3BTHE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
221
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bthE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bthE02
4D7GA 4M7GA 3ZVDA 1O2MA 2NU0E 1QL7A 1YKTA 3SUEA 2G5VA 1LPGB 3O8CA 3V0XA 2BDBA 4Y0ZE 1HPGA 1Z71A 1ZJKA 1SR5C 1ARCA 1O2TA 1XUGA 1OS8A 1Y5AT 1V2QT 4BXSA 3A7TA 3F9EA 5GDSH 2QF0A 4O97A 2UUYA 4WF8A 4OS5A 4UFDH 1GBCA 3SV8A 3ZV8A 2O8LA 5C3NA 3T2NA 1ABJH 2YNBA 1FY8E 3L33A 1ELCA 4OS7A 3A81A 2G5NA 1GMCG 2ZNKH 1CE5A 1C5ZB 4ABFA 1W8BH 2ZGHA 2VINA 2WV5A 3EA9A 1MD7A 1SG8B 1TA2A 1W11U 1BJVA 4WH8A 3SQEE 1C2KA 4NA9H 1INCA 2BD9A 1C4U2 1MTWA 2B0FA 4NA7A 1YPEH 1EZQA 1EUFA 1GHBG 1M9UA 1S0RA 1NT1A 2FI4E 4X8UH 3TJUA 4MTBA 3RXIA 2WYJA 3LKWA 4BTUB 5DG6A 1C1MA 4MNYA 4FUBA 3D65E 5F03A 1O30A 1AZZA 5L2YH 1BDAA 2J2UA 1C1VH 1GI0A 4UE7H 2ZI2H 1AKSA 1TNGA 2JH6D 2C3SA 1BBRK 4X6MA 1S85A 2FPZA 4QT8C 1KXFA 4ZHMU 1NFWA 1V2MT 3ZZ7A 4KKDA 5EODA 1GI4A 1WCZA 1O2QA 6ESTA 1MKXK 1QGFA 2ZP0H 5TCAA 2XTTB 4FU7A 3PWCA 1NS3A 2XRCA 4A6LA 3SZNA 2P8OC 4A1XA 2AGGX 2R9PA 3BIUH 5LH8A 5EW1H 1HRTH 1ZR0A 2H5DA 2ZPRA 3SNBA 2PKAB 2G00A 1ANEA 2BX4A 1IQIA 1DLKB 2GCHF 1S5SA 1CO7E 1ZOMA 4IC6A 1JRTA 2JH5D 4WXIA 2ZG0H 1LVBA 2SGEE 5GWZA 1C1PA 2XNIA 2FXRA 1O3OA 3A83A 4YM9A 1FPHH 2BTCE 2W3IA 1UHBA 2EEKA 3I29A 2IOTA 4XSKU 5F6MA 3SHCH 1GJ5H 4UONA 4U01A 4CHAC 4ZUHA 2FOCA 4NSYA 2FM2A 4YLUA 1IHSH 1V2WT 4ISOA 1RTLA 1K22H 2BHGA 3A86A 3BEFB 1GCTC 2M5TA 3RXCA 1QRZA 1CBWB 2J94A 3SU3A 2O8TA 1ETRH 3E0NB 3P6ZB 1OX1A 5F8XA 4H6SB 1ABIH 1O5FH 1IQFA 2BQ6B 2PHBA 1WTHD 2FOMB 4LZ4B 2C8XB 3BV9B 3NWUA 3UR6A 1FJSA 3KQEA 4AG2A 1T4UH 1BMAA 3TK5A 1IQKA 4TY7A 1CT4E 2CF8H 4GCHG 3GY7A 4AG1A 3Q77A 4JYVH 2CHAC 1F2SE 2BY7X 1QL9A 1MAYA 3P17H 2OQUA 1YPJH 2QAAA 1GVZA 2ZGJA 2QF3A 2THFB 4WXVA 1UJ1A 5A0BA 1W12U 6CHAB 5J4QA 