3BTHE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
221
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 54
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bthE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bthE02
1WTGH 2CGAA 4KTUA 4X6PA 3GCOA 3SU5A 1QB9A 2TBSA 1DPOA 4NGAH 4ABDA 1UK3A 2C8WB 2JH5D 3F9GA 4CR5A 4DY7B 4NA8A 3TK5A 1BJVA 1LVBA 2Z3CA 1GL0E 1SOTA 4Q2KA 3SNAA 1LTOA 1WBGB 3MYWA 1FAXA 4FVDA 1O38A 1UK4A 1O5AB 1D9IA 2BVXH 1DSUA 2JH0D 4IC5A 2ANMH 1N1LA 1VITG 1C1RA 2VGCB 1ZYOA 2H9EH 1TNKA 1ANEA 3BSQA 3TH2H 1TE0A 3EA7A 2A5AA 1Z6EA 3Q3KA 5IDKA 2BZ6H 5L2ZH 1N8OC 1TONA 2O9QA 1TGNA 2W3KA 4AGKA 3BV9B 1TNGA 2J95A 3O8BA 4JYUH 1NU9A 1QQ4A 1HXEH 1AI8H 1GJAB 2BX4A 1A0HB 1QA0A 2Y7XA 4GHQA 4DG4A 1T8MA 4ZKSU 1VCQA 2NU3E 2R3UA 1P02A 1TX6A 1RTKA 2XWAA 4PROA 4SGAE 3SN8A 3VB3A 2R9PA 1V2PT 1G3BA 3K6YA 3P70B 4WF8A 1PQ5A 1NU7B 3QWCH 3SUGA 4NZLA 4LOYH 4GUXA 1QNJA 1AKSA 1A2CH 3RXUA 1MTNC 3P8NA 1JMOH 4CRGA 1MMJN 1BTZA 3EA8A 6ESTA 5BRRE 4NIXA 4BTUB 3SJOA 4K1EA 3DFLA 3RXDA 3K2UA 1KLJH 2EI6A 3BTGE 1NROH 3A85A 2Y81A 3E90B 4ABGA 1W7XH 2BD2A 7GCHF 1ZPZA 5EPYA 5AVDA 1GCTC 1XXDA 2LNCA 2JETB 1YF4A 1E0FD 5JYIA 1HAZB 5DGJA 3SV2H 1KYNA 3U8RH 3AW1A 1P10A 2PSXA 1MZAA 1DE7H 3OY6U 4J1YA 1FLEE 2LPRA 4TYDA 1P9SA 1FY4A 2ZC9H 2F9VA 1P2MA 2G51A 3A86A 1O2IA 4GVUA 4I31A 1IQFA 2ZO3H 4MNVA 1MU6B 1C1NA 5JB8S 1GJCB 2G8TA 3RC6A 8LPRA 1Y5AT 2Z9JA 2BY9X 3PTNA 2ZDLA 2EI8A 1O2KA 1YPMH 2VWNA 2J94A 1GGDC 3P17H 1UCYH 2JKHA 5EOKA 3BIUH 1GG6C 1K1IA 1C1MA 3MH4A 5IYTA 4AGJA 4JZFH 4ZHMU 2P3FH 1MBQA 1QR3E 5T6FA 3SNBA 1FONA 1C2JA 1G32B 1O2UA 3QZRA 4MLFB 3QGJA 3SNCA 3E0NB 5FPSA 1GHBF 3ELAH 3SOSA 1LHGH 1IQGA 2A4QA 3PLBA 4OGYA 1ZZZA 1BHXF 1C4Y2 4YT6H 3ATLA 4FUGA 1L4DA 3SNEA 4Y8ZA 2BVSH 1WQVH 1OWJA 3I29A 3DUXH 2ZU1A 2BD9A 1Z6JH 4WMEA 5I46H 1PYTD 2XWBI 1RGQA 2AH4X 2Y5FA 2BDIA 3A80A 4UFDH 5GXPA 1O2RA 2STBE 3GDUA 3K6ZA 3VFEA 2Q6FA 2QA9E 1QRWA 1SQAA 1QGFA 4FU7A 1N8OB 1YCPH 1PQAA 1SOZA 2OP9A 3TGJE 3PMHB 1GJDB 4AG2A 2VH6A 1GBAA 4D9QA 3FANA 3ODDA 4NZQA 1QTFA 3S9BA 2M5TA 3ENSB 1DX5M 2A4GA 1S82A 1OWIA 1WU1A 4JYVH 3AAUA 1CO7E 4IW4E 2F9UA 2VNTA 5A8YA 2JETC 1PQ8A 1IQJA 2FX6A 1AN1E 1P04A 2EC9H 3SV8A 4XDEA 1AFQC 5DP9A 4OS2A 2G81E 3KIDU 2GCTB 2NU0E 3SZNA 1NT1A 1KTTB 1CHOF 1Y5UT 1ZPBA 3M3VA 5E2PA 5DP5A 1KXAA 3UTUH 1DT2A 2B9LA 4Z6AH 3QTVH 1ELFA 1E38B 5DG6A 2Y7ZA 3S7HB 1GCDA 1TOMH 2FLBH 2O8WA 1BHXB 4ZUHA 4ISLA 1KLIH 3D23A 3SJ8A 4NCYA 1JWTA 2TIOA 1B7XB 3Q76A 1HIAA 4CRBA 5EPNA 2ZHFH 3EDXB 2D26C 3NUMA 2H5CA 1BZXE 3LJJA 2G52A 1F5RA 2H6MA 3RXCA 1ARCA 1BMAA 4Y0ZE 2FPZA 1BIOA 1F92A 4ZH8A 1UTJA 1GI1A 5SGAE 1DWCH 1KLTA 2BMGB 4AOQA 1C5NH 2ZNKH 3SU1A 8GCHF 4INLA 3MHWU 4H6TA 4KKDA 3UOPA 3A81A 2CJIA 2HALA 1C2LA 3M3SA 3RU4E 1L4ZA 3P6ZB 2H9HA 4MVNA 1GBFA 1FIWA 1V2WT 2A4OA 4Y7BA 5DP7A 4A5TS 1DICA 3RC5A 1P2QA 3TK6A 1YCPK 1AGJA 2AMQA 3TJUA 3SU3A 5I25A 1C2EA 1P11E 2OUAA 1DXWA 5ESTE 3G01A 2F9OA 1GVLA 1MCVA 3F9FA 4GSOA 4KTSA 1BRAA 1EB1H 3GY3A 1B0FA 1GG6B 4WMDA 1KXEA 3KQDA 4ABAA 1O39A 1C1PA 1SI5H 1J9CH 2FODA 3P8OA 1PPEE 1FY5A 1O3IA 1O2YA 2ZHDA 1P12E 3SQHE 1ZGVA 2HLCA 1K28D 2GVFA 1C5OH 2FMJA 2XC4A 1TOCB 3FVFB 2JH6D 1SGFG 3F68H 1CBWC 1QCPA 1DWEH 1C5PA 1EJMA 1V6DA 2EI7A 3AASA 1W14U 2C93B 4DURA 3M37A 2J4IA 1BTUA 1QIXB 5ETXA 1OWEA 1NESE 2QY0B 1HFDA 2Y82A 4HGCA 1YPLH 3Q77A 5L2YH 1ETRH 1VGCC 1TGBA 3EAJA 1CVWH 1GMDG 3MMGA 3NZIA 4WJG2 1ZRBA 2QV1A 1S0QA 2OD3B 2ZHEH 1V2RT 4X6MA 1SLVB 1W0ZU 2XXLA 4Q7YA 3MU4A 1WCZA 2J2UA 3SU4A 3KEEA 3MWIU 4FU8A 1EAIA 2I6QA 4WWYA 4DCDA 3QX5H 1JOUB 1ZMLA 2P3TB 1SQOA 1HLTH 5AFYH 1AVXA 1YPEH 3SU6A 1G2MA 1XUIA 1RXPA 1BB0B 3HK3B 4ISHH 3R0FA 1NFWA 2AERH 2G4UA 1GJ9B 4TWWA 5LGOA 7GCHG 3FZDA 1O3BA 2DUCA 5DP4A 5ABWA 3GY8A 4YO9A 4B76A 1ZHRA 7LPRA 3V3MA 1RTLA 1TMTH 3SGQE 1V2MT 2R3YA 1BCUH 5EODA 1C1UH 3E8LA 1VCPA 1BTWA 3EYDA 1LKBA 1A5GH 2FM2A 3M5NA 2AMDA 4O97A 1VCWA 3RXQA 3RXHA 2ZU5A 1GI2A 3RMLH 1XKAC 3ZVFA 2GZ9A 4BAMB 6LPRA 4Y0YE 1Y3WA 1CHGA 1LCYA 4Y7AA 1W7GH 1MD8A 4INHA 1QBNA 4RKJB 1Q3XA 4I8JA 1THSH 3BG8A 1F0SA 1ELCA 1XUKA 3ZZ9A 4K3JA 1J8AA 1VJ9U 2XCNA 1HJAB 2F91A 4FVBA 1GI6A 3UPEA 1O2VA 3PROA 5HYOA 3S9AA 3MNSA 4MPXA 2HOBA 1DANH 3T5FH 1TBRH 2Z94A 3F9EA 1T4UH 2FYRA 1T8OA 4I33A 1GMCF 1TBQH 3ZVBA 4UFGH 3VXEH 4ZMAH 1AIXH 3ZZBA 1C2KA 2AGIX 1THRH 2VINA 2GCTC 1MD7A 4ISIH 1G2LA 2FESH 3LJOA 3M7TA 3PMJA 1LQDB 1KDQB 1P2IA 4K5ZA 1ZSKA 4K8BA 4DGJA 3A7TA 1QURH 1NFXA 3LGWA 2CXVA 2BD5A 1RRKA 1GJ5H 2FTLE 2WUCA 3S7KB 2ANYA 1W12U 1B5GH 2H2ZA 4FUBA 1TA2A 1H9HE 1GHVH 2FOHA 4AX9H 1DLKB 5A8XA 1O30A 3GY4A 2RA0A 4TY6A 4CBOA 2BD8A 5L6NH 4NWKA 4Y71A 3E1XB 3UQOA 1GHAF 2OINA 4X8VH 1P01A 2Z9IA 1WOFA 1H1BA 1CQQA 3RLWH 1FJSA 1O2XA 1P09A 3CS7A 2WPHS 6CHAB 2A7JA 3V0XA 4DVAU 1X7AC 1YYY1 1SGPE 3I78A 1CGIE 1EUFA 1T8NA 3SUFA 3E0PB 4YLQH 2BM2A 2FX4A 1NPMA 3T27A 1ELAA 4MPUA 5A0AE 5FX6A 1GBMA 5EQQA 3BG4B 3SO3A 4CH2B 2H1UA 1PYTC 4CR9A 2GMTB 1C4V2 3P95A 2BHGA 1GBTA 1P3EA 2IJOB 3A87A 3GCNA 5EG4A 3PLPA 3A7WA 1GMHG 1O2MA 5HXFA 2FZZA 1C5MD 3I77A 5T6DA 1D6RA 1OX1A 2UWPA 2ZU4A 2WINI 1GI8B 3KQEA 2ULLA 1H9IE 4BAQB 5T6GA 