1QA0A

Bovine trypsin 2-aminobenzimidazole complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qa0A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qa0A02
2OD3B 4X1NU 3RC6A 1V2QT 3T28A 1SGQE 3KQCA 3A8CA 2F83A 4X8VH 1K1NA 2AGEX 1HAGE 2P3FH 7LPRA 4XE4A 3ATKA 1PQ5A 4ZKNU 1GBBA 1SGNE 2PGQB 1ZYOA 1P2IA 3A82A 1NM6A 1HUTH 4GHTA 1G9IE 1GI1A 3TGKE 3D23A 5BPEA 2PR3A 3RC5A 4I33A 2F91A 1NRPH 1EP5A 2AYWA 1LHCH 1WUNH 1NRRH 1AD8H 3QWCH 3UTUH 3P8OA 1MAYA 4LZ1H 1P05A 1SGTA 2ZFTA 3ESTA 3M5MA 3P70B 2PKSB 3A88A 4DW2U 1P12E 3UOPA 4NIYA 1SGEE 2Z9KA 5DP7A 2OTVA 3UWJH 2P93A 1K1LA 2BX4A 5T3HA 4UONA 2OXSA 3PMBB 2Z3DA 4IW4E 2ANMH 2Y81A 3SHCH 5C2ZA 1IQMA 1AZ8A 2EI7A 7KMEH 4X8SH 1L4ZA 1G30B 1GPZA 4MNWA 1GBAA 1X7AC 2UWLA 1XXFA 5JB8S 1WTGH 2FIRH 3V0XA 2G5VA 5FPTA 1UJ1A 3VFEA 3B23B 1YP9A 1KDQA 5FX5A 3H5CB 6GCHG 1OS8A 1Z71A 2V3OH 4MPXA 1AVXA 1MCTA 2WPJS 1XUFA 1NS3A 3ZZ6A 1A0HB 3AW1A 4NIWA 2HNTF 1WQVH 1V2ST 1O3FA 1PQ8A 3KCGH 1ZPBA 1SI5H 5EG4A 1CBWB 1PQ7A 2AIQA 3U1IB 4DOQA 4B2AA 1DT2A 1TNIA 5FBEA 3KGPA 8GCHG 1JBUH 1GMHF 1KYNA 2FI5E 1RXPA 4CRFA 2O8LA 2ZU5A 3GCHC 4XBDA 2HWLB 1C4U2 2DE8A 4A7IB 1V2NT 2PLXA 1AIXH 4J2YB 1O3LA 4I32A 4OS2A 1E34B 3PROA 1PPHE 1GI8B 1QL8A 1O32A 2G55A 2A2XH 3TH3H 7ESTE 1C1QA 2BXUH 3MO9A 3OYPA 5HM2A 1UCYE 2BDYA 4CRAA 1T32A 1WBGB 4WMFA 1Q3XA 2H9HA 1ETRH 3UUZA 1MD7A 1W2KH 1UK2A 3RXBA 1QB1A 2ANKH 1TFXA 1GHYH 2ZDKA 3A87A 3RXKA 1C1RA 1C2IA 1ZJDA 3E8LA 4Q80A 2C8WB 1GMCG 1MQ6A 1ZZZA 1G32B 3S9AA 5G4BA 2GDEH 1GHAF 2PSXA 2PWXA 2Z7FE 1ZMJA 4B71A 3MU4A 1QBVH 2FOBA 3M36A 3PV4A 3MWIU 2A4OA 3MMGA 1TX8A 1ETTH 3UOUA 1PJPA 2WV5A 5EPNA 1LTOA 3PM3A 1ELGA 2PGBB 1F0TA 2ZU1A 4IBLH 1XKAC 3BN9A 1LKBA 2FEQH 3RMMH 1FN6A 1PPEE 1O2PA 4DGJA 2O8UA 1SL3A 1AFEH 1H9IE 2LNCA 3Q3YA 2TGAA 4ABJA 5DP3A 4LZ4B 1CE5A 5AF9H 1IQLA 1FY3A 3SNEA 1J8AA 2VWNA 1VJ9U 2VWMA 2O8MA 3SJ9A 1LPZB 2ZU3A 2BLWA 1W11U 1BITA 5LPRA 4X6NA 3SO3A 3FAOA 3GCNA 2Z94A 5ESTE 5I25A 1P8VC 3FVFB 5FHTA 1EAIA 3SUGA 2IOTA 3QTOH 2Y5GA 1FPHH 1H4WA 1SQOA 1GBJA 5A0CA 3M3SA 1S0QA 3QDZB 1F2SE 5JBBS 1FIWA 3GCHB 2FS9A 3PB1E 5FX6A 1P2QA 2ZHEH 1RTFB 4B2BA 4BTUB 3K2UA 1BJUA 3BTTE 5DJ7A 1RRKA 1C2EA 2VH6A 4MNVA 1AB9C 3O8CA 1S6HA 2BYAX 1C2DA 2PTNA 2QC2A 4AYVB 1DDJA 1HAVB 1EAUA 1A61H 1UCYK 1GVZA 2FTMA 1XKBC 3S7KB 1ESBA 3F68H 4E05H 4I8HA 3RXEA 1KXCA 2WYJA 1BMLA 1O3HA 1UTOA 1NO9H 4WJG2 3GDSA 3A84A 1DXWA 2BY8X 4O3TA 1QR3E 1SMFE 1HFDA 3A7TA 2RDLA 1SFQB 3KIDU 1XM1A 1V6DA 2HNTC 7GCHF 1P2NA 2BDGA 1HBTH 1O2HA 2F9OA 4IGDA 4K60A 1AKSA 1E37B 2BD2A 3FFGA 1O37A 4DURA 1Y5UT 1GVKB 3M3TA 1Q2WA 1Y3YA 4DVAU 2OQ5A 1O2GH 4Y7BA 1FY8E 1P2JA 4Y11E 4ABAA 1IQKA 4UFEH 2ANWA 1ZSKA 4O3UA 2ESTE 5F8TA 5TCCA 1GJBB 3HATH 5B6OA 1ELFA 1MD8A 3PTBA 3UQVA 4I31A 4ZHLU 5TJXA 2KAIB 2Y7XA 5C67A 2GGVB 4WH8A 1SVPA 2AH4X 3ZYDA 1C1OA 3EDXB 2FP7B 4FXGH 1BT7A 2VH0A 2A1DB 5L6NH 1W7GH 4MQAA 5F6MA 2HGTH 3S9CA 2EI8A 1C2KA 1EX3A 1BBRE 2ZP0H 1C5NH 1EPTC 3RXIA 3ZZ7A 1VITG 1TNKA 2XC4A 4JK6A 3GY6A 4B74A 5H4IB 2OBQA 1OP8A 2CHAC 2SGFE 1MBQA 3BTQE 4TPYA 3GY3A 1NRNH 3V3MA 1SLWB 4FUIA 4ZKOU 4AOQA 5LH8A 5JBCS 5FCRA 1MMJN 1GBCA 4ZAEA 3JZ2B 1LQDB 1MU8B 1F0RA 1O3IA 2BZ6H 1EZSC 3KL6A 4BANB 2PSYA 1O3AA 3A81A 3S9BA 4ISOA 4O03A 1Z8JB 3SHAH 4CR5A 1XVOA 1TPOA 3D49H 3TK9A 1B5GH 2W5EA 1OPHB 1S0RA 4YLQH 2XXLA 1K1PA 1ACBE 2FYQA 3DA9B 4YOIA 4GUXA 4NA7A 4OS1A 5J4QA 1CA0C 1AB9B 1UK3A 3HGNA 4AB8A 3MOCA 1TPSA 1BRUP 3OTJE 1A4WH 2I6SA 1MTSA 3SNBA 2J94A 2ZI2H 1GCDA 5T6FA 2WPMS 1K1IA 1IQJA 1GDUA 1ABIH 2RCEA 4OGXA 1DLEA 1SGYE 1AO5A 2C8YB 4AN7A 4CH8B 1QJ6B 1QJ1B 5FPYA 3ATLA 1RJXB 1ELVA 5C1UA 4MLFB 1PPBH 3FP6E 4YT6H 2XWBI 1UVOA 2VIPA 4XFQA 1EZUC 4D9RA 3P17H 3ZZ3A 4OS4A 1D3DB 4IMZA 5IYTA 3TITA 1HPGA 3ZVAA 1DE7H 2ANYA 3ZZ8A 1LVBA 5EGMA 4OGYA 5AHGH 1P03A 1LKAA 1MCVA 1QB9A 3MH5A 2BXTH 2WPHS 4FUBA 2ZIQH 3LT3A 1MQ5A 1HAPH 3LPRA 4Q7XA 1WU1A 1YPHC 3QGJA 3RXGA 3P95A 1VR1H 2GV6A 2XYAA 2GCTC 1O5EH 1ZHPA 1K22H 1C2FA 1C5LH 1T8OA 3CS0A 3S0NA 1BBRK 2PW8H 3KQDA 3GDUA 2GD4B 1EPTB 2A45B 1EB1H 5JBAS 1P06A 4FUJA 2V3HH 1TALA 1LCYA 4YESB 2CHAB 4LXBH 4ESTE 1J16A 1FJSA 1ZTLA 2B9LA 2F9VA 1SGFG 1PPZA 5EQSA 2XC5A 9LPRA 2D1JA 2J2UA 3MH7A 1OP0A 1RD3B 1ANCA 1O2NA 3W94A 3ENSB 2Q6FA 3SQEE 4JZEH 2R9PA 4ABGA 1OSSA 1ZTJA 2HALA 1HAYB 3SN8A 2A7CA 1V2VT 2H2ZA 4YO9A 1EB2A 2ZGXH 1HDTH 1LPKB 3E90B 3RDZA 4K5ZA 2C93B 3DFJA 2XWAA 3UY9A 1CGJE 4B75A 3U98H 1TMUH 1TA6A 1TNJA 1GMHG 1HXFH 1MAXA 3S69A 1C1UH 1CA0B 2SNWA 1C2MA 1L1JA 3SI4H 3A7VA 2XBWA 1KXEA 1ZMLA 5T6GA 3P8NA 1LHGH 3PLBA 3RLYH 1GHWH 2XCNA 1FNIA 4FU7A 2GZ8A 1P2MA 4NWLA 1TABE 1CQQA 2CMYA 1T8MA 2BDBA 1OKXA 2FM2A 3I29A 3SJIA 1NFWA 1AUTC 5AVDA 4DG4A 3RC4A 2Z9JA 2BDHA 4YM9A 2C4FH 3A83A 3E0PB 5A0BA 1SGCA 1HAHH 1PPCE 2STBE 4CHAC 2A4RA 2QF3A 4DCDA 5FPSA 3T62A 2W3KA 3ZV8A 3T27A 4WXIA 5EXMA 4BOHA 1UHBB 1TA2A 1YLDA 2Q6GA 1V2LT 4WXVA 1ZGVA 3U1JB 2WPLS 1LHEH 1OP2A 1S83A 3TU7H 2BD3A 5GPIB 1GBIA 1QA7A 2ZKSA 3TK5A 1XUKA 2AMDA 5L30H 1C5QA 3V7TA 1GHAG 3SZNA 3TPIZ 1BUIA 1KTSB 1B0EA 8KME2 1SHHB 1TNGA 3P92A 2G4TA 4R0IA 1O34A 2GCTB 1JIRA 1V2RT 4AFQA 1GHVH 3ZVGA 2G8TA 1SBWA 3FZDA 