA 1SPJA 5H4IB 3STIA 1GI4A 4X2XA 1GBLA 1NO9H 3PMJA 4BXWA 4JK5A 5G4BA 4WXIA 2YNAA 2IN2A 2WZQA 4ZUHA 4Z6AH 2A0QB 2ZEBA 1OHHD 1XKBC 2EEKA 4B74A 3AASA 1ELBA 2ZPQA 4H42U 1VITH 1F0RA 3O8BA 2Q6FA 2XC5A 3PTNA 2GV6A 1P2IA 1O2UA 6GCHF 2ALPA 2FOEA 5EOKA 1ZRKA 3C27B 5A2MH 2W26A 3FN8A 3Q3XA 4CH8B 1UVPA 1TNHA 3A80A 3SJIA 1YY3A 5F8XA 2XTTB 2V3HH 1AZZA 3ZYEA 2O8TA 4UE7H 2XCFA 3DFLA 1HAYB 4FUGA 1CBWB 1ELAA 1JXPA 4OS4A 5DP8A 1KIGH 1NESE 1P3EA 1QR3E 3AAVA 1ACBE 1H9HE 2FOGA 2J98B 3SNBA 3ZV9A 4UFDH 1ZZZA 3U1JB 2ZP0H 1AI8H 4LOYH 1HFDA 2GGVB 1C1NA 3C1KA 1QTFA 1O30A 1MQ5A 3RUOA 1K1MA 2Y81A 2ZCHP 2GCHG 5ESBA 4ISOA 1K1OA 3RU4D 1J17T 3ELAH 2OP9A 4GSOA 1XVOA 1Z1IA 1GHAG 2HLDD 5T6DA 1ZJKA 4HI3A 4CHAC 4DY7B 1KXEA 1YPHC 1ANCA 3M5MA 1CU1A 2D1JA 2QE7D 1EZXC 1EAXA 1WQVH 1ZHPA 3A85A 2KAIA 1P2JA 5JBAS 1K1JA 1Y3VA 4LK4A 4NWLA 2Z3DA 1A5HA 1ETTH 1XUIA 2NU1E 1O2QA 3PWBA 1WXRA 2BQ6B 1FPHH 1O5CB 3M3SA 1O3OA 4DVAU 2QF5A 1GBHA 1F92A 5E0JA 1EASA 1O39A 2RCEA 2WUCA 4DW2U 1BRBE 1T7CA 4ZXXH 2GZ7A 3KEEA 2H9TH 2PKAB 4UD9H 4NGAH 3WWFA 5E0GA 2GV7A 4X1QU 4WMEA 1FY4A 3RXJA 4I33A 3A83A 4AB9A 3PWCA 2BOHB 1SLUB 3BV9B 2QXJA 2OK5A 1P11E 2NU4E 1TB6H 1GBTA 1SHHB 2Z9LA 3BSQA 4NG9H 1ZSKA 1C2MA 5L2YH 1C1MA 3ZVEA 1NS3A 1PJPA 1XUKA 4B2BA 2F9BH 1V6DA 2OC8A 2D26C 3BTDE 3TU7H 5EIYA 1MKWH 2YOLA 2Z3CA 3PM3A 4CRFA 1AE5A 1XXFA 2PLXA 1FIWA 2RDEA 4RKJB 4Y10E 1DUEA 3ESTA 3OEHD 2B9LA 1DWEH 3A8AA 1BQYA 2O8LA 2FP7B 1G32B 2W3KA 1UTNA 5EJ1A 3VB4A 1TFXA 5CE1A 1GJ9B 3P70B 1QNJA 1AKSA 3UWIA 1QBOA 1F0SA 3BIVH 4NFEA 3ATMA 4XFQA 3DHKH 1ZJDA 1TNKA 1GBBA 1TAWA 1Y3WA 3G01A 3GYLB 3SU3A 4DJZB 1ESAA 3O8RA 1SG8B 4JZDH 2LP6A 3KQCA 4CRCA 3P8FA 4KGAA 1OYTH 3JZ1B 5FXLA 3FP8E 5BRRE 1QQUA 3UIRA 4KTCA 2Y80A 3NRLA 3BTFE 1FY5A 1WBGB 4AGKA 3ZVDA 3VXFH 2P3TB 3A89A 2WUBA 1KTTB 5GIBA 1KSNA 4F55A 1Y59T 3QZRA 4X6OA 2BVSH 3ITIA 2BVXH 4GCHF 2H1UA 1T4VH 2OTVA 1SQAA 2C4FH 2AFQB 3RXTA 1O2OA 2OQ5A 3GY3A 1TWXB 4AORA 2BX4A 3A8DA 4XSKU 1TIOA 3SJ8A 3BTHE 4YT7H 3ZYDA 1TPPA 4NCYA 3F3BA 1DY8A 1HV7A 2BZ6H 2SGAA 3UQVA 3BN9A 4TYDA 4AZ2B 1P0SH 1F7ZA 4RT1A 1K1IA 4MTBA 1TGCA 1VZQH 2J98A 4JYUH 1WOFA 1QY6A 1J9CH 3QTOH 1LDTT 1O34A 3E90B 4ISHH 4DIHH 3E0NB 2ZFSA 1F0UA 7GCHF 2GKVE 4RSPA 1GDUA 1NTPA 2WPLS 4MPVA 1CA8B 1E1RD 1GJBB 2W6ID 3MH4A 1OS8A 1FAXA 1GJ4H 1GL0E 3E8LA 5T3HA 1W8BH 1BT7A 3Q3YA 2FOHA 3H09A 1MCTA 1GBMA 3F0PA 4AFSA 1L4DA 1CHGA 4Q63A 2PSYA 3UNSA 1BB0B 1UHBB 1MBQA 2A5IA 2WV9A 1Q31A 2ZG0H 2ZKSA 