1GCDA

Refined crystal structure of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
237
Chain Sequence
CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-CHYMOTRYPSIN
publication title Refined crystal structures of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(serine proteinase)
total genus 50
structure length 237
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1994-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA01
1TX8A 1K22H 2Z9GA 3VB3A 5A8XA 3SI4H 1QJ1B 4DCDA 4D9QA 1SFQB 3HK6B 1CGIE 1A0LA 3KL6A 4X8VH 1V2QT 1F7ZA 5HM9A 3BN9A 1FIWA 2A0QB 1MKXH 2BDCA 3GY8A 1SGDE 3O8BA 4Y6DA 1V2TT 1KSNA 5AVDA 2GDDA 5JBBS 5GWZA 2OQ5A 2VIWA 2PLXA 1EAXA 1ZGVA 3MWIU 1T4VH 1AD8H 1JXPA 3N7OA 1P06A 4ABHA 1EX3A 4ISNA 3BV9B 3SNCA 1LHGH 2NU4E 2THFB 2XW9A 1FAXA 4IN1A 5GPIB 1GJ8B 2EA3A 2O8TA 1C5VA 1O2OA 3QK1A 3OSYA 2Z7FE 1YPEH 1C2KA 1MD8A 5TCAA 3T62A 2XTTB 5E0GA 1HIAB 4CBNA 1RIWB 1ZR0A 5A8YA 3SQEE 3HK3B 3FZDA 3ZZAA 3DUXH 3V3MA 1MZDA 5DO4H 3DFJA 3GCTG 2PKAA 2ZFFH 3U98H 1SI5H 1AE8H 3I29A 2OC0A 3UNRA 3MMGA 2A5IA 3SNBA 2BD4A 1GJ7B 5FBEA 3MYWA 4X0WU 2Y81A 4DIIH 1SHHB 2VNTA 2BDGA 3M37A 2BDHA 3NUMA 1JRSA 3SOSA 1Z8IB 4INHA 5EPYA 3K9XB 3NKKA 3BG4B 3GDUA 1OKXA 1UTOA 2JH0D 2AGEX 1ZMNA 4HFPB 2UWOA 1O3NA 3SV9A 1GI9B 1GBJA 1J8AA 1XVMA 7KMEH 1EPTC 1HJ8A 1MTSA 2BVSH 2YNAA 2CGAA 3UQVA 3M3TA 5EQSA 3RU4D 4I8KA 3V0XA 2WPLS 1RTLA 3MU4A 1TOCB 1GBAA 2UWLA 4CRAA 4B2CA 1TGTA 3BG4C 3T2NA 3P8GA 3BSQA 4NIVA 1OYQA 1TX6A 2DE9A 4UDWH 3E8LA 3TK6A 3ZZCA 2BLOA 2H9EH 2TGPZ 5HGGA 4X2VA 5T6DA 2BDIA 2VIQA 1L2EA 1TPSA 2ZZUH 4ZKOU 1NM6A 1MBMA 1SLXB 1DLKB 1NT1A 3P95A 1VJAU 1VZQH 1CA0B 2JETB 1IQFA 2ZTXA 3LGWA 4DJZB 2WPIS 1DM4B 1EASA 1F5LA 3QZQA 2J4IA 1ANEA 1LCYA 2ZC9H 4KP0A 4F49A 3RUOA 2A1DB 3KQBA 2G8TA 1ZSKA 1DPOA 2RA0A 2UUYA 1GHVH 1V6DA 1G9IE 2A7CA 3M3VA 4WVPE 1BBRE 1N6YA 1Q3XA 2J2UA 4MPXA 2WINI 4GVUA 2JETC 1HPGA 1JBUH 1P0SH 2H6MA 2QY0B 1DSTA 4BAHB 1TWXB 3ZZ7A 1OSSA 3TJNA 1BTYA 3A80A 2PSYA 3E91A 1FN8A 4FUGA 5I25A 3GOVB 2OBQA 2STAE 3L6PA 3Q3XA 4TY7A 2Y80A 1TGSZ 3PWCA 4NA9H 1GBHA 3SNEA 2PR3A 1THSH 3BEFB 4KTCA 3UQOA 3TJVA 4A6LA 1C1NA 1GBDA 1TGBA 3A82A 1B5GH 1Z71A 1MH0A 1Y3YA 4F4OC 1FDPA 1CGHA 1C5MD 1BITA 2IJOB 2PWXA 2M5TA 3SGAE 1AB9B 1BUIA 1C2FA 3K65B 1C5XB 1HDTH 1DY9A 1LHDH 4HI3A 4I31A 2R0KA 3MU0A 2RA3A 1O2KA 2ZGXH 5F8ZA 1MAXA 1C2LA 2XC0A 2XNIA 2PW8H 1NFYA 4GUXA 1GI7B 4B76A 2G51A 3RXKA 2P16A 4GHQA 1O3IA 2ZDVH 2ZQ1A 1P2QA 1AVXA 3M3SA 4O3TA 1W0YH 1Z8RA 3D23A 1Z7KA 1K9OE 3QZRA 1Z8GA 1K1MA 4JYTA 1AQ7A 4SGAE 3SJ9A 4X1RU 4ZAEA 2D8WA 3TGIE 1NFUA 1ZMJA 2CV3A 3ZV8A 1O2ZA 3EA9A 4BAMB 1C1QA 1E37B 1EAWA 2C90B 2W3KA 1GHBF 3QLPH 1AZZA 1WQSA 1DUEA 4YESB 1C9PA 5I46H 3T29A 2BY9X 4I8GA 1THPB 2AEIH 1L1JA 4DIHH 4CR9A 3FP6E 2FS9A 5EGMA 2BZ6H 2ZTZA 3RLWH 1GDQA 1HAVA 1QJ6B 2JKHA 4ZKSU 2PFEA 4CBOA 1VR1H 2UUJB 4YLQH 1ABJH 6CHAB 1QRXA 2A4QA 2VU8E 3SU0A 1WUNH 2FI5E 1T8LA 4K1SA 2FP7B 3OX7U 1EZQA 3PROA 2XBXA 1ZPCA 4NGAH 3TJUA 4IGDA 4JK6A 4H6TA 2ZDAH 2OXSA 5DG6A 4TYDA 4HGCA 1OS8A 1P3CA 2GP9B 4NWLA 4TPIZ 1F2SE 4MG3A 2ANMH 1TMUH 2AFQB 3MNBA 1W10U 5GCHF 1ESBA 3M61U 2B9LA 1D6WA 3BTQE 3TK5A 2ZFRH 4D8NA 2VWMA 1ANBA 1GHBG 1UMAH 5ETXA 3A84A 1T31A 2J34A 4KELA 1CBWB 3UIRA 1FNIA 1P2JA 2QYIA 1SGYE 1C1RA 2V3OH 2CF8H 3C1KA 4JMYA 3SV7A 2ZNKH 1F5RA 3HATH 1HAHH 3S9BA 4ZHAA 1TRMA 4IS5A 2QF3A 1C1TA 3A8CA 4XSKU 2BM2A 3ESTA 3MU1A 4GCHF 3ZZ8A 4CR5A 2BLWA 3I78A 1DT2A 1QRWA 2R3YA 4BAKB 2FDAA 1LPZB 2P3TB 3QWCH 1S0RA 5F8TA 1Z6JH 2G81E 1TRYA 2G5NA 2ODQA 4GPGA 5L2YH 1HFDA 1FI8A 1CBWC 1TRNA 3A8BA 1S83A 2ZHFH 2HPPH 4DW2U 4AB8A 1MCTA 3UWJH 5ESTE 1VCWA 2FZZA 1EOJA 2FLBH 1DOJA 1O36A 2Y7ZA 3LGVA 5DK1A 3QO6A 2C3SA 4FUIA 1C2GA 3RXEA 2BX3A 4NFEA 1LQEA 2BD7A 4AG1A 2HPQH 1K1NA 5DP4A 2ZF0H 1SGQE 5GCHG 1SGPE 5A0BA 2WYGA 2XYAA 4NSYA 1FY5A 2GX4A 3EE0B 3ATWA 1IQEA 2HNTF 2C8ZB 1ELEE 3K6ZA 3LGYA 2XBYA 3NPSA 1TABE 1C1UH 5AHGH 1GI2A 2Y5GA 4DY7B 1V2RT 3LKWA 4LK4A 3LGUA 1GBIA 4Q7XA 4IBLH 1Y3WA 1O3FA 1H4WA 2VGCC 3SV8A 1O2UA 2FLRH 4J1YA 1V3XA 4GCHG 3M36A 1EJMA 4KGAA 3QTOH 1PPBH 2FX6A 1LVBA 3KIDU 1W14U 1A0HB 1LVYA 1Y5BT 3EDXB 3AW0A 4NCYA 1HV7A 5GJ4B 1AVGH 1YPGH 3T25A 3LDXH 3P70B 5TCCA 3GY3A 1A5GH 2FOAA 1FPCH 1Z1JA 1FLEE 4OS6A 2AMDA 1H8DH 3NWUA 1DUAA 3P8FA 3OY6U 5JB8S 4NG9H 2GZ8A 2ZHWH 3FP7E 4B71A 4UFDH 1O5FH 4YT6H 2FEQH 4AYYB 1V2WT 1W11U 4UFGH 3U69H 2DE8A 2R9PA 1NROH 5DGJA 2RDLA 3M7QA 2VIDA 5DPAA 1GJBB 3O8DA 3PMHB 3KNXA 1T8MA 2B7DH 4WXVA 5FBIA 2AERH 1SGIB 1EAIA 4UFEH 4FXGH 1V2PT 1GVKB 1BQYA 1O2GH 3F1SB 1UCYE 2PTNA 2ODPA 1HCGA 1O2XA 2GCTB 3RXLA 4MNXA 3VB5A 2BD9A 1SQOA 1YBWA 6ESTA 4A1VA 1AMHA 1NRRH 2QCYA 2STBE 1C2MA 4Q80A 2HRVA 1MAYA 1IQGA 3GY5A 1P8VC 3A89A 3PYHA 1HAPH 1XUKA 4Z0KA 1F0RA 4Y76A 4GSOA 5PTPA 1TGCA 1AWFH 3HKJB 1O32A 1OWJA 1XXFA 2B0FA 3M5NA 3MNSA 2Z6BD 1XUFA 1YCPH 2V3HH 3ZYDA 3MOCA 1D3QB 1IHSH 1HGTH 3UOPA 1E38B 2WUBA 4BOHA 5ABWA 1KLTA 4Y79A 4IW4E 1GMHF 1C5LH 5CHAB 3SHAH 1TYNA 1CA8B 3DHKH 3UOUA 1DITH 3EQ0H 3ZVGA 2J95A 4X1SU 1W2KH 1C2DA 3SUFA 3SORA 3E1XB 1WTGH 1H1BA 2VJ1A 1V2NT 1CT2E 1TQ0B 4WJG2 1GMDG 2ZQ2A 1O5DH 1QBVH 2R2MB 2GMTC 4K8BA 