1MUEB 3DD2H 4YOGA 1GG6C 1SQAA 3RXAA 4Y7AA 2Y5FA 1NESE 1AUJA 5HYOA 1S5SA 3SV7A 1N6XA 2FMJA 2OUAA 4NGAH 5GDSH 2A31A 4X6PA 3SGBE 3AASA 4HI3A 3RXLA 2STAE 4FUCA 4CRDA 4DT7B 1XUJA 1TONA 1KLIH 5DKMA 1C4Y2 1YCPH 2TRMA 2UUFB 1YPLH 1BA8B 2B5TB 2OC0A 2ZFFH 1CT0E 3LU9B 1HAVA 1W10U 1HAOH 2QXGA 4Y6DA 1C2LA 1E38B 2ZHFH 4A5TS 2WUCA 2BHGA 2EC9H 2C90B 4X1PU 2H9EH 2HVXA 1NPMA 1O3NA 2Z9LA 5EOKA 1F7ZA 3V12A 2BD7A 4FVDA 1PYTC 3BTDE 2AMPA 2P94A 3U9AH 1KSNA 4WVPE 1A2CH 3SUDA 4WMEA 4BAKB 1W14U 1EJMA 3CS7A 3SV9A 4H4FA 3RXTA 4ASHA 2CJIA 5DGJA 1DLKB 4WY3A 1C5WB 3T29A 4BXWA 3RXCA 1SFIA 4CHAB 4BXSA 1ESTA 1S84A 3F9EA 2FLRH 3MFJA 1KLJH 3ZVBA 3BG8A 1UVPA 1GHBF 1D9IA 1YPGH 7GCHG 4LOYH 4MPVA 2SGPE 4ABHA 2C3SA 4AFSA 2W7SA 3M5LA 3FANA 1DXPA 3NZIA 3UNRA 2HNTE 4UEHH 1HNEE 1NRSH 5CHAC 5DK1A 1DX5M 1C1VH 2ZDLA 1B0FA 3ELAH 5ETXA 1AE8H 1OWHA 2VVUA 1L1NA 1O2YA 2GP9B 3TLOA 1BB0B 1AI8H 2BD5A 1FPCH 2FX6A 3QUMP 4AFZA 1IAUA 1GG6B 3UFAA 4K69A 1RFNA 1P2KA 4CH2B 1O3GA 1EKBB 1Y3WA 3SQHE 3SV6A 1H9LB 2OP9A 1FAKH 4K2YA 3PWCA 5SGAE 1Y3UA 2V35A 4ZUHA 1ZGIA 4UFFH 4OS5A 1CGHA 4AFUA 1J17T 1NC6A 3ZVCA 4AX9H 1DITH 1HB0B 4MPWA 3RP2A 1VGCC 3MH4A 3TGIE 1FY5A 1FQ3A 1V2JT 4I8KA 1TLDA 1Y59T 2F3CE 1IQHA 1MKWK 2FOHA 3LC5A 4SGBE 4XDEA 4BAOB 1C5PA 3SUEA 1C5XB 4DIIH 4GCHF 1MH0A 1M9UA 2W7UA 1LQEA 2ZGHA 1O30A 1GDNA 2A7HA 3HK3B 2XCFA 3EA8A 3M7TA 4GAWA 3A8DA 3MNXA 1AVWA 3GYLB 2A5AA 1A1RA 4H6SB 2H1UA 4CBOA 1O2VA 3SJ8A 2OCVB 5L2ZH 3E0NB 3RXDA 4JZDH 1ELAA 2ZU2A 4A1XA 2G52A 1EP6A 3DFLA 4E7NA 1TMBH 2VGCC 5EPYA 3RU4T 2NU2E 1HAIH 1O2OA 2F9PA 1E0FD 1D3TB 2ZQ2A 1G3EA 1O2UA 3A7YA 3C27B 2D26C 1GHXH 3OU0A 5F8ZA 1AY6H 4CRBA 4Y0ZE 1DWEH 4Q7YA 3E1XB 4ZXXH 1KIGH 1O5FH 1TOMH 1ABJH 2AGIX 2ZTYA 2JH0D 1C1NA 2VINA 2BVXH 3AAVA 1FUJA 4KP0A 3VB4A 1PYTD 2ZG0H 2SNVA 1KXDA 1IQGA 2NWNA 1W0YH 4ZHMU 3CP7A 1SQTA 2BOHB 2FESH 1S81A 1TE0A 1EAXA 1H8DH 1BHXB 2PKAA 5CHAB 4Z6AH 4FUFA 3LJOA 3DUXH 4IS5A 1OYTH 3B8JA 3SU0A 3UNQA 4U2WA 1RTKA 3E16B 4KKDA 1THRH 1EPTA 1LPGB 2OC8A 3Q76A 1YM0A 4ZHAA 1Y3VA 1PPGE 2Z9GA 2BLQA 1F5LA 2ZFPH 4GPGA 5HGGA 6CHAC 1QQ4A 1O5DH 1IQNA 1DANH 3HPTB 3M7QA 2YOLA 3ZZCA 3ZZBA 3O8RA 4NIXA 1AVGH 3BIUH 1THPB 2P3TB 2ZCHP 1T8NA 1N6YA 1O3DA 1YPHE 1WOFA 1JOUB 3Q00A 2JH5D 4TWYA 2AS9A 2CGAA 3TJOA 1HIAB 3VXEH 2QF0A 1WQSA 4UFDH 4Y76A 3T26A 5AFZH 1P9SA 1C5RA 3RXFA 2G81E 1O3MA 3GY2A 1GBHA 4WMDA 2ZPRA 3NK8A 1N8OC 2RA0A 1VGCB 1AGJA 4SGAE 3OX7U 2FXRA 3T5FH 4OS7A 1O38A 2FLBH 3NKKA 3F9HA 5JB9S 3M7UA 1Y3XA 2BY5X 2ZTZA 4X0WU 2ZDMA 2ZECA 4JZ1A 2UUYA 2PUXB 3S7HB 2TGPZ 2ZNKH 1NT1A 2SFAA 3PMHB 1MTNC 3GCTF 2ZC9H 4MNYA 1O35A 1GJ8B 1G3DA 3EA9A 4A1TA 2QN5T 1QGFA 1TWXB 2NU0E 1UCYH 4D9QA 2VJ1A 3LOXA 5EXLA 2WPKS 3ZVFA 3SU2A 1CT2E 2ZFSA 3L3TA 1UVUH 2J38A 3BG4C 2BVSH 2HRVA 5A0AE 3BTGE 1QNJA 1W12U 1PPFE 4Q7ZA 3RXPA 3PLPA 3KN2A 1EZXC 4JZIA 3VB5A 1PFXC 4BAQB 1EXFA 2VGCB 1UHBA 3LIWA 5CMXH 3KQBA 3SW2B 1K28D 1DFPA 2BQ6B 2VIQA 3R0FA 2ODQA 1MTWA 1FDPA 3QX5H 1CSOE 2XNIA 3QZQA 4ISNA 1ANEA 5LPEA 5EW2H 2CN0H 4H6TA 4IN2A 3MHWU 4MNXA 2QCYA 1JWTA 4U01A 1AU8A 3ZVEA 2VIWA 4UFGH 3GY7A 1O3JA 3ZZ5A 3RXRA 3FP7E 3SJOA 1XX9A 2GDDA 3GICB 4KTCA 4X2YA 2GCHG 3F9FA 2ZFQH 1JRSA 1LHFH 3MH6A 1O36A 4YZUA 4FU8A 2VIOA 2ZA5A 1C5TA 3F1SB 3ZZDA 1S85A 3TJUA 4I7YH 3BTKE 1YPKH 3F6UH 2CXVA 1HYLA 6CHAB 1K1JA 2HPQH 4ABIA 2BDCA 1TGSZ 1F92A 3ZZAA 3L33A 1YBWA 2OQUA 3O8BA 2ALVA 2V0BA 1ORFA 3M5OA 3EE0B 3OSYA 3SV2H 3K65B 2GKVE 3LKWA 1PQAA 4YTAA 5I46H 2FDAA 4O97A 4D7GA 5JBTA 1XUGA 2BLOA 1QRWA 1GHZA 4XSKU 1C5VA 3NCLA 3NUMA 2FI4E 2O8TA 1QURH 1GCTC 1O5CB 2WUBA 3BEUA 1N8OB 2WPIS 3PYHA 4KTSA 2BD8A 2QA9E 1VZQH 1O2JA 5AFYH 5PTPA 3PMAB 1IOEA 3TVJB 3VB3A 1L1GA 1NN6A 1YF4A 1RGQA 2H5DA 2P16A 1G3BA 3RXMA 1SOZA 4RKOB 2CF8H 4ABDA 1SGRE 3QO6A 3Q3XA 1DOJA 2EEKA 1C1MA 1F5RA 4RSPA 5C1XA 3MNCA 1U6QA 3MU5A 1MTNB 3MI4A 3TH4H 1YPMH 1WAYB 2VNTA 1WSSH 2VWOA 4TPIZ 3BTME 4AORA 1YYY1 4NA8A 2Q1JA 5JDUB 2QXHA 1TBRH 3BG4B 3OY5U 1WTHD 4R8TB 3LGUA 3UREA 1D6RA 1ZSJA 4ZKRU 3KNXA 2J9NA 1OWDA 2UWPA 3MYWA 1BOQA 1JXPA 1GWAA 4LK4A 1HRTH 3UQOA 4BAMB 1VJAU 4D8NA 3GY4A 1GI2A 3A89A 4ZROA 1O2RA 2QAAA 5C20A 4X6MA 1YPEH 1O0DH 5EW1H 2ZU4A 2OC7A 1KXBA 1TGTA 3QZRA 4JYUH 4NSVA 5T6DA 1B7XB 1GVLA 4Y79A 3W95A 1NU9A 1Z7KA 2ZCKP 3VPKA 1G3CA 4A6LA 3GY8A 4K1TA 2B8OH 1ZRKA 3MTYA 3A7XA 1GHBG 1F0UA 1G2LA 2FTLE 4AG2A 3QGNB 3QTVH 3LDXH 1GI9B 3ODFA 3D65E 5EU8A 2JETC 4NFEA 3LGYA 1GI6A 4NZLA 1DY8A 1IQEA 5DPAA 4ABEA 1GMDG 3UR6A 1QY6A 2JKHA 1BBRH 2R2WU 4FU9A 1BTPA 1J9CH 5CE1A 4BTIB 3BSQA 3H7TA 3SNAA 1BTXA 5DP6A 4ZKSU 4AB9A 4MDSA 2VIVA 4E06H 1F5KU 1O3BA 4ZH8A 2TGTA 2WV4A 1J15A 3QK1A 4X6OA 1NRQH 2ALPA 1QQUA 3A80A 5L2YH 1MZDA 4CREA 2J4IA 3PWBA 1ZSLA 2GTBA 3VGCC 1CHOF 1A0JA 1GCTB 3U8TH 1XXDA 1CU1A 1D6WA 1O2WA 1Z1IA 4THNH 1C2JA 1NFUA 2PKSC 1TB6H 1W8BH 2RG3A 2V6NA 4ISHH 1ZMNA 3STJA 1TPPA 3HK6B 2OC1A 1W3CA 2FZZA 2FYRA 3E3TA 2GCHF 4UE7H 3BTFE 2FOFA 1MKXK 1SG8B 4X8UH 2GVFA 2ASUB 3U8OH 2G00A 3MNSA 1AWFH 2P59A 3KEEA 1IHSH 2F9NA 1TNHA 4GCHG 4CRGA 3P6ZB 5LPFA 3P8FA 3E6PH 3MO6A 4CRCA 2EA3A 2OLGA 3VB6A 4FUHA 2IPHA 1V2TT 3IITA 3DT0H 4HZHA 3RMLH 