1GCDA

Refined crystal structure of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
237
Chain Sequence
CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structures of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(serine proteinase)
molecule keywords GAMMA-CHYMOTRYPSIN
total genus 50
structure length 237
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1994-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA01
3RXLA 3SU1A 1GI7B 1OWJA 5AFZH 4DOQA 4AFUA 1TRNA 1ELFA 3UOUA 1O36A 3TITA 4MNYA 1P0SH 2W26A 1MKXK 1GBCA 2BD7A 2PSXA 4JZFH 1C5NH 1SGYE 1W8BH 1O3EA 2QA9E 1P3CA 4DW2U 5A8XA 1H8IH 2GZ8A 1ZOMA 1LPKB 1H9IE 1C4U2 4HTCH 2HPQH 1ZRKA 5GCHG 4F4OC 1ZPZA 2H9TH 2PKAB 2PFEA 1UVUH 3PV4A 1MKXH 3ELAH 1NO9H 3UREA 3GDVA 5FX5A 1BTWA 1GMDG 2VVVA 1XUHA 1ZTLA 1G2LA 1AFQC 1LQDB 1OYQA 5E0GA 4X1SU 5L2YH 1BHXF 3ZV8A 1KIGH 4JZDH 4A6LA 1JMOH 5LH8A 5LGOA 1NT1A 2W5EA 4AFZA 1JRSA 3BTQE 3DUXH 2NWNA 1LPGB 1GBJA 1VCPA 2VWNA 1O2IA 1QQ4A 4KP0A 1ACBE 3LU9B 3BEFB 1SHYA 1J17T 4H4FA 1C2FA 1RD3B 1GCTB 2A45B 2SNWA 4YTAA 4LZ4B 1FY8E 2AIQA 1YPGH 2P16A 3QX5H 4YT6H 4Y7AA 3RXFA 2GDEH 2HNTC 3TJOA 2W3KA 1IQIA 1S0RA 2P8OC 2BMGB 2UWOA 1BTYA 4QT8C 3E6PH 1QY6A 4I8LA 4UFGH 1TA2A 3R3GB 3A8BA 1P8VC 2ZFPH 3V13A 3TVJB 4B74A 1F0SA 4AYVB 4U32A 2GT7A 4FUGA 1EATA 3E0NB 4XFQA 2PUQH 3QWCH 2P3FH 3UNQA 1O2KA 1IHTH 4RSPA 4UEHH 3S7KB 1NRSH 4VGCB 2FIRH 3F9FA 1NS3A 1K1NA 1AKSA 2AGIX 2Y5FA 2HOBA 1F2SE 1Q2WA 1SSXA 1KTTB 2UUYA 3UNRA 3VGCB 1W0ZU 2ZF0H 3RU4D 1G9IE 4WY3A 2BD8A 3S9BA 3BTEE 2AGEX 2F9OA 1TMUH 1RTLA 1D3DB 2PHBA 3Q77A 1IQMA 1V2KT 1C5UA 1GPZA 3MI4A 4OS6A 4A5TS 4BAQB 1AVXA 1GHBF 1TWXB 1BJUA 2WYGA 4X2YA 2ANMH 5C5OA 3CS7A 3ODFA 2F9BH 2YNAA 3UWIA 3BTTE 3ZVFA 2ASUB 2ZU4A 3T27A 5HXFA 2BVRH 2RA3A 3UY9A 2STAE 3PO1C 2QXHA 2VIOA 4O9VA 8LPRA 4LXBH 1GI3A 1V2WT 1E0FD 1OP2A 2Y82A 2ZCHP 3LGVA 4K2YA 3KF2A 1LDTT 2RCEA 2FOBA 4D7GA 4NFFA 1HJ8A 2ZTZA 1J14A 3FZDA 3HK3B 4YO9A 1THPB 1NFYA 5A8YA 1D3TB 1AD8H 1SGFA 3BIUH 4WMEA 5GJ4B 2OC8A 1WTGH 4DIIH 1ARBA 2JKHA 1N1LA 1YGCH 1HAPH 3UQOA 1SFQB 2D26C 2BDCA 3E1XB 1XUFA 1YKTA 4H6SB 1QQUA 2FLRH 3GCHB 1QBOA 4Y8XA 2CV3A 1VCWA 1FIWA 3B8JA 2EI8A 3A7XA 1FIZA 1O3CA 1Y5AT 1EZUC 3P8NA 1SI5H 5TJXA 3SUEA 1FY3A 1C4Y2 2QXGA 3SN8A 3PLPA 1YPHC 3AAVA 1BRCE 4ISLA 1IQHA 4XBBA 5E0JA 4X1PU 2QC2A 5AFYH 1A0LA 2AGGX 2GD4B 4IC5A 1NRNH 2SGQE 3A80A 2TIOA 3T2NA 5HMAA 2WPMS 2JH0D 2VVUA 2ZZUH 2H6MA 3SBKA 1KSNA 3BSQA 1W0YH 4TY6A 1Z1IA 1NPMA 1SBWA 2ZFSA 1ZTJA 3TU7H 1AY6H 1ZHMA 4NIYA 5CHAC 4BOHA 1QR3E 5DPAA 3RXSA 4Y79A 1F5RA 3KHVA 3LT3A 1THRH 4X8TH 1QB9A 1VZQH 1A1RA 1FJSA 1C5YB 1O2QA 1BBRE 1S83A 3A7WA 1PPGE 1WSSH 3V3MA 5DP3A 3RMOH 3UOPA 3PLBA 1QRWA 2PSYA 3SJ8A 4ABAA 2WPHS 3NWUA 1Z71A 3K9XB 3BG4B 1Q31A 1O2JA 1Z8RA 2W7SA 1V3XA 2QAAA 2A5IA 1CGIE 2VH0A 1DE7H 3W95A 3TH2H 4JCNA 2Z6BD 1K2I1 3RXTA 2J34A 1ZSKA 1ELDE 1BCUH 3ZZ4A 1AVWA 1AFEH 1TOCB 4FU8A 4X2VA 2J9NA 1V2VT 3UUZA 3TJNA 1FDPA 1YP9A 3GISB 2Z3EA 2ZGCA 1V2NT 1ZJDA 1E34B 5EOKA 3SU6A 1TAWA 5FPTA 2RDLA 2P3TB 5GDSH 4CRGA 4IC6A 2BD5A 1NM6A 1CHGA 4KTSA 1RTFB 1XVOA 4K1TA 1NRQH 3ZYEA 2ZIQH 3TGKE 2ZGHA 3A87A 5GIBA 1P2NA 1O3FA 3MTYA 4ABBA 1P03A 1C1MA 4X0WU 3RXAA 2A32A 2ZHWH 5CMXH 3MYWA 1EJAA 1EUFA 1MU8B 1TALA 1QA0A 1BUIA 3UWJH 1HPGA 3M37A 1Z6JH 2FOGA 4GVUA 2ZI2H 1GMHG 1MTNB 3ZZ7A 3BEIB 1XXFA 2FOEA 5T6FA 1LQEA 2ODQA 3LC5A 4MTBA 3OYPA 2QGRA 1ANBA 3M3SA 2H1UA 3LJJA 1GHAF 3RXCA 2R2MB 2VIDA 5SGAE 4FVBA 1QJ7B 2F9UA 4NIVA 2FEQH 2VWMA 1SB1H 3Q00A 4XSKU 1XKAC 2BQWB 5EXLA 4E7RG 4NG9H 4NWLA 5F8TA 1LPZB 4WH6A 1EPTB 1O2PA 1BT7A 1F5KU 4BXSA 3M5LA 4M7GA 4JZIA 1JBUH 2NU3E 5FPSA 1F92A 1Y3VA 1TGNA 2AEIH 1GDUA 3RMLH 1QL7A 2NU0E 3BG8A 4I33A 2DE9A 2XCFA 3QN7A 4ASHA 2XRCA 1XUIA 1AWHB 5FXLA 1XM1A 5DP9A 1MTWA 5L30H 1CVWH 3EA9A 4BAMB 1TNGA 5DP7A 1A7SA 6LPRA 1IQGA 1SHHB 2QCYA 2BD2A 1GHYH 3HGPA 3P70B 4MPWA 4WF8A 1A46H 1FNIA 3VEQB 3ZZ8A 1S82A 3ZVCA 1J9CH 2YNBA 2J95A 1OPHB 1S6FA 3RM2H 2WUBA 1HXEH 3T26A 4KKDA 1B0FA 1GI5A 1BZXE 2QIQA 1GHVH 5FBIA 1YYY1 3W94A 2ZDAH 3S9AA 3SHAH 3O8CA 1ANEA 1PQAA 3WY8A 2FI5E 4DCDA 2AERH 3ZVDA 1TMTH 1GI6A 1ZR0A 1ZSLA 4ZMAH 1GG6C 1PPBH 1GJCB 1PYTC 1CE5A 1UTLM 2ZG0H 7KMEH 2BDHA 2BQ6B 2FM2A 1ELTA 1NFWA 1YF4A 4GHQA 5FCRA 1WV7H 1FXYA 1K9OE 3A83A 3E0PB 4KGAA 1WBGB 2ZDVH 3MWIU 4ABDA 4I8GA 1VITF 1QBNA 1AKSB 1SR5C 1AFQB 3E91A 3RP2A 1Y3UA 3TGJE 2OTVA 4BAHB 1PPFE 4H6TA 1DWEH 1CA8B 2Q6FA 2OC7A 1HJAC 1ZHPA 2BOKA 1EOJA 3RU4T 3ITIA 3R0FA 1NROH 1HYLA 3LGWA 2BVXH 5DP4A 3F9GA 1V2UT 2A4OA 3N7OA 1FPHH 2PKSC 1P57B 1G37A 2HALA 1IQFA 4KTUA 3VPKA 2XC0A 4JK6A 1AIXH 1SQOA 2Z9JA 3ATMA 1GBIA 2ZECA 5JDUB 3LH1A 1DWCH 3ZZ3A 1HUTH 1C1PA 1EPTA 1V2TT 4ZHMU 1W14U 1MU6B 1SGFG 3U1IB 3STJA 1C1QA 2WPKS 1QHRB 1G36A 1MCVA 3RC5A 1FAKH 4Z6AH 5FBEA 3BTME 1GI2A 3T62A 1A4WH 1BMNH 5JYIA 3M7TA 1N8OB 2ODYB 1Y3YA 1SGEE 1T4UH 3QUMP 1S81A 1RS0A 3FAOA 4A1VA 4NSVA 1LHEH 2BLWA 1VCQA 2PKSB 5JBCS 1K22H 1MKWH 2BD9A 3EDXB 2EI7A 2OC0A 1ELBA 1TX8A 1T31A 1ZSJA 1C5WB 1YPLH 3RXPA 2P3UB 2P94A 3P8FA 2V35A 1TYNA 2BDYA 2GX4A 5ABWA 4Y0ZE 4DT7B 3QLPH 3GCHC 4IN2A 3EYDA 1O2XA 1GJ9B 2FO9A 2UUFB 3UR9A 3A8CA 