2PUXB 1O2LA 2PKSC 1B0FA 3UFAA 3V13A 1C5OH 4YLUA 3QN7A 5CHAC 4X2YA 1YPMH 2OD3B 2WUCA 2CJIA 1TOMH 1AIXH 1TPOA 4NA7A 3SU6A 1KXDA 1C1WH 3BTHE 1ETTH 1FQ3A 2ALPA 4X2XA 1LPGB 2FOMB 5C1YA 5EW2H 3TPIZ 1N6XA 5C3NA 1PJPA 2QF0A 3EAJA 2BY5X 3ZZBA 1GI1A 1AGJA 5GXPA 1G3EA 1AFQB 4Y8XA 2W7UA 1LMWB 4RN6A 3U8OH 2GT7A 1HB0B 1MBQA 5C2ZA 2FI4E 1QHRB 4BTUB 3RXTA 1GMHG 3BTTE 2UWPA 3RU4T 1C5QA 3GICB 4BTIB 3E0NB 2ZPQA 2ZPRA 1GBMA 1LHFH 4B74A 1ZHPA 4ISHH 4A1XA 4YM9A 2Y5FA 2SNWA 2ZU4A 4ZUHA 4WMDA 1C1VH 1O2VA 1BJUA 1ANDA 1BTPA 1EQ9A 3GCTF 1UK4A 2A4OA 4XDEA 4YTAA 4TY6A 4LOYH 4A5TS 1AFQC 5JPMH 4JCNA 2QXIA 3LONA 2HNTE 3UR6A 3KHVA 2WV5A 3AAUA 1C4U2 5T6GA 2P94A 2FIRH 1MCVA 1AWHB 2O8MA 3RMNH 1MTNC 1W12U 1O2HA 3SHCH 2FTLE 4BXWA 1XMNB 1ESAA 1O37A 5DP7A 2BD3A 3IWMA 1XVOA 1Y3UA 2J92A 4X1QU 3MNXA 1BOQA 1WTHD 2BB4A 3L3TA 4K69A 3DD2H 1C5WB 1MTUA 2BOKA 2G4UA 1V2UT 2QV1A 3GYMA 4A7IB 2ZFPH 3K6YA 1A5HA 1TBZH 2A4RA 4DGJA 1GL0E 1BRBE 1H8IH 3A87A 4FU8A 1P9UA 2VH0A 4D7GA 1MZAA 4AG2A 2AIPA 4AORA 1TB6H 3A8DA 3ATLA 3UPEA 4OS5A 3RMLH 5K0HA 2QN5T 4FU9A 1SB1H 3BTEE 4ABGA 3FANA 4AN7A 9LPRA 3MO9A 1C4V2 1SGCA 1IAUA 1T8NA 3TGKE 2FMJA 1KDQA 1C5TA 3AAVA 1IQIA 5EXLA 1EPTB 3S7KB 3ATKA 1XKBC 1T7CA 2G55A 1BDAA 3AASA 1O5CB 1V2JT 2P8OC 4I33A 2ZFTA 1ZOMA 1GI3A 1YYY1 3QX5H 1ZSJA 1L0ZA 2QIQA 1BA8B 2IN2A 1QL7A 2ILNA 3FP8E 3BTME 4ABIA 3HGPA 2G5VA 2D26C 1C4Y2 3ZVEA 3U8RH 2WV4A 4Y71A 3EGKH 1SQTA 2ZWLH 1FN6A 2O8WA 1EJAA 1V2LT 2ODYB 2SFAA 1MTVA 1D3DB 1V2ST 1XKAC 2Z9LA 1GWAA 1OWEA 3MU5A 1EAUA 2ZDLA 1SGFA 2W5EA 1C2EA 2FPZA 2F9BH 2ZIQH 4D7FA 4I8JA 3D49H 2NU2E 3K2UA 1O3MA 1LDTT 1BMLA 1ELVA 4MVNA 4AFSA 3SZNA 3S9CA 2RG3A 4X6PA 1VITF 1QL8A 1SVPA 1RD3B 1TA6A 4AFUA 4GLYA 3AW1A 3LC3A 1G3BA 1C2JA 1AE5A 1S84A 3RC5A 1L1NA 7ESTE 1C1PA 1ZRBA 3PO1C 1QURH 1GBTA 1NS3A 2KAIB 1FZZA 1ETSH 3TNSA 1LVOA 1J9CH 2DUCA 1EZSC 1O5AB 4K3JA 3NK8A 1D3PB 1C1SA 2FOFA 4Y7BA 4B1TA 4CRBA 1O2PA 3W94A 1SGRE 3LOXA 2ZU5A 4RKOB 1G2MA 2W3IA 3VEQB 4WF8A 1O2QA 1G32B 5AFZH 4YOJA 3KQCA 3B9FH 1C1MA 1MKWH 3STJA 3LPRA 1PPGE 3BIVH 1H9IE 2HOBA 1D6RA 4Q2KA 5BRRE 2A7JA 1EB1H 1AO5A 1GHZA 4BAOB 3E90B 4JYUH 2OC1A 2BX4A 1CGJE 1FAKH 3R0FA 1FONA 3KF2A 2AH4X 2XBVA 4IMZA 4CREA 1BRCE 1RJXB 5DP9A 1JOUB 1FV9A 1HAOH 1BBRH 4YT7H 2A5KA 1O5BB 1HAZB 2WPKS 1VITG 3ZZ5A 9ESTA 3LU9B 5HYOA 1J15A 1L4DA 4AOQA 2BY8X 3PTNA 4XBBA 3HGNA 5DJ7A 3ODDA 5LPFA 3MO6A 1O3CA 3JZ1B 5LH8A 6LPRA 5EPNA 1TLDA 1P2MA 5ESBA 3SW2B 2BXTH 4VGCB 2BDYA 1HUTH 1TA2A 2A2XH 2FXRA 4D9RA 2XCFA 3BIUH 1SBWA 1TBQH 3SQHE 4U2WA 1Q2WA 5AFYH 1A4WH 2Q6FA 3G01A 2I6SA 3LH3A 3TH3H 3GCOA 3P8NA 2XBWA 2Z94A 1IQLA 4RSPA 3OU0A 1UK3A 1TNHA 3VGCC 1ELTA 1CHGA 4DT7B 4VGCC 1GPZA 1C5PA 3TNTA 1N8OC 1MMJN 1XXDA 4AYVB 2GDEH 2TBSA 2OQUA 1HXFH 1Z1IA 4FU7A 1OWHA 1QQUA 1UVUH 1BRUP 3RXSA 1TIOA 1HAXB 1ARCA 2AGIX 2EEKA 3LIWA 3Q76A 4TPYA 2HNTC 1B0EA 2C8YB 1LKBA 1GBEA 4ABAA 3URDA 1P2KA 1M9UA 4KTSA 2ZECA 1WSSH 3PB1E 1O3KA 1P02A 5BPEA 1DWDH 1NY22 1NESE 1OP8A 1YCPK 1O3EA 1YGCH 5DP5A 2EI8A 3MH4A 1O2SA 1QB1A 4GHTA 1SL3A 1V2KT 4CH2B 4KKDA 3SV6A 1P09A 1SLUB 2XXLA 5GIBA 2JH5D 5FXLA 5JBTA 2FWWA 3T5FH 5HXFA 3KQDA 4XBDA 1OWIA 1LHCH 1UTKA 1GBLA 1TNIA 1P05A 4X1NU 2VVCA 2G52A 1ELCA 1S0QA 3PLKA 4BAQB 1DY8A 1XUHA 3BTDE 1GMCG 1EZUC 4FUDA 2ANKH 2CMYA 3GY6A 2ZCLP 1O38A 1SOTA 4B73A 3RXBA 2TGAA 1QQ4A 1P2IA 4X8UH 1PYTC 2A5AA 1IQNA 1TNJA 5EG4A 3KGPA 3TJOA 2PHBA 2VIOA 3RP2A 1S81A 1BTUA 2IPHA 3S7HB 5C5NA 2GVFA 3OYPA 2FS8A 2GV7A 2PSXA 4JZDH 1FY8E 1AKSA 1CU1A 1UK2A 1PQ7A 4NIYA 2ZU2A 2PKAB 1NN6A 1UHBA 1K21H 1NRNH 3GCHB 1L4ZA 3U9AH 3WY8A 1CVWH 1P12E 4NWKA 3BG8A 2ZP0H 4O97A 4I7YH 3PMAB 4DVAU 3T26A 1OWDA 5HM2A 3TH2H 5DP8A 4AZ2B 4CRFA 1MQ6A 3O8RA 3U8TH 1GHWH 4O3UA 5JBAS 1UVPA 7GCHF 1YF4A 3UREA 2GKVE 4A1TA 2BMGB 3SJ8A 5J4SA 1MQ5A 1XX9A 3RU4E 3ZZ9A 1RFNA 3RXHA 4LZ1H 3I77A 1O3PB 3LJOA 2H9HA 1EXFA 2VGCB 3GCHC 5E0HA 2H5DA 1ABIH 1DE7H 5JYIA 2QXGA 1TFXA 1DX5M 3RXVA 2OBOA 3A7ZA 4MPUA 2GT8A 1Y8TA 1TNLA 1Z8JB 4ZKNU 4FUFA 2AMQA 1J14A 3A83A 3KCGH 4XFQA 3MU8A 1FIZA 1EOLA 4ISLA 1BRAA 4NFFA 4FUHA 1RXPA 1HIAA 3ELAH 1BHXF 1J17T 4DURA 4NA8A 3FZZA 2G00A 1DICA 5FX6A 4H4FA 1D3TB 3ZVBA 1S85A 1WU1A 4U30A 1GI5A 2ANWA 1F5KU 1GGDC 1QB9A 1G30B 1YP9A 4WY3A 1F0TA 4H6SB 4R0IA 1ZYOA 2WPHS 1IOEA 1C5UA 2VINA 3W95A 1KXBA 2FTMA 1GHAF 1GI0A 1TPAE 3E3TA 5JB9S 1K1JA 2D1JA 3NXPA 3PM3A 2ULLA 3VB7A 2C4FH 7GCHG 1W8BH 4BANB 1PQ8A 4ZROA 2BD2A 1T4UH 1V2VT 2LPRA 1DDJA 4K60A 3SGBE 1SFIA 1BMNH 1INCA 2QGRA 3CS0A 4K1EA 4Y8YA 4ZH8A 5T6FA 1GDUA 1RGQA 1SMFE 1P2NA 4B2BA 2ZHQH 1GI4A 3RXOA 1HXEH 5A2MH 8GCHG 3LC5A 2P3FH 4CRGA 2ZHDA 3TK9A 4ISOA 1OP2A 5C1XA 1GMDF 1LPKB 1YLDA 2B8OH 5C1UA 2ZDNA 2Z9JA 1TMBH 3M35A 4OS1A 1BTZA 3MHWU 4Y10E 1ZTKA 1L1GA 6GCHF 5L30H 3RLYH 4E05H 2A7HA 4NIXA 2J9NA 1NTPA 1QCPA 2A45B 5A0CA 1H9LB 2BYAX 4BNRA 3URCA 2WYJA 1LHEH 2FX4A 3RXDA 3H7TA 3STIA 4SGBE 5FPSA 3Q3YA 3MH5A 5IYTA 2ZFQH 1NU9A 2UUKB 4K2YA 5F6MA 3UNSA 3LJJA 2H5CA 2VIPA 1KXFA 3A88A 1QFKH 3BTWE 1KTSB 1JRTA 1GHAG 2TPIZ 2F9VA 1CT4E 3M5MA 1IQJA 1S82A 3U1JB 4OGXA 5EU8A 3PLPA 2GMTB 1C9TA 1BTHH 2TRMA 1SQAA 3SUDA 2PKSB 1ZSLA 2FM2A 4ZKRU 5JDUB 2BVRH 1Y5AT 