1W3CA 2XYAA 3P92A 2PKAA 1MD8A 3E3TA 2HNTE 3ZZ5A 3UQOA 1GJDB 4ISNA 3ATKA 1OWHA 3SI4H 2BY7X 5TJXA 4TPIZ 1UCYK 1Z6JH 4A7IB 4AC9A 4B2CA 1UK4A 1BTYA 1PQAA 1FN8A 1JWTA 3DFJA 2P95A 3SGBE 1O2KA 1GCTC 1LVBA 2SNWA 4FUFA 2QN5T 1RGQA 4JZ1A 3M37A 4TPYA 3IWMA 3K6YA 3ODDA 1EP5A 1BJVA 3PO1B 1G3EA 3TNTA 4BTUB 2QY0B 5LGOA 3RXGA 2D2DA 1HNEE 1PPGE 3RC5A 1FJSA 1VJAU 1O3CA 2F9PA 3MMGA 4ACAA 1SB1H 1DSTA 2BYAX 1ESBA 1G30B 2HNTC 5FPYA 1Z8IB 1UTKA 5GNDA 1SQTA 5T6FA 3KQ5A 2BD5A 1SGEE 3M35A 1Y5BT 1O5AB 5CMXH 2EI7A 5L2ZH 3RU4E 1C5YB 2A1DB 3DUXH 3TGJE 3OU0A 2DUCA 2ZQ2A 3EE7A 4Q2KA 1VKYA 3U8RH 4I8JA 3P8GA 1T32A 3PV4A 2ANMH 4JK6A 4HZHA 4BOHA 3S69A 2ZECA 1S84A 1O3AA 2HOBA 2F9OA 1O5DH 3HKIB 1EQ9A 4KKDA 4HTCH 2WPIS 3E1XB 4WH6A 3OSYA 5L6NH 1L4ZA 2RG3A 1IQEA 2SGEE 3TGIE 2HNTF 4WMFA 1F0TA 3RXCA 1HBTH 1V2MT 2ODQA 1DITH 4JZIA 3UOUA 2WINI 2FOMB 5EW2H 1Q3XA 1SQOA 2GJGA 2HVXA 3MOCA 1VGCB 2QGRA 2AHME 2Q6GA 1FMGA 4RI0A 3WW7A 1TOMH 4TWYA 1Z8JB 4MNWA 3URDA 4MPWA 6GCHG 3GY2A 4MNYA 1K9OE 5C67A 3VPKA 3RXRA 1A0HB 1AMHA 1O3LA 3MWIU 2KM0A 4XD7D 1C9PA 2RFKC 3U8TH 1BITA 3MFJA 4A1XA 2J92A 3MHWU 2F91A 2WPKS 1KXDA 1MTVA 4PROA 3M7QA 2BHGA 5EJZA 3SU6A 3DCLA 1LVYA 3KQEA 1A61H 1H8DH 3MNCA 1N1LA 1AZ8A 2AYWA 2H9HA 1DVAH 3V7TA 1C5WB 2WSSD 3BEFB 1O37A 1ABIH 1GHBF 1KYNA 1VGCC 2ZPRA 2ZU4A 3BTEE 1NZQH 3VGCB 1BHXB 1NFYA 2PTCE 1A7SA 1E1QD 4ZKRU 1O2NA 5DO4H 5A09A 1MAXA 4CR9A 2FLBH 1O36A 2FX4A 1C5SA 2WYGA 3A8CA 2QC2A 2ZF0H 2P93A 3SU2A 3UWJH 3LGIA 2EY4C 2GCTB 2AGIX 4VGCC 4YOGA 1O2HA 1O32A 2A2XH 1UHBA 1S6FA 5B6OA 4FUBA 1EZSC 4B73A 2FS8A 1LHGH 2OLGA 1C1TA 1SI5H 1W2KH 2UWPA 2Y5GA 4IGDA 3FP6E 2PFEA 2ZFRH 1C5VA 2OC0A 1RRKA 3FKSD 3VGCC 2I6QA 3FO8D 5GXPA 2Z9KA 1T8NA 1YPKH 1W7GH 2VVCA 3ZZDA 1HJ8A 1PQ8A 3N7DA 4HGCA 2BDBA 2G4UA 3RM2H 3M5LA 3F9GA 2YMSD 2ODPA 2ZO3H 3TH4H 1QBNA 2KCPA 1AY6H 1E38B 1KY9A 3I29A 3ODFA 2XBVA 1C1PA 3O8DA 2GCTC 3ZZ4A 3F2HA 2FESH 3K65B 1G3CA 3Q3KA 1BRCE 3LDXH 1BZXE 3KL6A 2VIQA 3NZIA 5FHTA 1UTLM 1BIOA 2J34A 4Q4LA 5HM9A 2W6JD 1LO6A 1N8OC 1HRTH 2J97A 2ZTYA 1RIWB 1YP9A 1ANDA 1ZR0A 1AU8A 1OYQA 1BHXF 4A1VA 1D3TB 1C5TA 5GDSH 3LH3A 2Y82A 4XBBA 1XM1A 1KLIH 1Y3UA 3HK6B 3MQKC 3BIUH 1O3FA 3P95A 3E91A 3LKWA 4Y7BA 1TYNA 4O3TA 9LPRA 3FFGA 3LOXA 4ZAEA 3VEQB 1T8LA 5AVDA 5C5NA 1AO5A 2V7QD 1THRH 4ASUD 2BDHA 5C3NA 1FV9A 5LPFA 1BTUA 1TABE 5GWZA 1QFKH 1VCPA 2R2WU 1HAIH 1TNGA 1F5LA 3RXKA 1PPHE 2W5EA 1ZSJA 1CGIE 3ZZ8A 3STJA 1FQ3A 2A7JA 2LELA 1W14U 