3E1XB 2BY5X 1Z8IB 3ATLA 2GV7A 3RP2A 1GJ7B 4H42U 1T8LA 2ANYA 4DJZB 1N1LA 3QTVH 1EQ9A 2OXSA 2PUXB 3ZZCA 1HDTH 1HAPH 2F9PA 1SQTA 4K69A 2HVXA 1NRPH 1WU1A 3UTUH 3UR9A 1V2KT 5E2OA 4B1TA 1Q2WA 1G3DA 1P2IA 4ZXXH 2ANWA 1MCVA 2QXHA 5GCHG 3PTBA 1CGHA 1ZMNA 3VB6A 2FX4A 4AORA 1MU6B 1SLWB 1RIWC 3U8OH 1Q3XA 5JBTA 4ZROA 4U30A 2SGQE 3V12A 1F5RA 1LHCH 2FOAA 3LC3A 3MH7A 5JYIA 2OUAA 2WUBA 3DUXH 1SB1H 3UREA 3T28A 1TX8A 1C5XB 2Q6FA 4X1SU 4AOQA 2RG3A 1C2EA 1XXFA 5IYTA 2BLWA 1O2VA 1TIOA 2TGPZ 3RLWH 5DJ7A 1BRUP 1V2UT 1D3TB 3LJJA 1GBLA 1ID5H 2HOBA 1FMGA 1K2I1 2XC4A 1N6YA 2FOGA 3LGIA 3A7ZA 1O3GA 3SNAA 1BMMH 2ZDAH 2V6NA 1K1OA 1B7XB 4YOJA 4MNXA 4BANB 1T31A 4I8KA 2VIVA 4AFUA 4ZMAH 1P9UA 1QCPA 3FZDA 3E6PH 3I77A 5T6DA 3RMOH 3M3SA 1T32A 1QB1A 4KTCA 1YF4A 2V3HH 2PKAA 1VJAU 1BRBE 1ZGIA 5C2ZA 3ZVAA 1AWHB 1E36B 4I7YH 5E0GA 2AERH 2AS9A 4ZHLU 5CMXH 2HNTF 4ZKNU 4ABJA 2Z6BD 2BLQA 2GZ7A 1AFQB 3GCTF 3B23B 2SGPE 2BDCA 1AUTC 2EA3A 2R0KA 2P3UB 4AX9H 2GKVE 3LGTA 5EG4A 1MTNC 4CBNA 3UQVA 3QGNB 2C8YB 1GBJA 1YCPH 2OQ5A 2Z9LA 4HI3A 1P0SH 3STJA 3HKJB 4NA8A 1IQJA 3Q00A 3DFLA 2P59A 1O3NA 3ZZDA 4AFZA 1NTPA 2WPHS 1V6DA 3A8CA 3M37A 1DLEA 2AMQA 4B2BA 3P92A 1PPGE 5L2ZH 1RRKA 2FOHA 1N8OC 2Y5GA 3HGPA 1Z8GA 5BRRE 1EKBB 2C8WB 1H9LB 1ZYOA 5L6NH 2JETB 3JZ2B 1DY9A 4Q2KA 1OWIA 2FOEA 4BTIB 2FI5E 2EI6A 4I8GA 1ARBA 2C8ZB 1HV7A 1LCYA 1OWDA 2J92A 1GVLA 5DP4A 2FS8A 1HAVB 3EGKH 1JIMA 1G2MA 2W3KA 2IPHA 3KGPA 1DPOA 4DGJA 1TQ7B 4CH8B 3TNSA 3MU5A 1YCPK 4FUDA 1UTOA 1YYY1 2F9BH 1WV7H 3BSQA 1KXAA 1DWCH 2FIRH 4A92A 1VITH 4E06H 1TMUH 3BTWE 1ZHRA 1BCUH 3IWMA 3OY5U 3U8RH 2OBQA 4AGJA 3BEIB 4D9QA 1IQEA 1RFNA 3RXEA 2TPIZ 3RDZA 3SOSA 2YNAA 1ELTA 4MNWA 1O38A 1Y3UA 2VGCB 1SGPE 2FI3E 1BTUA 1P3CA 2D2DA 3BG4B 4YOIA 2G4TA 1UVTH 2ALPA 6GCHG 1KDQB 2O8UA 4Y0YE 2HWLB 2ESTE 1VCPA 3LGVA 