8LPRA 3GY2A 1F92A 1E35B 1LVMA 3EYDA 3T27A 1T32A 3VXEH 5B6OA 1OPHB 3SJKA 4CRDA 2QXHA 4INLA 3MH7A 1ZTLA 4ZHLU 3SBKA 4JZFH 4X2WA 5H4IB 3KQEA 4I8HA 1G36A 2HALA 1TPPA 3RXCA 1HNEE 2A4GA 5EQQA 5DP6A 1UTPA 4Y11E 1C1OA 5EQRA 1TE0A 4Y0YE 4H42U 6GCHG 1ELAA 2OLGA 1P03A 1O3BA 3A86A 2Q6GA 3RM0H 3SV2H 1VGCB 4Y7AA 3RXJA 2HWLB 3PTBA 1MTWA 1EZXC 1W13U 4FUCA 3VB4A 4K1TA 1HAVB 4JYVH 3GY4A 2SGFE 2EC9H 5FPTA 5FHTA 1F0UA 3T28A 1MKWK 2QA9E 2F9OA 1O5GH 5F03A 2NU3E 3A7VA 2ANYA 4BTTB 1LQDB 4CH8B 1ZHRA 1WV7H 1A1RA 1VGCC 4HZHA 5C20A 1O2TA 5A0AE 1N1LA 1C5RA 3VPKA 8KME2 4X8TH 2F3CE 5FPYA 1FY1A 1BBRK 1TQ7B 4AGJA 3U1IB 3UR9A 4WH8A 1MTNB 1O3GA 4MLFB 1C5NH 2SNVA 2GCHG 1A2CH 1V2MT 2QAAA 3B23B 2QC2A 1DVAH 4E06H 3ENSB 2P95A 1EB2A 1B7XB 1K2I1 3P92A 2ASUB 2HGTH 3O8CA 3UWIA 3BEUA 4MNWA 3TLOA 1BMMH 1FJSA 4WMFA 2Y6TA 1HLTH 2OC8A 1SGFG 1GJ5H 2CHAC 1NRQH 4YOIA 3ZZ4A 1FY3A 1MU6B 3BTKE 3PMJA 2ZCKP 3ZVCA 1ZRKA 1O31A 1K1PA 5AF9H 4WXIA 4X6MA 5FCRA 1TGNA 4FUJA 2PUQH 2BQWB 1IQKA 3UY9A 1A5IA 3ZVDA 2Z3DA 2W26A 4D76A 1A3BH 1WOFA 3ZVAA 3TU7H 2FOCA 1GBFA 3A81A 1GG6C 1FXYA 3BF6H 4ABDA 1ACBE 2Y82A 2YNBA 4AGKA 1ZPBA 3RXPA 2LNCA 2P8OB 1K28D 3RC6A 4MDSA 3SN8A 4LXBH 1ORFA 1OYTH 1NC6A 1ZHMA 1O35A 4MNVA 4XE4A 4UFFH 1MU8B 1BTWA 2JH6D 4I8LA 2A32A 4IC6A 1A7SA 4U32A 1BT7A 2O8UA 3SJOA 1ZLRA 2O9QA 1ETRH 2BDAA 4XBCA 1C2HA 2NWNA 3D65E 2F91A 1PPEE 1AI8H 1NRSH 5EODA 4YO9A 4ZXYH 3RXRA 1UTQA 3NZIA 4ZMAH 5EXMA 1ELGA 1XUIA 3V7TA 3M7TA 3A7WA 3MH6A 1FMGA 3D62A 2BOHB 2IOTA 2GZ9A 1CO7E 1GHYH 4ESTE 5CMXH 3A85A 1SHYA 3RXIA 1TMTH 3IITA 1WCZA 3F9FA 1GI6A 1UO6A 4THNH 2Z3CA 2Q6DA 1P10A 3LT3A 3M5LA 1TONA 1GCDA 2WPJS 2R2WU 1A61H 1O3OA 2VVVA 3E16B 1UVOA 1YCPM 1RIWC 1MD7A 4WWYA 1O3JA 3PO1B 1QNJA 1W7XH 4OS4A 5G4BA 2RCEA 5L2ZH 3S9AA 1C2IA 5EOKA 2FESH 2BLVA 2VB0A 2ZGBH 4KTUA 1KLIH 5K7RA 3SU3A 1GL1A 3F68H 2ALVA 1TNGA 1O30A 2H1UA 1NO9H 1P57B 1CQQA 3QUMP 3F9EA 1BCUH 1QBNA 1YPJH 3RC4A 1ELBA 1EUFA 1O33A 2H2ZA 2XC5A 3GY7A 3LGIA 4Z6AH 1JIMA 3Q00A 3MNCA 5A09A 1ELFA 1ELDE 2P59A 1UTLM 4ASHA 3GCNA 1BIOA 1ZPZA 5E2PA 1OXGA 1BJVA 1O0DH 1QA7A 1GJDB 1D4PB 2FOEA 3DT0H 3E0PB 1O39A 2BLQA 2CXVA 4ABFA 1ARBA 2ZU3A 4NSVA 3QGNB 5DKMA 1A46H 3QGJA 2SGDE 4FUEA 3ZZ3A 1P11E 1O34A 4MPWA 1BTXA 2Y7XA 2NU0E 4OS7A 2W7SA 2BQ6B 2B5TB 1GJ6A 5LGOA 4M7GA 3RXQA 4YZUA 1VCPA 1CA0C 4YOGA 1DFPA 1EJNA 4GAWA 2O8LA 2ZFSA 4Y0ZE 3SU4A 4J2YB 1WAYB 1TNKA 3R3GB 1NZQH 3GDSA 2BXUH 2FODA 1QRZA 2FOHA 4X6NA 4K5ZA 5FAHA 2ZPSA 1EP6A 1UVSH 2Z9IA 3ITIA 3S69A 4JK5A 3VGCB 3HKIB 3PMBB 4MPVA 1QY6A 4MTBA 1N8OB 5T3HA 2GD4B 2ZEBA 1AUJA 2XCNA 3LH1A 4X6OA 2G4TA 4INKA 1TAWA 1U6QA 1HJ9A 1O2IA 2R3UA 4TWYA 1HJAB 1KTTB 2D2DA 2Z9KA 2FYQA 1Y3XA 1NRPH 1YPHC 2GGVB 2XWBI 1QGFA 4AB9A 1AZ8A 1BMAA 4E7NA 1QJ7B 1KYNA 1GMCF 1ZMLA 2VWOA 4IMQA 1YPLH 1BHXB 1ZJKA 1P04A 3PLBA 1HAYB 1RTFB 2PGQB 2SGEE 3TH4H 3S0NA 2BHGA 1IHTH 3CS7A 3P8OA 1Y5UT 1ESTA 1AB9C 3DFLA 1THRH 2OINA 1W3CA 2CN0H 1XM1A 5EXNA 1G3CA 1HJAC 2ZGCA 3PWBA 4ISIH 1UTNA 1SG8B 2AMPA 2VWLA 2GZ7A 3H7OA 3RM2H 1HYLA 3RXUA 1ID5H 4FVBA 1PQAA 2ZG0H 1CT0E 4O03A 1LO6A 1Y3VA 4AX9H 5EW1H 2OUAA 3HPTB 4ZHMU 3EA7A 1PPCE 1SOZA 2Y5HA 1VCQA 2VH6A 2VVUA 3MFJA 4HTCH 2P3UB 5LPEA 1CE5A 1YKTA 1IQMA 3ATMA 2BD8A 3Q77A 2BDBA 4OS2A 2P93A 3PV4A 3L33A 1AFEH 4DG4A 1SR5C 3TIUA 3VFEA 1W0ZU 3ZV9A 1UCYK 3KEEA 1C5SA 1CHOF 1O2JA 2HLCA 1RS0A 1GCTB 1D9IA 4R8TB 1AU8A 2EI6A 2HVXA 1O2YA 5A8ZA 1ANCA 2NU1E 2ZI2H 2K1QA 3UNQA 5FCKA 1HAIH 3AVZA 3SGQE 1XUJA 3VXFH 8ESTE 1O3DA 4A92A 2F83A 1P3EA 3ZZ6A 2SGPE 2J38A 2TGDA 4JZ1A 3F9HA 3SUEA 1AY6H 1EATA 2BZAA 6CHAC 1GCTC 1SC8U 2C8WB 2FO9A 1SGTA 2H9TH 4UEHH 1AVWA 1ZJDA 5FX5A 4PROA 3SU5A 1QTFA 1KIGH 1AUTC 2SGQE 3QTVH 2QXJA 1KXEA 1KDQB 1BB0B 3TVJB 2F9PA 2FOGA 1GBKA 2V0BA 2VIVA 5GDSH 4O9VA 3MI4A 1O3AA 2I6QA 3IG6B 3VB6A 1E0FD 3ODFA 5IDKA 4JZEH 1TALA 1X7AC 4IN2A 1O2MA 4JZIA 1CHOG 3SU1A 1A3EH 4AFQA 4K8YA 5TJXA 5C67A 1WBGB 1GVZA 2FOBA 4I32A 8GCHF 2AIQA 3MTYA 1QL9A 2C93B 1SGEE 1RTKA 2YOLA 2ZTYA 2AYWA 5L6NH 3A7YA 2ZA5A 1GGDB 1K1OA 2J94A 4Q7YA 1VITH 1Q31A 1ZTJA 4WH6A 1DWEH 3SI3H 5E8EH 3E6PH 4FUBA 1HBTH 3BEIB 1TX7A 4IC5A 1SPJA 2TGTA 2FYRA 1E34B 3H5CB 5E2OA 2ZO3H 3ZVFA 1P01A 4OGYA 1EPTA 1KXAA 1Y59T 3Q3KA 4B75A 1S5SA 1UTJA 3FVFB 4RKJB 1EP5A 1SLVB 5F8XA 1DWCH 1WYKA 1PYTD 1XUGA 3SO3A 1MKXK 5E0JA 1OOKB 1NU7B 4UE7H 4FVDA 1GDNA 1UVTH 2TIOA 3RDZA 3V12A 1O3HA 1CSOE 2V6NA 2ZCHP 2CF9H 1G2LA 1J16A 2XC4A 1PFXC 1PQ5A 4AFZA 4TWWA 4UD9H 3OTJE 1TBRH 3F9GA 1O2NA 1C5ZB 1OWKA 1GBCA 3M5OA 1GHXH 3DA9B 1DLEA 2ZGJA 1NPMA 1FUJA 1AN1E 2AS9A 2BD5A 3CP7A 1FPHH 1O2WA 3TITA 1W7GH 1JIRA 2ZDKA 1DWBH 2A2QH 1PPFE 5LPRA 3BTFE 1SLWB 5C5OA 4XOJA 3SNDA 1QA0A 2BY6X 4ABJA 2OTVA 1YLCA 4WMEA 3B8JA 4BXSA 4Y8ZA 2VWNA 3BTGE 2ESTE 1LKAA 3RXFA 3TGJE 5J4QA 3RXGA 1GI8B 3FFGA 3GYLB 4QT8C 2XRCA 2KAIA 2BVXH 1NFXA 1JMOH 1UTMA 5DP3A 3QDZB 5CE1A 2C8XB 1QB6A 3A8AA 2EI7A 1E36B 1S6HA 4NZQA 1UCYH 2ZU1A 3ZZDA 1JWTA 3GISB 1GJ4H 3P17H 1WQVH 4E7RG 1K1IA 1DS2E 2PGBB 1GVLA 3JZ2B 1F0SA 3SUGA 2ZGHA 4ABBA 3CENA 3KN2A 3FAOA 3ATIA 2GCTC 2Z3EA 1H9HE 4ZXXH 2GCHF 1SGNE 1YC0A 1G3DA 1VJ9U 3UTUH 3RXAA 2F9UA 1HAGE 2OC7A 1O3LA 1K1LA 4ABEA 2Q1JA 2R0LA 3RXMA 4NIWA 1KY9A 4U01A 2V35A 1PPZA 2BY7X 4MQAA 2F9NA 3GDVA 5JBCS 4NZLA 1KLJH 3LGTA 2ZKSA 4X8SH 1ZZZA 4B2AA 1YM0A 1PPHE 3A7XA 3ZYEA 1DXWA 3OY5U 1T8OA 2UUFB 1O2RA 1GJCB 1UJ1A 3SU2A 1DSUA 3M7UA 2SGAA 1GBBA 3SJIA 3A7TA 1DXPA 7LPRA 1QBOA 1P9SA 2GV6A 1OX1A 3C27B 2GTBA 3P6ZB 1YPKH 4CRCA 1YPHE 2ZDMA 2A31A 4CHAB 1AHTH 3MO3A 1DANH 1V2OT 1S6FA 2OP9A 1C5YB 1GJAB 2CHAB 2OCVB 5SGAE 1OP0A 1ZGIA 4X1PU 1IQHA 3RMOH 3NCLA 4LZ4B 5HMAA 1FY4A 1O5EH 2FI3E 2PV9B 1EKBB 1G37A 1RRKA 1SSXA 4UONA 3UUZA 3RMMH 2ZHEH 1P2OA 1QIXB 1GJ9B 1GG6B 4MNYA 4CHAC 4DOQA 1MUEB 1BZXE 4Q7ZA 1HRTH 3SNAA 1AKSB 1LTOA 2AGGX 2PTCE 2BTCE 2BQ7B 1QR3E 2XWAA 1NFWA 2WPMS 3EA8A 1Z6EA 1KXCA 3F6UH 1A0JA 1UHBB
