3BTHE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
221
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bthE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bthE02
1TX7A 3KQCA 1BDAA 1Q2WA 1BTWA 2PKAA 1OOKB 1O2UA 1EASA 1OWJA 4AG2A 3BTEE 2BLWA 4B2AA 2GZ8A 4MPUA 2XC0A 3SNBA 1O2LA 4RKOB 1CHOG 1T8LA 4ISOA 4E05H 1H9HE 1BTHH 4A7IB 4ZHAA 1RIWB 2ANKH 4KP0A 2BVRH 5JB9S 4SGBE 2GTBA 1GVLA 1NRNH 1CQQA 1J9CH 1SGRE 3E91A 3GCTF 1HDTH 1C1WH 1P03A 1TAWA 2F83A 4AX9H 3BEUA 3K6ZA 2ZDVH 2VH6A 3TJNA 2B8OH 4CREA 5L6NH 5LGOA 1MCTA 1OXGA 2Z9JA 3SGBE 1NM6A 1DITH 3LT3A 1OWDA 1WTGH 4MPXA 2VIQA 2EA3A 2AGGX 3GICB 1P2KA 2B5TB 5JYIA 1DS2E 1SLWB 1THSH 3MOCA 4XBCA 1W14U 5J4SA 1H8DH 3PROA 1AU8A 4O9VA 2ZA5A 2H1UA 2J38A 1MKWK 5DGJA 2PKSB 1HAVB 3RXRA 3LGYA 5C5OA 1HV7A 3RLWH 1EAWA 5ESTE 1HJ9A 2FESH 1P05A 3QZRA 2CN0H 1P04A 3UWIA 1GHAF 1EJNA 3ZZ6A 3RXVA 1TRMA 1D6RA 3PTBA 4Q7YA 2FOFA 5C5NA 4WVPE 3S9AA 1P2OA 1BMLA 1LTOA 1DICA 2BDAA 9ESTA 4ABDA 1C1OA 1L1JA 4A1XA 3D62A 2R9PA 3QUMP 5FX5A 2WV4A 3F68H 1HAOH 1NROH 1PPBH 4CRCA 4GLYA 1BMNH 2TIOA 2SNWA 1GBIA 2B0FA 4AFSA 3G01A 5EQSA 2TGTA 1C5OH 2FP7B 2P8OB 1GI8B 2XBVA 1XUFA 3C1KA 1AWHB 1S0QA 4AG1A 1OX1A 1XUGA 4K2YA 5T3HA 1SLXB 1YPHE 3LH1A 1TRYA 1S5SA 4AFUA 2ZGBH 4R0IA 3M5LA 1KLIH 4DG4A 5A0CA 4WH6A 4NIYA 1UTLM 2OQUA 1LHGH 2Y6TA 2OBQA 3RXOA 1JXPA 2YOLA 1T4UH 2RA3A 1QJ6B 1ESAA 1V6DA 5EODA 1VITG 1XUKA 3M7UA 1C1MA 2QY0B 4OS2A 3VEQB 3GY8A 2OINA 1ZTJA 3BG4B 1C4U2 1JIRA 4IS5A 3SNEA 3OX7U 2Y5HA 2AIQA 2WPLS 2EC9H 1U6QA 1O32A 5F8TA 4LK4A 2J34A 3UR6A 1FZZA 5DP6A 1SGPE 3STIA 2ZKSA 3Q00A 1YLCA 4UONA 4OS7A 4X6OA 3T62A 1BTZA 2J92A 3KEEA 1NRRH 1ARBA 1T7CA 1JWTA 1WQVH 4XBBA 1XKAC 1C9TA 1O2VA 2RCEA 1O5CB 1L1GA 3GCHC 1TBQH 2AERH 4GVUA 2ZDMA 3S0NA 3ZV8A 1K22H 4K60A 3VXEH 1M9UA 3DFJA 1C1NA 4K8BA 4WXIA 1IQFA 1BT7A 3U8OH 2A4QA 1O5DH 1AFEH 5FBEA 2ZPRA 5F6MA 2JETB 4A5TS 1NT1A 2BQ7B 2HOBA 4ZKNU 1NY22 2VWNA 1F92A 2XRCA 4JZEH 1Y3VA 4U30A 4Y0YE 3ZVBA 3FVFB 4MNWA 2NU2E 1K21H 3PMBB 2GCHF 1EJAA 2B9LA 4VGCC 1AIXH 4XDEA 1MD8A 1AMHA 4I7YH 1AY6H 3BIVH 1GI9B 1XVMA 4GHQA 1ELAA 3M5NA 2OC0A 1OSSA 1GBAA 2XCFA 2SGAA 2ODQA 3RXMA 5FPYA 1C2FA 1AZZA 2HNTF 2PLXA 3GY5A 6GCHG 2JKHA 1GJDB 3M61U 3AW1A 1DXWA 3DT0H 4CHAC 4AGJA 2BVXH 4X0WU 3RUOA 3ATKA 3GDVA 1G9IE 2FYQA 1N1LA 2GD4B 1DSTA 4DOQA 4AOQA 1O3AA 4U32A 1YM0A 2FIRH 1KDQB 1SOTA 1SGYE 4K8YA 4WY3A 2PW8H 2XBYA 2VVVA 1H8IH 3HGNA 2WUBA 2W26A 2V3HH 3T27A 4YOIA 1CGJE 3GYLB 2ZQ1A 4NA7A 3VGCB 1C4V2 3TITA 1C9PA 1A61H 4BXWA 4YT7H 4CBNA 3ZVAA 1HBTH 4X1PU 3E1XB 2ZFTA 4AB9A 4D7GA 1N6XA 3M7TA 1ESTA 1N8OC 1QJ1B 3HGPA 3T5FH 1G3CA 3ZVDA 2VGCC 3A7WA 2A1DB 2RG3A 3BN9A 4TWYA 5EXMA 1GG6C 3TH2H 1BBRE 5EPYA 1ANBA 2F9PA 1SVPA 3UFAA 2OUAA 1O0DH 5EXLA 4B74A 1TNIA 3GY6A 1SG8B 1EJMA 1UTKA 2ZI2H 2Q6DA 3PMHB 3S7HB 1OP8A 2ZU3A 3MH7A 1P57B 1SQOA 3MU8A 5HXFA 3ENSB 1RGQA 1IHSH 3TJUA 1GMHF 4D76A 4D9RA 1B5GH 2BTCE 3SU5A 4FVDA 5JBBS 2NU3E 3L3TA 3OYPA 1UTOA 4F49A 1TFXA 3FZDA 1S85A 1ZGVA 3RXKA 1OYQA 4ABJA 3PB1E 3V7TA 1GI3A 3PLPA 2GX4A 6CHAB 2FI4E 1IQHA 1SFQB 1W7GH 4X6PA 2C8XB 2FWWA 3S9BA 1P01A 1O5GH 1F5LA 1BRAA 2VWLA 2FDAA 3S9CA 2XXLA 2AS9A 4TYDA 2FM2A 4NGAH 5K7RA 3MYWA 2PUXB 1WQSA 2Z3DA 4ZH8A 4IW4E 2I6QA 1E38B 2H6MA 3ZZ9A 5B6OA 3A8BA 1SHHB 3RXEA 1A5GH 1ETSH 1GJ5H 1GI7B 4X8TH 4CR5A 2BD4A 1GGDC 4U2WA 3SHCH 1ZPBA 1SB1H 2IPHA 1AUTC 4GAWA 1TNHA 1INCA 1HAHH 1VGCC 4H6TA 1FV9A 1NESE 5GJ4B 2WPKS 5L2ZH 1SPJA 1G2LA 4X1QU 4X1SU 1YPHC 2Z9LA 1FMGA 1HXFH 3UUZA 2ZHEH 3HK3B 3O8BA 1O2NA 3FP6E 5EQQA 1GJ9B 2HRVA 4ZKSU 2SNVA 4I8LA 3M3TA 4ISNA 1O2YA 2Z94A 1TALA 2RDLA 1BIOA 3UNRA 4MTBA 1A46H 1GBJA 1KLTA 1NRQH 2AMDA 1O3OA 1UK3A 2ILNA 1FJSA 4Y8YA 4Y71A 1F0TA 1BQYA 1QA0A 4PROA 4DY7B 5EU8A 3ZYDA 1Y5AT 5AHGH 1W0YH 4FUHA 1WSSH 3PTNA 1BRCE 1NFWA 1GDNA 2SGPE 1O3LA 4ABIA 2ZCKP 2D2DA 1O3BA 3EA8A 1SGEE 3SV8A 1C1SA 2IOTA 3A7ZA 1ZPCA 3ATLA 4IBLH 3FZZA 2PKAB 1JBUH 4YM9A 3SU4A 3M3VA 3RXCA 3CP7A 1GHAG 1ELTA 2P94A 4I33A 1K1MA 4X6MA 4K1TA 1PQ5A 4OGYA 2XYAA 5AVDA 2VINA 3RXGA 1BTXA 1L2EA 3EGKH 5DG6A 3TJOA 3LGIA 1LPZB 1GPZA 1SI5H 2BQWB 1DWEH 1QCPA 4NSYA 3A8CA 3LPRA 2AMQA 1SGFG 2TGPZ 4DIIH 3MNSA 3MU1A 2HLCA 4I8GA 4KELA 1O30A 3ODDA 3P8OA 4O97A 2ZTXA 1K1IA 4INKA 2ZHFH 1MZAA 1C5LH 2A2QH 1QB6A 3A82A 2M5TA 1SLVB 2NU1E 2H9EH 4D8NA 4NG9H 3A8DA 1PYTC 2TBSA 2FTMA 1O3CA 3ZZ8A 3ZV9A 3UPEA 1O2MA 2NWNA 1SQTA 7GCHG 3NXPA 1AFQC 2ZFSA 1Y3YA 1VR1H 1ANEA 4MLFB 1O2GH 2J95A 5DK1A 4YOJA 5GCHG 1P9SA 2PV9B 1C2KA 1VCQA 1ELCA 1W7XH 3P95A 1C1QA 4ISLA 1HJ8A 1YPJH 2XBXA 1CT0E 1A1RA 1FAKH 1QL9A 2NU0E 3ZVEA 1O5BB 2QAAA 1QTFA 3SV2H 4DJZB 1LO6A 1C2EA 4IC6A 4B71A 1O2OA 3BF6H 1QJ7B 3OSYA 1IQLA 4CRDA 2CV3A 1HAYB 1O3GA 1NRPH 1F5KU 4BNRA 3SUGA 3HKJB 5FBIA 3ZVCA 4OS6A 1Z8RA 2OD3B 3A7VA 1KLJH 5HM9A 1MU6B 1TWXB 5EXNA 1HRTH 1A7SA 1FDPA 5DJ7A 1O3KA 1ELBA 4Z6AH 1P09A 1RFNA 1DSUA 4ZHMU 3V13A 2B7DH 4IC5A 5C1UA 3P8GA 5IYTA 1EZSC 1S83A 1GBTA 1O2QA 3GY4A 3M7QA 1NO9H 3GCHB 3SW2B 1IAUA 4YO9A 4MVNA 2VWOA 2AFQB 3MWIU 2WV5A 4BAQB 3TGKE 1P3EA 1V2LT 5GPIB 5FHTA 3H7OA 4JYUH 5CMXH 4B73A 3QTOH 2A0QB 5EW2H 3V3MA 