3TH2H 1XXDA 4IBLH 4AX9H 4U30A 4U01A 2BLQA 3OY6U 5I25A 3Q00A 2KX4A 2QF0A 1O2WA 5KGOA 2O8UA 2ZHQH 1BJUA 5HYOA 5KECA 3DSOA 1MKWK 3A86A 2VVVA 3MYWA 1EPTB 2FO9A 3BEUA 5J4QA 5C94A 4ZHAA 1THSH 3GDVA 4O3UA 2KZ4A 3ZZ3A 2KCYA 3SOSA 2VIVA 4GCHG 1V2JT 1LHCH 1HIAB 3GS9A 4YO9A 3A81A 2XNIA 1FDPA 1C5MD 4U32A 4FUEA 1P9SA 2HLCA 1V2PT 3ATLA 2QF3A 3DA9B 2PGBB 2BDYA 3IITA 5CDFE 4FVBA 1TQ7B 3F68H 3AK5A 2BD4A 1SOZA 4ABAA 2G52A 1IQIA 1O2SA 1MQ6A 1YC0A 2A45B 2JH5D 3U28C 5ETXA 5KEDA 1EPTC 3CP7A 2HVYB 1B0EA 1EJNA 2ANYA 1NRSH 3UUZA 3M5NA 3RXIA 3RXBA 1FZZA 1HAVB 2ZU3A 1ELEE 1P02A 7GCHG 3HGNA 1TLDA 1AB9C 1T8OA 2ZHFH 4X2VA 1P3CA 1NPMA 3SYJA 2R2MB 2FYRA 2BLWA 2C90B 4X6NA 1IQKA 2PGQB 3MH5A 2VH6A 4YXWD 3TK6A 3UAIC 2BQWB 1YPJH 2A5AA 1H8ED 4BTTB 1H8IH 1SLVB 1DFPA 1C5QA 1O5GH 5B6LA 1TRNA 3OX7U 3RXMA 2CMYA 1CHOF 1OP2A 2R3YA 1TBZH 1ELCA 4NIVA 1C5NH 1YPHE 5FL7D 4IMQA 2WHXA 1TA6A 4INLA 1O38A 1GBAA 4E7RG 1H8HD 3JZ2B 1P01A 3SNAA 4CHAB 3P6ZB 1FY1A 4YLUA 2AGGX 1C4U2 1OKXA 1WV7H 1A3EH 1Z1JA 1TMBH 2XBXA 4AG1A 1LQEA 3MU8A 3BG8A 2JDID 4B6EA 1MKXK 2C8XB 2TGPZ 4ASHA 1IHSH 4P00A 1EB1H 2M5TA 2ZDLA 1GHXH 4TSFD 2Y5HA 4MLFB 3T62A 2P3UB 1AGJA 1FONA 1GI6A 1EAUA 4WF8A 3DSGA 1A2CH 1ZMNA 4Y0YE 5A0BA 2RDLA 1K2I1 3M3TA 3SI3H 4I32A 1HDTH 1QRXA 2SGDE 3QGJA 3UTUH 1C5UA 1QJ1B 4K69A 1H9LB 2VU8E 3EYDA 5C5OA 3UY9A 4IW4E 5F8TA 1TX8A 2W7UA 4Y11E 1UK2A 1V2UT 1XUFA 4D7FA 5DP3A 2CN0H 1PYTC 2EI6A 1D3QB 3A7XA 1A0LA 1C5PA 3SV8A 2ZZUH 1LHEH 3UFAA 1GBCA 2BMGB 3M5OA 1QHRB 3PV5A 1EFRD 2ZNKH 5EQQA 1P2NA 4CBOA 3V12A 4Y0ZE 1Y5UT 5F8ZA 4FUJA 5EG4A 2ZWLH 3Q76A 3GCHC 2VBCA 3UREA 4OM9A 1NRPH 4O97A 1H9IE 4CREA 1HXFH 4MG3A 2J2UA 1A4WH 1UMAH 1C4Y2 1TGTA 2NU3E 1EUFA 2G51A 3PB1E 3ZVFA 2SFAA 2WV4A 1D9IA 3RXAA 3GCNA 1FI8A 2L74A 2WPHS 3HGPA 1BBRK 1OWEA 1YPEH 4OS5A 3GY8A 1D3PB 5EW1H 1DPOA 4OS2A 3VB3A 6CHAC 7KMEH 3KYFA 1KLJH 3SU1A 5IDKA 2H5DA 4THNH 4ZCNA 4X0WU 4YM9A 1G37A 3SU4A 1YPMH 1FXYA 1ZHMA 1AWFH 4TWWA 3OYPA 1AN1E 3TGKE 2ZU1A 2VWOA 3LC5A 4Y8ZA 5DKMA 1BMAA 1UTQA 2JJ2D 3BEIB 1WSSH 1SGCA 3VG8A 4K8YA 4MPUA 1G2LA 2K0QA 2FTLE 4I86A 2F4LA 1S0QA 3F6UH 2FM2A 4X6PA 3PMHB 4Q80A 4FETA 2V35A 5JB9S 1O33A 4ABBA 1YCPM 2THFB 5K0HA 1HXEH 3RXLA 1WCZA 2AIPA 3SW2B 4ABDA 2ZFFH 1SLWB 2FI4E 2Z7FE 2J94A 2NU0E 1GHBG 1P2QA 1IQGA 1W0ZU 1LHDH 2FEQH 3RXPA 1VCQA 2XXLA 3T29A 2TPIZ 1ZGIA 1JMOH 2P94A 3SUGA 4D7GA 1SGFG 4H4FA 2QAAA 3OEED 2FOCA 3TJNA 1YCPH 1WUNH 1NRNH 3TJVA 4MNVA 4Y6DA 2YMSC 1A5IA 