chains in the Genus database with same CATH superfamily
4ACAA 1TX8A 1K22H 2Z9GA 3VB3A 5A8XA 3SI4H 1QJ1B 4DCDA 4D9QA 1SFQB 3HK6B 1CGIE 3OE7D 1A0LA 3KL6A 4X8VH 1V2QT 1F7ZA 5HM9A 3BN9A 1FIWA 2A0QB 4ZCNA 1MKXH 2BDCA 3GY8A 1SGDE 3O8BA 4Y6DA 1V2TT 1KSNA 5AVDA 2GDDA 5JBBS 5GWZA 2OQ5A 2VIWA 2PLXA 1EAXA 1ZGVA 3MWIU 1T4VH 1AD8H 1JXPA 3N7OA 1P06A 4ABHA 1EX3A 4ISNA 3BV9B 3SNCA 1LHGH 2NU4E 2THFB 2XW9A 1FAXA 4IN1A 5GPIB 1GJ8B 2EA3A 2O8TA 1C5VA 2AHME 1O2OA 3QK1A 3OSYA 2Z7FE 1YPEH 1C2KA 1MD8A 5TCAA 3T62A 2XTTB 5E0GA 1HIAB 4CBNA 1RIWB 1ZR0A 5A8YA 3SQEE 3HK3B 3FZDA 3ZZAA 3DUXH 3V3MA 1MZDA 5DO4H 3DFJA 3GCTG 2PKAA 2QF4A 2ZFFH 3U98H 1SI5H 1AE8H 3I29A 2OC0A 3UNRA 3MMGA 2A5IA 3SNBA 2BD4A 1GJ7B 3UB0A 5FBEA 3MYWA 4X0WU 2Y81A 4DIIH 1SHHB 2VNTA 2BDGA 3M37A 1COWD 2BDHA 3NUMA 1JRSA 5KGOA 3SOSA 1Z8IB 4INHA 5EPYA 3K9XB 3NKKA 3BG4B 3GDUA 1OKXA 1UTOA 2JH0D 2AGEX 1ZMNA 4HFPB 2UWOA 1O3NA 3SV9A 1GI9B 1GBJA 1J8AA 1XVMA 7KMEH 1EPTC 1HJ8A 1MTSA 2BVSH 2YNAA 2CGAA 3UQVA 3M3TA 5EQSA 3RU4D 4I8KA 3V0XA 2WPLS 1RTLA 3MU4A 1TOCB 1GBAA 2UWLA 3PV2A 4CRAA 2CK3D 4B2CA 1TGTA 3BG4C 3T2NA 3P8GA 3BSQA 4NIVA 1OYQA 1TX6A 2DE9A 4UDWH 3E8LA 3TK6A 3ZZCA 2BLOA 2H9EH 2TGPZ 5HGGA 4X2VA 5T6DA 2BDIA 3PV5A 2VIQA 1L2EA 1TPSA 2ZZUH 4ZKOU 1NM6A 1MBMA 2IPQX 1SLXB 1DLKB 1NT1A 3P95A 1VJAU 1VZQH 5C0TA 1CA0B 2JETB 2M2AA 1IQFA 2ZTXA 3LGWA 4DJZB 2WPIS 1DM4B 1EASA 1F5LA 3QZQA 2J4IA 1ANEA 1LCYA 2ZC9H 4KP0A 4F49A 3RUOA 2A1DB 3KQBA 2G8TA 1ZSKA 1DPOA 2RA0A 2UUYA 1GHVH 1V6DA 1G9IE 2A7CA 3M3VA 4WVPE 1BBRE 1N6YA 4I86A 1Q3XA 2J2UA 5C17A 4MPXA 2WINI 5IK2D 4GVUA 2JETC 3F0OA 1HPGA 1JBUH 1P0SH 2H6MA 2QY0B 1DSTA 2J5UA 4BAHB 1TWXB 3ZZ7A 1OSSA 3TJNA 1BTYA 3A80A 2PSYA 3PRDA 3E91A 1FN8A 4FUGA 5I25A 3GOVB 2OBQA 2STAE 3L6PA 3Q3XA 4TY7A 2Y80A 1TGSZ 3PWCA 4NA9H 1GBHA 3SNEA 2PR3A 1THSH 3BEFB 4KTCA 3UQOA 3TJVA 4A6LA 1C1NA 1GBDA 1TGBA 3A82A 1B5GH 1Z71A 1MH0A 1Y3YA 4F4OC 1FDPA 1CGHA 1C5MD 1BITA 2IJOB 2PWXA 2M5TA 3SGAE 1AB9B 1BUIA 1C2FA 3K65B 1C5XB 1HDTH 1DY9A 1LHDH 4HI3A 4I31A 2R0KA 3MU0A 2RA3A 1O2KA 2ZGXH 5F8ZA 1MAXA 1C2LA 2GJGA 2XC0A 2XNIA 2PW8H 1NFYA 1OHHD 4GUXA 1GI7B 4B76A 2G51A 3RXKA 2P16A 4GHQA 1O3IA 2ZDVH 2ZQ1A 1P2QA 1AVXA 3M3SA 4O3TA 1W0YH 1Z8RA 3D23A 1Z7KA 1K9OE 3QZRA 1Z8GA 1K1MA 4JYTA 4Q4LA 1AQ7A 4SGAE 3SJ9A 4X1RU 4ZAEA 2D8WA 3TGIE 1NFUA 2OK5A 2V7QD 1ZMJA 2CV3A 3ZV8A 1O2ZA 3EA9A 4BAMB 1C1QA 1E37B 1EAWA 2C90B 2W3KA 1GHBF 3QLPH 1AZZA 1WQSA 1DUEA 4YESB 1C9PA 5I46H 3T29A 2BY9X 4I8GA 1THPB 2AEIH 1L1JA 4DIHH 4CR9A 5C94A 3FP6E 2FS9A 5EGMA 2RFKC 2BZ6H 2ZTZA 3RLWH 1GDQA 1HAVA 2WHXA 1QJ6B 2JKHA 4ZKSU 2PFEA 4CBOA 1VR1H 2UUJB 4YLQH 1SKYE 1ABJH 6CHAB 1QRXA 2A4QA 2VU8E 3SU0A 1WUNH 2FI5E 1T8LA 4K1SA 2FP7B 3OX7U 1EZQA 3PROA 2XBXA 1ZPCA 4NGAH 3TJUA 4IGDA 4JK6A 1QZ8A 4H6TA 2ZDAH 2OXSA 5DG6A 4TYDA 4HGCA 1OS8A 1P3CA 2GP9B 4NWLA 4TPIZ 1F2SE 4MG3A 5EIYA 2ANMH 1TMUH 2AFQB 3MNBA 1W10U 5GCHF 1ESBA 3M61U 2B9LA 1D6WA 3BTQE 2EQNA 4FETA 3TK5A 2ZFRH 4D8NA 2VWMA 3SZEA 1ANBA 1GHBG 1UMAH 5ETXA 3A84A 1T31A 2J34A 4KELA 1CBWB 3UIRA 1FNIA 1P2JA 2QYIA 1SGYE 1C1RA 2V3OH 2CF8H 3C1KA 4JMYA 3SV7A 2ZNKH 1F5RA 3HATH 1HAHH 3S9BA 4ZHAA 1TRMA 4IS5A 2QF3A 1C1TA 3A8CA 4XSKU 2BM2A 3ESTA 3F2HA 3MU1A 4GCHF 3ZZ8A 4CR5A 2BLWA 3I78A 1DT2A 1QRWA 2R3YA 4BAKB 2FDAA 1LPZB 2P3TB 2W6JD 3QWCH 1S0RA 5F8TA 1Z6JH 2G81E 1TRYA 2G5NA 2ODQA 4GPGA 5L2YH 1HFDA 1FI8A 1CBWC 1TRNA 3A8BA 1S83A 2ZHFH 2HPPH 4DW2U 4AB8A 1MCTA 3UWJH 5ESTE 1VCWA 2FZZA 1EOJA 2FLBH 1DOJA 1O36A 2Y7ZA 3LGVA 5DK1A 3U28C 3QO6A 2C3SA 4FUIA 1C2GA 3RXEA 2BX3A 4NFEA 1LQEA 2BD7A 4AG1A 2HPQH 1K1NA 2HVYB 5DP4A 2ZF0H 1SGQE 5GCHG 1SGPE 5A0BA 1H8HD 2WYGA 2XYAA 4NSYA 1FY5A 1S6LA 2GX4A 3EE0B 3ATWA 1IQEA 2HNTF 2C8ZB 2KZ4A 1ELEE 3K6ZA 3LGYA 2XBYA 3NPSA 1TABE 4Q63A 1C1UH 5AHGH 1GI2A 2Y5GA 4DY7B 1V2RT 3LKWA 4LK4A 3LGUA 1GBIA 4Q7XA 4IBLH 1Y3WA 1O3FA 1H4WA 2VGCC 3SV8A 1O2UA 2FLRH 4J1YA 1V3XA 4GCHG 2XOKD 1EJMA 3M36A 3QTOH 4KGAA 1PPBH 2FX6A 1LVBA 3KIDU 1W14U 1A0HB 1LVYA 1Y5BT 3EDXB 3AW0A 1VKYA 4NCYA 1HV7A 5GJ4B 1AVGH 1YPGH 3T25A 3LDXH 3P70B 3DSGA 5TCCA 3GY3A 1A5GH 2FOAA 1FPCH 1Z1JA 5F53A 1FLEE 4OS6A 2AMDA 3FO8D 1H8DH 3NWUA 1DUAA 3MQKC 3P8FA 3OY6U 5JB8S 4NG9H 2GZ8A 2ZHWH 3CNRA 3FP7E 4B71A 4UFDH 1O5FH 4YT6H 2FEQH 4AYYB 1V2WT 1W11U 4UFGH 3U69H 2DE8A 2R9PA 1NROH 5DGJA 2RDLA 3M7QA 2VIDA 5DPAA 1GJBB 3O8DA 3PMHB 3KNXA 1T8MA 2B7DH 4WXVA 5FBIA 2AERH 2J97A 1SGIB 1EAIA 4UFEH 