4FUCA 2GMTC 3GY7A 1MD8A 3D49H 1S84A 2GV7A 1C5ZB 4PROA 1KTSB 2A4GA 3V7TA 5HM2A 1O32A 3QO6A 4AG1A 4Q7XA 1N6YA 4XE4A 1AN1E 1A3BH 4AFSA 2G55A 2BD4A 1SLXB 3SGAE 1IQJA 1MQ6A 3TH3H 1IOEA 1E36B 2AFQB 2F9VA 2ZGBH 4X6NA 5EU8A 1V2ST 3PROA 3SU0A 3V12A 2B9LA 4HGCA 2EI6A 1ZLRA 1AGJA 2ZQ1A 3LONA 1SFIA 1RIWC 4CHAB 1O3KA 1TGCA 1C1SA 1GGDC 5C20A 1GMCG 5C2ZA 1VITG 2ZFQH 1O2YA 1P2KA 1FY1A 1GWAA 2FLBH 3RXQA 1BBRK 1TGBA 3D23A 2GCTC 1O38A 2VINA 4BTIB 4A1XA 1NESE 2V6NA 3GYMA 3MU8A 1D4PB 4CR9A 3GY8A 1C5XB 1EXFA 4GLYA 4DY7B 4FUFA 2Z9KA 1AE8H 1UMAH 2ZC9H 4J2YB 1SLUB 2FODA 2UUJB 5DP8A 3H5CB 2AYWA 2O8WA 1KDQA 2YOLA 3KNXA 2BQ7B 1G3BA 2A7HA 1AB9B 1FPCH 1EOLA 1WCZA 2G00A 2EA3A 4OS7A 2AS9A 1C2EA 4BTUB 4D8NA 1BMLA 1C2DA 1O3AA 3SI4H 1EX3A 5L6NH 3KQBA 3HPTB 2BDAA 4ABEA 4ABFA 1V2MT 1K1IA 1EKBB 4Y7BA 3B23B 1W2KH 3MU1A 1U6QA 5PTPA 1AWFH 1GBFA 1L1JA 2A4QA 4WH8A 4ZKOU 1W7XH 2A1DB 3P92A 3SNBA 5I46H 1DX5M 1Z8GA 3UNSA 3RXHA 1Z7KA 1SLWB 3SUDA 4SGAE 1BTZA 2A7JA 3HKJB 3SV9A 2R2WU 1GI1A 3KEEA 4RKJB 1GBDA 4MPXA 1LKBA 3KQEA 1F0TA 1ELAA 3A82A 3CENA 3LGYA 1EAWA 1N6XA 1P2QA 4UFEH 4X6MA 1GVLA 1BMAA 1HBTH 3FANA 1O5GH 2JETC 4INLA 4TY7A 5F8XA 2Q6GA 3AASA 2FPZA 4FUIA 2PR3A 1L4DA 1YC0A 1CHOG 1MD7A 1VJAU 4O3TA 1C5SA 1AZZA 3RU4E 3ZVEA 1WQVH 2BX4A 2D8WA 3MO6A 3SJKA 3T28A 3QGJA 5C1YA 1P10A 2J38A 1EB1H 4LZ1H 4GSOA 5DGJA 1O35A 2TRMA 4KTCA 1YCPK 3RLWH 2M5TA 3SNEA 1QRXA 1EPTC 2Z7FE 3KQCA 2FI4E 1JIRA 1SGDE 3HK6B 3SW2B 2A5AA 2PGQB 1ELVA 1FUJA 4NIWA 5ESTE 4XDEA 1UCYE 1A2CH 3URDA 2LPRA 2UUKB 1HAOH 4ISHH 1AVGH 3U1JB 1MBQA 3DA9B 3VFEA 4UONA 5CHAB 5GWZA 3S0NA 3LIWA 1HRTH 4NA8A 1G2MA 4ABGA 3F1SB 1Y5UT 5AF9H 4OS1A 4UE7H 1D9IA 1EJNA 3GY6A 4YOGA 1T32A 1OS8A 2BY9X 4MNVA 2JH6D 1INCA 4I8JA 1IQLA 4D9RA 3ZZCA 1XUKA 1C2MA 4CRBA 3I78A 2GZ9A 3I29A 2CN0H 2SNVA 1Z1JA 2FMJA 1HFDA 2ZDLA 2GTBA 4WXIA 4B2CA 1ZHRA 1MTSA 1PYTD 2GCHF 1BTHH 4ISOA 1TPSA 3ATWA 1DSUA 5GCHF 5IYTA 1ZJKA 1YCPH 2HRVA 5ETXA 5L2ZH 2FS8A 3B9FH 1J16A 4VGCC 3SORA 2F9PA 2Y80A 4AG2A 1D3PB 1SPJA 2QXIA 2SGPE 1YPJH 2C90B 4I7YH 1T7CA 4E06H 2OBOA 1FY4A 1HIAB 1DICA 9LPRA 1H8DH 1O2LA 2BY8X 3MH6A 3PTNA 2OQ5A 1JWTA 1OWHA 1BQYA 1MQ5A 2EC9H 2SGFE 2ZPRA 2PTNA 1K1JA 4I8KA 2TGPZ 1GCDA 2UWPA 5FPYA 3SV8A 4GPGA 1P01A 1V2PT 1O3OA 3L33A 2VIWA 4O03A 2A7CA 5C5NA 1CT0E 2WYJA 2W7UA 4BANB 1G3EA 3NK8A 1DY9A 1EB2A 1O2VA 3OY5U 2SGEE 1QJ1B 3A84A 1ESTA 3U98H 5F8ZA 1DM4B 2C8ZB 4R0IA 3MU4A 1G32B 1O2MA 1XUJA 4UFDH 4AGJA 1RTKA 3SNAA 1D6RA 5E2PA 4NIXA 3MFJA 1NTPA 2PW8H 1TIOA 3DT0H 3PYHA 1UVTH 4GHTA 1BIOA 2BLVA 1OWDA 1TX6A 3ATLA 3RXIA 1NFXA 1KY9A 1AE5A 1GBTA 2AMPA 1VJ9U 3BTWE 4AB8A 2QY0B 4ZHAA 2A5KA 2AIPA 1H1BA 3S9CA 1MUEB 5JBBS 4HI3A 1G3DA 3ATIA 1W13U 1QTFA 3BTFE 1AUJA 1LHDH 4Y6DA 1GBBA 4ABIA 1LVYA 3I77A 1QBVH 4E7NA 1NC6A 5LPEA 3NZIA 1O5CB 3ZVGA 4WVPE 1GBKA 3TK5A 1P12E 4BNRA 1DOJA 1HNEE 3NPSA 2C8YB 1SGTA 2ZKSA 2PV9B 3TNSA 2H9EH 2ZDMA 1THSH 4IBLH 5FCKA 2OD3B 1Z8IB 2ZP0H 2BHGA 1TLDA 2FI3E 1C2GA 1LO6A 4BTTB 1C1VH 1O5BB 4ZXYH 1CO7E 2FOMB 1BB0B 1ZMLA 2XC4A 3M7QA 1O3NA 4JYVH 1HAHH 4I31A 1BJVA 1HJAB 1WUNH 5JPMH 5EQQA 2OUAA 3MO9A 2PUXB 3LPRA 4Y76A 1TQ0B 1SC8U 4IS5A 2GMTB 2HGTH 2BB4A 3BTHE 2Y6TA 1TOMH 1Y3WA 1KXAA 3EA7A 4B75A 4AB9A 1IQNA 3CP7A 1K21H 1TGSZ 3P8OA 3VB4A 2Z9GA 1UHBA 2G5VA 2PTCE 1MAXA 1O3IA 2ZU2A 3DFLA 1C5QA 1TPOA 2BDBA 3BV9B 1EAIA 3AAUA 3MOCA 3P95A 3MHWU 1VGCC 1HDTH 1QCPA 1TE0A 1CT2E 1GJ7B 5BPEA 1XX9A 2F83A 1PPCE 4YZUA 4MNXA 1O5EH 1UO6A 1C2KA 1K1MA 1OKXA 5I25A 1C5RA 3KQDA 4U30A 4IMZA 1FQ3A 4CR5A 1HXFH 3VXFH 2UWLA 1GGDB 1O3BA 4TPIZ 1YLCA 8KME2 3MNCA 3TJVA 3DFJA 5EXNA 1DLKB 4TYDA 1ELEE 4H42U 1GJ8B 3M61U 1O34A 3ODDA 2BOHB 1UTPA 4Q7YA 5DJ7A 5DP5A 1TGTA 2V3HH 1GI4A 1T8MA 1OSSA 1PJPA 5DO4H 2ZNKH 3MNXA 3PMBB 3LGTA 2K1QA 2ANKH 4FUDA 4E05H 2OP9A 2P8OB 1MTUA 2P95A 1FZZA 5EQRA 2QN5T 1ANDA 2HWLB 1TX7A 2XBXA 1HAIH 2SGDE 1ESAA 1P2MA 1XVMA 1DXWA 2BD3A 5AHGH 2PKAA 1PFXC 1RXPA 6CHAB 1EZSC 1P06A 2ZHDA 1TRMA 1RIWB 2GKVE 4MG3A 1TPPA 2KAIB 3ZZDA 2CJIA 1ESBA 1C5LH 1KXFA 4AORA 1S0QA 4CH2B 5JB9S 3BTGE 1CA0C 1AI8H 4O97A 3KGPA 1T8LA 3STIA 1X7AC 1OWKA 3PWCA 1ARCA 5T6GA 3M5NA 4GUXA 3SUFA 1O2RA 2W3IA 1O2TA 1BDAA 1B0EA 3URCA 1AZ8A 2GP9B 1Y5BT 2QXJA 3LKWA 1F0UA 2BXUH 3A81A 1O30A 3LC3A 1TFXA 4X1QU 3C27B 4INKA 4MDSA 1AB9C 1V2OT 3K2UA 2CGAA 2DUCA 3VB5A 1UTJA 1H9HE 2ODPA 1A3EH 2BXTH 2ALVA 5E0HA 1FN8A 1Y3XA 1GMCF 5EPYA 2FXRA 1DUEA 3JZ2B 1ZZZA 2BZAA 1YM0A 4NCYA 3QZQA 4GCHF 2BYAX 1CQQA 2CXVA 4DURA 1O2WA 1ABIH 3ESTA 1GMHF 3SZNA 3H7OA 1GJ5H 1C5MD 2Q1JA 4X2WA 1LCYA 2VWLA 1O3JA 4IW4E 1S85A 4OS2A 5DKMA 1PPZA 4JYUH 4MQAA 1QURH 3SU5A 3D62A 5TCAA 3GDSA 2XCNA 3PMHB 4X8SH 1O2HA 2ILNA 1C5TA 5DG6A 3MNBA 4ZKRU 2JETB 2ZTYA 2ZQ2A 4B1TA 3KL6A 1BTPA 2OLGA 4X1RU 1G3CA 3TLOA 2XBYA 1T8NA 2ZHFH 4AYYB 1ELGA 1BHXB 6ESTA 1UK3A 4WJG2 1ETRH 1MH0A 1VGCB 3GCOA 2VIPA 1O3DA 3Q76A 2VIVA 1C9PA 3ZZ5A 3Q3XA 3T29A 2ZU3A 1EQ9A 4CBOA 1PPEE 3EGKH 1YPKH 1DWDH 4Y71A 3OX7U 1P9SA 2O8TA 2ZDNA 4ABHA 1KYNA 4K8YA 1C4V2 1SL3A 4TPYA 3QTOH 5BRRE 2ZO3H 3TJUA 4JMYA 4A92A 1ZYOA 2FESH 1LVMA 3M3VA 5J4QA 1V2RT 4DVAU 4DIHH 2XBVA 2C93B 4MLFB 4OS5A 1A0JA 2VU8E 3ZV9A 