1GCDA

Refined crystal structure of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
237
Chain Sequence
CGVPAIQPVLIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYNTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structures of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(serine proteinase)
molecule keywords GAMMA-CHYMOTRYPSIN
total genus 50
structure length 237
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1994-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gcdA01
5DP9A 3BSQA 1KXEA 3PYHA 1GJDB 2V3OH 2FI5E 2P8OC 2VH6A 5LPFA 3VB4A 1NT1A 4YO9A 2ZPQA 1G37A 2PLXA 2VIWA 1HAIH 2GV6A 2SGQE 3TK5A 1PYTC 4X8TH 3UQVA 4B74A 3UTUH 3TGKE 1AB9C 3SJOA 4INKA 3K2UA 1C5LH 1EPTB 1WTGH 3ATIA 3SUFA 2XBYA 4KGAA 1RD3B 4A1VA 3MHWU 1OXGA 1H1BA 1GDNA 4A7IB 6LPRA 1VCPA 3KHVA 5GPIB 1FPHH 1LDTT 1T4UH 3NPSA 4GHTA 3VB5A 2WYGA 3RXVA 1C2IA 1MKWK 2XC0A 1P09A 4NCYA 1LKBA 2F83A 2FOHA 2Y6TA 1P2IA 4JZ1A 1BMLA 2Z9GA 4VGCC 3RP2A 3GCHB 2BDHA 3BTHE 1AGJA 3GDVA 1BITA 1EUFA 3P8GA 6GCHG 2JH0D 3ZV8A 1XX9A 2BLVA 1FN8A 2O8WA 1SGCA 5SGAE 2H9TH 1SVPA 1NRQH 1H4WA 1CA8B 1HAHH 3GYLB 2ZF0H 1C2LA 2ZU5A 1HIAA 2EI7A 1O36A 2HVXA 3MO6A 3ZVGA 1HAVA 1O3CA 1EJMA 1GI1A 2HOBA 1Z7KA 1PPEE 3MH5A 3BV9B 4O3UA 1MBMA 5G4BA 1KDQA 1QURH 2BQ7B 3L33A 3AW0A 1EOJA 1DLKB 1DANH 2FESH 5H4IB 3RMMH 1TB6H 3M61U 1A5IA 2BY9X 3LOXA 5GIBA 1CT2E 4E7RG 5JB9S 1Y8TA 3A8CA 1V2WT 4CRBA 4B73A 4Q7YA 2RCEA 2J95A 1GJ4H 3RXUA 3UR6A 4DJZB 1CO7E 1W11U 4X6PA 1ZHMA 1TABE 3TIUA 1BMNH 3B8JA 4I8HA 1HAGE 1O3KA 3OSYA 3PROA 4NA8A 1VITH 3K65B 3LC3A 3M5LA 5CHAB 4IN1A 1HLTH 1ZR0A 2ZU3A 3ZZ7A 2G5NA 3SZNA 1THSH 2BY5X 1SPJA 1EP6A 4B71A 1YC0A 1CQQA 3HK3B 5DP5A 1ZHRA 3SI4H 1FN6A 2QGRA 1AE8H 8ESTE 2TGAA 2TGTA 1BTYA 1QJ7B 1D6RA 3B23B 2Z3DA 1MD8A 5LH8A 2H5CA 5GCHF 4AG2A 1ELVA 1FLEE 1EOLA 4YOIA 1XKBC 2R0LA 2V3HH 1FXYA 1FV9A 3EQ0H 1C1TA 2WPJS 1LHEH 2Q6DA 1OYQA 3MH7A 2DUCA 1HJAC 2P16A 4B76A 2A32A 1EB1H 4GAWA 2Y82A 4BAHB 3PWCA 2PUQH 4FUEA 4ABDA 1WQSA 3P95A 3LGTA 3ODDA 4B2BA 4TY6A 2GD4B 2NU3E 2XWAA 3V3MA 1KLTA 2AGEX 2BD5A 4RN6A 1ELEE 3SQHE 1TA6A 2Z3CA 1UTJA 2BDGA 2XBWA 4CHAC 2STBE 2BB4A 1OS8A 5GXPA 1MTVA 4X6MA 1ESBA 2I6SA 3BTME 3ESTA 1GMHF 1UTOA 5E8EH 5FXLA 3IWMA 1P3CA 4NA7A 1CHOG 2FOMB 4YESB 1GWAA 3GY8A 1TPAE 2FOAA 3RC5A 5FPYA 1KXCA 1EP5A 2FODA 2OUAA 2ZHWH 4XBDA 2Y5FA 1YPEH 2B0FA 1FI8A 2A2QH 5AVDA 3UY9A 4PROA 1NFYA 1W8BH 2BLQA 3A80A 5EXNA 4XSKU 3DFJA 4H4FA 4IBLH 2ALVA 1K1OA 1ZHPA 8GCHF 1BJVA 1UCYK 4DIHH 1EB2A 1GJAB 5HMAA 1K28D 3AAUA 5LPRA 1J14A 3FVFB 4H42U 1BTPA 1O3LA 4I8JA 1EX3A 3HGPA 4FUBA 1GPZA 2F9BH 4FVBA 1J16A 4OS6A 4K60A 1CHOF 1AZ8A 3W95A 3NCLA 5AF9H 3ZVAA 4ZKSU 2PGBB 4KTUA 2BMGB 2A5KA 1ANBA 2Y5GA 4K1SA 4X8UH 1D3PB 1YGCH 2D1JA 1HCGA 1BTXA 1E38B 2UUFB 1TLDA 2G00A 3LGIA 1DY8A 1AB9B 1GBJA 4MNXA 2J38A 2BDCA 4UFGH 4LK4A 2PV9B 1UMAH 1O5CB 2GDEH 4B1TA 4X1QU 1KY9A 1TWXB 4D9RA 5J4QA 2NU4E 4JZFH 3SUDA 1DITH 4CHAB 1NU9A 1WTHD 4GHQA 1GBDA 1ZJKA 1C2EA 5T3HA 4FU9A 5E0GA 2YOLA 2VWMA 1TNIA 1LVOA 1F2SE 3D65E 2QN5T 3KIDU 2PTCE 3BIVH 1O2LA 2ZDVH 2ZWLH 2QF3A 3UOUA 1TONA 3A89A 1C5WB 1FY4A 3ATKA 5DP6A 4AB8A 4GPGA 1RTKA 1WSSH 2ZCHP 5T6FA 1W10U 1UHBA 4DG4A 3S7HB 4YM9A 1LPKB 2FI4E 2W7UA 4TWYA 3A81A 2ZU1A 1P10A 1XVOA 1ZRKA 2GDDA 1O35A 1SBWA 1T8NA 1K2I1 2BOKA 1AY6H 3M5MA 1P2MA 1SLXB 3P92A 4THNH 4YTAA 2H9EH 3P6ZB 3SV6A 2D26C 3H7OA 1OP0A 1O2QA 2Z7FE 5FPSA 2GCHF 2OC7A 1O5DH 2A5AA 3RXKA 1GI8B 3GY6A 1TPPA 1YPKH 2WPKS 3SU2A 2BD9A 4IGDA 1BMMH 1KDQB 5ETXA 5JBCS 3S9AA 3HPTB 4NZLA 1HFDA 1NFWA 3EDXB 4X2WA 2CGAA 1A0HB 5C1UA 2C90B 3QLPH 2BQWB 3E6PH 2TRMA 1FNIA 2BQ6B 1GJ8B 3ZZ6A 5FBIA 2ZP0H 1NTPA 3D23A 4ABFA 2FS8A 3QTVH 3O8RA 1ELGA 1JWTA 3MYWA 1BBRH 1CE5A 3QTOH 1GCTC 1QTFA 1O5GH 3A7TA 2UWOA 1MKXK 1GI9B 4Y8ZA 1C1QA 3S7KB 4UONA 5E2OA 2ZKSA 5C20A 3OTJE 3A7ZA 2XC5A 1XUHA 3LGWA 2ZDAH 4ABEA 3MNCA 1MAYA 1WQVH 1F0TA 5FBEA 1MTWA 2AGGX 1GHVH 2XBXA 1C5VA 3E3TA 1OYTH 2Q6FA 1UK4A 2A4RA 3ELAH 1TMBH 3CENA 1W12U 4TPYA 3AASA 2AS9A 1SLWB 1XUKA 2QA9E 2GMTB 2WUBA 1V2MT 8LPRA 3E0NB 3MH6A 4LZ1H 4IW4E 1P06A 1UVSH 1HAPH 1AUTC 1AFQC 2ZFFH 3EYDA 5A8YA 7ESTE 2R0KA 1P03A 5C1XA 3ZVEA 1YPHE 1OWEA 1XXDA 3M3VA 1OP2A 1C2JA 5T6GA 2SGDE 4A1XA 3SN8A 2JETC 1NM6A 4WVPE 3RXHA 1HAZB 1TE0A 4R8TB 2BX3A 4BANB 2ZHFH 3KNXA 5L30H 4NIVA 3F6UH 4OS2A 1B0EA 4O03A 5E2PA 1L1NA 4BAOB 4Y7BA 1C1OA 1WCZA 4ZMAH 1ZPZA 1G3BA 3CS0A 1ELDE 3BTEE 3L3TA 3RXAA 3RXJA 1V2PT 2HNTE 1GI7B 1K1PA 1QQUA 1O2SA 1JXPA 1P2NA 1KXDA 4Q7XA 1GG6C 3RU4T 2ZGJA 1MH0A 1LHGH 1SGEE 5L6NH 4WMEA 3T26A 1S81A 2VWNA 1YPJH 3LC5A 1ESTA 2NU1E 3K6YA 1J9CH 3RXGA 4GLYA 1DM4B 1JRSA 1E37B 1FIZA 3DA9B 1K1LA 3SNDA 1TX7A 3QX5H 2C4FH 1K1NA 3O8DA 2LNCA 2ASUB 2ESTE 2RG3A 3BTTE 3CS7A 4Y76A 3RXBA 5FAHA 1SFIA 3F9HA 1TALA 1BDAA 2J34A 4YZUA 1LVBA 1XUJA 5DGJA 1O3OA 2CV3A 3DUXH 2G51A 1TNGA 2C8XB 1FY1A 3UR9A 5EXMA 1Q31A 1GJ9B 3ZZBA 1YLDA 2J9NA 3RMOH 1S0RA 1L2EA 2VJ1A 4CRFA 2UWLA 3TGIE 4Q2KA 2GMTC 1O2TA 2A1DB 3MMGA 3SW2B 4INHA 2YNBA 1B5GH 3TITA 1DXPA 1AFQB 4HTCH 3VXFH 1AN1E 2OBOA 2FX4A 4CBNA 2TPIZ 3RXPA 1IHSH 4IS5A 1ZSKA 3BEFB 7KMEH 2ZA5A 1H9IE 1SSXA 4K8YA 2IOTA 