2GCHG 1T8NA 1TGSZ 4BTIB 2YNAA 3KQDA 2FMJA 4HI3A 3TVJB 3D23A 3A7YA 3N7OA 1TNKA 3L6PA 1FN8A 1J17T 4MPWA 3T26A 5A2MH 1PPHE 3LJJA 4FU8A 2J2UA 1H1BA 2ANMH 4UFFH 3SHAH 1TNLA 1E35B 2STAE 2BVSH 2ZEBA 2UWPA 4AYYB 2BDYA 3TH4H 1FY1A 2Z7FE 4AN7A 3PO1C 1C1RA 1T8MA 2LPRA 1WTHD 2BLQA 3LH3A 3AASA 3MHWU 4Y6DA 1SLUB 1CGHA 3RXSA 4CHAB 5AFZH 1GHBF 3QN7A 5FPSA 1DOJA 1QNJA 3GY3A 2AH4X 2Y5GA 3TGJE 2UUYA 2CGAA 1P10A 1HGTH 1BTPA 1F0UA 1BTYA 2ODYB 3ZZ7A 2BXTH 3VXFH 1AI8H 2GT8A 2J94A 2O8TA 1O2SA 2JH6D 2VIDA 3RXPA 1DE7H 2W3KA 1GBKA 1TQ0B 3KCGH 1UVSH 1EZUC 1AB9B 1C2GA 1EAIA 3MNCA 4ZHLU 5C2ZA 4NFEA 2ZGJA 1P02A 1CO7E 2Y7ZA 1W10U 2FOCA 1H9LB 1N8OB 3F1SB 2VGCB 3CS7A 1BBRH 3QLPH 1P2IA 4X8VH 1GG6B 1DX5M 1TOMH 1GMHG 4ZROA 3U8RH 1SGQE 2ZTYA 3P8NA 3IG6B 2A32A 2Z6BD 3F9EA 1GHWH 4B76A 1ZRKA 2VIWA 1B0EA 1ZHPA 2ZCLP 1CT2E 4X1RU 2VIPA 3VB6A 1MTWA 4AORA 2R3YA 1Q3XA 2BD3A 3KN2A 2F91A 2NU4E 2BY9X 3D65E 1S0RA 1HXEH 5C1XA 1TRNA 1IQJA 1BRUP 4ABGA 2BD7A 4B2BA 1YYY1 1SR5C 1P0SH 1BBRK 2BY5X 1W12U 1GI4A 4Y7BA 2O8UA 1V2RT 4ZUHA 1E0FD 3HKIB 3MU5A 3AVZA 3P8FA 4I32A 1JIMA 1QB1A 4Y10E 1C5SA 3NK8A 4TPYA 3BTHE 2RA0A 4F4OC 3K6YA 2BD5A 4I8JA 1AD8H 4Y0ZE 4NIWA 3SORA 3ATWA 4E06H 1ZRBA 2ZZUH 1XX9A 2G55A 1O2RA 1LPGB 3I77A 3RMLH 2GP9B 3QDZB 7GCHF 1QBNA 1ZJKA 1HLTH 1GGDB 1XUJA 1GCTC 4DW2U 2BXUH 1NS3A 1SGNE 1ETRH 4LZ1H 1A2CH 5GCHF 2IJOB 3LGTA 1AVXA 1EAXA 3UQVA 1HJAC 2DE8A 4NIVA 4KTCA 4FUFA 1EOJA 1WCZA 1ZLRA 2BY6X 1KSNA 2GMTC 1HAZB 1V2PT 3BTFE 1GBCA 5I25A 4TY6A 4CBOA 1UMAH 8KME2 1HB0B 1BMAA 1S6HA 4U01A 2VIVA 1GVZA 3A7TA 4J2YB 1UVUH 2P3FH 1MAYA 4HFPB 2BY7X 2HGTH 1PQ7A 3DUXH 3VFEA 1W3CA 4Y11E 5DPAA 2UWLA 1EUFA 2FX4A 1HAPH 1GWAA 5J4QA 2ULLA 3MH4A 3URCA 5K0HA 1P9UA 2ZCHP 3BEFB 1EPTC 2C8YB 3P17H 2UUKB 1Y3WA 3PWBA 1UTNA 4WXVA 1KTSB 2G4UA 2Z9GA 3DD2H 3QK1A 1MTNC 1CA0B 3T29A 4KKDA 2BDGA 1EQ9A 2DE9A 2F3CE 4Q7XA 5BPEA 3TK9A 4THNH 1QFKH 3LC5A 2WPJS 1GBBA 3SO3A 3CS0A 1P2MA 5EPNA 1BOQA 2F9BH 1X7AC 1LVYA 2FPZA 3RU4T 1O3DA 1NU7B 2A4RA 1JRTA 3IWMA 1V2ST 1MCVA 1KIGH 3R3GB 5L2YH 3KL6A 3V12A 4RKJB 3T28A 4INLA 2BX3A 2GDDA 1ZJDA 2ZFPH 2VVUA 2V6NA 1FLEE 4OS5A 3A7XA 5DP8A 1ID5H 3WY8A 3P70B 5FCRA 2HALA 4MPVA 2ZNKH 1Y5UT 3W94A 2XWAA 1NFUA 3ZYEA 5DP9A 2XC4A 4GPGA 2FLRH 3ITIA 2HVXA 3RLYH 1P8VC 2A45B 3LIWA 2CF8H 4HZHA 4KGAA 3QTVH 1D6WA 1QR3E 4UDWH 4BAOB 1MKXH 4YLUA 1A3EH 3ATMA 1UTPA 1Q31A 1IQKA 3MO6A 1P06A 2ZFRH 2THFB 1LHEH 1D9IA 2H5DA 2CMYA 1OWIA 1TLDA 1O2XA 2CHAC 4X8SH 1DUAA 1C1UH 1F5RA 1FY3A 3P6ZB 1O33A 2F9VA 1G2MA 3M37A 4JMYA 1ZR0A 1C5YB 4XFQA 4GUXA 3RMMH 5TCAA 2BDHA 1B0FA 1AFQB 3ZZ5A 1HIAA 4X2VA 1RXPA 1UK4A 2OQ5A 3SNAA 1BB0B 1FIZA 1LHCH 1RS0A 1P12E 2ZTZA 1F2SE 2VU8E 1CBWC 1DT2A 3H7TA 4YLQH 3M36A 5DO4H 3QO6A 1VITH 2O8LA 1FPCH 4Z0KA 3P92A 1DANH 3PLBA 2W3IA 1BHXF 1TGCA 1Y59T 3U1IB 2FOEA 1MZDA 1FQ3A 3A83A 1GJAB 3AAUA 3RC5A 1V2UT 1V2WT 3UTUH 1KXFA 1A3BH 2GKVE 1K1OA 1HAGE 2R3UA 3F9FA 1B7XB 1ZSKA 4HGCA 1MBMA 1G3BA 2GV6A 3LDXH 1ZTLA 1ZMJA 1WOFA 1IHTH 1GJ7B 2H2ZA 1RRKA 3QGNB 1XM1A 1P3CA 4NFFA 4JK5A 2VIOA 2WUCA 2AGIX 2ZHWH 4K5ZA 1AUJA 1DM4B 2FOAA 2Q6FA 2EI6A 1O37A 5HGGA 1DUEA 3LGVA 2Z3CA 1OP2A 2PKSC 1CA8B 2OC8A 4X2YA 1AGJA 1C1VH 5EG4A 4ABAA 1TABE 1YCPM 4FU9A 1SBWA 3U69H 3PMAB 4BAHB 3LC3A 5DP7A 4WJG2 2YNBA 1DXPA 2SFAA 5E0GA 1O3EA 2TRMA 1ABJH 2SGFE 2A5KA 1GBMA 1NC6A 8GCHF 2XW9A 2QYIA 4K1SA 1AE8H 1UTJA 2PFEA 3SJKA 1QGFA 6ESTA 3RXJA 3O8CA 2QC2A 3LGWA 4ZXYH 1BA8B 1TMTH 5LPEA 2C90B 3GOVB 2WYJA 3A89A 1GVKB 1EAUA 2Z3EA 3VB3A 4XE4A 1UVTH 4YZUA 2FOGA 1D4PB 1UK2A 5HM2A 2QXIA 3OY5U 1WBGB 1GBHA 1GHBG 1KXBA 3E16B 3O8RA 4UFGH 3PO1B 2JH5D 3MH6A 4JZ1A 1SGFA 2GV7A 1C2IA 5JBTA 1J15A 5GXPA 2R0KA 1HYLA 1S6FA 3RXDA 1LQDB 4B2CA 4X8UH 4UFDH 4IN1A 3UY9A 1YCPH 2EEKA 1YLDA 3E6PH 5F8ZA 1TPAE 2BLVA 1BHXB 1H9IE 3MI4A 1SGTA 4Y8ZA 2FLBH 1FI8A 3A86A 1EOLA 5ABWA 3PM3A 1SQAA 2BDBA 1TBZH 1SOZA 1TMBH 4LXBH 4UD9H 5DKMA 1AN1E 1GBEA 4KTUA 2GT7A 1K9OE 1MMJN 1SSXA 1AE5A 4FUBA 1GDUA 1VJ9U 1UTMA 3S69A 1ZTKA 3QWCH 1EXFA 2ZFQH 1MTUA 2ZPQA 5E2OA 4Q2KA 2J9NA 2D26C 1FAXA 1CU1A 4O3UA 1ZSJA 2OP9A 1C5NH 3LKWA 4WMEA 5E0JA 3GDUA 2UWOA 5T6FA 2BY8X 4O3TA 1FY4A 3CENA 2VH0A 3RXTA 2UUFB 1A0LA 2WPHS 3TPIZ 3F6UH 1O5FH 2G5VA 1ZHRA 4NA8A 4Y76A 7LPRA 4FUDA 1OPHB 1J8AA 3H5CB 1TPPA 1W0ZU 3GCNA 3BTKE 5LH8A 1A5HA 1V3XA 4Q80A 1W2KH 2ZPSA 4AZ2B 1UCYH 1PPGE 3A88A 3VB5A 1ETTH 4K3JA 4BTUB 1DVAH 4BOHA 1E36B 1LHDH 3BIUH 1NU9A 1P2JA 4AGKA 3ZVGA 1PPEE 1UTQA 4ISIH 3ELAH 1IQGA 1KYNA 2BDCA 5LPRA 3ATIA 1BRBE 3B23B 4Y8XA 1ELFA 4YOGA 2FOHA 1A0HB 1MD7A 4ABFA 3BTGE 4Y79A 3B8JA 3A85A 4X2XA 2Y82A 3URDA 3PYHA 3UNSA 2Y5FA 2ZG0H 4SGAE 4TPIZ 3FANA 2SGDE 3F9HA 4TWWA 4FVBA 3BTTE 3KQBA 2A4GA 1MQ5A 1SGCA 4JYVH 1O2WA 5IDKA 4OS4A 1S81A 4CRGA 2SGEE 2ZHQH 2F9UA 2OCVB 1G30B 1QIXB 4IN2A 2PGBB 2EI8A 3KGPA 1O36A 1KTTB 3NPSA 4B1TA 1AVWA 5H4IB 1CT4E 1L0ZA 2G51A 3BTQE 1GBDA 1GCTB 2ALPA 2ZGCA 2PHBA 1J14A 4IMQA 3T2NA 2FOMB 3SQHE 1HJAB 3SI4H 5E8EH 4FUEA 3VGCC 5A0BA 4AFQA 2PUQH 2WPIS 1TOCB 1XXFA 2GMTB 1GBLA 5AF9H 3S7KB 3FP8E 4X6NA 2TPIZ 2GZ7A 4JYTA 1TNJA 5AFYH 1MTSA 1OWHA 1RTKA 1Y3XA 2OC1A 1Z6EA 