2TGDA 1O2UA 3F9EA 2HNTE 1LVOA 4CRCA 1J15A 4HFPB 1YPEH 1YLDA 1AQ7A 2B0FA 2CMYA 2OCVB 1BTXA 1C1WH 1FMGA 2P59A 1CT4E 2ALPA 3SV7A 2VB0A 1TRYA 2R3UA 4MVNA 4B2AA 5EPNA 3IG6B 1A5GH 6CHAC 1ZGIA 1CBWB 1C5VA 2GCHG 4FXGH 1LKAA 5HGGA 3IITA 3E3TA 3MH5A 4Q80A 3MH7A 1WTHD 2B8OH 1RGQA 2Z3DA 4D76A 1L1GA 3KIDU 2F91A 1MZAA 1SOTA 3QTVH 3RXRA 1GMDF 4R8TB 1QA7A 1N8OC 6GCHF 5C3NA 5K0HA 1SVPA 2ZHEH 1EZQA 2XTTB 4MPUA 4ZKSU 2FOAA 1PPHE 3RM0H 3LGIA 4NA7A 5A8ZA 3O8RA 1A61H 2Z9IA 4FUBA 4Q2KA 1DT2A 1FI8A 1SGNE 2HVXA 2ZFRH 1Z6EA 3BIVH 4FUHA 3AW0A 2RA0A 2BTCE 4NGAH 1KXDA 2A2XH 1UJ1A 3TGIE 4ESTE 3RXKA 3GY5A 4WMFA 1A5HA 1DS2E 4F49A 1W11U 3TK6A 5E8EH 1V2QT 1MAYA 3RXMA 4Y10E 2R3YA 4AN7A 1GVZA 3QK1A 5JBAS 1GDNA 2WV5A 3KN2A 3VB7A 1BOQA 4THNH 1KXCA 2J4IA 1UTOA 8GCHG 2GCTB 3Q3KA 4K69A 1L2EA 1YPMH 5HM9A 3E8LA 2GZ7A 5A2MH 1O3PB 1K1PA 2QV1A 2V3OH 2WINI 1LVBA 3PM3A 3GY3A 1SGQE 1GVKB 1VITH 5TCCA 2BY6X 1ABJH 1ETTH 1W3CA 1LHCH 1RFNA 1OP8A 2Z94A 2H5DA 1ZRBA 1S5SA 1KXBA 3SU3A 4X6OA 3PO1B 1D3QB 3FZZA 5A0CA 2AMQA 1ZPCA 2FDAA 3GY4A 2LNCA 4YLUA 1HAVB 2BX3A 4Y8YA 1RRKA 2HLCA 1HGTH 1KLIH 4Y0YE 3LOXA 1W12U 1YCPM 3SNDA 1HB0B 3F6UH 1PQ5A 1NRRH 1OP0A 2ZPSA 1O2GH 3HATH 3UPEA 3LH3A 8ESTE 1GHAG 1HAXB 2OXSA 4K5ZA 4SGBE 2ZGXH 3TNTA 5J4SA 1P2IA 1QIXB 1AO5A 1CA0B 1WYKA 1C1OA 1C2IA 1TNIA 2ZGJA 1ZTKA 1DUAA 1EZXC 1K1LA 2Q6DA 3G01A 4ZXXH 3FP6E 4OGYA 1GHWH 2BDGA 1IQEA 2ANWA 3O8BA 1KXEA 1NFUA 4AX9H 2C8WB 1HAYB 3LJOA 3RXBA 2F9NA 1T8OA 3ZVBA 2ZFFH 4TWWA 2H2ZA 1QB1A 2P93A 2VWOA 3SJOA 2VJ1A 2TGAA 3L3TA 3VXEH 2CF9H 4NA9H 1UTNA 3FP8E 1IAUA 1W7GH 3MO3A 1OWIA 4YT7H 1SGPE 2IOTA 5EQSA 5FHTA 4TWYA 3U69H 2G5NA 1MKWK 4X6PA 1JRTA 3FFGA 5EG4A 3RC6A 2ZPQA 1NN6A 2FOHA 3L6PA 3TH4H 4D9QA 3A8AA 5DP6A 2PLXA 2Z3CA 1EAXA 4ABJA 3F9HA 1C9TA 1GDQA 4LOYH 4A7IB 1ID5H 1TNJA 2D1JA 1DWBH 1P05A 2WPIS 2ULLA 3BEUA 4BXWA 4Y8ZA 2OC1A 1HLTH 4JK5A 1BRUP 3OTJE 5B6OA 2TPIZ 1O3MA 3SV2H 1Z8JB 1O39A 3VB3A 1C2HA 5CE1A 2FX6A 3SUGA 3HGNA 1CU1A 3SV6A 3LDXH 2FP7B 2WUCA 3PB1E 1O0DH 4CRDA 1DXPA 4DG4A 1LHFH 3ZZ6A 1QFKH 5FAHA 5C1XA 1UK2A 1Y8TA 1CHOF 2GV6A 1ZGVA 5C67A 4BAKB 2NU1E 1NU9A 5HYOA 2BVSH 3BN9A 2BDIA 2STBE 1O2ZA 1Q3XA 3DHKH 3A88A 4JZ1A 4K1EA 3SHCH 1EASA 3IWMA 4K8BA 1K1OA 4ZH8A 1QGFA 3SU2A 2O8MA 1K28D 5A09A 4FUJA 4K60A 2B5TB 5EW1H 2FWWA 2ZDKA 2XWAA 2Y5HA 4D7FA 1FONA 3RC4A 5T3HA 2A4RA 1DDJA 3NKKA 3NCLA 2XNIA 1BRBE 2A0QB 1IQKA 5EGMA 3ZZBA 2C4FH 5A0BA 3PMJA 3QZRA 4ISNA 1E37B 3H7TA 1O5AB 4YLQH 3JZ1B 1H9LB 2Y81A 2ZEBA 5C1UA 2SFAA 4U01A 1T4VH 2ZU1A 4ZUHA 1YBWA 1GL1A 3ZYDA 2IJOB 2R0KA 4J1YA 2WPJS 2ZFTA 2G52A 1JIMA 1HCGA 1UVPA 3GDUA 2VIQA 3SJ9A 4INHA 1MZDA 1VR1H 4B76A 4XOJA 1P3EA 3EAJA 4CREA 1TPAE 4FU7A 4YESB 5GXPA 7GCHF 3TIUA 2XYAA 3M7UA 4I8HA 3A7TA 1JXPA 5EODA 1UHBB 1XKBC 1TBRH 1ZMJA 2BLQA 4FU9A 1MTNC 1XMNB 1GJBB 1TB6H 2OQUA 1GBLA 1UTMA 1P2JA 4NWKA 1CGJE 1V6DA 3SNCA 3AW1A 2A31A 2J94A 1TMBH 2CHAC 3RXOA 3C1KA 1BITA 2QF0A 4WMDA 2ZWLH 3PWBA 1LTOA 4AFQA 3SGBE 3S7HB 1AU8A 1FN6A 4IMQA 3M3TA 4B2BA 3PLKA 4IGDA 2NU4E 3P8GA 2PGBB 5IDKA 1TQ7B 1UCYH 1KLTA 1A0HB 1WQSA 2GGVB 2G4UA 3LGUA 1ETSH 4GCHG 3VGCC 4CRFA 4Y11E 2VGCB 2I6SA 4BAOB 1BMMH 4KELA 4WWYA 3ZZAA 4K3JA 1GHBG 3D65E 3RXDA 3UFAA 3NXPA 4ZROA 2Z9LA 1GJ4H 1H4WA 2ZHQH 3U8RH 1SOZA 3FVFB 4MPVA 2ZA5A 1XUGA 4UDWH 2ESTE 4AOQA 2ZCKP 1L0ZA 3MU0A 2FS9A 1AUTC 1HAGE 2ZCLP 1FLEE 1GG6B 1A5IA 1ORFA 2FYQA 3RXGA 1GCTC 3CS0A 3M36A 1NU7B 2J2UA 1TNLA 1AHTH 4ZHLU 1C5PA 4DGJA 2I6QA 3TK9A 4NZLA 2KAIA 2IN2A 1UVSH 1DVAH 1MTVA 3SO3A 3KCGH 1HAVA 2VGCC 3BTDE 3SOSA 4K1SA 1O31A 1SMFE 1C2JA 2HPPH 1DSTA 1O2SA 1ZPBA 1UVOA 1DLEA 3O8DA 2THFB 1PQ7A 1MMJN 3E16B 5EW2H 3ZVAA 1GBAA 1GBEA 1C1UH 3U9AH 2IPHA 4NZQA 4YM9A 3FP7E 4GAWA 2AMDA 3GICB 3BG4C 1F7ZA 1O37A 5EXMA 1YPHE 5K7RA 4X1NU 1P9UA 1OOKB 1GI0A 1GHXH 2TGTA 3EE0B 1ELCA 1LMWB 3TPIZ 3NUMA 2G4TA 3SI3H 3F68H 4FUEA 5JBTA 4I32A 4RKOB 4AGKA 5LPRA 2XWBI 4ZAEA 2XBWA 4MNWA 2H5CA 4O3UA 1OXGA 3T5FH 1DITH 1M9UA 3AVZA 3GOVB 4Q7ZA 1UTKA 4Z0KA 1QL9A 4ZKNU 3OU0A 5F03A 1TBZH 2PWXA 5F6MA 1C2LA 1W10U 5A0AE 1CSOE 3MMGA 2HNTF 2ZU5A 1NY22 2R0LA 3RUOA 1GBHA 3A89A 3ZZ9A 1NRPH 1IHSH 4ISIH 3ATKA 1O3LA 1RJXB 2G51A 4LK4A 2Y7ZA 3GCTF 2VVCA 1G30B 1O3GA 1ANCA 4A1TA 2F3CE 5T6DA 1GI9B 1QL8A 4YOIA 9ESTA 1EP6A 1C1NA 3S69A 2OBQA 2FOFA 1EAUA 1HJ9A 1WOFA 2O8UA 2OINA 3U8OH 3V0XA 1O2OA 2TBSA 4WXVA 5H4IB 1EP5A 4NFEA 1GJAB 1ZMNA 4YOJA 3GCTG 1HAZB 3HKIB 3RXJA 3SU4A 3A8DA 2CHAB 2A2QH 3QGNB 3PMAB 4AZ2B 2ANYA 1SG8B 2V0BA 1B7XB 1TNKA 4RN6A 4OGXA 3K6YA 1O3HA 2WPLS 3UQVA 1E35B 1PQ8A 3BTKE 3GY2A 1SGCA 2Y5GA 2NU2E 1MCTA 2R9PA 6GCHG 2FZZA 5LPFA 1O2NA 4XBCA 3A7YA 1E38B 1SQTA 1Y59T 2FOCA 4CHAC 1SGIB 2C8XB 2VNTA 1P04A 1GHZA 2QF3A 4CRAA 3ENSB 3VB6A 1TABE 2FX4A 3RXUA 1CGHA 1O5FH 1F5LA 5G4BA 2QYIA 3RMMH 1C1RA 1D6WA 3SQHE 7ESTE 3RMNH 2FTMA 1J8AA 4HZHA 3A7VA 1C5OH 1P02A 1V2LT 1OX1A 2XXLA 3EQ0H 3MNSA 3PTBA 4XBDA 5DK1A 1QRZA 3OSYA 1S6HA 2CF8H 1P11E 4B73A 2XW9A 4X2XA 2GT8A 1DY8A 1O5DH 3QDZB 1AMHA 4JYTA 2O9QA 1DPOA 3RLYH 3UIRA 1BA8B 2SGAA 1BRAA 2Y7XA 2BY7X 3Q3YA 3A86A 3GYLB 1UK4A 1WU1A 1WAYB 4FVDA 2AH4X 3A7ZA 2BZ6H 5FX6A 2BY5X 1QNJA 1B5GH 2G81E 4JZEH 3EA8A 3M5OA 3BF6H 4X8UH 3M5MA 2WV4A 1HV7A 4U2WA 1UCYK 3T25A 2ZTXA 3GCNA 1O33A 1BTUA 3U8TH 1OYTH 1TONA 2BM2A 2G8TA 1SGRE 2JH5D 2DE8A 2VH6A 3RDZA 3UTUH 2RG3A 1DANH 1GJDB 4UFFH 2H9HA 5AVDA 5E2OA 2J92A 5JB8S 1TBQH 1QJ6B 2C3SA 1MBMA 2XC5A 4CBNA 2B7DH 1FAXA 1TNHA 3RXEA 3UR6A 2GDDA 3E90B 1KDQB 1BBRH 1HIAA 3SJIA 1NZQH 2FYRA 1C1TA 2GVFA 1SLVB 3P6ZB 4B71A 4NSYA 1F0RA 2BLOA 2FTLE 1LHGH 1FV9A 5GPIB 1CBWC 2O8LA 1L4ZA 1KLJH 1DFPA 4CH8B 1UTQA 1FY5A 1V2JT 2D2DA 3MH4A 4X8VH 3K6ZA 3SGQE 3RXVA 4IN1A 1SQAA 3P17H 1EJMA 7GCHG 4UD9H 3A85A 1QB6A 1TA6A 3K65B 8GCHF 1OWEA 2EEKA 1L1NA 3OY6U 3SQEE 5ESBA 1P2OA 1GI8B 1GL0E 1P09A 1XXDA 3MU5A 4DJZB 7LPRA 3M35A 4OS4A 3DD2H 1GBMA 1JOUB 1GJ6A