1RTFB 1O3PB 4YT7H 2B5TB 3ZVCA 1O2HA 2IN2A 3LPRA 2XC5A 1FMGA 1EOJA 3RXMA 2Z3DA 3NK8A 2ZTZA 1DWDH 2A7CA 3FZZA 3STIA 1SC8U 2QAAA 1TNLA 3KQCA 1LQEA 4Y79A 1FY1A 2FI4E 2ZPSA 1QL7A 1TNJA 2HWLB 4BAOB 3O8CA 5F8ZA 2YOLA 1ESAA 2PGQB 5AF9H 3SI4H 3ESTA 1SGRE 3TNSA 1Y8TA 1O5CB 1TLDA 1L1GA 2J9NA 2SFAA 3VEQB 2NU4E 4DW2U 2G00A 1ABJH 4AFUA 4WH6A 1V2VT 4CRCA 1L1NA 9ESTA 4WVPE 1GHYH 2ZGXH 1LKAA 1TRMA 2ZTYA 3DFJA 4UDWH 5HGGA 3VPKA 1SHYA 1FI8A 1KXDA 3D49H 4ZHLU 1S6HA 1TQ0B 1SSXA 1WSSH 3U69H 1O5FH 5FPYA 1P3CA 1T31A 1CHOG 1W13U 1GI4A 2PKAA 1MTNB 3MU1A 1IHTH 3RU4T 1H4WA 4MQAA 1QBVH 6GCHG 4ZKNU 5E2OA 1INCA 1L1JA 1G37A 4X2VA 3TITA 4XE4A 4YOGA 2QYIA 1F0TA 4H4FA 5ESBA 2Q6GA 5E0GA 1DDJA 1C5SA 3MU5A 2ZDKA 1C5QA 1KTSB 3SGBE 4ZKRU 4K8YA 3RLYH 1QJ1B 3T29A 1HIAB 1KXCA 1K1NA 3PMAB 2J92A 1UCYK 4FUHA 4VGCC 3T2NA 7KMEH 1GBHA 2OBOA 1NFYA 1O36A 2Z9GA 3PM3A 2GP9B 1C1WH 2DE8A 1EATA 1DITH 3LIWA 3P92A 1T8LA 1SL3A 4GLYA 3S9CA 1Z7KA 5CHAC 5TCCA 3TNTA 4A1TA 2VVCA 4AB8A 3IWMA 1O3LA 2ZFPH 1GJ6A 1YGCH 3ITIA 2WPIS 3LGUA 1AO5A 3W94A 4FUCA 3BIVH 4IN1A 3C27B 2PGBB 1GVZA 1QY6A 5FBEA 5EGMA 1T4VH 1GJ4H 1EZQA 1ELBA 3U9AH 4GCHG 4O3TA 2V3HH 3BTFE 1UO6A 1OPHB 1TX7A 3SJ9A 1RIWC 1GBIA 3B9FH 3TGIE 3KN2A 3UNQA 2EEKA 2QIQA 1HAVB 1QB1A 3STJA 1UVPA 2GDDA 1KSNA 5EQSA 3ZV8A 1VJAU 3DHKH 4TWYA 4A1XA 4MPWA 3SI3H 4X2YA 4A92A 5DK1A 1FN8A 1F0UA 1TGSZ 1EZXC 5TJXA 3T25A 1D3QB 4RN6A 4OGXA 1ORFA 3E6PH 2ZDAH 1ZLRA 5C5OA 3ZZ4A 1M9UA 1Z8JB 4NWLA 2QF0A 2VU8E 4Y8XA 2QXGA 1IOEA 3A7XA 3HATH 4YLUA 2OQ5A 3PYHA 2PUXB 2OTVA 2ZIQH 3OTJE 1SGYE 1SLXB 4AB9A 1GHAG 2Y5HA 3LGVA 5C2ZA 2R0KA 1CBWB 4JK6A 1E35B 1O2ZA 2BZAA 2F9NA 2P93A 3BTWE 4X6NA 1YPJH 2VIQA 1FZZA 1ABIH 1C2FA 4XBCA 4JZEH 1W8BH 2ANWA 2XBVA 1QJ7B 1O3HA 1PPZA 1HJAC 1NO9H 1C2DA 1AZZA 1G36A 1UVTH 4XBDA 2FEQH 3KNXA 4A1VA 3A8DA 3SHAH 5DO4H 1BUIA 4YESB 1XXFA 2VH0A 2B0FA 1O2SA 1HJ9A 1ZHPA 5FBIA 3M5LA 1Z1JA 2OC1A 2J34A 1B0EA 2A4RA 1TA6A 1EB2A 2GV6A 3O8RA 1O2PA 4I32A 4B71A 2HRVA 3TU7H 2GD4B 3U8TH 1O3OA 3SJIA 1THPB 2B8OH 1XVOA 3MH7A 1IQNA 1C5TA 1XUFA 4B2CA 1UTPA 3BEFB 5GPIB 2ZPRA 1GWAA 1EPTA 3GICB 1BBRK 3RXKA 2G4TA 4FU9A 2PKSB 2V35A 1AD8H 3ZZAA 2VWLA 3K9XB 4MNYA 1O5EH 4HZHA 2OC8A 1Y3VA 3PMBB 3QZQA 2VGCC 1UTNA 1YP9A 2ZDVH 1PPFE 2UUFB 4NSVA 3T62A 1FQ3A 1GJ7B 1JIRA 2ZZUH 1ZJKA 4D8NA 1C1SA 1ZTLA 2ZDNA 3E16B 2QCYA 1CA8B 3QK1A 4FUIA 1MH0A 1AKSB 1TRNA 1MTSA 3ZZ6A 1D3TB 1FY3A 1D3DB 1YBWA 4NA7A 3TLOA 4ABEA 1F5LA 4Y76A 2F9BH 3ZVDA 2PTNA 2CF9H 3Q3YA 3RXEA 1RFNA 1QBOA 1AHTH 3B8JA 1TALA 2PLXA 1O2GH 3SV9A 1UTLM 2VVUA 3KL6A 1HUTH 2BYAX 1OP8A 3CENA 1UK2A 5B6OA 4XOJA 1DFPA 1DWBH 1S85A 1N6XA 1TB6H 5GCHF 1SG8B 3WY8A 1K22H 2UUKB 3M61U 1IQHA 2GZ7A 1LPGB 1Z71A 2V3OH 3KHVA 4OS1A 5H4IB 1D4PB 1AVWA 1IQLA 3VB6A 1O35A 1QQUA 3AVZA 2AGEX 2TRMA 1GJBB 4ASHA 1MTVA 2BLWA 2FYQA 3A7VA 1OP0A 4H42U 1BA8B 1O3NA 2ZFFH 3HPTB 1SGQE 3GDSA 5E0HA 1A4WH 1KDQA 3OYPA 3GCHC 3U1JB 4BXSA 2BQ7B 4AFQA 4CREA 5F6MA 1HAVA 1MZDA 3M5MA 1FPHH 2VVVA 1GBJA 1MQ5A 1O5DH 2A7HA 4CRAA 3DA9B 1G30B 2BDBA 4A7IB 1GI0A 2A2QH 3N7OA 1UTMA 4X2XA 1SLUB 3PB1E 1O32A 4B1TA 1NRPH 1SGCA 5JB9S 3MTYA 2ZFSA 4DIHH 1NY22 5K7RA 4X2WA 1GBBA 2P3UB 2CF8H 1YLCA 1C5VA 1P0SH 1ZSJA 3DT0H 1MAYA 4BXWA 3ATMA 5FXLA 3TJVA 2XC0A 3IITA 1KIGH 2XYAA 3EE0B 3LKWA 3UWJH 3SU2A 2ZF0H 1AB9C 2XBXA 4DOQA 2I6SA 4GPGA 4WXIA 1A46H 1SGEE 1BRUP 3LT3A 1AFQB 2BD7A 2R2MB 2W26A 4D76A 4B74A 3GDVA 4O9VA 4IS5A 4OS6A 4ZHAA 4U2WA 3UR9A 1SQTA 1HAXB 2THFB 1MKWK 2YNAA 1NRRH 4TY7A 2HNTE 5HMAA 3VGCB 1H8IH 1SHHB 3RUOA 5LPRA 3LGYA 3VXFH 1O37A 1AQ7A 3MU8A 4D7GA 2FS8A 2FOCA 2A2XH 3KCGH 2V0BA 2FI5E 5T3HA 1HB0B 1D3PB 4INKA 2FI3E 1K9OE 1ZR0A 1P05A 3ZVAA 1EPTB 1LDTT 1TPOA 3UNSA 1LVOA 3SUEA 2GTBA 3OSYA 2F3CE 2PFEA 2YNBA 2BDAA 4LXBH 1S6FA 5J4SA 2GKVE 3SQEE 3ZZ5A 1FNIA 2ZU2A 4FUJA 1DSTA 3EGKH 5A2MH 5A0BA 3M7QA 3RP2A 4UFFH 2FOFA 2Z7FE 5DP6A 1GMCG 1G3CA 1BMMH 2PWXA 2H9TH 1E34B 3Q00A 1VZQH 3ZV9A 2XW9A 4AYVB 1C9TA 3SW2B 1W0YH 3QUMP 3W95A 3PLKA 1TGCA 4ABHA 4XSKU 2WPKS 2AYWA 5LPEA 2Y6TA 4GHTA 1NRSH 3UQVA 4NIWA 3QLPH 1W11U 1O0DH 4HI3A 2NWNA 2GT7A 5G4BA 1CA0C 2GCHF 1O3AA 4MTBA 4K69A 3FP8E 4X0WU 1NRNH 2CN0H 3HKJB 4U30A 1T7CA 5HM2A 4E06H 2UUYA 3NPSA 2XNIA 1YKTA 3RM2H 3PTBA 1TBZH 3TIUA 2ZCLP 1MU8B 2Z9LA 3T28A 2C90B 1HAIH 4X8UH 3RXRA 1RS0A 1C2GA 2VJ1A 4CBNA 1ELEE 4GAWA 1O2JA 1EAWA 1YPHC 3A84A 3MH5A 1BOQA 1XUJA 4B73A 1ID5H 2B7DH 2PW8H 4O03A 1ELDE 2P59A 2BX3A 2HNTC 3PO1B 1P2KA 4XBBA 2BDCA 2WPMS 1NFUA 3ODFA 1TQ7B 1TYNA 5JBAS 5JPMH 2XCFA 1CU1A 1HRTH 4Q7XA 2J38A 2P94A 3H7TA 1T32A 3D62A 1ZSLA 2SGDE 1TRYA 4X6OA 1HAYB 1P57B 1UHBB 1SBWA 1UCYE 3BTDE 3LH1A 3M35A 3VB7A 4K1SA 1O3KA 1HGTH 2FOEA 5E8EH 1ZTKA 2BTCE 3BF6H 4Y11E 1C4U2 1HXFH 4YM9A 3CP7A 3FP7E 5C1UA 3L33A 3MFJA 3UREA 1IAUA 1GBDA 4UE7H 2A32A 2UWLA 1LHFH 1FDPA 3ATKA 1AE8H 4RKOB 1AMHA 1UHBA 3O8DA 2CHAB 6CHAC 1XMNB 5GIBA 4R0IA 3ATWA 1JRSA 1C5UA 3L6PA 1IQEA 1HJ8A 4WH8A 5FCKA 1SGNE 1WQSA 4Q80A 1BQYA 2VIDA 1GPZA 1Q2WA 3UFAA 4X1PU 1O3FA 1N6YA 1P2JA 1O3DA 1BRCE 1XUHA 1EJNA 2ZHWH 3R3GB 4H6SB 4WXVA 1HBTH 1AFEH 2WYJA 3BN9A 1O34A 2QXJA 2ANKH 2ZU3A 4X1RU 