1GCDA

Refined crystal structure of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
237
Chain Sequence
CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords GAMMA-CHYMOTRYPSIN
publication title Refined crystal structures of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
total genus 50
structure length 237
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1994-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA01
2BMGB 3LGIA 4Q7ZA 1MTSA 2V35A 1P04A 2Z3DA 1FONA 1LVOA 2Z9GA 5DK1A 3CS7A 1UTJA 2GD4B 1CVWH 3DFJA 3QO6A 4E06H 2A1DB 5DP7A 1TGBA 1CO7E 3RMLH 1DWBH 3VB4A 4YOGA 3NKKA 1TE0A 2WPMS 1YYY1 1E36B 1QQUA 1S82A 2BY9X 4M7GA 3GCTF 1GI6A 2BD8A 1EJNA 1BOQA 4FU9A 4Q7XA 1W12U 5K7RA 1BITA 3GDVA 1SBWA 2OBOA 1DUEA 1AUTC 1LHDH 2SGPE 1OP2A 3RXQA 3SV8A 2R2WU 1V2UT 4ZROA 2ODQA 3MO9A 3SNAA 2BXTH 2PR3A 1MBQA 1GBAA 4AB8A 1Z8JB 4DGJA 1RTLA 1SR5C 2GCHF 3GCOA 3N7OA 6GCHF 1CBWB 4R8TB 1O2PA 1SGFA 1TMTH 4NIYA 3A82A 3P95A 1F5KU 3SJOA 2P3FH 3OTJE 1W7XH 1GBMA 2UUJB 2G81E 4ZXXH 2ILNA 2LNCA 1TNKA 5J4SA 1DFPA 1FNIA 1TFXA 3VXEH 3M35A 3E90B 2XBWA 5EPYA 1B0EA 1ELFA 4ISLA 1G3BA 1ETRH 1CU1A 3C27B 1DOJA 1YLDA 4OS7A 1S5SA 3MU5A 1ZLRA 2F9PA 1AO5A 4ZKSU 1HGTH 2Z94A 2STAE 2C93B 4MTBA 1QA7A 3RXTA 1BTHH 2A7JA 4TPIZ 1LHFH 2FS8A 2BDGA 1D3DB 1BDAA 1QNJA 2AERH 5E2PA 1O2OA 2A0QB 2BQ6B 3LPRA 1TONA 4O03A 1H9LB 2JKHA 2ZDKA 1EB1H 3PTNA 1INCA 4XDEA 9LPRA 2RG3A 4XBDA 4CRFA 2OP9A 4BTIB 2R2MB 1HAPH 3ZZDA 3K2UA 2ZTZA 1SLUB 1TNIA 4AN7A 3RU4D 1G32B 2VIQA 1V3XA 3BEIB 4XBCA 4Y8YA 3SOSA 2AFQB 3OSYA 1V2TT 2C3SA 2D26C 1MMJN 3ENSB 4AG1A 3SV6A 1C5MD 1O39A 2ZNKH 2KAIB 2PSYA 2XXLA 4D8NA 2PGQB 4CHAC 1SGYE 1EZXC 3HPTB 3F9EA 5FCRA 1ZTJA 1V2WT 5C2ZA 3RXJA 1O2VA 4IS5A 3G01A 1HYLA 4MPUA 5EQSA 1O2LA 1ZPZA 2W7UA 2ZI2H 3M5NA 4ASHA 1THPB 1W13U 4F4OC 1GMDG 3BTME 4IMZA 3EGKH 2BD4A 4MDSA 1GI5A 5HM2A 4AZ2B 3MO3A 3D49H 5A8YA 5C67A 1L4ZA 3I77A 3QN7A 1OS8A 2XBVA 4DG4A 2C4FH 3TVJB 3E1XB 1EP5A 1IAUA 1AMHA 2GV7A 1WQVH 1KXEA 4H4FA 2ZO3H 1GVKB 2TGDA 4AFUA 2DE9A 1EZUC 1MAXA 1C1OA 1QFKH 3UNSA 4NSVA 3T62A 3BTKE 1C5SA 2BVSH 4O3TA 3UWJH 1NN6A 1HNEE 1SQTA 2VB0A 1MZAA 2QA9E 1HFDA 1WTGH 2ZP0H 5BRRE 1Z8IB 1MKWH 1SG8B 1YCPH 4YT7H 3A7VA 1O3KA 2FTLE 3EYDA 1Y3UA 2PKSB 2VGCB 4TY6A 3QUMP 1SFQB 2SGFE 4A1VA 2CV3A 3VB5A 1HDTH 5DP5A 1TALA 5E8EH 1QJ6B 1GI2A 2BD3A 4JK6A 3SNDA 2OC1A 2C90B 3OYPA 3RM0H 1TPPA 2ZGXH 2G5NA 2W3KA 1TB6H 3KQDA 5LPEA 2RCEA 4HFPB 1DWCH 2G4TA 4FUCA 1P2OA 4ZHAA 1GJ9B 3SU1A 1VJ9U 2HNTF 4HI3A 3BIVH 3RLYH 1A0LA 1ZRKA 3MI4A 1SGQE 1W10U 5L2ZH 3LH1A 3E0NB 3LGVA 4YESB 1HAXB 2FIRH 3UTUH 1MKXH 4X1QU 1T8NA 1ZHMA 3RXCA 1G2MA 4ZKNU 5JB8S 1AU8A 2O8WA 1HAIH 3SU4A 2F9UA 2ZPSA 1BQYA 4Y6DA 1JMOH 3ZVGA 5CE1A 1HRTH 1TRNA 3NWUA 1TOCB 1C1TA 1KDQA 3ATLA 3ZZAA 1HIAB 1GHXH 3HGNA 2P94A 1GGDB 3D23A 2ZDAH 1SQAA 3SQHE 2XW9A 1MU8B 4MG3A 1HAVB 4ABIA 1NY22 1TGNA 1GBLA 3MH7A 3QX5H 2DUCA 3PLPA 3PO1C 5LPFA 4YLUA 4OS5A 1JXPA 1BJVA 2ANMH 4RSPA 3DUXH 4UONA 3GYLB 3V3MA 1AFQC 5GCHG 3RXBA 5EG4A 1BMLA 1K1JA 3SU0A 1C2FA 1A3EH 1QRWA 4O9VA 3ZZ3A 5FX5A 3URCA 3A7XA 1O2IA 3PV4A 2D2DA 1MBMA 1BTZA 4B75A 4I31A 3BTTE 1PPHE 3ODFA 1EAUA 2VWOA 4THNH 2FDAA 1FMGA 1J14A 4NSYA 1QIXB 1O5AB 1CT4E 1G30B 5H4IB 5L2YH 1KXAA 3BG8A 5EW1H 4NZQA 1V2VT 3F9FA 1C1NA 1ORFA 2QXHA 2FYQA 1QBVH 2XBYA 7LPRA 4JZEH 4X8UH 1O5DH 4JYUH 1FPHH 1CHOF 1UHBB 1EUFA 1EB2A 2CF9H 4I33A 1UK4A 2P8OC 2ZGCA 3V7TA 4A6LA 3SHAH 3S7HB 1MTUA 3GY3A 3UFAA 1SL3A 4Y7AA 2A4GA 4FUFA 2SNVA 1EZQA 1A46H 5K0HA 2BB4A 3A87A 3AW1A 1FY1A 1O3EA 4NFEA 5F6MA 1ETTH 3RC5A 1TOMH 1YPKH 3ZZ4A 1JIMA 3EDXB 2G51A 1GBEA 4X2XA 3A88A 3MMGA 3QGJA 1P2QA 2ZDVH 2PLXA 2O9QA 1C1UH 3A7WA 5ETXA 5AFZH 1C5QA 2ZU4A 2XYAA 1HXFH 1XUHA 5DP9A 5JBBS 1CBWC 1F2SE 4AB9A 4Q2KA 1Q3XA 3ZVFA 2ZF0H 5DKMA 4X6MA 2ODPA 3E91A 4YTAA 3LC5A 1LPZB 2PUQH 2J9NA 1H8DH 1L1JA 3SUFA 1AD8H 1GMHG 1KLTA 1PPFE 5JBAS 2ZGJA 2FI3E 4WH8A 2WPHS 2OC7A 1ZOMA 2VIVA 1C1MA 4DVAU 1NRQH 2ZZUH 4INKA 1T7CA 1PYTC 3RXAA 1XM1A 2QF0A 1O2HA 4K60A 1JIRA 1ZSKA 1M9UA 1B0FA 2SGAA 4MPVA 3F1SB 1OWIA 1FV9A 2EI8A 2Y5GA 1MQ6A 1C9TA 4WXVA 1W3CA 4CHAB 2ZCHP 2BYAX 3HGPA 4I32A 4K69A 1FN8A 4DT7B 3V0XA 5DP3A 1GHZA 1UMAH 3QGNB 5AHGH 1O2JA 3HKIB 1PQ8A 1O3BA 1Y3XA 3HK6B 3GY6A 3EE0B 3ATIA 1RJXB 5JBCS 3UIRA 5AVDA 1S0RA 1P8VC 1MCTA 2TGAA 2HVXA 1RIWC 1C5ZB 2RDLA 2QCYA 1V2JT 1TWXB 1MH0A 5DO4H 2XRCA 5GJ4B 3AAUA 1Y8TA 2XNIA 5DPAA 2Z3EA 2QIQA 1P05A 8ESTE 5I25A 2CXVA 4Z6AH 1QJ1B 2HPPH 2Y5FA 1TPOA 2OCVB 3A8BA 1ELTA 3ATMA 1KXCA 3MU4A 4B73A 4X6OA 1UCYK 1EAWA 2FM2A 2XBXA 2OC8A 4CREA 1Z6EA 4MNVA 3PWCA 4YT6H 1C4Y2 3GY5A 5E0GA 4X8VH 2ZHEH 5FBIA 5HM9A 3ZV9A 2WPJS 3TGIE 3ITIA 2G4UA 3U1IB 3LJOA 5T6DA 1BTXA 1NRPH 1L1NA 1UO6A 2VINA 4Y71A 1UCYE 1GMDF 1Z6JH 1ZMLA 3UWIA 2Y82A 4ISIH 1NO9H 3VFEA 3ZVBA 1LQEA 3RXKA 3DFLA 1V2MT 2KAIA 1G36A 2F91A 4IC6A 3RLWH 2ZEBA 1A0JA 2D1JA 3KCGH 5L30H 2GVFA 1WBGB 2TGPZ 1ACBE 1NTPA 3SNBA 1TGSZ 2GMTC 5DP6A 1ZJDA 3I78A 4K3JA 1P2IA 1EPTA 2Z9KA 4ZHMU 1L0ZA 5AFYH 1ESBA 3SI4H 4AFQA 3OY6U 3KQCA 4ZKRU 4D7GA 2PKSC 1BZXE 3S69A 1YPJH 2ZDNA 1A3BH 2ZWLH 4F49A 4YLQH 1DITH 1GJAB 1FLEE 3AVZA 1PPZA 