1P2OA 1ESAA 3W94A 1CA0B 5H4IB 8ESTE 4LK4A 3OY6U 1O37A 3LU9B 2A4GA 1FY5A 1QBOA 1MBMA 1Y3VA 2PKSB 4YLQH 1UTMA 1GMHF 1IQGA 3ELAH 3VXFH 1ELGA 2ZHWH 2QN5T 4Q7XA 4IN1A 1EPTB 5T6GA 1JWTA 1OKXA 4XBCA 1IQHA 8KME2 2ZQ2A 4NG9H 3ZZ8A 4FXGH 1B0EA 1Y59T 1PYTD 1SL3A 5E0HA 1QNJA 1GJ9B 3QZQA 3SJOA 3EA7A 2STBE 5A8XA 1O35A 4WMEA 1K1NA 4K8YA 1BQYA 1SGDE 1O33A 2D8WA 3UWIA 2WPJS 2ZU2A 2ZPQA 1JMOH 1KLJH 2ZFTA 3FAOA 1GG6B 3UNSA 2VIDA 1GDQA 4D8NA 3UUZA 8GCHF 1BA8B 1UK4A 3E91A 1EJAA 1QBNA 2GX4A 1THRH 1LKBA 1A1RA 4IMQA 2R2MB 3ZVCA 2ZECA 1O3EA 1HAHH 3DFJA 3ENSB 5JDUB 1HIAB 1ZTKA 4YESB 1EP6A 1FY1A 1KLIH 2R3UA 3BTQE 4FUEA 2ZCKP 2TRMA 1UTNA 4AN7A 5LPEA 2TGDA 2SGAA 2BXUH 1S6HA 3MHWU 5T3HA 4DURA 1LMWB 4WJG2 2J95A 5HM9A 1FIZA 2ZFPH 3L6PA 4DY7B 4JZEH 4X1PU 2ZHEH 1H8IH 4NWKA 2WPLS 1L1GA 1SQAA 2EC9H 1GI7B 3ODFA 2ZGXH 3AAVA 4R0IA 5ABWA 2HLCA 3K2UA 3K6YA 2RA3A 2ZU4A 4Z0KA 1YM0A 5JB8S 4DIHH 1WSSH 1ELVA 3C1KA 2H9TH 1MU8B 2G55A 4YZUA 2NU2E 5JB9S 1H4WA 1SQOA 2OCVB 1A5IA 2BZAA 2OD3B 1S6FA 2P93A 1GI3A 3Q76A 2VIWA 2ZFSA 4I8JA 3SU4A 4UD9H 1NC6A 2R2WU 1A2CH 1CHGA 3NPSA 1SGEE 1T7CA 4IGDA 4MPVA 1SPJA 2AGEX 1CBWC 5EOKA 1RTFB 5A8YA 3GCOA 1PFXC 3H7TA 1G2LA 1NROH 1GHXH 1GWAA 1UVSH 4IMZA 1J9CH 1FAXA 1V2PT 2B7DH 4JYTA 1Z8JB 3PMBB 1HAVA 2BOHB 2ZGBH 1TX7A 4Y8ZA 4D7FA 6LPRA 1RD3B 2Q6DA 1DXPA 4FU8A 2V3OH 1OWJA 1EXFA 1O2PA 1OP2A 2G51A 1RTKA 1W0ZU 1HAYB 4JZ1A 4FVBA 1TYNA 4MNVA 6CHAC 1GJBB 3UOUA 3MTYA 3PO1B 1SGIB 5IDKA 1AVXA 1HFDA 1FV9A 1MKWK 1KDQA 4KGAA 5DGJA 1OOKB 1C4Y2 4YT7H 1SGFA 2FX6A 1L4ZA 2FDAA 1TWXB 3FP7E 1A3EH 3SNDA 1YLDA 4X8TH 3SJ9A 2OC7A 1XM1A 4TWYA 2AH4X 3M3VA 1GI6A 4CH2B 4DW2U 5DP5A 1PYTC 5FHTA 2ZTYA 4RN6A 1MH0A 3O8RA 1O36A 2ZFRH 2BDIA 3SNEA 2HGTH 1L1NA 1J8AA 1P02A 1UK3A 2H5CA 3TK9A 1Y5BT 2GGVB 1DSTA 2J38A 3FZZA 2DUCA 1XKAC 3A82A 1C5NH 1BTXA 