1A3BH 1SR5C 1ELFA 1BUIA 1N6XA 1C1RA 1J15A 1IQNA 1O2RA 3LU9B 2XWAA 1PFXC 2A5KA 1WYKA 2Q6DA 3GICB 5GPIB 3P8OA 3MO3A 5EJLA 9ESTA 3UR6A 1FIZA 1AWHB 4F4OC 1GVKB 3UB0A 1UJ1A 2STAE 2FIRH 5C2ZA 1MABB 1F2SE 1GMHF 1SFQB 1EX3A 4FXGH 1O2LA 1DSUA 2B0FA 3VXEH 1UTJA 4B75A 2ZDVH 5F03A 3ZIAD 1BOQA 2VIWA 1W11U 1LPGB 2QYIA 4O9VA 1Z8RA 2EQNA 4YOJA 1FX0B 3RXOA 1TNJA 3P17H 2IOTA 3LIWA 2BXUH 1KMHB 1O5FH 1PPCE 5EGMA 3BTGE 1Y8TA 4FUDA 1JIMA 1V2ST 3A7VA 3UOPA 3QGNB 1W13U 3V0XA 4FU8A 1S6LA 1QGFA 2BY6X 3RXHA 1P9UA 1SKYE 3U98H 1TGNA 2ZGCA 3A87A 5FX6A 2BLVA 3FZDA 1V2TT 1YLCA 5ABWA 2FODA 1XX9A 2VGCB 2J5UA 1RTFB 1AVXA 1GCTB 1UCYE 2XWBI 2R0LA 5C17A 1HJAB 2OBOA 4JYVH 2P16A 4BNRA 1NN6A 4BXSA 3BTQE 3NUMA 1D6RA 4DGJA 3RXVA 1QURH 3U69H 2VVUA 4TT3D 3MH7A 1B5GH 2ULLA 1ELVA 3LGVA 3S9CA 1S85A 1T4UH 1WTGH 1Z6EA 2YNBA 2ZFPH 3T2NA 1ZMJA 5JPMH 1WU1A 3F1SB 4RT0A 3H7OA 2Y5FA 4AGJA 1GHVH 4Q7ZA 1IQLA 1GDQA 2Z3EA 2FTMA 5A0CA 1C5OH 1BTZA 1NFWA 1CT0E 1P57B 5EXNA 4KP0A 3IG6B 1XKAC 1O3BA 1J16A 2CGAA 2VGCC 2O8MA 2A2QH 1S83A 1O2JA 4UEHH 1GBIA 5TCAA 1IHTH 4FUIA 4XDEA 4WXVA 1HPGA 2BQ7B 1PPFE 1C4V2 3T25A 1NY22 4I8LA 4MDSA 1HJAC 2KCOA 1YGCH 1JOUB 3D49H 1S6HA 1HUTH 1EAWA 1C1QA 2KFWA 3BF6H 3CNRA 1QCPA 1O2IA 3HPTB 5DJ7A 4B1TA 1MTWA 3LGUA 3M7UA 4BAOB 1BRAA 2O8WA 1C9TA 3GDUA 3RC4A 3OFND 1HAHH 2GT8A 2Z9IA 5C20A 1QJ7B 1XUJA 1ORFA 4K1SA 1AFEH 3SHAH 1O3MA 1H4WA 1L1JA 1P2OA 4GLYA 2SGPE 2QXHA 1GI0A 3TK5A 2JIZD 3P8NA 1TONA 2BD9A 3WWBA 2CXVA 2OUAA 2GMTC 2ZDNA 3RXUA 2STBE 1U6QA 1PYTD 4I31A 1O2VA 3PLKA 4MVNA 2ASUB 4B76A 2OQUA 5F53A 1GJ8B 1GBJA 1CE5A 1ARBA 1ZGVA 1FUJA 1ANEA 3EDXB 4H6TA 4KTUA 1RXPA 4ABFA 1SOTA 3S7HB 3F2FA 4NSVA 3GOVB 1D4PB 4ISIH 1SBWA 3S0NA 2L6OA 1J8AA 3GISB 1LMWB 5FAHA 4Y79A 1HAPH 1UVUH 3MH6A 1CHOG 4BAQB 3NWUA 1A1RA 2NU2E 1NU9A 5EPNA 1L2EA 3H7TA 1ZPZA 1IAUA 1G3DA 2ZU2A 2VINA 3I78A 1O2MA 1YWUA 3B8JA 3QK1A 4FU7A 2BX3A 3AVZA 1A5GH 1LCYA 5IYTA 5JDUB 4ISLA 2P8OC 4OGYA 3UR9A 1ZMLA 4VGCB 1W10U 3RMNH 4YOIA 1ZRBA 3ENSB 1GHWH 1C2HA 3LH1A 1CSOE 2D8WA 4CR5A 5LPRA 4MNXA 1NFXA 1PPZA 2A4GA 5HXFA 3TNSA 3EQ0H 1KTSB 3ZVCA 1OWDA 1Z71A 4ZMAH 2CK3D 1CT2E 2B8OH 5FPTA 3GCTF 3V13A 1XUGA 4NIWA 2GX4A 3MU4A 3RM0H 3ZVAA 1MH0A 1C1OA 1QA0A 1GG6B 1NRQH 4FUHA 3BTWE 1NM6A 4KTSA 1BCUH 1SGTA 2BXTH 4GUXA 2KR7A 2UUYA 4K5ZA 1C2EA 1YLDA 2ILNA 5EODA 1KXCA 3BG4B 1S0RA 2EI8A 1S5SA 1S82A 4M9FA 3URCA 3M36A 1K21H 2IJOB 1GCDA 1MCVA 1W12U 2ZFTA 1TMTH 3LJOA 1UTMA 1N8OB 2QCYA 