1EASA 1L0ZA 1OKXA 2VIVA 3GCTF 1VITH 1FY8E 4AZ2B 1SLWB 1P06A 3EQ0H 2TGAA 1GHXH 1S84A 2BY6X 2AGGX 1TPAE 4LZ4B 3UUZA 1EP5A 1BTXA 1K1JA 3HKIB 3JZ2B 1EP6A 2STAE 4JZDH 3RM0H 4NA9H 4MG3A 6GCHF 4QT8C 1JIMA 1QL9A 2ZCKP 2PKAB 2OLGA 1C1OA 3UIRA 1UTKA 3RMMH 3TPIZ 1SR5C 5C1YA 5F8TA 3A83A 3MH6A 1J16A 2PUQH 2RA3A 2QXIA 2BY8X 1UVSH 1OWDA 2PKSC 1O3MA 3P8FA 1YC0A 1BJUA 2OQUA 3RDZA 2ZA5A 4JZIA 1A5IA 3MO6A 4MNXA 2BLOA 1EX3A 1ANDA 2Q1JA 1AUTC 2K1QA 3RXVA 1W2KH 1S5SA 5K0HA 4NG9H 5A09A 4ABJA 1G3EA 1GL1A 1G3DA 2W3IA 2ZGBH 5HM9A 1HPGA 2KAIB 1P9UA 1ETTH 3SV6A 4K2YA 2BB4A 3SORA 2Z6BD 4DIIH 3HK6B 1WTHD 1S0RA 2DE9A 3RC4A 5F8XA 1MTWA 3ZVEA 1OSSA 7ESTE 1DS2E 2F9PA 1EPTC 5C3NA 3GYMA 1HAPH 1GBKA 1QB6A 1Z8RA 3BG4C 5CE1A 3TK9A 1LHCH 1K1LA 1WUNH 1EAXA 3A82A 1KY9A 1Z8IB 1C5XB 1UVOA 4IMZA 3QO6A 1V2JT 1RJXB 1BBRE 2A5IA 3LOXA 1SGTA 2NU1E 1XKBC 4K60A 2VIPA 3URCA 2GX4A 3HGNA 1TNHA 1DUAA 4E7RG 2ODYB 5BPEA 1FPCH 8ESTE 5EW2H 3OX7U 1MBMA 1GGDB 5EU8A 5JBTA 1GHBG 1HAGE 2H5DA 1DM4B 3FAOA 4BAKB 1CT4E 4NSYA 4TPIZ 1ZTJA 2A45B 1JXPA 2KAIA 1AB9B 1ELGA 2SNVA 2ASUB 1BTHH 5EW1H 1V2QT 1Y5BT 2BXTH 2ODQA 1OS8A 3OY5U 1O33A 3KF2A 1J14A 1D6WA 9LPRA 2ALPA 2EA3A 5JDUB 1VGCB 1Z8GA 3NXPA 3B23B 3LC3A 4UEHH 1NS3A 1AE5A 3TH3H 3DD2H 2ZWLH 3KQBA 3MNBA 1MKXH 3A7ZA 3MNCA 4BAHB 1GCTB 3ZZ7A 2GGVB 2AEIH 1AU8A 2A1DB 1SFQB 3LC5A 1CA0B 1GHWH 4SGBE 1A0LA 2SGQE 2Z3EA 2ZTXA 1NZQH 2PR3A 1XVMA 1QHRB 1ZRKA 2G5VA 4FUDA 4XFQA 5CMXH 3M36A 5LPFA 4X1QU 4FXGH 1O2LA 1TFXA 2WV4A 2BOHB 2FWWA 2P8OB 1Z1IA 3FP6E 1LHEH 2ZQ2A 1C1TA 3NCLA 2Z9KA 2BOKA 5JBCS 3A8CA 1RD3B 2Y5GA 2WV5A 1ZMNA 2NU2E 1HCGA 1S83A 4LZ1H 1TX8A 3A8AA 4AORA 3CS0A 1VITF 2RDLA 4AG1A 1C5WB 1FV9A 1MQ6A 1O2TA 1G9IE 2FTMA 3GYLB 3GY2A 1C5LH 2HPPH 1EKBB 2SGFE 1A7SA 2ZGHA 5FHTA 4IGDA 3MO9A 4ABFA 3S69A 2FLRH 1J17T 1AY6H 3LDXH 2AIQA 2QGRA 1XUGA 3GY5A 2Q6DA 1K21H 1C5ZB 2ZPQA 2ZHQH 2ZFTA 1V3XA 1DY9A 3LGIA 1V2OT 3LH3A 1TNIA 2D8WA 1GHZA 5E0JA 1QFKH 1SFIA 2TGPZ 1O2QA 1YM0A 1HNEE 1YLDA 4YOIA 3D65E 3BTME 1OP2A 3GY7A 4YTAA 4B2AA 1A61H 5EXNA 1ZGIA 2FOMB 3H5CB 1ANCA 5AHGH 3GCTG 1LPKB 2O8LA 4YOJA 2VWOA 4JZ1A 3QDZB 4JYTA 4YZUA 2QN5T 2ZEBA 3TJOA 1DUEA 1QL8A 2BD4A 2OC0A 4X1NU 3V13A 4GCHF 3ATIA 2ZGJA 1YPKH 4CHAC 4I8KA 3RXIA 4X8TH 1QJ6B 1DLEA 1OYQA 1CGHA 2GZ8A 1NTPA 2FIRH 3RXBA 3SV7A 1BTYA 4BTTB 5EXLA 4DJZB 4B75A 5FX5A 2W7UA 3C1KA 1W10U 1XM1A 2HGTH 1ANBA 1H9LB 1OWKA 3T26A 1JRTA 3M7UA 2GMTC 3UY9A 1RIWB 1ELTA 1P03A 2ODPA 3GOVB 2TPIZ 2PSYA 5GCHG 3A88A 8GCHG 4I7YH 1EJAA 1U6QA 2FOBA 1KXBA 4U01A 2WUBA 3GCHB 2SGEE 2WPLS 1ELVA 4UONA 1O3EA 4MNWA 1FXYA 5AFZH 4ZAEA 1ZJDA 3M5OA 1P8VC 3MU0A 3P8GA 4UD9H 1EQ9A 3K65B 1AUJA 4IN2A 1FIZA 4LK4A 3QGNB 2TGDA 4FUEA 1V2NT 4O3UA 2AIPA 2PV9B 1O3CA 4BANB 3ZZCA 1EOLA 3U98H 2SGAA 1GBEA 2OBQA 1HYLA 2HPQH 1ESBA 1VR1H 1Y3UA 3ZZ3A 2XBYA 4ZKOU 2HNTF 1ETSH 1TPSA 2BD3A 1YPHE 1A0JA 2ZG0H 2BQ6B 4F49A 5C5NA 1C5YB 1O5BB 4WMFA 1TAWA 2HVXA 3NKKA 4UFEH 1C2HA 1C2MA 1BDAA 4AFZA 4CHAB 2P16A 1V2LT 5DKMA 4IMQA 2QC2A 4MDSA 1K1MA 1E37B 4HFPB 4ZROA 1ESTA 1DXPA 1ACBE 2ALVA 3IG6B 3SGAE 1PFXC 1LVYA 1JBUH 1TABE 3UNRA 3SU0A 3FFGA 4KP0A 4BNRA 2G55A 3RXTA 1IQMA 3BTHE 3SUDA 2BLQA 1TGTA 1MTUA 2BDYA 1F2SE 1ZOMA 1PPBH 4B2BA 3MOCA 5FCRA 2CMYA 2ZFRH 3GY6A 2A31A 2BLVA 1SB1H 1BTPA 5FAHA 1IHSH 3TGKE 1GDNA 5J4QA 4I8HA 1F7ZA 1DVAH 2BVRH 2W5EA 3PWCA 1O3JA 2ZFQH 1GI5A 3F1SB 3E3TA 1K1PA 3A89A 1GDUA 4D7FA 1GBLA 1F5KU 1GI3A 3VB5A 1V2KT 3LGTA 2FDAA 4E7NA 1EZUC 1LPZB 3SJKA 1EXFA 2OCVB 1UTOA 1TIOA 4KTCA 1IQIA 4BTIB 4Q7ZA 1PPCE 1GI7B 3A7YA 1CE5A 4ABIA 3MO3A 2C4FH 3BTKE 4M7GA 3RXGA 1HV7A 5DJ7A 1QRZA 2D2DA 5EXMA 5TCAA 3V7TA 3BTTE 1TPPA 1WYKA 4I8GA 3EA9A 1AWHB 4NIVA 1EAUA 2GDEH 1MAXA 3BEUA 2FO9A 1H8DH 2Y80A 3VB4A 2P8OC 2QF3A 3RXOA 4FUFA 1A3EH 1BBRH 1C9PA 2AFQB 3RXPA 1WV7H 1SGIB 2FP7B 5A8ZA 2ZI2H 1LO6A 1NC6A 3Q3XA 3VGCC 1FN6A 1O2NA 1WAYB 1ZMJA 4HTCH 3HGPA 4X1SU 1EZSC 3ZZ8A 1PPGE 2C8XB 5C20A 2ZDMA 3MNXA 2ESTE 2FXRA 2ILNA 2AS9A 4AYYB 3PV4A 1SGFA 1HAHH 4ISOA 1GI9B 5F03A 2IPHA 4JMYA 3U8OH 1C5RA 1S81A 2D1JA 1GDQA 4Z0KA 2C3SA 4CRDA 2GT8A 3TVJB 1GMHF 2PTCE 3OU0A 3RMOH 4ESTE 2QXHA 2VB0A 1OXGA 1TWXB 1XX9A 3KGPA 4DT7B 3ZYEA 1GBCA 1Y3XA 2BDGA 1L2EA 5DP3A 2SNWA 2UUJB 2ZGCA 5LH8A 2R2WU 1GVKB 3PWBA 1BT7A 2A0QB 1BMLA 1NN6A 1YPGH 4U32A 1MKWH 2OXSA 3QTOH 1BRBE 3SNDA 1GJ8B 2VIOA 2VWMA 4CH8B 1K2I1 1C2IA 1FUJA 4ZXYH 3LU9B 1LMWB 4BOHA 3BTQE 4ISNA 3TH4H 4AN7A 3SBKA 4R8TB 3BTEE 4WY3A 4NIYA 2V6NA 2XTTB 1SGDE 1K1OA 1BMNH 5DP8A 2XRCA 4THNH 1Y59T 1MKXK 2A5KA 1TMBH 5CHAB 1DY8A 4RSPA 2FS9A 2C8ZB 2RCEA 1ARBA 2G5NA 1A5HA 3U1IB 2BDHA 2XBWA 1AVGH 3H7OA 8KME2 1NRQH 1CSOE 4VGCB 1AZ8A 1C1QA 2WYGA 2ZQ1A 1Q31A 3ZZDA 1HAOH 1KXFA 1O2OA 1ZHMA 5GWZA 1UTQA 3V12A 1O3GA 1TMUH 2BY5X 2PHBA 3M3TA 3RU4D 2CV3A 4IC6A 3SHCH 1A3BH 3A8BA 3QN7A 4KGAA 5L30H 1MUEB 2VIWA 1QA7A 1V2TT 3RXJA 4I8LA 1CT0E 1UVUH 5C67A 2O8MA 2OC7A 3AW0A 3S0NA 1SPJA 3ZVGA 1O2WA 2ZKSA 2R0LA 2P95A 4NFEA 4OS5A 2AMPA 1V2ST 4AFSA 1Y3YA 3UOUA 3UR6A 1AWFH 1PJPA 1UMAH 3RXFA 1HDTH 3JZ1B 3GISB 2BY7X 4E05H 4J2YB 2ZCHP 1BITA 4Y10E 5PTPA 3RXLA 4X8SH 2RG3A 4NFFA 5GDSH 3BEIB 3TJNA 4D9RA 1O31A 2F83A 4KELA 1OYTH 1E36B 1MCTA 4IBLH 1DOJA 2ZECA 3ZYDA 1UJ1A 5DPAA 3L3TA 3UWIA 2C8YB 5C1XA 3F9HA 4Y8YA 3E91A 1QRXA 2TGTA 4JK5A 4K1TA 4A6LA 4ABBA 2CHAC 2WPJS 2ZP0H 4OS7A 3URDA 4Y6DA 4F4OC 1OWHA 1CT2E 1IQKA 3MI4A 5GJ4B 1SMFE 3AAVA 1GMDF 4OS4A 1P2OA 2SGPE 1J15A 1LHDH 1SVPA 3F6UH 1CGJE 1FAKH 3NWUA 2FOAA 4CRFA 1OOKB 5A0CA 1W3CA 1O5GH 1LVMA 4JCNA 2O8UA 3LONA 2O8TA 5FPTA 2GCHG 1P2NA 3PO1C 1V2UT 4MPVA 1YCPM 5JBBS 1PPHE 1PQ7A 1NM6A 2W7SA 2IOTA 5EQRA 4ZXXH 2FOGA 2BQWB 1ZPCA 4TPYA 2GV7A 2UWOA 1A1RA 1F0RA 1C1VH 3RMNH 3RXSA 3RXAA 2BXUH
