1GCDA

Refined crystal structure of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
237
Chain Sequence
b'CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-CHYMOTRYPSIN
publication title Refined crystal structures of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(serine proteinase)
total genus 50
structure length 237
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1994-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA01
1A2CH 1XKBC 4I8GA 3F68H 2BVXH 1PPFE 4IN1A 4Y11E 1PFXC 3NCLA 3RXMA 3M3SA 3GOVB 1AFEH 3ZZ8A 1IHTH 4INLA 2VIPA 2RDLA 2J38A 3RP2A 2DUCA 1S82A 3SI3H 2QXIA 1Q2WA 1ZSLA 4MNWA 2A7CA 3C1KA 2G5VA 5T6GA 5JB8S 1BTYA 3RXTA 2ZU4A 8KME2 4B74A 4CRGA 2XBYA 1UO6A 2ZEBA 1TRNA 3SZNA 1GVLA 1C1UH 1SQAA 2JH5D 1XUFA 2VB0A 5CHAB 1GJ6A 1P05A 3M37A 4Q2KA 4J1YA 1O3OA 1QIXB 1Y3XA 3GY2A 3L3TA 3MU5A 1JXPA 4GVUA 3LGYA 4LZ1H 3NPSA 4CHAB 2G4UA 1N8OC 1GBCA 2Y7XA 4BAKB 1QBOA 3PMJA 1XM1A 2FYQA 3TIUA 3A87A 1G9IE 1UHBA 4Y0ZE 2OCVB 4IS5A 4YOGA 1IOEA 1V2QT 2GVFA 2SGEE 1N1LA 2FOEA 7KMEH 2FOCA 1LO6A 2J34A 1MBQA 1SHHB 4LK4A 1QL8A 2ZDAH 2QA9E 1CVWH 2BQ6B 1ANBA 4E06H 4INHA 1O34A 1T8NA 1F5KU 1AZ8A 1YF4A 4Y0YE 4LOYH 3PO1C 4NWLA 3KQCA 2EI7A 1BJUA 2PWXA 1FDPA 2OC1A 2GV7A 1EZQA 3RXPA 2Y81A 1C2DA 5K7RA 1W7GH 3A7TA 3BTME 2ZHQH 4Y8YA 1GHXH 2Q6GA 3SHCH 4K8YA 1ZMNA 4B75A 5JBBS 5FX6A 1TB6H 1YM0A 3M5LA 1HLTH 1GDQA 1RIWC 1T8OA 1GBMA 1C4Y2 5DP8A 3TK6A 4FUDA 2BZ6H 2HGTH 4KELA 3TPIZ 1G3CA 1DWCH 3FAOA 3ODDA 5AHGH 1G36A 3EA8A 3TGKE 2OLGA 1O2HA 3VGCC 2PKSB 1OWKA 1O2OA 2OUAA 2Y5FA 3P6ZB 3PV4A 3MU4A 3UWIA 2CHAB 3BTWE 1XMNB 1YYY1 2F9NA 3UNQA 3MH4A 4I8LA 1S84A 2VWLA 2ZF0H 5E2OA 1EZSC 2TGAA 2VWNA 3P8NA 4JK6A 1DWEH 3MNCA 1UVUH 1F0RA 2FS9A 2BDHA 1H8DH 5GWZA 3FP8E 1V2TT 3T28A 2WPMS 1S0QA 1SGIB 1OYQA 1QR3E 1W14U 1P9UA 2VWOA 3SU5A 3RLYH 3QLPH 2ESTE 1V2ST 2HPQH 4FVBA 3AAUA 4NFEA 3TH3H 1BTUA 4MTBA 2FESH 4ABAA 2RCEA 1FAKH 1BDAA 4NIYA 2W3IA 2XNIA 1IHSH 3BTHE 2ZNKH 1HXEH 1H1BA 3I29A 2TGTA 1V2VT 4IW4E 3MHWU 2ZFFH 1X7AC 3GCHB 4GHTA 2XC4A 1C5MD 2QN5T 1HJAC 2QV1A 1O33A 1TGTA 1QA0A 1VITF 1XX9A 3Q00A 4CR5A 4ZXXH 2FO9A 2BLQA 2P95A 2ZTYA 3TJOA 1QJ6B 2WUBA 3ZVFA 2BDYA 3FFGA 3OSYA 4AZ2B 4NFFA 1SLXB 2F9PA 1Y5BT 3A7XA 1MTNB 1QB6A 1SBWA 1C1SA 4AX9H 1VCPA 1TBQH 1GGDB 1THPB 1S6HA 3SNDA 4BAMB 1INCA 2O8WA 1JIRA 1ZOMA 1DM4B 2ZFRH 4AB9A 4OS1A 1ELEE 3V3MA 2QAAA 3VB7A 3BEFB 4FUIA 1WCZA 2H5DA 3GISB 1HAOH 2ZDKA 1HPGA 1JBUH 5JBAS 3PTNA 3MOCA 3UQVA 4E7NA 2AIPA 5A8YA 4NG9H 1O3CA 2ZGJA 5LPEA 1DWDH 4OGYA 1ABJH 3LC3A 3SGAE 3M7QA 1ZSJA 4UONA 1FY8E 5DP7A 4Y6DA 1DPOA 1ZR0A 2VIWA 1FIWA 2AEIH 1CQQA 1C5PA 2JH0D 3I78A 1O2VA 5EODA 2TBSA 2ZO3H 1QRXA 1P3EA 2DE9A 1QFKH 5EQRA 1C2MA 1UHBB 3RC5A 4H42U 2GCHF 1ZPZA 4XSKU 2C8YB 2J94A 1QQUA 4LXBH 1H9LB 1BRAA 1N8OB 4WMFA 1ELDE 4D9RA 1IQMA 2OTVA 3KQBA 1THSH 4NWKA 4AFZA 1G30B 3A8CA 1KXCA 2C8ZB 1GJCB 4DW2U 2AIQA 2GZ8A 2ZCKP 1NU9A 4BAQB 1Z1IA 1RJXB 1SGCA 2Q6FA 4OS5A 3ZZ7A 3BTDE 3T27A 2STBE 4A5TS 1FN6A 4K1TA 4R0IA 4LZ4B 1C2LA 1LCYA 4AFSA 1T4VH 4E7RG 1GHAF 2YNBA 4K8BA 2GT7A 2CJIA 3SU0A 1O3PB 3U8OH 1YPHE 2D1JA 3ZVCA 5C1XA 1BZXE 1O3KA 1Z71A 3GY5A 1DVAH 1P06A 1P2KA 2IPHA 2W26A 3PO1B 1LPZB 1G3EA 1YPHC 1W7XH 1GJAB 2SGDE 4HZHA 2ZDMA 1LHFH 4FXGH 3U1JB 1GHBF 2FMJA 3M61U 1FV9A 4AN7A 2VVCA 1U6QA 1GI3A 2BOHB 2VIQA 2ZQ1A 1EJAA 1O5DH 1XVMA 3GICB 5BPEA 3ZYDA 4ABHA 4MPWA 1KYNA 1QL9A 2ANWA 1NM6A 2CN0H 3SO3A 1FIZA 1RIWB 2TIOA 1BT7A 1GI6A 1T31A 3RXEA 1D3QB 1RRKA 1L1GA 5AFZH 3VGCB 1GBEA 1C5VA 1XXDA 2A4QA 2WUCA 2ZQ2A 5DK1A 1WUNH 2F9VA 1A61H 2FWWA 2ODQA 1ZPBA 4ZHAA 1C5NH 1YP9A 3ATMA 3PWCA 4I33A 5HXFA 1GI0A 1CBWC 3QO6A 1EXFA 3PROA 1OWIA 3EA7A 1ELCA 4DCDA 3LT3A 3QTVH 5ESBA 1HAVA 5EQQA 1LHEH 1C5TA 1D9IA 3RMOH 2DE8A 1C5XB 1GHVH 3GDSA 4MG3A 1ELFA 1N6XA 4BOHA 2I6QA 5E0HA 2V6NA 2BXTH 5T3HA 3W94A 1ID5H 3PMBB 4CRAA 2P3FH 2R9PA 4ZKSU 5EPYA 2XBXA 3T25A 1ZMLA 2BX3A 1T8LA 1EQ9A 1UJ1A 1E35B 1NT1A 2XC0A 1LTOA 1HJAB 1YPMH 2FTLE 5EG4A 5A0BA 2HNTC 1Z7KA 2ZU2A 4CH2B 2FP7B 1C5WB 1QQ4A 1TONA 4YT7H 1O5BB 2Z9GA 5H4IB 3RXBA 1P12E 2Z3CA 1DSUA 3S7KB 2LNCA 1RD3B 1SGEE 3D62A 3MI4A 3SUDA 1TGCA 3SUEA 3RXUA 2HRVA 1K1MA 4TY6A 5C1YA 2Z9LA 1TAWA 1THRH 1BMMH 5EW2H 1ZJKA 3F9GA 4ZKRU 1Y3YA 2WPKS 3C27B 1P01A 5A0AE 2FM2A 1P2MA 1O3GA 4SGAE 3A8DA 1BTHH 4UDWH 5C2ZA 3UUZA 2GDDA 2PKAA 1BBRH 1O5EH 2ZA5A 1EATA 4I8HA 1O2WA 5I25A 1FAXA 4CRBA 1FI8A 3A7YA 1J14A 1UVTH 2CGAA 2P3UB 3CS7A 4THNH 1NTPA 1P2IA 5CMXH 3R3GB 4BXWA 3TVJB 1QBVH 3VB5A 2QXHA 1SFQB 1RFNA 1ZYOA 2P93A 2SNVA 1ESAA 2OC7A 2QXGA 3MO6A 5FAHA 3OYPA 1LPKB 3E0NB 4Q7ZA 1GMCF 1BITA 1C5QA 4AG1A 2SGPE 1NU7B 1D3PB 2CF9H 5EXMA 2PR3A 3EYDA 1SGPE 1FZZA 1L0ZA 1TALA 2UUKB 1AQ7A 1O2JA 3F9FA 2NU2E 2VGCC 1TBZH 1BBRK 3P8OA 2VIDA 2ZFSA 1O3DA 4XFQA 5L6NH 4UFDH 3DD2H 4Y10E 2H5CA 1ZTLA 4BTIB 1O3LA 3SGQE 3KL6A 4WF8A 4ZAEA 5DP9A 4HI3A 2ZHWH 3ZVEA 1QBNA 1F5LA 1OYTH 2OBQA 2ZU5A 3DUXH 1Y59T 3HGNA 1TMTH 3KIDU 4ISIH 3B8JA 2AMQA 1PPBH 2C8WB 3VXFH 1F7ZA 5LH8A 1MMJN 7GCHG 1TNHA 1GDUA 1GMDF 2ZHDA 1O5FH 3UPEA 1MQ6A 4ASHA 5JDUB 2Z9IA 1C2IA 2FOAA 4JZDH 1TOCB 1O3EA 1O2PA 1NFXA 1O3NA 3OU0A 5LPFA 1UK2A 1NS3A 