1ZRBA 1TGCA 1YLCA 4X2WA 4B76A 1O5AB 2ZHDA 3RXQA 1KLTA 1GI3A 4H42U 2THFB 1TQ7B 5F8XA 3A86A 5GCHG 3UNSA 1P10A 1GBLA 4GVUA 1C4V2 5EQRA 1ARBA 1H8IH 1QL9A 1YGCH 4MVNA 1GI7B 4FVBA 1A3EH 4X2VA 3URCA 2BY7X 2VU8E 1NY22 4U32A 3UPEA 1GBEA 1GBDA 1FZZA 1Y8TA 1N1LA 4DJZB 4A1VA 4TYDA 4JCNA 4I8GA 2Z6BD 2ODPA 1RTLA 1W13U 4WH6A 4XBCA 4K8YA 1ZHMA 1WCZA 2JETB 1BMMH 1D3PB 1UVTH 4FUDA 1GJCB 2A5IA 2FOMB 2HLCA 2R2MB 2TPIZ 1OWJA 1G2MA 3G01A 4IMQA 3QN7A 4AYYB 1J14A 4BAHB 3A85A 1BTWA 4Q2KA 2C8XB 3Q77A 1Z6JH 1DM4B 1P01A 5HXFA 1AZZA 1OXGA 1UTJA 1HIAA 2GT8A 3SBKA 1TMTH 1V3XA 1EAWA 5DP5A 4AGKA 1O2TA 3ZVDA 3ZYEA 1ELBA 1C1PA 3BV9B 4INLA 2TIOA 2WINI 5GJ4B 3VB7A 1AQ7A 3VGCB 1EOJA 1P11E 1BDAA 1FV9A 4D76A 3KF2A 1RIWC 1TYNA 1BRAA 2B0FA 3TJNA 4DIHH 1C1WH 3P8GA 1KTTB 1AWHB 3RU4D 3GY5A 4BNRA 4Y10E 1UTLM 1QBNA 1BJVA 2G51A 1GI4A 2GX4A 1MTVA 1GGDC 1HV7A 1FY1A 1GI0A 2P8OC 1P09A 2YNBA 3URDA 3TGJE 1ELDE 2VB0A 4CR9A 3LC3A 1DSUA 3RXVA 1EASA 1ELEE 2ZEBA 1TPAE 1K1MA 4VGCC 1NROH 5K0HA 1GJAB 1TGBA 1GMDF 3GCTG 1O3OA 2KAIA 5BRRE 2ZTXA 2VIDA 2NU1E 1O5BB 3SUFA 3C1KA 2P3UB 1A5HA 1O3EA 5FAHA 3QLPH 5E2OA 4WF8A 3SI3H 3STIA 1VITH 1BRCE 1FLEE 2IN2A 2ZDNA 1C1TA 2HPPH 4NZQA 4QT8C 1LVYA 4HGCA 1GJ9B 1H1BA 2GT7A 2BLVA 3MU0A 3GCOA 5K7RA 3K6YA 1O31A 4Y8ZA 2QXIA 1SC8U 3F9GA 1SLXB 2FOAA 4YT7H 1MTUA 1OWEA 2UUJB 1T31A 2XC0A 5C5NA 4Y8XA 4ISIH 5C1YA 3RM0H 1SLUB 3O8DA 1W0ZU 2ZHQH 5IDKA 3RLWH 2Y6TA 1P3CA 1TGNA 1NFXA 5GIBA 4M7GA 3RXOA 1BMNH 2BDIA 2ODYB 1GBTA 1V2KT 4TY6A 2ZPQA 1GBMA 2BD4A 1HAXB 1CHGA 1A0LA 1CGIE 2K1QA 4IC6A 2FX4A 6LPRA 1TX7A 4NWKA 3M3VA 2TGDA 3LJJA 1V2PT 1K21H 2AERH 2R3YA 1DWCH 2ZDVH 1SHYA 3K6ZA 4U30A 1HGTH 3E91A 2BY6X 1Z8RA 1DICA 1MZAA 3I78A 1TAWA 1DPOA 1QRXA 3D62A 3TNTA 1HJ8A 1SGFA 3RUOA 2PTCE 2F9UA 2W26A 3HGPA 3SU3A 1HXEH 3N7OA 2JH6D 3ZZ4A 4AG1A 1DS2E 1A46H 2A5KA 1A3BH 2VWLA 1RIWB 5GCHF 2BDAA 2HOBA 1O3CA 5ESBA 1BTYA 3RXJA 1NZQH 1UMAH 2ZHWH 1K9OE 2BD9A 4X1QU 3A7WA 1HJ9A 1VCWA 3NPSA 4MG3A 1AE5A 8LPRA 1C5ZB 2G4UA 1MKWH 1GGDB 1ID5H 4HTCH 2P8OB 5FBIA 1Z1JA 2ZGBH 3TNSA 1V2UT 1AHTH 2FO9A 1EQ9A 1O2ZA 1HJAC 4X2XA 1YKTA 3UWIA 2BVRH 5A8YA 2FI3E 4IN1A 4ZMAH 1QRZA 2R0LA 1W7XH 2A4GA 4NG9H 4VGCB 1LDTT 2H6MA 4XOJA 2BZAA 4YLUA 4O9VA 1TBZH 4TWWA 5E0HA 4GHQA 4NSYA 3B9FH 4NCYA 4Z0KA 1O2KA 1FIZA 1LVMA 2BQ7B 1CVWH 4I8LA 3TK6A 4B2CA 2FOCA 4OS6A 1GBFA 3T2NA 3GOVB 4JZFH 1GBKA 4CBNA 1CA8B 3PO1C 3Q3KA 1BTZA 5E8EH 2OBOA 3H7OA 3RMOH 3U69H 4K1EA 4X8TH 1O33A 1P9UA 1QBOA 2Z3CA 4KELA 3RMNH 1FMGA 4K3JA 2C8ZB 4ISLA 4MPUA 3SU6A 1LO6A 2A0QB 1ELTA 3BEFB 4B73A 5A2MH 2SGDE 4JYTA 4JYVH 4XBBA 1Z8GA 1BCUH 5A8XA 2XW9A 2BX3A 2VVCA 1P04A 1D4PB 3JZ1B 3TIUA 3ITIA 2XRCA 2BM2A 3OY6U 5C3NA 4KGAA 4K8BA 2QIQA 3VEQB 1EUFA 1UTMA 1T4UH 2FWWA 1XMNB 1P02A 4INKA 4BTTB 1KY9A 3FP8E 1T7CA 2DE9A 2SGEE 5EODA 1HAZB 1SOTA 3SNDA 1YCPM 2ULLA 2BOKA 3A8BA 2LPRA 1EATA 1ZLRA 1GDQA 2Y82A 1FI8A 1C2HA 3TJVA 1ZPZA 3RXUA 1ZTKA 1OX1A 1SR5C 1O2QA 1A5GH 3V13A 4AGJA 2Y5HA 1BZXE 1V2MT 4INHA 1C2GA 2CV3A 3LGWA 1BTHH 1JMOH 1G37A 4MTBA 3EYDA 1C9TA 1QHRB 1DUAA 1TRYA 3SGAE 3VXFH 4X1SU 6GCHF 3IWMA 2GZ9A 3RU4E 2ZFRH 5EQQA 2ZQ1A 1O39A 4DY7B 2Y7ZA 4TY7A 2ZWLH 4ABFA 5HM9A 1CT4E 1Y5AT 2H9TH 2OINA 1OWKA 3HKJB 2YNAA 1INCA 3BTWE 5DP8A 1CHOG 4NIVA 3SU5A 2ZF0H 1XUHA 1KDQB 3MU8A 8GCHF 1Y5BT 2FOEA 2J34A 4WWYA 2O8WA 2ZPSA 1HJAB 4FUEA 5E2PA 5J4SA 1EZQA 2QXJA 1AMHA 5FXLA 5F03A 3NWUA 5HMAA 4Y0YE 5DP9A 1O3KA 1AFQC 1O2LA 1S82A 1TBQH 4RN6A 1UVSH 1G36A 4ZXYH 3RM2H 1P2OA 2VVVA 3UIRA 3T25A 1L2EA 3AW0A 3AAUA 4YOJA 1HCGA 3TH2H 3LH3A 1GL0E 3SORA 5TCAA 1ANDA 5EXNA 2A2QH 1FY4A 4Y8YA 1QIXB 2BMGB 1GJ7B 2F9BH 3LGVA 3SNCA 1C5OH 2H5CA 1Q31A 1DUEA 3PO1B 1QTFA 1SGIB 3ATIA 3EQ0H 2A4QA 3I77A 3SOSA 3A7ZA 2AGGX 4J1YA 1C5YB 2AEIH 1FXYA 1TX6A 3EGKH 2P95A 1GMCF 2BB4A 1THSH 2O9QA 4RKJB 2AIPA 1AN1E 1BMAA 1C5UA 3BF6H 3GISB 3RXSA 1ELCA 1O3PB 1BIOA 3SJKA 2ZGJA 4FUGA 1O2MA 4PROA 2ZDAH 1ZHRA 5JYIA 4JK5A 1UTQA 1NU7B 2QYIA 2FODA 2Q6DA 1IQFA 2PV9B 1DVAH 1F0SA 1ZR0A 1UTNA 1MU6B 1WV7H 3SU4A 1XVMA 1DY9A 3CENA 4I8JA 1YC0A 2GMTC 2SGQE 1UO6A 1OYQA 3ZV9A 1JRTA 3LH1A 1ANBA 1KXFA 1C5MD 3PTNA 5A8ZA 1YPJH 2G5NA 5DP4A 1UK4A 2NU4E 1P0SH 1DWDH 3ATWA 1A7SA 2Z9IA 1GL1A 1LMWB 4GSOA 3MU1A 1Z8IB 1O2XA 2ZO3H 1ARCA 2XTTB 1O2SA 2RA3A 4UDWH 1ESAA 2B7DH 1V2WT 3FZZA 2CF9H 5DO4H 2J95A 1EJAA 1C5SA 2DUCA 1SSXA 2QGRA 1LHDH 2M5TA 1SGPE 4A92A 2W3IA 3A8AA 2IJOB 2FPZA 1TNLA 2Y80A 2PKAB 2ILNA 1C9PA 1MBMA 1AFQB 3BEIB 2I6QA 4F4OC 9ESTA 3BIVH 1FN8A 1QJ7B 2UUKB 1QCPA 3BTEE 1L4DA 3DHKH 1H9HE 1ETSH 1NTPA 1K2I1 2XBYA 1T8LA 1FAXA 5E0JA 1T4VH 3K9XB 2J92A 3SGQE 3BTHE 2SGAA 5E0GA 1BQYA 1DWBH 3MNBA 3HKIB 3L6PA 3UR9A 1SPJA 3LGTA 4IC5A 1P3EA 1VCPA 1L0ZA 2R3UA 2GV7A 3ATMA 1ZPCA 1EJNA 3RXHA 1S6FA 3M5NA 1QA0A 2ZGCA 3GYMA 1BRBE 4Y71A 4E7RG 6ESTA 2AMQA 2XBXA 2EI6A 2D8WA 2TBSA 2GZ7A 2A32A 3LGIA 1DSTA 2PFEA 4NA9H 5DG6A 1TRMA 1QFKH 3R3GB 1BHXF 3M61U 1TIOA 3ZZ9A 1QB6A 1E35B 1GI5A 4HFPB 3M35A 1C1SA 3U8RH 1AKSB 3MO3A 5JPMH 4JMYA 1A5IA 1TRNA 1TOCB 2BQWB 1V2OT 3SV8A 1O2IA 1VCQA 2BY9X 2AFQB 2QY0B 5LGOA 3AVZA 2FOGA 1GJ4H 2QV1A 2WYGA 1P57B 1WYKA 2GMTB 2UWOA 1ZJKA 1JIMA 1KXAA 1K1OA 3PLKA 1IHTH 1VITF 8ESTE 4K1SA 2D2DA 4X1RU 4ABBA 3LONA 1OWIA 4F49A 1QL7A 3KHVA 2PHBA 1SB1H 3IG6B 1GJ5H 3GDVA 1XUIA 4KTUA 5C5OA 1IQIA 1EOLA 2NU3E 5GWZA 1CBWC 5A09A 5GXPA 4GLYA 4D7FA 2ZZUH 2FS8A 1GJDB 1SGDE 1MKXH 3M37A 1TQ0B 3WY8A 2A7JA 5FCKA 1YCPK 1Z6EA 1ZOMA 1UTPA 1HLTH 1NFYA 2R0KA 1E36B 3PMJA 1UTKA 2XBVA 5ABWA 1SLVB 3EAJA 4NFFA 1CO7E 2ZCLP 4UD9H 3ODDA 2PUQH 1RS0A 3NXPA 1GJ6A 1FONA 2BTCE 4AZ2B 1OOKB 4B1TA 1BTUA 3SU1A 1LVOA 3KQEA 3EA7A 1D3QB 1O5GH 2Z3EA