1K22H 1GHVH 2J92A 4A7IB 1YPHE 1FQ3A 3NUMA 1ABJH 1ARCA 2Y7ZA 1K21H 2BDAA 3SNCA 2Z9IA 4FUEA 2W7SA 3M5LA 4CRAA 3PM3A 1NPMA 3A8CA 3KGPA 3RU4E 1QB9A 1BBRH 3SU3A 3U98H 3KN2A 3PO1B 5EXNA 1TAWA 3LKWA 1AFQB 2A5KA 1OP0A 2J34A 4UFEH 2PFEA 1GG6C 4IC5A 6LPRA 1SC8U 2O8UA 1BHXB 2ASUB 4JMYA 1TBQH 2FOAA 1T32A 1ANCA 2YOLA 1BTUA 2P95A 5HXFA 1YPLH 1ELGA 1T8MA 4K1EA 3TJOA 3ZVEA 2Y7XA 7GCHF 4CBNA 1K28D 4TPYA 1GGDC 4IW4E 4GCHF 1K1IA 1H9HE 1BRUP 3T2NA 4LZ4B 1C4U2 3U69H 4E7RG 4ZKOU 1FPCH 1C5LH 1H1BA 3ATWA 3TH2H 3V12A 1YPEH 3LGYA 2P8OB 1GMCG 4NA9H 2Z3CA 4B2CA 1PQAA 1YPHC 2ODYB 2PSXA 1QR3E 1ZPCA 3SHCH 1SSXA 1GDQA 4D9RA 5GCHF 2ZQ2A 2UUKB 4ZHLU 1ZR0A 4CRGA 1HIAA 4K2YA 3TLOA 3T26A 1UTKA 3UREA 4BOHA 1HAVA 3P92A 4KTUA 2B9LA 4GLYA 4NG9H 2SGQE 5DGJA 2PTCE 4UDWH 1O36A 2Y6TA 3FP8E 1O2UA 1AE5A 4LZ1H 4JCNA 1X7AC 5LPRA 3B8JA 3PMJA 1O2RA 2H2ZA 3UQVA 7KMEH 5IDKA 1YM0A 2J2UA 2FOHA 1GDNA 2P3TB 1QY6A 1DLEA 2D8WA 2UUFB 3RM2H 1HAGE 5FPTA 1C9PA 5A2MH 2ZG0H 1BJUA 5FAHA 3UOUA 2AGIX 1CGHA 1LPGB 3SGAE 1MU6B 1MZDA 1Z1JA 1MCVA 3RUOA 1QHRB 1SGEE 5C1YA 1NS3A 4B71A 1NC6A 3BTGE 3DD2H 1UHBA 2GGVB 2P59A 1GHAG 4FUBA 1SLVB 1LDTT 2ZA5A 1FXYA 4WMDA 2FYRA 3URDA 4B76A 5B6OA 2A4RA 2G00A 3RXMA 4E05H 4X1NU 2H5CA 2J94A 3VB6A 1BTWA 4FUIA 1EOJA 5ESBA 1TGTA 3A85A 2TRMA 1XUIA 1PPEE 1RIWB 2OQUA 1NU7B 2CMYA 1O3IA 3BSQA 1C2KA 3ATKA 1GMHF 1C4V2 1HJ9A 3S0NA 2PWXA 4JZDH 2A4OA 2QV1A 1O5GH 3PYHA 4AOQA 2BHGA 1BMMH 4GUXA 1O2XA 4D76A 2ZPQA 1LVBA 1ESAA 2C8WB 1TPSA 1TRYA 2CN0H 2BX3A 2LPRA 5A0CA 1WV7H 1FY5A 1GJ8B 5F8ZA 4D7FA 1XXDA 4KGAA 3M7TA 3QWCH 4A1TA 1OP8A 1OWHA 2ZGBH 2ALVA 3F6UH 4BAHB 3BIUH 1F0RA 3MNCA 2ULLA 1ANEA 2HOBA 3STIA 1W11U 1S83A 2HWLB 2TBSA 1O3NA 1A5IA 1BT7A 1QL7A 4KP0A 2XC5A 3EA9A 1TMBH 1IQGA 1K1MA 3I29A 4DY7B 8KME2 5F8XA 1OXGA 2Y80A 1DWDH 1XUGA 1F7ZA 1IQEA 2BLVA 1AVGH 1BTPA 1TQ0B 2VH6A 1P2MA 4UEHH 1DXPA 1BUIA 3DT0H 1V2OT 4RKJB 1GBFA 1GL1A 1SGDE 1EX3A 1UTPA 2VVUA 1UVTH 2RA0A 5JB9S 1GHYH 3BTHE 2GMTB 1QCPA 4ZUHA 1DVAH 4FU7A 1ZGVA 2QAAA 2IJOB 1C2HA 2XC4A 1GCTC 2QXGA 2Q6FA 2XCFA 1J15A 4ABHA 1E0FD 1D6WA 3T28A 3SUEA 2H9TH 1G3EA 1PQ5A 1OX1A 3QTVH 1H9IE 2BD5A 2Z6BD 1C2GA 4IN1A 1E35B 3FANA 4WY3A 2BQ7B 4KTSA 4CH8B 2SGDE 1FI8A 2BZAA 5CMXH 1TBZH 2IN2A 3CP7A 3QDZB 3D65E 1ZRBA 4UFGH 2C8YB 4X2YA 1CT2E 1P9UA 1O3AA 1GHBG 1P12E 4WVPE 2PV9B 4H6SB 2GKVE 1SGRE 8GCHF 3BEFB 4GAWA 1JOUB 5LH8A 4SGBE 3SNEA 1DLKB 2AIQA 1VJAU 2ZFRH 4AYVB 3S9CA 1KTSB 4IGDA 1OYQA 3RMMH 1OWEA 4O97A 4WMFA 1GI3A 1YBWA 1W8BH 4KKDA 4OGYA 1F5LA 4WXIA 5C5OA 2AGEX 3L6PA 4X2WA 1GG6B 1A0HB 4AFSA 4BXWA 1GCDA 4X1RU 1EASA 1P3CA 3LONA 1RFNA 1VITF 1HAOH 1SLWB 1O2KA 3ZYDA 1BTYA 1GJ6A 2FOCA 3Q3XA 4X1SU 4XSKU 3EAJA 3K9XB 1BRAA 2H9EH 4GVUA 2UUYA 1SVPA 1O0DH 1XUFA 1H8IH 2BY5X 1GBHA 2H1UA 3VPKA 5TCCA 1BRBE 2O8TA 2VIWA 1ETSH 2AMPA 1S0QA 2GZ8A 1HXEH 3PMAB 1IQJA 1QURH 2OQ5A 2HRVA 4Y76A 4I7YH 2V6NA 4BXSA 2AYWA 1SGNE 2I6SA 3LU9B 1BHXF 1SHYA 1VCQA 3H5CB 4NGAH 3PB1E 7ESTE 3KHVA 1K1LA 4YOJA 3SJ8A 1BRCE 1O3GA 4TWYA 5FHTA 2A45B 1QRXA 2FOMB 5FXLA 4ABGA 1IOEA 1Q31A 2FWWA 3M36A 5JBTA 2FI4E 3DA9B 3AAVA 4HGCA 3BTEE 1T8OA 1KY9A 1D3TB 1O35A 1YKTA 2BLWA 4NA8A 1U6QA 3LOXA 1PFXC 1O2YA 1G9IE 1MUEB 1N8OC 4ZMAH 5C5NA 1ZHRA 3TH4H 2FO9A 1GBJA 5A0BA 1CT0E 4DIIH 2G52A 3ZVCA 1GJCB 3P8NA 4FVBA 1VITH 4X8TH 3A7YA 1KSNA 1O30A 1UTQA 1C5YB 2BDIA 3W94A 1B7XB 3MWIU 1AN1E 1O32A 1QGFA 2FPZA 3M61U 6GCHG 1WTHD 3P70B 1IQNA 3WY8A 3U8OH 1TRMA 4K1SA 5GDSH 1JRSA 1O34A 1LCYA 3LDXH 1QTFA 1EJAA 1TIOA 1P57B 1O3MA 6ESTA 2G55A 4KTCA 2ZFTA 1EOLA 4J2YB 1LVMA 1V2ST 3LIWA 3SGQE 1O3DA 2FOBA 2FZZA 4AX9H 3MNBA 4Y11E 3UPEA 2QYIA 2OTVA 3BEUA 4HTCH 1ELBA 1ID5H 1DS2E 2FXRA 2DE8A 1SGCA 1WQSA 3STJA 2VJ1A 5EQQA 1XXFA 1SMFE 6CHAB 2AMQA 3FFGA 3M7UA 1GBIA 3BG4C 4ISNA 3PWBA 2ZFQH 1UVOA 1AZZA 1T4VH 4XOJA 3M7QA 4NIXA 4YO9A 3Q77A 1DX5M 1FY3A 4B74A 2AS9A 3IWMA 2ESTE 1EXFA 1ZHPA 4KELA 4CR9A 3RXOA 1EP6A 2QC2A 1H4WA 2FI5E 4FVDA 4INHA 4B2BA 2OXSA 2WPKS 3TPIZ 2BOKA 2ZQ1A 3RXFA 1FZZA 4OS2A 2BLQA 4X6NA 1OKXA 1LQDB 4I8KA 1NRNH 1OYTH 1YGCH 2HGTH 4Z0KA 1HJAB 4OS1A 1FJSA 2JH5D 1GHAF 3E8LA 1NM6A 1EAIA 1DT2A 2B5TB 1C1SA 3SO3A 2VIDA 5GWZA 4JZ1A 1Y3YA 1BB0B 1N1LA 3RC4A 3ZVAA 3TJUA 2GT7A 2GDDA 2QXIA 3UQOA 1D9IA 3TIUA 1HBTH 3QTOH 1WOFA 1TNGA 3ELAH 2YNBA 2A4QA 1VGCB 3QZQA 2WPIS 2H9HA 1O2WA 2Y5HA 1ELCA 1E37B 1EJMA 3H7OA 1O5CB 1O37A 3KIDU 3M3VA 1GCTB 3SV2H 2NWNA 3GDSA 1LHCH 4FUGA 1IQFA 1AKSB 2OUAA 1V2RT 3CENA 3TGJE 4IN2A 3MH6A 4Y7BA 1HV7A 1ZYOA 1C2DA 1T31A 8LPRA 2I6QA 2AH4X 1XVOA 1O3JA 2XC0A 5HYOA 4SGAE 5DP4A 1DM4B 3RXDA 1XKBC 1TNLA 3NK8A 1C1PA 2IOTA 4AGKA 1CA0C 1DXWA 1TA2A 2ZU5A 3H7TA 1W2KH 2BY8X 2FX4A 2WINI 2ZCLP 1XX9A 2BDHA 5DP8A 4U30A 2XWBI 1ESTA 4Y8ZA 5JYIA 1KLIH 4GHQA 1P01A 2P3UB 3F68H 1DUAA 2JETB 2ZU1A 1VCPA 1FUJA 1TABE 3SUDA 1NFUA 2FEQH 4BTUB 5FBEA 1O5EH 2XWAA 3S9AA 1DDJA 1GBCA 2IPHA 3RXIA 1S81A 4OS6A 5GPIB 2A2QH 1O5FH 3U8RH 3GICB 4LK4A 4UFDH 3RP2A 2VNTA 2F9NA 4BAOB 3R0FA 3SN8A 4NIWA 1UVPA 2ZU3A 2NU3E 4Y0ZE 1QJ7B 2Z7FE 2AEIH 2G5VA 1AWFH 1XUKA 5EOKA 4Y0YE 1Z71A 4B1TA 1IHTH 1DANH 3ZVDA 4I8GA 1A2CH 2ALPA 2XCNA 2BD2A 2SGEE 1AIXH 1E34B 1GHBF 1IQIA 