2G52A 3PWCA 4GHTA 1EKBB 2G8TA 3KQEA 4NZQA 1O3MA 4WF8A 2GGVB 1AVGH 3LJOA 1VZQH 1YPLH 2ALVA 4GSOA 3U98H 1FY8E 2XTTB 2OC7A 4FUIA 2PTCE 4IMZA 3B9FH 3ZZAA 4CH2B 1VCWA 1YP9A 3SV7A 5JB8S 4IGDA 1EZQA 1XVOA 1V2VT 1Z8GA 2ZGXH 1F7ZA 1GI0A 1O3FA 4H4FA 1EB2A 3ODFA 1C5RA 3MU0A 1GL1A 2BDIA 5DP3A 3A80A 3RXHA 2WPMS 5A8XA 1OKXA 1HAIH 4NSVA 1ELVA 8LPRA 5L30H 7KMEH 1V2KT 4VGCB 3K65B 1JRSA 2P3TB 1WV7H 2D1JA 5F8XA 3MNBA 3QZQA 4A1VA 1T8OA 1YGCH 3A87A 2ZWLH 1ZOMA 2FO9A 1IQIA 3M3SA 3O8DA 2OLGA 3Q3YA 3Q3KA 1C5TA 2CF9H 3TJVA 2K1QA 1OWKA 1GHXH 3SI3H 5ESBA 1O31A 1ORFA 3DFLA 1MTVA 1SC8U 2WINI 3GDSA 2CHAB 4MNYA 2P93A 4A92A 2ZC9H 1MAXA 2J4IA 1GJ4H 2Q1JA 1TMUH 2P95A 1TYNA 4FUGA 1GMCF 1BCUH 2OTVA 1GL0E 3OU0A 3UQOA 1TGNA 3U9AH 4CR9A 3GY7A 5PTPA 5JBAS 3TH3H 2Z9KA 1TA2A 1EX3A 2GCTC 4ISHH 4LZ4B 4JZFH 1CBWB 4LOYH 4UEHH 1C5UA 1O2JA 1C2LA 3E8LA 1MKWH 1BUIA 2TGAA 3ZZDA 1CVWH 1TIOA 2EI7A 2QN5T 2LNCA 3U8TH 3TK5A 2BHGA 3T25A 3SZNA 2G4TA 4CH8B 5FX6A 1O2TA 1TONA 5G4BA 1RD3B 3MO3A 3RXLA 1THRH 3Q76A 1D3PB 3TGIE 3PMJA 4YT6H 3ZZ3A 4TY7A 2CJIA 2ZDNA 1K1LA 1T32A 3A8AA 1TGBA 4Q7ZA 3D49H 1UCYE 2FOBA 4BAKB 1AKSA 3BG8A 1GMDG 1O39A 1P2NA 4GCHF 1ZGIA 2ZF0H 1KY9A 4Y7AA 1CHGA 2V35A 2Z9IA 4ZKRU 4K1EA 8GCHG 1V2NT 1XUHA 1EP5A 4XSKU 1LVOA 5GDSH 3SOSA 3ZZBA 5BRRE 3R0FA 2HPPH 5ETXA 1V2TT 4WH8A 1HIAB 1FPHH 3K9XB 2C3SA 1J16A 3RXAA 1EPTA 2FZZA 2VB0A 1GJ8B 2QF3A 1FY5A 3M5MA 1AQ7A 4NA9H 5EGMA 1FUJA 5GWZA 2R2WU 1LVMA 2BB4A 1D3TB 1XUIA 2FEQH 5HYOA 1TB6H 5TCCA 1FIWA 2A7HA 2PSXA 1QL7A 4H6SB 1LKBA 3RXBA 2WYGA 1YPMH 1GJ6A 2C4FH 1KXDA 2XC5A 2V3OH 3JZ1B 1QBVH 2BLOA 1OWEA 1XMNB 1TX8A 3DHKH 3UWJH 1VGCB 4BTTB 3RU4D 1LCYA 1C1PA 1D3DB 1OYTH 1QB9A 3SQEE 1C5QA 1TNGA 1K1PA 4E7RG 1FXYA 1Z1JA 2QA9E 1Z6JH 3UIRA 4OGXA 2W7UA 4CRFA 2FODA 1OP0A 5A0AE 3SV9A 2TGDA 4DURA 1DWDH 3ZVFA 1C5XB 1HFDA 2BZ6H 1LKAA 1UHBB 3UR9A 3ZZ4A 6LPRA 1UVPA 1CSOE 4I8HA 1GHZA 1MU8B 1NN6A 2IN2A 1LDTT 1JOUB 3IITA 2ANWA 1V2JT 1HNEE 3HPTB 3ESTA 4JZDH 3Q3XA 2ZDLA 3AAVA 3M5OA 3EE0B 3TK6A 3SJ9A 1BJVA 4ABHA 3HK6B 4FXGH 3UREA 4X2WA 3V0XA 1PJPA 3EA9A 1RTFB 4MQAA 3GISB 5CHAC 1W11U 3RM0H 3JZ2B 1YKTA 2HWLB 2C8WB 2Q6GA 2H9HA 1T31A 1H4WA 4RSPA 3SN8A 1JMOH 3SU0A 4JZIA 1O35A 1KXCA 1UO6A 1V2OT 1ZZZA 1TGTA 3LU9B 4DT7B 5F03A 3VB7A 4CRBA 1TA6A 3ZZCA 1QQ4A 2KAIB 1IQMA 1O3IA 1Z7KA 3EA7A 2BOKA 4RN6A 8ESTE 3E90B 3SNCA 1O2ZA 1HCGA 2C8ZB 3Q77A 3PV4A 4KTSA 4A6LA 1P11E 1C2JA 3GCOA 1PQ8A 1FNIA 2BD2A 1GJBB 3SV6A 1VJAU 4YESB 3RXIA 3RC6A 3QX5H 2QXJA 1G36A 2CXVA 1CGIE 2ZQ2A 3SBKA 5FCKA 2R0LA 3MH5A 5E0HA 2P16A 4QT8C 3STJA 4DCDA 2PGQB 1Y3UA 3RP2A 1NFXA 2PR3A 3E3TA 5HMAA 4ZAEA 1WYKA 1K28D 1F0RA 1HAVA 1QHRB 4J1YA 2VVCA 1PPFE 1RIWC 1ABIH 2XBWA 3BTDE 2AIPA 3UNQA 3K2UA 2W7SA 4D7FA 3SU6A 4D9QA 1O2KA 1BJUA 3U1JB 1SFIA 1ACBE 1CHOF 4NWKA 4E7NA 3LONA 1MKXK 2GVFA 3SUDA 5JPMH 3C27B 3OTJE 1HUTH 2ZFFH 3L33A 5I46H 1NZQH 5GIBA 3FAOA 4NZLA 2VJ1A 1EATA 3PLKA 1S82A 1C2HA 1RJXB 1C5VA 1GBFA 3SJ8A 1AB9C 1ELDE 2BQ6B 1NTPA 2PTNA 4UE7H 4ABEA 2V0BA 5JDUB 1V2QT 1C2MA 1IQNA 4CRAA 3I29A 2BD8A 1O3HA 5A8ZA 1GI5A 1TQ7B 3SNDA 1YPGH 1K2I1 4WWYA 2A7JA 5TJXA 3KHVA 1YF4A 4ZXXH 5JBCS 4R8TB 1PFXC 1GMDF 1C5WB 1L1NA 1QL8A 1C2DA 1UHBA 5T6GA 1G3EA 3GYMA 3SGQE 2G5NA 1MBQA 2Y7XA 2ZO3H 1KXAA 4ZMAH 1TPSA 1W13U 1E37B 3NUMA 1YC0A 3A81A 1N6YA 1O34A 1O38A 1BZXE 5DP5A 1E34B 2OXSA 5A8YA 1O3JA 2HPQH 1AO5A 1G37A 4O03A 1A0JA 2HNTE 1O2IA 3TLOA 1Z8IB 1ZYOA 1TE0A 3GY2A 1GI6A 1GCDA 4NCYA 3BEIB 4MNXA 4AYVB 3RMOH 2BX4A 2FI5E 2FX6A 1G3DA 3EDXB 2QCYA 1GHVH 1F0SA 1ZHMA 3AW0A 1YPKH 3DA9B 2P8OC 1Z1IA 1FONA 2KAIA 3MTYA 3FP7E 2ZU5A 3MMGA 3E0NB 5EQRA 2FTLE 1ANDA 5A09A 2QV1A 2ZU4A 3A84A 1QRXA 3NKKA 5T6DA 3KIDU 4AFZA 1XXDA 1GI1A 3KF2A 2BM2A 3HATH 1DY8A 3VB4A 1XKBC 1GJCB 1A5IA 1GMCG 2O8WA 5E2PA 1IQEA 4MG3A 2AGEX 2SGQE 1C5PA 3UOUA 1ZMNA 3M35A 2GZ9A 1THPB 2AYWA 3TNTA 4I8KA 3GCTG 2A2XH 3BG4C 1BTUA 1LHFH 1Z71A 2F9NA 4DVAU 1QBOA 1QQUA 2D8WA 1VITF 4ABBA 3RU4E 3SU3A 2PSYA 3NZIA 3F9GA 2ANYA 5C20A 1WUNH 2GCTB 2ZU1A 2DUCA 3EAJA 4H42U 1LPKB 2GDEH 1AWFH 1C1TA 1UJ1A 4INHA 1ELGA 4BAMB 2ESTE 4M7GA 3RXUA 2VNTA 1HAXB 5C1YA 4A1TA 3SGAE 2ZP0H 1C4Y2 1CA0C 2F9OA 4DGJA 1YPEH 3I78A 1PQAA 1YCPK 4FU7A 4XBDA 4FUJA 1KDQA 3W95A 2STBE 3TU7H 2VWMA 4DIHH 3LGUA 3RM2H 1O2HA 4GCHG 1GHYH 1QURH 1ARCA 3BTME 2A5AA 1DPOA 2JETC 1K1JA 2PWXA 2W5EA 2XWBI 4FUCA 2XNIA 2P3UB 1A4WH 1Y5BT 1BMMH 1ELEE 5EOKA 1O3NA 3SU2A 1L4ZA 1IOEA 1LMWB 3LOXA 1G32B 2UUJB 3UOPA 5FPTA 2FS8A 3VPKA 1P2QA 2C93B 3EQ0H 4X1NU 1FN6A 2QXHA 2O8MA 1SGDE 3MO9A 2G81E 2BD9A 4XOJA 4WMDA 1EZXC 3E0PB 3SUFA 4MDSA 1O5AB 3RMNH 2XCNA 3FFGA 5C3NA 1Z8JB 1O5EH 5DP4A 1SL3A 1NFYA 4MNVA 3SJOA 4BANB 1SMFE 1DDJA 1C5MD 1UCYK 4JCNA 1YBWA 1WAYB 6GCHF 1NRSH 1DWCH 1T4VH 1O3PB 3BTWE 3QGJA 5FAHA 3NCLA 3TIUA 2H5CA 1Y8TA 3RC4A 2QIQA 2AMPA 5LPFA 1KXEA 1L4DA 1SHYA 9LPRA 1QRZA 4NIXA 1AKSB 2A5IA 3SU1A 1ANCA 1ZMLA 1S84A 3SJIA 2OBOA 3MU4A 1DWBH 2ZGHA 1QY6A 5FXLA 2JH0D 2QXGA 1MUEB 4ASHA 3BSQA 3MFJA 2A31A 1RTLA 2FXRA 4UFEH 1GDQA 2A7CA 1SGIB 3NWUA 2A4OA 1LVBA 1EP6A 7ESTE 2FI3E 1PPCE 1OS8A 1TPOA 4ZKOU 1EPTB 2QF0A 3BV9B 4JK6A 4I31A 2I6SA 1LQEA 1AZ8A 2ODPA 1QA7A 1MTNB 1EB1H 1W8BH 1WU1A 5C67A 1VCPA 3MNXA 4AB8A 5SGAE 1TBRH 4K69A 4B75A 2H9TH 1HPGA 4ESTE 1AHTH 1V2MT 3TNSA 1PPZA 2P59A 5CHAB 4YTAA 1DY9A 1DFPA 2BOHB 2Y80A 2BZAA 6CHAC 1MH0A 3OY6U 1TX6A 1DLEA 4NWLA 2BMGB 5EW1H 1C5ZB 1PYTD 2ZIQH 1ZPZA 4OS1A 1MQ6A 1DLKB 4BXSA 2AEIH 2ASUB 3RXFA 2ZDAH 2ZHDA 1NPMA 3RDZA 2HNTC 4HTCH 2ZECA 3EYDA 1ESBA 5CE1A 3KNXA 3RXQA 1D3QB 1ZSLA 2ZU2A 1QRWA 2FS9A 3SUEA 2Y81A 2BYAX 1O2PA 2FYRA 1CE5A 1UVOA 4WMFA 2R2MB 2G00A 2QGRA 2ZDKA 1K1NA 1BITA 1GI2A 2O9QA