chains in the Genus database with same CATH superfamily
2OD3B 4X1NU 3RC6A 1V2QT 3T28A 1SGQE 3KQCA 3A8CA 2F83A 4X8VH 1K1NA 2AGEX 1HAGE 2P3FH 7LPRA 3SZEA 4XE4A 3ATKA 1PQ5A 4ZKNU 1GBBA 1SGNE 3F0OA 2PGQB 1ZYOA 1P2IA 3A82A 1NM6A 1HUTH 4GHTA 1G9IE 1GI1A 3OEHD 3TGKE 3D23A 5BPEA 2PR3A 3RC5A 4I33A 2F91A 1NRPH 1EP5A 2AYWA 1LHCH 1WUNH 1NRRH 1AD8H 3QWCH 3UTUH 3P8OA 1MAYA 4LZ1H 1P05A 1SGTA 2ZFTA 3ESTA 3M5MA 3P70B 2PKSB 3A88A 4DW2U 1P12E 3UOPA 4NIYA 1SGEE 2Z9KA 5DP7A 2OTVA 3UWJH 2P93A 1K1LA 2BX4A 5T3HA 4UONA 2OXSA 3PMBB 2Z3DA 4IW4E 2ANMH 2Y81A 3SHCH 5C2ZA 1IQMA 1AZ8A 2EI7A 7KMEH 4X8SH 1L4ZA 1G30B 1GPZA 4MNWA 1GBAA 1X7AC 2UWLA 3FOAA 1XXFA 5JB8S 1WTGH 2FIRH 3V0XA 2G5VA 5FPTA 1UJ1A 3VFEA 3B23B 1YP9A 1KDQA 5FX5A 3H5CB 3UB0A 6GCHG 1OS8A 1Z71A 2V3OH 4MPXA 1AVXA 1MCTA 2WPJS 1XUFA 1NS3A 3ZZ6A 1A0HB 3AW1A 4NIWA 2HNTF 1FX0B 1WQVH 1V2ST 1O3FA 1PQ8A 3KCGH 1ZPBA 1SI5H 5EG4A 1CBWB 1PQ7A 2AIQA 3U1IB 4DOQA 4B2AA 1DT2A 1TNIA 5FBEA 3KGPA 3GS9A 1JBUH 8GCHG 1GMHF 1KYNA 2FI5E 1RXPA 4CRFA 2O8LA 2ZU5A 3GCHC 4XBDA 2HWLB 1C4U2 2DE8A 4A7IB 1V2NT 2PLXA 1AIXH 4J2YB 1O3LA 4I32A 4OS2A 1E34B 1OHHD 3PROA 1PPHE 1GI8B 1QL8A 1O32A 2G55A 2A2XH 3TH3H 7ESTE 5IK2D 1C1QA 2BXUH 3MO9A 3OYPA 5EJLA 5HM2A 1UCYE 2BDYA 4CRAA 1K0HA 5CDFE 1T32A 1WBGB 4WMFA 1Q3XA 2H9HA 1ETRH 3UUZA 1MD7A 1W2KH 1UK2A 3RXBA 1QB1A 2ANKH 1TFXA 1GHYH 2ZDKA 3A87A 3RXKA 1C1RA 1BMFD 1C2IA 1ZJDA 3E8LA 4Q80A 2C8WB 1GMCG 1MQ6A 1ZZZA 1G32B 3S9AA 4ZCNA 5G4BA 2GDEH 1GHAF 2PSXA 2PWXA 2Z7FE 1ZMJA 4B71A 3MU4A 1QBVH 2FOBA 1S6LA 3M36A 3PV4A 3MWIU 1WXRA 2A4OA 3MMGA 1TX8A 4DT4A 1ETTH 3UOUA 1PJPA 2WV5A 5EPNA 1LTOA 3PM3A 1ELGA 2PGBB 1F0TA 2ZU1A 3OE7D 4IBLH 1XKAC 3BN9A 1LKBA 2FEQH 3RMMH 1FN6A 1PPEE 1O2PA 4DGJA 2O8UA 1SL3A 1AFEH 1H9IE 2LNCA 3Q3YA 2TGAA 4ABJA 5DP3A 4TT3D 4LZ4B 1CE5A 5AF9H 1IQLA 1FY3A 3SNEA 1J8AA 2KCAA 2VWNA 1VJ9U 2VWMA 2O8MA 3SJ9A 1LPZB 2ZU3A 3U28C 2BLWA 1W11U 1BITA 5LPRA 4X6NA 3SO3A 4F48B 3FAOA 3GCNA 2Z94A 5ESTE 5I25A 1P8VC 3FVFB 5FHTA 1EAIA 3SUGA 2IOTA 3QTOH 2Y5GA 1FPHH 1H4WA 1SQOA 1GBJA 5A0CA 3M3SA 1S0QA 3QDZB 3UAIC 1F2SE 5JBBS 1FIWA 3GCHB 2FS9A 3PB1E 5FX6A 1P2QA 2ZHEH 1RTFB 5F53A 4B2BA 4BTUB 3K2UA 1BJUA 3BTTE 5DJ7A 1RRKA 1C2EA 2VH6A 4MNVA 1E1RD 1AB9C 3O8CA 1S6HA 2BYAX 1C2DA 2PTNA 2QC2A 4AYVB 1DDJA 1HAVB 1EAUA 1A61H 1UCYK 1GVZA 2FTMA 1XKBC 3S7KB 1ESBA 3F68H 4E05H 4I8HA 3RXEA 1KXCA 2WYJA 1BMLA 1O3HA 1UTOA 1NO9H 4WJG2 3GDSA 3A84A 1DXWA 2BY8X 4O3TA 1YWUA 1QR3E 1SMFE 1HFDA 3A7TA 2RDLA 1SFQB 3KIDU 1XM1A 1V6DA 2YMSC 2HNTC 7GCHF 1P2NA 2BDGA 1HBTH 1O2HA 2F9OA 2WZQA 4IGDA 4K60A 1AKSA 1E37B 2BD2A 3FFGA 1O37A 4DURA 1Y5UT 1GVKB 3M3TA 1Q2WA 1Y3YA 4DVAU 2OQ5A 1O2GH 4Y7BA 1FY8E 1P2JA 4Y11E 4ABAA 1IQKA 4UFEH 2ANWA 1ZSKA 4O3UA 2ESTE 5F8TA 5TCCA 1QZ8A 1GJBB 3HATH 5B6OA 1ELFA 1MD8A 3PTBA 3UQVA 4I31A 4ZHLU 5TJXA 2KAIB 2Y7XA 5C67A 2GGVB 4WH8A 1SVPA 2AH4X 3ZYDA 1C1OA 3EDXB 2FP7B 4FXGH 4RI0A 1BT7A 2VH0A 2A1DB 5L6NH 1W7GH 4MQAA 5F6MA 2HGTH 3S9CA 2EI8A 1C2KA 1EX3A 1BBRE 2ZP0H 1C5NH 1EPTC 2F43B 3RXIA 3ZZ7A 1VITG 1TNKA 2XC4A 4JK6A 3GY6A 4B74A 5H4IB 2OBQA 1OP8A 2CHAC 2SGFE 1MBQA 3BTQE 4TPYA 3GY3A 1NRNH 3V3MA 1SLWB 4FUIA 4ZKOU 4AOQA 5LH8A 5JBCS 5FCRA 1MMJN 1GBCA 4ZAEA 3JZ2B 1LQDB 1MU8B 1F0RA 2J98A 1O3IA 2BZ6H 1EZSC 2QF4A 3KL6A 4BANB 3KQ5A 2PSYA 1O3AA 3A81A 3S9BA 4ISOA 3VG8A 4O03A 1Z8JB 3SHAH 4CR5A 1XVOA 1TPOA 3D49H 3TK9A 1B5GH 2W5EA 1OPHB 1S0RA 4YLQH 2XXLA 1K1PA 1ACBE 2FYQA 3DA9B 4YOIA 4GUXA 4NA7A 4OS1A 5J4QA 1CA0C 1AB9B 1UK3A 5HKKD 3N7EA 3HGNA 4AB8A 3MOCA 1H8HD 1TPSA 1BRUP 3OTJE 1A4WH 2I6SA 1MTSA 3SNBA 2J94A 2ZI2H 1GCDA 5T6FA 2WPMS 1K1IA 1IQJA 1GDUA 1ABIH 2RCEA 4OGXA 1DLEA 1SGYE 1AO5A 3EE7A 1W0JD 2C8YB 4AN7A 4CH8B 1QJ6B 1QJ1B 2YMSB 5FPYA 3ATLA 1RJXB 1ELVA 5C1UA 4MLFB 1PPBH 3FP6E 4YT6H 3NRLA 2XWBI 1UVOA 2VIPA 4XFQA 1EZUC 4D9RA 3P17H 3ZZ3A 4OS4A 1D3DB 4IMZA 5IYTA 3TITA 1HPGA 3ZVAA 1DE7H 2ANYA 3ZZ8A 1LVBA 3F2GA 5EGMA 4OGYA 5AHGH 1P03A 1LKAA 1MCVA 1QB9A 3MH5A 2BXTH 2WPHS 4FUBA 2ZIQH 3LT3A 1MQ5A 1HAPH 3LPRA 4Q7XA 1WU1A 1YPHC 2YMSD 3QGJA 3P95A 3RXGA 1VR1H 5HIYA 2GV6A 2XYAA 2GCTC 1O5EH 1ZHPA 1K22H 1C2FA 1C5LH 1T8OA 3CS0A 3S0NA 1BBRK 2PW8H 3KQDA 3GDUA 2GD4B 1EPTB 2A45B 1EB1H 5JBAS 1P06A 4FUJA 2V3HH 2JDID 1TALA 1LCYA 4YESB 2CHAB 4LXBH 4ESTE 1J16A 1FJSA 1ZTLA 2B9LA 2HVYB 2F9VA 1SGFG 1PPZA 5EQSA 2XC5A 9LPRA 2D1JA 2J2UA 3MH7A 1OP0A 1RD3B 1ANCA 1O2NA 3W94A 3ENSB 2Q6FA 3SQEE 4JZEH 2R9PA 4ABGA 1OSSA 1ZTJA 2HALA 1HAYB 3SN8A 2A7CA 1V2VT 2H2ZA 4YO9A 1EB2A 2ZGXH 1HDTH 1LPKB 3E90B 3RDZA 4K5ZA 2C93B 3DFJA 2XWAA 3UY9A 1CGJE 4B75A 3U98H 