5FX5A 3U98H 1O5GH 1TNLA 1F5KU 3D49H 5HMAA 1C5OH 1TPPA 2HALA 1A0JA 1UCYK 3SUDA 1AIXH 1HUTH 3BTGE 1BBRH 5A0CA 1K1IA 3A80A 3G01A 1C2FA 1UTPA 4FVDA 2LPRA 3SN8A 1LVOA 1MKXH 1C2DA 1KTTB 1XX9A 1ZLRA 3RC5A 4I8LA 1KXCA 1C1OA 3MH4A 1WYKA 4NZLA 3FANA 2BYAX 1IQLA 3M5OA 1O2IA 1HIAA 3O8DA 5DKMA 1AFEH 3A85A 4AYYB 2HNTE 3MU0A 1BB0B 2GT7A 2Z9JA 1L1JA 3A7XA 1VITF 3A8DA 1HAGE 2PFEA 4HZHA 5A09A 1BRAA 2ZFQH 1AGJA 3URDA 2XBWA 1HGTH 1JRSA 1UO6A 4XBDA 1VR1H 1L2EA 1C1NA 3ZZ6A 2AGIX 4J1YA 1ZSJA 1FN8A 3S7HB 1LHDH 1W2KH 1AFQC 5C5NA 3TK6A 2NWNA 3HKIB 3GCHB 1A0LA 4WWYA 3K65B 3EA8A 3MNCA 3U1JB 1AN1E 1O2NA 1VCQA 2VVVA 1YP9A 2WYGA 3L3TA 3SU2A 1O5BB 1PPHE 1P2NA 2H9HA 2BD4A 4X8SH 2G8TA 1GI8B 2B5TB 1O2WA 2BY8X 1AE5A 1GBFA 3SUGA 3SV2H 4B2AA 4ABGA 4Y79A 7ESTE 1GMHG 1KXEA 1P04A 1HXFH 2RDLA 2H1UA 3SU0A 3E8LA 1V2ST 4E7RG 1CHOG 1NRSH 1TOCB 2GVFA 2XBYA 2CMYA 1ZTJA 4Q80A 2JETC 3QN7A 3C27B 1BMLA 4BXWA 1E37B 1TNJA 1VGCB 1GJ8B 3MNBA 5GPIB 1TFXA 5BPEA 4NFFA 1KSNA 4WMDA 1F7ZA 2UWLA 2H6MA 1O3LA 3TGJE 4XBBA 3MI4A 5FBIA 3KN2A 5FPYA 1LHEH 4NGAH 3SGBE 1AO5A 5G4BA 3LH1A 3UPEA 2O8MA 1J16A 1J15A 1AU8A 1O2YA 1SSXA 4TPIZ 5FBEA 3KQCA 1BJUA 5F8ZA 2GDEH 5FPTA 3FP6E 1BOQA 2Q6GA 1MAXA 3MU4A 2XWBI 1UVOA 1V2RT 2UUKB 2PSYA 1KY9A 1TPAE 3TJOA 2CF9H 1GJ6A 1KLTA 3D62A 4ABDA 1WBGB 2A1DB 3BG4C 1SOZA 3A8AA 2SFAA 4INKA 4ZKRU 3E16B 1FXYA 5EXLA 2BZ6H 2ZU1A 1CA0C 1G37A 2VVUA 2XBVA 1DITH 3ATMA 3OSYA 3T26A 3SGQE 1W0YH 1D6WA 1C2IA 2Z3CA 2PKSC 4MPWA 3T25A 1O2HA 2BD3A 1HNEE 4MPUA 1O3MA 1HBTH 3QZRA 3TH2H 2ODQA 1A61H 3QLPH 1P57B 1SGQE 1NY22 5I25A 4CRDA 3F68H 3M36A 3SV7A 1TPSA 1ETTH 1GI9B 5JBAS 2PWXA 1F92A 1AI8H 1GBBA 1W7GH 1AY6H 2W26A 1TAWA 1G3BA 2D26C 3W95A 3AAUA 4ISIH 3R3GB 2A31A 3ZZBA 1DX5M 2OINA 1O3JA 2TIOA 4B75A 3ZZ5A 2ZA5A 7GCHF 3ZZ4A 3IG6B 1P05A 1NFXA 3NZIA 1OPHB 1C5RA 