4Y76A 1JBUH 1O2PA 1TBQH 3F9EA 3U8OH 2G8TA 2C8YB 4ABHA 1V2OT 1C5XB 2VH0A 4XOJA 4DIIH 4OS6A 2FI3E 1GMDF 3NPSA 1GBKA 3RP2A 3AW0A 1NBMD 1DDJA 4K1EA 5HIYA 1BMFD 3BTME 1GG6C 1KXAA 2ZQ1A 3SNDA 2QV1A 3W1EA 4E05H 3KN2A 5JB8S 1GPZA 4NA9H 2BDIA 3L3TA 5C0TA 1YYY1 3UPEA 2OCVB 1DT2A 1C2JA 1ZPCA 1P06A 3BG4C 6ESTA 3CENA 1C1WH 2FZZA 2AERH 4X1NU 1F5KU 4UFFH 4DT7B 1E79D 3KCGH 4GHQA 2A4OA 5E8EH 3ZV8A 1UCYH 1GI7B 1O3HA 1RJXB 2LNCA 1EXFA 4E7NA 1GGDC 2ZCLP 2EC9H 2H2ZA 5A8ZA 1GI9B 4LXBH 1VITF 4JCNA 3E6PH 3HKJB 1FY3A 4A92A 4Z0KA 1QZ8A 4DURA 4D9QA 1CQQA 2C8WB 3RC6A 1W0JD 2BOKA 4UDWH 1KLTA 2FLRH 4ZKNU 2G4TA 5JBCS 2ZFQH 4K60A 1MD7A 5JBBS 5T6GA 1FNIA 2CF9H 1WDIA 2BTCE 2XBYA 5AFZH 1QB1A 3VFEA 5DG6A 2ZGHA 4X8UH 1BMMH 1P2KA 1DY9A 1P10A 4K2YA 1P2MA 1K1PA 2F9VA 4GVUA 1DWCH 1COWD 4YLQH 3RU4T 3SGAE 2IPQX 3KYGA 4E06H 5IK2D 3KIDU 5DGJA 4X1SU 4Y8YA 3K6ZA 2JETC 3LGYA 4I8HA 2ZHEH 1PQ7A 1V3XA 2TIOA 1O2ZA 2PWXA 2ZHDA 2XW9A 3EA8A 3PMAB 2PKSC 1TGSZ 1CGHA 1GJAB 1O3KA 3RLYH 1UTPA 1LTOA 1RTKA 2G00A 3ATWA 3OTJE 5EQSA 1XVMA 4AFUA 1AB9B 1EZQA 1O3GA 1A46H 4NA8A 1ELTA 2IPHA 3MU0A 1EJMA 1EP6A 2LPRA 4X1RU 3SUFA 1UW7A 4I8KA 2FXRA 1QL7A 4XE4A 1OP0A 4IN1A 1H1BA 1GMHG 4P02A 1AIXH 1C2DA 1E34B 1QRWA 3MO6A 3HK3B 1ANBA 3TIUA 3TPIZ 1ZSLA 1UVSH 1IQHA 4TY6A 4YT6H 1EZUC 1C5RA 1GWAA 4AFZA 4MQAA 1AUJA 1QIXB 3OY5U 2K8IA 4BAKB 1AFQC 2J38A 1MMJN 1AVWA 1OPHB 1SSXA 4X8TH 1MUEB 5HM2A 3AW1A 3SUEA 1WQSA 3KQDA 3QZQA 1E37B 1SMFE 2WPDD 1YCPK 1DXPA 2H5CA 2HWLB 2RA3A 4U2WA 3BTTE 2ZTZA 1AKSB 2ZGJA 3U1IB 3R0FA 5A8YA 2HPPH 1SGYE 3M3VA 2AMPA 5HMAA 5FCKA 2AGEX 1V2QT 1DICA 1YBWA 3ZZCA 5TCCA 1XMNB 3NKKA 1VR1H 1GI3A 3M61U 2GTBA 4IS5A 4ESTE 5GJ4B 4A6LA 4K8BA 2SNVA 4WY3A 1AE8H 1OSSA 3A7WA 1HGTH 2UWLA 3TJUA 1GI2A 5I46H 1YM0A 3D65E 3D62A 1GI5A
chains in the Genus database with same CATH topology
5DP6A 2I6SA 3SNCA 4NZQA 1GMCF 1ETSH 1W7XH 2HPQH 3KHVA 1FY8E 2A7HA 3A82A 4Q7YA 1HAOH 4WJG2 1JIRA 4NZLA 1QA7A 4LZ1H 3KGPA 3SZNA 1BMLA 4X8SH 1VCWA 2UUKB 2BDAA 2DE9A 8GCHG 1O35A 1T31A 1K28D 3GCHB 2ZI2H 3FP7E 3GCOA 1O3EA 3MI4A 1AQ7A 1C1VH 2BM2A 1TE0A 2VB0A 1TNLA 1LKBA 1SC8U 5SGAE 1KXFA 1LVOA 2DE8A 3BTKE 5GCHF 3RLWH 2C3SA 1QB6A 2PUQH 1EOLA 2BY9X 2FI5E 3MO9A 4AB8A 3KF2A 5EU8A 2AS9A 1MZAA 4DCDA 5DP5A 3T5FH 5FBEA 5LPEA 5JYIA 4A1TA 2FYQA 6CHAB 1SGIB 5DP7A 3QO6A 7LPRA 1S81A 1BBRE 4SGBE 4ZKSU 4A5TS 1LVMA 2ZC9H 3UNRA 3WY8A 1YPLH 1RTLA 1DX5M 1GL1A 3QTVH 3EAJA 1CBWC 1QL9A 3B23B 5DPAA 