1TMUH 1TA6A 1TNJA 1GMHG 5C0TA 1HXFH 1MAXA 3S69A 1C1UH 1CA0B 2SNWA 1C2MA 1L1JA 3SI4H 3A7VA 2XBWA 1KXEA 1ZMLA 5T6GA 3P8NA 1LHGH 3PLBA 3RLYH 1GHWH 2XCNA 4Q63A 1FNIA 4FU7A 2GZ8A 1P2MA 4NWLA 1TABE 1CQQA 2CMYA 1T8MA 2BDBA 1OKXA 2FM2A 3I29A 3SJIA 1NFWA 1AUTC 5AVDA 4DG4A 3RC4A 2Z9JA 2BDHA 4YM9A 2C4FH 3A83A 3E0PB 5A0BA 1SGCA 1HAHH 1PPCE 2STBE 4CHAC 2A4RA 2QF3A 4DCDA 5FPSA 3T62A 2L74A 2W3KA 3ZV8A 3T27A 4WXIA 5EXMA 4BOHA 1UHBB 1TA2A 1YLDA 2Q6GA 1V2LT 4WXVA 1ZGVA 2CK3D 3U1JB 2WPLS 1LHEH 1OP2A 1S83A 3TU7H 2BD3A 5GPIB 1GBIA 1QA7A 2ZKSA 3TK5A 1XUKA 2AMDA 5L30H 1C5QA 3V7TA 1GHAG 3SZNA 3TPIZ 1BUIA 1KTSB 1B0EA 8KME2 1SHHB 1TNGA 3P92A 2G4TA 4R0IA 2WV9A 1O34A 2GCTB 1JIRA 1V2RT 4AFQA 3WWFA 1GHVH 3ZVGA 2G8TA 1SBWA 3FZDA 1MUEB 3DD2H 4YOGA 1GG6C 1SQAA 2QF5A 3RXAA 4Y7AA 5EJ1A 2Y5FA 1NESE 1AUJA 5HYOA 1S5SA 3SV7A 1N6XA 2FMJA 2OUAA 4NGAH 5GDSH 2A31A 3FKSD 4X6PA 3SGBE 3AASA 4HI3A 3RXLA 2STAE 4FUCA 3PRDA 4CRDA 4DT7B 1XUJA 1TONA 1KLIH 5DKMA 1C4Y2 1YCPH 2TRMA 2UUFB 1YPLH 1BA8B 1H8ED 2B5TB 2OC0A 2ZFFH 2KR7A 1CT0E 3LU9B 5KGOA 1HAVA 1W10U 1HAOH 2QXGA 4Y6DA 1C2LA 1E38B 2ZHFH 4A5TS 2WUCA 2BHGA 2EC9H 2C90B 4X1PU 2H9EH 2HVXA 1NPMA 1O3NA 2Z9LA 5EOKA 5T1VA 1F7ZA 3V12A 2BD7A 4FVDA 1PYTC 3BTDE 2AMPA 2P94A 3U9AH 1KSNA 4WVPE 4P02A 1A2CH 3SUDA 2M2AA 4WMEA 4BAKB 1W14U 1EJMA 3CS7A 3SV9A 4H4FA 3RXTA 4ASHA 2CJIA 5DGJA 1DLKB 4WY3A 1C5WB 3F0PA 3T29A 3SYJA 4BXWA 3RXCA 1SFIA 4CHAB 2RFKC 4BXSA 1ESTA 1S84A 1YY3A 1YLNA 3F9EA 2FLRH 3MFJA 1KLJH 2K8IA 3BG8A 1UVPA 3ZVBA 1GHBF 1D9IA 1YPGH 7GCHG 4LOYH 4MPVA 2SGPE 4ABHA 2C3SA 4AFSA 2W7SA 3M5LA 3FANA 1KMHB 1DXPA 3NZIA 3UNRA 2HNTE 4UEHH 1HNEE 1NRSH 5CHAC 5DK1A 1DX5M 1C1VH 2ZDLA 1B0FA 3ELAH 5ETXA 1AE8H 1OWHA 2VVUA 1L1NA 1O2YA 2GP9B 3TLOA 1BB0B 1AI8H 2BD5A 1FPCH 2FX6A 3QUMP 2J5UA 4AFZA 1IAUA 1GG6B 3UFAA 4K69A 1RFNA 1P2KA 4CH2B 2V3MA 1O3GA 1EKBB 1Y3WA 2KZ4A 3SQHE 3SV6A 1H9LB 2OP9A 1FAKH 4K2YA 3PWCA 5SGAE 1Y3UA 2V35A 4ZUHA 1ZGIA 4UFFH 4OS5A 1CGHA 4AFUA 1J17T 1NC6A 3ZVCA 2WSSD 4AX9H 1DITH 1HB0B 4MPWA 3RP2A 1VGCC 2IJD1 3MH4A 3TGIE 1FY5A 1FQ3A 1V2JT 4I8KA 1TLDA 1Y59T 2F3CE 1IQHA 1MKWK 2FOHA 3LC5A 4SGBE 4XDEA 4BAOB 4Q4LA 1C5PA 3SUEA 1C5XB 4DIIH 4GCHF 1MH0A 1M9UA 2W7UA 1LQEA 2ZGHA 1O30A 1GDNA 2A7HA 3HK3B 2XCFA 3EA8A 3M7TA 4GAWA 3A8DA 3MNXA 1AVWA 3GYLB 2A5AA 1A1RA 4H6SB 2H1UA 2V7QD 4CBOA 1O2VA 3SJ8A 2OCVB 5L2ZH 3E0NB 3RXDA 4JZDH 1ELAA 2ZU2A 4A1XA 2G52A 4AC9A 1EP6A 3DFLA 4E7NA 1TMBH 2VGCC 5EPYA 2W6ID 2NU2E 3RU4T 1HAIH 1O2OA 2F9PA 1E0FD 1D3TB 2ZQ2A 1G3EA 1O2UA 3A7YA 3C27B 2D26C 1GHXH 3OU0A 5F8ZA 1AY6H 4CRBA 4Y0ZE 1DWEH 4Q7YA 3E1XB 4ZXXH 1KIGH 3PV5A 1O5FH 1TOMH 1ABJH 2AGIX 2ZTYA 2JH0D 1C1NA 2VINA 2BVXH 3AAVA 1FUJA 4KP0A 3VB4A 1PYTD 2ZG0H 2SNVA 1KXDA 1IQGA 2NWNA 1W0YH 4ZHMU 1MABB 3CP7A 1SQTA 2BOHB 2FESH 1S81A 1TE0A 1EAXA 1H8DH 1BHXB 2PKAA 5CHAB 4Z6AH 4FUFA 3LJOA 3DUXH 4IS5A 1OYTH 3B8JA 3SU0A 3UNQA 4U2WA 1RTKA 3E16B 4KKDA 1THRH 1EPTA 1LPGB 2OC8A 3Q76A 1YM0A 4ZHAA 1Y3VA 1PPGE 2Z9GA 2BLQA 1F5LA 2ZFPH 4GPGA 5HGGA 6CHAC 1QQ4A 1O5DH 1IQNA 1DANH 2XOKD 4B6EA 3HPTB 3M7QA 2YOLA 3ZZCA 3ZZBA 3O8RA 4NIXA 1AVGH 3BIUH 4RT1A 1THPB 2P3TB 2ZCHP 1T8NA 1N6YA 1O3DA 1YPHE 1WOFA 1JOUB 3Q00A 2JH5D 4TWYA 2AS9A 2CGAA 3TJOA 1HIAB 3VXEH 2QF0A 1WQSA 4UFDH 4Y76A 3T26A 5AFZH 1P9SA 1C5RA 3RXFA 2G81E 1O3MA 3GY2A 1GBHA 4WMDA 2ZPRA 3NK8A 1N8OC 2RA0A 1VGCB 1AGJA 4SGAE 3OX7U 2FXRA 3T5FH 4OS7A 1O38A 2FLBH 3NKKA 3F9HA 5JB9S 3M7UA 1Y3XA 2BY5X 2ZTZA 4X0WU 2ZDMA 2ZECA 4JZ1A 2UUYA 2PUXB 4XRNA 3S7HB 2TGPZ 2ZNKH 1NT1A 5C0UA 2SFAA 3PMHB 1MTNC 4F55A 3GCTF 2ZC9H 4MNYA 1O35A 1GJ8B 1G3DA 3EA9A 4A1TA 2QN5T 1QGFA 1TWXB 2NU0E 1UCYH 4D9QA 2VJ1A 3LOXA 5EXLA 2WPKS 3ZVFA 3SU2A 1CT2E 2ZFSA 1W0KD 3L3TA 1UVUH 2J38A 3BG4C 2BVSH 2HRVA 5A0AE 3BTGE 1QNJA 1W12U 1PPFE 4Q7ZA 3RXPA 3PLPA 2W6JD 3KN2A 1EZXC 4JZIA 3VB5A 1PFXC 4BAQB 1EXFA 2IPQX 2VGCB 5KEDA 1UHBA 3LIWA 2QE7D 5CMXH 3KQBA 3SW2B 1K28D 1DFPA 2BQ6B 2VIQA 3R0FA 2ODQA 1MTWA 1FDPA 3QX5H 1CSOE 2XNIA 3QZQA 4ISNA 1ANEA 5LPEA 5EW2H 2CN0H 4H6TA 4IN2A 3MHWU 2KCOA 4MNXA 2QCYA 1JWTA 2KX4A 4U01A 1AU8A 3ZVEA 2VIWA 4UFGH 3GY7A 1O3JA 3ZZ5A 3RXRA 3FP7E 4RT0A 3SJOA 1XX9A 5C94A 2GDDA 3GICB 1E1QD 4KTCA 4X2YA 2GCHG 3F9FA 2ZFQH 1JRSA 1LHFH 3MH6A 1O36A 4YZUA 4FU8A 3F3BA 2VIOA 2ZA5A 2RDEA 1C5TA 3F1SB 3ZZDA 1S85A 3TJUA 4I7YH 3BTKE 1YPKH 3F6UH 3FN8A 2CXVA 1HYLA 6CHAB 1K1JA 2HPQH 2KCYA 4ABIA 2BDCA 1TGSZ 1F92A 3ZZAA 3L33A 1YBWA 2VBCA 2OQUA 3O8BA 2ALVA 2V0BA 5EJZA 1ORFA 3M5OA 3DSOA 3EE0B 3OSYA 3SV2H 3K65B 2GKVE 3LKWA 1PQAA 2LELA 4YTAA 2FDAA 4O97A 5I46H 4D7GA 5JBTA 1XUGA 2BLOA 1QRWA 1GHZA 4XSKU 1C5VA 3NCLA 3NUMA 2FI4E 2O8TA 1QURH 1GCTC 1O5CB 2WUBA 2J97A 3BEUA 1N8OB 2WPIS 3PYHA 4KTSA 2BD8A 2QA9E 1VZQH 1O2JA 5AFYH 5PTPA 3PMAB 5B6LA 1IOEA 3TVJB 3VB3A 2EQNA 1L1GA 1NN6A 1YF4A 1RGQA 2H5DA 2P16A 3F2FA 1G3BA 3RXMA 1SOZA 4RKOB 2CF8H 4ABDA 1SGRE 3QO6A 3Q3XA 1DOJA 2EEKA 1C1MA 1F5RA 4RSPA 5C1XA 3MNCA 1U6QA 3MU5A 1MTNB 3MI4A 3TH4H 1YPMH 3OEED 1WAYB 2VNTA 1WSSH 2VWOA 4TPIZ 4FETA 3BTME 4AORA 1YYY1 4NA8A 2Q1JA 5JDUB 2QXHA 1TBRH 3BG4B 3OY5U 1WTHD 4R8TB 3LGUA 3UREA 1D6RA 