3E90B 4BNRA 1G2LA 4A7IB 1DDJA 4WXIA 3BSQA 1A4WH 3PLBA 2J95A 2ZKSA 1ZRKA 1KXAA 1QY6A 3KEEA 3D23A 1O3JA 3RXLA 3LGWA 1QRZA 2D8WA 4DURA 1FJSA 2WINI 2FOBA 2J9NA 2FDAA 3BTFE 3PTBA 1DUAA 2BY9X 2AS9A 1ZRBA 1SVPA 2WPIS 3NUMA 1SSXA 1OWJA 1KXDA 4X1QU 2ZPRA 3LDXH 3SU3A 1O3AA 1ANCA 1C5RA 3KQDA 1BTWA 3PLPA 1V2UT 3HKIB 2ZFTA 1C1RA 1QGFA 3A88A 1CBWB 4NA7A 1C2EA 2R0LA 1VZQH 1EAWA 1TGNA 1ARCA 1FONA 2JETC 4BANB 3DFJA 4FUFA 3BTKE 1MTUA 1SGNE 1ZGVA 1YLCA 3V13A 1TABE 1A0LA 2G51A 3RU4E 1SGYE 1BHXB 1ELAA 4ZHMU 2ZWLH 5TCCA 6GCHG 1V6DA 2GZ7A 2P8OC 2GGVB 1AD8H 4F4OC 4NZLA 3BTTE 5EOKA 4AORA 2IN2A 4IC6A 2SFAA 1ZHMA 4FUGA 1VJ9U 2PV9B 1EB2A 3RXOA 2AERH 3M7UA 1KXBA 1TGBA 4WH8A 4WY3A 3MNXA 3PLKA 3MMGA 2GX4A 3RM2H 5J4QA 1C1WH 2LPRA 3BG4C 1SQTA 1C1PA 4A92A 1C5LH 1P0SH 1LDTT 1V2PT 1TPOA 2ZGXH 8ESTE 3O8DA 4IC5A 1F2SE 1DICA 2R2MB 6CHAC 5B6OA 4CBNA 1GMHG 1P2JA 4YESB 3SU6A 1FY3A 4X0WU 1O2TA 2PKAB 3M5OA 5FPSA 1ELTA 1IQFA 1ANDA 1SR5C 4JZFH 1NPMA 2RA0A 3S69A 5E8EH 3MU0A 3V7TA 1JIMA 1JOUB 2VH6A 5JYIA 4FUEA 3A80A 1SL3A 2QF0A 4ABEA 4D76A 3MO3A 3A85A 1SGTA 4DVAU 1YPLH 3ATLA 3E3TA 1DANH 3SORA 2F83A 3JZ2B 1FUJA 3TNSA 4KTSA 1Y8TA 1G32B 1HV7A 1ACBE 2PUXB 4O3TA 1ETSH 4AFUA 2XYAA 2KAIA 2OC8A 1ZTKA 4IMZA 4RSPA 1GVKB 1AMHA 1CHOF 4YOIA 1ZTJA 1GBLA 1DY8A 2A2QH 3NZIA 1FY5A 1BMNH 2XRCA 3LGTA 1HAXB 2BVRH 2Z7FE 3MU1A 1AB9C 4JZ1A 4CH8B 5F03A 2UWPA 1GCTC 1GBKA 1GI1A 2C3SA 4ABJA 4AGJA 2AFQB 1JWTA 2FX4A 2VGCB 3LIWA 3V0XA 1Y3UA 2EA3A 4OS6A 1EP6A 1Z6EA 5LPRA 1ZHRA 1E36B 4GHQA 1D3TB 1O2YA 3KF2A 3TNTA 1UTKA 1VITH 1QB9A 3P8FA 1O2IA 2Y6TA 1TA2A 1FMGA 1OX1A 4QT8C 4ZROA 5DG6A 2EC9H 4FUHA 1ZHPA 1IQIA 2GDEH 3RXJA 5HMAA 2FOHA 3ZVDA 1P11E 3H5CB 4YT6H 1UK3A 1C5ZB 1W12U 4YM9A 4MDSA 3QWCH 1TNIA 4ABGA 3MNSA 3ZVGA 3F9HA 2Y7ZA 2TRMA 4KGAA 5AF9H 5L30H 1XKAC 5DKMA 4YOJA 6ESTA 1V2KT 3RXSA 1O5GH 4MVNA 1GI8B 1ELVA 1A7SA 2ANKH 3SI4H 1S83A 2FLRH 1C5OH 4OGXA 3A7ZA 3LKWA 4ISNA 3LC5A 4JYVH 1C2JA 1QTFA 4BAHB 1LQDB 2FOFA 4BTTB 2P94A 3RXVA 2H2ZA 3P17H 4CREA 2ZPSA 5EPNA 1SB1H 1MTWA 2SNWA 3K9XB 3VXEH 5A0CA 1J16A 4AYVB 1ORFA 1O2SA 1P2QA 3BN9A 2FTMA 4DGJA 2EEKA 3PYHA 3LPRA 3MH6A 3HGPA 4MPUA 3ZZAA 4Y8XA 2QF3A 5FX5A 1DXWA 2TPIZ 2A7HA 2BD4A 5DP4A 4ZHLU 1XVOA 1OSSA 5TCAA 2AMPA 4B2AA 1DT2A 4TWYA 1CGHA 2WYJA 1ETRH 1B0EA 3A7WA 1ZZZA 1E0FD 1GBJA 1GBTA 2JETB 2BX4A 3R0FA 4XBDA 1O2KA 2AMDA 1J15A 1QA7A 2YNAA 1K21H 3A7VA 1TNJA 1GI5A 4A1XA 1GJ7B 1C2HA 3RDZA 1KLTA 1FXYA 3NXPA 3EE0B 1O3MA 1M9UA 2OXSA 3E1XB 1F92A 1GBBA 1DFPA 2QXJA 1NRRH 2J2UA 1LHDH 1Z8RA 3GY8A 1O5AB 1E34B 1OOKB 4Y7BA 1GJBB 1P04A 1VR1H 1XUIA 5JBCS 4K69A 2ZG0H 3AAVA 4JZIA 1B5GH 2Q1JA 3HATH 5SGAE 1MU8B 1P9SA 1BTXA 1RXPA 1C1MA 2FXRA 2BDCA 3RLWH 3BG4B 1C9TA 4D8NA 2FX6A 4IBLH 1TBRH 2AGEX 3E16B 1O2LA 1Q31A 1J9CH 4A6LA 1VGCC 1K1JA 4BTUB 2Z94A 1EJNA 4UFFH 1WQVH 3S7HB 4TYDA 4IGDA 4MPXA 1QNJA 1A0HB 1O38A 1YC0A 4B2CA 5C1UA 1UVSH 1Z6JH 1GI2A 1C4U2 3QGJA 2KAIB 1XUGA 1UTMA 1W2KH 4XBCA 3K6YA 1EZXC 2WPLS 1OS8A 4ZKNU 5JPMH 2PGBB 2H1UA 1DLEA 4HGCA 3ZVBA 1MUEB 4B71A 3RXHA 9LPRA 4XE4A 1FY4A 4CR9A 1BMAA 1P2NA 1F5RA 3SJ8A 2BZAA 2GD4B 2SGQE 4X8VH 4Y71A 3S0NA 1OP2A 1KIGH 3GCOA 1MH0A 1BOQA 5DJ7A 1TGSZ 2WV4A 2FLBH 4GCHF 4UE7H 1K28D 3LOXA 4WJG2 1AB9B 3RXIA 4GPGA 1O30A 1XXFA 1GCTB 1HNEE 2YOLA 4JZEH 4B76A 1CGJE 4X2VA 4D9QA 1HAZB 1L4ZA 4FU8A 2B0FA 3PB1E 3LU9B 4JMYA 3A8BA 1OP0A 1WSSH 4H6TA 5FPYA 1T32A 3RU4D 4ABBA 1SGRE 3U8RH 1OWHA 4YO9A 2PHBA 1W0ZU 2ILNA 2NU0E 2PW8H 3LGVA 3GCTG 1T4UH 2EI8A 1C9PA 1GJ4H 4B2BA 4X1NU 3UIRA 4WVPE 2R2WU 1P02A 3AW0A 3UOPA 1YCPM 1YPKH 1B0FA 2F3CE 5DP5A 1MCVA 1YBWA 2ZTZA 2TGPZ 1P3CA 4YLUA 3SV2H 2H9EH 1NZQH 1IQHA 4ISHH 2G4TA 3QDZB 3SW2B 1TLDA 3DHKH 4M7GA 3MFJA 1GI4A 2EI6A 3RXRA 5JBTA 2FZZA 1GJ8B 1PPEE 2BLOA 3RMLH 4X8SH 1V2MT 1EUFA 4MNVA 1UTPA 2QYIA 3QGNB 3A86A 4Y8ZA 3SV8A 3ZV8A 2BD5A 2PSXA 3HKJB 1BA8B 2FI5E 2W5EA 2QC2A 1XUJA 1G37A 3SQEE 1UMAH 2V3HH 5HYOA 1UTNA 3ITIA 3L33A 3TGIE 2XBWA 3ZZDA 2PTNA 1AKSA 3A8AA 4CBOA 2HNTE 3KGPA 3F1SB 1K2I1 4I31A 3CS0A 1GBHA 1JMOH 2H6MA 2PFEA 3LH3A 3MWIU 1D6WA 3A83A 2IOTA 1W13U 3UTUH 2BY5X 5GPIB 1OWDA 1CU1A 1UCYE 1SC8U 1QJ1B 1ARBA 1TQ0B 2ZCHP 1AY6H 4Z0KA 3URCA 3F9EA 1P57B 1KDQA 4X2YA 3SNAA 1G3DA 4NSVA 3UY9A 3RXDA 4TY7A 1S6FA 4ZMAH 1BHXF 1O37A 3UOUA 2D2DA 2R0KA 6LPRA 4K3JA 1AI8H 4I8KA 1GCDA 3T26A 8GCHG 3GYLB 1GHYH 5L2ZH 3HPTB 2ASUB 1UTOA 1EJMA 2H9TH 3MH5A 1EAIA 3P95A 9ESTA 2G5NA 2ALVA 3P8GA 4VGCC 1SMFE 5IDKA 2JH6D 2HNTF 5AVDA 3M3VA 2Y80A 2CF8H 3RUOA 4CHAC 2ANMH 3TITA 1K1OA 1SLVB 2AGGX 1MZDA 1O3HA 1VGCB 1CGIE 3GY7A 1KTTB 1OKXA 1KXFA 1C2GA 7GCHF 3UNSA 1AFQC 3RXFA 5A09A 1O2QA 3U69H 1HIAA 4DIIH 1O2MA 2AH4X 1NRSH 1PJPA 2OQ5A 1A5IA 1LVOA 2XTTB 3NKKA 1DS2E 2O8LA 2BXUH 4DJZB 5BRRE 1TRYA 2CXVA 2B8OH 4NIWA 3M36A 5JB9S 1SOTA 2ULLA 1KTSB 1RS0A 2BD2A 2Y82A 1C4V2 1TPSA 3CP7A 4O3UA 1EP5A 2AGIX 1AU8A 2GT8A 1ANEA 4FUBA 1P2OA 4MLFB 2BY7X 3T5FH 4NA9H 1GI9B 3ENSB 4X6NA 1IQEA 4RN6A 4X2XA 5A8XA 1TOMH 3Q3YA 4RKOB 2PUQH 5T6DA 1EAXA 1W3CA 1HXFH 4HTCH 2A5AA 4RKJB 1B7XB 4U2WA 1HJ9A 1IQGA 1GMCG 2G00A 4CRFA 1CA0C 5F8TA 3GDVA 1EASA 5EXLA 2A45B 3ZZ9A 2B7DH 1K1NA 2Z6BD 1MAXA 