chains in the Genus database with same CATH superfamily
1TX7A 3KQCA 1BDAA 1Q2WA 1BTWA 2PKAA 1OOKB 1O2UA 1EASA 1OWJA 4AG2A 3BTEE 2BLWA 4B2AA 2GZ8A 4MPUA 2XC0A 3SNBA 1O2LA 4RKOB 1CHOG 1T8LA 4ISOA 4E05H 1H9HE 1BTHH 4A7IB 4ZHAA 1E1QD 1RIWB 2ANKH 4KP0A 2BVRH 5JB9S 4SGBE 2GTBA 1GVLA 3F0PA 1NRNH 4B6EA 1CQQA 1J9CH 1SGRE 3E91A 3GCTF 1HDTH 1C1WH 1P03A 1TAWA 2F83A 4AX9H 3BEUA 3K6ZA 3FN8A 2ZDVH 2VH6A 5HKKD 3TJNA 2B8OH 4CREA 5L6NH 5LGOA 1MCTA 1OXGA 2Z9JA 3N7EA 3SGBE 1NM6A 1DITH 3LT3A 1OWDA 1WTGH 4MPXA 2VIQA 2EA3A 2AGGX 2M2AA 3GICB 1P2KA 2B5TB 5FL7D 3WWFA 5JYIA 2JJ2D 1DS2E 1SLWB 1THSH 3MOCA 4XBCA 1W14U 5J4SA 1H8DH 3PROA 1AU8A 4O9VA 2ZA5A 1H8HD 2H1UA 2J38A 1MKWK 5DGJA 2PKSB 1HAVB 3RXRA 3LGYA 5C5OA 1HV7A 3RLWH 1EAWA 5ESTE 1HJ9A 2FESH 1P05A 3QZRA 2CN0H 1P04A 4TT3D 3UWIA 1GHAF 2GJGA 1EJNA 2WV9A 3RXVA 1TRMA 3ZZ6A 1D6RA 3PTBA 4Q7YA 2FOFA 5C5NA 4WVPE 3S9AA 1P2OA 1BMLA 1LTOA 1DICA 2BDAA 2V3MA 9ESTA 4ABDA 1C1OA 1L1JA 4A1XA 3D62A 2R9PA 3QUMP 5FX5A 2WV4A 3F68H 1HAOH 1NROH 1PPBH 4CRCA 4GLYA 5B6LA 1BMNH 2TIOA 2SNWA 1GBIA 2B0FA 4AFSA 3G01A 5EQSA 2TGTA 1C5OH 2FP7B 2P8OB 1GI8B 2XBVA 1XUFA 3C1KA 1AWHB 1S0QA 4AG1A 1OX1A 1YWUA 1XUGA 4K2YA 5T3HA 1SLXB 1YPHE 3LH1A 1TRYA 1S5SA 4AFUA 2ZGBH 4R0IA 3M5LA 1KLIH 4DG4A 5A0CA 4WH6A 4NIYA 1UTLM 2OQUA 1LHGH 2Y6TA 2OBQA 3RXOA 1JXPA 2YOLA 5CDFE 1T4UH 2RA3A 1QJ6B 1ESAA 1V6DA 5EODA 1VITG 1XUKA 3M7UA 1C1MA 2QY0B 4OS2A 3VEQB 3GY8A 2OINA 1ZTJA 3BG4B 1C4U2 1JIRA 4IS5A 3SNEA 3OX7U 2Y5HA 2AIQA 2WPLS 2EC9H 1U6QA 1O32A 2VBCA 5F8TA 4LK4A 2J34A 3UR6A 1FZZA 5DP6A 1SGPE 3STIA 2ZKSA 3Q00A 1YLCA 4UONA 4OS7A 4X6OA 3T62A 1BTZA 3ZIAD 2J92A 3KEEA 1NRRH 1ARBA 1T7CA 1JWTA 1WQVH 4XBBA 1XKAC 1C9TA 1O2VA 2RCEA 1O5CB 1NBMD 1L1GA 3GCHC 1TBQH 2AERH 4GVUA 2ZDMA 3S0NA 3ZV8A 1K22H 4K60A 3VXEH 2L74A 1M9UA 3DFJA 1C1NA 4K8BA 4WXIA 1IQFA 1BT7A 3U8OH 2A4QA 1O5DH 1AFEH 5FBEA 2ZPRA 4TSFD 5F6MA 2JETB 4A5TS 1NT1A 5DSFA 2BQ7B 2HOBA 4ZKNU 1NY22 2VWNA 1F92A 2XRCA 4JZEH 1Y3VA 4U30A 4Y0YE 3ZVBA 3FVFB 4MNWA 2NU2E 1K21H 3PMBB 2GCHF 1EJAA 2B9LA 4VGCC 1AIXH 4XDEA 1MD8A 1AMHA 4I7YH 1AY6H 3BIVH 1GI9B 1XVMA 4GHQA 1ELAA 3M5NA 2OC0A 1OSSA 1GBAA 2XCFA 2SGAA 2ODQA 3RXMA 5FPYA 1C2FA 1AZZA 2HNTF 2PLXA 3GY5A 6GCHG 2JKHA 3U28C 1GJDB 3M61U 3AW1A 1DXWA 3DT0H 4CHAC 4AGJA 2BVXH 4X0WU 3RUOA 3ATKA 3GDVA 1G9IE 2FYQA 1N1LA 2GD4B 1DSTA 4DOQA 4AOQA 1O3AA 4U32A 1YM0A 2FIRH 1KDQB 1SOTA 1SGYE 4K8YA 4WY3A 2PW8H 2XBYA 2VVVA 1H8IH 3HGNA 2WUBA 2W26A 2V3HH 3T27A 4YOIA 1CGJE 3GYLB 2ZQ1A 4NA7A 3VGCB 1C4V2 3TITA 1C9PA 1A61H 4BXWA 4YT7H 4CBNA 3ZVAA 1HBTH 4X1PU 3E1XB 2ZFTA 4AB9A 4D7GA 4ZCNA 1N6XA 3M7TA 1ESTA 1N8OC 1QJ1B 3HGPA 3T5FH 1G3CA 3ZVDA 2VGCC 3A7WA 2A1DB 2RG3A 3BN9A 4TWYA 5EXMA 1GG6C 3TH2H 1BBRE 5EPYA 1ANBA 2F9PA 1SVPA 3UFAA 2OUAA 1O0DH 5EXLA 4B74A 1TNIA 3GY6A 1SG8B 1EJMA 1UTKA 2ZI2H 2Q6DA 3PMHB 3S7HB 1OP8A 2ZU3A 4F48B 2K8IA 3MH7A 1P57B 1SQOA 3MU8A 5HXFA 3ENSB 1RGQA 1IHSH 3TJUA 1GMHF 4D76A 4D9RA 1B5GH 2BTCE 3SU5A 4P00A 4FVDA 5JBBS 4Q4LA 2NU3E 3L3TA 3OYPA 1UTOA 4F49A 1TFXA 3FZDA 1S85A 1ZGVA 3RXKA 2W6JD 1OYQA 4ABJA 3PB1E 3V7TA 1GI3A 3PLPA 2GX4A 6CHAB 2FI4E 1IQHA 1SFQB 1W7GH 5HIZA 4X6PA 2C8XB 2FWWA 3S9BA 1P01A 1O5GH 1F5LA 1BRAA 2VWLA 2FDAA 3S9CA 2XXLA 2AS9A 4TYDA 2FM2A 4NGAH 5K7RA 3MYWA 2PUXB 1WQSA 2Z3DA 4ZH8A 4IW4E 2I6QA 1E38B 2H6MA 3ZZ9A 1KMHB 5B6OA 3A8BA 1SHHB 3RXEA 1A5GH 1ETSH 1GJ5H 1GI7B 4X8TH 4CR5A 2BD4A 1GGDC 4U2WA 2JDID 3SHCH 1ZPBA 1SB1H 2IPHA 5KECA 1AUTC 4GAWA 1TNHA 1INCA 1HAHH 1VGCC 4H6TA 1FV9A 1NESE 4F55A 5GJ4B 2WPKS 5L2ZH 1SPJA 1G2LA 4X1QU 4X1SU 4Q63A 1YPHC 2Z9LA 1FMGA 1HXFH 3UUZA 2ZHEH 3HK3B 1SKYE 3O8BA 1O2NA 3FP6E 5EQQA 1GJ9B 2HRVA 4ZKSU 2SNVA 4I8LA 3M3TA 3F2GA 4ISNA 1O2YA 2Z94A 1TALA 2RDLA 1BIOA 3UNRA 4MTBA 1A46H 4RI0A 1GBJA 1KLTA 1NRQH 2AMDA 1O3OA 1UK3A 2ILNA 1FJSA 3GS9A 4Y8YA 4Y71A 1F0TA 1BQYA 1QA0A 4PROA 4DY7B 5EU8A 3ZYDA 1Y5AT 5AHGH 1W0YH 3F2HA 4FUHA 4ACAA 1WSSH 3PTNA 1BRCE 1NFWA 1GDNA 2SGPE 1O3LA 4ABIA 2ZCKP 2D2DA 1O3BA 3EA8A 1SGEE 3SV8A 1C1SA 2IOTA 3A7ZA 1ZPCA 3ATLA 4IBLH 3FZZA 2PKAB 1JBUH 4YM9A 3SU4A 3M3VA 3RXCA 3CP7A 1GHAG 1ELTA 2P94A 4I33A 1K1MA 4X6MA 4K1TA 1PQ5A 4OGYA 2XYAA 5AVDA 2L6OA 2VINA 3RXGA 1BTXA 1L2EA 3EGKH 5DG6A 3TJOA 3LGIA 1LPZB 1GPZA 1SI5H 2BQWB 1DWEH 1QCPA 4NSYA 1NBME 3A8CA 3LPRA 2AMQA 1SGFG 2TGPZ 4DIIH 3MNSA 3MU1A 2HLCA 4I8GA 4KELA 1O30A 3ODDA 3P8OA 4O97A 2ZTXA 1K1IA 4INKA 5EJZA 2ZHFH 1MZAA 1C5LH 2A2QH 1QB6A 3A82A 4M9FA 2M5TA 1SLVB 2NU1E 2H9EH 4D8NA 4NG9H 3A8DA 1PYTC 2TBSA 2FTMA 1O3CA 3ZZ8A 3ZV9A 3UPEA 1O2MA 2NWNA 1SQTA 7GCHG 