chains in the Genus database with same CATH superfamily
3RXLA 3SU1A 1GI7B 1OWJA 5AFZH 4DOQA 4AFUA 1TRNA 1ELFA 3UOUA 1O36A 3TITA 4MNYA 1P0SH 2W26A 1MKXK 1GBCA 2BD7A 2PSXA 4JZFH 3MQKC 1C5NH 1SGYE 1W8BH 1O3EA 2QA9E 1P3CA 4DW2U 5A8XA 1H8IH 2GZ8A 1ZOMA 1LPKB 1H9IE 1C4U2 4HTCH 2HPQH 4AC9A 1ZRKA 5GCHG 4F4OC 1ZPZA 2H9TH 2PKAB 2PFEA 4B6FA 1UVUH 3PV4A 1MKXH 3ELAH 1NO9H 3UREA 3GDVA 5FX5A 1BTWA 1GMDG 2VVVA 1XUHA 1ZTLA 1G2LA 1AFQC 1LQDB 1OYQA 5E0GA 4X1SU 5L2YH 1BHXF 3ZV8A 1KIGH 4JZDH 4A6LA 1JMOH 5LH8A 5LGOA 1NT1A 2W5EA 4AFZA 1JRSA 3BTQE 3DUXH 2NWNA 1LPGB 1GBJA 1VCPA 2VWNA 1O2IA 1QQ4A 4KP0A 4Q4LA 1ACBE 3LU9B 3BEFB 1SHYA 1J17T 4H4FA 5EJ1A 1C2FA 1RD3B 1GCTB 2A45B 2SNWA 4YTAA 4LZ4B 1FY8E 2AIQA 1YPGH 2P16A 3QX5H 4YT6H 4Y7AA 3RXFA 2GDEH 2HNTC 3TJOA 2W3KA 1IQIA 1S0RA 2P8OC 2BMGB 2UWOA 1BTYA 4QT8C 3E6PH 1QY6A 4I8LA 4UFGH 1TA2A 3R3GB 3A8BA 1P8VC 2ZFPH 3V13A 3TVJB 2GJGA 4B74A 1F0SA 4AYVB 4U32A 2GT7A 4FUGA 1EATA 3E0NB 4XFQA 2PUQH 3QWCH 2P3FH 3UNQA 3N7DA 1O2KA 1IHTH 1OHHD 4RSPA 4UEHH 3S7KB 1NRSH 4VGCB 2FIRH 3F9FA 1NS3A 1K1NA 1AKSA 2AGIX 2Y5FA 2HOBA 1F2SE 1Q2WA 1SSXA 2W6ID 1KTTB 2UUYA 3UNRA 3VGCB 1W0ZU 2ZF0H 3RU4D 1G9IE 4WY3A 2BD8A 3S9BA 3BTEE 2AGEX 2F9OA 1TMUH 1RTLA 1D3DB 2PHBA 3Q77A 1H8ED 1IQMA 1V2KT 1C5UA 1GPZA 2K0QA 3MI4A 4OS6A 5CHBA 1AVXA 1GHBF 1TWXB 1BJUA 2WYGA 4X2YA 4A5TS 2ANMH 5C5OA 3FKSD 3CS7A 3ODFA 2F9BH 2YNAA 3UWIA 3BTTE 3ZVFA 2ASUB 2ZU4A 3T27A 5HXFA 2BVRH 2RA3A 3UY9A 2STAE 3PO1C 2QXHA 2VIOA 4O9VA 8LPRA 4LXBH 1GI3A 1V2WT 1E0FD 1OP2A 2Y82A 2ZCHP 3LGVA 4K2YA 3KF2A 1LDTT 2RCEA 2FOBA 4D7GA 4NFFA 1HJ8A 2ZTZA 1J14A 3FZDA 3HK3B 4YO9A 1THPB 1NFYA 5A8YA 1D3TB 1AD8H 1SGFA 3BIUH 4WMEA 5GJ4B 2OC8A 1WTGH 4DIIH 1ARBA 1UW7A 2JKHA 1N1LA 1YGCH 5GNDA 1HAPH 3UQOA 1SFQB 2D26C 2BDCA 3E1XB 1XUFA 1YKTA 4H6SB 1QQUA 2FLRH 2J5UA 3GCHB 1QBOA 4Y8XA 2CV3A 1VCWA 1FIWA 3B8JA 2EI8A 3A7XA 1FIZA 1O3CA 1Y5AT 1EZUC 2L6OA 5HIZA 3P8NA 4ACBA 1SI5H 5TJXA 3SUEA 1FY3A 1C4Y2 2QXGA 3SN8A 3PLPA 1YPHC 3AAVA 1BRCE 4ISLA 1IQHA 4XBBA 1SKYE 5E0JA 4X1PU 2QC2A 5AFYH 1A0LA 2AGGX 2GD4B 4IC5A 1NRNH 2SGQE 3A80A 2TIOA 3T2NA 5HMAA 2WPMS 2JH0D 2VVUA 2ZZUH 2H6MA 3SBKA 1KSNA 3BSQA 1COWD 1W0YH 4TY6A 1Z1IA 1NPMA 1SBWA 2ZFSA 1ZTJA 3TU7H 1AY6H 1FX0B 1ZHMA 4NIYA 5CHAC 4BOHA 1QR3E 5DPAA 3RXSA 4Y79A 1F5RA 3KHVA 3LT3A 1THRH 4X8TH 1QB9A 1VZQH 1A1RA 1FJSA 1C5YB 1O2QA 1BBRE 1S83A 3A7WA 1PPGE 1WSSH 4TT3D 3V3MA 5DP3A 3RMOH 3UOPA 3PLBA 1QRWA 2PSYA 3SJ8A 4ABAA 2V7QD 2WPHS 3NWUA 1Z71A 3K9XB 3BG4B 1Q31A 1O2JA 1Z8RA 2W7SA 1V3XA 2QAAA 2A5IA 1CGIE 2VH0A 1DE7H 3W95A 3TH2H 4JCNA 2Z6BD 1K2I1 3RXTA 2J34A 1ZSKA 1ELDE 1BCUH 3ZZ4A 1AVWA 1AFEH 1TOCB 4FU8A 4X2VA 2J9NA 1V2VT 3UUZA 3TJNA 2WV9A 1FDPA 1YP9A 3GISB 2Z3EA 2ZGCA 3F2HA 3OEED 1V2NT 1ZJDA 1E34B 2KCPA 5EOKA 3SU6A 1TAWA 5FPTA 2RDLA 2P3TB 5GDSH 4CRGA 4IC6A 2KX4A 3H09A 2BD5A 1NM6A 1CHGA 4KTSA 1RTFB 1XVOA 4K1TA 1NRQH 3ZYEA 2ZIQH 3TGKE 2ZGHA 3A87A 5GIBA 1P2NA 1O3FA 3MTYA 4ABBA 1P03A 1C1MA 4X0WU 3RXAA 2A32A 2ZHWH 5CMXH 3MYWA 1EJAA 5EJZA 1EUFA 1MU8B 1TALA 1QA0A 1BUIA 3UWJH 1HPGA 3M37A 1Z6JH 2FOGA 4GVUA 2ZI2H 1GMHG 1MTNB 3ZZ7A 3BEIB 1XXFA 2FOEA 5T6FA 1LQEA 2ODQA 3LC5A 4MTBA 4B6EA 3OYPA 2QGRA 1ANBA 3M3SA 5CDFE 2H1UA 3LJJA 1GHAF 3RXCA 2R2MB 2VIDA 5SGAE 4FVBA 1QJ7B 2F9UA 4NIVA 1EFRD 2FEQH 2VWMA 1SB1H 1BMFD 3Q00A 4XSKU 1XKAC 2BQWB 5EXLA 4E7RG 4NG9H 4NWLA 5F8TA 1LPZB 4WH6A 1EPTB 1O2PA 1BT7A 1F5KU 4BXSA 3M5LA 4M7GA 4JZIA 1JBUH 2NU3E 5FPSA 1F92A 3F3BA 1Y3VA 1TGNA 5C17A 2AEIH 1GDUA 3RMLH 1QL7A 2NU0E 2KCYA 3BG8A 4I33A 2DE9A 2XCFA 3QN7A 4ASHA 2XRCA 1XUIA 1AWHB 5FXLA 1XM1A 5DP9A 2LELA 1MTWA 5L30H 1CVWH 3OEHD 3EA9A 4BAMB 1TNGA 5DP7A 1A7SA 6LPRA 1IQGA 1SHHB 2QCYA 2BD2A 1GHYH 3HGPA 3P70B 4MPWA 2OK5A 4WF8A 1A46H 1FNIA 1YLNA 3VEQB 3ZZ8A 1S82A 3ZVCA 1J9CH 2YNBA 2J95A 1OPHB 1S6FA 3RM2H 2WUBA 1HXEH 3T26A 5EIYA 4KKDA 1B0FA 1GI5A 1BZXE 4I86A 2QIQA 1GHVH 5FBIA 1YYY1 5FL7D 3W94A 2KCOA 2ZDAH 3S9AA 3SHAH 3O8CA 1ANEA 1PQAA 3WY8A 2FI5E 4DCDA 2AERH 3ZVDA 1TMTH 1GI6A 1ZR0A 1ZSLA 4ZMAH 1GG6C 1PPBH 1GJCB 1PYTC 1CE5A 1UTLM 2ZG0H 7KMEH 2BDHA 2BQ6B 2FM2A 1ELTA 1NFWA 1YF4A 4GHQA 5FCRA 1WV7H 1FXYA 1K9OE 3A83A 3E0PB 4KGAA 1WBGB 2ZDVH 3MWIU 4ABDA 4I8GA 1VITF 1QBNA 1AKSB 1SR5C 1AFQB 3E91A 3RP2A 1Y3UA 4ASUD 3TGJE 1WDIA 2OTVA 4BAHB 5HIYA 1PPFE 4H6TA 1DWEH 1CA8B 2Q6FA 2OC7A 2RDEA 1HJAC 1ZHPA 2BOKA 1EOJA 3RU4T 3ITIA 3R0FA 1NROH 1HYLA 3LGWA 2BVXH 5DP4A 3F9GA 