1UK3A 2BQWB 4RN6A 2ZGHA 5GIBA 3OU0A 3PMBB 2FP7B 2FX6A 1HLTH 1IQKA 3BN9A 1HCGA 1C5NH 2BXUH 1GPZA 5L6NH 9ESTA 2R0KA 2C8XB 1N6YA 2QGRA 3ESTA 1DWEH 1OWDA 1QRZA 1PQ7A 5JPMH 3RDZA 1NZQH 1GJDB 1N8OB 3M3TA 4NA7A 2BVXH 4D9QA 1FN6A 2A2XH 4DCDA 1AI8H 1TYNA 3BTWE 1VCWA 1C5VA 3A83A 3RXEA 2ZTYA 4MNWA 3GOVB 1C2EA 2UWPA 2A7HA 4Y8XA 4NWKA 5G4BA 1O2QA 2ZFPH 4IMQA 3M5MA 1CGIE 4X8SH 1AVWA 4ESTE 2GZ9A 1OSSA 1XUJA 3M37A 3O8DA 5T6FA 1G3DA 1Z7KA 2BDYA 2NU2E 3TITA 4Y10E 2B7DH 1EZSC 4LOYH 3P6ZB 4K8BA 1T8LA 2VWMA 1UCYH 1O2ZA 3MU8A 4E7NA 1C1VH 2ZKSA 3MNSA 4FXGH 1FIWA 4ABDA 3E0PB 5LGOA 1F92A 4BAMB 3P8GA 1C2IA 3MU1A 5T6GA 4CRCA 1ELDE 2BDCA 1DPOA 3SORA 1P2JA 1WU1A 4MVNA 3SJ9A 5EPNA 1FAKH 3A8AA 3O8BA 1GJ4H 3P17H 1SOZA 3SQEE 2P93A 3SU2A 4UD9H 1C5TA 2A5AA 3LJJA 3TNTA 1SLXB 1MKWK 3RU4T 1YCPK 3MYWA 2K1QA 1MTVA 3AASA 1KTTB 5FCKA 1THRH 1TA6A 1PPBH 3BG4B 3ODDA 3MFJA 2FS9A 4H42U 2GCTC 3PMHB 4TWWA 1D6RA 1HJ8A 1AFEH 1RRKA 4PROA 5HMAA 3HKJB 1C1WH 1NFXA 2CGAA 5EW2H 3LC3A 3F9GA 1S84A 5TCAA 1HB0B 1S6FA 3LH3A 3FP7E 2R3YA 1ZMJA 2BOHB 2EI7A 4JZFH 2ZHQH 1O2MA 3A81A 3SU6A 4DURA 3B9FH 1BIOA 4YOIA 1O38A 2ANKH 1V2QT 4JK5A 4JYTA 3TJVA 1G37A 5E2OA 1AY6H 3BTDE 4ABEA 4B2AA 1LKBA 1AWHB 5FPYA 1MTNB 6CHAC 4I8LA 1A4WH 1BA8B 3GY4A 5I46H 1LO6A 3SJIA 1QQ4A 1AZ8A 1DE7H 3A7ZA 4K5ZA 1MKXK 1OPHB 4ABFA 3S9BA 2ANWA 1S85A 2PGBB 3FAOA 4K1TA 3DHKH 4CRBA 1O31A 4FUHA 2Z9LA 3M3SA 3Q3YA 4ISHH 5IYTA 4MPXA 3L33A 4X1PU 3ZZ5A 1V6DA 1J9CH 1C1RA 3UR9A 1RS0A 2QF3A 1IQHA 1WYKA 4TY7A 2M5TA 1OWJA 1TGCA 4I8JA 4BNRA 1RTKA 1MTWA 3AW0A 3UNQA 1GBBA 2FTMA 4XBBA 4H6TA 1W7GH 1AE8H 1KXFA 1HUTH 1MAYA 1WAYB 2EA3A 2C8ZB 5EXMA 3EA8A 2PW8H 1HJAC 2QN5T 1CA8B 3LT3A 2PKAB 1GHWH 2BZ6H 3UR6A 3RXGA 1IHSH 1QA0A 2CHAB 3SI3H 1C5XB 1GI9B 1Y3WA 1NT1A 1RD3B 1A61H 3PLKA 1QBNA 1AVXA 3GISB 5DJ7A 3RXUA 4GHTA 4U01A 3NXPA 2BY6X 2ZHWH 2BD7A 3TK9A 2ZFSA 1LHGH 2QY0B 1TPAE 3O8CA 3JZ2B 1AB9C 1ZSJA 1EPTB 1CA0B 2ANYA 2ZECA 2ZU2A 3QZRA 5C20A 5AF9H 3KQEA 3SV9A 2CJIA 4CRDA 2BDBA 1WCZA 1GJ7B 1VGCC 3S7KB 2H6MA 4AYYB 1P09A 2WYGA 2ZIQH 3QLPH 2HNTE 3GY2A 1A7SA 1G2LA 4MPWA 4RKOB 3E3TA 1YF4A 3U1JB 2VVVA 1SGPE 3GY7A 5C1XA 1JRTA 1GI1A 3KF2A 2THFB 4Q80A 1PJPA 4A1XA 4INLA 1SOTA 3P8FA 4ISOA 2BX4A 4FUDA 3NZIA 1C5UA 1PPGE 1SGTA 1K1PA 2W26A 4YZUA 4AORA 2W3IA 3EA7A 1LKAA 3PLBA 5EODA 1HAHH 3A80A 3U8TH 2V3OH 1TLDA 1D3QB 3VGCB 1DSUA 3IG6B 2EI6A 5A8XA 1FAXA 1NU9A 4FU8A 1LPKB 4BTTB 4IBLH 1P9SA 1HPGA 3BTFE 2AMDA 5A8ZA 2ZC9H 2A32A 4WMEA 3GCHC 1GI4A 2FODA 4ZAEA 2ZCKP 1YC0A 2BM2A 1DSTA 1DY8A 5CHAB 2ZPRA 3PROA 1LVYA 2JH6D 4MQAA 1O3LA 2ZDMA 1AKSA 5E0HA 4U2WA 2GV6A 2TPIZ 5FX6A 2JETC 1ANBA 1GBKA 2J95A 2HLCA 1AGJA 1O3FA 1Y3VA 1D4PB 4ABBA 3ZZCA 5F8TA 1Y5BT 4GSOA 2A5IA 1TX7A 1ARBA 1QBOA 1TX6A 1ZSLA 2FLRH 3HATH 3KEEA 3SU5A 4XFQA 2FOFA 2BLOA 1GJBB 1OWKA 4R0IA 2ZFFH 1MD8A 2SNWA 4VGCC 2TIOA 2R3UA 1NROH 1ZGIA 4BAQB 2SFAA 5ESTE 2HNTC 3Q00A 1F5RA 1NRRH 3KNXA 2GDEH 1XVMA 4MNXA 2GP9B 3TK6A 3O8RA 3B23B 7GCHG 4UE7H 3GDUA 1TBRH 5EQRA 2WV4A 3FZZA 4YM9A 1RXPA 3SZNA 3VB3A 5F03A 3Q76A 4GCHG 1C2JA 4I8HA 1FDPA 1UTOA 2F9VA 2J4IA 4OS4A 4WH6A 1NFWA 2YNAA 2AIPA 2AGGX 3MU0A 1L2EA 1K2I1 1N6XA 3UY9A 1SGFG 2G8TA 3SW2B 1OOKB 5EGMA 1O3PB 2A31A 2PHBA 1MQ5A 1O3CA 3FP6E 2HALA 2F9BH 1SFIA 3OY5U 5GXPA 1YCPM 3A7TA 1P11E 1NESE 1GI8B 5T3HA 3GCTG 5FPSA 4MLFB 1P2KA 1Y5AT 1ANDA 2BVRH 3Q3KA 4FUJA 4A5TS 1ZMNA 5A09A 1CE5A 4X6PA 1Z8GA 3VXFH 4DOQA 1VR1H 3F9HA 1UJ1A 5EU8A 3FZDA 1YPMH 2BY7X 4JZIA 3LGWA 1O5BB 2GT8A 4QT8C 5C3NA 3ZZ8A 1WSSH 1CQQA 2F83A 5HGGA 3NPSA 3TH3H 1GBTA 1FY8E 1VZQH 2GCHG 4MNYA 2GCTB 2ZHFH 4BAKB 2R0LA 3VB7A 2O8MA 2Q6DA 2B0FA 3L3TA 4DJZB 1BCUH 1GMCF 3A89A 1THSH 3TK5A 1P06A 1P0SH 3K65B 1O2GH 1KIGH 3T29A 2Q6GA 1A5GH 1KXBA 1FY4A 2OBQA 3FVFB 2OD3B 1KLJH 3RMOH 2EEKA 4NCYA 2WUBA 2GTBA 1TMUH 1P2NA 1TNJA 5JDUB 3MOCA 1ZPBA 1P3EA 4O3UA 4NZLA 4ZH8A 2H5DA 1CHGA 2CF8H 2V0BA 1GDUA 3MH5A 4OGXA 2VU8E 2F3CE 3E6PH 1ZTLA 1NFYA 4NFFA 3R3GB 3EQ0H 1G3CA 1RTFB 1HAYB 1ELVA 1O3HA 1TQ7B 3W95A 2FOEA 2O8LA 1B5GH 3ZZ7A 1EQ9A 1F0SA 3KQBA 2TGTA 1C2MA 1KXDA 3RXSA 3RXLA 3SV7A 1YPGH 3ZZ9A 2J38A 4LXBH 1QL8A 3BTQE 3UUZA 2OLGA 2VIPA 1IQLA 1UVUH 1W14U 3CS0A 1JBUH 3K6YA 4ABAA 1C5PA 1BBRK 1YP9A 1ZZZA 1YLCA 2HPQH 3T5FH 3VEQB 3A86A 2W5EA 1GVLA 1GWAA 1MTNC 4ABJA 2OINA 1UTMA 1A5HA 1J17T 2GX4A 3RXHA 1C5RA 2NU0E 2JH0D 2STBE 5E0JA 1UK2A 1Q2WA 1V2PT 4HZHA 1T4UH 4GPGA 3A84A 1BBRE 2ZDLA 1C2LA 1A1RA 1LTOA 4X0WU 3MHWU 1SI5H 1AUJA 1K1OA 4ZXYH 1AB9B 3SJKA 2NU4E 5PTPA 1V2KT 1P03A 1J16A 1SQOA 3ZZBA 3RC6A 2V3HH 3P8OA 2UWLA 2OC0A 1TNHA 4NIVA 1K9OE 3UNRA 1GBDA 4A92A 4CBOA 5EXLA 3M5OA 1L4DA 2VWNA 2NU1E 3RMNH 1SPJA 3OX7U 3BF6H 1GJ5H 3ZZ6A 3UOPA 5A0AE 1AHTH 1O2TA 2CHAC 2Y81A 1O2NA 3C1KA 4Y79A 1KYNA 1V2LT 5ABWA 4Q7YA 2FESH 1EAXA 2UWOA 1LHEH 2BD9A 3HK3B 1AQ7A 1PPCE 4XE4A 1O3OA 4BANB 3MNXA 3GCHB 2WUCA 1IQMA 4X2VA 1EPTC 3GYMA 2VWLA 3T25A 1JWTA 1GI0A 3PTBA 1V2NT 1LMWB 1UVSH 1P02A 1W0ZU 3SUGA 1Y5UT 3MTYA 1HAZB 1QB6A 1Z1IA 2F9OA 2R9PA 1ABIH 1RGQA 4K8YA 3GY8A 2PKAA 1UTNA 8GCHG 3LGUA 1PYTD 1XMNB 3KL6A 1SGIB 3A8DA 1TX8A 4NWLA 4WF8A 5J4QA 1ZTKA 1KDQB 4UFFH 3D62A 1F0UA 4J1YA 5C1UA 4JYVH 1EATA 4WJG2 3VGCC 2ZHDA 1GI7B 4VGCB 1D3PB 3MH4A 1DY9A 1SB1H 1UTLM 1J8AA 2QXJA 4AGJA 3TNSA 1P10A 2FOGA 2VGCC 1O2SA 1VITG 3MO6A 3SGBE 5CHAC 3RXPA 3TJNA 3GCNA 3QK1A 3V13A 2A7CA 1GL0E 1ZJKA 1WUNH 1BMAA 1CSOE 1MD7A 3JZ1B 3T27A 1Z8RA 1O33A 2WYJA 4CR5A 1ELEE 2Q1JA 1NRSH 2GZ7A 1L1GA 2RA3A 3K6ZA 4DW2U 2BTCE 2WV5A 1QB1A 1C1QA 2EC9H 1DICA 1GVZA 1ELAA 1CGJE 1W0YH 2FLBH 1EKBB 5BPEA 1E38B 2Z9JA 2WPLS 3TU7H 1FIZA 3U9AH 4DIHH 3ZYEA 3RXRA 2ZTXA 3TGKE 2VVCA 1BMNH 1K1NA 2VH0A 1C5OH 1F0TA 3NCLA 3SBKA 3IITA 2B8OH 4U32A 5SGAE 2PTNA 4AFZA 1XKAC 3ZV8A 2VIOA 1Y59T 2XTTB 3E16B 3LGTA 3RXVA 4TYDA 4WWYA 1SHHB 4CH2B 1S6HA 5DG6A 2PUXB 4AG2A 2FMJA 5TJXA 1QL9A 2P16A 1C5WB 1CHOG 3BV9B