5GDSH 3BTKE 4A6LA 4WJG2 1KXAA 3RM2H 1P01A 1E36B 1X7AC 4NSYA 1UCYE 2NWNA 3R3GB 1P2KA 1KYNA 4D8NA 1HIAB 4Y79A 4CH2B 1Y5AT 2CMYA 1O32A 5C5NA 5I46H 1TBZH 2BX4A 1ZPCA 1Z8IB 1O2HA 3FZZA 2VIDA 1GG6B 2BXTH 2OINA 1TAWA 1RTLA 3T27A 1CSOE 1ELTA 1WYKA 5HGGA 1O3IA 2BXUH 3SV7A 1G30B 1W0ZU 3PO1C 5FCKA 1QGFA 2FP7B 2CF9H 1MUEB 2BHGA 3GCTF 1A0LA 2SGFE 4NIWA 3RXQA 4AOQA 2OLGA 1NO9H 2Y7XA 2C8ZB 3W94A 1NU7B 1C5OH 5E0JA 1LO6A 1J8AA 1SGPE 1HNEE 3TJUA 1QQ4A 1AVXA 3QN7A 4DIIH 1OWHA 1XM1A 2XNIA 1MTUA 1GCDA 3ZZ5A 1K1MA 2WPHS 2GCTC 2WUCA 3SU3A 3M5OA 3UQOA 4K5ZA 1QBOA 1WAYB 3KQDA 1IQKA 1QRXA 3FP8E 3MI4A 3C27B 3PV4A 2Z3EA 1DUEA 4AFZA 4K1EA 3MTYA 2XBVA 1MZAA 4NFFA 1D9IA 1SI5H 1GCTB 1P02A 1T31A 1W13U 4CRDA 5I25A 1TPOA 1BHXF 1GI2A 3STJA 5EW1H 4JK5A 2SFAA 4LOYH 1W7XH 3UOPA 1L4DA 2JH5D 1HAOH 3VPKA 1S5SA 1TX6A 2ANMH 2G55A 3OY6U 1SQOA 3SOSA 1NPMA 1AI8H 3IITA 4JK6A 4DY7B 3K9XB 4F49A 5J4SA 3KL6A 4ABGA 5L2YH 1OWJA 1GHXH 1UO6A 1O3AA 4LXBH 3ZZDA 4A5TS 2RA0A 1C5RA 1SGQE 1C1NA 1LKAA 2BOHB 2ZFSA 1Y5UT 1O5AB 4ZKOU 3F9EA 3M5NA 2P3FH 1O3EA 1A0JA 1TQ7B 2XCNA 1S85A 2F9VA 4AFQA 1U6QA 3GISB 2SNVA 1C1SA 3PB1E 1AD8H 2ALPA 3DFLA 2ZPSA 3RLWH 2HNTF 2BLWA 3MU4A 2J2UA 1W2KH 1FJSA 4K69A 4SGAE 5A0AE 2GT8A 1C5MD 3WY8A 3A88A 1IQHA 1O3MA 5EPNA 3VB3A 3VGCC 1C2GA 1LVMA 3S69A 4MLFB 4Z6AH 1O5BB 1NS3A 2D8WA 3RDZA 3UWJH 2ZCLP 4D7FA 2FLBH 2EI8A 1P3EA 1TNKA 4XOJA 1IAUA 1FIWA 1C1MA 2AEIH 2FOEA 1GJBB 3QUMP 2J92A 1ELAA 2P3TB 4Y8XA 2VGCC 1MU6B 2ZHEH 3BTFE 1EZXC 1OSSA 3T29A 1G3CA 2ZI2H 4E05H 2GCTB 1CT4E 5EW2H 4FUJA 1KLJH 3SI3H 4I8GA 1KSNA 4UFFH 4YLUA 1EZUC 4MPXA 1RS0A 2GX4A 1DS2E 2A7JA 2ZDNA 1THRH 1UTMA 3RU4E 1QBVH 1G2MA 1MCTA 4ISLA 3RXIA 2Z6BD 1DPOA 2P95A 1A2CH 1C5QA 1XUIA 4GUXA 4MPVA 1ZJDA 1YP9A 4AYVB 1BOQA 2VVUA 1G32B 1NY22 1HV7A 2BDYA 3QDZB 1SQAA 5LGOA 3FANA 4TYDA 3ZZ9A 5JBBS 2ZU4A 1J15A 5TJXA 1O34A 1ZGIA 2BM2A 3GY7A 3MNBA 1AWFH 2A4QA 3KQEA 4NZQA 3HGNA 1GGDB 1EASA 1D3DB 2H6MA 1QL8A 1Z6JH 3QGJA 3ZZ8A 2ZO3H 3TVJB 4ZHAA 1A61H 4Z0KA 4UEHH 1Z6EA 1ELFA 3MU0A 2ZQ1A 2TBSA 1PJPA 3SQEE 3M7QA 2Y80A 1CU1A 3U1JB 3A7VA 3LT3A 1THPB 1O38A 1YPLH 4X6OA 5DP3A 1BRCE 4GVUA 1LHDH 5A2MH 2VIPA 2ZEBA 1XKAC 3MH4A 1CVWH 3SHCH 2YNAA 2K1QA 1GBCA 1W0YH 1DSUA 1F92A 3U8TH 4FUDA 3UUZA 1HRTH 1LVYA 4KTSA 3B9FH 3VB7A 2ZCKP 1IQLA 1HAXB 4YOJA 1G36A 2ZG0H 2FTMA 1DFPA 1T7CA 1NRPH 2CHAC 1JBUH 4IMZA 1UJ1A 4Y10E 1C1VH 3SU5A 1WOFA 3GCOA 4I7YH 1MQ5A 3A8AA 4U30A 2OXSA 3TH4H 4IMQA 1O2JA 2ZPRA 1S82A 1DSTA 1YM0A 3JZ2B 1G2LA 1CT0E 1OX1A 1XXFA 1QA7A 1LMWB 1DLEA 4DOQA 2PSXA 1AWHB 4BAMB 2VIOA 3TJOA 3I29A 1KTSB 1EQ9A 1GBFA 3HK6B 1UK3A 1V2RT 3LPRA 3TU7H 3S0NA 2P8OB 3M7TA 1PPBH 1O2VA 1TNLA 3HKJB 1B7XB 3CP7A 3RM0H 4JZDH 3SUGA 1C5PA 1DOJA 4BTIB 4NA9H 5IDKA 1HB0B 5F03A 4TWWA 3F9FA 3M3SA 1V2ST 4CRAA 1TNHA 2ZDMA 3SGBE 4D76A 1JIMA 1EPTC 1KIGH 2IJOB 1C5XB 3FFGA 1O2RA 2RDLA 1IQNA 4I32A 1TGCA 1C1UH 3RXOA 3I77A 2QIQA 1SOZA 1C2MA 2CN0H 1P9UA 2PUXB 3PMHB 4F4OC 4JCNA 1C2FA 2AMQA 1RXPA 2GKVE 1IHTH 3OU0A 4Y0YE 3SGAE 2VVCA 2A7CA 5DO4H 1BHXB 3U9AH 1JRTA 4ISIH 1BT7A 3BG4B 4NWKA 4JZIA 3ENSB 4ZAEA 2G81E 3O8BA 1F7ZA 2QXGA 1QB6A 2Y81A 1GHWH 3GY5A 2ZTYA 1NRRH 1SGIB 2BDAA 2W7SA 1ETSH 1RTFB 2NU2E 1TFXA 3URDA 1OOKB 1GI6A 1NRSH 3A8DA 1PQAA 4CBOA 2C93B 3ZVCA 1QL7A 2WV4A 1UVUH 4ZHMU 4D7GA 3A82A 6ESTA 1MD7A 3MNSA 1LHCH 1TNJA 2QXIA 4TPIZ 2ZTZA 4ZXYH 4DT7B 2ZFRH 1SGDE 2ZGBH 2M5TA 5JBTA 4WXVA 3NZIA 3TK6A 1Z8JB 1YCPM 2G8TA 1SL3A 1IQGA 3GOVB 3T28A 1T8MA 3UWIA 3Q76A 2VWOA 3SV9A 1UVPA 8GCHG 1NZQH 4Y71A 5JB8S 1HXEH 1T4VH 5DK1A 2AMPA 3M3TA 3RC4A 1O3DA 4YLQH 1PQ8A 1K9OE 2D2DA 1O2OA 2CF8H 3TJNA 1ZTLA 2PKAB 1GHZA 2H1UA 5FPTA 3TGJE 3SBKA 5GWZA 4JMYA 3ZZAA 2XCFA 4AB9A 1O3PB 6CHAC 2Z9IA 3SJKA 4BTTB 1FY8E 3P70B 1GMHG 2ZU2A 5EQSA 2C8YB 3MU5A 1H9LB 4HFPB 1ETTH 3KQBA 2G5VA 2GVFA 4X1SU 2W3KA 2ULLA 3O8CA 2WYJA 4BNRA 3LH1A 2ZQ2A 4X2YA 2IPHA 3TNSA 1MTSA 4X1PU 1AIXH 2FIRH 3SNCA 2FMJA 4NWLA 1AU8A 2P59A 4X1NU 1IQMA 1RGQA 1A3EH 4XBCA 5ESBA 1BTZA 4ZKRU 4AGKA 1MAXA 1LQEA 1V2TT 4O9VA 3GCTG 3FP7E 1WBGB 2A4OA 1P8VC 2PW8H 5FCRA 1S84A 3OYPA 2QXHA 3RC6A 1JIRA 2FM2A 2I6QA 6GCHF 1FAXA 4BOHA 3ZYEA 1RJXB 1ZMJA 1TRYA 5HM9A 1RFNA 1YCPK 1SMFE 1H8IH 3A84A 5FHTA 1ARBA 1CGHA 3BTDE 3V13A 1A4WH 1P04A 1E35B 1TOCB 3RXSA 3TLOA 1GMCF 1SGRE 1O3HA 3E8LA 4GCHF 2BD7A 3SJ8A 1ARCA 2H9HA 4UFEH 1GHAG 1PFXC 1P0SH 4ESTE 1HXFH 1IQIA 2BVXH 3VB6A 4Y6DA 3MU1A 1HJ8A 1ZPBA 1ZTJA 1VR1H 1AHTH 4AX9H 2QV1A 1UTQA 1MKWH 2AYWA 1BTHH 4FU8A 4JYVH 1D4PB 2OQUA 5FX5A 6CHAB 4WF8A 4B75A 3VXEH 2QCYA 1TGBA 2H2ZA 1GBMA 3ATWA 2FDAA 1P2OA 3AVZA 1DWEH 4DURA 2O8TA 3FZDA 1DDJA 1P2QA 3SUEA 1XUFA 1O2YA 1TRNA 5C1YA 3P17H 3SU0A 2V35A 3Q77A 3EA7A 4NG9H 3QZRA 1V2KT 1PQ5A 1Z71A 2XW9A 4DCDA 2W3IA 1GBBA 1GMDF 1TBQH 2AMDA 5A0CA 2FS9A 5A0BA 3PMBB 2DE8A 3U8RH 1OKXA 1FQ3A 1ZYOA 3UNQA 1A5GH 1C1PA 2A5IA 3P8FA 4FUHA 1O30A 4GSOA 4SGBE 2LPRA 2BYAX 1VITG 1ZSJA 2PKSC 5JDUB 1MZDA 3MO3A 2V6NA 1YPHC 2ZECA 1SR5C 4UDWH 3G01A 1N8OC 5HXFA 1ZMNA 4NIYA 1O5FH 4Q80A 1OPHB 5A8ZA 2R2WU 1VJAU 3A8BA 1NN6A 3Q3KA 7GCHG 3F68H 2P93A 2OBQA 1UTKA 3C1KA 4AN7A 2XRCA 3V7TA 1HUTH 2GTBA 1BBRK 1YCPH 4IN2A 1GMDG 