1V2UT 2A4OA 3N7OA 1FPHH 2JIZD 2PKSC 1P57B 1G37A 2HALA 1IQFA 4KTUA 2KR7A 2XC0A 3VPKA 4JK6A 1AIXH 1SQOA 2Z9JA 3ATMA 1GBIA 2ZECA 5JDUB 3LH1A 1DWCH 2K8IA 3ZZ3A 1HUTH 1C1PA 1EPTA 1V2TT 4ZHMU 1W14U 1MU6B 1SGFG 3U1IB 3STJA 1C1QA 2WPKS 1QHRB 1G36A 1MCVA 3RC5A 1FAKH 4Z6AH 5FBEA 3BTME 1GI2A 3T62A 1A4WH 1BMNH 5JYIA 3M7TA 1N8OB 2ODYB 1Y3YA 1SGEE 1T4UH 3QUMP 2RFKC 1S81A 1RS0A 3FAOA 4A1VA 4NSVA 1LHEH 2BLWA 1VCQA 2PKSB 5JBCS 1K22H 1MKWH 2BD9A 3EDXB 2EI7A 2OC0A 1ELBA 1TX8A 1T31A 1ZSJA 1C5WB 1YPLH 3RXPA 2P3UB 2P94A 3P8FA 2V35A 1TYNA 4XRNA 2BDYA 2GX4A 5ABWA 4Y0ZE 4DT7B 3QLPH 3GCHC 4IN2A 4F55A 3EYDA 1O2XA 3U28C 1GJ9B 2FO9A 2UUFB 3UR9A 3A8CA 4FUCA 2GMTC 3GY7A 1MD8A 3D49H 1S84A 2GV7A 1C5ZB 4PROA 1KTSB 2A4GA 3V7TA 5HM2A 1O32A 3QO6A 4AG1A 4Q7XA 1N6YA 4XE4A 1AN1E 1A3BH 4AFSA 2G55A 2BD4A 1SLXB 3SGAE 1IQJA 1MQ6A 3TH3H 1IOEA 1E36B 2AFQB 2F9VA 2ZGBH 4X6NA 5EU8A 1V2ST 3PROA 3SU0A 3V12A 2B9LA 4HGCA 2EI6A 1ZLRA 1AGJA 2ZQ1A 3LONA 1SFIA 1RIWC 4CHAB 1O3KA 1TGCA 1C1SA 1GGDC 5C20A 1GMCG 5C2ZA 1VITG 2ZFQH 1O2YA 1P2KA 1FY1A 1GWAA 2FLBH 3RXQA 1BBRK 1TGBA 3D23A 2GCTC 1O38A 2VINA 4BTIB 4A1XA 1NESE 2V6NA 3GYMA 3MU8A 1D4PB 4CR9A 3GY8A 1C5XB 1EXFA 4GLYA 4DY7B 4FUFA 2Z9KA 1AE8H 1UMAH 2ZC9H 4J2YB 1SLUB 2FODA 2UUJB 5DP8A 1QZ8A 3H5CB 2AYWA 2O8WA 4M9FA 1KDQA 2YOLA 3KNXA 2BQ7B 1G3BA 2A7HA 2YMSD 1AB9B 1FPCH 1EOLA 1WCZA 2G00A 2EA3A 4OS7A 2AS9A 1C2EA 4BTUB 4D8NA 1BMLA 1C2DA 1O3AA 3SI4H 1EX3A 5L6NH 3KQBA 3HPTB 2BDAA 4ABEA 4ABFA 1V2MT 1K1IA 1EKBB 4Y7BA 3B23B 1W2KH 3MU1A 1U6QA 5PTPA 1AWFH 1GBFA 1L1JA 2A4QA 4WH8A 4ZKOU 1W7XH 2A1DB 3P92A 3SNBA 5I46H 1DX5M 1Z8GA 3UNSA 3RXHA 1Z7KA 1SLWB 3SUDA 4SGAE 1BTZA 2A7JA 3HKJB 3SV9A 2R2WU 1GI1A 3KEEA 4RKJB 1GBDA 4MPXA 1LKBA 3KQEA 1F0TA 1ELAA 3A82A 3CENA 3LGYA 4F48B 1EAWA 1N6XA 1P2QA 4UFEH 3AK5A 4Z1MD 4X6MA 2JJ1D 1GVLA 1BMAA 2HVYB 1HBTH 3FANA 1O5GH 2JETC 4INLA 4TY7A 5F8XA 2Q6GA 3AASA 2FPZA 4FUIA 2PR3A 1L4DA 1YC0A 1CHOG 1MD7A 1VJAU 4O3TA 1VKYA 1C5SA 1AZZA 3RU4E 3ZVEA 1WQVH 2BX4A 2D8WA 3MO6A 3SJKA 3T28A 3QGJA 5C1YA 1P10A 2J38A 1EB1H 4LZ1H 4GSOA 5DGJA 1O35A 2TRMA 4KTCA 1YCPK 3RLWH 2M5TA 3SNEA 1QRXA 1EPTC 2Z7FE 3KQCA 2FI4E 1JIRA 1SGDE 3HK6B 3SW2B 2A5AA 2PGQB 1ELVA 1FUJA 4NIWA 5ESTE 4XDEA 1UCYE 1A2CH 3SZEA 3URDA 2LPRA 2UUKB 1HAOH 4ISHH 1AVGH 3U1JB 1MBQA 3DA9B 3VFEA 4UONA 5CHAB 5GWZA 3S0NA 3LIWA 1HRTH 2WHXA 4NA8A 1G2MA 4ABGA 3F1SB 1Y5UT 5AF9H 4OS1A 4UE7H 1D9IA 1EJNA 3GY6A 4YOGA 1T32A 1OS8A 2BY9X 4MNVA 2JH6D 1INCA 4I8JA 1IQLA 4D9RA 3ZZCA 1XUKA 1C2MA 4CRBA 3I78A 2GZ9A 3I29A 2CN0H 2SNVA 1Z1JA 2FMJA 1HFDA 2ZDLA 2GTBA 4WXIA 4B2CA 2YMSB 1ZHRA 1MTSA 1PYTD 2GCHF 1BTHH 4ISOA 4P00A 1TPSA 3N99A 3ATWA 1SQRA 1DSUA 5GCHF 5IYTA 1ZJKA 1YCPH 2HRVA 5ETXA 5L2ZH 2FS8A 3B9FH 1J16A 3W1EA 4VGCC 4RI0A 3SORA 2F9PA 2Y80A 4AG2A 1D3PB 1SPJA 2QXIA 2SGPE 1YPJH 2C90B 4I7YH 1T7CA 4E06H 2OBOA 1FY4A 3KYFA 1HIAB 3WW7A 1DICA 9LPRA 1H8DH 1O2LA 2BY8X 2WZQA 3MH6A 3PTNA 2OQ5A 1JWTA 1OWHA 1BQYA 1MQ5A 2EC9H 2SGFE 2ZPRA 2PTNA 1K1JA 4I8KA 2TGPZ 1GCDA 2UWPA 5FPYA 4RT1A 4GPGA 1P01A 1V2PT 3SV8A 1O3OA 3L33A 2VIWA 4O03A 2A7CA 5C5NA 1CT0E 2WYJA 2W7UA 4BANB 1G3EA 3NK8A 1DY9A 1EB2A 1O2VA 3OY5U 2SGEE 1QJ1B 3A84A 3UB0A 5HKKD 1ESTA 3U98H 5F8ZA 1DM4B 2C8ZB 3N7EA 4R0IA 3MU4A 2VBCA 3OAAD 1G32B 1O2MA 1XUJA 4UFDH 4AGJA 1RTKA 3SNAA 1D6RA 5E2PA 4NIXA 3MFJA 1NTPA 2PW8H 1TIOA 3DT0H 3PYHA 1UVTH 4GHTA 1BIOA 2BLVA 1OWDA 1TX6A 3ATLA 3RXIA 1NFXA 1KY9A 1AE5A 1GBTA 2AMPA 3PRDA 1VJ9U 3BTWE 4AB8A 2QY0B 4ZHAA 2A5KA 2AIPA 1H1BA 3S9CA 1MUEB 5JBBS 4HI3A 1G3DA 3ATIA 3WWBA 1W13U 1QTFA 3BTFE 1AUJA 1LHDH 4Y6DA 1GBBA 4ABIA 1LVYA 3I77A 1QBVH 4E7NA 1NC6A 5LPEA 3NZIA 1O5CB 3ZVGA 4WVPE 1GBKA 3TK5A 1P12E 4BNRA 1DOJA 1HNEE 3NPSA 2C8YB 1SGTA 2ZKSA 2W6JD 2PV9B 3TNSA 2H9EH 2ZDMA 1THSH 4IBLH 5FCKA 2OD3B 1Z8IB 2ZP0H 2BHGA 1TLDA 2FI3E 1C2GA 1LO6A 4BTTB 1C1VH 1O5BB 4ZXYH 1CO7E 2FOMB 1BB0B 1ZMLA 2XC4A 3M7QA 1O3NA 4JYVH 1HAHH 4I31A 1BJVA 1HJAB 1WUNH 5JPMH 5C0UA 5EQQA 2OUAA 3MO9A 2PUXB 3LPRA 2AHME 4Y76A 1TQ0B 3EE7A 1SC8U 4IS5A 2GMTB 2HGTH 2BB4A 3BTHE 2Y6TA 1TOMH 1Y3WA 1KXAA 3EA7A 4B75A 4AB9A 1IQNA 3CP7A 1K21H 1TGSZ 3P8OA 3VB4A 2Z9GA 1UHBA 2G5VA 2PTCE 1MAXA 1O3IA 2ZU2A 3DFLA 1C5QA 1TPOA 2BDBA 3BV9B 1EAIA 3AAUA 3FOAA 3MOCA 3P95A 3MHWU 1VGCC 1HDTH 1QCPA 1E79D 1TE0A 1CT2E 1GJ7B 5BPEA 1XX9A 2F83A 1PPCE 4YZUA 4MNXA 1O5EH 1UO6A 1C2KA 1K1MA 1OKXA 2YMSC 5I25A 1C5RA 3KQDA 4U30A 4IMZA 3GS9A 1FQ3A 4CR5A 1HXFH 3VXFH 2UWLA 4TSFD 3DSOA 1GGDB 1O3BA 4TPIZ 1YLCA 8KME2 3MNCA 3TJVA 3DFJA 5EXNA 1DLKB 4TYDA 1ELEE 4H42U 1GJ8B 3M61U 1O34A 3ODDA 2BOHB 2F4LA 1UTPA 4Q7YA 5DJ7A 5DP5A 1TGTA 3CNRA 2V3HH 1GI4A 1T8MA 1OSSA 1PJPA 5DO4H 2ZNKH 4YXWD 3MNXA 3PMBB 3LGTA 2K1QA 2ANKH 4FUDA 4E05H 2OP9A 2P8OB 1MTUA 2P95A 3DSPA 1FZZA 5EQRA 2QN5T 1ANDA 2HWLB 1TX7A 2XBXA 1HAIH 2SGDE 1ESAA 1P2MA 1XVMA 1DXWA 2BD3A 5AHGH 2PKAA 4ACAA 1PFXC 1RXPA 6CHAB 1EZSC 1P06A 2ZHDA 1TRMA 1RIWB 2GKVE 4MG3A 1TPPA 2KAIB 3ZZDA 2CJIA 1ESBA 1C5LH 1KXFA 3UAIC 4AORA 1S0QA 4CH2B 5JB9S 3BTGE 1CA0C 1AI8H 2QF5A 3KGPA 1T8LA 4O97A 3STIA 1X7AC 1OWKA 3PWCA 1ARCA 5T6GA 3M5NA 4GUXA 3SUFA 1O2RA 2W3IA 1O2TA 1BDAA 1B0EA 3URCA 