3NXPA 1AFQC 2ZFSA 1Y3YA 1VR1H 2EQNA 1ANEA 4MLFB 1O2GH 2J95A 5DK1A 4YOJA 5GCHG 1P9SA 2PV9B 1C2KA 1VCQA 1ELCA 1W7XH 2CK3D 3P95A 1C1QA 4ISLA 1HJ8A 1YPJH 2XBXA 1CT0E 1A1RA 1FAKH 1QL9A 2NU0E 3ZVEA 1O5BB 2QAAA 1QTFA 3SV2H 4DJZB 1LO6A 1C2EA 4IC6A 4B71A 1O2OA 3BF6H 1QJ7B 3OSYA 1IQLA 4CRDA 2CV3A 1HAYB 1O3GA 1NRPH 3DCLA 1F5KU 4BNRA 3SUGA 3HKJB 3UB0A 5FBIA 3ZVCA 4OS6A 1Z8RA 2OD3B 3A7VA 1KLJH 5HM9A 1MU6B 1TWXB 5EXNA 2W6ID 1HRTH 3H09A 1A7SA 1FDPA 5DJ7A 1O3KA 1ELBA 4Z6AH 1P09A 1RFNA 1DSUA 4ZHMU 2XNDD 3V13A 2B7DH 2PP6A 4IC5A 5C1UA 3P8GA 5IYTA 1EZSC 1S83A 1GBTA 1O2QA 5T1VA 3GY4A 3M7QA 1NO9H 3GCHB 3SZEA 3SW2B 1IAUA 4YO9A 4MVNA 2VWOA 2AFQB 3MWIU 2WV5A 4BAQB 3TGKE 1P3EA 1V2LT 5GPIB 5FHTA 3H7OA 4JYUH 5CMXH 4B73A 3QTOH 2A0QB 5EW2H 3V3MA 2GCHG 1T8NA 1TGSZ 4BTIB 2YNAA 3KQDA 2FMJA 2XOKD 4HI3A 3TVJB 3D23A 3A7YA 3N7OA 1TNKA 3L6PA 1FN8A 1J17T 4MPWA 3T26A 5A2MH 1PPHE 3LJJA 4FU8A 2J2UA 1H1BA 2ANMH 4UFFH 3SHAH 1TNLA 1E35B 2STAE 2BVSH 2ZEBA 2UWPA 4AYYB 2BDYA 3TH4H 1FY1A 2Z7FE 4AN7A 3PO1C 1C1RA 1T8MA 2LPRA 1WTHD 2BLQA 3LH3A 3AASA 3MHWU 4Y6DA 1SLUB 1CGHA 3RXSA 4CHAB 5AFZH 1GHBF 3QN7A 5FPSA 1DOJA 1QNJA 3GY3A 5EIYA 2AH4X 2Y5GA 3TGJE 2UUYA 2CGAA 1P10A 1HGTH 1BTPA 1F0UA 1BTYA 2ODYB 3ZZ7A 2BXTH 1YY3A 3VXFH 2YMSC 1AI8H 2GT8A 2J94A 2O8TA 1O2SA 2JH6D 2VIDA 2WHXA 3RXPA 1DE7H 1WDIA 2W3KA 1GBKA 1TQ0B 3KCGH 1UVSH 1EZUC 1AB9B 1C2GA 1EAIA 3MNCA 4ZHLU 5C2ZA 4NFEA 2ZGJA 1P02A 1CO7E 2Y7ZA 1W10U 2FOCA 1H9LB 1N8OB 3F1SB 3OFND 2VGCB 3CS7A 1BBRH 3QLPH 1P2IA 4X8VH 1GG6B 1DX5M 3FO8D 5KGOA 1TOMH 1GMHG 4ZROA 3U8RH 1SGQE 2ZTYA 3P8NA 3IG6B 2A32A 2Z6BD 3F9EA 1GHWH 4B76A 1ZRKA 2VIWA 1B0EA 1ZHPA 2ZCLP 1CT2E 4X1RU 2VIPA 3VB6A 1MTWA 4AORA 2R3YA 1Q3XA 2BD3A 3KN2A 2F91A 2NU4E 2BY9X 3D65E 1S0RA 1HXEH 2RDEA 5C1XA 1TRNA 1IQJA 1BRUP 4ABGA 2BD7A 4B2BA 1YYY1 2AHME 1SR5C 1P0SH 3N99A 1BBRK 2BY5X 1W12U 1GI4A 4Y7BA 3DSGA 2O8UA 1V2RT 4ZUHA 1E0FD 3HKIB 3MU5A 3AVZA 3P8FA 4I32A 1JIMA 1QB1A 4Y10E 1C5SA 3NK8A 4TPYA 3BTHE 2RA0A 4F4OC 3K6YA 2BD5A 4I8JA 1AD8H 3KYGA 4Y0ZE 4NIWA 3SORA 3ATWA 1WXRA 4E06H 1ZRBA 2ZZUH 1XX9A 2G55A 1O2RA 1LPGB 3I77A 3RMLH 2GP9B 3QDZB 7GCHF 1QBNA 1ZJKA 1HLTH 1GGDB 1XUJA 1GCTC 4DW2U 2BXUH 1NS3A 1SGNE 1ETRH 4LZ1H 1A2CH 5GCHF 2K0QA 2IJOB 3LGTA 1AVXA 1EAXA 3UQVA 1HJAC 2DE8A 4NIVA 4KTCA 4FUFA 1EOJA 1WCZA 1ZLRA 2BY6X 1KSNA 2GMTC 1HAZB 1V2PT 3BTFE 1GBCA 5I25A 4TY6A 4CBOA 1UMAH 8KME2 1HB0B 1BMAA 1S6HA 4U01A 2VIVA 1GVZA 3A7TA 4J2YB 1UVUH 2P3FH 1MAYA 4HFPB 2BY7X 2HGTH 1PQ7A 3DUXH 3VFEA 1W3CA 4Y11E 5DPAA 2UWLA 1EUFA 2FX4A 1HAPH 1GWAA 5J4QA 2ULLA 3MH4A 2RFKC 3URCA 5K0HA 1P9UA 2KCYA 2ZCHP 3BEFB 1EPTC 2C8YB 3P17H 2UUKB 1Y3WA 3PWBA 1UTNA 4WXVA 1KTSB 2G4UA 2Z9GA 3DD2H 3QK1A 1MTNC 1CA0B 3T29A 4KKDA 2BDGA 1EQ9A 2DE9A 2F3CE 4Q7XA 5BPEA 3TK9A 4THNH 1QFKH 3LC5A 2WPJS 1GBBA 3SO3A 3CS0A 1P2MA 5EPNA 1BOQA 2F9BH 1X7AC 1LVYA 2FPZA 3RU4T 1O3DA 1NU7B 2A4RA 1JRTA 3IWMA 1V2ST 1MCVA 1KIGH 3R3GB 5L2YH 3KL6A 3V12A 4RKJB 3T28A 4INLA 2F4LA 2BX3A 2GDDA 1ZJDA 2ZFPH 2VVUA 2V6NA 1FLEE 4OS5A 3A7XA 5DP8A 1ID5H 3WY8A 3P70B 5FCRA 2HALA 4MPVA 2ZNKH 1Y5UT 3W94A 2XWAA 1NFUA 3ZYEA 5DP9A 2XC4A 4GPGA 2FLRH 3ITIA 2HVXA 3RLYH 1P8VC 2A45B 3LIWA 2CF8H 4HZHA 4KGAA 3QTVH 1D6WA 1QR3E 4UDWH 4BAOB 1MKXH 2QF5A 4YLUA 1A3EH 3ATMA 1UTPA 5DN6D 1Q31A 1IQKA 3MO6A 1P06A 2ZFRH 2THFB 1LHEH 1D9IA 2H5DA 2CMYA 1OWIA 1TLDA 1O2XA 2CHAC 4X8SH 1DUAA 1C1UH 1F5RA 1FY3A 3P6ZB 1O33A 2F9VA 1G2MA 3M37A 4JMYA 1ZR0A 1K0HA 2KX4A 1C5YB 4XFQA 4GUXA 3RMMH 5TCAA 2BDHA 1B0FA 1AFQB 3ZZ5A 1HIAA 4X2VA 1RXPA 1UK4A 2OQ5A 3SNAA 1BB0B 1FIZA 1LHCH 2QF4A 1RS0A 1P12E 2ZTZA 1F2SE 2VU8E 1CBWC 1DT2A 3H7TA 4YLQH 3M36A 5DO4H 3QO6A 1VITH 2O8LA 1FPCH 4Z0KA 3P92A 1DANH 3PLBA 2W3IA 1BHXF 1TGCA 1Y59T 3U1IB 2FOEA 1MZDA 2LELA 1FQ3A 3A83A 1GJAB 3AAUA 3RC5A 1V2UT 1V2WT 3UTUH 1KXFA 1A3BH 2GKVE 1K1OA 1HAGE 2R3UA 3F9FA 1B7XB 1ZSKA 3DSPA 4HGCA 1MBMA 1G3BA 2GV6A 3LDXH 1ZTLA 1ZMJA 1WOFA 1IHTH 1GJ7B 2H2ZA 1RRKA 3QGNB 1XM1A 1P3CA 4NFFA 4JK5A 2VIOA 2WUCA 2AGIX 2ZHWH 4K5ZA 1AUJA 1DM4B 2FOAA 2Q6FA 3PV2A 2EI6A 1O37A 5HGGA 1DUEA 3LGVA 2Z3CA 1OP2A 2PKSC 1CA8B 2OC8A 4X2YA 1AGJA 1C1VH 5EG4A 4ABAA 1TABE 1YCPM 4FU9A 1SBWA 3U69H 3PMAB 4BAHB 3LC3A 4YXWD 5DP7A 4WJG2 2YNBA 1DXPA 2WSSD 2SFAA 5E0GA 1O3EA 2TRMA 1ABJH 2SGFE 2A5KA 1GBMA 1NC6A 2OK5A 8GCHF 2XW9A 2QYIA 4K1SA 1AE8H 1UTJA 2PFEA 3SJKA 1QGFA 6ESTA 3RXJA 5IK2D 3O8CA 1SQRA 1W0KD 2QC2A 3LGWA 4ZXYH 1BA8B 1TMTH 5LPEA 2C90B 3GOVB 2WYJA 3A89A 1GVKB 1EAUA 2Z3EA 3VB3A 4XE4A 1UVTH 4YZUA 2FOGA 1D4PB 3WWBA 1UK2A 5HM2A 2QXIA 3OY5U 1WBGB 1GBHA 1GHBG 1KXBA 3E16B 3O8RA 4UFGH 3PO1B 2JH5D 3MH6A 4JZ1A 2IPQX 1SGFA 2GV7A 1C2IA 5JBTA 1J15A 5GXPA 2R0KA 1HYLA 1S6FA 3RXDA 1LQDB 3FOAA 2KCPA 4X8UH 4UFDH 4B2CA 4IN1A 3UY9A 1YCPH 2EEKA 1YLDA 3E6PH 5F8ZA 1TPAE 2BLVA 1BHXB 1H9IE 2WPDD 3MI4A 1SGTA 4Y8ZA 2FLBH 1FI8A 3A86A 1EOLA 5ABWA 3PM3A 1SQAA 2BDBA 1TBZH 1SOZA 1TMBH 2YMSB 4LXBH 4UD9H 5DKMA 1AN1E 1GBEA 4KTUA 2GT7A 1K9OE 2WZQA 1MMJN 1SSXA 1AE5A 4FUBA 1GDUA 1VJ9U 5F53A 1EFRD 2J5UA 1UTMA 3F3BA 3S69A 1ZTKA 3QWCH 1EXFA 2ZFQH 1MTUA 2ZPQA 5E2OA 4Q2KA 2J9NA 2D26C 