4FXGH 1V2PT 1GVKB 1BQYA 1O2GH 3F1SB 1UCYE 2PTNA 2ODPA 1HCGA 1O2XA 2GCTB 3RXLA 4MNXA 4B6FA 3VB5A 2BD9A 1SQOA 1YBWA 6ESTA 4A1VA 1AMHA 1NRRH 2QCYA 2STBE 1C2MA 4Q80A 2HRVA 1MAYA 1IQGA 2J98B 3GY5A 1P8VC 3A89A 3KYGA 3PYHA 1HAPH 1XUKA 4Z0KA 1F0RA 4Y76A 4GSOA 5PTPA 1TGCA 1AWFH 5CHBA 3HKJB 1O32A 1OWJA 1XXFA 2B0FA 3M5NA 3MNSA 2Z6BD 1XUFA 1YCPH 2V3HH 3ZYDA 3MOCA 1D3QB 1IHSH 1NBME 1HGTH 3UOPA 1E38B 2WUBA 4BOHA 5ABWA 1KLTA 4Y79A 4IW4E 1GMHF 1C5LH 5CHAB 3SHAH 1TYNA 1CA8B 3DHKH 3UOUA 1DITH 3EQ0H 3WWFA 3ZVGA 2J95A 4X1SU 1W2KH 1C2DA 3SUFA 3SORA 3E1XB 1WTGH 1H1BA 2VJ1A 1V2NT 1CT2E 1TQ0B 2VBCA 4WJG2 1GMDG 1K0HA 2ZQ2A 1O5DH 1QBVH 2R2MB 2GMTC 4K8BA 2PUXB 1O2LA 2PKSC 2V3MA 1B0FA 3UFAA 3V13A 1C5OH 4YLUA 3QN7A 5CHAC 4X2YA 3WWBA 1YPMH 2OD3B 2WUCA 2CJIA 1TOMH 3UAIC 1AIXH 1TPOA 4NA7A 3SU6A 3H09A 1KXDA 1C1WH 3BTHE 1ETTH 1FQ3A 4P02A 2ALPA 4X2XA 1LPGB 2FOMB 5C1YA 5EW2H 3TPIZ 1N6XA 5C3NA 1PJPA 4HG6A 2QF0A 3EAJA 2YMSD 2BY5X 3ZZBA 1GI1A 1AGJA 5GXPA 1G3EA 1AFQB 1FX0B 2QE7D 4Y8XA 2W7UA 1LMWB 4RN6A 3U8OH 2GT7A 1HB0B 1MBQA 5C2ZA 2FI4E 1QHRB 4BTUB 3RXTA 1GMHG 3BTTE 2UWPA 3RU4T 1C5QA 3GICB 4BTIB 3E0NB 2ZPQA 2JJ1D 2ZPRA 1GBMA 1LHFH 4B74A 1ZHPA 4ISHH 4A1XA 4YM9A 2Y5FA 2SNWA 2ZU4A 4ZUHA 4WMDA 1C1VH 1O2VA 1BJUA 1ANDA 1BTPA 1EQ9A 3GCTF 1UK4A 2A4OA 2KX4A 4XDEA 4YTAA 4TY6A 3NRLA 4LOYH 4A5TS 1AFQC 5JPMH 4JCNA 2QXIA 3LONA 2HNTE 3UR6A 3KHVA 2WV5A 3AAUA 1C4U2 5T6GA 2P94A 2FIRH 1MCVA 1AWHB 2O8MA 3RMNH 1MTNC 1W12U 1O2HA 3SHCH 2FTLE 1E79D 4BXWA 1XMNB 1ESAA 1O37A 5DP7A 2BD3A 3IWMA 1XVOA 1Y3UA 3OEHD 2J92A 4X1QU 3MNXA 4M9FA 1BOQA 1WTHD 2BB4A 3L3TA 4K69A 3DD2H 1C5WB 1MTUA 2BOKA 2G4UA 1V2UT 2QV1A 3GYMA 4A7IB 2ZFPH 3K6YA 1A5HA 1TBZH 2A4RA 4DGJA 1GL0E 4TSFD 1BRBE 1H8IH 3A87A 4FU8A 1P9UA 2VH0A 4D7GA 1MZAA 4AG2A 2AIPA 4AORA 1TB6H 3A8DA 3ATLA 3UPEA 4OS5A 3RMLH 5K0HA 2QN5T 4FU9A 1SB1H 3BTEE 4ABGA 3FANA 4AN7A 9LPRA 3MO9A 1C4V2 1SGCA 1IAUA 1T8NA 3TGKE 2FMJA 1KDQA 1C5TA 3AAVA 1IQIA 5EXLA 1EPTB 3S7KB 3ATKA 1XKBC 1T7CA 2G55A 4RT1A 1BDAA 3AASA 1O5CB 1V2JT 2P8OC 4I33A 2ZFTA 1ZOMA 1GI3A 1YYY1 3QX5H 2KFWA 1ZSJA 1L0ZA 2QIQA 1BA8B 2IN2A 1QL7A 2ILNA 3FP8E 3BTME 4ABIA 3HGPA 2G5VA 2D26C 1C4Y2 3ZVEA 3U8RH 5HKKD 1E1QD 2WV4A 4Y71A 3EGKH 1SQTA 2ZWLH 1FN6A 2O8WA 1EJAA 1V2LT 2ODYB 2SFAA 1MTVA 1D3DB 1V2ST 1XKAC 2Z9LA 1GWAA 1OWEA 3MU5A 1EAUA 5CDFE 2ZDLA 1SGFA 5HIYA 2W5EA 1C2EA 2FPZA 2F9BH 2ZIQH 4D7FA 4I8JA 3D49H 2NU2E 3K2UA 1O3MA 1LDTT 1BMLA 1ELVA 4MVNA 4AFSA 3SZNA 3S9CA 2RG3A 4X6PA 1VITF 1QL8A 1SVPA 1RD3B 1TA6A 4AFUA 4GLYA 4B6EA 3AW1A 3LC3A 1G3BA 1C2JA 1AE5A 1S84A 3RC5A 1L1NA 7ESTE 1C1PA 1ZRBA 2LP6A 3PO1C 1QURH 1GBTA 1NS3A 2KAIB 1FZZA 1ETSH 3TNSA 1LVOA 1J9CH 2DUCA 1EZSC 1O5AB 4K3JA 3NK8A 1D3PB 1C1SA 2FOFA 4Y7BA 4B1TA 4CRBA 1O2PA 3W94A 1SGRE 3LOXA 2ZU5A 2F43B 1G2MA 4RKOB 2W3IA 3VEQB 3N7EA 4WF8A 1O2QA 1G32B 5AFZH 4YOJA 3KQCA 2L74A 3B9FH 1C1MA 1MKWH 3STJA 3LPRA 1PPGE 3BIVH 1H9IE 2HOBA 1D6RA 4Q2KA 5BRRE 2A7JA 1EB1H 1AO5A 1GHZA 4BAOB 3E90B 4JYUH 2OC1A 2BX4A 1CGJE 1FAKH 2JIZD 3R0FA 1FONA 3KF2A 2AH4X 2XBVA 4IMZA 4CREA 1BRCE 1RJXB 5DP9A 1JOUB 1FV9A 1HAOH 1BBRH 4YT7H 2A5KA 1O5BB 1HAZB 2WPKS 1VITG 3ZZ5A 9ESTA 3LU9B 5HYOA 1J15A 1L4DA 4AOQA 2BY8X 3PTNA 4XBBA 3HGNA 5DJ7A 3ODDA 5LPFA 3MO6A 1O3CA 3JZ1B 5LH8A 6LPRA 5EPNA 1TLDA 4OM9A 1P2MA 5ESBA 3SW2B 2BXTH 4VGCB 2BDYA 1HUTH 1TA2A 2A2XH 2FXRA 3F3BA 4D9RA 2XCFA 3BIUH 1SBWA 1TBQH 3SQHE 4U2WA 1Q2WA 5AFYH 1A4WH 2Q6FA 3G01A 2I6SA 3LH3A 3TH3H 3GCOA 3P8NA 2XBWA 2Z94A 1IQLA 4RSPA 3OU0A 1UK3A 1TNHA 3VGCC 1ELTA 1CHGA 4DT7B 4VGCC 1GPZA 1C5PA 3TNTA 2IJD1 1N8OC 1MMJN 1XXDA 4AYVB 2GDEH 2TBSA 2OQUA 1HXFH 4Z1MD 1Z1IA 4FU7A 1OWHA 1QQUA 1UVUH 1BRUP 3RXSA 1TIOA 1HAXB 1ARCA 4TT3D 2AGIX 2EEKA 3LIWA 3Q76A 4TPYA 2HNTC 1B0EA 2C8YB 1LKBA 1GBEA 4ABAA 3URDA 1P2KA 1M9UA 4KTSA 2ZECA 1WSSH 3PB1E 1O3KA 2KR7A 1P02A 4P00A 5BPEA 1DWDH 1NY22 1NESE 1OP8A 1YCPK 1O3EA 1YGCH 5DP5A 2EI8A 3MH4A 1O2SA 1QB1A 4GHTA 1SL3A 1V2KT 4CH2B 4KKDA 3SV6A 1P09A 1SLUB 2XXLA 5GIBA 2JH5D 5FXLA 5JBTA 2FWWA 2PP6A 3T5FH 5HXFA 3KQDA 4XBDA 1OWIA 1LHCH 1UTKA 1GBLA 1TNIA 1P05A 4X1NU 2VVCA 2G52A 1ELCA 1S0QA 3PLKA 4BAQB 1DY8A 1XUHA 3BTDE 3AK5A 1GMCG 1EZUC 4FUDA 2ANKH 2CMYA 3GY6A 2ZCLP 1O38A 1SOTA 4B73A 3RXBA 2TGAA 1QQ4A 1P2IA 4X8UH 1PYTC 2A5AA 1IQNA 1TNJA 5EG4A 3KGPA 3TJOA 2PHBA 2VIOA 3RP2A 1S81A 1BTUA 2IPHA 4F55A 3S7HB 5C5NA 2GVFA 3OYPA 2FS8A 2GV7A 2XNDD 2PSXA 4JZDH 1FY8E 1AKSA 1CU1A 1UK2A 1PQ7A 4NIYA 2ZU2A 1KMHB 2PKAB 1NN6A 1UHBA 1K21H 1NRNH 3GCHB 1L4ZA 3U9AH 3WY8A 1CVWH 1P12E 4NWKA 3BG8A 2ZP0H 4O97A 4I7YH 3PMAB 3F0PA 4DVAU 3T26A 1OWDA 5HM2A 3TH2H 5DP8A 4AZ2B 4CRFA 1MQ6A 3O8RA 3U8TH 1GHWH 4O3UA 5JBAS 1UVPA 7GCHF 1YF4A 3UREA 2GKVE 4A1TA 2BMGB 3SJ8A 5J4SA 1MQ5A 1XX9A 3RU4E 3ZZ9A 1RFNA 3RXHA 4LZ1H 3I77A 1O3PB 3LJOA 2H9HA 1EXFA 2VGCB 3EE7A 3GCHC 5E0HA 2H5DA 1ABIH 1DE7H 5JYIA 2QXGA 1TFXA 1DX5M 3RXVA 2OBOA 3A7ZA 4MPUA 2GT8A 1Y8TA 1TNLA 1Z8JB 4ZKNU 4FUFA 2AMQA 1J14A 3A83A 3KCGH 4XFQA 3MU8A 1FIZA 1EOLA 1YWUA 2JJ2D 4ISLA 1BRAA 4NFFA 4FUHA 1RXPA 1HIAA 3ELAH 1BHXF 1J17T 4DURA 4NA8A 3FZZA 2G00A 1DICA 5FX6A 4H4FA 1D3TB 3ZVBA 1S85A 1WU1A 4U30A 1GI5A 