chains in the Genus database with same CATH superfamily
1WTGH 2CGAA 4KTUA 4X6PA 3GCOA 3SU5A 1QB9A 2TBSA 1DPOA 4NGAH 4ABDA 1UK3A 2C8WB 2JH5D 3F9GA 3PRDA 4CR5A 4DY7B 4NA8A 3TK5A 1BJVA 2KX4A 1LVBA 2Z3CA 1GL0E 1SOTA 4Q2KA 2QE7D 3SNAA 1LTOA 1WBGB 3MYWA 2M2AA 1FAXA 4Q63A 4FVDA 1O38A 1UK4A 1O5AB 1D9IA 2BVXH 1DSUA 2JH0D 4IC5A 2ANMH 5KECA 1N1LA 1VITG 1C1RA 2VGCB 4TSFD 1ZYOA 2KFWA 2H9EH 1TNKA 1MABB 1ANEA 3BSQA 3TH2H 2IPQX 1TE0A 3EA7A 2A5AA 1Z6EA 3Q3KA 5IDKA 2BZ6H 5L2ZH 1N8OC 1TONA 2O9QA 1TGNA 2W3KA 4AGKA 3BV9B 1TNGA 2J95A 3O8BA 4JYUH 1NU9A 1QQ4A 1HXEH 1AI8H 1GJAB 2BX4A 1A0HB 1QA0A 2Y7XA 4GHQA 4DG4A 1T8MA 4ZKSU 1VCQA 2NU3E 2R3UA 1P02A 1TX6A 1RTKA 2KR7A 2XWAA 4PROA 4SGAE 3SN8A 3VB3A 2R9PA 1V2PT 3OFND 5HIYA 1G3BA 3K6YA 3UB0A 3P70B 4WF8A 1PQ5A 1NU7B 3QWCH 3SUGA 4NZLA 4LOYH 4GUXA 1QNJA 1AKSA 1A2CH 3RXUA 1MTNC 3P8NA 4I86A 1JMOH 4CRGA 1MMJN 1BTZA 3EA8A 6ESTA 5BRRE 4NIXA 4BTUB 3SJOA 4K1EA 3DFLA 3RXDA 3K2UA 1KLJH 2EI6A 3BTGE 1NROH 3A85A 2Y81A 3E90B 4ABGA 1W7XH 2BD2A 7GCHF 5EIYA 1ZPZA 5EPYA 5AVDA 1GCTC 1XXDA 2LNCA 2JETB 1YF4A 1E0FD 5JYIA 1HAZB 5DGJA 3SV2H 1KYNA 3U8RH 3AW1A 1P10A 2PSXA 1MZAA 5EJLA 1DE7H 3OY6U 4F55A 4J1YA 1FLEE 2LPRA 4TYDA 1P9SA 1FY4A 2ZC9H 1NBME 2F9VA 1P2MA 2G51A 3A86A 1O2IA 4GVUA 4I31A 1IQFA 2ZO3H 4MNVA 1MU6B 1C1NA 5JB8S 1GJCB 2G8TA 3DSOA 3RC6A 4P00A 8LPRA 1Y5AT 2Z9JA 2BY9X 3PTNA 2ZDLA 2EI8A 1O2KA 1YPMH 2VWNA 2J94A 1GGDC 3P17H 1UCYH 2JKHA 5EOKA 3BIUH 1GG6C 1K1IA 1K0HA 1C1MA 3MH4A 5IYTA 4AGJA 4JZFH 4ZHMU 2P3FH 1MBQA 1QR3E 5T6FA 3SNBA 1FONA 1C2JA 1G32B 1O2UA 3QZRA 4MLFB 3QGJA 3SNCA 3E0NB 5FPSA 1GHBF 3ELAH 3SOSA 1LHGH 1IQGA 2A4QA 3PLBA 4OGYA 1ZZZA 1BHXF 1C4Y2 4YT6H 3ATLA 4FUGA 1L4DA 3SNEA 4Y8ZA 2BVSH 1WQVH 5C94A 1OWJA 3I29A 3DUXH 2ZU1A 2BD9A 4FOUC 2AHME 1Z6JH 4WMEA 5I46H 1PYTD 2XWBI 1RGQA 2AH4X 2Y5FA 2BDIA 3A80A 4UFDH 5GXPA 1O2RA 2STBE 3GDUA 3K6ZA 3VFEA 2Q6FA 2QA9E 1QRWA 1SQAA 1QGFA 4FU7A 1N8OB 1YCPH 1PQAA 2WSSD 1SOZA 2OP9A 3TGJE 3PMHB 1GJDB 4AG2A 2VH6A 1GBAA 4D9QA 3FANA 3ODDA 4NZQA 1QTFA 3S9BA 2M5TA 3ENSB 3CNRA 1DX5M 2A4GA 1S82A 1OWIA 1WU1A 4JYVH 3AAUA 1CO7E 4IW4E 2F9UA 2VNTA 5A8YA 2JETC 1PQ8A 1IQJA 2FX6A 1AN1E 1P04A 2EC9H 3SV8A 4XDEA 1AFQC 5DP9A 4OS2A 2G81E 3KIDU 2GCTB 2NU0E 3SZNA 1NT1A 1KTTB 1CHOF 1Y5UT 1ZPBA 3M3VA 5E2PA 5DP5A 1KXAA 3UTUH 1DT2A 2B9LA 4Z6AH 3QTVH 1ELFA 1E38B 5DG6A 2Y7ZA 3S7HB 1GCDA 1TOMH 2FLBH 2O8WA 1BHXB 4ZUHA 4ISLA 1KLIH 3D23A 3SJ8A 4NCYA 1JWTA 2TIOA 1B7XB 3Q76A 1HIAA 4CRBA 5EPNA 2ZHFH 3EDXB 2D26C 3NUMA 2H5CA 1BZXE 3LJJA 2G52A 1F5RA 2H6MA 3RXCA 1ARCA 1BMAA 4Y0ZE 2FPZA 1BIOA 1F92A 4ZH8A 1UTJA 1GI1A 5SGAE 1DWCH 1KLTA 2BMGB 4AOQA 1C5NH 2ZNKH 3SU1A 8GCHF 4INLA 3MHWU 4H6TA 4KKDA 3UOPA 3A81A 3ZIAD 2CJIA 2HALA 1C2LA 3M3SA 3RU4E 1L4ZA 3P6ZB 2H9HA 4MVNA 1GBFA 1FIWA 1V2WT 2KCOA 2A4OA 4Y7BA 5DP7A 4A5TS 1DICA 3RC5A 1P2QA 3TK6A 1YCPK 1AGJA 2AMQA 3TJUA 3SU3A 5I25A 1C2EA 1P11E 2OUAA 1DXWA 5ESTE 3FOAA 4Q4LA 3G01A 2F9OA 1GVLA 1MCVA 3F9FA 4GSOA 4KTSA 1BRAA 1EB1H 1YWUA 3GY3A 1B0FA 1GG6B 4WMDA 1KXEA 3KQDA 4ABAA 1O39A 1C1PA 1SI5H 4YXWD 1J9CH 2FODA 3P8OA 1PPEE 1FY5A 1O3IA 1O2YA 2ZHDA 1P12E 3SQHE 1ZGVA 2HLCA 1K28D 2GVFA 1C5OH 2FMJA 1TOCB 2XC4A 3FVFB 2JH6D 1SGFG 3F68H 1CBWC 1QCPA 1DWEH 5C0UA 1C5PA 1EJMA 1V6DA 3GS9A 3F2HA 2EI7A 3AASA 1W14U 2C93B 4DURA 3PV5A 3M37A 2J4IA 1BTUA 1QIXB 5ETXA 1OWEA 1NESE 4P02A 2QY0B 1HFDA 2Y82A 4HGCA 1YPLH 3Q77A 5L2YH 1ETRH 1VGCC 1TGBA 3EAJA 1CVWH 1GMDG 3MMGA 3NZIA 2RDEA 4WJG2 1ZRBA 2QV1A 1S0QA 2OD3B 2ZHEH 1V2RT 4X6MA 1SLVB 1W0ZU 2XXLA 4Q7YA 3MU4A 1WCZA 2J2UA 3SU4A 3KEEA 3MWIU 4FU8A 1EAIA 2I6QA 4WWYA 4DCDA 3QX5H 1JOUB 1ZMLA 2P3TB 1SQOA 1HLTH 5AFYH 1AVXA 1YPEH 3SU6A 1G2MA 1XUIA 1RXPA 1BB0B 3HK3B 4ISHH 3R0FA 1NFWA 2AERH 2G4UA 1GJ9B 4TWWA 4ZCNA 5LGOA 7GCHG 3FZDA 1O3BA 2DUCA 5DP4A 5ABWA 3GY8A 3KYFA 4YO9A 4B76A 1ZHRA 7LPRA 3V3MA 1RTLA 1TMTH 3SGQE 1V2MT 2R3YA 1BCUH 5EODA 1C1UH 3E8LA 1VCPA 1BTWA 3EYDA 1LKBA 1A5GH 2FM2A 3M5NA 2AMDA 4O97A 1VCWA 3RXQA 3RXHA 2ZU5A 1GI2A 3RMLH 1XKAC 3ZVFA 2GZ9A 4BAMB 6LPRA 4Y0YE 1Y3WA 1CHGA 3DCLA 1LCYA 4Y7AA 1W7GH 1MD8A 4INHA 1QBNA 4RKJB 1Q3XA 4I8JA 1THSH 3BG8A 1F0SA 1ELCA 1XUKA 3ZZ9A 4K3JA 1J8AA 1VJ9U 2XCNA 1HJAB 2F91A 4FVBA 1GI6A 3UPEA 1O2VA 3N99A 3PROA 5HYOA 3S9AA 3MNSA 4MPXA 2HOBA 1DANH 3T5FH 1TBRH 2Z94A 3F9EA 1T4UH 2FYRA 1T8OA 4I33A 1GMCF 4HG6A 1TBQH 3ZVBA 4UFGH 3VXEH 4ZMAH 1AIXH 3ZZBA 1C2KA 2AGIX 1THRH 2VINA 2GCTC 1MD7A 4ISIH 1G2LA 2FESH 3LJOA 3M7TA 3PMJA 1LQDB 4XRNA 1KDQB 1P2IA 4K5ZA 1ZSKA 4K8BA 4DGJA 3A7TA 1QURH 