1AZ8A 2GP9B 1Y5BT 2QXJA 3LKWA 1F0UA 2BXUH 3A81A 1O30A 3LC3A 1TFXA 4X1QU 3C27B 4INKA 4MDSA 1AB9C 1V2OT 2XOKD 3K2UA 2CGAA 2DUCA 3VB5A 3PRBA 1UTJA 1H9HE 2ODPA 1A3EH 2BXTH 5C94A 2ALVA 5E0HA 3WWFA 1FN8A 1Y3XA 1GMCF 5EPYA 2FXRA 1DUEA 3JZ2B 1ZZZA 2BZAA 1YM0A 4NCYA 3QZQA 4GCHF 2BYAX 1CQQA 2CXVA 4DURA 1O2WA 3OFND 1ABIH 3ESTA 1GMHF 3SZNA 3H7OA 1GJ5H 1YWUA 1C5MD 2Q1JA 4X2WA 2JDID 1LCYA 2VWLA 4Q63A 1O3JA 4IW4E 1S85A 4OS2A 5DKMA 1PPZA 4JYUH 4MQAA 1QURH 3SU5A 3D62A 5TCAA 2KCAA 3GDSA 2XCNA 3PMHB 4X8SH 1O2HA 2ILNA 1C5TA 5DG6A 3MNBA 4ZKRU 2JETB 1NBMD 2ZTYA 2ZQ2A 5F53A 4B1TA 3KL6A 1BTPA 2OLGA 4X1RU 1G3CA 3TLOA 2XBYA 2LP6A 1T8NA 2ZHFH 4AYYB 1ELGA 1BHXB 6ESTA 1UK3A 4WJG2 1ETRH 1MH0A 1VGCB 3GCOA 2VIPA 1O3DA 3Q76A 2VIVA 1C9PA 3ZZ5A 3Q3XA 3T29A 2PP6A 2ZU3A 1EQ9A 4CBOA 1PPEE 3EGKH 1YPKH 1DWDH 4Y71A 3OX7U 1P9SA 2O8TA 2ZDNA 4ABHA 1KYNA 4K8YA 4DT4A 1C4V2 1SL3A 4TPYA 3QTOH 5BRRE 2ZO3H 5DN6D 3TJUA 4JMYA 4A92A 1ZYOA 2FESH 1LVMA 3M3VA 5J4QA 1V2RT 4DVAU 4DIHH 2XBVA 2C93B 4MLFB 4OS5A 1A0JA 2VU8E 3ZV9A 2TGDA 1O2UA 3F9EA 2HNTE 1LVOA 1YY3A 4CRCA 1J15A 4HFPB 1YPEH 1YLDA 1AQ7A 2B0FA 2CMYA 2OCVB 1BTXA 1C1WH 1FMGA 2P59A 1CT4E 2ALPA 3SV7A 2VB0A 1TRYA 2F43B 2R3UA 4MVNA 4B2AA 5EPNA 3IG6B 1A5GH 3F0OA 6CHAC 1ZGIA 1CBWB 1C5VA 2GCHG 4FXGH 1LKAA 5HGGA 1H8HD 3IITA 3E3TA 3MH5A 4Q80A 3MH7A 1WTHD 2B8OH 1RGQA 5KEDA 2Z3DA 4D76A 1L1GA 3KIDU 2F91A 1MZAA 1SOTA 3QTVH 3RXRA 1GMDF 4R8TB 3OTPA 1QA7A 2QE7D 1N8OC 6GCHF 5C3NA 5K0HA 1SVPA 2ZHEH 1EZQA 2XTTB 4MPUA 4ZKSU 2FOAA 1PPHE 3RM0H 3LGIA 4NA7A 3ZIAD 5A8ZA 3O8RA 1A61H 2Z9IA 4FUBA 4Q2KA 1DT2A 1FI8A 1SGNE 2QF4A 2HVXA 2ZFRH 1Z6EA 3BIVH 4FUHA 3AW0A 2RA0A 2BTCE 4NGAH 1KXDA 2A2XH 2KZ4A 1UJ1A 1KMHB 4ESTE 3TGIE 3RXKA 3GY5A 4WMFA 1A5HA 4BAQB 1DS2E 4F49A 1WXRA 1W11U 3TK6A 5E8EH 1V2QT 5B6LA 1MAYA 3RXMA 3VG8A 4Y10E 2R3YA 4AN7A 1GVZA 3QK1A 5JBAS 1GDNA 2WV5A 3KN2A 3VB7A 1BOQA 4THNH 4P02A 1KXCA 2J4IA 1UTOA 8GCHG 2GCTB 1W0JD 3Q3KA 4K69A 2J98A 2V3MA 1L2EA 1YPMH 5HM9A 3E8LA 2GZ7A 3NRLA 5A2MH 1O3PB 1K1PA 2QV1A 2V3OH 2WINI 3F0PA 1LVBA 3DCLA 3PM3A 3GY3A 1SGQE 1GVKB 1VITH 5TCCA 2BY6X 1ABJH 1ETTH 1W3CA 1LHCH 1RFNA 1OP8A 2Z94A 2H5DA 1ZRBA 1S5SA 1KXBA 3SU3A 4X6OA 3PO1B 1D3QB 3FZZA 5A0CA 2AMQA 1ZPCA 2FDAA 3GY4A 2LNCA 4YLUA 1HAVB 2BX3A 4Y8YA 1RRKA 2HLCA 4OM9A 1HGTH 3KYGA 1KLIH 1W0KD 4Y0YE 3LOXA 1W12U 1YCPM 3SNDA 1HB0B 3F6UH 1PQ5A 1NRRH 1OP0A 2ZPSA 1K0HA 1O2GH 3HATH 3UPEA 3LH3A 8ESTE 1GHAG 1HAXB 2OXSA 3DSGA 4K5ZA 4SGBE 2ZGXH 3TNTA 5J4SA 1P2IA 1QIXB 1AO5A 1CA0B 1WYKA 2KM0A 1C1OA 1C2IA 1TNIA 2ZGJA 1ZTKA 1DUAA 1EZXC 1K1LA 2Q6DA 3G01A 4ZXXH 3FP6E 4OGYA 1GHWH 2BDGA 4HG6A 1IQEA 5C0TA 2ANWA 3O8BA 4FOUC 1KXEA 1NFUA 4AX9H 2C8WB 1HAYB 2J97A 3LJOA 3RXBA 2F9NA 1T8OA 3ZVBA 2ZFFH 4TWWA 2H2ZA 1QB1A 2P93A 2VWOA 3SJOA 2VJ1A 2TGAA 3L3TA 3VXEH 2CF9H 4NA9H 1UTNA 3FP8E 1IAUA 1W7GH 3MO3A 3PV2A 2IPQX 1OWIA 4YT7H 1SGPE 2IOTA 5EQSA 5FHTA 4TWYA 3U69H 2G5NA 1MKWK 4X6PA 1JRTA 3FFGA 5EG4A 3RC6A 2ZPQA 1NN6A 2FOHA 3L6PA 3TH4H 4D9QA 3A8AA 5DP6A 2PLXA 2Z3CA 3SYJA 1EAXA 4ABJA 3F9HA 1C9TA 1GDQA 4LOYH 4A7IB 3FO8D 1E1RD 1ID5H 1TNJA 2D1JA 1DWBH 1P05A 2WPIS 2ULLA 3BEUA 4BXWA 3PV5A 4Y8ZA 2OC1A 1HLTH 4JK5A 1BRUP 3OTJE 5B6OA 2TPIZ 1O3MA 3SV2H 1Z8JB 1O39A 3VB3A 1C2HA 5CE1A 2FX6A 3SUGA 3HGNA 1CU1A 3SV6A 3LDXH 2FP7B 2WUCA 3PB1E 1O0DH 4CRDA 1DXPA 4DG4A 1LHFH 2EQNA 3ZZ6A 3FN8A 1QFKH 5FAHA 5C1XA 1UK2A 1Y8TA 1CHOF 2GV6A 1ZGVA 5C67A 4BAKB 2NU1E 1NU9A 5HYOA 2BVSH 3BN9A 3OE7D 2BDIA 2STBE 1O2ZA 1Q3XA 3DHKH 3A88A 3F2GA 4JZ1A 4K1EA 3SHCH 1EASA 3IWMA 4K8BA 1K1OA 4ZH8A 1QGFA 3SU2A 2O8MA 1K28D 5A09A 2WPDD 4FUJA 4K60A 2B5TB 4FETA 5EW1H 2FWWA 2ZDKA 2XWAA 2Y5HA 4D7FA 1FONA 3RC4A 5T3HA 2A4RA 1DDJA 3NKKA 3NCLA 2XNIA 1BRBE 2A0QB 1IQKA 5EGMA 3ZZBA 2C4FH 5A0BA 3PMJA 2J98B 3QZRA 4ISNA 1E37B 5DSFA 3H7TA 1O5AB 4YLQH 3JZ1B 1H9LB 2Y81A 2KFWA 2ZEBA 5C1UA 2SFAA 4U01A 1T4VH 2ZU1A 4ZUHA 1YBWA 1GL1A 3ZYDA 2IJOB 2M2AA 2R0KA 2WPJS 4J1YA 2ZFTA 2G52A 1JIMA 1HCGA 1UVPA 3GDUA 2VIQA 3SJ9A 4INHA 1MZDA 1VR1H 4B76A 4XOJA 1P3EA 3EAJA 4CREA 1TPAE 4FU7A 4YESB 5GXPA 7GCHF 3TIUA 2XYAA 3M7UA 4I8HA 3A7TA 1JXPA 5EODA 1UHBB 1XKBC 1TBRH 1ZMJA 2BLQA 4FU9A 1MTNC 1XMNB 1GJBB 1TB6H 4RT0A 2OQUA 2XNDD 1GBLA 1UTMA 1P2JA 4NWKA 1CGJE 1V6DA 3SNCA 3AW1A 2A31A 2J94A 1TMBH 2CHAC 3RXOA 3C1KA 1BITA 2QF0A 4XD7D 4WMDA 2ZWLH 3PWBA 1LTOA 4AFQA 3SGBE 3S7HB 1AU8A 1FN6A 3KQ5A 4IMQA 1S6LA 3M3TA 4B2BA 3PLKA 4IGDA 2NU4E 3P8GA 2PGBB 5IDKA 1TQ7B 1UCYH 1KLTA 1A0HB 1WQSA 2GGVB 2G4UA 3LGUA 1ETSH 4GCHG 3VGCC 4CRFA 4Y11E 2VGCB 2I6SA 4BAOB 1BMMH 4KELA 4WWYA 3ZZAA 4K3JA 1GHBG 3D65E 3RXDA 3UFAA 3NXPA 4ZROA 2Z9LA 1GJ4H 2L74A 1H4WA 2ZHQH 3U8RH 1SOZA 3FVFB 4MPVA 2ZA5A 1XUGA 4UDWH 2ESTE 4AOQA 2ZCKP 1L0ZA 3MU0A 2FS9A 1AUTC 1HAGE 2ZCLP 1FLEE 1GG6B 1A5IA 1ORFA 2FYQA 3RXGA 1GCTC 3CS0A 3M36A 1NU7B 2J2UA 1TNLA 1AHTH 1MABB 4ZHLU 1C5PA 4DGJA 2I6QA 3TK9A 4NZLA 2KAIA 2IN2A 1UVSH 1DVAH 1MTVA 3SO3A 3KCGH 1HAVA 2VGCC 3BTDE 3SOSA 4K1SA 1O31A 1SMFE 1C2JA 2HPPH 1DSTA 2IJD1 1O2SA 1ZPBA 1UVOA 1DLEA 3O8DA 2THFB 1PQ7A 1MMJN 3E16B 5EW2H 3ZVAA 1GBAA 1GBEA 1C1UH 5EJLA 2EY4C 2IPHA 3U9AH 4NZQA 4YM9A 3FP7E 4GAWA 