1A5GH 2XBVA 1NRQH 1WQSA 1TX6A 5GJ4B 2GCTC 1QCPA 3T2NA 2THFB 6GCHF 1HAVB 2ZI2H 3KQEA 3RXKA 3IG6B 2BVSH 4X1PU 1SLWB 3UQOA 7LPRA 3LJOA 2BQ7B 1GL1A 3VFEA 4FVDA 2BDAA 2HPPH 3UWJH 1CE5A 1IQKA 3STIA 1O2RA 3SN8A 1AKSB 4DT7B 3OX7U 1HFDA 4K1SA 3GCHC 2QY0B 2IJOB 1Q3XA 3LH1A 4YTAA 1GJ5H 1OXGA 1WU1A 2A7JA 1ZPCA 2A32A 3ZZ4A 4U32A 4XBBA 3JZ1B 2OBOA 4GAWA 1IQNA 5HGGA 5ESTE 2QGRA 1LHCH 2Z3EA 1E37B 3MH7A 5DP6A 2ZHFH 4K5ZA 1TMBH 1SGFA 2C93B 3QK1A 1KDQB 3RMNH 4NCYA 1S85A 1AUJA 3BG8A 3VB3A 1GBIA 4ZH8A 3K6ZA 2RA3A 2A5IA 1WOFA 2C8XB 2OD3B 1FPCH 1O2GH 1NRPH 3Q3XA 1ESBA 2VH0A 1H8IH 4FU7A 2Z9KA 3T29A 1TNGA 1UK4A 1SI5H 2P59A 1AO5A 1E38B 1EB1H 5EXNA 1MD8A 3PMHB 1AE5A 3SJKA 5EW1H 1A3BH 1QB1A 1BJVA 3MU8A 2BDGA 1BQYA 1EAUA 5GCHG 2ZP0H 1UTQA 2FIRH 5CE1A 1F0TA 2BD9A 5DGJA 1W0YH 1YLDA 5ETXA 4ABDA 1H9IE 4DG4A 1L2EA 4VGCB 2ZGBH 1WV7H 4Y76A 2GV6A 4GLYA 3FP7E 5E0GA 3O8CA 1WAYB 1HB0B 1IQLA 4O97A 1HIAB 2P16A 2B5TB 4ESTE 2ZIQH 2R3YA 3KCGH 4X8TH 1SGFG 1QRWA 3SNBA 2FODA 2ODYB 4Q80A 1A3EH 4WXVA 2G8TA 1NRNH 2FOMB 1AFQB 1TFXA 3SNEA 3K2UA 1LVYA 2BD7A 2XC5A 1GDNA 4AGKA 5F6MA 4Q7YA 1BRBE 1Y5UT 4I7YH 1AWHB 4UFEH 1GBDA 3IITA 3N7OA 1YKTA 3SNCA 4NSYA 1SGDE 1NY22 2OINA 2QIQA 1O3BA 1KY9A 3Q76A 1D3DB 2BLWA 5DP3A 4DOQA 1SHYA 1BMLA 4KP0A 1CT2E 1YPGH 3GCNA 1A46H 5EQSA 1S5SA 3UNRA 1DLKB 3S9CA 3ATIA 2GZ9A 3E6PH 2WV5A 1O2XA 1MAYA 2ZCLP 4TWWA 1O35A 1CHOG 3S9BA 4R8TB 1PPCE 2C90B 4B1TA 4MPVA 1TX7A 2BYAX 1CA0B 3GY4A 3HK3B 1ETTH 2A4OA 5LGOA 1AVXA 1PYTD 3AASA 1RTLA 1GG6C 4CRCA 3FP6E 4NIVA 2GMTC 4ISLA 1LHGH 1TX8A 5C67A 1PQ8A 1AGJA 4I8JA 3EA9A 3NK8A 1GJ9B 1EX3A 1W8BH 1O5CB 2GCTB 1V3XA 3OY5U 4AB8A 4WMDA 2V35A 1A1RA 1DE7H 1O3FA 3UR6A 1O39A 4H4FA 2G81E 4ISOA 1LKAA 1LVMA 1AUTC 3BTGE 2BLVA 1Z8IB 2PGQB 1TWXB 3AVZA 1W10U 4HFPB 1C5YB 4TPIZ 1AVWA 1CT4E 4KKDA 5ABWA 2V0BA 3VEQB 2FI3E 3ZZ5A 2FOGA 2PLXA 2UUYA 1BUIA 2F9BH 3CENA 1BTPA 3D49H 4YZUA 1D6RA 1CO7E 1O2NA 2HOBA 1BB0B 1NN6A 2BY6X 2G55A 1IAUA 2VU8E 2A2XH 1V2OT 2OC0A 1NFWA 1NO9H 1QJ7B 1QHRB 2Q6DA 1V2RT 1DY9A 2BY8X 1Y3VA 3GY6A 1EZUC 3VB6A 2P8OB 3QZRA 1YPEH 3EDXB 1EOLA 5FCKA 1AWFH 1HRTH 1G2MA 2VNTA 1MTVA 1WYKA 1V2WT 2QCYA 1MKWH 5EU8A 1O32A 1P10A 3U9AH 1AHTH 5FXLA 1NROH 2ZDVH 2OQUA 2NU4E 4ABIA 1K9OE 2SGAA 1HAPH 1XUHA 3E0PB 6CHAB 2FI4E 2ZC9H 2W7UA 4NZQA 2A31A 1T7CA 1VITG 3SQHE 1L1NA 4WMEA 4XOJA 1H4WA 2O8MA 3SUGA 3TGJE 1WTGH 3L6PA 5FCRA 2ZGCA 2BTCE 3U1IB 2GTBA 1A0JA 3G01A 3M5NA 3RM0H 2CMYA 2BB4A 1SFIA 2VJ1A 4X6PA 3FANA 3MNBA 4D7FA 3QUMP 2A4RA 1MKWK 3H7OA 1AE8H 1P09A 2O8UA 1TYNA 1HGTH 1C5SA 1C1QA 3ATWA 1NFYA 1HYLA 3P70B 2ZTXA 1TMUH 4Y7AA 3H7TA 3SUFA 4WH6A 5A2MH 1JRTA 1PQ7A 2HVXA 3SU1A 4INKA 3RC6A 1CA8B 4I32A 1UTLM 3GCTF 7ESTE 3RXQA 1G3BA 3A81A 2I6SA 2ZU1A 5C3NA 1V2JT 3ZZCA 1O2UA 3O8RA 4O03A 3M35A 3NWUA 1MTSA 3QN7A 1LKBA 2XCFA 1HAYB 2XWAA 5FPTA 3UR9A 4PROA 2W7SA 3SU4A 1HAHH 3PWBA 1S81A 1VCQA 3GYMA 4FUCA 1WBGB 2HALA 4K60A 1CSOE 3DT0H 3O8BA 3SJ9A 1ESTA 2F9UA 4A1VA 3RC4A 1RGQA 4TPYA 1UVPA 1C5UA 2XCNA 1KLIH 1XUKA 1HUTH 1ZGIA 2GCHG 1D4PB 1OPHB 3GY3A 4JK5A 2A0QB 3U8TH 1DWBH 2ZGHA 1CT0E 2BOKA 3EAJA 1GWAA 4SGBE 1ELGA 1W11U 2ZFPH 3BIVH 2WPHS 3SU2A 4AFQA 4E05H 4ZXYH 3TK5A 5DPAA 1PPHE 3SV6A 1V2LT 2BD8A 1GHZA 1K22H 4JYUH 1NFUA 4A1TA 1GHAG 2GP9B 3LJJA 2BDBA 1PPZA 2BM2A 4BXSA 4AYYB 3OY6U 1IQJA 2V3OH 2XW9A 2AYWA 1MZAA 1ZJDA 2FYRA 1ZSKA 1BRUP 4J2YB 4B73A 1PPGE 2ALPA 1V2NT 2H9HA 4GCHG 3ODFA 1O36A 1O2ZA 3I77A 1UVOA 2F91A 1GHBG 5E0JA 1TNLA 1GG6B 1GI7B 2R3UA 4O9VA 2GMTB 3Q3KA 2ZDNA 1HAGE 5AFYH 1EPTC 1LQEA 3QTOH 1HDTH 1MU6B 3RXAA 3TU7H 1UCYH 1C2FA 1Y3WA 3BEIB 4MQAA 3AW1A 5GDSH 4OS2A 3Q77A 2OP9A 3BTQE 8GCHF 3SHAH 3U98H 1FLEE 3SBKA 1EPTA 2P3TB 4IMQA 2ANYA 3TJVA 1C1NA 1RTKA 3BF6H 4NIXA 2M5TA 4XDEA 1FQ3A 2CV3A 1AIXH 1QL7A 2A1DB 1LVBA 1P8VC 1HBTH 1OWEA 5TJXA 1GBAA 2A5KA 5C5NA 1DX5M 5K0HA 1O3IA 4X1RU 1GBFA 5G4BA 1J8AA 2J92A 3VB4A 1EOJA 1C2KA 2FPZA 3MTYA 1FN8A 1TIOA 1T8MA 1S0RA 1C1OA 4U30A 3LONA 4Y79A 3LGIA 2FS8A 1ELBA 1K1IA 3KHVA 3SOSA 3ZVAA 1YGCH 2K1QA 1UCYK 1DOJA 2J4IA 1K1LA 3W95A 4WWYA 1BIOA 3S9AA 1PYTC 2SGFE 1O0DH 4X8UH 3ZZ6A 4X6MA 1DSTA 3E8LA 3FZDA 1P03A 4D7GA 2UWLA 3FZZA 2Z3DA 2STAE 1MCTA 3QX5H 3A82A 3KN2A 3LGUA 4AOQA 2D26C 5CHAC 2A4GA 3IWMA 1CHGA 3SGBE 5I46H 3BEUA 2O8TA 2GKVE 3DA9B 1A5HA 3FVFB 3T62A 3RU4T 1ZMJA 4OS7A 1MD7A 2Y5GA 5F8XA 3HK6B 1KXEA 5E2PA 2BDIA 4YLQH 1MQ5A 3EQ0H 5L2YH 4NA8A 1TNKA 1Z8JB 2BHGA 4Q7XA 3B9FH 2NU1E 3ESTA 2BD3A 5T6FA 3TJNA 5C5OA 1O31A 3EGKH 4IN2A 3MO9A 3V12A 3A84A 1F0UA 2ZPQA 3URDA 5A8ZA 5C20A 2ZHEH 1TA6A 2UWOA 1KLJH 1GJDB 2UUFB 1SGQE 1BBRE 4K2YA 1TRMA 1HAIH 3PMAB 3D65E 3P92A 2ZECA 4BAOB 3QZQA 2BMGB 2G52A 1JRSA 2ZU3A 3RXGA 1J17T 4UEHH 2RG3A 2ZFQH 2C4FH 2PSYA 3TJUA 1DITH 4K1EA 1SPJA 2NWNA 4KTUA 4X6OA 4CRDA 4X1SU 3M5MA 3M3TA 1GHWH 3TH4H 2XXLA 5J4SA 4DY7B 2UUJB 2WPJS 5FBIA 3BV9B 1TE0A 3F6UH 4KTCA 1BRCE 4H6SB 2VIOA 4JCNA 2XWBI 3E91A 3OTJE 4GSOA 3K65B 1YCPH 1SLUB 1TPAE 4NGAH 5GIBA 1PQAA 1C1TA 1FPHH 1FNIA 4DIHH 4UFGH 3RXCA 2PKSC 2Y5HA 1DXPA 2ZZUH 3BIUH 3ELAH 3GDUA 3TK9A 1HCGA 3MYWA 3SJIA 1AZZA 2CHAC 4Z6AH 2JKHA 4MNYA 2BQWB 3A89A 4F49A 5GXPA 1AVGH 1GL0E 4ABFA 4FUJA 1ZLRA 4ZUHA 3SJOA 3DFLA 1Y5AT 3SV9A 1UTJA 3ZZBA 5F8ZA 5PTPA 2ZDLA 5FBEA 3STJA 1LPGB 4U01A 5IYTA 5HM9A 1SG8B 2WYGA 3WY8A 1HJ8A 2VWMA 1LMWB 1K1PA 3PM3A 4FU9A 3ZZ3A 1YCPK 2FEQH 5DO4H 1SQOA 1EKBB 1AN1E 1L1JA 3BTEE 1GMDG 3KNXA 1DUEA 1MBMA 2NU3E 3VPKA 1H9HE 3RMMH 8LPRA 1KSNA 1C1VH 1Z1JA 1MKXH 2HWLB 3ZYEA 2F9OA 5HM2A 1N6YA 1OP8A 3TLOA 1TQ7B 1L4DA 1SOZA 1Z8GA 2VVVA 3B23B 5EGMA 2VVUA 1VJAU 2PTCE 1WTHD 3ATKA 4JYTA 1BTZA 1GMHF 3UFAA 1EPTB 2VINA 5FHTA 1NESE 2TGDA 4UD9H 3SV7A 1PQ5A 2Z9JA 1GVZA 1GPZA 1YPJH 2ODPA 2B9LA 1BCUH 4AG2A 2O9QA 1ABIH 1MTNC 2W3KA 2HLCA 4MNXA 1QURH 3M7TA 1VCWA 4GUXA 5GCHF 1GGDC 1RTFB 3TH2H 3ZV9A 4ZKOU 2VIVA 3UREA 4X2WA 1FY1A 1NC6A 1F0SA 1TPPA 4OS4A 1MKXK