chains in the Genus database with same CATH superfamily
2BMGB 3LGIA 4Q7ZA 1MTSA 2V35A 1P04A 2Z3DA 1FONA 1LVOA 2Z9GA 5DK1A 1YY3A 1UTJA 3CS7A 2GD4B 1CVWH 3DFJA 3QO6A 4E06H 2A1DB 5DP7A 1TGBA 1CO7E 3RMLH 1DWBH 3VB4A 4YOGA 3NKKA 1TE0A 2WPMS 1YYY1 1E36B 1QQUA 1S82A 2BY9X 4M7GA 1E1QD 3GCTF 1GI6A 2BD8A 1EJNA 1BOQA 4FU9A 4Q7XA 4FOUC 1W12U 5K7RA 1BITA 3GDVA 1SBWA 2OBOA 1DUEA 1AUTC 1LHDH 2SGPE 1OP2A 3RXQA 3SV8A 2R2WU 1V2UT 4ZROA 2ODQA 3MO9A 5EJLA 3SNAA 2BXTH 2PR3A 1MBQA 1GBAA 4AB8A 1Z8JB 2KCAA 4DGJA 1RTLA 1SR5C 2GCHF 3GCOA 3N7OA 6GCHF 1CBWB 4R8TB 1O2PA 1SGFA 1TMTH 4NIYA 3A82A 3P95A 1F5KU 3SJOA 2P3FH 3OTJE 1W7XH 1GBMA 2UUJB 2G81E 4ZXXH 2ILNA 2LNCA 1TNKA 5J4SA 1DFPA 1FNIA 1TFXA 4RT1A 3VXEH 3M35A 3E90B 2XBWA 5EPYA 1B0EA 1ELFA 4ISLA 1G3BA 1ETRH 1CU1A 3C27B 1DOJA 1YLDA 4OS7A 1S5SA 3MU5A 1ZLRA 2F9PA 1AO5A 4ZKSU 1HGTH 2Z94A 2STAE 2C93B 4MTBA 3DSOA 1QA7A 3RXTA 1BTHH 2A7JA 4TPIZ 1LHFH 2FS8A 2BDGA 1D3DB 1BDAA 1QNJA 2AERH 5E2PA 1O2OA 2A0QB 2BQ6B 3LPRA 1TONA 4O03A 4ASUD 1H9LB 2JKHA 2ZDKA 1EB1H 3PTNA 1INCA 4XDEA 9LPRA 2RG3A 4XBDA 4CRFA 1E1RD 2OP9A 4BTIB 2R2MB 1HAPH 3ZZDA 5GNDA 3K2UA 3UB0A 2ZTZA 1SLUB 1TNIA 3WW7A 4AN7A 5EJZA 3RU4D 1G32B 2VIQA 1V3XA 3BEIB 4XBCA 2VBCA 4Y8YA 3SOSA 2AFQB 3OSYA 1V2TT 2C3SA 2D26C 1MMJN 3ENSB 4AG1A 3SV6A 1C5MD 1O39A 2ZNKH 2KAIB 2PSYA 2XXLA 4D8NA 2PGQB 5CHBA 4CHAC 1SGYE 1EZXC 3HPTB 3F9EA 5FCRA 1ZTJA 1V2WT 5C2ZA 3RXJA 2J98B 1O2VA 3GS9A 4IS5A 3G01A 1HYLA 4MPUA 5EQSA 1O2LA 1ZPZA 2W7UA 2ZI2H 3M5NA 4ASHA 1THPB 1W13U 4F4OC 1GMDG 3BTME 4IMZA 3EGKH 2BD4A 4MDSA 1GI5A 4Q63A 5HM2A 4AZ2B 3MO3A 3D49H 5A8YA 5C67A 1L4ZA 3I77A 3QN7A 1OS8A 2XBVA 4DG4A 2C4FH 3TVJB 3E1XB 1EP5A 1IAUA 1AMHA 2GV7A 1WQVH 1KXEA 4H4FA 2ZO3H 1GVKB 2TGDA 2F43B 4AFUA 2DE9A 1EZUC 1MAXA 1C1OA 1QFKH 3UNSA 4NSVA 3T62A 3BTKE 1C5SA 2BVSH 4O3TA 3UWJH 1NN6A 1HNEE 1SQTA 2VB0A 1MZAA 2QA9E 1HFDA 1WTGH 2ZP0H 5BRRE 1Z8IB 1MKWH 1SG8B 1YCPH 4YT7H 3A7VA 1O3KA 2FTLE 3EYDA 1Y3UA 2PKSB 2VGCB 4TY6A 3QUMP 1SFQB 2SGFE 4A1VA 2CV3A 5KGOA 3VB5A 1HDTH 5DP5A 1TALA 5E8EH 1QJ6B 1GI2A 2BD3A 4JK6A 3SNDA 2OC1A 2C90B 3OYPA 3RM0H 1TPPA 2ZGXH 2G5NA 2QE7D 2W3KA 1TB6H 3KQDA 5LPEA 2RCEA 4HFPB 1DWCH 2G4TA 4FUCA 1P2OA 4ZHAA 1GJ9B 3SU1A 1VJ9U 2HNTF 4HI3A 3BIVH 3RLYH 1A0LA 1ZRKA 3F2HA 3MI4A 1SGQE 1W10U 5L2ZH 3LH1A 3E0NB 3LGVA 4YESB 2QF4A 1HAXB 5EJ1A 2FIRH 3UTUH 1MKXH 4X1QU 1T8NA 1ZHMA 3RXCA 1G2MA 4ZKNU 5JB8S 1AU8A 2O8WA 1HAIH 3SU4A 2F9UA 2ZPSA 1BQYA 4Y6DA 1JMOH 3ZVGA 5CE1A 1HRTH 1TRNA 3NWUA 1TOCB 1C1TA 1KDQA 3ATLA 3ZZAA 1HIAB 1GHXH 3HGNA 2P94A 1GGDB 3D23A 2ZDAH 1SQAA 3SQHE 2XW9A 1MU8B 4MG3A 1HAVB 4ABIA 1NY22 1TGNA 1GBLA 3MH7A 3QX5H 2DUCA 3PLPA 3PO1C 5LPFA 3FO8D 4YLUA 4OS5A 1JXPA 1BJVA 2ANMH 4RSPA 3DUXH 4P00A 4UONA 3GYLB 3V3MA 1AFQC 5GCHG 3RXBA 5EG4A 1BMLA 1K1JA 3SU0A 1C2FA 1A3EH 1QRWA 4O9VA 3ZZ3A 5FX5A 3URCA 3A7XA 1O2IA 3PV4A 2D2DA 1MBMA 1BTZA 3OAAD 4B75A 4I31A 3BTTE 1PPHE 3ODFA 1EAUA 2VWOA 4THNH 2FDAA 1FMGA 1J14A 4NSYA 1QIXB 1O5AB 1CT4E 1G30B 5H4IB 5L2YH 1KXAA 3BG8A 5EW1H 4NZQA 1V2VT 3F9FA 1C1NA 1ORFA 2QXHA 2FYQA 1QBVH 2XBYA 7LPRA 4JZEH 1H8HD 2W6ID 4X8UH 1O5DH 4JYUH 3KQ5A 1FPHH 1CHOF 1UHBB 1EUFA 1EB2A 2CF9H 4I33A 1UK4A 2P8OC 2ZGCA 3V7TA 4A6LA 3SHAH 3S7HB 1MTUA 3GY3A 3UFAA 1SL3A 4Y7AA 2A4GA 4FUFA 2SNVA 1EZQA 1A46H 5K0HA 2BB4A 3A87A 3AW1A 1FY1A 1O3EA 4NFEA 5F6MA 1ETTH 3RC5A 1TOMH 1YPKH 3ZZ4A 1JIMA 3EDXB 3OFND 2G51A 2CK3D 1GBEA 4X2XA 3A88A 3MMGA 3QGJA 1P2QA 2ZDVH 2PLXA 2O9QA 1C1UH 3A7WA 5ETXA 5AFZH 1C5QA 2ZU4A 2XYAA 1HXFH 1XUHA 5DP9A 5JBBS 1CBWC 1F2SE 4AB9A 4Q2KA 1Q3XA 3ZVFA 2ZF0H 5DKMA 4X6MA 2HLDD 2ODPA 3E91A 4YTAA 3LC5A 1LPZB 2PUQH 2J9NA 1H8DH 1L1JA 4F55A 3SUFA 1AD8H 1GMHG 1KLTA 1PPFE 5JBAS 2ZGJA 2FI3E 4WH8A 3F3BA 2WPHS 5HIZA 2OC7A 1ZOMA 2VIVA 1C1MA 4DVAU 1NRQH 2ZZUH 4INKA 1T7CA 1PYTC 3RXAA 1XM1A 2QF0A 1O2HA 4K60A 1JIRA 1ZSKA 1M9UA 1B0FA 2SGAA 4MPVA 3F1SB 1OWIA 1FV9A 2EI8A 2Y5GA 1MQ6A 1C9TA 5C17A 4WXVA 1W3CA 4CHAB 2ZCHP 2BYAX 3HGPA 4I32A 4K69A 1FN8A 4DT7B 1W0JD 3V0XA 5DP3A 2J97A 1GHZA 1UMAH 1YWUA 3FKSD 3QGNB 5AHGH 1O2JA 3HKIB 1PQ8A 3F0OA 1O3BA 1Y3XA 3HK6B 3GY6A 3EE0B 3ATIA 1RJXB 5JBCS 3UIRA 5AVDA 1S0RA 1P8VC 1MCTA 2TGAA 2HVXA 1RIWC 1C5ZB 2RDLA 2QCYA 1V2JT 1TWXB 1MH0A 5DO4H 2XRCA 5GJ4B 3AAUA 3OTPA 1Y8TA 2XNIA 5DPAA 2Z3EA 2QIQA 1P05A 8ESTE 5I25A 2CXVA 4Z6AH 1QJ1B 2HPPH 2Y5FA 1TPOA 2OCVB 3A8BA 1ELTA 3ATMA 1KXCA 3MU4A 5DN6D 4B73A 4X6OA 1UCYK 1EAWA 