1BQYA 1TQ0B 3EAJA 4OS7A 1FDPA 1PQ7A 3H5CB 5AFZH 4I31A 1NRNH 2SNWA 5TCCA 4Y0ZE 1SGTA 5LPEA 1DICA 1GJ7B 3SNAA 1L1GA 1K22H 4K8BA 1YF4A 1ORFA 1EZSC 2HPQH 1YKTA 1SHHB 2C8WB 4CRGA 2BY7X 1G9IE 4WY3A 2BLOA 1AO5A 2HGTH 1GHBG 5AFYH 2XYAA 5B6OA 4RKOB 3OX7U 3F1SB 4KELA 5C67A 3Q00A 3HATH 1O3GA 3EGKH 1D3TB 1V6DA 1ANCA 1GBTA 2ZGHA 1O2XA 1TRMA 2EA3A 1ZZZA 2ZGXH 5K0HA 1EATA 1S6FA 1SFQB 1HJAB 3QK1A 2FLRH 1HYLA 1LPZB 1GHYH 2H5DA 4FUIA 1F5RA 1BMAA 3A87A 4X6NA 1FPCH 1MQ6A 5F8XA 5EXLA 2J4IA 4JYTA 2BD8A 4WMDA 5ESTE 2AIPA 1LQDB 1O2GH 3K6ZA 3BTGE 1SG8B 1N8OB 3DT0H 5PTPA 1QJ1B 3URCA 1MU8B 2XTTB 1BRBE 2BD2A 1SLVB 1PPCE 5CE1A 3KGPA 3ATLA 3RMLH 3RU4D 1ZSLA 2TGDA 1GL1A 1GBEA 4AORA 1DWDH 3PLPA 4MNVA 2Z94A 4FUGA 2VNTA 3ZV9A 2O9QA 5K7RA 4NGAH 1DX5M 4I8LA 1UTNA 3T2NA 1ZRBA 1N6YA 1P12E 2ANKH 1O2PA 1A46H 1EAIA 1TGTA 5DP8A 3PM3A 1JOUB 5CMXH 3RXCA 3SV2H 1ELCA 2TGPZ 3QWCH 4MG3A 1GHAF 3DD2H 4ABJA 4WXIA 2AERH 2P94A 3PLBA 1C4Y2 3LJJA 1AE5A 1TGSZ 2G52A 1KXFA 4KKDA 2EC9H 4AG1A 3UNRA 2ODYB 4O97A 3MWIU 2A2XH 1SB1H 3T5FH 4UD9H 2OC8A 4ABIA 1FUJA 3GDSA 4CR9A 1FZZA 8KME2 4B2AA 1YLCA 2WINI 3QZQA 2VVVA 2ZZUH 3E91A 1D6WA 1EAXA 1YPMH 1DXWA 3RLYH 3LKWA 4JYUH 1QIXB 5EU8A 3KN2A 1MCVA 3E0PB 4H6TA 4FU7A 2J94A 2ZC9H 2BY8X 3QO6A 2A4GA 3BEIB 3AW1A 5DJ7A 1L1JA 1O3NA 2AH4X 4R0IA 4HI3A 3GY4A 3LONA 1OWKA 4NIXA 1T32A 4UFDH 1XVMA 1ZLRA 3PWBA 2W5EA 3MO9A 3LGVA 4I33A 2BTCE 2WPLS 3KCGH 1C2KA 1TGNA 3PMJA 3AAVA 1VGCB 4ZKNU 3EE0B 2IN2A 1Z1JA 1FY5A 4FVDA 4XFQA 5A8XA 4YT7H 1TX8A 1UTPA 5EQRA 1W14U 5HM2A 1FONA 1O3JA 2QF0A 1EPTA 4XE4A 1C9TA 2BZAA 1AVGH 1LPGB 4E06H 4OS4A 3SU1A 1V2LT 2QYIA 1LTOA 4U01A 1OWIA 4FXGH 4MTBA 1QB9A 1P05A 1TA2A 1GBKA 2ZFQH 4ZHLU 3NK8A 3GY3A 1AMHA 3NWUA 1DWCH 1AQ7A 4MQAA 1NFUA 2C3SA 2XXLA 4X0WU 2QAAA 1HAVB 4IC6A 4A92A 1VJ9U 1BCUH 2FI3E 1NFXA 5BRRE 3TJVA 1SGNE 2FO9A 2ODQA 5TCAA 7GCHF 1BZXE 3A7WA 4OGXA 2FYRA 2PTNA 1F0UA 2PFEA 3RXMA 4MPUA 2F9NA 3TH2H 1C1WH 1GJCB 1SHYA 1BTWA 4X2VA 1K1IA 2HWLB 1YBWA 3SGQE 2F9OA 1ZOMA 1QJ6B 3RXTA 3A7YA 5BPEA 4Y11E 1ANEA 5C5OA 1QCPA 3M36A 9ESTA 5C2ZA 1N1LA 1JMOH 1E0FD 1Z8GA 2O8UA 4NSVA 5EOKA 1AUJA 1GHBF 1S0QA 1Y59T 3Q3XA 3PO1B 1A5HA 3GY2A 4A1TA 3GCNA 2G4UA 1VITF 1GBHA 3U8OH 1DY9A 2PHBA 4WWYA 3RXRA 1LHFH 3OY5U 3A7XA 2ZHQH 5EG4A 1ABJH 2F3CE 3NXPA 1QR3E 3NKKA 4CRCA 2VIVA 2OCVB 4YOGA 5HYOA 1C2HA 3ATMA 4X1RU 4BXSA 3D62A 1AZZA 2FOFA 1AKSB 5FX6A 1GBIA 1O2ZA 4D9QA 4K1TA 3RXLA 4HGCA 3STIA 2ZFPH 2BDBA 1ZGVA 2RA3A 4K3JA 2KAIA 3V0XA 1QY6A 3V12A 2BVRH 3MOCA 3SNBA 2P3UB 1EAWA 1HGTH 1P11E 4DVAU 5JBAS 1S83A 1P9SA 2VWLA 3LU9B 3ZZ3A 1UHBB 5F6MA 3GICB 3MFJA 2Z9LA 5EPYA 1EJAA 1ACBE 2JETB 1T8OA 2A7HA 3KQCA 3RXEA 1BIOA 2ZNKH 2BD4A 1GVKB 3TK9A 4MVNA 1YYY1 1QRZA 3BF6H 1SGYE 1WU1A 3LJOA 3FP6E 4U32A 1GBLA 1GDQA 2CHAB 1W3CA 1MBQA 1WUNH 2PGQB 4IC5A 1G3DA 4AGJA 3S9CA 2R3UA 1C5NH 1SOTA 1D3QB 1T8LA 4OGYA 7LPRA 2OP9A 3ZZ4A 4BAKB 2A31A 1UCYH 1C1RA 1GMCG 1Q2WA 1S6HA 2EI6A 1QA0A 2ILNA 2O8MA 3VGCB 4M7GA 1C5UA 2EEKA 1O5EH 4J1YA 4YT6H 5DP7A 2B9LA 1QBNA 1XUGA 1EXFA 1C5YB 1AKSA 1TBRH 1ANDA 5GCHG 3H7TA 5A09A 3U1IB 1HBTH 1OP8A 4B2CA 4KTCA 4MDSA 1TIOA 2SGPE 4ASHA 2HRVA 3E16B 1UVOA 2GV7A 1P57B 1KXBA 2HPPH 2OTVA 4ABHA 3EA9A 1EJNA 1IOEA 1ETRH 3VFEA 4ISHH 1RIWB 1G3EA 1VCQA 3N7OA 2BY6X 2Q6GA 5F8ZA 2Q1JA 3DHKH 3LGYA 3EA8A 3UNSA 3LDXH 2Z9KA 3PTBA 1V2JT 4BXWA 2F9UA 2ZDKA 4ISOA 1O2IA 3BIUH 2WPIS 1TPSA 1AVWA 1HDTH 4K2YA 2SGAA 1ESAA 1ABIH 2CJIA 1L4ZA 3SORA 1VGCC 4OS1A 1NESE 2BZ6H 3LH3A 4X8SH 5ABWA 1O2WA 2GZ9A 1UVTH 1ZMLA 1GGDC 2FOBA 2UUYA 2B7DH 2O8LA 3F9GA 1MTNB 2A45B 1XMNB 2QY0B 1FAKH 4WH8A 1WV7H 2UUJB 3T25A 2XWBI 2ZGCA 4ZH8A 1BJUA 3SV8A 3E90B 1MKXH 2AFQB 1TMTH 4O3TA 2JKHA 2GZ8A 3MNXA 1O31A 3PTNA 1O33A 1F0RA 1C5TA 1KLIH 2A0QB 1GI3A 1HPGA 3L6PA 4RKJB 4U2WA 2HNTC 1H8DH 3U98H 1F0SA 1Y3YA 1V2QT 1ZTKA 3ZVDA 2WPMS 3ITIA 2ZFTA 3M7UA 3P8OA 1EAUA 1Z8RA 3ZVFA 1BRAA 4TY7A 1P2JA 3GYMA 1HJ9A 1CHGA 2Y5HA 3E1XB 4LZ4B 1F5LA 1Y3VA 5GJ4B 1E34B 1SGFG 1VZQH 1O2MA 1Z1IA 1Y5BT 3U69H 1DE7H 2HLCA 1V3XA 4MPWA 3UPEA 2GGVB 3IG6B 1C5SA 1Y3XA 5EODA 1Q3XA 4BTUB 1PPGE 1RIWC 3GDUA 3QGNB 2WV5A 4AFUA 2ZIQH 1QB1A 5EQQA 2ODPA 2DE9A 2AGIX 2FWWA 1ELBA 5JPMH 5E0HA 1F5KU 1SLUB 1INCA 2QXJA 1A7SA 1GJ6A 2PR3A 2FXRA 1QHRB 1AFEH 1CBWC 1OWDA 2ZTXA 4DGJA 1Y3WA 2BD3A 1ID5H 1V2OT 1N6XA 1VCWA 5C3NA 4J2YB 2V0BA 2OQ5A 1C2DA 4I8KA 2PSYA 2FX6A 3VEQB 2Z9JA 3ZZCA 2R3YA 4DW2U 4WMFA 1BUIA 2GCHG 2GP9B 1QL9A 3UFAA 3LGUA 1CA0C 3SNEA 2GT7A 2FTLE 1M9UA 1IQEA 2VINA 2JH6D 5L2ZH 3TNTA 3P8NA 1K1JA 1Y3UA 3RMNH 1IQFA 1UK2A 2OC1A 1EZQA 3D49H 3SHAH 2TIOA 3R0FA 3BG4C 1O2KA 4H6SB 3BTWE 1PPZA 1K21H 1QRWA 4Y7AA 4Y8YA 4CR5A 3I78A 3BTQE 2VB0A 3TH3H 4GCHG 2STAE 5F8TA 2BVSH 1BTUA 1LCYA 1GI0A 2KAIB 4ZUHA 4ZROA 5DKMA 1W7GH 3T62A 1QFKH 4AZ2B 4KP0A 1GBAA 1B0FA 2VGCB 1O2UA 1TOMH 2FPZA 2B5TB 1C4V2 5CHAC 2ANWA 4WH6A 3ZVBA 3BG8A 3S9BA 3UREA 3JZ1B 2B8OH 1V2VT 4MNYA 5T6DA 1O3FA 1TMUH 2PWXA 1GI5A 4JZEH 1PPFE 1O3BA 3PLKA 3TPIZ 4BAQB 3M35A 2THFB 2ZHDA 3ODFA 1SGFA 1O37A 5EGMA 4QT8C 4CREA 4HZHA 4NFEA 1GJ5H 1O2NA 4XDEA 4AYYB 3SU6A 3BEUA 4RSPA 2GZ7A 1BA8B 1CBWB 3RXDA 4OS5A 3KF2A 1GL0E 1DT2A 2AIQA 2ANYA 2UUKB 1QNJA 2VU8E 1GVLA 2FYQA 2FOCA 2CXVA 2FEQH 4ABAA 2F91A 1J17T 5IYTA 1CGIE 1SQTA 4CH8B 2G4TA 1SC8U 2FOGA 5JYIA 1BB0B 3KEEA 2PKSB 1CA0B 3HKIB 1DUAA 1BBRE 2VH0A 1TYNA 2BDIA 2VIQA 1PPHE 2Y7ZA 1H9HE 2W26A 1CGJE 1PYTD 3BN9A 1C5ZB 3SO3A 3LIWA 1EKBB 3A85A 4ABBA 3NUMA 4X2XA 5DG6A 4VGCB 4MNWA 1GVZA 2PKAA 1FY3A 3GCHC 3ZYDA 4ISNA 2XC4A 1DVAH 3SJIA 4FUFA 2FZZA 4X8VH 1MMJN 2ZDLA 3FAOA 1GI4A 1NC6A 4FUCA 1NROH 4XBBA 3RUOA 1C9PA 1UTLM 4ZXXH 5DPAA 2OD3B 2SGEE 3Q3YA 3M37A 1A3BH 3RXFA 4E7NA 9LPRA 2OC0A 1MTNC 1IQJA 4INLA 4Q7ZA 1C4U2 1V2NT 3A86A 3SU4A 1BRUP 1YPGH 3MU8A 2R9PA 2UWPA 4UE7H 5DP4A 3A83A 1GDUA 2HALA 1DWBH 2R2MB 2F9PA 1KTTB 2QC2A 1FMGA 1RRKA 3UIRA 1L0ZA 3SJ9A 1HAYB 4AFSA 5AHGH 1V2UT 3PMAB 1O0DH 1A1RA 2NU0E 1O39A