1NFXA 3LGWA 2CXVA 2BD5A 1RRKA 1GJ5H 2FTLE 2WUCA 3S7KB 2ANYA 1W12U 3WW7A 1B5GH 2H2ZA 4FUBA 1TA2A 1H9HE 1GHVH 2FOHA 4AX9H 1DLKB 5A8XA 1O30A 3GY4A 2RA0A 4TY6A 4CBOA 2BD8A 5L6NH 4NWKA 4Y71A 3E1XB 3UQOA 1GHAF 2OINA 4ACBA 4X8VH 1P01A 3WWBA 2Z9IA 1WOFA 1H1BA 1CQQA 3RLWH 1FJSA 1O2XA 1P09A 3CS7A 5DN6D 2WPHS 6CHAB 2A7JA 3V0XA 4DVAU 1X7AC 1YYY1 1SGPE 4TT3D 3I78A 1CGIE 1EUFA 1T8NA 3SUFA 3E0PB 2W6JD 4YLQH 2BM2A 2FX4A 2IJD1 1NPMA 3T27A 1ELAA 4MPUA 5A0AE 5FX6A 1GBMA 5EQQA 3BG4B 3SO3A 4CH2B 2H1UA 1PYTC 4CR9A 2GMTB 1C4V2 3P95A 2BHGA 1GBTA 1P3EA 2IJOB 3A87A 3GCNA 5EG4A 3PLPA 3A7WA 1GMHG 1O2MA 5HXFA 2FZZA 1C5MD 3I77A 5T6DA 1D6RA 1OX1A 2UWPA 2ZU4A 2WINI 1GI8B 3KQEA 2ULLA 1H9IE 1NBMD 4BAQB 5T6GA 1RTFB 2KM0A 1O3PB 4YT7H 2B5TB 3ZVCA 1O2HA 2IN2A 3LPRA 2XC5A 1FMGA 1EOJA 3RXMA 2Z3DA 3NK8A 2ZTZA 1DWDH 2A7CA 3FZZA 3STIA 1SC8U 2QAAA 1TNLA 3KQCA 1LQEA 4Y79A 1FY1A 2FI4E 2ZPSA 1QL7A 1TNJA 2HWLB 4BAOB 3O8CA 5F8ZA 2YOLA 1ESAA 2PGQB 5AF9H 3SI4H 3ESTA 1SGRE 3F2GA 3TNSA 1Y8TA 1O5CB 1TLDA 1L1GA 2J9NA 2SFAA 5HIZA 2NU4E 3VEQB 4DW2U 2G00A 1ABJH 4AFUA 4WH6A 1V2VT 4CRCA 1L1NA 9ESTA 3WWFA 4WVPE 1GHYH 2ZGXH 1LKAA 1TRMA 2ZTYA 3DFJA 4UDWH 5HGGA 3VPKA 1SHYA 1FI8A 1KXDA 3D49H 5EJZA 4ZHLU 1S6HA 1TQ0B 1SSXA 1WSSH 3U69H 1O5FH 5FPYA 1P3CA 1T31A 1CHOG 1W13U 2PKAA 1GI4A 1MTNB 3MU1A 1IHTH 3RU4T 2KCPA 1H4WA 4MQAA 1QBVH 6GCHG 4ZKNU 5E2OA 1INCA 1L1JA 1G37A 4X2VA 1YLNA 3TITA 4XE4A 4YOGA 2QYIA 1F0TA 4H4FA 2F43B 5ESBA 2Q6GA 5E0GA 1DDJA 1C5SA 3KQ5A 2ZDKA 1C5QA 3MU5A 1KTSB 3SGBE 4ZKRU 4K8YA 3PRBA 3RLYH 1QJ1B 3T29A 1HIAB 1KXCA 1K1NA 3PMAB 2J92A 1UCYK 4FUHA 4VGCC 3T2NA 7KMEH 1GBHA 2OBOA 1NFYA 1O36A 2Z9GA 3PM3A 3OTPA 2GP9B 1C1WH 4FETA 2DE8A 1EATA 1DITH 3LIWA 3P92A 1T8LA 1SL3A 4GLYA 3S9CA 1Z7KA 5CHAC 5TCCA 3TNTA 4A1TA 2VVCA 4AB8A 3IWMA 1O3LA 2ZFPH 1GJ6A 1YGCH 3ITIA 2WPIS 3LGUA 1AO5A 3W94A 4FUCA 2WV9A 3BIVH 4IN1A 3C27B 2PGBB 1GVZA 1QY6A 5FBEA 4RI0A 1T4VH 1GJ4H 5EGMA 1EZQA 1ELBA 2W6ID 3U9AH 4GCHG 4O3TA 2V3HH 3BTFE 1UO6A 1OPHB 1TX7A 5DSFA 3SJ9A 1RIWC 1GBIA 3B9FH 3TGIE 3KN2A 3UNQA 2EEKA 2QIQA 1HAVB 1QB1A 3STJA 1UVPA 2GDDA 1OHHD 1KSNA 5EQSA 3ZV8A 1VJAU 3DHKH 4TWYA 4A1XA 4MPWA 3SI3H 4X2YA 4A92A 5C17A 5DK1A 1FN8A 1F0UA 1TGSZ 1EZXC 5TJXA 2OK5A 3T25A 1D3QB 4RN6A 4OGXA 1ORFA 3E6PH 2ZDAH 1ZLRA 5C5OA 3ZZ4A 1M9UA 1Z8JB 4NWLA 2QF0A 2VU8E 4Y8XA 2QXGA 1IOEA 3A7XA 3HATH 4YLUA 2OQ5A 3PYHA 2PUXB 2OTVA 2ZIQH 3OTJE 1SGYE 1SLXB 3N7DA 4AB9A 1GHAG 2Y5HA 3LGVA 3SYJA 5C2ZA 2R0KA 1CBWB 4JK6A 1E35B 1O2ZA 2BZAA 2F9NA 2P93A 3BTWE 4X6NA 1YPJH 2VIQA 1FZZA 1ABIH 1C2FA 4XBCA 4JZEH 1W8BH 2ANWA 2XBVA 1QJ7B 1O3HA 1PPZA 1HJAC 1NO9H 1C2DA 1FX0B 1AZZA 1G36A 1UVTH 4XBDA 2FEQH 3KNXA 4A1VA 3A8DA 3SHAH 5DO4H 2K0QA 1BUIA 4YESB 1XXFA 2VH0A 2B0FA 1O2SA 1HJ9A 1ZHPA 5FBIA 3M5LA 1Z1JA 2OC1A 2J34A 1B0EA 2A4RA 1TA6A 3U28C 1EB2A 2GV6A 3O8RA 5KEDA 1O2PA 4I32A 4B71A 2HRVA 3TU7H 2GD4B 3U8TH 1O3OA 3SJIA 1THPB 2B8OH 1XVOA 3MH7A 1IQNA 1C5TA 1XUFA 4B2CA 1UTPA 3BEFB 5GPIB 2ZPRA 1GWAA 1EPTA 3GICB 1BBRK 3RXKA 2G4TA 4FU9A 2PKSB 2V35A 1AD8H 3ZZAA 2VWLA 3K9XB 4MNYA 1O5EH 4HZHA 2OC8A 1Y3VA 3PMBB 3QZQA 2VGCC 1UTNA 1YP9A 2ZDVH 2QF5A 1PPFE 2UUFB 3F0OA 4NSVA 3T62A 1FQ3A 5CHBA 1GJ7B 1JIRA 2ZZUH 1ZJKA 4D8NA 1C1SA 1ZTLA 2ZDNA 3E16B 2QCYA 1CA8B 4M9FA 3QK1A 4FUIA 1MH0A 1AKSB 1TRNA 1MTSA 3ZZ6A 1D3TB 1FY3A 1D3DB 1YBWA 4NA7A 3TLOA 4ABEA 1F5LA 4Y76A 2F9BH 3ZVDA 2PTNA 2CF9H 3Q3YA 3RXEA 1RFNA 1QBOA 1AHTH 3B8JA 1TALA 2PLXA 1O2GH 3SV9A 5EJ1A 1UTLM 2VVUA 3KL6A 1HUTH 2BYAX 1OP8A 3CENA 1SKYE 1UK2A 5B6OA 4XOJA 1DFPA 1DWBH 1S85A 1N6XA 1TB6H 2EY4C 5GCHF 1SG8B 3WY8A 1K22H 2UUKB 3SZEA 3M61U 1IQHA 2GZ7A 1LPGB 1Z71A 2V3OH 3KHVA 4OS1A 5H4IB 1D4PB 1AVWA 1IQLA 3VB6A 1O35A 1QQUA 3AVZA 2AGEX 2TRMA 1GJBB 4ASHA 1MTVA 2BLWA 2FYQA 3A7VA 1OP0A 1VKYA 4H42U 1BA8B 1O3NA 1WDIA 2ZFFH 3HPTB 1SGQE 3GDSA 5E0HA 1A4WH 1KDQA 3OYPA 3GCHC 3U1JB 4BXSA 2BQ7B 4AFQA 4CREA 5F6MA 1HAVA 1MZDA 3M5MA 1FPHH 2VVVA 1GBJA 1MQ5A 1O5DH 2A7HA 4CRAA 3DA9B 1G30B 4B6FA 2BDBA 4A7IB 1GI0A 2A2QH 3N7OA 1UTMA 4X2XA 1SLUB 1W0KD 3PB1E 1O32A 4B1TA 1NRPH 1SGCA 5JB9S 3MTYA 2ZFSA 4DIHH 1NY22 5K7RA 4X2WA 1GBBA 2P3UB 2CF8H 2LELA 5C0TA 1YLCA 1C5VA 1P0SH 1ZSJA 3DT0H 1MAYA 4BXWA 3ATMA 5FXLA 3TJVA 2XC0A 4RT0A 3IITA 1KIGH 2XYAA 3EE0B 3LKWA 3UWJH 3SU2A 2KCAA 2ZF0H 1AB9C 2XBXA 4DOQA 2I6SA 4GPGA 4WXIA 1A46H 1SGEE 1BRUP 3LT3A 1AFQB 2BD7A 2R2MB 2W26A 4D76A 3MQKC 4B74A 3GDVA 4O9VA 4IS5A 4OS6A 4ZHAA 4U2WA 3UR9A 1SQTA 1HAXB 2THFB 1MKWK 2YNAA 1NRRH 4TY7A 2HNTE 5HMAA 3VGCB 1H8IH 1SHHB 3RUOA 5LPRA 3LGYA 3VXFH 1O37A 1AQ7A 3MU8A 4D7GA 2FS8A 2FOCA 2A2XH 3KCGH 2V0BA 2FI5E 5T3HA 1HB0B 1D3PB 4INKA 2FI3E 1K9OE 3DSGA 1ZR0A 1P05A 3ZVAA 1EPTB 1LDTT 1TPOA 3UNSA 1LVOA 3SUEA 2GTBA 3OSYA 2F3CE 2PFEA 2YNBA 2BDAA 4LXBH 1S6FA 3W1EA 5J4SA 2GKVE 3SQEE 3ZZ5A 1FNIA 2ZU2A 4FUJA 1DSTA 3EGKH 5A2MH 5A0BA 3M7QA 5B6LA 3RP2A 4UFFH 2FOFA 2Z7FE 5DP6A 1GMCG 1G3CA 1BMMH 2PWXA 2H9TH 1E34B 3Q00A 1VZQH 3ZV9A 2XW9A 4AYVB 1C9TA 3SW2B 1W0YH 3QUMP 3W95A 3PLKA 1TGCA 4ABHA 4XSKU 2HLDD 2WPKS 2AYWA 5LPEA 2Y6TA 4GHTA 1NRSH 3UQVA 4NIWA 3QLPH 1W11U 1O0DH 4HI3A 2NWNA 2GT7A 