4FUHA 2FO9A 2GD4B 1Y3WA 1YC0A 2TGAA 1QFKH 1GG6C 1K1MA 4D76A 1TGNA 2WPMS 1TOMH 2ILNA 1B0FA 1DANH 3U69H 3EDXB 2ZDKA 3GICB 4OGXA 1XMNB 4O3TA 4O3UA 1UTQA 2ZWLH 4WVPE 1GMDF 1C5TA 1O3HA 3S9AA 1FUJA 1OSSA 3LONA 2A5IA 3MOCA 1X7AC 2FOFA 1WAYB 2ZKSA 4X6OA 3UWJH 1EP5A 1QRXA 1PQ7A 1NRNH 5HM2A 3SNCA 1EAIA 2PTNA 3QWCH 1DUEA 2ZU3A 1S83A 1O5AB 3S9CA 1GHAG 2A5KA 3LJOA 1YPLH 4X1RU 1ESBA 2O9QA 1O2LA 2FLRH 2SNWA 3KQDA 4B71A 1EJNA 4CBOA 1SFIA 2OC1A 1RGQA 1BUIA 1TPOA 2EI8A 1C5QA 1V2JT 3RXRA 3HK6B 4GLYA 1OYQA 1GBMA 1YGCH 4TWWA 2BY9X 3GYMA 1C4V2 3QX5H 4YOGA 1EZSC 1YPHE 4FUGA 7KMEH 5FPSA 1P09A 2VVCA 1JBUH 4BTTB 1GBKA 4ISLA 4YT6H 1QY6A 1JIRA 2SGDE 2Y81A 2VWNA 1NRQH 1C5SA 3MYWA 1B5GH 3LOXA 2TGTA 2VU8E 3BIVH 3T27A 4FU9A 1D9IA 2D1JA 3BTFE 4INHA 1ELEE 1BTPA 1YLCA 1XKBC 2QY0B 1EB1H 1C9TA 1PQAA 1TRYA 5DO4H 2ZF0H 5DK1A 4BNRA 1O32A 3RXVA 2VJ1A 2UWOA 3RXBA 3F9HA 1HB0B 2ODPA 1C2MA 2P3TB 1Y3XA 4JZIA 1GBIA 1QB6A 5DP6A 1D6RA 1O2KA 1O3DA 3S0NA 2A5AA 3PO1C 1DICA 1MQ5A 3PLPA 1OWEA 4IS5A 1W10U 1ZHPA 1VCWA 2XC0A 1QQ4A 1VITG 3H7OA 3LGUA 1C2HA 1PPZA 1EASA 3CP7A 1K28D 2KAIB 1G36A 3FFGA 1TMTH 2H2ZA 3MMGA 1GMCF 5EQRA 2ZCHP 1ZTLA 4DCDA 2A0QB 4GVUA 1BRCE 1NU7B 5FX6A 2BD7A 4KELA 2HNTC 5EQSA 2G52A 4X0WU 1RXPA 5ETXA 1GPZA 2A2QH 2BM2A 3KCGH 1GHBF 3A88A 3RXDA 4GSOA 1P2QA 1QBVH 3BTEE 2XXLA 2GTBA 3MU1A 1IOEA 3P95A 1SBWA 4Y11E 3T5FH 3RXQA 3K9XB 5EPYA 4MG3A 4O03A 1DM4B 1C5LH 4X6NA 1HXEH 1TBRH 1FIWA 1C5VA 4AFSA 1A5GH 2BMGB 2ZFFH 3BG8A 1EAWA 5GJ4B 1DXWA 4Y8YA 1TA6A 3ZVGA 1Y5UT 1WOFA 3RUOA 5EXMA 3SQHE 2W7UA 3CS0A 3RXOA 2B9LA 1TALA 4IW4E 5PTPA 1F0UA 2GCHG 1IAUA 3TJVA 1GHYH 1XUHA 4A1VA 3EQ0H 1FAKH 2BXTH 3PB1E 2VIOA 2AFQB 5HYOA 1ZSKA 5C20A 1QJ1B 2XW9A 1YPGH 4ABIA 1D3DB 1TNIA 1BTWA 1O5CB 3AW0A 4MQAA 1S81A 1O3PB 4O9VA 2ZDNA 1GBTA 2ZO3H 1C1UH 3GYLB 9ESTA 1P9SA 