chains in the Genus database with same CATH superfamily
5DP9A 3BSQA 3VG8A 1KXEA 3PYHA 1GJDB 2V3OH 2FI5E 2P8OC 2VH6A 1YY3A 5LPFA 3VB4A 1NT1A 4YO9A 1VKYA 2ZPQA 1G37A 2EY4C 2PLXA 2VIWA 1HAIH 2GV6A 2J97A 5CDFE 2SGQE 3TK5A 1PYTC 4X8TH 3UQVA 4B74A 3UTUH 3TGKE 1AB9C 3SJOA 4INKA 3K2UA 1C5LH 1EPTB 1WTGH 3ATIA 3SUFA 2XBYA 4KGAA 1RD3B 4A1VA 3MHWU 1OXGA 1H1BA 1GDNA 4A7IB 6LPRA 1VCPA 3KHVA 5GPIB 1FPHH 5DSFA 1LDTT 1T4UH 3NPSA 4GHTA 3VB5A 2WYGA 3RXVA 1C2IA 1MKWK 2XC0A 1P09A 4NCYA 1KMHB 1LKBA 2F83A 2FOHA 2Y6TA 4Z1MD 1P2IA 4JZ1A 1BMLA 5B6LA 2Z9GA 4VGCC 3RP2A 2RDEA 5C17A 3GCHB 2BDHA 2QE7D 3BTHE 1AGJA 3GDVA 1BITA 1EUFA 3P8GA 6GCHG 2JH0D 3ZV8A 1XX9A 2BLVA 1FN8A 2O8WA 1SGCA 5SGAE 2H9TH 1SVPA 1NRQH 1H4WA 1CA8B 1HAHH 3GYLB 2ZF0H 1C2LA 2ZU5A 1HIAA 2EI7A 1O36A 2HVXA 3MO6A 3ZVGA 1HAVA 1O3CA 1EJMA 1GI1A 2HOBA 1Z7KA 1PPEE 3MH5A 3BV9B 4O3UA 1MBMA 5G4BA 1KDQA 3OFND 1QURH 2BQ7B 3L33A 3AW0A 1EOJA 1DLKB 3EE7A 1DANH 2FESH 5H4IB 3RMMH 1TB6H 3M61U 1A5IA 2BY9X 3LOXA 5GIBA 1CT2E 4E7RG 5JB9S 1Y8TA 3A8CA 1V2WT 4CRBA 4B73A 4Q7YA 2RCEA 2J95A 1GJ4H 3RXUA 3UR6A 4DJZB 1CO7E 1W11U 2F4LA 4X6PA 1ZHMA 1TABE 3TIUA 1BMNH 3B8JA 4I8HA 1HAGE 1O3KA 3OSYA 3PROA 4NA8A 1VITH 3K65B 3LC3A 3M5LA 2RFKC 5CHAB 4IN1A 1HLTH 1ZR0A 2ZU3A 3ZZ7A 5HIYA 2G5NA 3SZNA 4F48B 2WSSD 1THSH 2BY5X 1SPJA 1EP6A 4B71A 1YC0A 1CQQA 3HK3B 5DP5A 1ZHRA 3SI4H 1FN6A 2QGRA 1AE8H 8ESTE 2TGAA 2TGTA 1BTYA 1QJ7B 1D6RA 3B23B 2Z3DA 1MD8A 3OEHD 5LH8A 2H5CA 5GCHF 1OHHD 4AG2A 1ELVA 1FLEE 1EOLA 4YOIA 1XKBC 2R0LA 2KCPA 1FXYA 1FV9A 2V3HH 3EQ0H 1FX0B 1C1TA 2WPJS 1LHEH 2Q6DA 1OYQA 3MH7A 2DUCA 1HJAC 2P16A 4B76A 2A32A 1EB1H 3SYJA 4GAWA 2Y82A 4BAHB 3PWCA 2PUQH 4FUEA 4ABDA 1WQSA 3P95A 3LGTA 3ODDA 4B2BA 4TY6A 2GD4B 2NU3E 2XWAA 3V3MA 1KLTA 2AGEX 2BD5A 4RN6A 1ELEE 3SQHE 1TA6A 2Z3CA 1UTJA 3SZEA 2BDGA 2XBWA 4CHAC 2STBE 2BB4A 1OS8A 5GXPA 1MTVA 4X6MA 1ESBA 2I6SA 3BTME 3ESTA 1GMHF 1UTOA 5E8EH 5FXLA 3IWMA 1P3CA 4NA7A 1CHOG 2FOMB 4YESB 3DSOA 2IJD1 1GWAA 3GY8A 1TPAE 2FOAA 3RC5A 5FPYA 1KXCA 1EP5A 2FODA 2OUAA 2ZHWH 1BMFD 4XBDA 2Y5FA 1YPEH 2B0FA 1FI8A 2A2QH 5AVDA 3UY9A 4PROA 1NFYA 1W8BH 2BLQA 3A80A 2JJ2D 5EXNA 4XSKU 3DSGA 3DFJA 4H4FA 3F3BA 4IBLH 2ALVA 1K1OA 1ZHPA 8GCHF 1BJVA 1UCYK 4DIHH 1EB2A 1GJAB 5HMAA 1K28D 3AAUA 5LPRA 1J14A 3FVFB 2KR7A 1BTPA 1O3LA 4H42U 4I8JA 1EX3A 3HGPA 4FUBA 1GPZA 2F9BH 4FVBA 1J16A 4OS6A 4K60A 1CHOF 1AZ8A 3W95A 3NCLA 4OM9A 5AF9H 3ZVAA 4ZKSU 2PGBB 4KTUA 2BMGB 2A5KA 1ANBA 2Y5GA 4K1SA 4X8UH 5EJZA 1D3PB 1YGCH 2D1JA 1HCGA 1BTXA 1E38B 2UUFB 1TLDA 2G00A 3LGIA 1DY8A 1AB9B 1GBJA 4MNXA 2J38A 2BDCA 4UFGH 4LK4A 2PV9B 1UMAH 1O5CB 1NBME 2GDEH 4B1TA 4X1QU 1KY9A 1TWXB 3OTPA 4D9RA 5J4QA 2NU4E 4JZFH 3SUDA 1DITH 4CHAB 1NU9A 1WTHD 4GHQA 1GBDA 1ZJKA 2KCYA 1C2EA 5T3HA 4FU9A 5E0GA 2YOLA 2VWMA 1TNIA 1LVOA 1F2SE 3D65E 2QN5T 3KIDU 2PTCE 3BIVH 4XRNA 1O2LA 2YMSC 2ZDVH 2ZWLH 2QF3A 3UOUA 1TONA 3A89A 4B6FA 1C5WB 1FY4A 3ATKA 5DP6A 4AB8A 4GPGA 3FOAA 1RTKA 1WSSH 2ZCHP 5T6FA 1W10U 1UHBA 4DG4A 3S7HB 4YM9A 1LPKB 2FI4E 2W7UA 4TWYA 3A81A 2ZU1A 1P10A 1XVOA 1ZRKA 2GDDA 1O35A 1SBWA 1T8NA 1K2I1 2BOKA 1AY6H 3M5MA 1P2MA 1SLXB 3P92A 4THNH 3N99A 4YTAA 2H9EH 3P6ZB 3SV6A 2D26C 3H7OA 1OP0A 4I86A 1O2QA 2Z7FE 5FPSA 2GCHF 2OC7A 1O5DH 2A5AA 3RXKA 1GI8B 3GY6A 1TPPA 1YPKH 2WPKS 3SU2A 3WW7A 2BD9A 4IGDA 1BMMH 1KDQB 5ETXA 4DT4A 5JBCS 3S9AA 3HPTB 4NZLA 1HFDA 1NFWA 3EDXB 4X2WA 2CGAA 1A0HB 5C1UA 2C90B 3QLPH 2BQWB 3E6PH 2TRMA 1FNIA 2BQ6B 1GJ8B 3ZZ6A 5FBIA 2ZP0H 1NTPA 3D23A 3UB0A 4ABFA 2FS8A 3QTVH 3O8RA 1ELGA 1JWTA 3MYWA 1BBRH 1CE5A 3QTOH 1GCTC 1QTFA 1O5GH 3A7TA 2UWOA 1MKXK 1GI9B 4Y8ZA 1C1QA 3S7KB 4UONA 5E2OA 2ZKSA 5C20A 3OTJE 3A7ZA 2XC5A 5GNDA 1XUHA 3LGWA 2ZDAH 4P02A 4ABEA 3MNCA 1MAYA 1WQVH 1F0TA 5FBEA 1MTWA 2AGGX 1GHVH 2XBXA 1C5VA 3E3TA 1OYTH 2Q6FA 1UK4A 2A4RA 3ELAH 1TMBH 3CENA 1W12U 4TPYA 3AASA 2AS9A 1SLWB 1SKYE 1XUKA 2QA9E 2GMTB 2WUBA 1V2MT 8LPRA 3E0NB 3MH6A 3F2FA 4LZ1H 4IW4E 1P06A 1UVSH 1HAPH 1AUTC 1AFQC 2ZFFH 3EYDA 5A8YA 7ESTE 2R0KA 1P03A 5C1XA 3ZVEA 1YPHE 1OWEA 1XXDA 3M3VA 1OP2A 1C2JA 5T6GA 2SGDE 4A1XA 3SN8A 2JETC 1NM6A 4WVPE 3RXHA 1HAZB 1TE0A 4R8TB 2BX3A 4BANB 2ZHFH 3KNXA 5L30H 4NIVA 3F6UH 4OS2A 1B0EA 4O03A 5E2PA 5DN6D 5IK2D 1L1NA 4BAOB 4Y7BA 1C1OA 1WCZA 4ZMAH 1ZPZA 1G3BA 3CS0A 1ELDE 3BTEE 3L3TA 3RXAA 1E1QD 3RXJA 1V2PT 2HNTE 1GI7B 1K1PA 1QQUA 1O2SA 1JXPA 1P2NA 1KXDA 4Q7XA 4RT1A 1GG6C 