chains in the Genus database with same CATH superfamily
1A2CH 1XKBC 4I8GA 3F68H 2BVXH 1PPFE 4IN1A 4Y11E 1PFXC 3NCLA 3RXMA 3M3SA 3GOVB 1AFEH 3ZZ8A 1IHTH 4INLA 2VIPA 2RDLA 2J38A 3RP2A 2DUCA 1S82A 3SI3H 2QXIA 1Q2WA 1ZSLA 4MNWA 2A7CA 3C1KA 2G5VA 5T6GA 5JB8S 1BTYA 4B6FA 3RXTA 2ZU4A 8KME2 4B74A 4CRGA 2YMSC 2XBYA 1UO6A 2ZEBA 2QF5A 1TRNA 3SZNA 1GVLA 3WWBA 1C1UH 1SQAA 2JH5D 1XUFA 2VB0A 5CHAB 1GJ6A 1P05A 3M37A 4Q2KA 4J1YA 1O3OA 1QIXB 1Y3XA 3GY2A 3L3TA 3MU5A 1JXPA 4GVUA 3LGYA 4LZ1H 3NPSA 4CHAB 2G4UA 1N8OC 1GBCA 2Y7XA 4BAKB 1QBOA 3PMJA 1XM1A 2FYQA 3TIUA 3A87A 1G9IE 1UHBA 2KX4A 4Y0ZE 2OCVB 4IS5A 4YOGA 1IOEA 1V2QT 2GVFA 2SGEE 1N1LA 2FOEA 7KMEH 2FOCA 1LO6A 2J34A 1MBQA 1SHHB 4LK4A 1QL8A 2ZDAH 2QA9E 1CVWH 2BQ6B 1ANBA 4E06H 4INHA 1O34A 1T8NA 5EJ1A 1F5KU 4RT1A 1AZ8A 1YF4A 4Y0YE 4LOYH 3PO1C 4NWLA 3KQCA 2EI7A 1BJUA 2PWXA 1FDPA 2OC1A 2GV7A 2WPDD 1EZQA 3RXPA 2Y81A 1C2DA 5K7RA 1W7GH 3A7TA 3BTME 2ZHQH 4Y8YA 1GHXH 2Q6GA 3SHCH 4K8YA 1ZMNA 4B75A 5JBBS 5FX6A 1TB6H 1YM0A 3M5LA 1HLTH 1GDQA 1RIWC 1T8OA 1GBMA 1C4Y2 5DP8A 3TK6A 1W0JD 4FUDA 2BZ6H 2HGTH 4KELA 3TPIZ 1G3CA 1DWCH 3FAOA 3ODDA 5AHGH 1G36A 3EA8A 3TGKE 2OLGA 1O2HA 3VGCC 2PKSB 1OWKA 1O2OA 2OUAA 2Y5FA 3P6ZB 3PV4A 3MU4A 3UWIA 2CHAB 3BTWE 1XMNB 1YYY1 2F9NA 3UNQA 2WZQA 3MH4A 4I8LA 1S84A 2VWLA 2ZF0H 5E2OA 1EZSC 2TGAA 2VWNA 3P8NA 4JK6A 1DWEH 3MNCA 3PRBA 1UVUH 1F0RA 2FS9A 2BDHA 1H8DH 5GWZA 3FP8E 1V2TT 3T28A 2WPMS 1S0QA 1SGIB 1OYQA 1QR3E 3SYJA 1W14U 1P9UA 2VWOA 3SU5A 3RLYH 3QLPH 2ESTE 1V2ST 2HPQH 4FVBA 3AAUA 4NFEA 3TH3H 1BTUA 4MTBA 2FESH 2V7QD 4ABAA 2RCEA 1FAKH 1BDAA 4NIYA 2W3IA 2XNIA 1IHSH 3BTHE 3FOAA 2ZNKH 1HXEH 1H1BA 3I29A 2TGTA 2JDID 1V2VT 4IW4E 3MHWU 2ZFFH 1X7AC 3GCHB 1YLNA 2XC4A 4GHTA 1C5MD 2QN5T 1HJAC 2QV1A 1O33A 1TGTA 1QA0A 1VITF 1XX9A 3Q00A 4CR5A 4ZXXH 2FO9A 2BLQA 2P95A 2ZTYA 3TJOA 1QJ6B 2WUBA 3ZVFA 2BDYA 3FFGA 3OSYA 4AZ2B 3ZIAD 4NFFA 1SLXB 2F9PA 4F48B 1Y5BT 3A7XA 1MTNB 1QB6A 1SBWA 1C1SA 4AX9H 1VCPA 1TBQH 1GGDB 1THPB 1S6HA 3SNDA 4BAMB 1INCA 2O8WA 2KCOA 1JIRA 1ZOMA 1DM4B 2ZFRH 4AB9A 4OS1A 1ELEE 3V3MA 3OE7D 2QAAA 3VB7A 3BEFB 4FUIA 1WCZA 2H5DA 3GISB 1HAOH 2ZDKA 1HPGA 1JBUH 5JBAS 3PTNA 3MOCA 3UQVA 4E7NA 2AIPA 5A8YA 4NG9H 1O3CA 2ZGJA 5LPEA 1DWDH 4OGYA 1ABJH 3LC3A 3SGAE 3M7QA 1ZSJA 4UONA 1FY8E 5DP7A 4Y6DA 1DPOA 1ZR0A 2VIWA 1FIWA 2AEIH 1CQQA 1C5PA 2JH0D 2YMSB 3I78A 1O2VA 5EODA 2TBSA 2ZO3H 1QRXA 1P3EA 2DE9A 1QFKH 5EQRA 1C2MA 1UHBB 3RC5A 4H42U 2GCHF 1ZPZA 4XSKU 2C8YB 2J94A 1QQUA 4FOUC 4LXBH 1H9LB 1BRAA 1N8OB 4WMFA 1ELDE 4D9RA 1IQMA 2EY4C 2OTVA 3KQBA 1THSH 4NWKA 4AFZA 1G30B 3A8CA 1KXCA 2C8ZB 1GJCB 4DW2U 2AIQA 1YWUA 2GZ8A 2ZCKP 1NU9A 3OFND 1Z1IA 4BAQB 1RJXB 1SGCA 2Q6FA 4OS5A 3ZZ7A 3BTDE 3T27A 2STBE 4A5TS 1FN6A 5CDFE 4K1TA 4R0IA 4LZ4B 1C2LA 1LCYA 4AFSA 1T4VH 4E7RG 1GHAF 2YNBA 4K8BA 2GT7A 2CJIA 3SU0A 3UAIC 1O3PB 3U8OH 1YPHE 2D1JA 3ZVCA 5C1XA 1BZXE 1O3KA 1Z71A 3H09A 3GY5A 1DVAH 1P06A 1P2KA 2IPHA 2W26A 3PO1B 2JJ2D 1LPZB 1G3EA 1YPHC 1W7XH 5HKKD 3MQKC 1GJAB 2SGDE 4HZHA 2ZDMA 1LHFH 4FXGH 3U1JB 1GHBF 2FMJA 3M61U 1FV9A 4AN7A 2VVCA 1U6QA 1GI3A 2BOHB 2VIQA 2ZQ1A 1EJAA 1O5DH 1XVMA 3GICB 5BPEA 3ZYDA 4ABHA 2J5UA 4MPWA 1KYNA 1QL9A 2ANWA 1NM6A 2CN0H 3SO3A 1FIZA 1RIWB 2TIOA 1BT7A 1GI6A 1T31A 3RXEA 2VBCA 1D3QB 1RRKA 2IPQX 1L1GA 5AFZH 3VGCB 1GBEA 1C5VA 1XXDA 2A4QA 2WUCA 2ZQ2A 5DK1A 1WUNH 2F9VA 1A61H 2FWWA 2ODQA 1ZPBA 4ZHAA 1C5NH 1YP9A 3ATMA 3PWCA 4I33A 5HXFA 1GI0A 3DSOA 1CBWC 3QO6A 1EXFA 2YMSD 1OWIA 3EA7A 3PROA 1ELCA 4DCDA 3LT3A 3F0OA 3QTVH 5ESBA 1HAVA 5EQQA 1LHEH 1C5TA 1D9IA 3RMOH 2DE8A 2KCYA 2J98A 1C5XB 1GHVH 3GDSA 4MG3A 1ELFA 1N6XA 4BOHA 2I6QA 5E0HA 2V6NA 2BXTH 5T3HA 3W94A 1ID5H 3PMBB 4CRAA 2P3FH 2R9PA 4ZKSU 5EPYA 2XBXA 3T25A 1ZMLA 2BX3A 4ASUD 1T8LA 1EQ9A 1UJ1A 1E35B 1NT1A 2XC0A 1LTOA 1HJAB 1YPMH 2FTLE 5EG4A 5A0BA 2HNTC 3FO8D 1Z7KA 2ZU2A 4CH2B 2FP7B 1C5WB 1QQ4A 1TONA 2QF4A 4YT7H 1O5BB 3W1EA 2Z9GA 5H4IB 3RXBA 1P12E 2Z3CA 1DSUA 3S7KB 2LNCA 1RD3B 1SGEE 3D62A 3MI4A 3SUDA 1TGCA 5KEDA 3SUEA 3RXUA 2HRVA 1K1MA 4TY6A 5C1YA 2Z9LA 1TAWA 1THRH 1BMMH 5EW2H 1ZJKA 3F9GA 4ZKRU 1Y3YA 2WPKS 3C27B 1P01A 5A0AE 2FM2A 1P2MA 1O3GA 4SGAE 3A8DA 1BTHH 4UDWH 5C2ZA 3UUZA 2GDDA 2PKAA 1BBRH 1O5EH 2ZA5A 1EATA 4I8HA 1O2WA 5I25A 1FAXA 4CRBA 1FI8A 3A7YA 1J14A 1UVTH 2CGAA 2P3UB 3CS7A 4THNH 1NTPA 1P2IA 5CMXH 3R3GB 4BXWA 3TVJB 1QBVH 3VB5A 2QXHA 1SFQB 1RFNA 1ZYOA 2P93A 2SNVA 3OEHD 1ESAA 2OC7A 