1FAXA 1CU1A 4OM9A 4O3UA 1ZSJA 2OP9A 1C5NH 3LKWA 5EJ1A 4WMEA 5E0JA 3GDUA 2UWOA 5T6FA 2BY8X 4O3TA 1FY4A 3CENA 2VH0A 3RXTA 2UUFB 1A0LA 2WPHS 3TPIZ 3F6UH 1O5FH 2G5VA 1ZHRA 4NA8A 4Y76A 7LPRA 4FUDA 1OPHB 1J8AA 3H5CB 1TPPA 1W0ZU 3GCNA 3BTKE 5LH8A 1A5HA 1V3XA 4Q80A 1W2KH 2ZPSA 4AZ2B 1UCYH 1PPGE 3A88A 3VB5A 1ETTH 4K3JA 4BTUB 1DVAH 4BOHA 1E36B 1LHDH 3BIUH 1NU9A 1P2JA 4AGKA 3ZVGA 3W1EA 1PPEE 1UTQA 4ISIH 3ELAH 1IQGA 1KYNA 2BDCA 5LPRA 3ATIA 1BRBE 3B23B 4Y8XA 1ELFA 4YOGA 2FOHA 1A0HB 1MD7A 4ABFA 3BTGE 4Y79A 3B8JA 3A85A 4X2XA 2Y82A 3URDA 3PYHA 3UNSA 2Y5FA 2ZG0H 4SGAE 4TPIZ 3FANA 2SGDE 3F9HA 4TWWA 4FVBA 3BTTE 3KQBA 2A4GA 1MQ5A 1SGCA 4JYVH 1O2WA 5IDKA 4OS4A 1S81A 4CRGA 2SGEE 2ZHQH 2F9UA 4DT4A 2OCVB 1G30B 1QIXB 4IN2A 2PGBB 2EI8A 3KGPA 1O36A 1KTTB 3NPSA 4B1TA 4XD7D 1AVWA 5H4IB 1CT4E 1L0ZA 2G51A 3BTQE 1GBDA 1GCTB 2ALPA 2ZGCA 2PHBA 1J14A 4IMQA 3T2NA 2KZ4A 2FOMB 3SQHE 1HJAB 3SI4H 5C94A 5E8EH 4FUEA 3VGCC 5A0BA 4AFQA 2PUQH 2WPIS 1TOCB 1XXFA 2GMTB 1GBLA 5AF9H 3S7KB 3FP8E 4X6NA 3MQKC 2TPIZ 2GZ7A 4JYTA 1TNJA 5AFYH 1MTSA 1OWHA 1RTKA 1Y3XA 2OC1A 1Z6EA 2G52A 3PWCA 4GHTA 1EKBB 2G8TA 2KR7A 3KQEA 4NZQA 1O3MA 4WF8A 2GGVB 1AVGH 3LJOA 1VZQH 1YPLH 2ALVA 4GSOA 3U98H 1FY8E 2XTTB 2OC7A 4FUIA 2PTCE 4IMZA 3B9FH 3ZZAA 4CH2B 1VCWA 1YP9A 3SV7A 4Z1MD 5JB8S 4IGDA 1EZQA 1XVOA 1V2VT 1Z8GA 2ZGXH 1F7ZA 1GI0A 1O3FA 4H4FA 1EB2A 2HLDD 3ODFA 1C5RA 3MU0A 1GL1A 2BDIA 5DP3A 3A80A 2F43B 3RXHA 2WPMS 5A8XA 1OKXA 1HAIH 4NSVA 1ELVA 8LPRA 5L30H 7KMEH 1V2KT 4VGCB 1E79D 3K65B 1JRSA 2P3TB 1WV7H 2D1JA 5F8XA 3MNBA 3QZQA 4A1VA 2JIZD 1T8OA 1YGCH 3A87A 2ZWLH 1ZOMA 2FO9A 1IQIA 3M3SA 3O8DA 4RT0A 2OLGA 3Q3YA 3Q3KA 1C5TA 2CF9H 3TJVA 2K1QA 1OWKA 1GHXH 3SI3H 5ESBA 1O31A 1ORFA 3DFLA 1MTVA 1SC8U 2WINI 3GDSA 2CHAB 4MNYA 2P93A 4A92A 2ZC9H 1MAXA 2J4IA 3OE7D 1GJ4H 2Q1JA 1TMUH 5CHBA 2P95A 1TYNA 4FUGA 1GMCF 3F2FA 1BCUH 2OTVA 1GL0E 3OU0A 3UQOA 1TGNA 3U9AH 4CR9A 3GY7A 5PTPA 5JBAS 3TH3H 2Z9KA 1TA2A 1EX3A 2GCTC 4ISHH 4LZ4B 4JZFH 1CBWB 4LOYH 4UEHH 1C5UA 1O2JA 1C2LA 3E8LA 1MKWH 1BUIA 2TGAA 3ZZDA 1CVWH 1TIOA 2EI7A 2QN5T 2LNCA 3U8TH 3NRLA 3TK5A 2BHGA 3T25A 3SZNA 2G4TA 4CH8B 3PRBA 5FX6A 1O2TA 1TONA 5G4BA 1RD3B 3MO3A 3RXLA 1THRH 3Q76A 1D3PB 3TGIE 3PMJA 4YT6H 3ZZ3A 4TY7A 2CJIA 2ZDNA 1K1LA 1T32A 3A8AA 1TGBA 4Q7ZA 3D49H 1UCYE 1W0JD 2FOBA 4BAKB 1AKSA 3BG8A 1GMDG 2J98A 1O39A 1P2NA 4GCHF 1ZGIA 2ZF0H 1KY9A 4Y7AA 3FKSD 1CHGA 2V35A 2Z9IA 4ZKRU 4K1EA 8GCHG 1V2NT 1XUHA 1EP5A 4XSKU 3OEHD 1LVOA 5GDSH 3SOSA 3ZZBA 5BRRE 5C17A 3R0FA 2HPPH 5ETXA 1V2TT 4WH8A 1HIAB 1FPHH 3K9XB 2C3SA 1J16A 3RXAA 1EPTA 2FZZA 2VB0A 1GJ8B 2QF3A 1FY5A 3M5MA 1AQ7A 4NA9H 5EGMA 1FUJA 5GWZA 2R2WU 1LVMA 2BB4A 1D3TB 1XUIA 2FEQH 5HYOA 1TB6H 5TCCA 2A7HA 1FIWA 2PSXA 1QL7A 4H6SB 1LKBA 1UW7A 3RXBA 2WYGA 1YPMH 1GJ6A 2C4FH 1KXDA 2XC5A 2V3OH 3JZ1B 1QBVH 2V7QD 2BLOA 1OWEA 1XMNB 2YMSD 1TX8A 3DHKH 1E1RD 3UWJH 1VGCB 4BTTB 3RU4D 4P02A 1LCYA 1C1PA 1D3DB 1OYTH 1QB9A 3PRDA 3SQEE 1C5QA 1TNGA 1K1PA 4E7RG 1FXYA 1Z1JA 2QA9E 1Z6JH 3UIRA 4OGXA 2W7UA 4CRFA 2FODA 1OP0A 5A0AE 1COWD 3SV9A 2TGDA 4DURA 1DWDH 3ZVFA 1C5XB 1HFDA 2BZ6H 1LKAA 1UHBB 3UR9A 3ZZ4A 6LPRA 1UVPA 1CSOE 4I8HA 1GHZA 1MU8B 1NN6A 2IN2A 1LDTT 1JOUB 3IITA 2ANWA 1V2JT 1HNEE 3HPTB 3ESTA 1MABB 4JZDH 3Q3XA 2ZDLA 3AAVA 3M5OA 3EE0B 3TK6A 3OAAD 3F0OA 3SJ9A 1BJVA 4FETA 4ABHA 3HK6B 4FXGH 3UREA 4X2WA 3V0XA 1PJPA 3EA9A 1RTFB 4MQAA 3GISB 5CHAC 1W11U 3RM0H 3JZ2B 1YKTA 2HWLB 2C8WB 2Q6GA 3VG8A 2H9HA 1T31A 1H4WA 4RSPA 3SN8A 1JMOH 3SU0A 4JZIA 1O35A 1KXCA 1UO6A 1V2OT 1ZZZA 1TGTA 3LU9B 4DT7B 5F03A 3VB7A 4CRBA 1TA6A 3ZZCA 1QQ4A 2KAIB 1IQMA 1O3IA 1Z7KA 3EA7A 2BOKA 4RN6A 8ESTE 3E90B 4RT1A 3SNCA 1O2ZA 1HCGA 2C8ZB 3Q77A 3PV4A 4KTSA 4A6LA 1P11E 1C2JA 3GCOA 1PQ8A 4XRNA 1FNIA 2BD2A 1GJBB 3SV6A 1VJAU 4YESB 3RXIA 3RC6A 3QX5H 2QXJA 1G36A 2CXVA 1CGIE 2ZQ2A 3SBKA 5FCKA 2R0LA 3MH5A 5E0HA 2IJD1 2P16A 4QT8C 3STJA 4DCDA 2PGQB 2LP6A 1Y3UA 3RP2A 1NFXA 2PR3A 3E3TA 3OTPA 5HMAA 4ZAEA 1WYKA 1K28D 1F0RA 1HAVA 1QHRB 4J1YA 2VVCA 1PPFE 1RIWC 1ABIH 2XBWA 3BTDE 2AIPA 3UNQA 3K2UA 2W7SA 4D7FA 3SU6A 4D9QA 1O2KA 1BJUA 3U1JB 1SFIA 1ACBE 1CHOF 4NWKA 4E7NA 3LONA 1MKXK 2GVFA 3SUDA 4ACBA 4ASUD 5JPMH 3C27B 3OTJE 1HUTH 2ZFFH 3L33A 3WW7A 5I46H 1NZQH 5GIBA 3FAOA 4NZLA 4FOUC 2VJ1A 1EATA 3PLKA 1S82A 1C2HA 1RJXB 1C5VA 1GBFA 3SJ8A 1AB9C 1ELDE 2BQ6B 1NTPA 2PTNA 4UE7H 4ABEA 3PV5A 2V0BA 5JDUB 1V2QT 1C2MA 1IQNA 4CRAA 3I29A 2BD8A 1O3HA 5A8ZA 1GI5A 1TQ7B 3SNDA 1YPGH 1K2I1 4WWYA 2A7JA 5TJXA 3KHVA 1YF4A 2HVYB 4ZXXH 5JBCS 4R8TB 1PFXC 1GMDF 1C5WB 1L1NA 1QL8A 1C2DA 1UHBA 5T6GA 1G3EA 3GYMA 3SGQE 2G5NA 1MBQA 2Y7XA 2ZO3H 1KXAA 4ZMAH 1TPSA 1W13U 1BMFD 1E37B 3NUMA 1YC0A 3A81A 1VKYA 1N6YA 1O34A 1O38A 1BZXE 5DP5A 1E34B 2OXSA 5A8YA 1O3JA 2HPQH 1AO5A 1G37A 4O03A 1A0JA 2JJ1D 2HNTE 1O2IA 3AK5A 3TLOA 1Z8IB 1ZYOA 1TE0A 2KCOA 1GI6A 1GCDA 3GY2A 4NCYA 3BEIB 4MNXA 4AYVB 3RMOH 2BX4A 2FI5E 2FX6A 1G3DA 3EDXB 2QCYA 1GHVH 2EY4C 1F0SA 1ZHMA 3AW0A 1YPKH 3DA9B 2P8OC 1Z1IA 2KCAA 1FONA 2KAIA 3MTYA 3FP7E 2ZU5A 3MMGA 3E0NB 5EQRA 2FTLE 1ANDA 5A09A 2QV1A 2ZU4A 3A84A 1QRXA 3NKKA 5T6DA 3KIDU 4AFZA 