2FM2A 2XBXA 2OC8A 4CREA 1Z6EA 4MNVA 3PWCA 4YT6H 1C4Y2 3GY5A 5E0GA 4X8VH 2ZHEH 5FBIA 5HM9A 3ZV9A 2WPJS 3TGIE 2LELA 3ITIA 2G4UA 3U1IB 3LJOA 5T6DA 1BTXA 1NRPH 2LP6A 1L1NA 3SYJA 2KFWA 1UO6A 2VINA 1S6LA 4Y71A 1UCYE 3KYGA 1E79D 1GMDF 1Z6JH 1ZMLA 3UWIA 2Y82A 4ISIH 1NO9H 3VFEA 3ZVBA 1LQEA 3RXKA 3DFLA 1V2MT 2KAIA 1G36A 2F91A 4IC6A 3RLWH 2ZEBA 1A0JA 2D1JA 3KCGH 5L30H 2GVFA 3FOAA 1WBGB 2TGPZ 1ACBE 1NTPA 3SNBA 1TGSZ 2GMTC 5DP6A 1ZJDA 2J98A 3I78A 4K3JA 4TSFD 1P2IA 1EPTA 2Z9KA 4ZHMU 1L0ZA 5AFYH 1ESBA 3SI4H 4AFQA 3OY6U 3KQCA 4ZKRU 4D7GA 2PKSC 1BZXE 3S69A 1YPJH 2ZDNA 1A3BH 2ZWLH 4F49A 2M2AA 4YLQH 1DITH 1GJAB 1FLEE 3AVZA 1PPZA 1K22H 1GHVH 2J92A 4A7IB 1YPHE 1FQ3A 3NUMA 1ABJH 1ARCA 2Y7ZA 1K21H 2BDAA 3SNCA 2Z9IA 4FUEA 2W7SA 3M5LA 4CRAA 3PM3A 1NPMA 3A8CA 3KGPA 3RU4E 2JIZD 2IPQX 1QB9A 1BBRH 3SU3A 3U98H 3KN2A 3PO1B 5EXNA 1TAWA 3LKWA 1AFQB 2A5KA 1OP0A 2J34A 4UFEH 2PFEA 1GG6C 4IC5A 6LPRA 1SC8U 2O8UA 1BHXB 2ASUB 4JMYA 1TBQH 2FOAA 1T32A 1ANCA 2YOLA 1BTUA 2P95A 5HXFA 1YPLH 1ELGA 1T8MA 4K1EA 3TJOA 3ZVEA 2Y7XA 1NBMD 4CBNA 7GCHF 1K28D 1WXRA 4TPYA 3H09A 1GGDC 4IW4E 4GCHF 1K1IA 1H9HE 1BRUP 3T2NA 4LZ4B 1C4U2 3U69H 4E7RG 4ZKOU 1FPCH 1C5LH 1H1BA 3ATWA 3TH2H 3V12A 1YPEH 3LGYA 2P8OB 1GMCG 4NA9H 2Z3CA 2WHXA 4B2CA 1PQAA 1YPHC 2ODYB 2PSXA 1QR3E 1ZPCA 3SHCH 1SSXA 1GDQA 4D9RA 5GCHF 2ZQ2A 2UUKB 4ZHLU 1ZR0A 4CRGA 1HIAA 4K2YA 3TLOA 4RI0A 4ZCNA 3T26A 1UTKA 3UREA 4BOHA 1HAVA 3P92A 4KTUA 2B9LA 4GLYA 4NG9H 2SGQE 5DGJA 2PTCE 4UDWH 1O36A 2Y6TA 3FP8E 2J5UA 1O2UA 2IJD1 1AE5A 4LZ1H 4JCNA 1X7AC 5LPRA 2OK5A 3B8JA 3PMJA 1O2RA 2H2ZA 3UQVA 7KMEH 5IDKA 1YM0A 2J2UA 2FOHA 1GDNA 5FL7D 2P3TB 1QY6A 1DLEA 2D8WA 2UUFB 2KCOA 3RM2H 1HAGE 5FPTA 1C9PA 2RDEA 5A2MH 2ZG0H 1BJUA 5FAHA 3UOUA 2AGIX 1CGHA 1LPGB 3SGAE 1MU6B 1MZDA 1Z1JA 1MCVA 3RUOA 1QHRB 1SGEE 5C1YA 1NS3A 4B71A 1NC6A 3BTGE 3DD2H 1UHBA 2GGVB 2P59A 1GHAG 4FUBA 1SLVB 1LDTT 2ZA5A 1FXYA 4WMDA 2FYRA 3URDA 4B76A 5B6OA 2A4RA 2G00A 3RXMA 4E05H 4X1NU 2H5CA 2J94A 3VB6A 1BTWA 2EY4C 4FUIA 1EOJA 5ESBA 1TGTA 3A85A 2TRMA 1XUIA 1PPEE 1RIWB 2OQUA 1NU7B 2CMYA 1O3IA 3BSQA 1C2KA 3ATKA 1GMHF 1C4V2 1HJ9A 3S0NA 2PWXA 4JZDH 2A4OA 2QV1A 1O5GH 3PYHA 4AOQA 2BHGA 1BMMH 4GUXA 1O2XA 4D76A 2ZPQA 1LVBA 1ESAA 2C8WB 1TPSA 1TRYA 2CN0H 2BX3A 2LPRA 5A0CA 1WV7H 1FY5A 1GJ8B 5F8ZA 4D7FA 1XXDA 4KGAA 1KMHB 3M7TA 3QWCH 1FX0B 4FETA 4A1TA 1OP8A 1OWHA 2ZGBH 2ALVA 3F6UH 4BAHB 3BIUH 1F0RA 3MNCA 2ULLA 1ANEA 2HOBA 3STIA 1W11U 1S83A 2HWLB 2TBSA 1O3NA 1A5IA 1BT7A 1QL7A 4KP0A 2XC5A 3EA9A 1TMBH 1IQGA 1K1MA 3I29A 4DY7B 8KME2 5F8XA 1OXGA 2Y80A 1DWDH 1XUGA 1F7ZA 1IQEA 2BLVA 1AVGH 1BTPA 1TQ0B 2VH6A 1P2MA 4UEHH 1DXPA 1BUIA 3DT0H 1V2OT 4RKJB 1GBFA 1GL1A 1SGDE 1EX3A 1UTPA 2VVUA 1UVTH 4XRNA 2RA0A 5JB9S 1GHYH 3BTHE 2GMTB 1QCPA 4ZUHA 1DVAH 4FU7A 1ZGVA 2QAAA 2IJOB 3EE7A 1C2HA 2XC4A 1GCTC 4ACAA 2QXGA 2Q6FA 2XCFA 1J15A 4ABHA 1E0FD 1D6WA 3T28A 3SUEA 2H9TH 2RFKC 1G3EA 1PQ5A 1OX1A 3QTVH 1H9IE 2BD5A 2Z6BD 2QF5A 2YMSD 1C2GA 4IN1A 1E35B 3FANA 4WY3A 2BQ7B 4KTSA 4CH8B 2SGDE 1FI8A 2BZAA 5CMXH 1TBZH 2IN2A 3CP7A 3QDZB 3D65E 1ZRBA 4UFGH 2C8YB 4X2YA 1CT2E 1P9UA 1O3AA 1GHBG 1P12E 4WVPE 2PV9B 4H6SB 2GKVE 1SGRE 1QZ8A 8GCHF 3BEFB 4GAWA 1JOUB 5LH8A 4SGBE 3SNEA 1DLKB 2AIQA 1VJAU 2ZFRH 4AYVB 3S9CA 1KTSB 4IGDA 1OYQA 3RMMH 1OWEA 4O97A 4WMFA 5HIYA 1GI3A 1YBWA 1W8BH 4KKDA 4OGYA 3F2GA 1F5LA 4WXIA 5C5OA 2AGEX 3L6PA 4X2WA 1GG6B 1A0HB 1W0KD 4AFSA 4BXWA 2EQNA 2AHME 1GCDA 4X1RU 1EASA 1P3CA 3LONA 1RFNA 1VITF 1HAOH 1SLWB 1O2KA 3ZYDA 1BTYA 1GJ6A 2FOCA 3Q3XA 4X1SU 4XSKU 3EAJA 3K9XB 1BRAA 2H9EH 4GVUA 2UUYA 1SVPA 1O0DH 1XUFA 2KR7A 1H8IH 2BY5X 1GBHA 2H1UA 3VPKA 5TCCA 1BRBE 2O8TA 2VIWA 1ETSH 2AMPA 1S0QA 2GZ8A 1HXEH 3PMAB 3DSGA 1IQJA 1QURH 2OQ5A 2HRVA 4Y76A 5IK2D 4I7YH 2V6NA 4BXSA 2AYWA 1SGNE 5C0TA 2I6SA 3LU9B 1BHXF 1SHYA 1VCQA 3H5CB 4NGAH 3PB1E 7ESTE 3KHVA 1K1LA 4YOJA 3SJ8A 1BRCE 1O3GA 4TWYA 5FHTA 2A45B 1QRXA 2FOMB 5FXLA 4ABGA 1IOEA 1Q31A 2FWWA 3M36A 5JBTA 2FI4E 3DA9B 3AAVA 4HGCA 3BTEE 1T8OA 1KY9A 1D3TB 4AC9A 1O35A 1YKTA 2BLWA 4NA8A 1U6QA 3LOXA 1PFXC 1O2YA 1G9IE 1MUEB 1N8OC 4ZMAH 5C5NA 1ZHRA 3TH4H 2FO9A 1GBJA 5A0BA 1CT0E 4DIIH 2G52A 3ZVCA 1GJCB 3P8NA 4FVBA 1VITH 4X8TH 3A7YA 5C0UA 1KSNA 1O30A 1UTQA 1C5YB 2BDIA 3W94A 1B7XB 3MWIU 1AN1E 1O32A 1QGFA 2FPZA 3M61U 6GCHG 1WTHD 3P70B 4Q4LA 1IQNA 3WY8A 3U8OH 1TRMA 4K1SA 5GDSH 1JRSA 1O34A 1LCYA 3LDXH 1QTFA 1EJAA 1TIOA 1P57B 2JJ1D 4M9FA 1O3MA 6ESTA 2G55A 4KTCA 2ZFTA 1EOLA 4J2YB 1LVMA 1V2ST 3LIWA 3SGQE 1O3DA 2FOBA 2FZZA 4AX9H 2V7QD 3MNBA 4Y11E 3DCLA 3UPEA 2QYIA 2OTVA 3BEUA 2XOKD 1ELBA 1ID5H 4HTCH 1DS2E 2FXRA 2DE8A 1SGCA 1WQSA 3STJA 2VJ1A 5EQQA 1XXFA 1SMFE 6CHAB 2AMQA 3VG8A 3FFGA 3M7UA 1GBIA 3BG4C 4ISNA 3PWBA 2ZFQH 1UVOA 1AZZA 1T4VH 4OM9A 4XOJA 3M7QA 2YMSB 4NIXA 4YO9A 3Q77A 1DX5M 1FY3A 4B6FA 4B74A 2AS9A 3IWMA 2ESTE 1EXFA 1ZHPA 4KELA 4CR9A 3RXOA 1EP6A 2QC2A 1H4WA 2FI5E 4FVDA 4INHA 4B2BA 2OXSA 2WPKS 2WV9A 3TPIZ 2BOKA 2ZQ1A 3RXFA 1FZZA 4OS2A 2BLQA 4X6NA 1NBME 1OKXA 1LQDB 5T1VA 4I8KA 1NRNH 1OYTH 1YGCH 2HGTH 4Z0KA 1HJAB 4OS1A 1FJSA 2JH5D 1GHAF 3E8LA 1NM6A 1EAIA 1DT2A 2B5TB 2KZ4A 1C1SA 3SO3A 2VIDA 5GWZA 4JZ1A 