2XC4A 4JMYA 4OS1A 4X1PU 1FLEE 2ZDMA 3A7TA 1K22H 1ZLRA 3SU0A 2ALVA 1V2VT 1INCA 2Y7XA 1B7XB 3TK9A 2CJIA 3ZZBA 1EPTA 2GVFA 2Z9GA 1ZPBA 1SLXB 2FX6A 2ZGBH 3E16B 1ZOMA 2ANKH 4NFFA 4OS7A 1OOKB 1HIAA 1IQJA 3A8BA 4MPXA 1C2LA 3CS7A 1YF4A 1TRYA 2QIQA 1ELGA 2F83A 3RXQA 2TBSA 1TPAE 3RXEA 2ZA5A 1TX7A 3QWCH 2FOBA 2OC1A 1P05A 3AAUA 3GY6A 2UWOA 3MU1A 4Q7XA 3QX5H 4XBCA 2XCNA 3MNSA 4F49A 1OXGA 4ABEA 1JRSA 3FANA 8ESTE 3FVFB 1ZTKA 2BD7A 5CHAB 1TMUH 1HAVA 4ZXYH 1GHYH 2C8ZB 4DOQA 2V0BA 4ZHMU 1WAYB 3EGKH 3SORA 1O3NA 3A7YA 1O3JA 3GCTG 3N7OA 2PUXB 1PPBH 1J14A 4JZFH 5DK1A 5AHGH 1MBMA 1TBRH 2WYJA 5HGGA 3T27A 3KQBA 4AYYB 4D8NA 1HAZB 2ZTXA 4ABJA 1QB9A 2P3FH 2A31A 3A7ZA 3T28A 2GZ9A 1WTHD 3PTBA 1C1SA 1V2WT 2TGTA 1C5LH 2VWNA 5CHAC 2VJ1A 2XRCA 2Y7ZA 2CV3A 4NWKA 4YZUA 3DT0H 1O3DA 5EPYA 1ZHRA 1GMDG 1HB0B 1BDAA 2PR3A 3SO3A 1RFNA 1TQ0B 2WV5A 2W7SA 1FN6A 5C1UA 1BMNH 2GDEH 3GY5A 1HAXB 2ZU5A 1V2NT 4ZHLU 1BTXA 1P12E 3LPRA 5AFYH 1TRMA 1L1NA 2TGDA 1DOJA 5FCRA 2VIOA 3RXFA 3E0PB 3PYHA 3LGTA 4WWYA 2AIQA 1BTWA 2BY8X 1T8MA 3S9BA 3TVJB 2GDDA 2BVRH 3EA9A 1MKXH 2G5VA 3KNXA 2UUJB 4X2YA 1LKAA 3V3MA 2RA0A 2G55A 1VITG 1IOEA 3D23A 2BY5X 3ZZ7A 1GBDA 1O0DH 1RS0A 1TNIA 2OBQA 2OINA 2FOAA 4R0IA 1G9IE 3SV6A 1P8VC 1PQ5A 1O31A 5ESTE 4WVPE 1GJCB 1AD8H 3SU5A 2A32A 1DUAA 4ABGA 4TY7A 3HATH 1V2KT 4K3JA 3QUMP 1EB2A 2QXGA 3RXDA 1LPKB 1DANH 1IQMA 4IC6A 1DE7H 3SHCH 1BTPA 2G81E 1BTHH 4AYVB 3MNBA 2PW8H 1C2GA 3TITA 4UFGH 1A0JA 1FAKH 3TJOA 1CVWH 4LZ4B 1ID5H 8GCHF 1SGDE 3QDZB 1KDQB 4AFQA 2OC7A 2B5TB 1OWJA 3LONA 2AMDA 2H6MA 3GDSA 2GMTB 1C2KA 2OD3B 2GT7A 1O2YA 2ZPSA 3Q77A 4WMDA 2FS9A 1THPB 4Y71A 1QBVH 1TALA 3F9FA 2V6NA 2A4QA 2HALA 2F3CE 1GJ7B 4IN2A 4NA7A 1BBRH 1V2LT 2VIPA 3SQEE 2TGAA 2GCHF 1GBFA 4J1YA 3SV2H 4CH2B 1LPZB 1HLTH 3PROA 4GHTA 2GP9B 1GHAF 2BD8A 3K2UA 3RMOH 1LHFH 5E2OA 1V2RT 2PV9B 2A4RA 1GI1A 4QT8C 1G2MA 3EE0B 1KXBA 1FPCH 4BAMB 4ZH8A 2O9QA 4B71A 1AVGH 1SGPE 3ATIA 1CGJE 1TGBA 3LJJA 4RKOB 1DS2E 3ZVGA 1DM4B 2W3IA 4I7YH 7ESTE 4JZEH 4FVDA 2VIDA 4OGXA 2BDGA 3F9HA 4K1TA 4AOQA 4B2AA 1NFUA 1M9UA 2SGFE 1YKTA 2P8OB 3SBKA 3FZZA 1XUHA 2F9NA 1E35B 2PHBA 1DLKB 2R3UA 4CRDA 1SGRE 4R8TB 1GI8B 3PO1C 1Y5AT 3SN8A 1GJ5H 1ETRH 2H9EH 1N6YA 4AN7A 1CO7E 2TRMA 1W0YH 3PLPA 1VJ9U 2Z94A 4H6SB 2CF8H 1UVTH 2G5NA 1SGQE 3MTYA 4IMZA 1MU8B 1AUTC 1OWIA 1C5ZB 1GMCG 2EA3A 4BAHB 2GZ8A 3U9AH 3SJKA 3CS0A 1DXWA 3S7KB 1D3DB 3RXSA 4O03A 1HCGA 1EJAA 3A84A 1UO6A 2FDAA 5A8XA 3PLBA 8LPRA 