5C0UA 1XXDA 1GI1A 3KF2A 2BM2A 3HATH 1DY8A 3VB4A 1XKBC 1GJCB 1A5IA 1GMCG 2O8WA 5E2PA 1IQEA 4MG3A 2AGEX 2SGQE 1C5PA 3UOUA 1ZMNA 3M35A 2GZ9A 1THPB 5GNDA 5HIYA 2AYWA 3TNTA 4I8KA 3GCTG 2A2XH 3BG4C 1BTUA 1LHFH 1Z71A 2F9NA 4DVAU 1QBOA 1QQUA 2D8WA 1VITF 4ABBA 3RU4E 3SU3A 2PSYA 3NZIA 3F9GA 2ANYA 5C20A 1WUNH 2GCTB 2ZU1A 2DUCA 3EAJA 4H42U 1LPKB 2GDEH 1AWFH 1C1TA 1UJ1A 4INHA 1ELGA 4BAMB 1FX0B 2ESTE 4M7GA 2VNTA 3RXUA 1HAXB 5C1YA 4A1TA 3EE7A 3SGAE 2ZP0H 1C4Y2 1CA0C 2F9OA 4DGJA 1YPEH 3I78A 1PQAA 1YCPK 4FU7A 4XBDA 4FUJA 1KDQA 3W95A 1YLNA 2STBE 3TU7H 2VWMA 4DIHH 3LGUA 3RM2H 1O2HA 4GCHG 1GHYH 1QURH 1ARCA 3BTME 2A5AA 1DPOA 2JETC 1K1JA 2PWXA 2W5EA 2XWBI 4FUCA 2XNIA 2P3UB 1A4WH 1Y5BT 1BMMH 1ELEE 5EOKA 1O3NA 3SU2A 1L4ZA 2KM0A 1IOEA 1LMWB 3LOXA 1G32B 2QE7D 2UUJB 3UOPA 5FPTA 2FS8A 3VPKA 1P2QA 2C93B 3EQ0H 4X1NU 1FN6A 2QXHA 2O8MA 1SGDE 3MO9A 2G81E 2BD9A 4XOJA 4WMDA 1EZXC 3E0PB 1S6LA 3SUFA 4MDSA 1O5AB 3RMNH 2XCNA 3FFGA 3UAIC 5C3NA 1Z8JB 1O5EH 5DP4A 1SL3A 1NFYA 4MNVA 3SJOA 4BANB 1SMFE 1DDJA 1C5MD 1UCYK 4JCNA 1YBWA 1WAYB 6GCHF 1NRSH 1DWCH 4AC9A 1T4VH 1O3PB 3BTWE 3QGJA 5FAHA 3NCLA 3TIUA 2H5CA 1Y8TA 3RC4A 2QIQA 2AMPA 5LPFA 1KXEA 1L4DA 1SHYA 9LPRA 1QRZA 4NIXA 1AKSB 2A5IA 3SU1A 1ANCA 2J98B 1ZMLA 1S84A 3SJIA 2OBOA 3MU4A 1DWBH 2ZGHA 1QY6A 5FXLA 2JH0D 1OHHD 4HG6A 3KYFA 2QXGA 1MUEB 4ASHA 1H8ED 3BSQA 3MFJA 2A31A 1RTLA 2FXRA 4UFEH 1GDQA 2A7CA 1SGIB 3NWUA 4I86A 2A4OA 1LVBA 1EP6A 7ESTE 2FI3E 1PPCE 1OS8A 1TPOA 4ZKOU 1EPTB 3N7DA 2QF0A 3BV9B 4JK6A 4I31A 2I6SA 1LQEA 1AZ8A 2ODPA 4B6FA 3OEED 1QA7A 1MTNB 1EB1H 1W8BH 1WU1A 5C67A 1VCPA 3MNXA 4AB8A 3CNRA 5SGAE 1TBRH 4K69A 4B75A 2H9TH 1HPGA 4ESTE 3KQ5A 1AHTH 1V2MT 3TNSA 1PPZA 2P59A 5CHAB 4YTAA 1DY9A 1DFPA 2BOHB 2Y80A 2BZAA 3DSOA 6CHAC 1MH0A 3OY6U 1TX6A 2J97A 1DLEA 4NWLA 2BMGB 5EW1H 1C5ZB 5KEDA 1PYTD 2ZIQH 2KFWA 1ZPZA 4OS1A 1MQ6A 1DLKB 4BXSA 2AEIH 2ASUB 3RXFA 2ZDAH 2ZHDA 1NPMA 3RDZA 2HNTC 4HTCH 2ZECA 3EYDA 1ESBA 5CE1A 3KNXA 3RXQA 1QZ8A 1D3QB 1ZSLA 3SYJA 2ZU2A 1QRWA 2FS9A 5EJLA 3SUEA 2Y81A 2BYAX 1O2PA 2FYRA 1CE5A 1UVOA 4WMFA 2R2MB 2G00A 5C0TA 2QGRA 2ZDKA 1K1NA 1BITA 1GI2A 2O9QA
chains in the Genus database with same CATH topology
1TX7A 3KQCA 1BDAA 1Q2WA 1BTWA 2PKAA 1OOKB 1O2UA 1EASA 1OWJA 4AG2A 3BTEE 2BLWA 4B2AA 2GZ8A 4MPUA 2XC0A 3SNBA 1O2LA 4RKOB 1CHOG 1T8LA 4ISOA 4E05H 1H9HE 1BTHH 4A7IB 4ZHAA 1RIWB 2ANKH 4KP0A 2BVRH 5JB9S 4SGBE 2GTBA 1GVLA 1NRNH 1CQQA 1J9CH 1SGRE 3E91A 3GCTF 1HDTH 1C1WH 1P03A 1TAWA 2F83A 4AX9H 3BEUA 3K6ZA 2ZDVH 2VH6A 3TJNA 2B8OH 4CREA 5L6NH 5LGOA 1MCTA 1OXGA 2Z9JA 3SGBE 1NM6A 1DITH 3LT3A 1OWDA 1WTGH 4MPXA 2VIQA 2EA3A 2AGGX 3GICB 1P2KA 2B5TB 5JYIA 1DS2E 1SLWB 1THSH 3MOCA 4XBCA 1W14U 5J4SA 1H8DH 3PROA 1AU8A 4O9VA 2ZA5A 2H1UA 2J38A 1MKWK 5DGJA 2PKSB 1HAVB 3RXRA 3LGYA 5C5OA 1HV7A 3RLWH 1EAWA 5ESTE 1HJ9A 2FESH 1P05A 3QZRA 2CN0H 1P04A 3UWIA 1GHAF 1EJNA 3ZZ6A 3RXVA 1TRMA 1D6RA 3PTBA 4Q7YA 2FOFA 5C5NA 4WVPE 3S9AA 1P2OA 1BMLA 1LTOA 1DICA 2BDAA 9ESTA 4ABDA 1C1OA 1L1JA 4A1XA 3D62A 2R9PA 3QUMP 5FX5A 2WV4A 3F68H 1HAOH 1NROH 1PPBH 4CRCA 4GLYA 1BMNH 2TIOA 2SNWA 1GBIA 2B0FA 4AFSA 3G01A 5EQSA 2TGTA 1C5OH 2FP7B 2P8OB 1GI8B 2XBVA 1XUFA 3C1KA 1AWHB 1S0QA 4AG1A 1OX1A 1XUGA 4K2YA 5T3HA 1SLXB 1YPHE 3LH1A 1TRYA 1S5SA 4AFUA 2ZGBH 4R0IA 3M5LA 1KLIH 4DG4A 5A0CA 4WH6A 4NIYA 1UTLM 2OQUA 1LHGH 2Y6TA 2OBQA 3RXOA 1JXPA 2YOLA 1T4UH 2RA3A 1QJ6B 1ESAA 1V6DA 5EODA 1VITG 1XUKA 3M7UA 1C1MA 2QY0B 4OS2A 3VEQB 3GY8A 2OINA 1ZTJA 3BG4B 1C4U2 1JIRA 4IS5A 3SNEA 3OX7U 2Y5HA 2AIQA 2WPLS 2EC9H 1U6QA 1O32A 5F8TA 4LK4A 2J34A 3UR6A 1FZZA 5DP6A 1SGPE 3STIA 2ZKSA 3Q00A 1YLCA 4UONA 4OS7A 4X6OA 3T62A 1BTZA 2J92A 3KEEA 1NRRH 1ARBA 1T7CA 1JWTA 1WQVH 4XBBA 1XKAC 1C9TA 1O2VA 2RCEA 1O5CB 1L1GA 3GCHC 1TBQH 2AERH 4GVUA 2ZDMA 3S0NA 3ZV8A 1K22H 4K60A 3VXEH 1M9UA 3DFJA 1C1NA 4K8BA 4WXIA 1IQFA 1BT7A 3U8OH 2A4QA 1O5DH 1AFEH 5FBEA 2ZPRA 5F6MA 2JETB 4A5TS 1NT1A 2BQ7B 2HOBA 4ZKNU 1NY22 2VWNA 1F92A 2XRCA 4JZEH 1Y3VA 4U30A 4Y0YE 3ZVBA 3FVFB 4MNWA 2NU2E 1K21H 3PMBB 2GCHF 1EJAA 2B9LA 4VGCC 1AIXH 4XDEA 1MD8A 1AMHA 4I7YH 1AY6H 3BIVH 1GI9B 1XVMA 4GHQA 1ELAA 3M5NA 2OC0A 1OSSA 1GBAA 2XCFA 2SGAA 2ODQA 3RXMA 5FPYA 1C2FA 1AZZA 2HNTF 2PLXA 3GY5A 6GCHG 2JKHA 1GJDB 3M61U 3AW1A 1DXWA 3DT0H 4CHAC 4AGJA 2BVXH 4X0WU 3RUOA 3ATKA 3GDVA 1G9IE 2FYQA 1N1LA 2GD4B 1DSTA 4DOQA 4AOQA 1O3AA 4U32A 1YM0A 2FIRH 1KDQB 1SOTA 1SGYE 4K8YA 4WY3A 2PW8H 2XBYA 2VVVA 1H8IH 3HGNA 2WUBA 2W26A 2V3HH 3T27A 4YOIA 1CGJE 3GYLB 2ZQ1A 4NA7A 3VGCB 1C4V2 3TITA 1C9PA 1A61H 4BXWA 4YT7H 4CBNA 3ZVAA 1HBTH 4X1PU 3E1XB 2ZFTA 4AB9A 4D7GA 1N6XA 3M7TA 1ESTA 1N8OC 1QJ1B 3HGPA 3T5FH 1G3CA 3ZVDA 2VGCC 3A7WA 2A1DB 2RG3A 3BN9A 4TWYA 5EXMA 1GG6C 3TH2H 1BBRE 5EPYA 1ANBA 2F9PA 1SVPA 3UFAA 2OUAA 1O0DH 5EXLA 4B74A 1TNIA 3GY6A 1SG8B 1EJMA 1UTKA 2ZI2H 2Q6DA 3PMHB 3S7HB 1OP8A 2ZU3A 3MH7A 1P57B 1SQOA 3MU8A 5HXFA 3ENSB 1RGQA 1IHSH 3TJUA 1GMHF 4D76A 4D9RA 1B5GH 2BTCE 3SU5A 4FVDA 5JBBS 2NU3E 3L3TA 3OYPA 1UTOA 4F49A 1TFXA 3FZDA 1S85A 1ZGVA 3RXKA 1OYQA 4ABJA 3PB1E 3V7TA 1GI3A 3PLPA 2GX4A 6CHAB 2FI4E 1IQHA 1SFQB 1W7GH 