2HVYB 1OHHD 1Y3YA 1BB0B 1N1LA 3RC4A 3ZVAA 3TJUA 2GT7A 5KEDA 2GDDA 2QXIA 3UQOA 1D9IA 3TIUA 1HBTH 3QTOH 1WOFA 1TNGA 3ELAH 2YNBA 2A4QA 1VGCB 3QZQA 2WPIS 2H9HA 1O2WA 2Y5HA 1ELCA 1E37B 1EJMA 3H7OA 1O5CB 1O37A 3KIDU 3M3VA 1GCTB 3SV2H 2NWNA 3GDSA 1LHCH 4FUGA 1IQFA 1AKSB 2OUAA 1V2RT 3CENA 3TGJE 4IN2A 3MH6A 4Y7BA 1HV7A 1ZYOA 1C2DA 1T31A 8LPRA 3NRLA 2I6QA 2AH4X 1XVOA 1O3JA 2XC0A 5HYOA 4SGAE 3U28C 5DP4A 1DM4B 3RXDA 1XKBC 1TNLA 3NK8A 1C1PA 2IOTA 4AGKA 1CA0C 1DXWA 1TA2A 2ZU5A 3H7TA 1W2KH 2BY8X 2FX4A 2WINI 2ZCLP 1XX9A 2BDHA 4F48B 5DP8A 4U30A 2XWBI 1ESTA 4Y8ZA 5JYIA 1KLIH 4GHQA 1P01A 2P3UB 3F68H 1DUAA 2JETB 2ZU1A 1VCPA 1FUJA 1TABE 2XNDD 3SUDA 1NFUA 2FEQH 4BTUB 5FBEA 1O5EH 2XWAA 3S9AA 3WWFA 1DDJA 1GBCA 2IPHA 3RXIA 1S81A 4OS6A 5GPIB 1SQRA 2A2QH 1O5FH 3U8RH 3GICB 4LK4A 4UFDH 3RP2A 2VNTA 2F9NA 4BAOB 3R0FA 3SN8A 4NIWA 1UVPA 2ZU3A 2NU3E 4Y0ZE 1QJ7B 2Z7FE 2AEIH 2G5VA 1AWFH 1XUKA 5EOKA 4Y0YE 1Z71A 4B1TA 1IHTH 1DANH 3ZVDA 4I8GA 1A2CH 2ALPA 2XCNA 2BD2A 2SGEE 2KM0A 1AIXH 1E34B 1GHBF 1IQIA 1UK3A 2BQWB 4RN6A 2ZGHA 5GIBA 3OU0A 3PMBB 2FP7B 2FX6A 5HKKD 1HLTH 1IQKA 3BN9A 1HCGA 1C5NH 2BXUH 3N99A 1GPZA 5L6NH 9ESTA 2R0KA 2C8XB 1N6YA 2QGRA 3ESTA 1DWEH 1OWDA 1QRZA 1PQ7A 3PV2A 5JPMH 3RDZA 1NZQH 1GJDB 1N8OB 3M3TA 4NA7A 2BVXH 4D9QA 1FN6A 2A2XH 4DCDA 1AI8H 1TYNA 3BTWE 1VCWA 5KECA 1C5VA 3A83A 3RXEA 2ZTYA 4MNWA 3GOVB 3DSPA 1C2EA 2UWPA 2A7HA 4Y8XA 4NWKA 5G4BA 1O2QA 2ZFPH 4IMQA 3M5MA 1CGIE 4X8SH 1AVWA 4ESTE 3PRBA 2GZ9A 1OSSA 1XUJA 3M37A 3O8DA 5T6FA 1G3DA 1Z7KA 2BDYA 2NU2E 3TITA 4Y10E 2B7DH 1EZSC 4LOYH 3P6ZB 4K8BA 1T8LA 2VWMA 1UCYH 1O2ZA 3MU8A 4E7NA 1C1VH 2ZKSA 3MNSA 4FXGH 1FIWA 4ABDA 3E0PB 5LGOA 1F92A 4BAMB 4B6EA 3P8GA 1C2IA 3MU1A 5T6GA 4CRCA 1ELDE 2BDCA 1DPOA 2JJ2D 3SORA 1P2JA 1WU1A 4MVNA 3SJ9A 5EPNA 1FAKH 3A8AA 3O8BA 1GJ4H 3P17H 1YLNA 5DSFA 1SOZA 3SQEE 2P93A 3SU2A 4UD9H 1C5TA 2A5AA 3LJJA 3TNTA 1SLXB 1MKWK 3RU4T 1YCPK 3MYWA 2K1QA 1MTVA 3AASA 1KTTB 5FCKA 1THRH 1TA6A 1PPBH 3BG4B 3ODDA 3MFJA 2FS9A 4H42U 2GCTC 3PMHB 4TWWA 1D6RA 1HJ8A 1AFEH 1RRKA 4PROA 5HMAA 3FN8A 3HKJB 1C1WH 2K0QA 1NFXA 2CGAA 5EW2H 3LC3A 3F9GA 1S84A 5TCAA 1HB0B 1S6FA 3LH3A 3FP7E 2R3YA 1ZMJA 2BOHB 2EI7A 4JZFH 2ZHQH 1O2MA 3A81A 3SU6A 4DURA 3B9FH 1BIOA 4YOIA 1O38A 2ANKH 2L6OA 1V2QT 4JK5A 4JYTA 3TJVA 1G37A 5E2OA 1AY6H 3BTDE 4ABEA 4B2AA 1LKBA 1AWHB 5FPYA 1MTNB 6CHAC 4I8LA 1A4WH 1BA8B 3GY4A 5I46H 1LO6A 3SJIA 1QQ4A 1AZ8A 1DE7H 3A7ZA 4K5ZA 1MKXK 1OPHB 4ABFA 3S9BA 2ANWA 1S85A 2PGBB 2YMSC 3FAOA 4K1TA 3DHKH 4CRBA 4ACBA 1O31A 2F4LA 4FUHA 2Z9LA 3M3SA 3Q3YA 4ISHH 5IYTA 4MPXA 3L33A 4X1PU 3ZZ5A 1V6DA 2WZQA 1J9CH 1C1RA 3UR9A 1RS0A 2QF3A 1IQHA 1WYKA 4TY7A 2M5TA 1OWJA 1TGCA 4I8JA 4BNRA 1RTKA 1MTWA 3AW0A 3UNQA 1GBBA 2FTMA 4XBBA 4H6TA 1W7GH 1AE8H 1KXFA 1HUTH 1MAYA 1WAYB 2EA3A 2C8ZB 3OE7D 5EXMA 3EA8A 2PW8H 1HJAC 2QN5T 1CA8B 3LT3A 2PKAB 1GHWH 2BZ6H 3UR6A 3RXGA 1IHSH 1QA0A 2CHAB 3SI3H 1C5XB 1GI9B 1Y3WA 1NT1A 1RD3B 1A61H 3PLKA 1QBNA 1AVXA 3GISB 5DJ7A 3RXUA 4GHTA 4U01A 3NXPA 2BY6X 2ZHWH 2BD7A 3TK9A 2ZFSA 1LHGH 2QY0B 3N7DA 1TPAE 3O8CA 3JZ2B 1AB9C 1ZSJA 1EPTB 1CA0B 2ANYA 2ZECA 2ZU2A 3QZRA 5C20A 5AF9H 3KQEA 3SV9A 2CJIA 4CRDA 2BDBA 1WCZA 1GJ7B 1VGCC 3S7KB 2H6MA 4AYYB 1P09A 2WYGA 2ZIQH 3QLPH 2HNTE 3GY2A 1A7SA 1G2LA 2V3MA 4MPWA 4RKOB 3E3TA 1YF4A 3U1JB 2VVVA 1SGPE 3GY7A 5C1XA 1JRTA 1GI1A 3KF2A 2THFB 4Q80A 1PJPA 4A1XA 4INLA 1SOTA 3P8FA 4ISOA 2BX4A 4FUDA 2KCPA 3NZIA 1C5UA 1PPGE 1SGTA 1K1PA 2W26A 4YZUA 4AORA 2W3IA 3EA7A 1LKAA 3PLBA 5EODA 1HAHH 3A80A 3U8TH 2V3OH 3UAIC 1TLDA 1D3QB 3VGCB 1DSUA 3IG6B 2EI6A 5A8XA 1FAXA 1NU9A 4FU8A 1LPKB 4BTTB 4IBLH 1COWD 1P9SA 1HPGA 3BTFE 2AMDA 3PV5A 5A8ZA 2ZC9H 2A32A 4WMEA 3GCHC 1GI4A 2FODA 4ZAEA 2ZCKP 1YC0A 2BM2A 1DSTA 1DY8A 1VKYA 2ZPRA 3PROA 5CHAB 1LVYA 2JH6D 5B6LA 4MQAA 1O3LA 1MABB 1BMFD 2ZDMA 1AKSA 5E0HA 4U2WA 2GV6A 2TPIZ 5FX6A 2JETC 1ANBA 1GBKA 2J95A 2HLCA 1AGJA 1O3FA 1Y3VA 1D4PB 4ABBA 3ZZCA 5F8TA 1Y5BT 4GSOA 2A5IA 1TX7A 1ARBA 1QBOA 1TX6A 1ZSLA 2FLRH 3HATH 3KEEA 3SU5A 2KCYA 4TT3D 4XFQA 4XD7D 2FOFA 2BLOA 1GJBB 1OWKA 4R0IA 2ZFFH 1MD8A 2SNWA 4VGCC 2TIOA 1SKYE 2R3UA 1NROH 1ZGIA 4BAQB 2SFAA 5ESTE 2HNTC 3Q00A 1F5RA 1NRRH 3KNXA 2GDEH 1XVMA 4MNXA 2GP9B 3TK6A 3O8RA 3B23B 7GCHG 4UE7H 3GDUA 1TBRH 5EQRA 2WV4A 3FZZA 4YM9A 1RXPA 3SZNA 3VB3A 5F03A 3Q76A 4GCHG 1C2JA 4I8HA 1FDPA 1UTOA 2F9VA 2J4IA 4OS4A 4WH6A 1NFWA 2YNAA 2AIPA 2AGGX 3MU0A 1L2EA 1K2I1 1N6XA 3UY9A 1SGFG 2G8TA 3SW2B 1OOKB 5EGMA 1O3PB 2A31A 2PHBA 1MQ5A 1O3CA 3FP6E 2HALA 2F9BH 1SFIA 3OY5U 4DT4A 3OEHD 5GXPA 1YCPM 3A7TA 4Z1MD 5F53A 1P11E 1NESE 1GI8B 5T3HA 3GCTG 5FPSA 4MLFB 1P2KA 1Y5AT 1ANDA 2BVRH 3Q3KA 4FUJA 4A5TS 3WWBA 1ZMNA 5A09A 1CE5A 4X6PA 1Z8GA 3VXFH 4DOQA 1VR1H 3F9HA 1UJ1A 5EU8A 3FZDA 1YPMH 2BY7X 4JZIA 3LGWA 1O5BB 2GT8A 4QT8C 5C3NA 3ZZ8A 1WSSH 1CQQA 2F83A 5HGGA 3NPSA 3TH3H 1GBTA 1FY8E 1VZQH 2GCHG 4MNYA 2GCTB 2ZHFH 4BAKB 2R0LA 3VB7A 3PRDA 2O8MA 2WPDD 2Q6DA 2B0FA 3L3TA 4DJZB 1BCUH 1GMCF 3W1EA 3A89A 1THSH 3TK5A 1P06A 1P0SH 3K65B 1O2GH 1KIGH 3T29A 2Q6GA 1A5GH 1KXBA 1EFRD 1FY4A 2OBQA 3F0PA 3FVFB 2OD3B 1KLJH 3RMOH 2EEKA 4NCYA 2WUBA 2GTBA 1TMUH 1P2NA 1TNJA 