2QXGA 3MO6A 5FAHA 3OYPA 1LPKB 3E0NB 4Q7ZA 1GMCF 1BITA 3EE7A 1C5QA 4AG1A 2SGPE 1NU7B 1D3PB 2CF9H 5EXMA 2PR3A 3EYDA 1SGPE 1FZZA 1L0ZA 1TALA 2UUKB 1AQ7A 1O2JA 3F9FA 2NU2E 2VGCC 1TBZH 1BBRK 3P8OA 2VIDA 2ZFSA 1O3DA 3F2HA 4XFQA 5L6NH 4UFDH 3DD2H 4Y10E 2H5CA 1ZTLA 4BTIB 1O3LA 2JJ1D 3SGQE 3KL6A 4WF8A 4ZAEA 5DP9A 4HI3A 2ZHWH 3ZVEA 1QBNA 1F5LA 1OYTH 2OBQA 2ZU5A 3DUXH 1Y59T 3HGNA 1TMTH 3KIDU 4ISIH 3B8JA 2AMQA 1PPBH 2C8WB 3VXFH 1F7ZA 5LH8A 1MMJN 7GCHG 1TNHA 1GDUA 1GMDF 2ZHDA 1O5FH 3UPEA 1MQ6A 4ASHA 2LP6A 1QZ8A 3WWFA 5JDUB 2Z9IA 1C2IA 2FOAA 4JZDH 1TOCB 1O3EA 1O2PA 1NFXA 1O3NA 3OU0A 5LPFA 1UK2A 1NS3A 3E90B 4BNRA 1G2LA 4A7IB 1DDJA 4WXIA 3BSQA 1A4WH 2PP6A 3PLBA 2J95A 2ZKSA 1ZRKA 1KXAA 1QY6A 3KEEA 3D23A 1O3JA 3RXLA 3LGWA 1QRZA 2D8WA 4DURA 1FJSA 2WINI 2FOBA 2J9NA 2FDAA 3BTFE 4XD7D 3PTBA 1DUAA 2BY9X 2AS9A 1ZRBA 1SVPA 2WPIS 3NUMA 1SSXA 1OWJA 1KXDA 4X1QU 2ZPRA 3LDXH 3SU3A 1O3AA 1ANCA 1C5RA 3KQDA 1BTWA 3PLPA 2J98B 1V2UT 3HKIB 2ZFTA 1C1RA 1QGFA 3A88A 1CBWB 4NA7A 1C2EA 2R0LA 1VZQH 1EAWA 1TGNA 1ARCA 1FONA 2JETC 4BANB 3DFJA 4FUFA 3BTKE 1MTUA 1SGNE 1ZGVA 1YLCA 3V13A 1TABE 4YXWD 1A0LA 2G51A 3RU4E 1SGYE 1BHXB 1K0HA 1ELAA 4ZHMU 2ZWLH 5TCCA 6GCHG 1V6DA 2GZ7A 2P8OC 2GGVB 1AD8H 4F4OC 4NZLA 3BTTE 5EOKA 4AORA 2IN2A 4IC6A 2SFAA 1ZHMA 4FUGA 1VJ9U 2PV9B 1H8HD 2HLDD 1EB2A 3RXOA 2AERH 3M7UA 1KXBA 1TGBA 4WH8A 4WY3A 3MNXA 3PLKA 3MMGA 2GX4A 4OM9A 3RM2H 5J4QA 2WSSD 1C1WH 2LPRA 3BG4C 1SQTA 1C1PA 4A92A 1C5LH 1P0SH 1LDTT 1V2PT 1TPOA 2ZGXH 8ESTE 3O8DA 5C17A 4IC5A 1F2SE 1DICA 2R2MB 6CHAC 5B6OA 4CBNA 1GMHG 1P2JA 4YESB 5T1VA 3SU6A 1FY3A 4X0WU 1O2TA 2PKAB 3M5OA 5FPSA 1ELTA 1EFRD 1IQFA 1ANDA 1SR5C 4JZFH 1NPMA 2RA0A 3S69A 5E8EH 3MU0A 3V7TA 1JIMA 1JOUB 2VH6A 5JYIA 2K0QA 4FUEA 3A80A 1SL3A 2QF0A 4ABEA 4D76A 3MO3A 3A85A 1SGTA 4DVAU 1YPLH 3ATLA 3E3TA 1DANH 3SORA 2F83A 3JZ2B 1FUJA 3TNSA 4KTSA 1Y8TA 1G32B 1HV7A 1ACBE 2PUXB 4O3TA 1ETSH 4AFUA 2XYAA 2KAIA 2OC8A 1ZTKA 4IMZA 4RSPA 1GVKB 1AMHA 1CHOF 4YOIA 1ZTJA 1GBLA 1DY8A 2JIZD 2A2QH 3NZIA 1FY5A 1BMNH 2XRCA 3LGTA 1HAXB 2BVRH 2Z7FE 5FL7D 3MU1A 1AB9C 4JZ1A 4CH8B 5F03A 2UWPA 1GCTC 1GBKA 1GI1A 2C3SA 4ABJA 4AGJA 2AFQB 1JWTA 2FX4A 2VGCB 3LIWA 3V0XA 1Y3UA 2EA3A 4OS6A 1EP6A 1Z6EA 5LPRA 1ZHRA 1E36B 4GHQA 1D3TB 2KFWA 1O2YA 3KF2A 3TNTA 1UTKA 1VITH 1QB9A 3P8FA 1O2IA 2Y6TA 1TA2A 1FMGA 1OX1A 4QT8C 4ZROA 5DG6A 2W6JD 2EC9H 4FUHA 1ZHPA 1IQIA 3N99A 2GDEH 3RXJA 5HMAA 2FOHA 3ZVDA 1P11E 3DSGA 3H5CB 4YT6H 1UK3A 1C5ZB 1W12U 4YM9A 4MDSA 3QWCH 1TNIA 4ABGA 3MNSA 3ZVGA 3F9HA 2Y7ZA 2TRMA 4KGAA 5AF9H 5L30H 1XKAC 5DKMA 4YOJA 6ESTA 1V2KT 3RXSA 1O5GH 4MVNA 1GI8B 1ELVA 1A7SA 2ANKH 3SI4H 1S83A 2FLRH 5KECA 1C5OH 4OGXA 3A7ZA 3LKWA 2OK5A 4ISNA 3LC5A 4JYVH 1C2JA 1QTFA 4BAHB 1LQDB 2FOFA 4BTTB 2P94A 3RXVA 2H2ZA 3P17H 4CREA 2ZPSA 5EPNA 1SB1H 1MTWA 2SNWA 3K9XB 3VXEH 5A0CA 1J16A 4AYVB 1ORFA 1O2SA 1P2QA 3BN9A 2FTMA 4DGJA 2EEKA 3PYHA 3LPRA 3MH6A 3HGPA 4MPUA 3ZZAA 2L6OA 4Y8XA 2QF3A 5FX5A 1DXWA 2TPIZ 2A7HA 2BD4A 5DP4A 4ZHLU 1XVOA 2KZ4A 1OSSA 5TCAA 2AMPA 4B2AA 1DT2A 4TWYA 1CGHA 2WYJA 1ETRH 1B0EA 3A7WA 1ZZZA 1E0FD 1GBJA 1GBTA 2JETB 2BX4A 3R0FA 4XBDA 1O2KA 2AMDA 1J15A 1QA7A 2YNAA 1K21H 3A7VA 1TNJA 1GI5A 4A1XA 1GJ7B 1C2HA 3RDZA 1KLTA 1FXYA 2M2AA 3NXPA 3EE0B 4P00A 1O3MA 1M9UA 2OXSA 3E1XB 1F92A 1GBBA 1DFPA 2K8IA 1NRRH 2J2UA 2QXJA 1LHDH 3NRLA 1Z8RA 3GY8A 1O5AB 1E34B 1OOKB 4Y7BA 1GJBB 1P04A 1VR1H 1XUIA 5JBCS 4K69A 2ZG0H 3AAVA 4JZIA 5DSFA 1B5GH 2Q1JA 3HATH 5SGAE 1MU8B 1P9SA 1BTXA 1RXPA 1C1MA 2FXRA 2BDCA 3RLWH 3BG4B 1C9TA 4D8NA 2FX6A 4IBLH 1TBRH 2AGEX 3E16B 1O2LA 1Q31A 1J9CH 4A6LA 4Z1MD 2WV9A 1VGCC 1K1JA 4BTUB 2Z94A 1EJNA 4UFFH 1WQVH 3S7HB 4TYDA 4IGDA 4MPXA 1QNJA 1A0HB 1O38A 1YC0A 4B2CA 5C1UA 1UVSH 1Z6JH 1GI2A 1C4U2 4ZCNA 3QGJA 2KAIB 1XUGA 1UTMA 1W2KH 4XBCA 3K6YA 1EZXC 2XNDD 2WPLS 1OS8A 4ZKNU 5JPMH 2PGBB 2H1UA 1DLEA 4HGCA 3ZVBA 1MUEB 4B71A 3RXHA 9LPRA 4XE4A 1FY4A 4CR9A 1BMAA 1P2NA 1F5RA 3SJ8A 2BZAA 2GD4B 2SGQE 4X8VH 4Y71A 3S0NA 1OP2A 1KIGH 2W6ID 3GCOA 1MH0A 1BOQA 5DJ7A 1TGSZ 2WV4A 2FLBH 4GCHF 4UE7H 1K28D 3LOXA 4WJG2 1AB9B 3RXIA 4GPGA 1O30A 1XXFA 1GCTB 1HNEE 2YOLA 4JZEH 4B76A 1CGJE 4X2VA 4D9QA 1HAZB 1L4ZA 4FU8A 2B0FA 5EJLA 3PB1E 3LU9B 4JMYA 3A8BA 1OP0A 1WSSH 4H6TA 5FPYA 1T32A 5EJZA 3RU4D 4ABBA 1SGRE 3U8RH 1OWHA 4YO9A 2PHBA 1W0ZU 2ILNA 2NU0E 2PW8H 3LGVA 3GCTG 1T4UH 2EI8A 1C9PA 1YY3A 1GJ4H 1COWD 4B2BA 4X1NU 3UIRA 5B6LA 4WVPE 2R2WU 1P02A 3AW0A 3UOPA 1YCPM 1YPKH 1B0FA 2F3CE 5DP5A 1MCVA 1UW7A 1YBWA 2TGPZ 1P3CA 2ZTZA 4YLUA 3SV2H 2H9EH 1NZQH 1IQHA 3PV5A 4ISHH 2G4TA 3QDZB 3SW2B 1TLDA 3DHKH 4M7GA 3MFJA 1GI4A 2EI6A 3RXRA 5JBTA 2FZZA 4B6EA 1GJ8B 3SZEA 1PPEE 2BLOA 3RMLH 4X8SH 1V2MT 1EUFA 4MNVA 1UTPA 2QYIA 3QGNB 3A86A 2AHME 4Y8ZA 3SV8A 3ZV8A 2BD5A 2PSXA 3HKJB 1BA8B 2FI5E 2W5EA 2QC2A 1XUJA 1G37A 3SQEE 1UMAH 2V3HH 5HYOA 1UTNA 3ITIA 3L33A 3TGIE 2XBWA 3ZZDA 2PTNA 1AKSA 3A8AA 4CBOA 2HNTE 3KGPA 3F1SB 1K2I1 4I31A 3CS0A 1GBHA 1JMOH 2H6MA 2PFEA 3LH3A 3MWIU 1D6WA 3A83A 2IOTA 1W13U 3UTUH 2BY5X 5GPIB 1OWDA 1CU1A 1UCYE 1SC8U 1QJ1B 1ARBA 1TQ0B 2ZCHP 1AY6H 4Z0KA 3DSPA 3URCA 3F9EA 1P57B 1KDQA 1E1QD 4X2YA 3SNAA 1G3DA 4NSVA 