2AMDA 3GICB 3BG4C 1F7ZA 1O37A 5EXMA 1YPHE 5K7RA 4X1NU 1P9UA 1OOKB 1GI0A 1GHXH 2TGTA 3EE0B 1ELCA 1LMWB 3TPIZ 3NUMA 2G4TA 3SI3H 3F68H 4FUEA 5JBTA 4I32A 4RKOB 4AGKA 5LPRA 2XWBI 4ZAEA 2XBWA 4MNWA 2H5CA 2HLDD 4O3UA 1OXGA 3T5FH 1DITH 1M9UA 3AVZA 3GOVB 4Q7ZA 1UTKA 4Z0KA 1QL9A 4ZKNU 3OU0A 5F03A 1TBZH 2PWXA 5F6MA 1C2LA 1W10U 5A0AE 3F2FA 1CSOE 3MMGA 2HNTF 2ZU5A 1NY22 2R0LA 3RUOA 1GBHA 3A89A 3ZZ9A 1NRPH 1IHSH 4ISIH 3ATKA 1O3LA 1RJXB 1NBME 2G51A 4LK4A 2Y7ZA 3GCTF 2VVCA 2WSSD 1G30B 1O3GA 1ANCA 4A1TA 2F3CE 5T6DA 1GI9B 1QL8A 4ZCNA 4YOIA 9ESTA 1EP6A 1C1NA 3S69A 2OBQA 2FOFA 1EAUA 1HJ9A 1WOFA 2O8UA 5KECA 2OINA 3U8OH 3V0XA 1O2OA 2TBSA 4WXVA 5H4IB 1EP5A 4NFEA 1GJAB 1ZMNA 4YOJA 3GCTG 1HAZB 3HKIB 3RXJA 3SU4A 3A8DA 2CHAB 2A2QH 3QGNB 3PMAB 4AZ2B 2ANYA 1SG8B 2V0BA 1B7XB 1TNKA 4RN6A 4OGXA 3K6YA 1O3HA 2WPLS 3UQVA 1E35B 1PQ8A 3BTKE 3GY2A 1SGCA 2Y5GA 2NU2E 1MCTA 2R9PA 6GCHG 2FZZA 5LPFA 1O2NA 4XBCA 3A7YA 1E38B 1SQTA 1Y59T 2FOCA 4CHAC 1SGIB 2C8XB 2QF3A 1P04A 1GHZA 2CK3D 2VNTA 4CRAA 3ENSB 3VB6A 1TABE 2FX4A 3RXUA 1CGHA 5IK2D 1O5FH 5T1VA 1F5LA 5G4BA 2QYIA 3RMMH 1C1RA 1D6WA 3SQHE 7ESTE 3RMNH 2FTMA 1J8AA 4HZHA 3A7VA 1C5OH 1P02A 1V2LT 1OX1A 2XXLA 3EQ0H 3MNSA 3PTBA 4XBDA 5DK1A 1QRZA 3OSYA 1S6HA 2CF8H 1P11E 4B73A 2XW9A 4X2XA 2GT8A 1DY8A 1O5DH 3QDZB 1AMHA 4JYTA 2O9QA 1DPOA 3RLYH 3UIRA 1BA8B 2SGAA 1BRAA 2Y7XA 2BY7X 3Q3YA 3A86A 3GYLB 1UK4A 1WU1A 1WAYB 4FVDA 2AH4X 3A7ZA 2BZ6H 5FX6A 2BY5X 1QNJA 1B5GH 2G81E 4JZEH 3EA8A 3M5OA 3BF6H 4X8UH 3M5MA 2WV4A 1HV7A 4U2WA 1UCYK 3T25A 2ZTXA 3GCNA 1O33A 1BTUA 3U8TH 1OYTH 1TONA 2BM2A 2G8TA 1SGRE 2JH5D 2DE8A 2VH6A 3RDZA 3UTUH 2RG3A 1DANH 1GJDB 4UFFH 2H9HA 5AVDA 5E2OA 2J92A 5JB8S 1TBQH 1QJ6B 2C3SA 1MBMA 2XC5A 4CBNA 2B7DH 2JJ2D 1FAXA 1TNHA 3RXEA 3UR6A 2GDDA 3E90B 1KDQB 1BBRH 1HIAA 3SJIA 1NZQH 2FYRA 1C1TA 2GVFA 1SLVB 3P6ZB 4B71A 4NSYA 1F0RA 2BLOA 2FTLE 1LHGH 1FV9A 5GPIB 1CBWC 2O8LA 1L4ZA 5KGOA 1KLJH 1DFPA 4CH8B 1E1QD 1UTQA 1FY5A 1V2JT 2D2DA 3MH4A 4X8VH 3K6ZA 3SGQE 3RXVA 4IN1A 1SQAA 3P17H 1EJMA 7GCHG 4UD9H 3A85A 1QB6A 1TA6A 3K65B 8GCHF 1OWEA 2EEKA 1L1NA 3OY6U 3SQEE 5ESBA 1P2OA 1GI8B 1GL0E 1P09A 1XXDA 3MU5A 4DJZB 7LPRA 3M35A 4OS4A 3DD2H 1GBMA 1JOUB 1GJ6A
chains in the Genus database with same CATH topology
3RXLA 3SU1A 1GI7B 1OWJA 5AFZH 4DOQA 4AFUA 1TRNA 1ELFA 3UOUA 1O36A 3TITA 4MNYA 1P0SH 2W26A 1MKXK 1GBCA 2BD7A 2PSXA 4JZFH 1C5NH 1SGYE 1W8BH 1O3EA 2QA9E 1P3CA 4DW2U 5A8XA 1H8IH 2GZ8A 1ZOMA 1LPKB 1H9IE 1C4U2 4HTCH 2HPQH 1ZRKA 5GCHG 4F4OC 1ZPZA 2H9TH 2PKAB 2PFEA 1UVUH 3PV4A 1MKXH 3ELAH 1NO9H 3UREA 3GDVA 5FX5A 1BTWA 1GMDG 2VVVA 1XUHA 1ZTLA 1G2LA 1AFQC 1LQDB 1OYQA 5E0GA 4X1SU 5L2YH 1BHXF 3ZV8A 1KIGH 4JZDH 4A6LA 1JMOH 5LH8A 5LGOA 1NT1A 2W5EA 4AFZA 1JRSA 3BTQE 3DUXH 2NWNA 1LPGB 1GBJA 1VCPA 2VWNA 1O2IA 1QQ4A 4KP0A 1ACBE 3LU9B 3BEFB 1SHYA 1J17T 4H4FA 1C2FA 1RD3B 1GCTB 2A45B 2SNWA 4YTAA 4LZ4B 1FY8E 2AIQA 1YPGH 2P16A 3QX5H 4YT6H 4Y7AA 3RXFA 2GDEH 2HNTC 3TJOA 2W3KA 1IQIA 1S0RA 2P8OC 2BMGB 2UWOA 1BTYA 4QT8C 3E6PH 1QY6A 4I8LA 4UFGH 1TA2A 3R3GB 3A8BA 1P8VC 2ZFPH 3V13A 3TVJB 4B74A 1F0SA 4AYVB 4U32A 2GT7A 4FUGA 1EATA 3E0NB 4XFQA 2PUQH 3QWCH 2P3FH 3UNQA 1O2KA 1IHTH 4RSPA 4UEHH 3S7KB 1NRSH 4VGCB 2FIRH 3F9FA 1NS3A 1K1NA 1AKSA 2AGIX 2Y5FA 2HOBA 1F2SE 1Q2WA 1SSXA 1KTTB 2UUYA 3UNRA 3VGCB 1W0ZU 2ZF0H 3RU4D 1G9IE 4WY3A 2BD8A 3S9BA 3BTEE 2AGEX 2F9OA 1TMUH 1RTLA 1D3DB 2PHBA 3Q77A 1IQMA 1V2KT 1C5UA 1GPZA 3MI4A 4OS6A 4A5TS 4BAQB 1AVXA 1GHBF 1TWXB 1BJUA 2WYGA 4X2YA 2ANMH 5C5OA 3CS7A 3ODFA 2F9BH 2YNAA 3UWIA 3BTTE 3ZVFA 2ASUB 2ZU4A 3T27A 5HXFA 2BVRH 2RA3A 3UY9A 2STAE 3PO1C 2QXHA 2VIOA 4O9VA 8LPRA 4LXBH 1GI3A 1V2WT 1E0FD 1OP2A 2Y82A 2ZCHP 3LGVA 4K2YA 3KF2A 1LDTT 2RCEA 2FOBA 4D7GA 4NFFA 1HJ8A 2ZTZA 1J14A 3FZDA 3HK3B 4YO9A 1THPB 1NFYA 5A8YA 1D3TB 1AD8H 1SGFA 3BIUH 4WMEA 5GJ4B 2OC8A 1WTGH 4DIIH 1ARBA 2JKHA 1N1LA 1YGCH 1HAPH 3UQOA 1SFQB 2D26C 2BDCA 3E1XB 1XUFA 1YKTA 4H6SB 1QQUA 2FLRH 3GCHB 1QBOA 4Y8XA 2CV3A 1VCWA 1FIWA 3B8JA 2EI8A 3A7XA 1FIZA 1O3CA 1Y5AT 1EZUC 3P8NA 1SI5H 5TJXA 3SUEA 1FY3A 1C4Y2 2QXGA 3SN8A 3PLPA 1YPHC 3AAVA 1BRCE 4ISLA 1IQHA 4XBBA 5E0JA 4X1PU 2QC2A 5AFYH 1A0LA 2AGGX 2GD4B 4IC5A 1NRNH 2SGQE 3A80A 2TIOA 3T2NA 5HMAA 2WPMS 2JH0D 2VVUA 2ZZUH 2H6MA 3SBKA 1KSNA 3BSQA 1W0YH 4TY6A 1Z1IA 1NPMA 1SBWA 2ZFSA 1ZTJA 3TU7H 1AY6H 1ZHMA 4NIYA 5CHAC 4BOHA 1QR3E 5DPAA 3RXSA 4Y79A 1F5RA 3KHVA 3LT3A 1THRH 4X8TH 1QB9A 1VZQH 1A1RA 1FJSA 1C5YB 1O2QA 1BBRE 1S83A 3A7WA 1PPGE 1WSSH 3V3MA 5DP3A 3RMOH 3UOPA 3PLBA 1QRWA 2PSYA 3SJ8A 4ABAA 2WPHS 3NWUA 1Z71A 3K9XB 3BG4B 1Q31A 1O2JA 1Z8RA 2W7SA 1V3XA 2QAAA 2A5IA 1CGIE 2VH0A 1DE7H 3W95A 3TH2H 4JCNA 2Z6BD 1K2I1 3RXTA 2J34A 1ZSKA 1ELDE 1BCUH 3ZZ4A 1AVWA 1AFEH 1TOCB 4FU8A 4X2VA 2J9NA 1V2VT 3UUZA 3TJNA 1FDPA 1YP9A 3GISB 2Z3EA 2ZGCA 1V2NT 1ZJDA 1E34B 5EOKA 3SU6A 1TAWA 5FPTA 2RDLA 2P3TB 5GDSH 4CRGA 4IC6A 2BD5A 1NM6A 1CHGA 4KTSA 1RTFB 1XVOA 4K1TA 1NRQH 3ZYEA 2ZIQH 3TGKE 2ZGHA 3A87A 5GIBA 1P2NA 1O3FA 3MTYA 4ABBA 1P03A 1C1MA 4X0WU 3RXAA 2A32A 2ZHWH 5CMXH 3MYWA 1EJAA 1EUFA 1MU8B 1TALA 1QA0A 1BUIA 3UWJH 1HPGA 3M37A 1Z6JH 2FOGA 4GVUA 2ZI2H 1GMHG 