3B9FH 3SV9A 4JYTA 3VB5A 2K1QA 3SJOA 2R9PA 1BA8B 2ZDKA 5EXLA 1ZYOA 1GHZA 5C1YA 1E36B 4ABIA 4X6MA 1IQFA 1P04A 1ABJH 4HFPB 2BLOA 1HAGE 1E0FD 2OXSA 5C1XA 1GBEA 2QA9E 2CHAB 3ZZAA 1SHYA 1P09A 2QXIA 2F9UA 4RN6A 5GCHG 3EA7A 5FBIA 4X2WA 1O3IA 3GY7A 3I77A 4CBNA 4ZKOU 1Y3XA 4CRAA 1ELDE 4WH8A 3LC3A 5A0AE 1EAIA 1UTOA 1O2TA 5E2PA 2ZCKP 4INHA 2ANWA 3W95A 4CRBA 6LPRA 2JKHA 1AHTH 4GAWA 4IC5A 5PTPA 3PMBB 4XBDA 1GGDB 1UVOA 1QJ6B 1MTUA 1Z7KA 1NRRH 1QRZA 2V3OH 3SQHE 3O8CA 1CA0B 4UONA 5AF9H 2FPZA 2R0KA 5L30H 2XBWA 1QQ4A 2PSXA 2FOFA 1X7AC 2FWWA 3TH3H 2CHAC 4UFEH 1Q2WA 3A88A 1KDQA 4DG4A 1HJ9A 2VWLA 1TX6A 1OWKA 3RDZA 1L0ZA 1DWBH 1OX1A 1Y3YA 3T26A 3GY4A 2BD3A 4Y7AA 1TPOA 4I8GA 3QN7A 2B7DH 2PTNA 5E0HA 1GVZA 1P03A 2WPMS 4FUCA 4SGAE 1K1LA 1DWDH 5K7RA 1SFIA 1O2GH 3NCLA 1HYLA 2ZDAH 2J4IA 2ESTE 1CA0C 4GPGA 2JETB 3SJ9A 2GD4B 3ZZ9A 2ZHWH 3L6PA 3W94A 1C2FA 1ZTLA 3SGQE 1SVPA 1MTNB 5BPEA 1G3BA 4J2YB 2PKSB 1SGFA 1MAYA 3RMLH 3ZVBA 3LGWA 5F6MA 2AEIH 3NXPA 4YESB 1BRUP 2J9NA 2KAIB 3S9AA 4BTIB 2VNTA 3QLPH 1DLEA 2JH0D 4AG2A 5FPSA 3NK8A 3H5CB 3SUDA 2AMQA 1GDNA 1O2XA 2VWMA 1G36A 2Z6BD 1ESTA 1YPGH 3SV7A 4Y8XA 1GVLA 2A7CA 1K1NA 1NC6A 3LT3A 1AFQB 4YTAA 1NROH 2FMJA 3UNQA 3DD2H 2NWNA 1MTNC 1F5RA 2SGQE 2XC0A 1C1UH 1TOCB 2BB4A 3TLOA 2JH6D 1LQDB 3SNEA 1C2IA 1RIWC 4D76A 1B0FA 1O3PB 2AH4X 3MU5A 1D6WA 3R3GB 1O5BB 4KELA 3RMMH 3VB6A 1EKBB 5EQRA 1MTSA 1OP8A 1SGNE 1UK3A 2HRVA 2C93B 4NIXA 3ZZ6A 4BANB 4FU9A 3VB7A 5DP4A 2BD2A 5JBTA 3K9XB 1MU6B 3GYMA 3FAOA 1TPSA 1EATA 4CRGA 2HGTH 5FX5A 2Z9JA 5DP9A 1O5EH 1CT4E 1SL3A 2UUFB 2ZIQH 2P59A 3L33A 5LH8A 1Z8GA 1ARCA 4D9RA 8KME2 4M7GA 4ZROA 1TA2A 1PPEE 1NT1A 1QL8A 1L1GA 4NIYA 3M7TA 5EXMA 3MNXA 1RD3B 1GJ6A 2BZAA 1JRTA 2Y6TA 2ODYB 2WPJS 1ZTJA 1NU7B 2ZGXH 2BDCA 4NSYA 4X8VH 5J4SA 2J95A 4INKA 2Q1JA 1MZDA 1EOJA 1SPJA 5H4IB 3STIA 1GI4A 4X2XA 1GBLA 1NO9H 3PMJA 4BXWA 4JK5A 5G4BA 4WXIA 2YNAA 2IN2A 4ZUHA 4Z6AH 2A0QB 2ZEBA 1XKBC 2EEKA 4B74A 3AASA 1ELBA 2ZPQA 4H42U 1VITH 1F0RA 3O8BA 2Q6FA 2XC5A 3PTNA 2GV6A 1P2IA 1O2UA 6GCHF 2ALPA 2FOEA 5EOKA 1ZRKA 3C27B 5A2MH 2W26A 4CH8B 3Q3XA 1UVPA 1TNHA 3A80A 3SJIA 5F8XA 2XTTB 2V3HH 1AZZA 3ZYEA 2O8TA 4UE7H 2XCFA 3DFLA 1HAYB 4FUGA 1CBWB 1ELAA 1JXPA 4OS4A 5DP8A 1KIGH 1NESE 1P3EA 1QR3E 3AAVA 1ACBE 1H9HE 2FOGA 3SNBA 3ZV9A 4UFDH 1ZZZA 3U1JB 2ZP0H 1AI8H 4LOYH 1HFDA 2GGVB 1C1NA 3C1KA 1QTFA 1O30A 1MQ5A 3RUOA 1K1MA 2Y81A 2ZCHP 2GCHG 5ESBA 4ISOA 1K1OA 3RU4D 1J17T 3ELAH 2OP9A 4GSOA 