3UY9A 3RXDA 4TY7A 1S6FA 4ZMAH 1BHXF 1O37A 3UOUA 2D2DA 2R0KA 6LPRA 4K3JA 1AI8H 4I8KA 1GCDA 3T26A 8GCHG 3GYLB 1GHYH 5L2ZH 3HPTB 2ASUB 1UTOA 1EJMA 2H9TH 3MH5A 1EAIA 3P95A 9ESTA 2G5NA 2ALVA 3P8GA 4VGCC 1SMFE 5IDKA 2JH6D 5C94A 2HNTF 5F53A 5AVDA 3M3VA 2Y80A 1OHHD 2CF8H 1W0KD 3RUOA 4CHAC 2ANMH 3TITA 4TT3D 1K1OA 1SLVB 2AGGX 1MZDA 1O3HA 1VGCB 1CGIE 3GY7A 3OAAD 1KTTB 1OKXA 1WDIA 3KQ5A 1KXFA 1C2GA 7GCHF 3UNSA 1AFQC 3RXFA 5A09A 1O2QA 3U69H 1HIAA 4DIIH 1O2MA 2AH4X 1NRSH 1PJPA 2OQ5A 1A5IA 1LVOA 2XTTB 3NKKA 1E1RD 1DS2E 2O8LA 2BXUH 4DJZB 5BRRE 1TRYA 3F0PA 2CXVA 2B8OH 4NIWA 2KCAA 5C0TA 3M36A 4I86A 5JB9S 1SOTA 2ULLA 1KTSB 1RS0A 2BD2A 2Y82A 1C4V2 1TPSA 3CP7A 4O3UA 1EP5A 2AGIX 1AU8A 2GT8A 1ANEA 4FUBA 1P2OA 3N7DA 4MLFB 2BY7X 3T5FH 4NA9H 1GI9B 3ENSB 4X6NA 1IQEA 4RN6A 3AK5A 4X2XA 5A8XA 1TOMH 3Q3YA 3KYGA 5KGOA 4TSFD 4RKOB 2PUQH 5T6DA 1EAXA 1W3CA 1HXFH 4HTCH 2KM0A 2A5AA 4RKJB 1B7XB 4HG6A 4U2WA 1HJ9A 1IQGA 1FX0B 2CK3D 2F4LA 1GMCG 2G00A 4CRFA 1CA0C 5F8TA 2KCPA 3GDVA 1EASA 3F2GA 5EXLA 2A45B 3ZZ9A 2B7DH 1K1NA 2Z6BD 2L74A 1MAXA 1A5GH 2XBVA 1NRQH 1WQSA 1TX6A 5GJ4B 2GCTC 1QCPA 3T2NA 2THFB 6GCHF 1HAVB 2ZI2H 3KQEA 3RXKA 3IG6B 2BVSH 4X1PU 1SLWB 3UQOA 7LPRA 3LJOA 2BQ7B 1GL1A 3VFEA 4FVDA 2BDAA 2HPPH 3UWJH 1CE5A 1IQKA 3STIA 1O2RA 3SN8A 1AKSB 4DT7B 3OX7U 1HFDA 4K1SA 3GCHC 2QY0B 2IJOB 1Q3XA 3LH1A 4YTAA 1GJ5H 3CNRA 1OXGA 1WU1A 2A7JA 1ZPCA 2A32A 3ZZ4A 4U32A 4XBBA 3JZ1B 2OBOA 4GAWA 1IQNA 4P02A 5HGGA 4Q63A 5ESTE 2QGRA 1LHCH 2Z3EA 1E37B 3MH7A 5DP6A 2ZHFH 4K5ZA 1TMBH 1SGFA 2C93B 2XOKD 1KDQB 3QK1A 3RMNH 4NCYA 1S85A 1AUJA 5C0UA 3BG8A 3VB3A 1GBIA 5EIYA 4ZH8A 3K6ZA 2RA3A 2A5IA 1WOFA 2C8XB 2OD3B 1FPCH 1O2GH 1NRPH 3Q3XA 1ESBA 2VH0A 1H8IH 4FU7A 2Z9KA 3T29A 1TNGA 1UK4A 1SI5H 2P59A 1AO5A 1E38B 1EB1H 3GS9A 1MD8A 3PMHB 2QE7D 5EXNA 1AE5A 3SJKA 5EW1H 1A3BH 1QB1A 1BJVA 3MU8A 2BDGA 1BQYA 1EAUA 2LELA 5GCHG 2ZP0H 1UTQA 1SKYE 2FIRH 5CE1A 1F0TA 2BD9A 5DGJA 1W0YH 1YLDA 5ETXA 4ABDA 1H9IE 4DG4A 1L2EA 4VGCB 2ZGBH 1WV7H 4Y76A 2GV6A 4ACAA 4GLYA 3FP7E 5E0GA 3O8CA 1WAYB 1HB0B 1IQLA 4O97A 1HIAB 2P16A 2B5TB 4ESTE 2ZIQH 2R3YA 3KCGH 4X8TH 1SGFG 1QRWA 3SNBA 2FODA 2ODYB 4Q80A 1A3EH 4WXVA 2G8TA 1NRNH 2FOMB 1AFQB 1TFXA 3SNEA 3K2UA 1LVYA 2BD7A 2XC5A 1GDNA 4AGKA 5F6MA 4Q7YA 1BRBE 1Y5UT 4I7YH 1AWHB 4UFEH 1GBDA 3IITA 3N7OA 1YKTA 5HIZA 3SNCA 4NSYA 1SGDE 1NY22 2OINA 2QIQA 1O3BA 1KY9A 3Q76A 1D3DB 2BLWA 2RFKC 5DP3A 4DOQA 1SHYA 1BMLA 4KP0A 1CT2E 1YPGH 3GCNA 1A46H 5EQSA 1S5SA 3UNRA 1DLKB 3S9CA 3ATIA 2GZ9A 3E6PH 2WV5A 1O2XA 1MAYA 2ZCLP 2J97A 1MABB 4TWWA 2HVYB 1O35A 1CHOG 3S9BA 4R8TB 1PPCE 2C90B 4B1TA 3PRDA 5IK2D 4MPVA 1TX7A 2BYAX 1CA0B 3GY4A 3HK3B 1ETTH 2IJD1 2A4OA 5CHBA 1AVXA 5LGOA 1PYTD 3AASA 1RTLA 1GG6C 4CRCA 3FP6E 4NIVA 2GMTC 4ISLA 1LHGH 1TX8A 1WXRA 5C67A 1PQ8A 1AGJA 4I8JA 1E79D 3EA9A 3NK8A 1GJ9B 1EX3A 1W8BH 1O5CB 2GCTB 1V3XA 3OY5U 4AB8A 4WMDA 2V35A 1A1RA 1DE7H 1O3FA 3UR6A 1O39A 4H4FA 2G81E 4ISOA 1LKAA 1LVMA 1AUTC 3BTGE 2BLVA 1Z8IB 2PGQB 1TWXB 3AVZA 1W10U 4HFPB 1C5YB 4TPIZ 1AVWA 1CT4E 4KKDA 5ABWA 2V0BA 3VEQB 2FI3E 3ZZ5A 2FOGA 2PLXA 2UUYA 1BUIA 2F9BH 3CENA 1BTPA 3D49H 4YZUA 1D6RA 1CO7E 1O2NA 2HOBA 1BB0B 1NN6A 2BY6X 2G55A 1IAUA 2VU8E 2A2XH 1V2OT 2OC0A 1NFWA 1NO9H 1QJ7B 1QHRB 2Q6DA 1V2RT 1DY9A 2BY8X 1Y3VA 3GY6A 1EZUC 3VB6A 4Q4LA 2P8OB 3QZRA 1YPEH 3EDXB 1EOLA 4RI0A 5FCKA 1AWFH 1HRTH 1G2MA 2VNTA 1MTVA 1WYKA 1V2WT 2QCYA 1MKWH 5EU8A 1O32A 1P10A 3U9AH 1AHTH 5FXLA 1NROH 2ZDVH 2OQUA 4RT0A 2NU4E 4ABIA 1K9OE 2SGAA 1HAPH 1XUHA 3E0PB 1NBMD 6CHAB 2FI4E 2ZC9H 2W7UA 4NZQA 2A31A 1T7CA 1VITG 3SQHE 1L1NA 4WMEA 4XOJA 1H4WA 2O8MA 3SUGA 3TGJE 1WTGH 3L6PA 5FCRA 2ZGCA 2BTCE 3U1IB 2GTBA 1A0JA 3G01A 3M5NA 3RM0H 2V3MA 2CMYA 2BB4A 1SFIA 2VJ1A 4X6PA 3FANA 3MNBA 4D7FA 3QUMP 2A4RA 1MKWK 3H7OA 1AE8H 1P09A 2O8UA 1TYNA 2GJGA 1HGTH 1C5SA 1H8ED 1C1QA 3ATWA 3UB0A 1NFYA 1HYLA 3P70B 2ZTXA 1TMUH 3OEED 4Y7AA 3H7TA 3SUFA 4WH6A 5A2MH 1JRTA 1PQ7A 2HVXA 3SU1A 4INKA 3RC6A 4M9FA 1CA8B 4I32A 1UTLM 3GCTF 7ESTE 3RXQA 1G3BA 3A81A 2I6SA 2KR7A 2ZU1A 5C3NA 1V2JT 3ZZCA 1O2UA 3O8RA 4O03A 3M35A 3NWUA 1MTSA 3VG8A 3QN7A 1LKBA 2XCFA 1HAYB 2XWAA 5FPTA 3UR9A 4PROA 2W7SA 3SU4A 1HAHH 3PWBA 1S81A 1VCQA 3GYMA 4FUCA 1WBGB 2HALA 4K60A 1CSOE 3DT0H 3O8BA 3SJ9A 1ESTA 2F9UA 4A1VA 3RC4A 1RGQA 4TPYA 1UVPA 1C5UA 2XCNA 1KLIH 1XUKA 1HUTH 1ZGIA 2GCHG 1D4PB 1OPHB 3GY3A 4JK5A 2A0QB 3U8TH 1DWBH 2ZGHA 1CT0E 2BOKA 3EAJA 1GWAA 4SGBE 1ELGA 1W11U 2ZFPH 3BIVH 2WPHS 3SU2A 4AFQA 3KYFA 4E05H 4AC9A 4ZXYH 3TK5A 5DPAA 1PPHE 3SV6A 1V2LT 2BD8A 1GHZA 1K22H 4JYUH 1NFUA 4A1TA 3FN8A 1GHAG 2GP9B 3LJJA 2BDBA 1PPZA 2BM2A 4BXSA 4AYYB 3OY6U 1IQJA 2V3OH 2XW9A 2AYWA 1MZAA 1ZJDA 2FYRA 1ZSKA 1BRUP 4J2YB 4B73A 1PPGE 2ALPA 1V2NT 2H9HA 4GCHG 3ODFA 1O36A 1O2ZA 3I77A 1UVOA 2F91A 1GHBG 5E0JA 1TNLA 1GG6B 1GI7B 2R3UA 4O9VA 2GMTB 3Q3KA 3F2FA 2ZDNA 1HAGE 5AFYH 1EPTC 1LQEA 3QTOH 1HDTH 1MU6B 3RXAA 3TU7H 2WHXA 1UCYH 1C2FA 1Y3WA 3BEIB 4MQAA 3AW1A 5GDSH 4OS2A 3Q77A 3U28C 1VKYA 2OP9A 3BTQE 8GCHF 3SHAH 3U98H 1FLEE 3SBKA 1EPTA 2P3TB 4IMQA 2ANYA 3TJVA 1C1NA 3FKSD 1RTKA 3BF6H 4NIXA 2M5TA 4XDEA 1FQ3A 2CV3A 1AIXH 1QL7A 2A1DB 1LVBA 