1MTNB 3ZZ7A 3BEIB 1XXFA 2FOEA 5T6FA 1LQEA 2ODQA 3LC5A 4MTBA 3OYPA 2QGRA 1ANBA 3M3SA 2H1UA 3LJJA 1GHAF 3RXCA 2R2MB 2VIDA 5SGAE 4FVBA 1QJ7B 2F9UA 4NIVA 2FEQH 2VWMA 1SB1H 3Q00A 4XSKU 1XKAC 2BQWB 5EXLA 4E7RG 4NG9H 4NWLA 5F8TA 1LPZB 4WH6A 1EPTB 1O2PA 1BT7A 1F5KU 4BXSA 3M5LA 4M7GA 4JZIA 1JBUH 2NU3E 5FPSA 1F92A 1Y3VA 1TGNA 2AEIH 1GDUA 3RMLH 1QL7A 2NU0E 3BG8A 4I33A 2DE9A 2XCFA 3QN7A 4ASHA 2XRCA 1XUIA 1AWHB 5FXLA 1XM1A 5DP9A 1MTWA 5L30H 1CVWH 3EA9A 4BAMB 1TNGA 5DP7A 1A7SA 6LPRA 1IQGA 1SHHB 2QCYA 2BD2A 1GHYH 3HGPA 3P70B 4MPWA 4WF8A 1A46H 1FNIA 3VEQB 3ZZ8A 1S82A 3ZVCA 1J9CH 2YNBA 2J95A 1OPHB 1S6FA 3RM2H 2WUBA 1HXEH 3T26A 4KKDA 1B0FA 1GI5A 1BZXE 2QIQA 1GHVH 5FBIA 1YYY1 3W94A 2ZDAH 3S9AA 3SHAH 3O8CA 1ANEA 1PQAA 3WY8A 2FI5E 4DCDA 2AERH 3ZVDA 1TMTH 1GI6A 1ZR0A 1ZSLA 4ZMAH 1GG6C 1PPBH 1GJCB 1PYTC 1CE5A 1UTLM 2ZG0H 7KMEH 2BDHA 2BQ6B 2FM2A 1ELTA 1NFWA 1YF4A 4GHQA 5FCRA 1WV7H 1FXYA 1K9OE 3A83A 3E0PB 4KGAA 1WBGB 2ZDVH 3MWIU 4ABDA 4I8GA 1VITF 1QBNA 1AKSB 1SR5C 1AFQB 3E91A 3RP2A 1Y3UA 3TGJE 2OTVA 4BAHB 1PPFE 4H6TA 1DWEH 1CA8B 2Q6FA 2OC7A 1HJAC 1ZHPA 2BOKA 1EOJA 3RU4T 3ITIA 3R0FA 1NROH 1HYLA 3LGWA 2BVXH 5DP4A 3F9GA 1V2UT 2A4OA 3N7OA 1FPHH 2PKSC 1P57B 1G37A 2HALA 1IQFA 4KTUA 3VPKA 2XC0A 4JK6A 1AIXH 1SQOA 2Z9JA 3ATMA 1GBIA 2ZECA 5JDUB 3LH1A 1DWCH 3ZZ3A 1HUTH 1C1PA 1EPTA 1V2TT 4ZHMU 1W14U 1MU6B 1SGFG 3U1IB 3STJA 1C1QA 2WPKS 1QHRB 1G36A 1MCVA 3RC5A 1FAKH 4Z6AH 5FBEA 3BTME 1GI2A 3T62A 1A4WH 1BMNH 5JYIA 3M7TA 1N8OB 2ODYB 1Y3YA 1SGEE 1T4UH 3QUMP 1S81A 1RS0A 3FAOA 4A1VA 4NSVA 1LHEH 2BLWA 1VCQA 2PKSB 5JBCS 1K22H 1MKWH 2BD9A 3EDXB 2EI7A 2OC0A 1ELBA 1TX8A 1T31A 1ZSJA 1C5WB 1YPLH 3RXPA 2P3UB 2P94A 3P8FA 2V35A 1TYNA 2BDYA 2GX4A 5ABWA 4Y0ZE 4DT7B 3QLPH 3GCHC 4IN2A 3EYDA 1O2XA 1GJ9B 2FO9A 2UUFB 3UR9A 3A8CA 4FUCA 2GMTC 3GY7A 1MD8A 3D49H 1S84A 2GV7A 1C5ZB 4PROA 1KTSB 2A4GA 3V7TA 5HM2A 1O32A 3QO6A 4AG1A 4Q7XA 1N6YA 4XE4A 1AN1E 1A3BH 4AFSA 2G55A 2BD4A 1SLXB 3SGAE 1IQJA 1MQ6A 3TH3H 1IOEA 1E36B 2AFQB 2F9VA 2ZGBH 4X6NA 5EU8A 1V2ST 3PROA 3SU0A 3V12A 2B9LA 4HGCA 2EI6A 1ZLRA 1AGJA 2ZQ1A 3LONA 1SFIA 1RIWC 4CHAB 1O3KA 1TGCA 1C1SA 1GGDC 5C20A 1GMCG 5C2ZA 1VITG 2ZFQH 1O2YA 1P2KA 1FY1A 1GWAA 2FLBH 3RXQA 1BBRK 1TGBA 3D23A 2GCTC 1O38A 2VINA 4BTIB 4A1XA 1NESE 2V6NA 3GYMA 3MU8A 1D4PB 4CR9A 3GY8A 1C5XB 1EXFA 4GLYA 4DY7B 4FUFA 2Z9KA 1AE8H 1UMAH 2ZC9H 4J2YB 1SLUB 2FODA 2UUJB 5DP8A 3H5CB 2AYWA 2O8WA 1KDQA 2YOLA 3KNXA 2BQ7B 1G3BA 2A7HA 1AB9B 1FPCH 1EOLA 1WCZA 2G00A 2EA3A 4OS7A 2AS9A 1C2EA 4BTUB 4D8NA 1BMLA 1C2DA 1O3AA 3SI4H 1EX3A 5L6NH 3KQBA 3HPTB 2BDAA 4ABEA 4ABFA 1V2MT 1K1IA 1EKBB 4Y7BA 3B23B 1W2KH 3MU1A 1U6QA 5PTPA 1AWFH 1GBFA 1L1JA 2A4QA 4WH8A 4ZKOU 1W7XH 2A1DB 3P92A 3SNBA 5I46H 1DX5M 1Z8GA 3UNSA 3RXHA 1Z7KA 1SLWB 3SUDA 4SGAE 1BTZA 2A7JA 3HKJB 3SV9A 2R2WU 1GI1A 3KEEA 4RKJB 1GBDA 4MPXA 1LKBA 3KQEA 1F0TA 1ELAA 3A82A 3CENA 3LGYA 1EAWA 1N6XA 1P2QA 4UFEH 4X6MA 1GVLA 1BMAA 1HBTH 3FANA 1O5GH 2JETC 4INLA 4TY7A 5F8XA 2Q6GA 3AASA 2FPZA 4FUIA 2PR3A 1L4DA 1YC0A 1CHOG 1MD7A 1VJAU 4O3TA 1C5SA 1AZZA 3RU4E 3ZVEA 1WQVH 2BX4A 2D8WA 3MO6A 3SJKA 3T28A 3QGJA 5C1YA 1P10A 2J38A 1EB1H 4LZ1H 4GSOA 5DGJA 1O35A 2TRMA 4KTCA 1YCPK 3RLWH 2M5TA 3SNEA 1QRXA 1EPTC 2Z7FE 3KQCA 2FI4E 1JIRA 1SGDE 3HK6B 3SW2B 2A5AA 2PGQB 1ELVA 1FUJA 4NIWA 5ESTE 4XDEA 1UCYE 1A2CH 3URDA 2LPRA 2UUKB 1HAOH 4ISHH 1AVGH 3U1JB 1MBQA 3DA9B 3VFEA 4UONA 5CHAB 5GWZA 3S0NA 3LIWA 1HRTH 4NA8A 1G2MA 4ABGA 3F1SB 1Y5UT 5AF9H 4OS1A 4UE7H 1D9IA 1EJNA 3GY6A 4YOGA 1T32A 1OS8A 2BY9X 4MNVA 2JH6D 1INCA 4I8JA 1IQLA 4D9RA 3ZZCA 1XUKA 1C2MA 4CRBA 3I78A 2GZ9A 3I29A 2CN0H 2SNVA 1Z1JA 2FMJA 1HFDA 2ZDLA 2GTBA 4WXIA 4B2CA 1ZHRA 1MTSA 1PYTD 2GCHF 1BTHH 4ISOA 1TPSA 3ATWA 1DSUA 5GCHF 5IYTA 1ZJKA 1YCPH 2HRVA 5ETXA 5L2ZH 2FS8A 3B9FH 1J16A 4VGCC 3SORA 2F9PA 2Y80A 4AG2A 1D3PB 1SPJA 2QXIA 2SGPE 1YPJH 2C90B 4I7YH 1T7CA 4E06H 2OBOA 1FY4A 1HIAB 1DICA 9LPRA 1H8DH 1O2LA 2BY8X 3MH6A 3PTNA 2OQ5A 1JWTA 1OWHA 1BQYA 1MQ5A 2EC9H 2SGFE 2ZPRA 2PTNA 1K1JA 4I8KA 2TGPZ 1GCDA 2UWPA 5FPYA 3SV8A 4GPGA 1P01A 1V2PT 1O3OA 3L33A 2VIWA 4O03A 2A7CA 5C5NA 1CT0E 2WYJA 2W7UA 4BANB 1G3EA 3NK8A 1DY9A 1EB2A 1O2VA 3OY5U 2SGEE 1QJ1B 3A84A 1ESTA 3U98H 5F8ZA 1DM4B 2C8ZB 4R0IA 3MU4A 1G32B 1O2MA 1XUJA 4UFDH 4AGJA 1RTKA 3SNAA 1D6RA 5E2PA 4NIXA 3MFJA 1NTPA 2PW8H 1TIOA 3DT0H 3PYHA 1UVTH 4GHTA 1BIOA 2BLVA 1OWDA 1TX6A 3ATLA 3RXIA 1NFXA 1KY9A 1AE5A 1GBTA 2AMPA 1VJ9U 3BTWE 4AB8A 2QY0B 4ZHAA 2A5KA 2AIPA 1H1BA 3S9CA 1MUEB 5JBBS 4HI3A 1G3DA 3ATIA 1W13U 1QTFA 3BTFE 1AUJA 1LHDH 4Y6DA 1GBBA 4ABIA 1LVYA 3I77A 1QBVH 4E7NA 1NC6A 5LPEA 3NZIA 1O5CB 3ZVGA 4WVPE 1GBKA 3TK5A 1P12E 4BNRA 1DOJA 1HNEE 3NPSA 2C8YB 1SGTA 2ZKSA 2PV9B 3TNSA 2H9EH 2ZDMA 1THSH 4IBLH 5FCKA 2OD3B 1Z8IB 2ZP0H 2BHGA 1TLDA 2FI3E 1C2GA 1LO6A 4BTTB 1C1VH 1O5BB 4ZXYH 1CO7E 2FOMB 1BB0B 1ZMLA 2XC4A 3M7QA 1O3NA 4JYVH 1HAHH 4I31A 1BJVA 1HJAB 1WUNH 5JPMH 5EQQA 2OUAA 3MO9A 2PUXB 3LPRA 4Y76A 1TQ0B 1SC8U 4IS5A 2GMTB 2HGTH 2BB4A 3BTHE 2Y6TA 1TOMH 1Y3WA 1KXAA 3EA7A 4B75A 4AB9A 1IQNA 3CP7A 1K21H 1TGSZ 3P8OA 3VB4A 2Z9GA 1UHBA 2G5VA 2PTCE 1MAXA 1O3IA 2ZU2A 3DFLA 1C5QA 1TPOA