3RU4T 2ZGJA 1MH0A 1LHGH 1SGEE 5L6NH 4WMEA 3T26A 1S81A 2VWNA 1YPJH 3LC5A 1W0JD 1ESTA 2NU1E 3K6YA 1J9CH 3RXGA 4GLYA 1DM4B 1JRSA 3DSPA 4P00A 2WV9A 1E37B 1FIZA 1WDIA 1K1LA 3DA9B 3SNDA 1TX7A 3QX5H 2C4FH 1K1NA 3O8DA 2LNCA 2ASUB 2ESTE 2RG3A 2JIZD 3BTTE 3CS7A 4Y76A 3RXBA 5FAHA 1SFIA 3F9HA 1TALA 1BDAA 2J34A 4YZUA 1LVBA 1XUJA 5DGJA 1O3OA 2CV3A 3DUXH 2G51A 1TNGA 2C8XB 1FY1A 3UR9A 5EXMA 1Q31A 1GJ9B 3ZZBA 1YLDA 2J9NA 3RMOH 1S0RA 1L2EA 2VJ1A 4CRFA 2UWLA 3TGIE 4Q2KA 2GMTC 5C0TA 1O2TA 2A1DB 3MMGA 3SW2B 4INHA 2YNBA 1B5GH 5EIYA 4RT0A 3TITA 2LP6A 1DXPA 1AFQB 4HTCH 3VXFH 1AN1E 2OBOA 2FX4A 4CBNA 2TPIZ 3RXPA 1IHSH 4IS5A 1ZSKA 3BEFB 7KMEH 2ZA5A 1H9IE 2QF5A 1SSXA 4K8YA 2IOTA 5GDSH 3BTKE 4A6LA 4WJG2 1KXAA 3RM2H 1P01A 1E36B 1X7AC 4NSYA 1UCYE 2NWNA 3R3GB 1P2KA 1KYNA 3PRDA 1HIAB 4Y79A 4D8NA 4CH2B 1Y5AT 2CMYA 1O32A 5C5NA 5I46H 1TBZH 2BX4A 1ZPCA 3W1EA 1Z8IB 1O2HA 3FZZA 2VIDA 1GG6B 2BXTH 2OINA 1TAWA 1RTLA 3T27A 1CSOE 1ELTA 1WYKA 5HGGA 1O3IA 2BXUH 3SV7A 1G30B 1W0ZU 3PO1C 5FCKA 1QGFA 2FP7B 2CF9H 1MUEB 2BHGA 3GCTF 1A0LA 2SGFE 4NIWA 3RXQA 4AOQA 2OLGA 1NO9H 2Y7XA 2C8ZB 3W94A 1NU7B 1C5OH 5E0JA 1LO6A 1J8AA 1SGPE 1HNEE 3TJUA 1QQ4A 1AVXA 3QN7A 4DIIH 1OWHA 1XM1A 2XNIA 1MTUA 1GCDA 3ZZ5A 1K1MA 2WPHS 1MABB 2GCTC 2WUCA 3SU3A 3M5OA 3UQOA 4K5ZA 1QBOA 1WAYB 3KQDA 1IQKA 1QRXA 3FP8E 3MI4A 3C27B 3PV4A 2Z3EA 1DUEA 4AFZA 4K1EA 3MTYA 2XBVA 1MZAA 4NFFA 1D9IA 1SI5H 1GCTB 1P02A 1T31A 1W13U 4CRDA 5I25A 4B6EA 1TPOA 1BHXF 1GI2A 3STJA 5EW1H 4JK5A 2SFAA 4LOYH 1W7XH 3UOPA 1L4DA 2JH5D 1HAOH 3VPKA 1S5SA 1TX6A 2ANMH 2G55A 3OY6U 1SQOA 3SOSA 1NPMA 1AI8H 3IITA 4JK6A 4DY7B 3K9XB 4F49A 5J4SA 3KL6A 4ABGA 5L2YH 1OWJA 1GHXH 1UO6A 1O3AA 4LXBH 3ZZDA 4A5TS 2RA0A 1C5RA 1SGQE 1C1NA 1LKAA 2BOHB 2ZFSA 1Y5UT 1O5AB 4ZKOU 3F9EA 3M5NA 2P3FH 1O3EA 1A0JA 1TQ7B 2XCNA 1S85A 2F9VA 1QZ8A 4AFQA 1U6QA 3GISB 2SNVA 1C1SA 3PB1E 1AD8H 2ALPA 3DFLA 2ZPSA 3RLWH 2HNTF 3KYFA 2BLWA 3MU4A 2J2UA 1W2KH 1FJSA 4K69A 4SGAE 5A0AE 2GT8A 1C5MD 3WY8A 3A88A 1IQHA 1O3MA 5EPNA 3VB3A 3VGCC 1C2GA 1LVMA 3S69A 4MLFB 4Z6AH 1O5BB 1NS3A 2D8WA 3RDZA 3UWJH 2ZCLP 3UAIC 4D7FA 2FLBH 2EI8A 1P3EA 1TNKA 4XOJA 1IAUA 1FIWA 3DCLA 1C1MA 2AEIH 2FOEA 1GJBB 3QUMP 2J92A 1ELAA 2P3TB 4Y8XA 2VGCC 1MU6B 2ZHEH 3BTFE 1EZXC 1OSSA 3T29A 1G3CA 2ZI2H 4E05H 2GCTB 1CT4E 5EW2H 4FUJA 1KLJH 3SI3H 4I8GA 1KSNA 4UFFH 4M9FA 4YLUA 1EZUC 4MPXA 1RS0A 2GX4A 1DS2E 2A7JA 2ZDNA 1THRH 1UTMA 3RU4E 1QBVH 1G2MA 1MCTA 4ISLA 3RXIA 2Z6BD 1DPOA 2P95A 1A2CH 1C5QA 2K0QA 1XUIA 4GUXA 4MPVA 1ZJDA 1YP9A 4AYVB 1BOQA 3FKSD 2VVUA 1G32B 1NY22 1HV7A 5HIZA 2BDYA 3QDZB 2V7QD 1SQAA 2F43B 5LGOA 3FANA 4TYDA 3FN8A 3ZZ9A 5JBBS 2ZU4A 1J15A 5TJXA 1O34A 1ZGIA 2BM2A 3GY7A 3MNBA 1AWFH 2A4QA 3KQEA 4NZQA 3HGNA 1GGDB 1EASA 1D3DB 2H6MA 1QL8A 1Z6JH 3QGJA 3ZZ8A 2ZO3H 3TVJB 4ZHAA 1A61H 4Z0KA 4UEHH 1Z6EA 1ELFA 3MU0A 2ZQ1A 2TBSA 1PJPA 3SQEE 4TT3D 3M7QA 2KM0A 2Y80A 1CU1A 3U1JB 3A7VA 3LT3A 1THPB 1O38A 1YPLH 4X6OA 1YLNA 5DP3A 1BRCE 4GVUA 1LHDH 5A2MH 2VIPA 2ZEBA 4YXWD 1XKAC 3MH4A 1CVWH 3SHCH 2YNAA 2K1QA 1GBCA 1W0YH 5C0UA 1DSUA 1F92A 3U8TH 4FUDA 3UUZA 1HRTH 1LVYA 4KTSA 3B9FH 3VB7A 2ZCKP 1IQLA 1HAXB 4YOJA 1G36A 2ZG0H 2FTMA 1DFPA 1T7CA 1NRPH 4FOUC 2CHAC 1JBUH 1W0KD 4IMZA 1UJ1A 4Y10E 1C1VH 3SU5A 1WOFA 3GCOA 4I7YH 1MQ5A 3A8AA 4U30A 2OXSA 3TH4H 4IMQA 1O2JA 2ZPRA 1S82A 1DSTA 1YM0A 3JZ2B 1G2LA 1CT0E 1OX1A 1XXFA 1QA7A 1LMWB 1DLEA 4DOQA 2PSXA 1AWHB 4BAMB 2VIOA 3TJOA 3I29A 1KTSB 1EQ9A 1GBFA 3HK6B 1UK3A 1V2RT 3LPRA 3TU7H 3S0NA 2P8OB 3M7TA 1PPBH 1O2VA 1TNLA 3HKJB 1B7XB 3CP7A 3RM0H 4JZDH 3SUGA 1C5PA 1DOJA 4BTIB 4NA9H 5IDKA 1HB0B 5F03A 4TWWA 3F9FA 3M3SA 1V2ST 4CRAA 1TNHA 2ZDMA 3SGBE 4D76A 1JIMA 1EPTC 1KIGH 2IJOB 1C5XB 3FFGA 1O2RA 2RDLA 1K0HA 1IQNA 4I32A 1TGCA 1C1UH 3RXOA 3I77A 2QIQA 1SOZA 1C2MA 2CN0H 2IPQX 1P9UA 2PUXB 3PMHB 3PV2A 4F4OC 4JCNA 1C2FA 2AMQA 1RXPA 2GKVE 1IHTH 3OU0A 1E79D 4Y0YE 3SGAE 2VVCA 2A7CA 5DO4H 1BHXB 3U9AH 1JRTA 4ISIH 1BT7A 2HVYB 3BG4B 4NWKA 4JZIA 3ENSB 4ZAEA 2G81E 3O8BA 1F7ZA 2QXGA 1QB6A 2Y81A 1GHWH 3GY5A 2ZTYA 1NRRH 1SGIB 2BDAA 2W7SA 1ETSH 1RTFB 2NU2E 1TFXA 3URDA 1OOKB 2KCOA 1GI6A 1NRSH 3A8DA 1PQAA 4CBOA 2C93B 3ZVCA 1QL7A 2WV4A 1UVUH 4ZHMU 4D7GA 3A82A 6ESTA 1MD7A 3MNSA 1LHCH 1TNJA 2QXIA 4TPIZ 2ZTZA 4ZXYH 4DT7B 2ZFRH 1SGDE 3F0PA 2ZGBH 2M5TA 5JBTA 4WXVA 3NZIA 3TK6A 1Z8JB 1YCPM 2G8TA 1SL3A 1IQGA 3GOVB 3T28A 1T8MA 3UWIA 3Q76A 2VWOA 3WWBA 3SV9A 2GJGA 1UVPA 8GCHG 1NZQH 4Y71A 5JB8S 1HXEH 1T4VH 5DK1A 2WHXA 2KFWA 2AMPA 3M3TA 3RC4A 1O3DA 4YLQH 1PQ8A 1K9OE 2D2DA 1O2OA 3GS9A 2CF8H 3TJNA 1UW7A 1ZTLA 2PKAB 1GHZA 2H1UA 5FPTA 3TGJE 3SBKA 5GWZA 4JMYA 3ZZAA 2XCFA 4AB9A 1O3PB 6CHAC 2Z9IA 3SJKA 4BTTB 1FY8E 3P70B 1GMHG 2ZU2A 5EQSA 2C8YB 3MU5A 1H9LB 4HFPB 1ETTH 3KQBA 2G5VA 2GVFA 4X1SU 2W3KA 2ULLA 3O8CA 2WYJA 4BNRA 3LH1A 2ZQ2A 4X2YA 2IPHA 3TNSA 1MTSA 4X1PU 1AIXH 2FIRH 2KX4A 3SNCA 2L74A 2FMJA 4NWLA 1AU8A 2P59A 2M2AA 2YMSB 4X1NU 1IQMA 1RGQA 1A3EH 4XBCA 5ESBA 1BTZA 4ZKRU 4AGKA 1MAXA 1LQEA 1V2TT 4O9VA 3GCTG 5T1VA 3FP7E 1WBGB 2A4OA 2CK3D 1P8VC 2PW8H 5FCRA 1S84A 3OYPA 2QXHA 3RC6A 1JIRA 2FM2A 2I6QA 6GCHF 1FAXA 4BOHA 3ZYEA 1RJXB 1ZMJA 1TRYA 5HM9A 1RFNA 