1ZSJA 4ZKRU 3KNXA 2J9NA 1OWDA 2UWPA 3MYWA 1BOQA 1JXPA 1GWAA 4LK4A 1HRTH 3UQOA 4BAMB 1VJAU 4D8NA 3GY4A 1GI2A 3A89A 4ZROA 1O2RA 2QAAA 5GNDA 4X6MA 5C20A 1YPEH 1O0DH 5EW1H 4ACBA 2ZU4A 2OC7A 1KXBA 1TGTA 3QZRA 4HG6A 4JYUH 4NSVA 5T6DA 1B7XB 1GVLA 4Y79A 3W95A 1NU9A 1Z7KA 2ZCKP 3VPKA 1G3CA 4A6LA 3GY8A 4K1TA 3WWBA 2B8OH 1ZRKA 3MTYA 3A7XA 1GHBG 4B6FA 1F0UA 1G2LA 2FTLE 4AG2A 3QGNB 3QTVH 3LDXH 1GI9B 3ODFA 3D65E 5EU8A 2JETC 4NFEA 3LGYA 1GI6A 4NZLA 1DY8A 1IQEA 5DPAA 4ABEA 1GMDG 3UR6A 1QY6A 2JKHA 1BBRH 2R2WU 4FU9A 1BTPA 1J9CH 5CE1A 4BTIB 3BSQA 3H7TA 3SNAA 1BTXA 5DP6A 4ZKSU 4AB9A 4MDSA 5CHBA 2VIVA 4E06H 1F5KU 1O3BA 4ZH8A 2TGTA 2WV4A 1J15A 3QK1A 4X6OA 1NRQH 2ALPA 1QQUA 3A80A 5L2YH 1MZDA 4CREA 2J4IA 3PWBA 1ZSLA 2GTBA 3VGCC 1CHOF 1A0JA 1GCTB 3U8TH 1XXDA 1CU1A 1D6WA 1O2WA 1Z1IA 4THNH 1C2JA 1NFUA 2PKSC 1TB6H 1W8BH 2RG3A 2V6NA 4ISHH 1ZMNA 3STJA 1TPPA 3HK6B 2OC1A 1W3CA 2FZZA 2FYRA 3E3TA 2GCHF 4UE7H 3BTFE 2FOFA 1MKXK 1SG8B 4X8UH 2GVFA 2ASUB 3U8OH 2G00A 3MNSA 1AWFH 2P59A 3KEEA 1IHSH 2F9NA 1TNHA 4GCHG 4CRGA 3P6ZB 4OM9A 5LPFA 3P8FA 3E6PH 3MO6A 4CRCA 1SQRA 2EA3A 2OLGA 3VB6A 4FUHA 2IPHA 1V2TT 3IITA 3DT0H 4HZHA 3RMLH 1ZRBA 1TGCA 1YLCA 4X2WA 4B76A 1O5AB 2ZHDA 3RXQA 1KLTA 1GI3A 4H42U 2THFB 1TQ7B 5F8XA 3A86A 5GCHG 3UNSA 1P10A 1GBLA 4GVUA 1C4V2 3MQKC 5EQRA 1ARBA 1H8IH 1QL9A 1YGCH 4MVNA 1GI7B 4FVBA 1A3EH 4X2VA 3URCA 2BY7X 2VU8E 1NY22 4U32A 3UPEA 1GBEA 1GBDA 2J98B 1FZZA 1Y8TA 1N1LA 4DJZB 4A1VA 4TYDA 4JCNA 3PV2A 4I8GA 2Z6BD 2ODPA 1RTLA 1W13U 4WH6A 4XBCA 4K8YA 1ZHMA 1WCZA 2JETB 1BMMH 1D3PB 1UVTH 4FUDA 1GJCB 2A5IA 2FOMB 2HLCA 2R2MB 2TPIZ 1OWJA 1G2MA 3G01A 4IMQA 2LP6A 2JJ2D 3QN7A 4AYYB 1J14A 4BAHB 2AHME 3A85A 1BTWA 4Q2KA 2C8XB 3Q77A 1Z6JH 1DM4B 1P01A 5HXFA 1AZZA 1OXGA 1UTJA 1HIAA 2GT8A 3SBKA 1TMTH 1V3XA 1EAWA 5DP5A 4AGKA 1O2TA 3ZVDA 3ZYEA 1ELBA 1C1PA 3BV9B 4INLA 2TIOA 2WINI 5GJ4B 3VB7A 1AQ7A 3VGCB 1EOJA 1P11E 1BDAA 1FV9A 4D76A 3KF2A 1RIWC 1TYNA 1BRAA 2B0FA 3TJNA 4DIHH 1C1WH 3P8GA 1KTTB 1AWHB 3RU4D 3GY5A 4BNRA 4Y10E 1UTLM 1QBNA 1BJVA 2G51A 1GI4A 2GX4A 1MTVA 1GGDC 1HV7A 1FY1A 1GI0A 2P8OC 1P09A 2YNBA 3URDA 3TGJE 3DSPA 1ELDE 2VB0A 4CR9A 3LC3A 1DSUA 3RXVA 1EASA 1ELEE 2ZEBA 1TPAE 1EFRD 1K1MA 4VGCC 1NROH 5K0HA 1GJAB 1TGBA 1GMDF 3GCTG 1O3OA 2KAIA 5BRRE 2ZTXA 2VIDA 4FOUC 2NU1E 1O5BB 3OFND 3C1KA 3SUFA 2P3UB 3KYGA 1A5HA 2EY4C 1O3EA 1UW7A 5FAHA 3QLPH 5E2OA 4WF8A 3SI3H 3STIA 5FL7D 1VITH 1BRCE 1FLEE 2IN2A 2ZDNA 1C1TA 2HPPH 4NZQA 4QT8C 1LVYA 4HGCA 1GJ9B 1H1BA 2GT7A 2BLVA 3MU0A 3GCOA 5K7RA 3K6YA 1O31A 4Y8ZA 2QXIA 1SC8U 3F9GA 1SLXB 5DN6D 2FOAA 4YT7H 1MTUA 1OWEA 2UUJB 1T31A 2XC0A 5C5NA 4Y8XA 3OAAD 4ISIH 5C1YA 3RM0H 1SLUB 3O8DA 1W0ZU 2ZHQH 5IDKA 3RLWH 2Y6TA 1P3CA 1TGNA 1NFXA 5GIBA 4M7GA 3RXOA 1BMNH 2BDIA 2ODYB 1GBTA 1V2KT 4TY6A 2ZPQA 1GBMA 2BD4A 1HAXB 1CHGA 1A0LA 1CGIE 2K1QA 4IC6A 2FX4A 6LPRA 1TX7A 4NWKA 3M3VA 2TGDA 3LJJA 1V2PT 1K21H 2AERH 2R3YA 3ZIAD 1DWCH 2ZDVH 1SHYA 3K6ZA 4U30A 1HGTH 3E91A 2BY6X 1Z8RA 1DICA 1MZAA 3I78A 1TAWA 1DPOA 1QRXA 3D62A 3TNTA 1HJ8A 1SGFA 3RUOA 2PTCE 2F9UA 2W26A 3HGPA 3SU3A 1HXEH 3N7OA 2JH6D 3ZZ4A 4AG1A 1DS2E 1A46H 2A5KA 1A3BH 2VWLA 1RIWB 5GCHF 2BDAA 2HOBA 1O3CA 2WHXA 5ESBA 1BTYA 3RXJA 1NZQH 1UMAH 2ZHWH 1K9OE 2BD9A 4X1QU 3A7WA 1HJ9A 1VCWA 3NPSA 4MG3A 2JJ1D 1AE5A 8LPRA 1C5ZB 2G4UA 1MKWH 1GGDB 1ID5H 4HTCH 2P8OB 5FBIA 1Z1JA 2ZGBH 3TNSA 1V2UT 1AHTH 2FO9A 1EQ9A 1O2ZA 1HJAC 4X2XA 2HLDD 1YKTA 3UWIA 2BVRH 5A8YA 2FI3E 4IN1A 4ZMAH 1QRZA 5C17A 2R0LA 1W7XH 2A4GA 4NG9H 4VGCB 1LDTT 2H6MA 4XOJA 2BZAA 4YLUA 2KFWA 4O9VA 1TBZH 4TWWA 5E0HA 3OTPA 4GHQA 4NSYA 3B9FH 4NCYA 2PP6A 4Z0KA 1O2KA 1FIZA 1LVMA 2KM0A 2OK5A 2BQ7B 1CVWH 4I8LA 3TK6A 4B2CA 1SKYE 2FOCA 4OS6A 1GBFA 3T2NA 3GOVB 4JZFH 1GBKA 3FO8D 4CBNA 1CA8B 3PO1C 3Q3KA 1BTZA 5E8EH 2OBOA 3H7OA 3RMOH 3U69H 4K1EA 4X8TH 1O33A 1P9UA 1QBOA 2Z3CA 4KELA 3RMNH 1FMGA 4K3JA 2C8ZB 4ISLA 4MPUA 3SU6A 1LO6A 2A0QB 1ELTA 3BEFB 4B73A 5A2MH 2SGDE 4JYTA 4JYVH 4XBBA 1Z8GA 1BCUH 5A8XA 2XW9A 2BX3A 2JIZD 2VVCA 1P04A 1D4PB 3JZ1B 1NBMD 3TIUA 3ITIA 2XRCA 2BM2A 3OY6U 5C3NA 4KGAA 4K8BA 2QIQA 3VEQB 1EUFA 1UTMA 1T4UH 2FWWA 1XMNB 1P02A 4INKA 4BTTB 1KY9A 5EIYA 3FP8E 1T7CA 2DE9A 2SGEE 5EODA 1HAZB 1SOTA 3SNDA 1YCPM 2ULLA 2BOKA 3A8BA 2LPRA 1EATA 3F2HA 1ZLRA 1GDQA 2Y82A 1FI8A 1C2HA 3TJVA 1ZPZA 3RXUA 1ZTKA 1OX1A 1SR5C 1O2QA 1A5GH 3V13A 4AGJA 2Y5HA 1BZXE 1V2MT 4INHA 1C2GA 2CV3A 3LGWA 1BTHH 1JMOH 1G37A 4MTBA 3EYDA 1C9TA 1QHRB 1DUAA 1TRYA 3SGAE 3VXFH 4X1SU 6GCHF 3IWMA 2GZ9A 3RU4E 2ZFRH 5EQQA 2ZQ1A 2GJGA 1O39A 4DY7B 2Y7ZA 4TY7A 2ZWLH 4ABFA 5HM9A 1CT4E 1Y5AT 2H9TH 2OINA 2F4LA 1OWKA 3HKJB 2YNAA 1INCA 3BTWE 5DP8A 1CHOG 4NIVA 3SU5A 4ASUD 4M9FA 2ZF0H 1XUHA 3W1EA 1KDQB 3MU8A 8GCHF 3CNRA 1Y5BT 2FOEA 2J34A 4WWYA 2O8WA 2ZPSA 1HJAB 4FUEA 5E2PA 5J4SA 1EZQA 2QXJA 1AMHA 3H09A 5FXLA 5F03A 3NWUA 5HMAA 4Y0YE 5DP9A 1O3KA 1AFQC 1O2LA 1S82A 1TBQH 4I86A 4RN6A 1UVSH 1G36A 4ZXYH 3RM2H 1E79D 1P2OA 2VVVA 1WDIA 3UIRA 3T25A 1L2EA 3AW0A 3AAUA 4YOJA 1HCGA 3TH2H 3LH3A 1GL0E 3SORA 5TCAA 1ANDA 5EXNA 2A2QH 1FY4A 4Y8YA 1QIXB 2BMGB 1GJ7B 2F9BH 3LGVA 3SNCA 1C5OH 2H5CA 1Q31A 