1XVOA 1Z1IA 1GHAG 5T6DA 1ZJKA 4HI3A 4CHAC 4DY7B 1KXEA 1YPHC 1ANCA 3M5MA 1CU1A 2D1JA 3A85A 1EZXC 1EAXA 1WQVH 1ZHPA 5JBAS 2KAIA 1P2JA 1K1JA 1Y3VA 4LK4A 4NWLA 2Z3DA 1A5HA 1ETTH 1XUIA 2NU1E 1O2QA 3PWBA 2BQ6B 1FPHH 1O5CB 3M3SA 1O3OA 4DVAU 1GBHA 1F92A 5E0JA 1EASA 1O39A 2RCEA 2WUCA 4DW2U 1BRBE 1T7CA 4ZXXH 2GZ7A 3KEEA 2H9TH 2PKAB 4UD9H 4NGAH 5E0GA 2GV7A 4X1QU 4WMEA 1FY4A 3RXJA 4I33A 3A83A 4AB9A 3PWCA 2BOHB 1SLUB 3BV9B 2QXJA 1P11E 2NU4E 1TB6H 1GBTA 1SHHB 2Z9LA 3BSQA 4NG9H 1ZSKA 1C2MA 5L2YH 1C1MA 3ZVEA 1NS3A 1PJPA 1XUKA 4B2BA 2F9BH 1V6DA 2OC8A 2D26C 3BTDE 3TU7H 1MKWH 2YOLA 2Z3CA 3PM3A 4CRFA 1AE5A 1XXFA 2PLXA 1FIWA 4RKJB 4Y10E 1DUEA 3ESTA 2B9LA 1DWEH 3A8AA 1BQYA 2O8LA 2FP7B 1G32B 2W3KA 1UTNA 3VB4A 1TFXA 5CE1A 1GJ9B 3P70B 1QNJA 1AKSA 3UWIA 1QBOA 1F0SA 3BIVH 4NFEA 3ATMA 4XFQA 3DHKH 1ZJDA 1TNKA 1GBBA 1TAWA 1Y3WA 3G01A 3GYLB 3SU3A 4DJZB 1ESAA 3O8RA 1SG8B 4JZDH 3KQCA 4CRCA 3P8FA 4KGAA 1OYTH 3JZ1B 5FXLA 3FP8E 5BRRE 1QQUA 3UIRA 4KTCA 2Y80A 3BTFE 1FY5A 1WBGB 4AGKA 3ZVDA 3VXFH 2P3TB 3A89A 2WUBA 1KTTB 5GIBA 1KSNA 1Y59T 3QZRA 4X6OA 2BVSH 3ITIA 2BVXH 4GCHF 2H1UA 1T4VH 2OTVA 1SQAA 2C4FH 2AFQB 3RXTA 1O2OA 2OQ5A 3GY3A 1TWXB 4AORA 2BX4A 3A8DA 4XSKU 1TIOA 3SJ8A 3BTHE 4YT7H 3ZYDA 1TPPA 4NCYA 1DY8A 1HV7A 2BZ6H 2SGAA 3UQVA 3BN9A 4TYDA 4AZ2B 1P0SH 1F7ZA 1K1IA 4MTBA 1TGCA 1VZQH 4JYUH 1WOFA 1QY6A 1J9CH 3QTOH 1LDTT 1O34A 3E90B 4ISHH 4DIHH 3E0NB 2ZFSA 1F0UA 7GCHF 2GKVE 4RSPA 1GDUA 1NTPA 2WPLS 4MPVA 1CA8B 1GJBB 3MH4A 1OS8A 1FAXA 1GJ4H 1GL0E 3E8LA 5T3HA 1W8BH 1BT7A 3Q3YA 2FOHA 1MCTA 1GBMA 4AFSA 1L4DA 1CHGA 2PSYA 3UNSA 1BB0B 1UHBB 1MBQA 2A5IA 1Q31A 2ZG0H 2ZKSA 1W3CA 2XYAA 3P92A 2PKAA 1MD8A 3E3TA 2HNTE 3ZZ5A 3UQOA 1GJDB 4ISNA 3ATKA 1OWHA 3SI4H 2BY7X 5TJXA 4TPIZ 1UCYK 1Z6JH 4A7IB 4B2CA 1UK4A 1BTYA 1PQAA 1FN8A 1JWTA 3DFJA 2P95A 3SGBE 1O2KA 1GCTC 1LVBA 2SNWA 4FUFA 2QN5T 1RGQA 4JZ1A 3M37A 4TPYA 3IWMA 3K6YA 3ODDA 1EP5A 1BJVA 3PO1B 1G3EA 3TNTA 4BTUB 2QY0B 5LGOA 3RXGA 2D2DA 1HNEE 1PPGE 3RC5A 1FJSA 1VJAU 1O3CA 2F9PA 3MMGA 1SB1H 1DSTA 2BYAX 1ESBA 1G30B 2HNTC 5FPYA 1Z8IB 1UTKA 1SQTA 5T6FA 2BD5A 1SGEE 3M35A 1Y5BT 1O5AB 5CMXH 2EI7A 5L2ZH 3RU4E 1C5YB 2A1DB 3DUXH 3TGJE 3OU0A 2DUCA 2ZQ2A 4Q2KA 3U8RH 4I8JA 3P8GA 1T32A 3PV4A 2ANMH 4JK6A 4HZHA 4BOHA 3S69A 2ZECA 1S84A 1O3AA 2HOBA 2F9OA 1O5DH 3HKIB 1EQ9A 4KKDA 4HTCH 2WPIS 3E1XB 4WH6A 3OSYA 5L6NH 1L4ZA 2RG3A 1IQEA 2SGEE 3TGIE 2HNTF 4WMFA 1F0TA 3RXCA 1HBTH 1V2MT 2ODQA 1DITH 4JZIA