1YCPK 1SMFE 1H8IH 3A84A 5FHTA 1ARBA 1CGHA 3BTDE 3V13A 1A4WH 2V3MA 1P04A 1E35B 1TOCB 3RXSA 3TLOA 1GMCF 1SGRE 1O3HA 3E8LA 3F0OA 2J98A 4GCHF 2BD7A 3SJ8A 1ARCA 2H9HA 1E1RD 4UFEH 1GHAG 1PFXC 1P0SH 4ESTE 1HXFH 1IQIA 2BVXH 3VB6A 4Y6DA 3MU1A 1HJ8A 2K8IA 1ZPBA 1ZTJA 1VR1H 1AHTH 4AX9H 2QV1A 1UTQA 1MKWH 2AYWA 1H8ED 1BTHH 4FU8A 4JYVH 1D4PB 2OQUA 5FX5A 6CHAB 4WF8A 4B75A 2KZ4A 3VXEH 2QCYA 1TGBA 2H2ZA 1GBMA 3ATWA 2FDAA 1P2OA 3AVZA 3CNRA 1DWEH 4DURA 2O8TA 3FZDA 1DDJA 1P2QA 3SUEA 1XUFA 1O2YA 1TRNA 5C1YA 3P17H 3SU0A 2V35A 3MQKC 3Q77A 3EA7A 4NG9H 2WZQA 3QZRA 4Q63A 1V2KT 1PQ5A 1NBMD 1Z71A 2XW9A 4DCDA 2W3IA 1GBBA 1GMDF 1TBQH 2AMDA 5A0CA 2FS9A 5A0BA 3PMBB 2DE8A 4ACAA 3U8RH 1OKXA 1FQ3A 1ZYOA 3UNQA 1A5GH 1C1PA 2A5IA 3P8FA 4FUHA 1O30A 4GSOA 4SGBE 2LPRA 2BYAX 1VITG 1ZSJA 2PKSC 5JDUB 1MZDA 3MO3A 2V6NA 1YPHC 2ZECA 1SR5C 4UDWH 3G01A 1N8OC 5HXFA 1ZMNA 4NIYA 1O5FH 2L6OA 4Q80A 1OPHB 5A8ZA 2JJ1D 2R2WU 1VJAU 3A8BA 3OEED 1NN6A 3Q3KA 7GCHG 3F68H 2P93A 2OBQA 1UTKA 3C1KA 4AN7A 2XRCA 3V7TA 1HUTH 2GTBA 1BBRK 1YCPH 4IN2A 1GMDG 1BQYA 1TQ0B 3EAJA 4OS7A 1FDPA 1PQ7A 3H5CB 5AFZH 5HKKD 4I31A 1NRNH 2SNWA 5TCCA 4Y0ZE 1SGTA 5LPEA 1DICA 1GJ7B 3SNAA 1L1GA 1K22H 4K8BA 1YF4A 1ORFA 1EZSC 2HPQH 1YKTA 1SHHB 2C8WB 4CRGA 2BY7X 1G9IE 4WY3A 2BLOA 1AO5A 2HGTH 1GHBG 5AFYH 2XYAA 5B6OA 4RKOB 3OX7U 3F1SB 2EQNA 4KELA 5C67A 3Q00A 3HATH 1O3GA 3EGKH 1D3TB 1V6DA 1ANCA 1GBTA 2ZGHA 1O2XA 1TRMA 2EA3A 1ZZZA 2ZGXH 5K0HA 1EATA 1S6FA 1SFQB 5EJLA 1HJAB 3QK1A 2FLRH 1HYLA 1LPZB 1GHYH 2H5DA 4FUIA 1F5RA 1BMAA 3A87A 4X6NA 1FPCH 1MQ6A 5F8XA 5EXLA 2J4IA 4JYTA 2BD8A 4RI0A 4WMDA 5ESTE 2AIPA 1LQDB 1O2GH 3K6ZA 2AHME 3BTGE 1SG8B 1N8OB 3DT0H 3F2GA 5PTPA 1QJ1B 3N7DA 3URCA 1MU8B 2XTTB 1BRBE 2BD2A 1SLVB 1PPCE 5CE1A 3KGPA 3ATLA 3RMLH 3RU4D 1ZSLA 2TGDA 1GL1A 1GBEA 4AORA 1DWDH 3PLPA 4MNVA 2Z94A 4FUGA 2VNTA 3ZV9A 2O9QA 5K7RA 3OE7D 4NGAH 1DX5M 4I8LA 4HG6A 1UTNA 3T2NA 1ZRBA 1N6YA 1P12E 2ANKH 1O2PA 1A46H 1EAIA 1TGTA 5DP8A 3PM3A 1JOUB 5CMXH 3RXCA 3SV2H 1ELCA 2TGPZ 3QWCH 4MG3A 1GHAF 3DD2H 4Q4LA 4ABJA 4WXIA 2AERH 2P94A 3PLBA 1C4Y2 3LJJA 1AE5A 1TGSZ 2G52A 1KXFA 4KKDA 2EC9H 4AG1A 3UNRA 2ODYB 4O97A 3MWIU 2VBCA 2A2XH 1SB1H 3T5FH 4UD9H 2OC8A 4ABIA 1FUJA 3GDSA 4CR9A 1FZZA 1H8HD 8KME2 4B2AA 1YLCA 2WINI 1WXRA 3QZQA 2VVVA 2ZZUH 3E91A 1D6WA 1EAXA 1YPMH 1DXWA 3RLYH 3LKWA 4JYUH 1QIXB 5EU8A 3KN2A 1MCVA 3E0PB 4H6TA 4FU7A 2J94A 2ZC9H 2BY8X 3QO6A 2A4GA 3BEIB 3AW1A 5DJ7A 1L1JA 1O3NA 2AH4X 4R0IA 4HI3A 3GY4A 3LONA 1OWKA 4NIXA 1T32A 4UFDH 1XVMA 1ZLRA 3PWBA 2W5EA 3MO9A 3LGVA 4I33A 2BTCE 2WPLS 3KCGH 1C2KA 1TGNA 3PMJA 3AAVA 1VGCB 4ZKNU 3EE0B 2IN2A 1Z1JA 1FY5A 4FVDA 4XFQA 5A8XA 4YT7H 1TX8A 3AK5A 1UTPA 5EQRA 1W14U 5HM2A 1FONA 1O3JA 3FO8D 2QF0A 1EPTA 4XE4A 1C9TA 2BZAA 1AVGH 1LPGB 4E06H 5F53A 4OS4A 3SU1A 1V2LT 2QYIA 1LTOA 4U01A 1OWIA 4FXGH 4MTBA 1QB9A 1P05A 1TA2A 1GBKA 2ZFQH 4ZHLU 3NK8A 3GY3A 1AMHA 3NWUA 1DWCH 1AQ7A 4MQAA 1NFUA 2C3SA 2XXLA 4X0WU 2QAAA 1HAVB 2QF4A 4IC6A 4A92A 1VJ9U 1BCUH 2FI3E 1NFXA 2YMSD 3TJVA 1SGNE 2FO9A 5BRRE 2ODQA 5TCAA 7GCHF 1BZXE 3A7WA 4OGXA 2FYRA 2PTNA 1F0UA 2PFEA 3RXMA 4MPUA 1COWD 2F9NA 3TH2H 1C1WH 1GJCB 1SHYA 1BTWA 4X2VA 1K1IA 2HWLB 1YBWA 3SGQE 2F9OA 1ZOMA 1QJ6B 3RXTA 3A7YA 5BPEA 4Y11E 1ANEA 5C5OA 1QCPA 3M36A 9ESTA 5C2ZA 1N1LA 1JMOH 1E0FD 1Z8GA 2O8UA 4NSVA 5EOKA 1AUJA 1GHBF 1S0QA 1Y59T 4ASUD 3Q3XA 3PO1B 1A5HA 3GY2A 4A1TA 2OK5A 3GCNA 2G4UA 1VITF 1GBHA 3U8OH 1DY9A 2PHBA 4WWYA 3RXRA 4AC9A 1LHFH 3OY5U 3A7XA 2ZHQH 5EG4A 1ABJH 2WPDD 2F3CE 3NXPA 1QR3E 3NKKA 4CRCA 2VIVA 2OCVB 4YOGA 5HYOA 1C2HA 3ATMA 4X1RU 4BXSA 3D62A 1AZZA 2FOFA 1AKSB 5FX6A 1GBIA 1O2ZA 5CHBA 4D9QA 4K1TA 3RXLA 4HGCA 3STIA 2ZFPH 2BDBA 1ZGVA 2RA3A 4K3JA 2KAIA 3V0XA 1QY6A 3V12A 2BVRH 3MOCA 3SNBA 2P3UB 1EAWA 1HGTH 3PV5A 1P11E 4DVAU 5JBAS 1S83A 1P9SA 2VWLA 3LU9B 3ZZ3A 1UHBB 5F6MA 3GICB 3MFJA 2Z9LA 5EPYA 1EJAA 1ACBE 2JETB 3NRLA 1T8OA 2A7HA 3KQCA 3RXEA 1BIOA 2ZNKH 2BD4A 1GVKB 3TK9A 4MVNA 1YYY1 4F55A 1QRZA 3BF6H 1SGYE 1WU1A 3LJOA 4ACBA 3FP6E 4U32A 1GBLA 1GDQA 2CHAB 1W3CA 1MBQA 1WUNH 2PGQB 4IC5A 1G3DA 4AGJA 3S9CA 2R3UA 1C5NH 1SOTA 1D3QB 1T8LA 4OGYA 7LPRA 2OP9A 3ZZ4A 4BAKB 2A31A 1UCYH 1C1RA 1GMCG 1Q2WA 1S6HA 2EI6A 1QA0A 2ILNA 2O8MA 3VGCB 4M7GA 1C5UA 1S6LA 2EEKA 1O5EH 4J1YA 4YT6H 5DP7A 2B9LA 1QBNA 3H09A 1XUGA 1EXFA 1C5YB 1AKSA 1TBRH 1ANDA 5GCHG 3H7TA 3KQ5A 5A09A 3U1IB 1HBTH 1OP8A 4B2CA 4KTCA 4ZCNA 4FETA 4MDSA 1TIOA 2SGPE 4ASHA 2HRVA 3E16B 1UVOA 2GV7A 1P57B 1KXBA 2HPPH 2OTVA 4ABHA 3EA9A 1EJNA 1IOEA 1ETRH 3VFEA 4ISHH 1RIWB 2J5UA 1G3EA 1VCQA 3N7OA 2BY6X 2Q6GA 5F8ZA 2Q1JA 3DHKH 3LGYA 3EA8A 3UNSA 3LDXH 2Z9KA 3PTBA 1V2JT 4BXWA 2F9UA 2ZDKA 4ISOA 1O2IA 3BIUH 2WPIS 1TPSA 1AVWA 1HDTH 4K2YA 2SGAA 1ESAA 1ABIH 2CJIA 1L4ZA 3SORA 1VGCC 4TSFD 4OS1A 1NESE 2BZ6H 3LH3A 4X8SH 5ABWA 1O2WA 2GZ9A 1UVTH 1ZMLA 3WWFA 1GGDC 2FOBA 2UUYA 2B7DH 2O8LA 3F9GA 1MTNB 2A45B 1XMNB 2QY0B 1FAKH 2HLDD 4WH8A 1WV7H 2UUJB 3T25A 2XWBI 2ZGCA 4ZH8A 1BJUA 3SV8A 3E90B 1MKXH 2AFQB 1TMTH 3OAAD 3N7EA 4O3TA 2JKHA 2GZ8A 3MNXA 1O31A 3PTNA 1O33A 1F0RA 1C5TA 1KLIH 2A0QB 1GI3A 1HPGA 3L6PA 1YWUA 4RKJB 4U2WA 2HNTC 1H8DH 3U98H 1F0SA 1Y3YA 1V2QT 