1DUEA 3PO1B 1QTFA 1SGIB 3ATIA 3EQ0H 2A4QA 3I77A 3SOSA 3A7ZA 2AGGX 4J1YA 1C5YB 2AEIH 1FXYA 1TX6A 3EGKH 2P95A 1GMCF 2BB4A 1THSH 2O9QA 4RKJB 2AIPA 1AN1E 1BMAA 1C5UA 3BF6H 3GISB 3RXSA 1ELCA 1O3PB 1BIOA 3SJKA 2ZGJA 4FUGA 1O2MA 4PROA 2ZDAH 1ZHRA 5JYIA 4JK5A 1UTQA 1NU7B 2QYIA 2FODA 2Q6DA 1IQFA 2PV9B 1DVAH 1F0SA 1ZR0A 1UTNA 1MU6B 1WV7H 3SU4A 1XVMA 4TSFD 1DY9A 3CENA 4I8JA 1YC0A 2GMTC 2SGQE 1UO6A 1OYQA 3ZV9A 1JRTA 3LH1A 1ANBA 1KXFA 1C5MD 3DSGA 3PTNA 5A8ZA 1YPJH 2G5NA 5DP4A 3WW7A 1UK4A 2NU4E 1P0SH 1DWDH 3ATWA 1A7SA 2Z9IA 1GL1A 1LMWB 4GSOA 3MU1A 1Z8IB 1O2XA 2ZO3H 3DCLA 1ARCA 3N7DA 2XTTB 1O2SA 2RA3A 4UDWH 1ESAA 2B7DH 4Z1MD 2KCPA 1V2WT 3FZZA 3N99A 2CF9H 5DO4H 2J95A 1EJAA 1C5SA 2DUCA 2XNDD 1SSXA 2QGRA 1LHDH 2M5TA 1SGPE 4A92A 2W3IA 3A8AA 2IJOB 2FPZA 1TNLA 2Y80A 5DSFA 2PKAB 2ILNA 1C9PA 1MBMA 1AFQB 3BEIB 2I6QA 4F4OC 9ESTA 5KECA 3BIVH 1FN8A 1QJ7B 2UUKB 1QCPA 3BTEE 1L4DA 3DHKH 1H9HE 1ETSH 1NTPA 1K2I1 2XBYA 1T8LA 1FAXA 5E0JA 1T4VH 3K9XB 2J92A 3SGQE 3BTHE 2SGAA 5E0GA 1BQYA 1DWBH 3MNBA 3HKIB 3L6PA 3UR9A 1SPJA 3LGTA 4IC5A 1P3EA 1VCPA 1L0ZA 2R3UA 2GV7A 3ATMA 1ZPCA 1EJNA 3RXHA 1S6FA 3M5NA 1QA0A 2ZGCA 3GYMA 1NBME 1BRBE 4Y71A 4E7RG 6ESTA 2AMQA 2XBXA 2EI6A 1VKYA 2D8WA 2TBSA 2GZ7A 2A32A 3LGIA 1DSTA 2PFEA 4NA9H 5DG6A 1TRMA 1QFKH 3R3GB 1BHXF 3M61U 1TIOA 3ZZ9A 1QB6A 1E35B 1GI5A 4HFPB 3M35A 1C1SA 3U8RH 1AKSB 3MO3A 5JPMH 4JMYA 1A5IA 1TRNA 1TOCB 2BQWB 1V2OT 3PRBA 3SV8A 1O2IA 1VCQA 2BY9X 2AFQB 2QY0B 5LGOA 3AVZA 2FOGA 1GJ4H 2QV1A 2WYGA 1P57B 1WYKA 2GMTB 2K0QA 2UWOA 1ZJKA 1JIMA 1KXAA 1K1OA 3PLKA 3AK5A 1IHTH 4ACAA 1VITF 8ESTE 4K1SA 2D2DA 4X1RU 4ABBA 3LONA 1OWIA 4XD7D 4F49A 1QL7A 3KYFA 3KHVA 2PHBA 1COWD 1SB1H 3IG6B 1GJ5H 3GDVA 4YXWD 1XUIA 4KTUA 5C5OA 1IQIA 1EOLA 2NU3E 5GWZA 1CBWC 5A09A 5GXPA 4GLYA 2L6OA 4D7FA 2ZZUH 2FS8A 1GJDB 1SGDE 1MKXH 3M37A 1TQ0B 3WY8A 2A7JA 5FCKA 5HIZA 1YCPK 1Z6EA 1ZOMA 1UTPA 4P00A 1HLTH 1NFYA 2R0KA 1E36B 3PMJA 1UTKA 2XBVA 5ABWA 1SLVB 3EAJA 4NFFA 1CO7E 2ZCLP 4UD9H 3ODDA 2PUQH 1RS0A 3NXPA 1GJ6A 1FONA 2BTCE 4AZ2B 1OOKB 4B1TA 1BTUA 3SU1A 2WPDD 1LVOA 3KQEA 3EA7A 1D3QB 1O5GH 2Z3EA
chains in the Genus database with same CATH topology
2OD3B 4X1NU 3RC6A 1V2QT 3T28A 1SGQE 3KQCA 3A8CA 2F83A 4X8VH 1K1NA 2AGEX 1HAGE 2P3FH 7LPRA 4XE4A 3ATKA 1PQ5A 4ZKNU 1GBBA 1SGNE 2PGQB 1ZYOA 1P2IA 3A82A 1NM6A 1HUTH 4GHTA 1G9IE 1GI1A 3TGKE 3D23A 5BPEA 2PR3A 3RC5A 4I33A 2F91A 1NRPH 1EP5A 2AYWA 1LHCH 1WUNH 1NRRH 1AD8H 3QWCH 3UTUH 3P8OA 1MAYA 4LZ1H 1P05A 1SGTA 2ZFTA 3ESTA 3M5MA 3P70B 2PKSB 3A88A 4DW2U 1P12E 3UOPA 4NIYA 1SGEE 2Z9KA 5DP7A 2OTVA 3UWJH 2P93A 1K1LA 2BX4A 5T3HA 4UONA 2OXSA 3PMBB 2Z3DA 4IW4E 2ANMH 2Y81A 3SHCH 5C2ZA 1IQMA 1AZ8A 2EI7A 7KMEH 4X8SH 1L4ZA 1G30B 1GPZA 4MNWA 1GBAA 1X7AC 2UWLA 1XXFA 5JB8S 1WTGH 2FIRH 3V0XA 2G5VA 5FPTA 1UJ1A 3VFEA 3B23B 1YP9A 1KDQA 5FX5A 3H5CB 6GCHG 1OS8A 1Z71A 2V3OH 4MPXA 1AVXA 1MCTA 2WPJS 1XUFA 1NS3A 3ZZ6A 1A0HB 3AW1A 4NIWA 2HNTF 1WQVH 1V2ST 1O3FA 1PQ8A 3KCGH 1ZPBA 1SI5H 5EG4A 1CBWB 1PQ7A 2AIQA 3U1IB 4DOQA 4B2AA 1DT2A 1TNIA 5FBEA 3KGPA 8GCHG 1JBUH 1GMHF 1KYNA 2FI5E 1RXPA 4CRFA 2O8LA 2ZU5A 3GCHC 4XBDA 2HWLB 1C4U2 2DE8A 4A7IB 1V2NT 2PLXA 1AIXH 4J2YB 1O3LA 4I32A 4OS2A 1E34B 3PROA 1PPHE 1GI8B 1QL8A 1O32A 2G55A 2A2XH 3TH3H 7ESTE 1C1QA 2BXUH 3MO9A 3OYPA 5HM2A 1UCYE 2BDYA 4CRAA 1T32A 1WBGB 4WMFA 1Q3XA 2H9HA 1ETRH 3UUZA 1MD7A 1W2KH 1UK2A 3RXBA 1QB1A 2ANKH 1TFXA 1GHYH 2ZDKA 3A87A 3RXKA 1C1RA 1C2IA 1ZJDA 3E8LA 4Q80A 2C8WB 1GMCG 1MQ6A 1ZZZA 1G32B 3S9AA 5G4BA 2GDEH 1GHAF 2PSXA 2PWXA 2Z7FE 1ZMJA 4B71A 3MU4A 1QBVH 2FOBA 3M36A 3PV4A 3MWIU 2A4OA 3MMGA 1TX8A 1ETTH 3UOUA 1PJPA 2WV5A 5EPNA 1LTOA 3PM3A 1ELGA 2PGBB 1F0TA 2ZU1A 4IBLH 1XKAC 3BN9A 1LKBA 2FEQH 3RMMH 1FN6A 1PPEE 1O2PA 4DGJA 2O8UA 1SL3A 1AFEH 1H9IE 2LNCA 3Q3YA 2TGAA 4ABJA 5DP3A 4LZ4B 1CE5A 5AF9H 1IQLA 1FY3A 3SNEA 1J8AA 2VWNA 1VJ9U 2VWMA 2O8MA 3SJ9A 1LPZB 2ZU3A 2BLWA 1W11U 1BITA 5LPRA 4X6NA 3SO3A 3FAOA 3GCNA 2Z94A 5ESTE 5I25A 1P8VC 3FVFB 5FHTA 1EAIA 3SUGA 2IOTA 3QTOH 2Y5GA 1FPHH 1H4WA 1SQOA 1GBJA 5A0CA 3M3SA 1S0QA 3QDZB 1F2SE 5JBBS 1FIWA 3GCHB 2FS9A 3PB1E 5FX6A 1P2QA 2ZHEH 1RTFB 4B2BA 4BTUB 3K2UA 1BJUA 3BTTE 5DJ7A 1RRKA 1C2EA 2VH6A 4MNVA 1AB9C 3O8CA 1S6HA 2BYAX 1C2DA 2PTNA 2QC2A 4AYVB 1DDJA 1HAVB 1EAUA 1A61H 1UCYK 1GVZA 2FTMA 1XKBC 3S7KB 1ESBA 3F68H 4E05H 4I8HA 3RXEA 1KXCA 2WYJA 1BMLA 1O3HA 1UTOA 1NO9H 4WJG2 3GDSA 3A84A 1DXWA 2BY8X 4O3TA 1QR3E 1SMFE 1HFDA 3A7TA 2RDLA 1SFQB 3KIDU 1XM1A 1V6DA 2HNTC 7GCHF 1P2NA 2BDGA 1HBTH 1O2HA 2F9OA 4IGDA 4K60A 1AKSA 1E37B 2BD2A 3FFGA 1O37A 4DURA 1Y5UT 1GVKB 3M3TA 1Q2WA 1Y3YA 4DVAU 2OQ5A 1O2GH 4Y7BA 1FY8E 1P2JA 4Y11E 4ABAA 1IQKA 4UFEH 2ANWA 1ZSKA 4O3UA 2ESTE 5F8TA 5TCCA 1GJBB 3HATH 5B6OA 1ELFA 1MD8A 3PTBA 3UQVA 4I31A 4ZHLU 5TJXA 2KAIB 2Y7XA 5C67A 2GGVB 4WH8A 1SVPA 2AH4X 3ZYDA 1C1OA 3EDXB 2FP7B 4FXGH 1BT7A 2VH0A 2A1DB 5L6NH 1W7GH 4MQAA 5F6MA 2HGTH 3S9CA 2EI8A 1C2KA 1EX3A 1BBRE 2ZP0H 1C5NH 1EPTC 3RXIA 3ZZ7A 1VITG 1TNKA 2XC4A 4JK6A 3GY6A 4B74A 5H4IB 2OBQA 1OP8A 2CHAC 2SGFE 1MBQA 3BTQE 4TPYA 3GY3A 1NRNH 3V3MA 1SLWB 4FUIA 4ZKOU 4AOQA 