5HIYA 1KMHB 1P8VC 1HBTH 1OWEA 5TJXA 1GBAA 2A5KA 5C5NA 1DX5M 5K0HA 1O3IA 4X1RU 1GBFA 5G4BA 1J8AA 2J92A 3VB4A 1EOJA 1C2KA 2FPZA 3MTYA 1FN8A 1TIOA 1T8MA 1S0RA 1C1OA 4U30A 3LONA 4Y79A 3LGIA 2FS8A 1ELBA 1K1IA 3KHVA 2F43B 3SOSA 3ZVAA 1YGCH 2K1QA 1UCYK 1DOJA 2J4IA 1K1LA 3W95A 4WWYA 1BIOA 3S9AA 1PYTC 2SGFE 1O0DH 4X8UH 3ZZ6A 3PV2A 1DSTA 4X6MA 3E8LA 3FZDA 1P03A 4D7GA 2UWLA 3FZZA 2Z3DA 2STAE 1MCTA 3QX5H 3A82A 3KN2A 3LGUA 4AOQA 2D26C 5CHAC 2A4GA 3IWMA 1CHGA 3SGBE 5I46H 3BEUA 2O8TA 2GKVE 3DA9B 1A5HA 3FVFB 3T62A 3RU4T 1ZMJA 4OS7A 1MD7A 4ACBA 2Y5GA 5F8XA 3F3BA 3HK6B 1KXEA 5E2PA 2BDIA 5GNDA 4YLQH 1MQ5A 3EQ0H 5L2YH 4NA8A 1TNKA 1Z8JB 2BHGA 4Q7XA 3B9FH 2NU1E 3ESTA 2BD3A 5T6FA 3TJNA 5C5OA 1O31A 3EGKH 4IN2A 3MO9A 3V12A 3A84A 1F0UA 2ZPQA 3URDA 5A8ZA 3N7EA 5C20A 2ZHEH 1TA6A 4XRNA 5DN6D 2UWOA 1KLJH 1GJDB 2UUFB 1SGQE 1BBRE 4K2YA 1TRMA 1HAIH 3PMAB 3D65E 3P92A 2ZECA 4BAOB 3QZQA 2BMGB 2G52A 1JRSA 2ZU3A 3RXGA 1J17T 4UEHH 2RG3A 2ZFQH 2C4FH 2PSYA 3TJUA 1DITH 4K1EA 1SPJA 2NWNA 4KTUA 4X6OA 4CRDA 4X1SU 3M5MA 3M3TA 1GHWH 3TH4H 1NBME 2XXLA 4DY7B 2UUJB 2WPJS 5J4SA 5FBIA 3BV9B 1TE0A 3F6UH 4KTCA 1BRCE 4H6SB 2VIOA 4JCNA 2XWBI 3E91A 3OTJE 4GSOA 3K65B 1YCPH 1SLUB 1TPAE 1BMFD 4NGAH 5GIBA 1PQAA 1C1TA 1FPHH 1FNIA 4DIHH 4UFGH 3RXCA 2PKSC 2Y5HA 1DXPA 2ZZUH 3BIUH 3ELAH 3GDUA 3TK9A 1HCGA 3MYWA 3SJIA 1S6LA 1AZZA 2CHAC 4Z6AH 2JKHA 4FETA 4MNYA 2BQWB 3A89A 4F49A 5GXPA 1AVGH 1GL0E 4ABFA 2EQNA 4FUJA 1ZLRA 4ZUHA 3SJOA 3DFLA 1Y5AT 3SV9A 1UTJA 3ZZBA 5F8ZA 5PTPA 2ZDLA 5FBEA 3STJA 1LPGB 1SQRA 4U01A 5IYTA 5HM9A 1SG8B 2WYGA 3WY8A 1HJ8A 2VWMA 1LMWB 1K1PA 3PM3A 4FU9A 3ZZ3A 1YCPK 2FEQH 5DO4H 1SQOA 3OTPA 1EKBB 1AN1E 1L1JA 3BTEE 4F55A 1GMDG 3KNXA 4DT4A 1DUEA 1MBMA 2NU3E 3VPKA 1H9HE 3RMMH 8LPRA 1KSNA 1C1VH 1Z1JA 1MKXH 2RDEA 2HWLB 3ZYEA 2F9OA 5HM2A 1N6YA 1OP8A 3TLOA 1TQ7B 1L4DA 1SOZA 1Z8GA 2VVVA 3B23B 5EGMA 2VVUA 1VJAU 2PTCE 1WTHD 3ATKA 4JYTA 1BTZA 1GMHF 3DCLA 3UFAA 1EPTB 2VINA 5FHTA 1NESE 2TGDA 4UD9H 3SV7A 1PQ5A 2Z9JA 1GVZA 1GPZA 1YPJH 2ODPA 3WW7A 2B9LA 1BCUH 4AG2A 2O9QA 1ABIH 1MTNC 2W3KA 2HLCA 4MNXA 1QURH 3M7TA 1VCWA 4GUXA 5GCHF 1GGDC 1RTFB 3TH2H 3ZV9A 4ZKOU 2VIVA 3UREA 4X2WA 1FY1A 1NC6A 1F0SA 1TPPA 4OS4A 1MKXK
chains in the Genus database with same CATH topology
1A2CH 1XKBC 4I8GA 3F68H 2BVXH 1PPFE 4IN1A 4Y11E 1PFXC 3NCLA 3RXMA 3M3SA 3GOVB 1AFEH 3ZZ8A 1IHTH 4INLA 2VIPA 2RDLA 2J38A 3RP2A 2DUCA 1S82A 3SI3H 2QXIA 1Q2WA 1ZSLA 4MNWA 2A7CA 3C1KA 2G5VA 5T6GA 5JB8S 1BTYA 3RXTA 2ZU4A 8KME2 4B74A 4CRGA 2XBYA 1UO6A 2ZEBA 1TRNA 3SZNA 1GVLA 1C1UH 1SQAA 2JH5D 1XUFA 2VB0A 5CHAB 1GJ6A 1P05A 3M37A 4Q2KA 4J1YA 1O3OA 1QIXB 1Y3XA 3GY2A 3L3TA 3MU5A 1JXPA 4GVUA 3LGYA 4LZ1H 3NPSA 4CHAB 2G4UA 1N8OC 1GBCA 2Y7XA 4BAKB 1QBOA 3PMJA 1XM1A 2FYQA 3TIUA 3A87A 1G9IE 1UHBA 4Y0ZE 2OCVB 4IS5A 4YOGA 1IOEA 1V2QT 2GVFA 2SGEE 1N1LA 2FOEA 7KMEH 2FOCA 1LO6A 2J34A 1MBQA 1SHHB 4LK4A 1QL8A 2ZDAH 2QA9E 1CVWH 2BQ6B 1ANBA 4E06H 4INHA 1O34A 1T8NA 1F5KU 1AZ8A 1YF4A 4Y0YE 4LOYH 3PO1C 4NWLA 3KQCA 2EI7A 1BJUA 2PWXA 1FDPA 2OC1A 2GV7A 1EZQA 3RXPA 2Y81A 1C2DA 5K7RA 1W7GH 3A7TA 3BTME 2ZHQH 4Y8YA 1GHXH 2Q6GA 3SHCH 4K8YA 1ZMNA 4B75A 5JBBS 5FX6A 1TB6H 1YM0A 3M5LA 1HLTH 1GDQA 1RIWC 1T8OA 1GBMA 1C4Y2 5DP8A 3TK6A 4FUDA 2BZ6H 2HGTH 4KELA 3TPIZ 1G3CA 1DWCH 3FAOA 3ODDA 5AHGH 1G36A 3EA8A 3TGKE 2OLGA 1O2HA 3VGCC 2PKSB 1OWKA 1O2OA 2OUAA 2Y5FA 3P6ZB 3PV4A 3MU4A 3UWIA 2CHAB 3BTWE 1XMNB 1YYY1 2F9NA 3UNQA 3MH4A 4I8LA 1S84A 2VWLA 2ZF0H 5E2OA 1EZSC 2TGAA 2VWNA 3P8NA 4JK6A 1DWEH 3MNCA 1UVUH 1F0RA 2FS9A 2BDHA 1H8DH 5GWZA 3FP8E 1V2TT 3T28A 2WPMS 1S0QA 1SGIB 1OYQA 1QR3E 1W14U 1P9UA 2VWOA 3SU5A 3RLYH 3QLPH 2ESTE 1V2ST 2HPQH 4FVBA 3AAUA 4NFEA 3TH3H 1BTUA 4MTBA 2FESH 4ABAA 2RCEA 1FAKH 1BDAA 4NIYA 2W3IA 2XNIA 1IHSH 3BTHE 2ZNKH 1HXEH 1H1BA 3I29A 2TGTA 1V2VT 4IW4E 3MHWU 2ZFFH 1X7AC 3GCHB 4GHTA 2XC4A 1C5MD 2QN5T 1HJAC 2QV1A 1O33A 1TGTA 1QA0A 1VITF 1XX9A 3Q00A 4CR5A 4ZXXH 2FO9A 2BLQA 2P95A 2ZTYA 3TJOA 1QJ6B 2WUBA 3ZVFA 2BDYA 3FFGA 3OSYA 4AZ2B 4NFFA 1SLXB 2F9PA 1Y5BT 3A7XA 1MTNB 1QB6A 1SBWA 1C1SA 4AX9H 1VCPA 1TBQH 1GGDB 1THPB 1S6HA 3SNDA 4BAMB 1INCA 2O8WA 1JIRA 1ZOMA 1DM4B 2ZFRH 4AB9A 4OS1A 1ELEE 3V3MA 2QAAA 3VB7A 3BEFB 4FUIA 1WCZA 2H5DA 3GISB 1HAOH 2ZDKA 1HPGA 1JBUH 5JBAS 3PTNA 3MOCA 3UQVA 4E7NA 2AIPA 5A8YA 4NG9H 1O3CA 2ZGJA 5LPEA 1DWDH 4OGYA 1ABJH 3LC3A 3SGAE 3M7QA 1ZSJA 4UONA 1FY8E 5DP7A 4Y6DA 1DPOA 1ZR0A 2VIWA 1FIWA 2AEIH 1CQQA 1C5PA 2JH0D 3I78A 1O2VA 5EODA 2TBSA 2ZO3H 1QRXA 1P3EA 2DE9A 1QFKH 5EQRA 1C2MA 1UHBB 3RC5A 4H42U 2GCHF 1ZPZA 4XSKU 2C8YB 2J94A 1QQUA 4LXBH 1H9LB 1BRAA 1N8OB 4WMFA 1ELDE 4D9RA 1IQMA 2OTVA 3KQBA 1THSH 4NWKA 4AFZA 1G30B 3A8CA 1KXCA 2C8ZB 1GJCB 4DW2U 2AIQA 2GZ8A 2ZCKP 1NU9A 4BAQB 1Z1IA 1RJXB 1SGCA 2Q6FA 4OS5A 3ZZ7A 3BTDE 3T27A 2STBE 4A5TS 1FN6A 4K1TA 4R0IA 4LZ4B 1C2LA 1LCYA 4AFSA 1T4VH 4E7RG 1GHAF 2YNBA 4K8BA 2GT7A 2CJIA 3SU0A 1O3PB 3U8OH 1YPHE 2D1JA 3ZVCA 5C1XA 1BZXE 1O3KA 1Z71A 3GY5A 1DVAH 1P06A 1P2KA 2IPHA 2W26A 3PO1B 1LPZB 1G3EA 1YPHC 1W7XH 1GJAB 2SGDE 4HZHA 2ZDMA 1LHFH 4FXGH 3U1JB 1GHBF 2FMJA 3M61U 1FV9A 4AN7A 2VVCA 1U6QA 1GI3A 2BOHB 2VIQA 2ZQ1A 