1ZTKA 3ZVDA 2WPMS 3ITIA 2ZFTA 3M7UA 3P8OA 1EAUA 1Z8RA 3ZVFA 1BRAA 4TY7A 1P2JA 3GYMA 1HJ9A 1CHGA 2Y5HA 3E1XB 2KCAA 4LZ4B 2XNDD 1F5LA 1Y3VA 5GJ4B 1E34B 1SGFG 1VZQH 1O2MA 1Z1IA 1Y5BT 3U69H 1DE7H 2HLCA 1V3XA 4MPWA 3UPEA 2GGVB 3IG6B 1C5SA 1Y3XA 5EODA 1Q3XA 4BTUB 1PPGE 1RIWC 3GDUA 3QGNB 2WV5A 4AFUA 2ZIQH 1QB1A 3ZIAD 5EQQA 1SQRA 2ODPA 2DE9A 2AGIX 2FWWA 1ELBA 5JPMH 5E0HA 2JDID 1F5KU 1SLUB 1INCA 2QXJA 1A7SA 2W6JD 2PP6A 1GJ6A 2PR3A 2FXRA 1QHRB 1AFEH 4XD7D 1CBWC 1OWDA 2ZTXA 4DGJA 1Y3WA 2BD3A 1ID5H 1V2OT 1N6XA 1VCWA 5C3NA 4J2YB 2V0BA 2OQ5A 1C2DA 4I8KA 2PSYA 2FX6A 3VEQB 2Z9JA 3ZZCA 2R3YA 4DW2U 4WMFA 1BUIA 2GCHG 2GP9B 1QL9A 3UFAA 3LGUA 1CA0C 3SNEA 2GT7A 2FTLE 1M9UA 1IQEA 2VINA 2JH6D 5L2ZH 3TNTA 3P8NA 1K1JA 1Y3UA 3RMNH 1IQFA 1UK2A 2OC1A 1EZQA 3D49H 3SHAH 2TIOA 3R0FA 3BG4C 1O2KA 4H6SB 3BTWE 1PPZA 1K21H 1QRWA 4Y7AA 4Y8YA 4CR5A 3I78A 3BTQE 2VB0A 3TH3H 4GCHG 2STAE 5F8TA 2BVSH 1BTUA 1LCYA 1GI0A 2KAIB 4ZUHA 4ZROA 5DKMA 1W7GH 5KEDA 3T62A 1QFKH 4AZ2B 4KP0A 5KECA 1GBAA 1B0FA 2J98B 2VGCB 1O2UA 1TOMH 2FPZA 2B5TB 1C4V2 5CHAC 2ANWA 4WH6A 3ZVBA 3BG8A 3S9BA 3UREA 3JZ1B 2B8OH 1V2VT 4MNYA 5T6DA 1O3FA 1TMUH 2PWXA 1GI5A 4JZEH 1PPFE 1O3BA 3PLKA 3TPIZ 3PRBA 4BAQB 3M35A 2THFB 2ZHDA 3ODFA 1SGFA 5FL7D 1O37A 5EGMA 4QT8C 4CREA 4HZHA 4NFEA 1GJ5H 1O2NA 4XDEA 4AYYB 3SU6A 3BEUA 4RSPA 2GZ7A 1BA8B 3F2HA 5KGOA 1CBWB 3RXDA 4OS5A 3KF2A 1GL0E 1DT2A 2AIQA 2ANYA 2UUKB 1EFRD 1QNJA 2VU8E 1GVLA 2FYQA 2FOCA 2CXVA 2FEQH 4ABAA 2F91A 1J17T 5IYTA 1CGIE 1SQTA 4CH8B 2G4TA 1SC8U 2FOGA 5JYIA 1BB0B 3KEEA 2PKSB 1CA0B 3HKIB 1DUAA 1BBRE 2VH0A 1TYNA 2BDIA 2VIQA 2LELA 1PPHE 2Y7ZA 2W6ID 1H9HE 2W26A 5EJ1A 1CGJE 1PYTD 3BN9A 1C5ZB 3SO3A 3LIWA 1EKBB 3A85A 3KYGA 3NUMA 4X2XA 5DG6A 3U28C 4VGCB 4ABBA 4MNWA 1GVZA 2PKAA 1FY3A 3GCHC 3ZYDA 4ISNA 2XC4A 1DVAH 3SJIA 4FUFA 2FZZA 4X8VH 1MMJN 2ZDLA 3FAOA 1GI4A 1NC6A 4FUCA 1NROH 4XBBA 3RUOA 1C9PA 1UTLM 4ZXXH 5DPAA 2XOKD 2OD3B 2SGEE 3Q3YA 3M37A 1A3BH 3RXFA 4E7NA 9LPRA 2OC0A 1MTNC 1IQJA 4INLA 4Q7ZA 1C4U2 1V2NT 3A86A 3SU4A 1BRUP 1YPGH 3MU8A 2R9PA 2UWPA 4UE7H 5DP4A 3A83A 1GDUA 2HALA 1DWBH 2R2MB 2F9PA 1KTTB 2QC2A 1FMGA 1RRKA 3UIRA 1L0ZA 3SJ9A 5C94A 1HAYB 4AFSA 5AHGH 1V2UT 3PMAB 1O0DH 1A1RA 2NU0E 1O39A
chains in the Genus database with same CATH topology
5DP9A 3BSQA 1KXEA 3PYHA 1GJDB 2V3OH 2FI5E 2P8OC 2VH6A 5LPFA 3VB4A 1NT1A 4YO9A 2ZPQA 1G37A 2PLXA 2VIWA 1HAIH 2GV6A 2SGQE 3TK5A 1PYTC 4X8TH 3UQVA 4B74A 3UTUH 3TGKE 1AB9C 3SJOA 4INKA 3K2UA 1C5LH 1EPTB 1WTGH 3ATIA 3SUFA 2XBYA 4KGAA 1RD3B 4A1VA 3MHWU 1OXGA 1H1BA 1GDNA 4A7IB 6LPRA 1VCPA 3KHVA 5GPIB 1FPHH 1LDTT 1T4UH 3NPSA 4GHTA 3VB5A 2WYGA 3RXVA 1C2IA 1MKWK 2XC0A 1P09A 4NCYA 1LKBA 2F83A 2FOHA 2Y6TA 1P2IA 4JZ1A 1BMLA 2Z9GA 4VGCC 3RP2A 3GCHB 2BDHA 3BTHE 1AGJA 3GDVA 1BITA 1EUFA 3P8GA 6GCHG 2JH0D 3ZV8A 1XX9A 2BLVA 1FN8A 2O8WA 1SGCA 5SGAE 2H9TH 1SVPA 1NRQH 1H4WA 1CA8B 1HAHH 3GYLB 2ZF0H 1C2LA 2ZU5A 1HIAA 2EI7A 1O36A 2HVXA 3MO6A 3ZVGA 1HAVA 1O3CA 1EJMA 1GI1A 2HOBA 1Z7KA 1PPEE 3MH5A 3BV9B 4O3UA 1MBMA 5G4BA 1KDQA 1QURH 2BQ7B 3L33A 3AW0A 1EOJA 1DLKB 1DANH 2FESH 5H4IB 3RMMH 1TB6H 3M61U 1A5IA 2BY9X 3LOXA 5GIBA 1CT2E 4E7RG 5JB9S 1Y8TA 3A8CA 1V2WT 4CRBA 4B73A 4Q7YA 2RCEA 2J95A 1GJ4H 3RXUA 3UR6A 4DJZB 1CO7E 1W11U 4X6PA 1ZHMA 1TABE 3TIUA 1BMNH 3B8JA 4I8HA 1HAGE 1O3KA 3OSYA 3PROA 4NA8A 1VITH 3K65B 3LC3A 3M5LA 5CHAB 4IN1A 1HLTH 1ZR0A 2ZU3A 3ZZ7A 2G5NA 3SZNA 1THSH 2BY5X 1SPJA 1EP6A 4B71A 1YC0A 1CQQA 3HK3B 5DP5A 1ZHRA 3SI4H 1FN6A 2QGRA 1AE8H 8ESTE 2TGAA 2TGTA 1BTYA 1QJ7B 1D6RA 3B23B 2Z3DA 1MD8A 5LH8A 2H5CA 5GCHF 4AG2A 1ELVA 1FLEE 1EOLA 4YOIA 1XKBC 2R0LA 2V3HH 1FXYA 1FV9A 3EQ0H 1C1TA 2WPJS 1LHEH 2Q6DA 1OYQA 3MH7A 2DUCA 1HJAC 2P16A 4B76A 2A32A 1EB1H 4GAWA 2Y82A 4BAHB 3PWCA 2PUQH 4FUEA 4ABDA 1WQSA 3P95A 3LGTA 3ODDA 4B2BA 4TY6A 2GD4B 2NU3E 2XWAA 3V3MA 1KLTA 2AGEX 2BD5A 4RN6A 1ELEE 3SQHE 1TA6A 2Z3CA 1UTJA 2BDGA 2XBWA 4CHAC 2STBE 2BB4A 1OS8A 5GXPA 1MTVA 4X6MA 1ESBA 2I6SA 3BTME 3ESTA 1GMHF 1UTOA 5E8EH 5FXLA 3IWMA 1P3CA 4NA7A 1CHOG 2FOMB 4YESB 1GWAA 3GY8A 1TPAE 2FOAA 3RC5A 5FPYA 1KXCA 1EP5A 2FODA 2OUAA 2ZHWH 4XBDA 2Y5FA 1YPEH 2B0FA 1FI8A 2A2QH 5AVDA 3UY9A 4PROA 1NFYA 1W8BH 2BLQA 3A80A 5EXNA 4XSKU 3DFJA 4H4FA 4IBLH 2ALVA 1K1OA 1ZHPA 8GCHF 1BJVA 1UCYK 4DIHH 1EB2A 1GJAB 5HMAA 1K28D 3AAUA 5LPRA 1J14A 3FVFB 4H42U 1BTPA 1O3LA 4I8JA 1EX3A 3HGPA 4FUBA 1GPZA 2F9BH 4FVBA 1J16A 4OS6A 4K60A 1CHOF 1AZ8A 3W95A 3NCLA 5AF9H 3ZVAA 4ZKSU 2PGBB 4KTUA 2BMGB 2A5KA 1ANBA 2Y5GA 4K1SA 4X8UH 1D3PB 1YGCH 2D1JA 1HCGA 1BTXA 1E38B 2UUFB 1TLDA 2G00A 3LGIA 1DY8A 1AB9B 1GBJA 4MNXA 2J38A 2BDCA 4UFGH 4LK4A 2PV9B 1UMAH 1O5CB 2GDEH 4B1TA 4X1QU 1KY9A 1TWXB 4D9RA 5J4QA 2NU4E 4JZFH 3SUDA 1DITH 4CHAB 1NU9A 1WTHD 4GHQA 1GBDA 1ZJKA 1C2EA 5T3HA 4FU9A 5E0GA 2YOLA 2VWMA 1TNIA 1LVOA 1F2SE 3D65E 2QN5T 3KIDU 2PTCE 3BIVH 1O2LA 2ZDVH 2ZWLH 2QF3A 3UOUA 1TONA 3A89A 1C5WB 1FY4A 3ATKA 5DP6A 4AB8A 4GPGA 1RTKA 1WSSH 2ZCHP 5T6FA 1W10U 1UHBA 4DG4A 3S7HB 4YM9A 1LPKB 2FI4E 2W7UA 4TWYA 3A81A 2ZU1A 1P10A 1XVOA 1ZRKA 2GDDA 1O35A 1SBWA 1T8NA 1K2I1 2BOKA 1AY6H 3M5MA 1P2MA 1SLXB 3P92A 4THNH 4YTAA 2H9EH 3P6ZB 3SV6A 2D26C 