5JDUB 3MOCA 1ZPBA 1P3EA 4O3UA 4I86A 4NZLA 4ZH8A 2H5DA 1CHGA 2CF8H 2V0BA 2K8IA 1UW7A 1GDUA 3MH5A 4OGXA 2VU8E 2F3CE 3E6PH 3F2FA 1ZTLA 3N7EA 1NFYA 4RT0A 4NFFA 2JDID 3R3GB 3EQ0H 1G3CA 1RTFB 1HAYB 2WSSD 1ELVA 1O3HA 1TQ7B 3W95A 2FOEA 2O8LA 1B5GH 3ZZ7A 1EQ9A 1F0SA 3KQBA 2TGTA 3KYFA 1C2MA 1KXDA 3RXSA 3RXLA 3SV7A 1YPGH 3ZZ9A 2J38A 4LXBH 1QL8A 3BTQE 3UUZA 2OLGA 2VIPA 1IQLA 1UVUH 1W14U 3CS0A 1JBUH 3K6YA 4ABAA 1C5PA 1BBRK 1YP9A 1ZZZA 1YLCA 2HPQH 3T5FH 3VEQB 3A86A 2W5EA 1GVLA 1GWAA 1MTNC 4ABJA 2OINA 1UTMA 1A5HA 1J17T 4YXWD 2GX4A 3RXHA 1C5RA 2NU0E 2JH0D 2STBE 5E0JA 1UK2A 1Q2WA 1V2PT 4HZHA 1T4UH 4GPGA 3A84A 1BBRE 2ZDLA 1C2LA 1A1RA 1LTOA 4X0WU 3MHWU 1SI5H 1AUJA 1K1OA 4ZXYH 1AB9B 3SJKA 2NU4E 5PTPA 1V2KT 1P03A 1J16A 1SQOA 3ZZBA 3RC6A 2V3HH 3P8OA 2UWLA 2OC0A 1TNHA 4NIVA 1K9OE 3UNRA 1GBDA 4A92A 4CBOA 5EXLA 3M5OA 1L4DA 2VWNA 2NU1E 3RMNH 1SPJA 3OX7U 3BF6H 5EIYA 1GJ5H 3ZZ6A 3UOPA 5A0AE 1AHTH 1O2TA 2CHAC 2Y81A 3CNRA 1O2NA 3C1KA 4Y79A 1KYNA 1V2LT 5ABWA 4Q7YA 2FESH 1EAXA 2UWOA 1LHEH 2BD9A 3HK3B 1H8ED 1AQ7A 1PPCE 4XE4A 1O3OA 4BANB 3MNXA 3GCHB 2WUCA 1IQMA 4X2VA 1EPTC 3GYMA 2VWLA 3T25A 1JWTA 1GI0A 3PTBA 1V2NT 2W6JD 1LMWB 4P02A 1UVSH 1P02A 1W0ZU 3SUGA 1Y5UT 3MTYA 2GJGA 1HAZB 1QB6A 1Z1IA 2F9OA 3SZEA 2R9PA 1ABIH 1RGQA 4K8YA 5C94A 3GY8A 2PKAA 1UTNA 8GCHG 3LGUA 1PYTD 1XMNB 3KL6A 1SGIB 3A8DA 1TX8A 4NWLA 4WF8A 5J4QA 1ZTKA 1KDQB 4UFFH 3D62A 1F0UA 1WDIA 4J1YA 5C1UA 4JYVH 1EATA 4WJG2 3VGCC 2KX4A 4HG6A 2ZHDA 1GI7B 4VGCB 1D3PB 3MH4A 1DY9A 1SB1H 1UTLM 1J8AA 2QXJA 4AGJA 3TNSA 1P10A 2FOGA 2VGCC 1O2SA 1VITG 3MQKC 3MO6A 1K0HA 3SGBE 5CHAC 3RXPA 3TJNA 3GCNA 3QK1A 3V13A 2A7CA 1GL0E 1ZJKA 1WUNH 1BMAA 1CSOE 1MD7A 3JZ1B 3T27A 1Z8RA 1O33A 2WYJA 4CR5A 1ELEE 5CDFE 2Q1JA 1NRSH 2GZ7A 1L1GA 2RA3A 3K6ZA 4DW2U 2BTCE 2WV5A 1QB1A 1C1QA 2EC9H 1DICA 1GVZA 1ELAA 1CGJE 1W0YH 2FLBH 1EKBB 5BPEA 1E38B 2Z9JA 2WPLS 3TU7H 1FIZA 3U9AH 4DIHH 3ZYEA 3RXRA 3ZIAD 2ZTXA 3TGKE 2VVCA 1BMNH 1K1NA 2VH0A 1C5OH 1F0TA 3NCLA 3SBKA 3IITA 2B8OH 4U32A 5SGAE 2PTNA 3AK5A 4AFZA 1XKAC 3ZV8A 2VIOA 1Y59T 2XTTB 3E16B 3LGTA 3RXVA 4TYDA 4WWYA 1SHHB 4CH2B 2PP6A 1S6HA 5DG6A 2PUXB 4AG2A 2FMJA 5TJXA 1QL9A 2L74A 2P16A 1C5WB 3OEED 1CHOG 3BV9B
chains in the Genus database with same CATH topology
2BMGB 3LGIA 4Q7ZA 1MTSA 2V35A 1P04A 2Z3DA 1FONA 1LVOA 2Z9GA 5DK1A 3CS7A 1UTJA 2GD4B 1CVWH 3DFJA 3QO6A 4E06H 2A1DB 5DP7A 1TGBA 1CO7E 3RMLH 1DWBH 3VB4A 4YOGA 3NKKA 1TE0A 2WPMS 1YYY1 1E36B 1QQUA 1S82A 2BY9X 4M7GA 3GCTF 1GI6A 2BD8A 1EJNA 1BOQA 4FU9A 4Q7XA 1W12U 5K7RA 1BITA 3GDVA 1SBWA 2OBOA 1DUEA 1AUTC 1LHDH 2SGPE 1OP2A 3RXQA 3SV8A 2R2WU 1V2UT 4ZROA 2ODQA 3MO9A 3SNAA 2BXTH 2PR3A 1MBQA 1GBAA 4AB8A 1Z8JB 4DGJA 1RTLA 1SR5C 2GCHF 3GCOA 3N7OA 6GCHF 1CBWB 4R8TB 1O2PA 1SGFA 1TMTH 4NIYA 3A82A 3P95A 1F5KU 3SJOA 2P3FH 3OTJE 1W7XH 1GBMA 2UUJB 2G81E 4ZXXH 2ILNA 2LNCA 1TNKA 5J4SA 1DFPA 1FNIA 1TFXA 3VXEH 3M35A 3E90B 2XBWA 5EPYA 1B0EA 1ELFA 4ISLA 1G3BA 1ETRH 1CU1A 3C27B 1DOJA 1YLDA 4OS7A 1S5SA 3MU5A 1ZLRA 2F9PA 1AO5A 4ZKSU 1HGTH 2Z94A 2STAE 2C93B 4MTBA 1QA7A 3RXTA 1BTHH 2A7JA 4TPIZ 1LHFH 2FS8A 2BDGA 1D3DB 1BDAA 1QNJA 2AERH 5E2PA 1O2OA 2A0QB 2BQ6B 3LPRA 1TONA 4O03A 1H9LB 2JKHA 2ZDKA 1EB1H 3PTNA 1INCA 4XDEA 9LPRA 2RG3A 4XBDA 4CRFA 2OP9A 4BTIB 2R2MB 1HAPH 3ZZDA 3K2UA 2ZTZA 1SLUB 1TNIA 4AN7A 3RU4D 1G32B 2VIQA 1V3XA 3BEIB 4XBCA 4Y8YA 3SOSA 2AFQB 3OSYA 1V2TT 2C3SA 2D26C 1MMJN 3ENSB 4AG1A 3SV6A 1C5MD 1O39A 2ZNKH 2KAIB 2PSYA 2XXLA 4D8NA 2PGQB 4CHAC 1SGYE 1EZXC 3HPTB 3F9EA 5FCRA 1ZTJA 1V2WT 5C2ZA 3RXJA 1O2VA 4IS5A 3G01A 1HYLA 4MPUA 5EQSA 1O2LA 1ZPZA 2W7UA 2ZI2H 3M5NA 4ASHA 1THPB 1W13U 4F4OC 1GMDG 3BTME 4IMZA 3EGKH 2BD4A 4MDSA 1GI5A 5HM2A 4AZ2B 3MO3A 3D49H 5A8YA 5C67A 1L4ZA 3I77A 3QN7A 1OS8A 2XBVA 4DG4A 2C4FH 3TVJB 3E1XB 1EP5A 1IAUA 1AMHA 2GV7A 1WQVH 1KXEA 4H4FA 2ZO3H 1GVKB 2TGDA 4AFUA 2DE9A 1EZUC 1MAXA 1C1OA 1QFKH 3UNSA 4NSVA 3T62A 3BTKE 1C5SA 2BVSH 4O3TA 3UWJH 1NN6A 1HNEE 1SQTA 2VB0A 1MZAA 2QA9E 1HFDA 1WTGH 2ZP0H 5BRRE 1Z8IB 1MKWH 1SG8B 1YCPH 4YT7H 3A7VA 1O3KA 2FTLE 3EYDA 1Y3UA 2PKSB 2VGCB 4TY6A 3QUMP 1SFQB 2SGFE 4A1VA 2CV3A 3VB5A 1HDTH 5DP5A 1TALA 5E8EH 1QJ6B 1GI2A 2BD3A 4JK6A 3SNDA 2OC1A 2C90B 3OYPA 3RM0H 1TPPA 2ZGXH 2G5NA 2W3KA 1TB6H 3KQDA 5LPEA 2RCEA 4HFPB 1DWCH 2G4TA 4FUCA 1P2OA 4ZHAA 1GJ9B 3SU1A 1VJ9U 2HNTF 4HI3A 3BIVH 3RLYH 1A0LA 1ZRKA 3MI4A 1SGQE 1W10U 5L2ZH 3LH1A 3E0NB 3LGVA 4YESB 1HAXB 2FIRH 3UTUH 1MKXH 4X1QU 1T8NA 1ZHMA 3RXCA 1G2MA 4ZKNU 5JB8S 1AU8A 2O8WA 1HAIH 3SU4A 2F9UA 2ZPSA 1BQYA 4Y6DA 1JMOH 3ZVGA 5CE1A 1HRTH 1TRNA 3NWUA 1TOCB 1C1TA 1KDQA 3ATLA 3ZZAA 1HIAB 1GHXH 3HGNA 2P94A 1GGDB 3D23A 2ZDAH 1SQAA 3SQHE 2XW9A 1MU8B 4MG3A 1HAVB 4ABIA 1NY22 1TGNA 1GBLA 3MH7A 3QX5H 2DUCA 3PLPA 3PO1C 5LPFA 4YLUA 4OS5A 1JXPA 1BJVA 2ANMH 4RSPA 3DUXH 4UONA 3GYLB 3V3MA 1AFQC 5GCHG 3RXBA 5EG4A 1BMLA 1K1JA 3SU0A 1C2FA 1A3EH 1QRWA 4O9VA 3ZZ3A 5FX5A 3URCA 3A7XA 1O2IA 3PV4A 2D2DA 1MBMA 1BTZA 4B75A 4I31A 3BTTE 1PPHE 3ODFA 1EAUA 2VWOA 4THNH 2FDAA 1FMGA 1J14A 4NSYA 1QIXB 1O5AB 1CT4E 1G30B 5H4IB 5L2YH 1KXAA 3BG8A 5EW1H 4NZQA 1V2VT 3F9FA 1C1NA 1ORFA 2QXHA 2FYQA 1QBVH 2XBYA 