2ANWA 1F5KU 1GGDC 1QB9A 1G30B 1YP9A 4WY3A 1F0TA 4H6SB 4R0IA 1ZYOA 2WPHS 1IOEA 1C5UA 2VINA 3W95A 1KXBA 1W0KD 2FTMA 1GHAF 1GI0A 1TPAE 2KCPA 3E3TA 3N99A 5JB9S 1K1JA 2D1JA 3NXPA 3PM3A 2ULLA 3VB7A 2C4FH 7GCHG 1W8BH 4BANB 1PQ8A 3GS9A 4ZROA 2BD2A 1T4UH 1V2VT 2LPRA 1DDJA 4K60A 3SGBE 1SFIA 1BMNH 1INCA 2QGRA 3CS0A 4K1EA 4Y8YA 4ZH8A 5T6FA 1GDUA 1RGQA 1SMFE 1P2NA 4B2BA 2ZHQH 1GI4A 3RXOA 1HXEH 5A2MH 8GCHG 3LC5A 2P3FH 4CRGA 2F4LA 2ZHDA 3TK9A 4ISOA 1OP2A 5C1XA 1GMDF 1LPKB 1YLDA 2B8OH 5C1UA 2ZDNA 2Z9JA 1TMBH 3M35A 4OS1A 1BTZA 3MHWU 4Y10E 1ZTKA 1L1GA 6GCHF 5L30H 3RLYH 4E05H 2A7HA 4NIXA 2J9NA 2KM0A 1NTPA 1QCPA 2A45B 5A0CA 1H9LB 2BYAX 4BNRA 3URCA 2WYJA 1LHEH 2FX4A 3RXDA 3H7TA 3STIA 4SGBE 5FPSA 3Q3YA 3MH5A 5IYTA 2ZFQH 1NU9A 2UUKB 4K2YA 5F6MA 3UNSA 1W0JD 2YMSC 3LJJA 2KCYA 2H5CA 2VIPA 1KXFA 3A88A 1QFKH 3BTWE 1KTSB 1JRTA 1GHAG 2TPIZ 2F9VA 1CT4E 3M5MA 1IQJA 3DSPA 1S82A 3U1JB 4OGXA 5EU8A 3PLPA 2WSSD 2GMTB 1C9TA 1BTHH 2TRMA 1SQAA 3SUDA 5EJLA 2PKSB 1ZSLA 2FM2A 4ZKRU 5JDUB 2BVRH 1Y5AT 8LPRA 3GY2A 1F92A 1E35B 1LVMA 3EYDA 3T27A 1T32A 3VXEH 5B6OA 1OPHB 3SJKA 4CRDA 2QXHA 4INLA 3MH7A 1ZTLA 4ZHLU 3SBKA 4JZFH 4X2WA 5H4IB 3KQEA 4I8HA 1G36A 2HALA 1TPPA 3RXCA 1HNEE 2A4GA 5EQQA 5DP6A 1UTPA 4Y11E 1C1OA 5EQRA 1TE0A 4Y0YE 4H42U 6GCHG 1ELAA 2OLGA 1P03A 1O3BA 3A86A 2Q6GA 3RM0H 3SV2H 1VGCB 4Y7AA 3RXJA 2HWLB 3PTBA 1MTWA 1EZXC 1W13U 4FUCA 3VB4A 4K1TA 1HAVB 4JYVH 3GY4A 2SGFE 2EC9H 5FPTA 5FHTA 1F0UA 3T28A 1MKWK 2QA9E 3F2GA 2F9OA 1O5GH 5F03A 2NU3E 3A7VA 2ANYA 4BTTB 1LQDB 4CH8B 1ZHRA 1WV7H 1A1RA 1VGCC 4HZHA 5C20A 1O2TA 5A0AE 2L6OA 1N1LA 2HLDD 3FOAA 1C5RA 3VPKA 8KME2 4X8TH 2F3CE 5FPYA 1FY1A 1BBRK 1TQ7B 4AGJA 3U1IB 3UR9A 4WH8A 1MTNB 3SYJA 1O3GA 4MLFB 3WW7A 1H8ED 1C5NH 2SNVA 2GCHG 1A2CH 1V2MT 2QAAA 3B23B 2QC2A 1DVAH 4E06H 3ENSB 2P95A 1EB2A 1B7XB 1K2I1 4XD7D 3P92A 2ASUB 2HGTH 3O8CA 3UWIA 3BEUA 4MNWA 3TLOA 1BMMH 1FJSA 4WMFA 2Y6TA 1HLTH 2OC8A 1SGFG 1GJ5H 2CHAC 1NRQH 5GNDA 3OAAD 4YOIA 1FY3A 3ZZ4A 1MU6B 3BTKE 3PMJA 2ZCKP 3ZVCA 1ZRKA 1O31A 1K1PA 5AF9H 4WXIA 4X6MA 5FCRA 1TGNA 4FUJA 5HIZA 2PUQH 2BQWB 1IQKA 1EFRD 3UY9A 1A5IA 3ZVDA 2Z3DA 2W26A 4D76A 1A3BH 1WOFA 3ZVAA 4RI0A 3TU7H 2FOCA 1GBFA 3A81A 1GG6C 1FXYA 3BF6H 4ABDA 1ACBE 2Y82A 2YNBA 4AGKA 1ZPBA 3RXPA 2LNCA 2P8OB 1K28D 3RC6A 4MDSA 3SN8A 4LXBH 1ORFA 1OYTH 1NC6A 1ZHMA 1O35A 4MNVA 4XE4A 4UFFH 1MU8B 1BTWA 2JH6D 4I8LA 2A32A 4IC6A 1A7SA 4U32A 1BT7A 2O8UA 3SJOA 1ZLRA 2O9QA 1ETRH 2BDAA 4XBCA 1C2HA 2NWNA 3D65E 2F91A 1PPEE 1AI8H 1NRSH 5EODA 4YO9A 4ZXYH 3RXRA 1UTQA 3NZIA 4ZMAH 5EXMA 1ELGA 1SQRA 1XUIA 3V7TA 3M7TA 3A7WA 3MH6A 1FMGA 3D62A 2BOHB 2IOTA 2GZ9A 1CO7E 1GHYH 4ESTE 5CMXH 3A85A 1SHYA 3RXIA 1TMTH 3IITA 1WCZA 3F9FA 1GI6A 1UO6A 4THNH 2Z3CA 2Q6DA 1P10A 3LT3A 3M5LA 1TONA 1GCDA 2WPJS 2R2WU 1A61H 1O3OA 2VVVA 3E16B 1UVOA 1YCPM 3OEED 1RIWC 4DT4A 1MD7A 4WWYA 1O3JA 5KECA 3PO1B 1QNJA 1W7XH 4OS4A 5G4BA 2RCEA 5L2ZH 4ASUD 3S9AA 1C2IA 5EOKA 2FESH 2BLVA 2VB0A 2ZGBH 4KTUA 1KLIH 5K7RA 3SU3A 1GL1A 2KCAA 3F68H 2ALVA 1TNGA 1O30A 2H1UA 1NO9H 1P57B 1CQQA 3QUMP 3F9EA 1BCUH 1QBNA 1YPJH 3RC4A 1ELBA 1EUFA 1O33A 1WDIA 2H2ZA 2XC5A 3GY7A 3LGIA 4Z6AH 1JIMA 3Q00A 3MNCA 5A09A 1ELFA 1ELDE 2P59A 1UTLM 4ASHA 3GCNA 1BIOA 1ZPZA 5E2PA 1OXGA 1YLNA 1BJVA 1O0DH 1QA7A 1GJDB 1D4PB 2FOEA 3DT0H 3E0PB 1O39A 1MABB 2BLQA 2CXVA 4ABFA 1ARBA 2ZU3A 4NSVA 3QGNB 5EJ1A 5DKMA 5B6LA 1A46H 3QGJA 2SGDE 4FUEA 3ZZ3A 1P11E 1O34A 4MPWA 1BTXA 2Y7XA 4FOUC 2NU0E 4OS7A 2W7SA 2BQ6B 2B5TB 1GJ6A 5LGOA 4M7GA 3RXQA 4YZUA 1VCPA 1CA0C 4YOGA 1DFPA 1EJNA 4GAWA 2O8LA 2ZFSA 4Y0ZE 3SU4A 4J2YB 1WAYB 1TNKA 3R3GB 3ZIAD 2W6ID 3KQ5A 1NZQH 3GDSA 2BXUH 2FODA 1QRZA 2FOHA 4X6NA 4K5ZA 5FAHA 2ZPSA 1EP6A 1UVSH 2Z9IA 3ITIA 3S69A 4JK5A 3VGCB 3HKIB 3PMBB 4MPVA 1QY6A 4MTBA 1N8OB 5T3HA 2GD4B 2ZEBA 1AUJA 2J98A 2XCNA 3LH1A 3N7DA 4X6OA 2G4TA 4INKA 1TAWA 1U6QA 1HJ9A 1O2IA 2R3UA 4TWYA 1HJAB 1KTTB 2D2DA 2Z9KA 2FYQA 1Y3XA 1NRPH 1YPHC 2GGVB 2XWBI 1QGFA 4AB9A 1AZ8A 1BMAA 4E7NA 1QJ7B 1KYNA 1GMCF 1ZMLA 2KCOA 2VWOA 4IMQA 1YPLH 1BHXB 1ZJKA 1P04A 5EJZA 3PLBA 1HAYB 1RTFB 2PGQB 2SGEE 3TH4H 3S0NA 3W1EA 2BHGA 1IHTH 3CS7A 3P8OA 1Y5UT 1ESTA 1NBMD 1AB9C 3DFLA 1THRH 2OINA 1W3CA 2CN0H 1XM1A 5EXNA 1G3CA 1HJAC 2ZGCA 3PWBA 4ISIH 1UTNA 1SG8B 2AMPA 2VWLA 2GZ7A 3H7OA 3RM2H 1HYLA 3VG8A 3RXUA 1ID5H 4FVBA 1PQAA 2ZG0H 1CT0E 4O03A 1LO6A 1Y3VA 3KYFA 4AX9H 2OUAA 5EW1H 3HPTB 4ZHMU 5FL7D 3EA7A 1PPCE 1SOZA 2Y5HA 1VCQA 2VH6A 2VVUA 3MFJA 4HTCH 2P3UB 5LPEA 1CE5A 1YKTA 1IQMA 3ATMA 2BD8A 3Q77A 2BDBA 4OS2A 2P93A 3PV4A 3L33A 1AFEH 4DG4A 1SR5C 3TIUA 3VFEA 1W0ZU 3ZV9A 2WV9A 1UCYK 3KEEA 1C5SA 1CHOF 1O2JA 2HLCA 1RS0A 3FN8A 1GCTB 1D9IA 4R8TB 1AU8A 2EI6A 2HVXA 1O2YA 5A8ZA 1ANCA 2NU1E 2ZI2H 2K1QA 3UNQA 5FCKA 4F48B 2EY4C 1HAIH 3AVZA 3SGQE 1XUJA 5T1VA 3VXFH 8ESTE 1O3DA 4A92A 2F83A 5C0UA 1P3EA 3ZZ6A 2SGPE 2J38A 2TGDA 3DCLA 4JZ1A 3F9HA 3SUEA 1AY6H 1EATA 2BZAA 6CHAC 1GCTC 1SC8U 2C8WB 2FO9A 3OFND 1SGTA 4AC9A 2H9TH 4UEHH 1AVWA 1ZJDA 5FX5A 4PROA 3SU5A 1QTFA 1KIGH 1AUTC 2SGQE 2K0QA 3QTVH 2QXJA 1KXEA 1KDQB 1BB0B 3TVJB 2F9PA 2FOGA 1GBKA 2V0BA 2VIVA 1UW7A 5GDSH 4O9VA 3MI4A 1O3AA 5DSFA 2I6QA 3IG6B 