5G4BA 1CA0C 2GCHF 1O3AA 4MTBA 4K69A 3FP8E 4X0WU 1NRNH 2CN0H 2YMSD 3HKJB 4U30A 1T7CA 5HM2A 4E06H 2UUYA 3NPSA 2XNIA 1YKTA 3RM2H 3PTBA 1TBZH 3TIUA 2ZCLP 1MU8B 2Z9LA 3T28A 2C90B 1HAIH 4X8UH 3RXRA 1RS0A 1C2GA 2VJ1A 4CBNA 1ELEE 4GAWA 1O2JA 1EAWA 1YPHC 3A84A 3MH5A 3VG8A 2YMSC 1BOQA 1XUJA 4B73A 1ID5H 2B7DH 2PW8H 4O03A 2CK3D 1ELDE 2P59A 2BX3A 2HNTC 3PO1B 1YY3A 5GNDA 1P2KA 4XBBA 2BDCA 2WPMS 1NFUA 3ODFA 1TQ7B 1TYNA 5JBAS 5JPMH 2XCFA 1CU1A 4F48B 1HRTH 4Q7XA 2J38A 2P94A 3H7TA 1T32A 5FL7D 3D62A 1ZSLA 2SGDE 1TRYA 4X6OA 1HAYB 1P57B 1UHBB 1SBWA 1UCYE 3BTDE 3LH1A 3M35A 3VB7A 4K1SA 1O3KA 1HGTH 2FOEA 5E8EH 1ZTKA 2BTCE 3BF6H 4Y11E 1C4U2 1HXFH 4YM9A 3CP7A 3FP7E 5C1UA 3L33A 3MFJA 3UREA 1IAUA 1GBDA 4UE7H 2A32A 2UWLA 1LHFH 1FDPA 3ATKA 1AE8H 4RKOB 1AMHA 1UHBA 3O8DA 2CHAB 2WPDD 2XNDD 3OEED 6CHAC 1XMNB 5GIBA 3N7EA 4R0IA 3ATWA 1JRSA 1C5UA 3L6PA 1IQEA 1HJ8A 4WH8A 5FCKA 1SGNE 1WQSA 4Q80A 1BQYA 2VIDA 1GPZA 5T1VA 1Q2WA 3UFAA 4X1PU 1O3FA 1N6YA 1P2JA 1O3DA 1BRCE 1XUHA 1EJNA 2ZHWH 3R3GB 4H6SB 2GJGA 4WXVA 1HBTH 1AFEH 2WYJA 3BN9A 1O34A 2QXJA 1BMFD 2ANKH 2ZU3A 4X1RU 2QF4A 1EASA 1L0ZA 1OKXA 2VIVA 3GCTF 1VITH 1FY8E 4AZ2B 1SLWB 1P06A 3EQ0H 2TGAA 1GHXH 1S84A 2BY6X 2AGGX 1TPAE 4LZ4B 3UUZA 1EP5A 1BTXA 1K1JA 3HKIB 3JZ2B 1EP6A 2STAE 4JZDH 3RM0H 4NA9H 4MG3A 6GCHF 4QT8C 1JIMA 1QL9A 2ZCKP 2PKAB 2OLGA 1C1OA 3UIRA 1UTKA 3RMMH 3TPIZ 1SR5C 5C1YA 5F8TA 3A83A 3MH6A 1J16A 2PUQH 2RA3A 2QXIA 2BY8X 1UVSH 1OWDA 2PKSC 1O3MA 3P8FA 2J98B 1YC0A 2L74A 1BJUA 2OQUA 3RDZA 2ZA5A 4JZIA 1A5IA 3MO6A 4MNXA 2BLOA 1EX3A 1ANDA 2Q1JA 1AUTC 2K1QA 3RXVA 1W2KH 1S5SA 3FN8A 5K0HA 4NG9H 5A09A 4ABJA 1G3EA 1GL1A 1G3DA 2W3IA 2ZGBH 5HM9A 1HPGA 2KAIB 1P9UA 1ETTH 3SV6A 4K2YA 2BB4A 3SORA 2Z6BD 2WZQA 3HK6B 1WTHD 1S0RA 2DE9A 3RC4A 4DIIH 5F8XA 2K8IA 1MTWA 3ZVEA 1OSSA 7ESTE 1DS2E 2F9PA 1EPTC 5C3NA 3GYMA 1HAPH 4DT4A 1GBKA 1QB6A 1Z8RA 3BG4C 5CE1A 3TK9A 1LHCH 1K1LA 3DSPA 1WUNH 1EAXA 3A82A 1KY9A 1Z8IB 1C5XB 1UVOA 4IMZA 3QO6A 1V2JT 1RJXB 1BBRE 2A5IA 3LOXA 1SGTA 2NU1E 1XKBC 2WHXA 4K60A 2VIPA 3URCA 2GX4A 3HGNA 1TNHA 1DUAA 4E7RG 2ODYB 5BPEA 1FPCH 8ESTE 5EW2H 3OX7U 1MBMA 1GGDB 5EU8A 5JBTA 1GHBG 1HAGE 2H5DA 1KMHB 4XD7D 1DM4B 3FAOA 4BAKB 1CT4E 4NSYA 4TPIZ 1ZTJA 2A45B 1JXPA 2KAIA 1AB9B 2SNVA 1ELGA 2ASUB 1BTHH 5EW1H 1V2QT 1Y5BT 2BXTH 2ODQA 1OS8A 3OY5U 1O33A 3KF2A 1J14A 1D6WA 2KZ4A 9LPRA 2ALPA 2EA3A 5JDUB 1VGCB 1Z8GA 3NXPA 3B23B 3LC3A 4UEHH 1NS3A 1AE5A 3TH3H 3DD2H 2ZWLH 3KQBA 3MNBA 1MKXH 3A7ZA 3MNCA 4BAHB 1GCTB 3ZZ7A 4ACAA 2GGVB 2AEIH 1AU8A 1S6LA 2A1DB 1SFQB 3LC5A 1CA0B 1GHWH 4SGBE 1A0LA 2SGQE 2XOKD 3KYGA 2J98A 2Z3EA 2ZTXA 1NZQH 2PR3A 1XVMA 1QHRB 1ZRKA 2G5VA 4FUDA 4XFQA 5CMXH 3M36A 5LPFA 4X1QU 4FXGH 2J5UA 1O2LA 1TFXA 2WV4A 2BOHB 2FWWA 3F3BA 2P8OB 1Z1IA 3FP6E 1H8HD 1LHEH 2ZQ2A 1C1TA 3NCLA 2Z9KA 2BOKA 5JBCS 3A8CA 1RD3B 2Y5GA 2WV5A 1ZMNA 2NU2E 1HCGA 1S83A 4LZ1H 1TX8A 1COWD 3A8AA 4AORA 3CS0A 1VITF 2RDLA 4AG1A 1C5WB 1FV9A 1MQ6A 1O2TA 1G9IE 2FTMA 3GYLB 3GY2A 1C5LH 2HPPH 1EKBB 2SGFE 1A7SA 2ZGHA 5FHTA 4IGDA 3MO9A 4ABFA 3S69A 2FLRH 1J17T 1EFRD 3OE7D 1AY6H 3LDXH 2AIQA 2QGRA 1XUGA 3GY5A 2Q6DA 1K21H 1C5ZB 2ZPQA 2ZHQH 2ZFTA 1V3XA 3AK5A 1DY9A 3LGIA 2KCYA 1V2OT 3LH3A 1TNIA 2D8WA 1GHZA 5E0JA 1QFKH 1SFIA 2J97A 2TGPZ 1O2QA 1YM0A 1HNEE 1YLDA 4YOIA 3D65E 3BTME 1OP2A 3GY7A 4YTAA 4B2AA 1A61H 5EXNA 1ZGIA 2FOMB 3H5CB 1ANCA 5AHGH 3GCTG 1LPKB 2O8LA 4YOJA 1QZ8A 2VWOA 4JZ1A 3QDZB 4JYTA 4YZUA 2QN5T 2ZEBA 3TJOA 1DUEA 1QL8A 2BD4A 2OC0A 4X1NU 3V13A 4GCHF 3ATIA 2ZGJA 1YPKH 4CHAC 3PV2A 4I8KA 3RXIA 4X8TH 1QJ6B 1DLEA 1OYQA 1CGHA 2GZ8A 1NTPA 2FIRH 3RXBA 3SV7A 1BTYA 4BTTB 5EXLA 4DJZB 4B75A 5FX5A 1E1RD 2HVYB 2W7UA 3C1KA 1W10U 1XM1A 2HGTH 1ANBA 1H9LB 1OWKA 3T26A 1JRTA 3M7UA 2GMTC 3UY9A 1RIWB 1ELTA 1P03A 2ODPA 3GOVB 2TPIZ 2PSYA 5GCHG 3A88A 8GCHG 4I7YH 1EJAA 2L6OA 1U6QA 2FOBA 1KXBA 4U01A 2WUBA 3GCHB 2SGEE 2WPLS 1ELVA 4UONA 1O3EA 4MNWA 1FXYA 5AFZH 4ZAEA 1ZJDA 2V3MA 3M5OA 1P8VC 3MU0A 3FO8D 3P8GA 1EQ9A 3K65B 4UD9H 1AUJA 4IN2A 1FIZA 4LK4A 3QGNB 2TGDA 4FUEA 1V2NT 4O3UA 2AIPA 2PV9B 1O3CA 4BANB 3ZZCA 1EOLA 3U98H 2SGAA 1GBEA 2OBQA 1HYLA 2HPQH 1ESBA 1VR1H 1Y3UA 3ZZ3A 2XBYA 4ZKOU 2HNTF 4Z1MD 1ETSH 1TPSA 2BD3A 1YPHE 1A0JA 2ZG0H 2BQ6B 4F49A 5C5NA 1C5YB 1O5BB 4AC9A 4WMFA 1TAWA 2HVXA 3H09A 3NKKA 4UFEH 1C2HA 1C2MA 1BDAA 4AFZA 4CHAB 2P16A 1V2LT 5DKMA 4IMQA 2QC2A 4MDSA 1K1MA 1E37B 2PP6A 4HFPB 4ZROA 1ESTA 1DXPA 3F0PA 1ACBE 2ALVA 3IG6B 3SGAE 1PFXC 1LVYA 1JBUH 1TABE 3UNRA 3SU0A 3FFGA 4KP0A 4BNRA 2G55A 3RXTA 1IQMA 3BTHE 3SUDA 2BLQA 1TGTA 1MTUA 2BDYA 1F2SE 1ZOMA 1PPBH 4B2BA 3MOCA 5FCRA 2CMYA 2ZFRH 3GY6A 2A31A 2BLVA 1SB1H 1BTPA 5FAHA 1IHSH 3TGKE 1GDNA 5J4QA 4I8HA 1F7ZA 1DVAH 2BVRH 2W5EA 3PWCA 1O3JA 2ZFQH 1GI5A 3F1SB 3E3TA 2F4LA 1K1PA 3A89A 1GDUA 4D7FA 1GBLA 1F5KU 1GI3A 3EE7A 3VB5A 1V2KT 3LGTA 3UAIC 2FDAA 4E7NA 1EZUC 1LPZB 3SJKA 1EXFA 2OCVB 1UTOA 1TIOA 4KTCA 1IQIA 4BTIB 4Q7ZA 1PPCE 1GI7B 1SQRA 3A7YA 1CE5A 4ABIA 3MO3A 2C4FH 3BTKE 4M7GA 3RXGA 1HV7A 5DJ7A 1QRZA 2D2DA 5EXMA 5TCAA 3V7TA 3BTTE 1TPPA 1WYKA 2JDID 1H8ED 4I8GA 3EA9A 1AWHB 4NIVA 1EAUA 2GDEH 1MAXA 3BEUA 2RFKC 