7LPRA 4JZEH 4X8UH 1O5DH 4JYUH 1FPHH 1CHOF 1UHBB 1EUFA 1EB2A 2CF9H 4I33A 1UK4A 2P8OC 2ZGCA 3V7TA 4A6LA 3SHAH 3S7HB 1MTUA 3GY3A 3UFAA 1SL3A 4Y7AA 2A4GA 4FUFA 2SNVA 1EZQA 1A46H 5K0HA 2BB4A 3A87A 3AW1A 1FY1A 1O3EA 4NFEA 5F6MA 1ETTH 3RC5A 1TOMH 1YPKH 3ZZ4A 1JIMA 3EDXB 2G51A 1GBEA 4X2XA 3A88A 3MMGA 3QGJA 1P2QA 2ZDVH 2PLXA 2O9QA 1C1UH 3A7WA 5ETXA 5AFZH 1C5QA 2ZU4A 2XYAA 1HXFH 1XUHA 5DP9A 5JBBS 1CBWC 1F2SE 4AB9A 4Q2KA 1Q3XA 3ZVFA 2ZF0H 5DKMA 4X6MA 2ODPA 3E91A 4YTAA 3LC5A 1LPZB 2PUQH 2J9NA 1H8DH 1L1JA 3SUFA 1AD8H 1GMHG 1KLTA 1PPFE 5JBAS 2ZGJA 2FI3E 4WH8A 2WPHS 2OC7A 1ZOMA 2VIVA 1C1MA 4DVAU 1NRQH 2ZZUH 4INKA 1T7CA 1PYTC 3RXAA 1XM1A 2QF0A 1O2HA 4K60A 1JIRA 1ZSKA 1M9UA 1B0FA 2SGAA 4MPVA 3F1SB 1OWIA 1FV9A 2EI8A 2Y5GA 1MQ6A 1C9TA 4WXVA 1W3CA 4CHAB 2ZCHP 2BYAX 3HGPA 4I32A 4K69A 1FN8A 4DT7B 3V0XA 5DP3A 1GHZA 1UMAH 3QGNB 5AHGH 1O2JA 3HKIB 1PQ8A 1O3BA 1Y3XA 3HK6B 3GY6A 3EE0B 3ATIA 1RJXB 5JBCS 3UIRA 5AVDA 1S0RA 1P8VC 1MCTA 2TGAA 2HVXA 1RIWC 1C5ZB 2RDLA 2QCYA 1V2JT 1TWXB 1MH0A 5DO4H 2XRCA 5GJ4B 3AAUA 1Y8TA 2XNIA 5DPAA 2Z3EA 2QIQA 1P05A 8ESTE 5I25A 2CXVA 4Z6AH 1QJ1B 2HPPH 2Y5FA 1TPOA 2OCVB 3A8BA 1ELTA 3ATMA 1KXCA 3MU4A 4B73A 4X6OA 1UCYK 1EAWA 2FM2A 2XBXA 2OC8A 4CREA 1Z6EA 4MNVA 3PWCA 4YT6H 1C4Y2 3GY5A 5E0GA 4X8VH 2ZHEH 5FBIA 5HM9A 3ZV9A 2WPJS 3TGIE 3ITIA 2G4UA 3U1IB 3LJOA 5T6DA 1BTXA 1NRPH 1L1NA 1UO6A 2VINA 4Y71A 1UCYE 1GMDF 1Z6JH 1ZMLA 3UWIA 2Y82A 4ISIH 1NO9H 3VFEA 3ZVBA 1LQEA 3RXKA 3DFLA 1V2MT 2KAIA 1G36A 2F91A 4IC6A 3RLWH 2ZEBA 1A0JA 2D1JA 3KCGH 5L30H 2GVFA 1WBGB 2TGPZ 1ACBE 1NTPA 3SNBA 1TGSZ 2GMTC 5DP6A 1ZJDA 3I78A 4K3JA 1P2IA 1EPTA 2Z9KA 4ZHMU 1L0ZA 5AFYH 1ESBA 3SI4H 4AFQA 3OY6U 3KQCA 4ZKRU 4D7GA 2PKSC 1BZXE 3S69A 1YPJH 2ZDNA 1A3BH 2ZWLH 4F49A 4YLQH 1DITH 1GJAB 1FLEE 3AVZA 1PPZA 1K22H 1GHVH 2J92A 4A7IB 1YPHE 1FQ3A 3NUMA 1ABJH 1ARCA 2Y7ZA 1K21H 2BDAA 3SNCA 2Z9IA 4FUEA 2W7SA 3M5LA 4CRAA 3PM3A 1NPMA 3A8CA 3KGPA 3RU4E 1QB9A 1BBRH 3SU3A 3U98H 3KN2A 3PO1B 5EXNA 1TAWA 3LKWA 1AFQB 2A5KA 1OP0A 2J34A 4UFEH 2PFEA 1GG6C 4IC5A 6LPRA 1SC8U 2O8UA 1BHXB 2ASUB 4JMYA 1TBQH 2FOAA 1T32A 1ANCA 2YOLA 1BTUA 2P95A 5HXFA 1YPLH 1ELGA 1T8MA 4K1EA 3TJOA 3ZVEA 2Y7XA 7GCHF 4CBNA 1K28D 4TPYA 1GGDC 4IW4E 4GCHF 1K1IA 1H9HE 1BRUP 3T2NA 4LZ4B 1C4U2 3U69H 4E7RG 4ZKOU 1FPCH 1C5LH 1H1BA 3ATWA 3TH2H 3V12A 1YPEH 3LGYA 2P8OB 1GMCG 4NA9H 2Z3CA 4B2CA 1PQAA 1YPHC 2ODYB 2PSXA 1QR3E 1ZPCA 3SHCH 1SSXA 1GDQA 4D9RA 5GCHF 2ZQ2A 2UUKB 4ZHLU 1ZR0A 4CRGA 1HIAA 4K2YA 3TLOA 3T26A 1UTKA 3UREA 4BOHA 1HAVA 3P92A 4KTUA 2B9LA 4GLYA 4NG9H 2SGQE 5DGJA 2PTCE 4UDWH 1O36A 2Y6TA 3FP8E 1O2UA 1AE5A 4LZ1H 4JCNA 1X7AC 5LPRA 3B8JA 3PMJA 1O2RA 2H2ZA 3UQVA 7KMEH 5IDKA 1YM0A 2J2UA 2FOHA 1GDNA 2P3TB 1QY6A 1DLEA 2D8WA 2UUFB 3RM2H 1HAGE 5FPTA 1C9PA 5A2MH 2ZG0H 1BJUA 5FAHA 3UOUA 2AGIX 1CGHA 1LPGB 3SGAE 1MU6B 1MZDA 1Z1JA 1MCVA 3RUOA 1QHRB 1SGEE 5C1YA 1NS3A 4B71A 1NC6A 3BTGE 3DD2H 1UHBA 2GGVB 2P59A 1GHAG 4FUBA 1SLVB 1LDTT 2ZA5A 1FXYA 4WMDA 2FYRA 3URDA 4B76A 5B6OA 2A4RA 2G00A 3RXMA 4E05H 4X1NU 2H5CA 2J94A 3VB6A 1BTWA 4FUIA 1EOJA 5ESBA 1TGTA 3A85A 2TRMA 1XUIA 1PPEE 1RIWB 2OQUA 1NU7B 2CMYA 1O3IA 3BSQA 1C2KA 3ATKA 1GMHF 1C4V2 1HJ9A 3S0NA 2PWXA 4JZDH 2A4OA 2QV1A 1O5GH 3PYHA 4AOQA 2BHGA 1BMMH 4GUXA 1O2XA 4D76A 2ZPQA 1LVBA 1ESAA 2C8WB 1TPSA 1TRYA 2CN0H 2BX3A 2LPRA 5A0CA 1WV7H 1FY5A 1GJ8B 5F8ZA 4D7FA 1XXDA 4KGAA 3M7TA 3QWCH 4A1TA 1OP8A 1OWHA 2ZGBH 2ALVA 3F6UH 4BAHB 3BIUH 1F0RA 3MNCA 2ULLA 1ANEA 2HOBA 3STIA 1W11U 1S83A 2HWLB 2TBSA 1O3NA 1A5IA 1BT7A 1QL7A 4KP0A 2XC5A 3EA9A 1TMBH 1IQGA 1K1MA 3I29A 4DY7B 8KME2 5F8XA 1OXGA 2Y80A 1DWDH 1XUGA 1F7ZA 1IQEA 2BLVA 1AVGH 1BTPA 1TQ0B 2VH6A 1P2MA 4UEHH 1DXPA 1BUIA 3DT0H 1V2OT 4RKJB 1GBFA 1GL1A 1SGDE 1EX3A 1UTPA 2VVUA 1UVTH 2RA0A 5JB9S 1GHYH 3BTHE 2GMTB 1QCPA 4ZUHA 1DVAH 4FU7A 1ZGVA 2QAAA 2IJOB 1C2HA 2XC4A 1GCTC 2QXGA 2Q6FA 2XCFA 1J15A 4ABHA 1E0FD 1D6WA 3T28A 3SUEA 2H9TH 1G3EA 1PQ5A 1OX1A 3QTVH 1H9IE 2BD5A 2Z6BD 1C2GA 4IN1A 1E35B 3FANA 4WY3A 2BQ7B 4KTSA 4CH8B 2SGDE 1FI8A 2BZAA 5CMXH 1TBZH 2IN2A 3CP7A 3QDZB 3D65E 1ZRBA 4UFGH 2C8YB 4X2YA 1CT2E 1P9UA 1O3AA 1GHBG 1P12E 4WVPE 2PV9B 4H6SB 2GKVE 1SGRE 8GCHF 3BEFB 4GAWA 1JOUB 5LH8A 4SGBE 3SNEA 1DLKB 2AIQA 1VJAU 2ZFRH 4AYVB 3S9CA 1KTSB 4IGDA 1OYQA 3RMMH 1OWEA 4O97A 4WMFA 1GI3A 1YBWA 1W8BH 4KKDA 4OGYA 1F5LA 4WXIA 5C5OA 2AGEX 3L6PA 4X2WA 1GG6B 1A0HB 4AFSA 4BXWA 1GCDA 4X1RU 1EASA 1P3CA 3LONA 1RFNA 1VITF 1HAOH 1SLWB 1O2KA 3ZYDA 1BTYA 1GJ6A 2FOCA 3Q3XA 4X1SU 4XSKU 3EAJA 3K9XB 1BRAA 2H9EH 4GVUA 2UUYA 1SVPA 1O0DH 1XUFA 1H8IH 2BY5X 1GBHA 2H1UA 3VPKA 5TCCA 1BRBE 2O8TA 2VIWA 1ETSH 2AMPA 1S0QA 2GZ8A 1HXEH 3PMAB 1IQJA 1QURH 2OQ5A 2HRVA 4Y76A 4I7YH 2V6NA 4BXSA 2AYWA 1SGNE 2I6SA 3LU9B 1BHXF 1SHYA 1VCQA 3H5CB 4NGAH 3PB1E 7ESTE 3KHVA 1K1LA 4YOJA 3SJ8A 1BRCE 1O3GA 4TWYA 5FHTA 2A45B 1QRXA 2FOMB 5FXLA 4ABGA 1IOEA 1Q31A 2FWWA 3M36A 5JBTA 2FI4E 3DA9B 3AAVA 4HGCA 3BTEE 1T8OA 1KY9A 1D3TB 1O35A 1YKTA 2BLWA 4NA8A 1U6QA 3LOXA 1PFXC 1O2YA 1G9IE 1MUEB 1N8OC 4ZMAH 5C5NA 1ZHRA 3TH4H 2FO9A 1GBJA 5A0BA 1CT0E 4DIIH 2G52A 3ZVCA 1GJCB 3P8NA 4FVBA 1VITH 4X8TH 3A7YA 1KSNA 1O30A 1UTQA