4X6PA 2C8XB 2FWWA 3S9BA 1P01A 1O5GH 1F5LA 1BRAA 2VWLA 2FDAA 3S9CA 2XXLA 2AS9A 4TYDA 2FM2A 4NGAH 5K7RA 3MYWA 2PUXB 1WQSA 2Z3DA 4ZH8A 4IW4E 2I6QA 1E38B 2H6MA 3ZZ9A 5B6OA 3A8BA 1SHHB 3RXEA 1A5GH 1ETSH 1GJ5H 1GI7B 4X8TH 4CR5A 2BD4A 1GGDC 4U2WA 3SHCH 1ZPBA 1SB1H 2IPHA 1AUTC 4GAWA 1TNHA 1INCA 1HAHH 1VGCC 4H6TA 1FV9A 1NESE 5GJ4B 2WPKS 5L2ZH 1SPJA 1G2LA 4X1QU 4X1SU 1YPHC 2Z9LA 1FMGA 1HXFH 3UUZA 2ZHEH 3HK3B 3O8BA 1O2NA 3FP6E 5EQQA 1GJ9B 2HRVA 4ZKSU 2SNVA 4I8LA 3M3TA 4ISNA 1O2YA 2Z94A 1TALA 2RDLA 1BIOA 3UNRA 4MTBA 1A46H 1GBJA 1KLTA 1NRQH 2AMDA 1O3OA 1UK3A 2ILNA 1FJSA 4Y8YA 4Y71A 1F0TA 1BQYA 1QA0A 4PROA 4DY7B 5EU8A 3ZYDA 1Y5AT 5AHGH 1W0YH 4FUHA 1WSSH 3PTNA 1BRCE 1NFWA 1GDNA 2SGPE 1O3LA 4ABIA 2ZCKP 2D2DA 1O3BA 3EA8A 1SGEE 3SV8A 1C1SA 2IOTA 3A7ZA 1ZPCA 3ATLA 4IBLH 3FZZA 2PKAB 1JBUH 4YM9A 3SU4A 3M3VA 3RXCA 3CP7A 1GHAG 1ELTA 2P94A 4I33A 1K1MA 4X6MA 4K1TA 1PQ5A 4OGYA 2XYAA 5AVDA 2VINA 3RXGA 1BTXA 1L2EA 3EGKH 5DG6A 3TJOA 3LGIA 1LPZB 1GPZA 1SI5H 2BQWB 1DWEH 1QCPA 4NSYA 3A8CA 3LPRA 2AMQA 1SGFG 2TGPZ 4DIIH 3MNSA 3MU1A 2HLCA 4I8GA 4KELA 1O30A 3ODDA 3P8OA 4O97A 2ZTXA 1K1IA 4INKA 2ZHFH 1MZAA 1C5LH 2A2QH 1QB6A 3A82A 2M5TA 1SLVB 2NU1E 2H9EH 4D8NA 4NG9H 3A8DA 1PYTC 2TBSA 2FTMA 1O3CA 3ZZ8A 3ZV9A 3UPEA 1O2MA 2NWNA 1SQTA 7GCHG 3NXPA 1AFQC 2ZFSA 1Y3YA 1VR1H 1ANEA 4MLFB 1O2GH 2J95A 5DK1A 4YOJA 5GCHG 1P9SA 2PV9B 1C2KA 1VCQA 1ELCA 1W7XH 3P95A 1C1QA 4ISLA 1HJ8A 1YPJH 2XBXA 1CT0E 1A1RA 1FAKH 1QL9A 2NU0E 3ZVEA 1O5BB 2QAAA 1QTFA 3SV2H 4DJZB 1LO6A 1C2EA 4IC6A 4B71A 1O2OA 3BF6H 1QJ7B 3OSYA 1IQLA 4CRDA 2CV3A 1HAYB 1O3GA 1NRPH 1F5KU 4BNRA 3SUGA 3HKJB 5FBIA 3ZVCA 4OS6A 1Z8RA 2OD3B 3A7VA 1KLJH 5HM9A 1MU6B 1TWXB 5EXNA 1HRTH 1A7SA 1FDPA 5DJ7A 1O3KA 1ELBA 4Z6AH 1P09A 1RFNA 1DSUA 4ZHMU 3V13A 2B7DH 4IC5A 5C1UA 3P8GA 5IYTA 1EZSC 1S83A 1GBTA 1O2QA 3GY4A 3M7QA 1NO9H 3GCHB 3SW2B 1IAUA 4YO9A 4MVNA 2VWOA 2AFQB 3MWIU 2WV5A 4BAQB 3TGKE 1P3EA 1V2LT 5GPIB 5FHTA 3H7OA 4JYUH 5CMXH 4B73A 3QTOH 2A0QB 5EW2H 3V3MA 2GCHG 1T8NA 1TGSZ 4BTIB 2YNAA 3KQDA 2FMJA 4HI3A 3TVJB 3D23A 3A7YA 3N7OA 1TNKA 3L6PA 1FN8A 1J17T 4MPWA 3T26A 5A2MH 1PPHE 3LJJA 4FU8A 2J2UA 1H1BA 2ANMH 4UFFH 3SHAH 1TNLA 1E35B 2STAE 2BVSH 2ZEBA 2UWPA 4AYYB 2BDYA 3TH4H 1FY1A 2Z7FE 4AN7A 3PO1C 1C1RA 1T8MA 2LPRA 1WTHD 2BLQA 3LH3A 3AASA 3MHWU 4Y6DA 1SLUB 1CGHA 3RXSA 4CHAB 5AFZH 1GHBF 3QN7A 5FPSA 1DOJA 1QNJA 3GY3A 2AH4X 2Y5GA 3TGJE 2UUYA 2CGAA 1P10A 1HGTH 1BTPA 1F0UA 1BTYA 2ODYB 3ZZ7A 2BXTH 3VXFH 1AI8H 2GT8A 2J94A 2O8TA 1O2SA 2JH6D 2VIDA 3RXPA 1DE7H 2W3KA 1GBKA 1TQ0B 3KCGH 1UVSH 1EZUC 1AB9B 1C2GA 1EAIA 3MNCA 4ZHLU 5C2ZA 4NFEA 2ZGJA 1P02A 1CO7E 2Y7ZA 1W10U 2FOCA 1H9LB 1N8OB 3F1SB 2VGCB 3CS7A 1BBRH 3QLPH 1P2IA 4X8VH 1GG6B 1DX5M 1TOMH 1GMHG 4ZROA 3U8RH 1SGQE 2ZTYA 3P8NA 3IG6B 2A32A 2Z6BD 3F9EA 1GHWH 4B76A 1ZRKA 2VIWA 1B0EA 1ZHPA 2ZCLP 1CT2E 4X1RU 2VIPA 3VB6A 1MTWA 4AORA 2R3YA 1Q3XA 2BD3A 3KN2A 2F91A 2NU4E 2BY9X 3D65E 1S0RA 1HXEH 5C1XA 1TRNA 1IQJA 1BRUP 4ABGA 2BD7A 4B2BA 1YYY1 1SR5C 1P0SH 1BBRK 2BY5X 1W12U 1GI4A 4Y7BA 2O8UA 1V2RT 4ZUHA 1E0FD 3HKIB 3MU5A 3AVZA 3P8FA 4I32A 1JIMA 1QB1A 4Y10E 1C5SA 3NK8A 4TPYA 3BTHE 2RA0A 4F4OC 3K6YA 2BD5A 4I8JA 1AD8H 4Y0ZE 4NIWA 3SORA 3ATWA 4E06H 1ZRBA 2ZZUH 1XX9A 2G55A 1O2RA 1LPGB 3I77A 3RMLH 2GP9B 3QDZB 7GCHF 1QBNA 1ZJKA 1HLTH 1GGDB 1XUJA 1GCTC 4DW2U 2BXUH 1NS3A 1SGNE 1ETRH 4LZ1H 1A2CH 5GCHF 2IJOB 3LGTA 1AVXA 1EAXA 3UQVA 1HJAC 2DE8A 4NIVA 4KTCA 4FUFA 1EOJA 1WCZA 1ZLRA 2BY6X 1KSNA 2GMTC 1HAZB 1V2PT 3BTFE 1GBCA 5I25A 4TY6A 4CBOA 1UMAH 8KME2 1HB0B 1BMAA 1S6HA 4U01A 2VIVA 1GVZA 3A7TA 4J2YB 1UVUH 2P3FH 1MAYA 4HFPB 2BY7X 2HGTH 1PQ7A 3DUXH 3VFEA 1W3CA 4Y11E 5DPAA 2UWLA 1EUFA 2FX4A 1HAPH 1GWAA 5J4QA 2ULLA 3MH4A 3URCA 5K0HA 1P9UA 2ZCHP 3BEFB 1EPTC 2C8YB 3P17H 2UUKB 1Y3WA 3PWBA 1UTNA 4WXVA 1KTSB 2G4UA 2Z9GA 3DD2H 3QK1A 1MTNC 1CA0B 3T29A 4KKDA 2BDGA 1EQ9A 2DE9A 2F3CE 4Q7XA 5BPEA 3TK9A 4THNH 1QFKH 3LC5A 2WPJS 1GBBA 3SO3A 3CS0A 1P2MA 5EPNA 1BOQA 2F9BH 1X7AC 1LVYA 2FPZA 3RU4T 1O3DA 1NU7B 2A4RA 1JRTA 3IWMA 1V2ST 1MCVA 1KIGH 3R3GB 5L2YH 3KL6A 3V12A 4RKJB 3T28A 4INLA 2BX3A 2GDDA 1ZJDA 2ZFPH 2VVUA 2V6NA 1FLEE 4OS5A 3A7XA 5DP8A 1ID5H 3WY8A 3P70B 5FCRA 2HALA 4MPVA 2ZNKH 1Y5UT 3W94A 2XWAA 1NFUA 3ZYEA 5DP9A 2XC4A 4GPGA 2FLRH 3ITIA 2HVXA 3RLYH 1P8VC 2A45B 3LIWA 2CF8H 4HZHA 4KGAA 3QTVH 1D6WA 1QR3E 4UDWH 4BAOB 1MKXH 4YLUA 1A3EH 3ATMA 1UTPA 1Q31A 1IQKA 3MO6A 1P06A 2ZFRH 2THFB 1LHEH 1D9IA 2H5DA 2CMYA 1OWIA 1TLDA 1O2XA 2CHAC 4X8SH 1DUAA 1C1UH 1F5RA 1FY3A 3P6ZB 1O33A 2F9VA 1G2MA 3M37A 4JMYA 1ZR0A 1C5YB 4XFQA 4GUXA 3RMMH 5TCAA 2BDHA 1B0FA 1AFQB 3ZZ5A 1HIAA 4X2VA 1RXPA 1UK4A 2OQ5A 3SNAA 1BB0B 1FIZA 1LHCH 1RS0A 1P12E 2ZTZA 1F2SE 2VU8E 1CBWC 1DT2A 3H7TA 4YLQH 3M36A 5DO4H 3QO6A 1VITH 2O8LA 1FPCH 4Z0KA 3P92A 1DANH 3PLBA 2W3IA 1BHXF 1TGCA 1Y59T 3U1IB 2FOEA 1MZDA 1FQ3A 3A83A 1GJAB 3AAUA 3RC5A 1V2UT 1V2WT 3UTUH 1KXFA 1A3BH 2GKVE 1K1OA 1HAGE 2R3UA 3F9FA 1B7XB 1ZSKA 4HGCA 1MBMA 1G3BA 2GV6A 3LDXH 1ZTLA 1ZMJA 1WOFA 1IHTH 1GJ7B 2H2ZA 1RRKA 3QGNB 1XM1A 1P3CA 4NFFA 4JK5A 2VIOA 2WUCA 2AGIX 2ZHWH 4K5ZA 1AUJA 1DM4B