3VB6A 1E0FD 3ODFA 5IDKA 4YXWD 4JZEH 1TALA 1X7AC 4IN2A 1O2MA 4JZIA 1CHOG 3SU1A 1A3EH 4AFQA 4K8YA 2LELA 5TJXA 5C67A 1WBGB 1GVZA 2FOBA 4I32A 8GCHF 2AIQA 3MTYA 4ACBA 1QL9A 2C93B 1SGEE 1RTKA 2YOLA 2ZTYA 2AYWA 5L6NH 3A7YA 2ZA5A 1YY3A 2RDEA 1GGDB 1K1OA 2J94A 4Q7YA 1VITH 1Q31A 1ZTJA 4WH6A 1DWEH 3SI3H 5E8EH 3E6PH 4FUBA 1HBTH 3BEIB 1TX7A 4IC5A 5DN6D 1SPJA 2TGTA 2FYRA 1E34B 3H5CB 5E2OA 2ZO3H 3ZVFA 1P01A 4OGYA 1BMFD 1EPTA 1KXAA 1Y59T 3DSOA 3Q3KA 4B75A 1S5SA 1UTJA 3FVFB 4RKJB 1EP5A 1SLVB 5F8XA 1DWCH 1WYKA 1PYTD 1XUGA 2K8IA 3SO3A 1MKXK 5E0JA 1OOKB 1NU7B 4UE7H 4FVDA 1GDNA 1UVTH 2TIOA 3RDZA 3V12A 1O3HA 1CSOE 2V6NA 2ZCHP 2CF9H 1G2LA 1J16A 2XC4A 1PFXC 1PQ5A 3PRBA 4AFZA 4TWWA 4UD9H 3OTJE 1TBRH 3F9GA 1O2NA 1C5ZB 1OWKA 1GBCA 3M5OA 1GHXH 3DA9B 1DLEA 2ZGJA 1NPMA 1FUJA 2YMSB 1AN1E 2AS9A 3OTPA 2WPDD 2BD5A 3CP7A 1FPHH 1O2WA 3TITA 1W7GH 1JIRA 2ZDKA 1DWBH 2A2QH 1PPFE 5LPRA 3BTFE 1SLWB 5C5OA 4XOJA 3SNDA 1QA0A 2BY6X 4ABJA 2OTVA 1YLCA 4WMEA 3B8JA 4BXSA 4Y8ZA 2VWNA 1WXRA 3BTGE 2ESTE 1LKAA 3RXFA 3TGJE 5J4QA 3RXGA 1GI8B 3FFGA 3GYLB 4QT8C 2XRCA 2KAIA 2BVXH 1NFXA 1JMOH 1UTMA 5DP3A 3QDZB 5CE1A 2C8XB 1QB6A 3A8AA 2EI7A 1E36B 1S6HA 4NZQA 2JDID 1E1RD 1UCYH 2ZU1A 3ZZDA 1JWTA 3GISB 1GJ4H 3P17H 1WQVH 4E7RG 1K1IA 1DS2E 2PGBB 1GVLA 3JZ2B 1F0SA 3SUGA 2ZGHA 4ABBA 3CENA 3KN2A 3FAOA 3ATIA 2GCTC 2Z3EA 1H9HE 4ZXXH 2GCHF 4RT0A 1SGNE 1YC0A 1G3DA 1VJ9U 3UTUH 3RXAA 2F9UA 1HAGE 5KEDA 2OC7A 1O3LA 1K1LA 2QF5A 4ABEA 2Q1JA 2R0LA 3RXMA 4NIWA 1KY9A 4U01A 2V35A 1PPZA 2BY7X 4MQAA 2F9NA 3GDVA 5JBCS 4NZLA 1KLJH 3LGTA 2ZKSA 4X8SH 1ZZZA 4B2AA 1YM0A 1PPHE 3A7XA 3ZYEA 1DXWA 3OY5U 1T8OA 2UUFB 1O2RA 1GJCB 1UJ1A 3SU2A 1DSUA 3M7UA 2SGAA 1GBBA 3SJIA 3A7TA 1DXPA 7LPRA 1QBOA 1P9SA 2GV6A 1OX1A 3C27B 2GTBA 3P6ZB 1YPKH 4CRCA 1YPHE 2ZDMA 2A31A 4CHAB 1AHTH 3MO3A 1DANH 1V2OT 1S6FA 2OP9A 1C5YB 1GJAB 2CHAB 2OCVB 5SGAE 1OP0A 1ZGIA 4X1PU 1IQHA 3RMOH 3NCLA 4LZ4B 5HMAA 1FY4A 1O5EH 2FI3E 2PV9B 1EKBB 1G37A 1RRKA 1SSXA 4UONA 3UUZA 3RMMH 2ZHEH 1P2OA 1QIXB 1GJ9B 1GG6B 4XRNA 4MNYA 4CHAC 4DOQA 1MUEB 1BZXE 2WZQA 4Q7ZA 1HRTH 3SNAA 3F2FA 1AKSB 1LTOA 2AGGX 2PTCE 2BTCE 2BQ7B 1QR3E 2XWAA 3FKSD 1NFWA 2WPMS 3EA8A 1Z6EA 1KXCA 3F6UH 1A0JA 1UHBB
chains in the Genus database with same CATH topology
1TX8A 1K22H 2Z9GA 3VB3A 5A8XA 3SI4H 1QJ1B 4DCDA 4D9QA 1SFQB 3HK6B 1CGIE 1A0LA 3KL6A 4X8VH 1V2QT 1F7ZA 5HM9A 3BN9A 1FIWA 2A0QB 1MKXH 2BDCA 3GY8A 1SGDE 3O8BA 4Y6DA 1V2TT 1KSNA 5AVDA 2GDDA 5JBBS 5GWZA 2OQ5A 2VIWA 2PLXA 1EAXA 1ZGVA 3MWIU 1T4VH 1AD8H 1JXPA 3N7OA 1P06A 4ABHA 1EX3A 4ISNA 3BV9B 3SNCA 1LHGH 2NU4E 2THFB 2XW9A 1FAXA 4IN1A 5GPIB 1GJ8B 2EA3A 2O8TA 1C5VA 1O2OA 3QK1A 3OSYA 2Z7FE 1YPEH 1C2KA 1MD8A 5TCAA 3T62A 2XTTB 5E0GA 1HIAB 4CBNA 1RIWB 1ZR0A 5A8YA 3SQEE 3HK3B 3FZDA 3ZZAA 3DUXH 3V3MA 1MZDA 5DO4H 3DFJA 3GCTG 2PKAA 2ZFFH 3U98H 1SI5H 1AE8H 3I29A 2OC0A 3UNRA 3MMGA 2A5IA 3SNBA 2BD4A 1GJ7B 5FBEA 3MYWA 4X0WU 2Y81A 4DIIH 1SHHB 2VNTA 2BDGA 3M37A 2BDHA 3NUMA 1JRSA 3SOSA 1Z8IB 4INHA 5EPYA 3K9XB 3NKKA 3BG4B 3GDUA 1OKXA 1UTOA 2JH0D 2AGEX 1ZMNA 4HFPB 2UWOA 1O3NA 3SV9A 1GI9B 1GBJA 1J8AA 1XVMA 7KMEH 1EPTC 1HJ8A 1MTSA 2BVSH 2YNAA 2CGAA 3UQVA 3M3TA 5EQSA 3RU4D 4I8KA 3V0XA 2WPLS 1RTLA 3MU4A 1TOCB 1GBAA 2UWLA 4CRAA 4B2CA 1TGTA 3BG4C 3T2NA 3P8GA 3BSQA 4NIVA 1OYQA 1TX6A 2DE9A 4UDWH 3E8LA 3TK6A 3ZZCA 2BLOA 2H9EH 2TGPZ 5HGGA 4X2VA 5T6DA 2BDIA 2VIQA 1L2EA 1TPSA 2ZZUH 4ZKOU 1NM6A 1MBMA 1SLXB 1DLKB 1NT1A 3P95A 1VJAU 1VZQH 1CA0B 2JETB 1IQFA 2ZTXA 3LGWA 4DJZB 2WPIS 1DM4B 1EASA 1F5LA 3QZQA 2J4IA 1ANEA 1LCYA 2ZC9H 4KP0A 4F49A 3RUOA 2A1DB 3KQBA 2G8TA 1ZSKA 1DPOA 2RA0A 2UUYA 1GHVH 1V6DA 1G9IE 2A7CA 3M3VA 4WVPE 1BBRE 1N6YA 1Q3XA 2J2UA 4MPXA 2WINI 4GVUA 2JETC 1HPGA 1JBUH 1P0SH 2H6MA 2QY0B 1DSTA 4BAHB 1TWXB 3ZZ7A 1OSSA 3TJNA 1BTYA 3A80A 2PSYA 3E91A 1FN8A 4FUGA 5I25A 3GOVB 2OBQA 2STAE 3L6PA 3Q3XA 4TY7A 2Y80A 1TGSZ 3PWCA 4NA9H 1GBHA 3SNEA 2PR3A 1THSH 3BEFB 4KTCA 3UQOA 3TJVA 4A6LA 1C1NA 1GBDA 1TGBA 3A82A 1B5GH 1Z71A 1MH0A 1Y3YA 4F4OC 1FDPA 1CGHA 1C5MD 1BITA 2IJOB 2PWXA 2M5TA 3SGAE 1AB9B 1BUIA 1C2FA 3K65B 1C5XB 1HDTH 1DY9A 1LHDH 4HI3A 4I31A 2R0KA 3MU0A 2RA3A 1O2KA 2ZGXH 5F8ZA 1MAXA 1C2LA 2XC0A 2XNIA 2PW8H 1NFYA 4GUXA 1GI7B 4B76A 2G51A 3RXKA 2P16A 4GHQA 1O3IA 2ZDVH 2ZQ1A 1P2QA 1AVXA 3M3SA 4O3TA 1W0YH 1Z8RA 3D23A 1Z7KA 1K9OE 3QZRA 1Z8GA 1K1MA 4JYTA 1AQ7A 4SGAE 3SJ9A 4X1RU 4ZAEA 2D8WA 3TGIE 1NFUA 1ZMJA 2CV3A 3ZV8A 1O2ZA 3EA9A 4BAMB 1C1QA 1E37B 1EAWA 2C90B 2W3KA 1GHBF 3QLPH 1AZZA 1WQSA 1DUEA 4YESB 1C9PA 5I46H 3T29A 2BY9X 4I8GA 1THPB 2AEIH 1L1JA 4DIHH 4CR9A 3FP6E 2FS9A 5EGMA 2BZ6H 2ZTZA 3RLWH 1GDQA 1HAVA 1QJ6B 2JKHA 4ZKSU 2PFEA 4CBOA 1VR1H 2UUJB 4YLQH 1ABJH 6CHAB 1QRXA 2A4QA 2VU8E 3SU0A 1WUNH 2FI5E 1T8LA 4K1SA 2FP7B 3OX7U 1EZQA 3PROA 2XBXA 1ZPCA 4NGAH 3TJUA 4IGDA 4JK6A 4H6TA 2ZDAH 2OXSA 5DG6A 4TYDA 4HGCA 1OS8A 1P3CA 2GP9B 4NWLA 4TPIZ 1F2SE 4MG3A 2ANMH 1TMUH 2AFQB 3MNBA 1W10U 5GCHF 1ESBA 3M61U 2B9LA 1D6WA 3BTQE 3TK5A 2ZFRH 4D8NA 2VWMA 1ANBA 1GHBG 1UMAH 5ETXA 3A84A 1T31A 2J34A 4KELA 1CBWB 3UIRA 1FNIA 1P2JA 2QYIA 1SGYE 1C1RA 2V3OH 2CF8H 3C1KA 4JMYA 3SV7A 2ZNKH 1F5RA 3HATH 