2FO9A 1H8DH 2Y80A 3VB4A 2P8OC 2QF3A 3RXOA 4FUFA 1A3EH 1BBRH 1C9PA 2AFQB 3RXPA 1WV7H 1SGIB 2FP7B 5A8ZA 2ZI2H 1LO6A 1NC6A 3Q3XA 3VGCC 1FN6A 1O2NA 1WAYB 1ZMJA 4HTCH 3HGPA 4X1SU 1EZSC 3ZZ8A 1PPGE 2C8XB 5C20A 2ZDMA 3MNXA 2ESTE 2FXRA 2ILNA 2AS9A 4AYYB 3PV4A 1SGFA 5CDFE 1HAHH 4ISOA 1GI9B 5F03A 2IPHA 4JMYA 3U8OH 1C5RA 1S81A 2D1JA 1GDQA 4Z0KA 2EQNA 2C3SA 4CRDA 2YMSB 2GT8A 3TVJB 1GMHF 2PTCE 3OU0A 3RMOH 4ESTE 2QXHA 1UW7A 2VB0A 1OXGA 1TWXB 1XX9A 3KGPA 4DT7B 3ZYEA 1GBCA 1Y3XA 2BDGA 1L2EA 5DP3A 2SNWA 2UUJB 2ZGCA 5HKKD 5LH8A 2R2WU 1GVKB 3PWBA 1BT7A 2A0QB 1BMLA 1NN6A 1YPGH 4U32A 1MKWH 2OXSA 3QTOH 1BRBE 3SNDA 1GJ8B 2VIOA 2VWMA 5F53A 4CH8B 1K2I1 1C2IA 1FUJA 4ZXYH 3LU9B 1LMWB 4BOHA 3BTQE 4OM9A 4ISNA 3F2FA 3TH4H 4AN7A 1W0JD 3SBKA 4R8TB 3BTEE 1E1QD 4WY3A 4NIYA 2V6NA 2XTTB 1SGDE 1K1OA 1BMNH 5DP8A 2XRCA 4THNH 1Y59T 1MKXK 2A5KA 1TMBH 1E79D 5CHAB 1DY8A 4RSPA 2FS9A 2C8ZB 2RCEA 1ARBA 2G5NA 3OEHD 1A5HA 3U1IB 2BDHA 2XBWA 1AVGH 3H7OA 8KME2 1NRQH 1CSOE 4VGCB 1AZ8A 1C1QA 2WYGA 2ZQ1A 1Q31A 3ZZDA 1HAOH 1KXFA 1O2OA 1ZHMA 5GWZA 1UTQA 3V12A 1O3GA 1TMUH 2BY5X 2PHBA 3M3TA 3RU4D 2CV3A 4IC6A 3SHCH 1A3BH 3A8BA 3QN7A 4KGAA 5L30H 1MUEB 2VIWA 1QA7A 1V2TT 3RXJA 4I8LA 1CT0E 1UVUH 2V7QD 5C67A 2O8MA 2OC7A 3AW0A 3S0NA 4RT1A 1SPJA 3ZVGA 1O2WA 2ZKSA 2R0LA 4B6EA 2P95A 4NFEA 4OS5A 2AMPA 1V2ST 4AFSA 1Y3YA 3UOUA 3UR6A 1AWFH 1PJPA 1UMAH 3RXFA 1HDTH 3JZ1B 3GISB 2BY7X 2LP6A 4E05H 4J2YB 5KGOA 2ZCHP 1BITA 4Y10E 5PTPA 3RXLA 4X8SH 2RG3A 4NFFA 5GDSH 3BEIB 3TJNA 4D9RA 1O31A 2F83A 4KELA 1OYTH 1E36B 1MCTA 4IBLH 1DOJA 2ZECA 3FKSD 3ZYDA 1UJ1A 5DPAA 3L3TA 3UWIA 2C8YB 5C1XA 3F9HA 4Y8YA 3E91A 1QRXA 2TGTA 2JIZD 4JK5A 4K1TA 4A6LA 4ABBA 2CHAC 2WPJS 2ZP0H 4OS7A 3URDA 4Y6DA 4F4OC 1OWHA 1CT2E 4ASUD 2JJ2D 1IQKA 3MI4A 5GJ4B 1SMFE 3AAVA 1GMDF 4OS4A 1P2OA 2SGPE 1J15A 3OAAD 1LHDH 1SVPA 3NRLA 3F6UH 1CGJE 2JJ1D 1FAKH 3NWUA 1WXRA 5IK2D 2FOAA 4CRFA 1OOKB 5A0CA 1W3CA 1O5GH 1LVMA 4JCNA 2O8UA 3LONA 2O8TA 5FPTA 2GCHG 1P2NA 3PO1C 1V2UT 4MPVA 1YCPM 5JBBS 1PPHE 1PQ7A 1NM6A 2W7SA 2IOTA 5EQRA 4ZXXH 2FOGA 2BQWB 1ZPCA 4TPYA 2GV7A 2UWOA 1A1RA 1F0RA 1C1VH 3RMNH 3RXSA 3RXAA 2BXUH 2VBCA
chains in the Genus database with same CATH topology
1WTGH 2CGAA 4KTUA 4X6PA 3GCOA 3SU5A 1QB9A 2TBSA 1DPOA 4NGAH 4ABDA 1UK3A 2C8WB 2JH5D 3F9GA 4CR5A 4DY7B 4NA8A 3TK5A 1BJVA 1LVBA 2Z3CA 1GL0E 1SOTA 4Q2KA 3SNAA 1LTOA 1WBGB 3MYWA 1FAXA 4FVDA 1O38A 1UK4A 1O5AB 1D9IA 2BVXH 1DSUA 2JH0D 4IC5A 2ANMH 1N1LA 1VITG 1C1RA 2VGCB 1ZYOA 2H9EH 1TNKA 1ANEA 3BSQA 3TH2H 1TE0A 3EA7A 2A5AA 1Z6EA 3Q3KA 5IDKA 2BZ6H 5L2ZH 1N8OC 1TONA 2O9QA 1TGNA 2W3KA 4AGKA 3BV9B 1TNGA 2J95A 3O8BA 4JYUH 1NU9A 1QQ4A 1HXEH 1AI8H 1GJAB 2BX4A 1A0HB 1QA0A 2Y7XA 4GHQA 4DG4A 1T8MA 4ZKSU 1VCQA 2NU3E 2R3UA 1P02A 1TX6A 1RTKA 2XWAA 4PROA 4SGAE 3SN8A 3VB3A 2R9PA 1V2PT 1G3BA 3K6YA 3P70B 4WF8A 1PQ5A 1NU7B 3QWCH 3SUGA 4NZLA 4LOYH 4GUXA 1QNJA 1AKSA 1A2CH 3RXUA 1MTNC 3P8NA 1JMOH 4CRGA 1MMJN 1BTZA 3EA8A 6ESTA 5BRRE 4NIXA 4BTUB 3SJOA 4K1EA 3DFLA 3RXDA 3K2UA 1KLJH 2EI6A 3BTGE 1NROH 3A85A 2Y81A 3E90B 4ABGA 1W7XH 2BD2A 7GCHF 1ZPZA 5EPYA 5AVDA 1GCTC 1XXDA 2LNCA 2JETB 1YF4A 1E0FD 5JYIA 1HAZB 5DGJA 3SV2H 1KYNA 3U8RH 3AW1A 1P10A 2PSXA 1MZAA 1DE7H 3OY6U 4J1YA 1FLEE 2LPRA 4TYDA 1P9SA 1FY4A 2ZC9H 2F9VA 1P2MA 2G51A 3A86A 1O2IA 4GVUA 4I31A 1IQFA 2ZO3H 4MNVA 1MU6B 1C1NA 5JB8S 1GJCB 2G8TA 3RC6A 8LPRA 1Y5AT 2Z9JA 2BY9X 3PTNA 2ZDLA 2EI8A 1O2KA 1YPMH 2VWNA 2J94A 1GGDC 3P17H 1UCYH 2JKHA 5EOKA 3BIUH 1GG6C 1K1IA 1C1MA 3MH4A 5IYTA 4AGJA 4JZFH 4ZHMU 2P3FH 1MBQA 1QR3E 5T6FA 3SNBA 1FONA 1C2JA 1G32B 1O2UA 3QZRA 4MLFB 3QGJA 3SNCA 3E0NB 5FPSA 1GHBF 3ELAH 3SOSA 1LHGH 1IQGA 2A4QA 3PLBA 4OGYA 1ZZZA 1BHXF 1C4Y2 4YT6H 3ATLA 4FUGA 1L4DA 3SNEA 4Y8ZA 2BVSH 1WQVH 1OWJA 3I29A 3DUXH 2ZU1A 2BD9A 1Z6JH 4WMEA 5I46H 1PYTD 2XWBI 1RGQA 2AH4X 2Y5FA 2BDIA 3A80A 4UFDH 5GXPA 1O2RA 2STBE 3GDUA 3K6ZA 3VFEA 2Q6FA 2QA9E 1QRWA 1SQAA 1QGFA 4FU7A 1N8OB 1YCPH 1PQAA 1SOZA 2OP9A 3TGJE 3PMHB 1GJDB 4AG2A 2VH6A 1GBAA 4D9QA 3FANA 3ODDA 4NZQA 1QTFA 3S9BA 2M5TA 3ENSB 1DX5M 2A4GA 1S82A 1OWIA 1WU1A 4JYVH 3AAUA 1CO7E 4IW4E 2F9UA 2VNTA 5A8YA 2JETC 1PQ8A 1IQJA 2FX6A 1AN1E 1P04A 2EC9H 3SV8A 4XDEA 1AFQC 5DP9A 4OS2A 2G81E 3KIDU 2GCTB 2NU0E 3SZNA 1NT1A 1KTTB 1CHOF 1Y5UT 1ZPBA 3M3VA 5E2PA 5DP5A 1KXAA 3UTUH 1DT2A 2B9LA 4Z6AH 3QTVH 1ELFA 1E38B 5DG6A 2Y7ZA 3S7HB 1GCDA 1TOMH 2FLBH 2O8WA 1BHXB 4ZUHA 4ISLA 1KLIH 3D23A 3SJ8A 4NCYA 1JWTA 2TIOA 1B7XB 3Q76A 1HIAA 4CRBA 5EPNA 2ZHFH 3EDXB 2D26C 3NUMA 2H5CA 1BZXE 3LJJA 2G52A 1F5RA 2H6MA 3RXCA 1ARCA 1BMAA 4Y0ZE 2FPZA 1BIOA 1F92A 4ZH8A 1UTJA 1GI1A 5SGAE 1DWCH 1KLTA 2BMGB 4AOQA 1C5NH 2ZNKH 3SU1A 8GCHF 4INLA 3MHWU 4H6TA 4KKDA 3UOPA 3A81A 2CJIA 2HALA 1C2LA 3M3SA 3RU4E 1L4ZA 3P6ZB 2H9HA 4MVNA 1GBFA 1FIWA 1V2WT 2A4OA 4Y7BA 5DP7A 4A5TS 1DICA 3RC5A 1P2QA 3TK6A 1YCPK 1AGJA 2AMQA 3TJUA 3SU3A 5I25A 1C2EA 1P11E 2OUAA 1DXWA 5ESTE 3G01A 2F9OA 1GVLA 1MCVA 3F9FA 4GSOA 4KTSA 1BRAA 1EB1H 3GY3A 1B0FA 1GG6B 4WMDA 1KXEA 3KQDA 4ABAA 1O39A 1C1PA 1SI5H 1J9CH 2FODA 3P8OA 1PPEE 1FY5A 1O3IA 1O2YA 2ZHDA 1P12E 3SQHE 1ZGVA 2HLCA 1K28D 2GVFA 