5LH8A 5JBCS 5FCRA 1MMJN 1GBCA 4ZAEA 3JZ2B 1LQDB 1MU8B 1F0RA 1O3IA 2BZ6H 1EZSC 3KL6A 4BANB 2PSYA 1O3AA 3A81A 3S9BA 4ISOA 4O03A 1Z8JB 3SHAH 4CR5A 1XVOA 1TPOA 3D49H 3TK9A 1B5GH 2W5EA 1OPHB 1S0RA 4YLQH 2XXLA 1K1PA 1ACBE 2FYQA 3DA9B 4YOIA 4GUXA 4NA7A 4OS1A 5J4QA 1CA0C 1AB9B 1UK3A 3HGNA 4AB8A 3MOCA 1TPSA 1BRUP 3OTJE 1A4WH 2I6SA 1MTSA 3SNBA 2J94A 2ZI2H 1GCDA 5T6FA 2WPMS 1K1IA 1IQJA 1GDUA 1ABIH 2RCEA 4OGXA 1DLEA 1SGYE 1AO5A 2C8YB 4AN7A 4CH8B 1QJ6B 1QJ1B 5FPYA 3ATLA 1RJXB 1ELVA 5C1UA 4MLFB 1PPBH 3FP6E 4YT6H 2XWBI 1UVOA 2VIPA 4XFQA 1EZUC 4D9RA 3P17H 3ZZ3A 4OS4A 1D3DB 4IMZA 5IYTA 3TITA 1HPGA 3ZVAA 1DE7H 2ANYA 3ZZ8A 1LVBA 5EGMA 4OGYA 5AHGH 1P03A 1LKAA 1MCVA 1QB9A 3MH5A 2BXTH 2WPHS 4FUBA 2ZIQH 3LT3A 1MQ5A 1HAPH 3LPRA 4Q7XA 1WU1A 1YPHC 3QGJA 3RXGA 3P95A 1VR1H 2GV6A 2XYAA 2GCTC 1O5EH 1ZHPA 1K22H 1C2FA 1C5LH 1T8OA 3CS0A 3S0NA 1BBRK 2PW8H 3KQDA 3GDUA 2GD4B 1EPTB 2A45B 1EB1H 5JBAS 1P06A 4FUJA 2V3HH 1TALA 1LCYA 4YESB 2CHAB 4LXBH 4ESTE 1J16A 1FJSA 1ZTLA 2B9LA 2F9VA 1SGFG 1PPZA 5EQSA 2XC5A 9LPRA 2D1JA 2J2UA 3MH7A 1OP0A 1RD3B 1ANCA 1O2NA 3W94A 3ENSB 2Q6FA 3SQEE 4JZEH 2R9PA 4ABGA 1OSSA 1ZTJA 2HALA 1HAYB 3SN8A 2A7CA 1V2VT 2H2ZA 4YO9A 1EB2A 2ZGXH 1HDTH 1LPKB 3E90B 3RDZA 4K5ZA 2C93B 3DFJA 2XWAA 3UY9A 1CGJE 4B75A 3U98H 1TMUH 1TA6A 1TNJA 1GMHG 1HXFH 1MAXA 3S69A 1C1UH 1CA0B 2SNWA 1C2MA 1L1JA 3SI4H 3A7VA 2XBWA 1KXEA 1ZMLA 5T6GA 3P8NA 1LHGH 3PLBA 3RLYH 1GHWH 2XCNA 1FNIA 4FU7A 2GZ8A 1P2MA 4NWLA 1TABE 1CQQA 2CMYA 1T8MA 2BDBA 1OKXA 2FM2A 3I29A 3SJIA 1NFWA 1AUTC 5AVDA 4DG4A 3RC4A 2Z9JA 2BDHA 4YM9A 2C4FH 3A83A 3E0PB 5A0BA 1SGCA 1HAHH 1PPCE 2STBE 4CHAC 2A4RA 2QF3A 4DCDA 5FPSA 3T62A 2W3KA 3ZV8A 3T27A 4WXIA 5EXMA 4BOHA 1UHBB 1TA2A 1YLDA 2Q6GA 1V2LT 4WXVA 1ZGVA 3U1JB 2WPLS 1LHEH 1OP2A 1S83A 3TU7H 2BD3A 5GPIB 1GBIA 1QA7A 2ZKSA 3TK5A 1XUKA 2AMDA 5L30H 1C5QA 3V7TA 1GHAG 3SZNA 3TPIZ 1BUIA 1KTSB 1B0EA 8KME2 1SHHB 1TNGA 3P92A 2G4TA 4R0IA 1O34A 2GCTB 1JIRA 1V2RT 4AFQA 1GHVH 3ZVGA 2G8TA 1SBWA 3FZDA 1MUEB 3DD2H 4YOGA 1GG6C 1SQAA 3RXAA 4Y7AA 2Y5FA 1NESE 1AUJA 5HYOA 1S5SA 3SV7A 1N6XA 2FMJA 2OUAA 4NGAH 5GDSH 2A31A 4X6PA 3SGBE 3AASA 4HI3A 3RXLA 2STAE 4FUCA 4CRDA 4DT7B 1XUJA 1TONA 1KLIH 5DKMA 1C4Y2 1YCPH 2TRMA 2UUFB 1YPLH 1BA8B 2B5TB 2OC0A 2ZFFH 1CT0E 3LU9B 1HAVA 1W10U 1HAOH 2QXGA 4Y6DA 1C2LA 1E38B 2ZHFH 4A5TS 2WUCA 2BHGA 2EC9H 2C90B 4X1PU 2H9EH 2HVXA 1NPMA 1O3NA 2Z9LA 5EOKA 1F7ZA 3V12A 2BD7A 4FVDA 1PYTC 3BTDE 2AMPA 2P94A 3U9AH 1KSNA 4WVPE 1A2CH 3SUDA 4WMEA 4BAKB 1W14U 1EJMA 3CS7A 3SV9A 4H4FA 3RXTA 4ASHA 2CJIA 5DGJA 1DLKB 4WY3A 1C5WB 3T29A 4BXWA 3RXCA 1SFIA 4CHAB 4BXSA 1ESTA 1S84A 3F9EA 2FLRH 3MFJA 1KLJH 3ZVBA 3BG8A 1UVPA 1GHBF 1D9IA 1YPGH 7GCHG 4LOYH 4MPVA 2SGPE 4ABHA 2C3SA 4AFSA 2W7SA 3M5LA 3FANA 1DXPA 3NZIA 3UNRA 2HNTE 4UEHH 1HNEE 1NRSH 5CHAC 5DK1A 1DX5M 1C1VH 2ZDLA 1B0FA 3ELAH 5ETXA 1AE8H 1OWHA 2VVUA 1L1NA 1O2YA 2GP9B 3TLOA 1BB0B 1AI8H 2BD5A 1FPCH 2FX6A 3QUMP 4AFZA 1IAUA 1GG6B 3UFAA 4K69A 1RFNA 1P2KA 4CH2B 1O3GA 1EKBB 1Y3WA 3SQHE 3SV6A 1H9LB 2OP9A 1FAKH 4K2YA 3PWCA 5SGAE 1Y3UA 2V35A 4ZUHA 1ZGIA 4UFFH 4OS5A 1CGHA 4AFUA 1J17T 1NC6A 3ZVCA 4AX9H 1DITH 1HB0B 4MPWA 3RP2A 1VGCC 3MH4A 3TGIE 1FY5A 1FQ3A 1V2JT 4I8KA 1TLDA 1Y59T 2F3CE 1IQHA 1MKWK 2FOHA 3LC5A 4SGBE 4XDEA 4BAOB 1C5PA 3SUEA 1C5XB 4DIIH 4GCHF 1MH0A 1M9UA 2W7UA 1LQEA 2ZGHA 1O30A 1GDNA 2A7HA 3HK3B 2XCFA 3EA8A 3M7TA 4GAWA 3A8DA 3MNXA 1AVWA 3GYLB 2A5AA 1A1RA 4H6SB 2H1UA 4CBOA 1O2VA 3SJ8A 2OCVB 5L2ZH 3E0NB 3RXDA 4JZDH 1ELAA 2ZU2A 4A1XA 2G52A 1EP6A 3DFLA 4E7NA 1TMBH 2VGCC 5EPYA 3RU4T 2NU2E 1HAIH 1O2OA 2F9PA 1E0FD 1D3TB 2ZQ2A 1G3EA 1O2UA 3A7YA 3C27B 2D26C 1GHXH 3OU0A 5F8ZA 1AY6H 4CRBA 4Y0ZE 1DWEH 4Q7YA 3E1XB 4ZXXH 1KIGH 1O5FH 1TOMH 1ABJH 2AGIX 2ZTYA 2JH0D 1C1NA 2VINA 2BVXH 3AAVA 1FUJA 4KP0A 3VB4A 1PYTD 2ZG0H 2SNVA 1KXDA 1IQGA 2NWNA 1W0YH 4ZHMU 3CP7A 1SQTA 2BOHB 2FESH 1S81A 1TE0A 1EAXA 1H8DH 1BHXB 2PKAA 5CHAB 4Z6AH 4FUFA 3LJOA 3DUXH 4IS5A 1OYTH 3B8JA 3SU0A 3UNQA 4U2WA 1RTKA 3E16B 4KKDA 1THRH 1EPTA 1LPGB 2OC8A 3Q76A 1YM0A 4ZHAA 1Y3VA 1PPGE 2Z9GA 2BLQA 1F5LA 2ZFPH 4GPGA 5HGGA 6CHAC 1QQ4A 1O5DH 1IQNA 1DANH 3HPTB 3M7QA 2YOLA 3ZZCA 3ZZBA 3O8RA 4NIXA 1AVGH 3BIUH 1THPB 2P3TB 2ZCHP 1T8NA 1N6YA 1O3DA 1YPHE 1WOFA 1JOUB 3Q00A 2JH5D 4TWYA 2AS9A 2CGAA 3TJOA 1HIAB 3VXEH 2QF0A 1WQSA 4UFDH 4Y76A 3T26A 5AFZH 1P9SA 1C5RA 3RXFA 2G81E 1O3MA 3GY2A 1GBHA 4WMDA 2ZPRA 3NK8A 1N8OC 2RA0A 1VGCB 1AGJA 4SGAE 3OX7U 2FXRA 3T5FH 4OS7A 1O38A 2FLBH 3NKKA 3F9HA 5JB9S 3M7UA 1Y3XA 2BY5X 2ZTZA 4X0WU 2ZDMA 2ZECA 4JZ1A 2UUYA 2PUXB 3S7HB 2TGPZ 2ZNKH 1NT1A 2SFAA 3PMHB 1MTNC 3GCTF 2ZC9H 4MNYA 1O35A 1GJ8B 1G3DA 3EA9A 4A1TA 2QN5T 1QGFA 1TWXB 2NU0E 1UCYH 4D9QA 2VJ1A 3LOXA 5EXLA 2WPKS 3ZVFA 3SU2A 1CT2E 2ZFSA 3L3TA 1UVUH 2J38A 3BG4C 2BVSH 2HRVA 5A0AE 3BTGE 1QNJA 1W12U 1PPFE 4Q7ZA 3RXPA 3PLPA 3KN2A 1EZXC 4JZIA 3VB5A 1PFXC 4BAQB 1EXFA 2VGCB 1UHBA 3LIWA 5CMXH 3KQBA 3SW2B 1K28D 1DFPA 2BQ6B 2VIQA 3R0FA 2ODQA 1MTWA 1FDPA 3QX5H 1CSOE 2XNIA 3QZQA 4ISNA 1ANEA 5LPEA 5EW2H 2CN0H 4H6TA 4IN2A 3MHWU 4MNXA 2QCYA 1JWTA 4U01A 1AU8A 3ZVEA 2VIWA 4UFGH 3GY7A