1HAHH 3S9BA 4ZHAA 1TRMA 4IS5A 2QF3A 1C1TA 3A8CA 4XSKU 2BM2A 3ESTA 3MU1A 4GCHF 3ZZ8A 4CR5A 2BLWA 3I78A 1DT2A 1QRWA 2R3YA 4BAKB 2FDAA 1LPZB 2P3TB 3QWCH 1S0RA 5F8TA 1Z6JH 2G81E 1TRYA 2G5NA 2ODQA 4GPGA 5L2YH 1HFDA 1FI8A 1CBWC 1TRNA 3A8BA 1S83A 2ZHFH 2HPPH 4DW2U 4AB8A 1MCTA 3UWJH 5ESTE 1VCWA 2FZZA 1EOJA 2FLBH 1DOJA 1O36A 2Y7ZA 3LGVA 5DK1A 3QO6A 2C3SA 4FUIA 1C2GA 3RXEA 2BX3A 4NFEA 1LQEA 2BD7A 4AG1A 2HPQH 1K1NA 5DP4A 2ZF0H 1SGQE 5GCHG 1SGPE 5A0BA 2WYGA 2XYAA 4NSYA 1FY5A 2GX4A 3EE0B 3ATWA 1IQEA 2HNTF 2C8ZB 1ELEE 3K6ZA 3LGYA 2XBYA 3NPSA 1TABE 1C1UH 5AHGH 1GI2A 2Y5GA 4DY7B 1V2RT 3LKWA 4LK4A 3LGUA 1GBIA 4Q7XA 4IBLH 1Y3WA 1O3FA 1H4WA 2VGCC 3SV8A 1O2UA 2FLRH 4J1YA 1V3XA 4GCHG 3M36A 1EJMA 4KGAA 3QTOH 1PPBH 2FX6A 1LVBA 3KIDU 1W14U 1A0HB 1LVYA 1Y5BT 3EDXB 3AW0A 4NCYA 1HV7A 5GJ4B 1AVGH 1YPGH 3T25A 3LDXH 3P70B 5TCCA 3GY3A 1A5GH 2FOAA 1FPCH 1Z1JA 1FLEE 4OS6A 2AMDA 1H8DH 3NWUA 1DUAA 3P8FA 3OY6U 5JB8S 4NG9H 2GZ8A 2ZHWH 3FP7E 4B71A 4UFDH 1O5FH 4YT6H 2FEQH 4AYYB 1V2WT 1W11U 4UFGH 3U69H 2DE8A 2R9PA 1NROH 5DGJA 2RDLA 3M7QA 2VIDA 5DPAA 1GJBB 3O8DA 3PMHB 3KNXA 1T8MA 2B7DH 4WXVA 5FBIA 2AERH 1SGIB 1EAIA 4UFEH 4FXGH 1V2PT 1GVKB 1BQYA 1O2GH 3F1SB 1UCYE 2PTNA 2ODPA 1HCGA 1O2XA 2GCTB 3RXLA 4MNXA 3VB5A 2BD9A 1SQOA 1YBWA 6ESTA 4A1VA 1AMHA 1NRRH 2QCYA 2STBE 1C2MA 4Q80A 2HRVA 1MAYA 1IQGA 3GY5A 1P8VC 3A89A 3PYHA 1HAPH 1XUKA 4Z0KA 1F0RA 4Y76A 4GSOA 5PTPA 1TGCA 1AWFH 3HKJB 1O32A 1OWJA 1XXFA 2B0FA 3M5NA 3MNSA 2Z6BD 1XUFA 1YCPH 2V3HH 3ZYDA 3MOCA 1D3QB 1IHSH 1HGTH 3UOPA 1E38B 2WUBA 4BOHA 5ABWA 1KLTA 4Y79A 4IW4E 1GMHF 1C5LH 5CHAB 3SHAH 1TYNA 1CA8B 3DHKH 3UOUA 1DITH 3EQ0H 3ZVGA 2J95A 4X1SU 1W2KH 1C2DA 3SUFA 3SORA 3E1XB 1WTGH 1H1BA 2VJ1A 1V2NT 1CT2E 1TQ0B 4WJG2 1GMDG 2ZQ2A 1O5DH 1QBVH 2R2MB 2GMTC 4K8BA 2PUXB 1O2LA 2PKSC 1B0FA 3UFAA 3V13A 1C5OH 4YLUA 3QN7A 5CHAC 4X2YA 1YPMH 2OD3B 2WUCA 2CJIA 1TOMH 1AIXH 1TPOA 4NA7A 3SU6A 1KXDA 1C1WH 3BTHE 1ETTH 1FQ3A 2ALPA 4X2XA 1LPGB 2FOMB 5C1YA 5EW2H 3TPIZ 1N6XA 5C3NA 1PJPA 2QF0A 3EAJA 2BY5X 3ZZBA 1GI1A 1AGJA 5GXPA 1G3EA 1AFQB 4Y8XA 2W7UA 1LMWB 4RN6A 3U8OH 2GT7A 1HB0B 1MBQA 5C2ZA 2FI4E 1QHRB 4BTUB 3RXTA 1GMHG 3BTTE 2UWPA 3RU4T 1C5QA 3GICB 4BTIB 3E0NB 2ZPQA 2ZPRA 1GBMA 1LHFH 4B74A 1ZHPA 4ISHH 4A1XA 4YM9A 2Y5FA 2SNWA 2ZU4A 4ZUHA 4WMDA 1C1VH 1O2VA 1BJUA 1ANDA 1BTPA 1EQ9A 3GCTF 1UK4A 2A4OA 4XDEA 4YTAA 4TY6A 4LOYH 4A5TS 1AFQC 5JPMH 4JCNA 2QXIA 3LONA 2HNTE 3UR6A 3KHVA 2WV5A 3AAUA 1C4U2 5T6GA 2P94A 2FIRH 1MCVA 1AWHB 2O8MA 3RMNH 1MTNC 1W12U 1O2HA 3SHCH 2FTLE 4BXWA 1XMNB 1ESAA 1O37A 5DP7A 2BD3A 3IWMA 1XVOA 1Y3UA 2J92A 4X1QU 3MNXA 1BOQA 1WTHD 2BB4A 3L3TA 4K69A 3DD2H 1C5WB 1MTUA 2BOKA 2G4UA 1V2UT 2QV1A 3GYMA 4A7IB 2ZFPH 3K6YA 1A5HA 1TBZH 2A4RA 4DGJA 1GL0E 1BRBE 1H8IH 3A87A 4FU8A 1P9UA 2VH0A 4D7GA 1MZAA 4AG2A 2AIPA 4AORA 1TB6H 3A8DA 3ATLA 3UPEA 4OS5A 3RMLH 5K0HA 2QN5T 4FU9A 1SB1H 3BTEE 4ABGA 3FANA 4AN7A 9LPRA 3MO9A 1C4V2 1SGCA 1IAUA 1T8NA 3TGKE 2FMJA 1KDQA 1C5TA 3AAVA 1IQIA 5EXLA 1EPTB 3S7KB 3ATKA 1XKBC 1T7CA 2G55A 1BDAA 3AASA 1O5CB 1V2JT 2P8OC 4I33A 2ZFTA 1ZOMA 1GI3A 1YYY1 3QX5H 1ZSJA 1L0ZA 2QIQA 1BA8B 2IN2A 1QL7A 2ILNA 3FP8E 3BTME 4ABIA 3HGPA 2G5VA 2D26C 1C4Y2 3ZVEA 3U8RH 2WV4A 4Y71A 3EGKH 1SQTA 2ZWLH 1FN6A 2O8WA 1EJAA 1V2LT 2ODYB 2SFAA 1MTVA 1D3DB 1V2ST 1XKAC 2Z9LA 1GWAA 1OWEA 3MU5A 1EAUA 2ZDLA 1SGFA 2W5EA 1C2EA 2FPZA 2F9BH 2ZIQH 4D7FA 4I8JA 3D49H 2NU2E 3K2UA 1O3MA 1LDTT 1BMLA 1ELVA 4MVNA 4AFSA 3SZNA 3S9CA 2RG3A 4X6PA 1VITF 1QL8A 1SVPA 1RD3B 1TA6A 4AFUA 4GLYA 3AW1A 3LC3A 1G3BA 1C2JA 1AE5A 1S84A 3RC5A 1L1NA 7ESTE 1C1PA 1ZRBA 3PO1C 1QURH 1GBTA 1NS3A 2KAIB 1FZZA 1ETSH 3TNSA 1LVOA 1J9CH 2DUCA 1EZSC 1O5AB 4K3JA 3NK8A 1D3PB 1C1SA 2FOFA 4Y7BA 4B1TA 4CRBA 1O2PA 3W94A 1SGRE 3LOXA 2ZU5A 4RKOB 1G2MA 2W3IA 3VEQB 4WF8A 1O2QA 1G32B 5AFZH 4YOJA 3KQCA 3B9FH 1C1MA 1MKWH 3STJA 3LPRA 1PPGE 3BIVH 1H9IE 2HOBA 1D6RA 4Q2KA 5BRRE 2A7JA 1EB1H 1AO5A 1GHZA 4BAOB 3E90B 4JYUH 2OC1A 2BX4A 1CGJE 1FAKH 3R0FA 1FONA 3KF2A 2AH4X 2XBVA 4IMZA 4CREA 1BRCE 1RJXB 5DP9A 1JOUB 1FV9A 1HAOH 1BBRH 4YT7H 2A5KA 1O5BB 1HAZB 2WPKS 1VITG 3ZZ5A 9ESTA 3LU9B 5HYOA 1J15A 1L4DA 4AOQA 2BY8X 3PTNA 4XBBA 3HGNA 5DJ7A 3ODDA 5LPFA 3MO6A 1O3CA 3JZ1B 5LH8A 6LPRA 5EPNA 1TLDA 1P2MA 5ESBA 3SW2B 2BXTH 4VGCB 2BDYA 1HUTH 1TA2A 2A2XH 2FXRA 4D9RA 2XCFA 3BIUH 1SBWA 1TBQH 3SQHE 4U2WA 1Q2WA 5AFYH 1A4WH 2Q6FA 3G01A 2I6SA 3LH3A 3TH3H 3GCOA 3P8NA 2XBWA 2Z94A 1IQLA 4RSPA 3OU0A 1UK3A 1TNHA 3VGCC 1ELTA 1CHGA 4DT7B 4VGCC 1GPZA 1C5PA 3TNTA 1N8OC 1MMJN 1XXDA 4AYVB 2GDEH 2TBSA 2OQUA 1HXFH 1Z1IA 4FU7A 1OWHA 1QQUA 1UVUH 1BRUP 3RXSA 1TIOA 1HAXB 1ARCA 2AGIX 2EEKA 3LIWA 3Q76A 4TPYA 2HNTC 1B0EA 2C8YB 1LKBA 1GBEA 4ABAA 3URDA 1P2KA 1M9UA 4KTSA 2ZECA 1WSSH 3PB1E 1O3KA 1P02A 5BPEA 1DWDH 1NY22 1NESE 1OP8A 1YCPK 1O3EA 1YGCH 5DP5A 2EI8A 3MH4A 1O2SA 1QB1A 4GHTA 1SL3A 1V2KT 4CH2B 4KKDA 3SV6A 1P09A 1SLUB 2XXLA 5GIBA 2JH5D 5FXLA 5JBTA 2FWWA 3T5FH 5HXFA 3KQDA 4XBDA 1OWIA 1LHCH 1UTKA 1GBLA 1TNIA 1P05A 4X1NU 2VVCA 2G52A 1ELCA 1S0QA 3PLKA 4BAQB 1DY8A 1XUHA 3BTDE 1GMCG 1EZUC 4FUDA 2ANKH 2CMYA 3GY6A 2ZCLP 1O38A 1SOTA 4B73A 3RXBA 2TGAA 1QQ4A 1P2IA