1EJAA 1O5DH 1XVMA 3GICB 5BPEA 3ZYDA 4ABHA 4MPWA 1KYNA 1QL9A 2ANWA 1NM6A 2CN0H 3SO3A 1FIZA 1RIWB 2TIOA 1BT7A 1GI6A 1T31A 3RXEA 1D3QB 1RRKA 1L1GA 5AFZH 3VGCB 1GBEA 1C5VA 1XXDA 2A4QA 2WUCA 2ZQ2A 5DK1A 1WUNH 2F9VA 1A61H 2FWWA 2ODQA 1ZPBA 4ZHAA 1C5NH 1YP9A 3ATMA 3PWCA 4I33A 5HXFA 1GI0A 1CBWC 3QO6A 1EXFA 3PROA 1OWIA 3EA7A 1ELCA 4DCDA 3LT3A 3QTVH 5ESBA 1HAVA 5EQQA 1LHEH 1C5TA 1D9IA 3RMOH 2DE8A 1C5XB 1GHVH 3GDSA 4MG3A 1ELFA 1N6XA 4BOHA 2I6QA 5E0HA 2V6NA 2BXTH 5T3HA 3W94A 1ID5H 3PMBB 4CRAA 2P3FH 2R9PA 4ZKSU 5EPYA 2XBXA 3T25A 1ZMLA 2BX3A 1T8LA 1EQ9A 1UJ1A 1E35B 1NT1A 2XC0A 1LTOA 1HJAB 1YPMH 2FTLE 5EG4A 5A0BA 2HNTC 1Z7KA 2ZU2A 4CH2B 2FP7B 1C5WB 1QQ4A 1TONA 4YT7H 1O5BB 2Z9GA 5H4IB 3RXBA 1P12E 2Z3CA 1DSUA 3S7KB 2LNCA 1RD3B 1SGEE 3D62A 3MI4A 3SUDA 1TGCA 3SUEA 3RXUA 2HRVA 1K1MA 4TY6A 5C1YA 2Z9LA 1TAWA 1THRH 1BMMH 5EW2H 1ZJKA 3F9GA 4ZKRU 1Y3YA 2WPKS 3C27B 1P01A 5A0AE 2FM2A 1P2MA 1O3GA 4SGAE 3A8DA 1BTHH 4UDWH 5C2ZA 3UUZA 2GDDA 2PKAA 1BBRH 1O5EH 2ZA5A 1EATA 4I8HA 1O2WA 5I25A 1FAXA 4CRBA 1FI8A 3A7YA 1J14A 1UVTH 2CGAA 2P3UB 3CS7A 4THNH 1NTPA 1P2IA 5CMXH 3R3GB 4BXWA 3TVJB 1QBVH 3VB5A 2QXHA 1SFQB 1RFNA 1ZYOA 2P93A 2SNVA 1ESAA 2OC7A 2QXGA 3MO6A 5FAHA 3OYPA 1LPKB 3E0NB 4Q7ZA 1GMCF 1BITA 1C5QA 4AG1A 2SGPE 1NU7B 1D3PB 2CF9H 5EXMA 2PR3A 3EYDA 1SGPE 1FZZA 1L0ZA 1TALA 2UUKB 1AQ7A 1O2JA 3F9FA 2NU2E 2VGCC 1TBZH 1BBRK 3P8OA 2VIDA 2ZFSA 1O3DA 4XFQA 5L6NH 4UFDH 3DD2H 4Y10E 2H5CA 1ZTLA 4BTIB 1O3LA 3SGQE 3KL6A 4WF8A 4ZAEA 5DP9A 4HI3A 2ZHWH 3ZVEA 1QBNA 1F5LA 1OYTH 2OBQA 2ZU5A 3DUXH 1Y59T 3HGNA 1TMTH 3KIDU 4ISIH 3B8JA 2AMQA 1PPBH 2C8WB 3VXFH 1F7ZA 5LH8A 1MMJN 7GCHG 1TNHA 1GDUA 1GMDF 2ZHDA 1O5FH 3UPEA 1MQ6A 4ASHA 5JDUB 2Z9IA 1C2IA 2FOAA 4JZDH 1TOCB 1O3EA 1O2PA 1NFXA 1O3NA 3OU0A 5LPFA 1UK2A 1NS3A 3E90B 4BNRA 1G2LA 4A7IB 1DDJA 4WXIA 3BSQA 1A4WH 3PLBA 2J95A 2ZKSA 1ZRKA 1KXAA 1QY6A 3KEEA 3D23A 1O3JA 3RXLA 3LGWA 1QRZA 2D8WA 4DURA 1FJSA 2WINI 2FOBA 2J9NA 2FDAA 3BTFE 3PTBA 1DUAA 2BY9X 2AS9A 1ZRBA 1SVPA 2WPIS 3NUMA 1SSXA 1OWJA 1KXDA 4X1QU 2ZPRA 3LDXH 3SU3A 1O3AA 1ANCA 1C5RA 3KQDA 1BTWA 3PLPA 1V2UT 3HKIB 2ZFTA 1C1RA 1QGFA 3A88A 1CBWB 4NA7A 1C2EA 2R0LA 1VZQH 1EAWA 1TGNA 1ARCA 1FONA 2JETC 4BANB 3DFJA 4FUFA 3BTKE 1MTUA 1SGNE 1ZGVA 1YLCA 3V13A 1TABE 1A0LA 2G51A 3RU4E 1SGYE 1BHXB 1ELAA 4ZHMU 2ZWLH 5TCCA 6GCHG 1V6DA 2GZ7A 2P8OC 2GGVB 1AD8H 4F4OC 4NZLA 3BTTE 5EOKA 4AORA 2IN2A 4IC6A 2SFAA 1ZHMA 4FUGA 1VJ9U 2PV9B 1EB2A 3RXOA 2AERH 3M7UA 1KXBA 1TGBA 4WH8A 4WY3A 3MNXA 3PLKA 3MMGA 2GX4A 3RM2H 5J4QA 1C1WH 2LPRA 3BG4C 1SQTA 1C1PA 4A92A 1C5LH 1P0SH 1LDTT 1V2PT 1TPOA 2ZGXH 8ESTE 3O8DA 4IC5A 1F2SE 1DICA 2R2MB 6CHAC 5B6OA 4CBNA 1GMHG 1P2JA 4YESB 3SU6A 1FY3A 4X0WU 1O2TA 2PKAB 3M5OA 5FPSA 1ELTA 1IQFA 1ANDA 1SR5C 4JZFH 1NPMA 2RA0A 3S69A 5E8EH 3MU0A 3V7TA 1JIMA 1JOUB 2VH6A 5JYIA 4FUEA 3A80A 1SL3A 2QF0A 4ABEA 4D76A 3MO3A 3A85A 1SGTA 4DVAU 1YPLH 3ATLA 3E3TA 1DANH 3SORA 2F83A 3JZ2B 1FUJA 3TNSA 4KTSA 1Y8TA 1G32B 1HV7A 1ACBE 2PUXB 4O3TA 1ETSH 4AFUA 2XYAA 2KAIA 2OC8A 1ZTKA 4IMZA 4RSPA 1GVKB 1AMHA 1CHOF 4YOIA 1ZTJA 1GBLA 1DY8A 2A2QH 3NZIA 1FY5A 1BMNH 2XRCA 3LGTA 1HAXB 2BVRH 2Z7FE 3MU1A 1AB9C 4JZ1A 4CH8B 5F03A 2UWPA 1GCTC 1GBKA 1GI1A 2C3SA 4ABJA 4AGJA 2AFQB 1JWTA 2FX4A 2VGCB 3LIWA 3V0XA 1Y3UA 2EA3A 4OS6A 1EP6A 1Z6EA 5LPRA 1ZHRA 1E36B 4GHQA 1D3TB 1O2YA 3KF2A 3TNTA 1UTKA 1VITH 1QB9A 3P8FA 1O2IA 2Y6TA 1TA2A 1FMGA 1OX1A 4QT8C 4ZROA 5DG6A 2EC9H 4FUHA 1ZHPA 1IQIA 2GDEH 3RXJA 5HMAA 2FOHA 3ZVDA 1P11E 3H5CB 4YT6H 1UK3A 1C5ZB 1W12U 4YM9A 4MDSA 3QWCH 1TNIA 4ABGA 3MNSA 3ZVGA 3F9HA 2Y7ZA 2TRMA 4KGAA 5AF9H 5L30H 1XKAC 5DKMA 4YOJA 6ESTA 1V2KT 3RXSA 1O5GH 4MVNA 1GI8B 1ELVA 1A7SA 2ANKH 3SI4H 1S83A 2FLRH 1C5OH 4OGXA 3A7ZA 3LKWA 4ISNA 3LC5A 4JYVH 1C2JA 1QTFA 4BAHB 1LQDB 2FOFA 4BTTB 2P94A 3RXVA 2H2ZA 3P17H 4CREA 2ZPSA 5EPNA 1SB1H 1MTWA 2SNWA 3K9XB 3VXEH 5A0CA 1J16A 4AYVB 1ORFA 1O2SA 1P2QA 3BN9A 2FTMA 4DGJA 2EEKA 3PYHA 3LPRA 3MH6A 3HGPA 4MPUA 3ZZAA 4Y8XA 2QF3A 5FX5A 1DXWA 2TPIZ 2A7HA 2BD4A 5DP4A 4ZHLU 1XVOA 1OSSA 5TCAA 2AMPA 4B2AA 1DT2A 4TWYA 1CGHA 2WYJA 1ETRH 1B0EA 3A7WA 1ZZZA 1E0FD 1GBJA 1GBTA 2JETB 2BX4A 3R0FA 4XBDA 1O2KA 2AMDA 1J15A 1QA7A 2YNAA 1K21H 3A7VA 1TNJA 1GI5A 4A1XA 1GJ7B 1C2HA 3RDZA 1KLTA 1FXYA 3NXPA 3EE0B 1O3MA 1M9UA 2OXSA 3E1XB 1F92A 1GBBA 1DFPA 2QXJA 1NRRH 2J2UA 1LHDH 1Z8RA 3GY8A 1O5AB 1E34B 1OOKB 4Y7BA 1GJBB 1P04A 1VR1H 1XUIA 5JBCS 4K69A 2ZG0H 3AAVA 4JZIA 1B5GH 2Q1JA 3HATH 5SGAE 1MU8B 1P9SA 1BTXA 1RXPA 1C1MA 2FXRA 2BDCA 3RLWH 3BG4B 1C9TA 4D8NA 2FX6A 4IBLH 1TBRH 2AGEX 3E16B 1O2LA 1Q31A 1J9CH 4A6LA 1VGCC 1K1JA 4BTUB 2Z94A 1EJNA 4UFFH 1WQVH 3S7HB 4TYDA 4IGDA 4MPXA 1QNJA 1A0HB 1O38A 1YC0A 4B2CA 5C1UA 1UVSH 1Z6JH 1GI2A 1C4U2 3QGJA 2KAIB 1XUGA 1UTMA 1W2KH 4XBCA 3K6YA 1EZXC 2WPLS 1OS8A 4ZKNU 5JPMH 2PGBB 2H1UA 1DLEA 4HGCA 3ZVBA 1MUEB 4B71A 3RXHA 9LPRA 4XE4A 1FY4A 4CR9A 1BMAA 1P2NA 1F5RA 3SJ8A 2BZAA 2GD4B 2SGQE 4X8VH 4Y71A 3S0NA 1OP2A 1KIGH 3GCOA 1MH0A 1BOQA 5DJ7A 1TGSZ 2WV4A 2FLBH 4GCHF 4UE7H 1K28D 3LOXA 4WJG2 1AB9B 3RXIA 4GPGA 1O30A 1XXFA 1GCTB 1HNEE 2YOLA 4JZEH 4B76A 1CGJE 4X2VA 4D9QA 1HAZB 1L4ZA 4FU8A 2B0FA