1C5OH 2FMJA 2XC4A 1TOCB 3FVFB 2JH6D 1SGFG 3F68H 1CBWC 1QCPA 1DWEH 1C5PA 1EJMA 1V6DA 2EI7A 3AASA 1W14U 2C93B 4DURA 3M37A 2J4IA 1BTUA 1QIXB 5ETXA 1OWEA 1NESE 2QY0B 1HFDA 2Y82A 4HGCA 1YPLH 3Q77A 5L2YH 1ETRH 1VGCC 1TGBA 3EAJA 1CVWH 1GMDG 3MMGA 3NZIA 4WJG2 1ZRBA 2QV1A 1S0QA 2OD3B 2ZHEH 1V2RT 4X6MA 1SLVB 1W0ZU 2XXLA 4Q7YA 3MU4A 1WCZA 2J2UA 3SU4A 3KEEA 3MWIU 4FU8A 1EAIA 2I6QA 4WWYA 4DCDA 3QX5H 1JOUB 1ZMLA 2P3TB 1SQOA 1HLTH 5AFYH 1AVXA 1YPEH 3SU6A 1G2MA 1XUIA 1RXPA 1BB0B 3HK3B 4ISHH 3R0FA 1NFWA 2AERH 2G4UA 1GJ9B 4TWWA 5LGOA 7GCHG 3FZDA 1O3BA 2DUCA 5DP4A 5ABWA 3GY8A 4YO9A 4B76A 1ZHRA 7LPRA 3V3MA 1RTLA 1TMTH 3SGQE 1V2MT 2R3YA 1BCUH 5EODA 1C1UH 3E8LA 1VCPA 1BTWA 3EYDA 1LKBA 1A5GH 2FM2A 3M5NA 2AMDA 4O97A 1VCWA 3RXQA 3RXHA 2ZU5A 1GI2A 3RMLH 1XKAC 3ZVFA 2GZ9A 4BAMB 6LPRA 4Y0YE 1Y3WA 1CHGA 1LCYA 4Y7AA 1W7GH 1MD8A 4INHA 1QBNA 4RKJB 1Q3XA 4I8JA 1THSH 3BG8A 1F0SA 1ELCA 1XUKA 3ZZ9A 4K3JA 1J8AA 1VJ9U 2XCNA 1HJAB 2F91A 4FVBA 1GI6A 3UPEA 1O2VA 3PROA 5HYOA 3S9AA 3MNSA 4MPXA 2HOBA 1DANH 3T5FH 1TBRH 2Z94A 3F9EA 1T4UH 2FYRA 1T8OA 4I33A 1GMCF 1TBQH 3ZVBA 4UFGH 3VXEH 4ZMAH 1AIXH 3ZZBA 1C2KA 2AGIX 1THRH 2VINA 2GCTC 1MD7A 4ISIH 1G2LA 2FESH 3LJOA 3M7TA 3PMJA 1LQDB 1KDQB 1P2IA 4K5ZA 1ZSKA 4K8BA 4DGJA 3A7TA 1QURH 1NFXA 3LGWA 2CXVA 2BD5A 1RRKA 1GJ5H 2FTLE 2WUCA 3S7KB 2ANYA 1W12U 1B5GH 2H2ZA 4FUBA 1TA2A 1H9HE 1GHVH 2FOHA 4AX9H 1DLKB 5A8XA 1O30A 3GY4A 2RA0A 4TY6A 4CBOA 2BD8A 5L6NH 4NWKA 4Y71A 3E1XB 3UQOA 1GHAF 2OINA 4X8VH 1P01A 2Z9IA 1WOFA 1H1BA 1CQQA 3RLWH 1FJSA 1O2XA 1P09A 3CS7A 2WPHS 6CHAB 2A7JA 3V0XA 4DVAU 1X7AC 1YYY1 1SGPE 3I78A 1CGIE 1EUFA 1T8NA 3SUFA 3E0PB 4YLQH 2BM2A 2FX4A 1NPMA 3T27A 1ELAA 4MPUA 5A0AE 5FX6A 1GBMA 5EQQA 3BG4B 3SO3A 4CH2B 2H1UA 1PYTC 4CR9A 2GMTB 1C4V2 3P95A 2BHGA 1GBTA 1P3EA 2IJOB 3A87A 3GCNA 5EG4A 3PLPA 3A7WA 1GMHG 1O2MA 5HXFA 2FZZA 1C5MD 3I77A 5T6DA 1D6RA 1OX1A 2UWPA 2ZU4A 2WINI 1GI8B 3KQEA 2ULLA 1H9IE 4BAQB 5T6GA 1RTFB 1O3PB 4YT7H 2B5TB 3ZVCA 1O2HA 2IN2A 3LPRA 2XC5A 1FMGA 1EOJA 3RXMA 2Z3DA 3NK8A 2ZTZA 1DWDH 2A7CA 3FZZA 3STIA 1SC8U 2QAAA 1TNLA 3KQCA 1LQEA 4Y79A 1FY1A 2FI4E 2ZPSA 1QL7A 1TNJA 2HWLB 4BAOB 3O8CA 5F8ZA 2YOLA 1ESAA 2PGQB 5AF9H 3SI4H 3ESTA 1SGRE 3TNSA 1Y8TA 1O5CB 1TLDA 1L1GA 2J9NA 2SFAA 3VEQB 2NU4E 4DW2U 2G00A 1ABJH 4AFUA 4WH6A 1V2VT 4CRCA 1L1NA 9ESTA 4WVPE 1GHYH 2ZGXH 1LKAA 1TRMA 2ZTYA 3DFJA 4UDWH 5HGGA 3VPKA 1SHYA 1FI8A 1KXDA 3D49H 4ZHLU 1S6HA 1TQ0B 1SSXA 1WSSH 3U69H 1O5FH 5FPYA 1P3CA 1T31A 1CHOG 1W13U 1GI4A 2PKAA 1MTNB 3MU1A 1IHTH 3RU4T 1H4WA 4MQAA 1QBVH 6GCHG 4ZKNU 5E2OA 1INCA 1L1JA 1G37A 4X2VA 3TITA 4XE4A 4YOGA 2QYIA 1F0TA 4H4FA 5ESBA 2Q6GA 5E0GA 1DDJA 1C5SA 3MU5A 2ZDKA 1C5QA 1KTSB 3SGBE 4ZKRU 4K8YA 3RLYH 1QJ1B 3T29A 1HIAB 1KXCA 1K1NA 3PMAB 2J92A 1UCYK 4FUHA 4VGCC 3T2NA 7KMEH 1GBHA 2OBOA 1NFYA 1O36A 2Z9GA 3PM3A 2GP9B 1C1WH 2DE8A 1EATA 1DITH 3LIWA 3P92A 1T8LA 1SL3A 4GLYA 3S9CA 1Z7KA 5CHAC 5TCCA 3TNTA 4A1TA 2VVCA 4AB8A 3IWMA 1O3LA 2ZFPH 1GJ6A 1YGCH 3ITIA 2WPIS 3LGUA 1AO5A 3W94A 4FUCA 3BIVH 4IN1A 3C27B 2PGBB 1GVZA 1QY6A 5FBEA 5EGMA 1T4VH 1GJ4H 1EZQA 1ELBA 3U9AH 4GCHG 4O3TA 2V3HH 3BTFE 1UO6A 1OPHB 1TX7A 3SJ9A 1RIWC 1GBIA 3B9FH 3TGIE 3KN2A 3UNQA 2EEKA 2QIQA 1HAVB 1QB1A 3STJA 1UVPA 2GDDA 1KSNA 5EQSA 3ZV8A 1VJAU 3DHKH 4TWYA 4A1XA 4MPWA 3SI3H 4X2YA 4A92A 5DK1A 1FN8A 1F0UA 1TGSZ 1EZXC 5TJXA 3T25A 1D3QB 4RN6A 4OGXA 1ORFA 3E6PH 2ZDAH 1ZLRA 5C5OA 3ZZ4A 1M9UA 1Z8JB 4NWLA 2QF0A 2VU8E 4Y8XA 2QXGA 1IOEA 3A7XA 3HATH 4YLUA 2OQ5A 3PYHA 2PUXB 2OTVA 2ZIQH 3OTJE 1SGYE 1SLXB 4AB9A 1GHAG 2Y5HA 3LGVA 5C2ZA 2R0KA 1CBWB 4JK6A 1E35B 1O2ZA 2BZAA 2F9NA 2P93A 3BTWE 4X6NA 1YPJH 2VIQA 1FZZA 1ABIH 1C2FA 4XBCA 4JZEH 1W8BH 2ANWA 2XBVA 1QJ7B 1O3HA 1PPZA 1HJAC 1NO9H 1C2DA 1AZZA 1G36A 1UVTH 4XBDA 2FEQH 3KNXA 4A1VA 3A8DA 3SHAH 5DO4H 1BUIA 4YESB 1XXFA 2VH0A 2B0FA 1O2SA 1HJ9A 1ZHPA 5FBIA 3M5LA 1Z1JA 2OC1A 2J34A 1B0EA 2A4RA 1TA6A 1EB2A 2GV6A 3O8RA 1O2PA 4I32A 4B71A 2HRVA 3TU7H 2GD4B 3U8TH 1O3OA 3SJIA 1THPB 2B8OH 1XVOA 3MH7A 1IQNA 1C5TA 1XUFA 4B2CA 1UTPA 3BEFB 5GPIB 2ZPRA 1GWAA 1EPTA 3GICB 1BBRK 3RXKA 2G4TA 4FU9A 2PKSB 2V35A 1AD8H 3ZZAA 2VWLA 3K9XB 4MNYA 1O5EH 4HZHA 2OC8A 1Y3VA 3PMBB 3QZQA 2VGCC 1UTNA 1YP9A 2ZDVH 1PPFE 2UUFB 4NSVA 3T62A 1FQ3A 1GJ7B 1JIRA 2ZZUH 1ZJKA 4D8NA 1C1SA 1ZTLA 2ZDNA 3E16B 2QCYA 1CA8B 3QK1A 4FUIA 1MH0A 1AKSB 1TRNA 1MTSA 3ZZ6A 1D3TB 1FY3A 1D3DB 1YBWA 4NA7A 3TLOA 4ABEA 1F5LA 4Y76A 2F9BH 3ZVDA 2PTNA 2CF9H 3Q3YA 3RXEA 1RFNA 1QBOA 1AHTH 3B8JA 1TALA 2PLXA 1O2GH 3SV9A 1UTLM 2VVUA 3KL6A 1HUTH 2BYAX 1OP8A 3CENA 1UK2A 5B6OA 4XOJA 1DFPA 1DWBH 1S85A 1N6XA 1TB6H 5GCHF 1SG8B 3WY8A 1K22H 2UUKB 3M61U 1IQHA 2GZ7A 1LPGB 1Z71A 2V3OH 3KHVA 4OS1A 5H4IB 1D4PB 1AVWA 1IQLA 3VB6A 1O35A 1QQUA 3AVZA 2AGEX 2TRMA 1GJBB 4ASHA 1MTVA 2BLWA 2FYQA 3A7VA 1OP0A 4H42U 1BA8B 1O3NA 2ZFFH 3HPTB 1SGQE 3GDSA 5E0HA 1A4WH 1KDQA 3OYPA 3GCHC 3U1JB 4BXSA 2BQ7B 4AFQA 4CREA 5F6MA 1HAVA 1MZDA 3M5MA 1FPHH 2VVVA 1GBJA 1MQ5A 1O5DH 2A7HA 4CRAA 3DA9B 1G30B 2BDBA 4A7IB 1GI0A 2A2QH 3N7OA 1UTMA 4X2XA 1SLUB 3PB1E 1O32A 4B1TA 1NRPH 1SGCA 5JB9S 3MTYA 2ZFSA 4DIHH 1NY2<