3H7OA 1OP0A 1O2QA 2Z7FE 5FPSA 2GCHF 2OC7A 1O5DH 2A5AA 3RXKA 1GI8B 3GY6A 1TPPA 1YPKH 2WPKS 3SU2A 2BD9A 4IGDA 1BMMH 1KDQB 5ETXA 5JBCS 3S9AA 3HPTB 4NZLA 1HFDA 1NFWA 3EDXB 4X2WA 2CGAA 1A0HB 5C1UA 2C90B 3QLPH 2BQWB 3E6PH 2TRMA 1FNIA 2BQ6B 1GJ8B 3ZZ6A 5FBIA 2ZP0H 1NTPA 3D23A 4ABFA 2FS8A 3QTVH 3O8RA 1ELGA 1JWTA 3MYWA 1BBRH 1CE5A 3QTOH 1GCTC 1QTFA 1O5GH 3A7TA 2UWOA 1MKXK 1GI9B 4Y8ZA 1C1QA 3S7KB 4UONA 5E2OA 2ZKSA 5C20A 3OTJE 3A7ZA 2XC5A 1XUHA 3LGWA 2ZDAH 4ABEA 3MNCA 1MAYA 1WQVH 1F0TA 5FBEA 1MTWA 2AGGX 1GHVH 2XBXA 1C5VA 3E3TA 1OYTH 2Q6FA 1UK4A 2A4RA 3ELAH 1TMBH 3CENA 1W12U 4TPYA 3AASA 2AS9A 1SLWB 1XUKA 2QA9E 2GMTB 2WUBA 1V2MT 8LPRA 3E0NB 3MH6A 4LZ1H 4IW4E 1P06A 1UVSH 1HAPH 1AUTC 1AFQC 2ZFFH 3EYDA 5A8YA 7ESTE 2R0KA 1P03A 5C1XA 3ZVEA 1YPHE 1OWEA 1XXDA 3M3VA 1OP2A 1C2JA 5T6GA 2SGDE 4A1XA 3SN8A 2JETC 1NM6A 4WVPE 3RXHA 1HAZB 1TE0A 4R8TB 2BX3A 4BANB 2ZHFH 3KNXA 5L30H 4NIVA 3F6UH 4OS2A 1B0EA 4O03A 5E2PA 1L1NA 4BAOB 4Y7BA 1C1OA 1WCZA 4ZMAH 1ZPZA 1G3BA 3CS0A 1ELDE 3BTEE 3L3TA 3RXAA 3RXJA 1V2PT 2HNTE 1GI7B 1K1PA 1QQUA 1O2SA 1JXPA 1P2NA 1KXDA 4Q7XA 1GG6C 3RU4T 2ZGJA 1MH0A 1LHGH 1SGEE 5L6NH 4WMEA 3T26A 1S81A 2VWNA 1YPJH 3LC5A 1ESTA 2NU1E 3K6YA 1J9CH 3RXGA 4GLYA 1DM4B 1JRSA 1E37B 1FIZA 3DA9B 1K1LA 3SNDA 1TX7A 3QX5H 2C4FH 1K1NA 3O8DA 2LNCA 2ASUB 2ESTE 2RG3A 3BTTE 3CS7A 4Y76A 3RXBA 5FAHA 1SFIA 3F9HA 1TALA 1BDAA 2J34A 4YZUA 1LVBA 1XUJA 5DGJA 1O3OA 2CV3A 3DUXH 2G51A 1TNGA 2C8XB 1FY1A 3UR9A 5EXMA 1Q31A 1GJ9B 3ZZBA 1YLDA 2J9NA 3RMOH 1S0RA 1L2EA 2VJ1A 4CRFA 2UWLA 3TGIE 4Q2KA 2GMTC 1O2TA 2A1DB 3MMGA 3SW2B 4INHA 2YNBA 1B5GH 3TITA 1DXPA 1AFQB 4HTCH 3VXFH 1AN1E 2OBOA 2FX4A 4CBNA 2TPIZ 3RXPA 1IHSH 4IS5A 1ZSKA 3BEFB 7KMEH 2ZA5A 1H9IE 1SSXA 4K8YA 2IOTA 5GDSH 3BTKE 4A6LA 4WJG2 1KXAA 3RM2H 1P01A 1E36B 1X7AC 4NSYA 1UCYE 2NWNA 3R3GB 1P2KA 1KYNA 4D8NA 1HIAB 4Y79A 4CH2B 1Y5AT 2CMYA 1O32A 5C5NA 5I46H 1TBZH 2BX4A 1ZPCA 1Z8IB 1O2HA 3FZZA 2VIDA 1GG6B 2BXTH 2OINA 1TAWA 1RTLA 3T27A 1CSOE 1ELTA 1WYKA 5HGGA 1O3IA 2BXUH 3SV7A 1G30B 1W0ZU 3PO1C 5FCKA 1QGFA 2FP7B 2CF9H 1MUEB 2BHGA 3GCTF 1A0LA 2SGFE 4NIWA 3RXQA 4AOQA 2OLGA 1NO9H 2Y7XA 2C8ZB 3W94A 1NU7B 1C5OH 5E0JA 1LO6A 1J8AA 1SGPE 1HNEE 3TJUA 1QQ4A 1AVXA 3QN7A 4DIIH 1OWHA 1XM1A 2XNIA 1MTUA 1GCDA 3ZZ5A 1K1MA 2WPHS 2GCTC 2WUCA 3SU3A 3M5OA 3UQOA 4K5ZA 1QBOA 1WAYB 3KQDA 1IQKA 1QRXA 3FP8E 3MI4A 3C27B 3PV4A 2Z3EA 1DUEA 4AFZA 4K1EA 3MTYA 2XBVA 1MZAA 4NFFA 1D9IA 1SI5H 1GCTB 1P02A 1T31A 1W13U 4CRDA 5I25A 1TPOA 1BHXF 1GI2A 3STJA 5EW1H 4JK5A 2SFAA 4LOYH 1W7XH 3UOPA 1L4DA 2JH5D 1HAOH 3VPKA 1S5SA 1TX6A 2ANMH 2G55A 3OY6U 1SQOA 3SOSA 1NPMA 1AI8H 3IITA 4JK6A 4DY7B 3K9XB 4F49A 5J4SA 3KL6A 4ABGA 5L2YH 1OWJA 1GHXH 1UO6A 1O3AA 4LXBH 3ZZDA 4A5TS 2RA0A 1C5RA 1SGQE 1C1NA 1LKAA 2BOHB 2ZFSA 1Y5UT 1O5AB 4ZKOU 3F9EA 3M5NA 2P3FH 1O3EA 1A0JA 1TQ7B 2XCNA 1S85A 2F9VA 4AFQA 1U6QA 3GISB 2SNVA 1C1SA 3PB1E 1AD8H 2ALPA 3DFLA 2ZPSA 3RLWH 2HNTF 2BLWA 3MU4A 2J2UA 1W2KH 1FJSA 4K69A 4SGAE 5A0AE 2GT8A 1C5MD 3WY8A 3A88A 1IQHA 1O3MA 5EPNA 3VB3A 3VGCC 1C2GA 1LVMA 3S69A 4MLFB 4Z6AH 1O5BB 1NS3A 2D8WA 3RDZA 3UWJH 2ZCLP 4D7FA 2FLBH 2EI8A 1P3EA 1TNKA 4XOJA 1IAUA 1FIWA 1C1MA 2AEIH 2FOEA 1GJBB 3QUMP 2J92A 1ELAA 2P3TB 4Y8XA 2VGCC 1MU6B 2ZHEH 3BTFE 1EZXC 1OSSA 3T29A 1G3CA 2ZI2H 4E05H 2GCTB 1CT4E 5EW2H 4FUJA 1KLJH 3SI3H 4I8GA 1KSNA 4UFFH 4YLUA 1EZUC 4MPXA 1RS0A 2GX4A 1DS2E 2A7JA 2ZDNA 1THRH 1UTMA 3RU4E 1QBVH 1G2MA 1MCTA 4ISLA 3RXIA 2Z6BD 1DPOA 2P95A 1A2CH 1C5QA 1XUIA 4GUXA 4MPVA 1ZJDA 1YP9A 4AYVB 1BOQA 2VVUA 1G32B 1NY22 1HV7A 2BDYA 3QDZB 1SQAA 5LGOA 3FANA 4TYDA 3ZZ9A 5JBBS 2ZU4A 1J15A 5TJXA 1O34A 1ZGIA 2BM2A 3GY7A 3MNBA 1AWFH 2A4QA 3KQEA 4NZQA 3HGNA 1GGDB 1EASA 1D3DB 2H6MA 1QL8A 1Z6JH 3QGJA 3ZZ8A 2ZO3H 3TVJB 4ZHAA 1A61H 4Z0KA 4UEHH 1Z6EA 1ELFA 3MU0A 2ZQ1A 2TBSA 1PJPA 3SQEE 3M7QA 2Y80A 1CU1A 3U1JB 3A7VA 3LT3A 1THPB 1O38A 1YPLH 4X6OA 5DP3A 1BRCE 4GVUA 1LHDH 5A2MH 2VIPA 2ZEBA 1XKAC 3MH4A 1CVWH 3SHCH 2YNAA 2K1QA 1GBCA 1W0YH 1DSUA 1F92A 3U8TH 4FUDA 3UUZA 1HRTH 1LVYA 4KTSA 3B9FH 3VB7A 2ZCKP 1IQLA 1HAXB 4YOJA 1G36A 2ZG0H 2FTMA 1DFPA 1T7CA 1NRPH 2CHAC 1JBUH 4IMZA 1UJ1A 4Y10E 1C1VH 3SU5A 1WOFA 3GCOA 4I7YH 1MQ5A 3A8AA 4U30A 2OXSA 3TH4H 4IMQA 1O2JA 2ZPRA 1S82A 1DSTA 1YM0A 3JZ2B 1G2LA 1CT0E 1OX1A 1XXFA 1QA7A 1LMWB 1DLEA 4DOQA 2PSXA 1AWHB 4BAMB 2VIOA 3TJOA 3I29A 1KTSB 1EQ9A 1GBFA 3HK6B 1UK3A 1V2RT 3LPRA 3TU7H 3S0NA 2P8OB 3M7TA 1PPBH 1O2VA 1TNLA 3HKJB 1B7XB 3CP7A 3RM0H 4JZDH 3SUGA 1C5PA 1DOJA 4BTIB 4NA9H 5IDKA 1HB0B 5F03A 4TWWA 3F9FA 3M3SA 1V2ST 4CRAA 1TNHA 2ZDMA 3SGBE 4D76A 1JIMA 1EPTC 1KIGH 2IJOB 1C5XB 3FFGA 1O2RA 2RDLA 1IQNA 4I32A 1TGCA 1C1UH 3RXOA 3I77A 2QIQA 1SOZA 1C2MA 2CN0H 1P9UA 2PUXB 3PMHB 4F4OC 4JCNA 1C2FA 2AMQA 1RXPA 2GKVE 1IHTH 3OU0A 4Y0YE 3SGAE 2VVCA 2A7CA 5DO4H 1BHXB 3U9AH 1JRTA 4ISIH 1BT7A 3BG4B 4NWKA 4JZIA 3ENSB 4ZAEA 2G81E 3O8BA 1F7ZA 2QXGA 1QB6A 2Y81A 1GHWH 3GY5A 2ZTYA 1NRRH 1SGIB 2BDAA 2W7SA 1ETSH 1RTFB 2NU2E 1TFXA 3URDA 1OOKB 1GI6A 1NRSH 3A8DA 1PQAA 4CBOA 2C93B 3ZVCA 1QL7A 2WV4A 1UVUH 4ZHMU 4D7GA 3A82A 6ESTA 1MD7A 3MNSA 1LHCH 1TNJA 2QXIA 4TPIZ 2ZTZA 4ZXYH 4DT7B 2ZFRH 1SGDE 2ZGBH