1TLDA 3UFAA 1KTSB 3LGWA 2ZCLP 5FCRA 1GBDA 3BTME 3TH4H 4CR5A 5DPAA 3F6UH 4BAQB 3TH3H 1BMNH 2FWWA 1U6QA 2UUJB 1ZSLA 2BY6X 3S69A 3QTOH 2Y6TA 5HGGA 3ZYEA 1MQ6A 2C4FH 1ZMJA 1TRMA 3MO6A 4MDSA 1LKAA 4CRBA 1HJAB 2QXGA 2QV1A 3P70B 1EB2A 3GCHC 2Z9KA 1SC8U 1NFUA 2CGAA 5EPNA 5C67A 3SI3H 2GCTB 3T62A 3VXEH 2Q1JA 1C1TA 2AIPA 1RS0A 3B8JA 5GIBA 1PQ8A 3SJKA 1FY3A 5C1XA 4OGYA 5E8EH 1WTGH 3P8FA 1O31A 1CGIE 1HCGA 3RXPA 4I8HA 3N7OA 1XUIA 3ATIA 3MWIU 2OC0A 4ZHAA 2FMJA 1ZRBA 1NESE 2QCYA 2WV4A 3GY3A 3ITIA 1N6XA 3KQBA 1BHXB 4LOYH 3STIA 5A8ZA 2AMDA 1SGNE 5E2PA 2Y82A 1C2LA 3V3MA 1VGCC 4Y71A 3NKKA 3ESTA 1AWFH 1HJ8A 1MKWH 2Z3EA 2QXIA 1C5PA 1Q31A 4XFQA 5A2MH 1LHFH 4PROA 3VB5A 2FS9A 3A89A 3SV9A 3OX7U 1TB6H 1AHTH 2ZTXA 2ZTZA 2HRVA 2OLGA 2OBOA 1DWDH 2O8WA 4U2WA 2STAE 3SW2B 2F9NA 3RU4T 2KAIA 2XC5A 2ZQ1A 2ODYB 1XUKA 5GCHF 4INLA 3VPKA 1AE8H 4ABEA 1UVUH 2W5EA 4K8BA 2V35A 5TJXA 1D4PB 2VB0A 4K1TA 1FI8A 2BDAA 3E90B 2YOLA 2BD8A 3A87A 3NK8A 4TPYA 5FCKA 1MCTA 2ALVA 1GHZA 1O3KA 4UFGH 1GBEA 1W14U 2NU4E 2BQWB 4KTUA 3ZZ9A 1MTUA 4YO9A 1GGDB 1P03A 4JZFH 3KHVA 3PYHA 1UCYH 4I32A 2GMTB 2OP9A 3GDUA 3RMMH 3CS7A 3M5MA 3K6ZA 1V2LT 2Z3DA 2A7HA 1EOLA 5ESBA 3LT3A 1ZZZA 1UVPA 5FAHA 2PGQB 1AVWA 2ZHQH 2FTLE 1J17T 1HJ9A 3BTKE 3PLBA 3PV4A 1CGJE 3LIWA 1MTVA 5C1YA 1Z6EA 3RXJA 1UMAH 2NU1E 5C5OA 4XE4A 4FUJA 4Y6DA 2H9EH 2WUCA 3SORA 1P2KA 1AZ8A 1EPTA 3SI4H 3GCTG 4NSVA 1MTSA 4Y7AA 2ZZUH 1UCYE 1TQ0B 1PJPA 2Z7FE 3SGAE 3TVJB 3EYDA 1GJDB 9LPRA 3SV6A 3TJNA 5C1UA 4JCNA 4TY6A 2ZEBA 3MNSA 1CVWH 1GCDA 4X6PA 4IBLH 1CSOE 2FOBA 2CV3A 1QL8A 2PW8H 1E38B 1H1BA 1P3EA 1A46H 4NIVA 2BLOA 4GHTA 1SGCA 2F9OA 1AUJA 1PQ5A 1C1WH 3H5CB 1YPHC 4ZKSU 2VWMA 2XCFA 1O3AA 1ELAA 1WQVH 3MH5A 4ISHH 3SU1A 3A7WA 2VNTA 2PGBB 4VGCB 2LNCA 2OTVA 2ZPSA 1H8DH 4I31A 4CRCA 1C1RA 1MD8A 1EAUA 1W7XH 4NFEA 1QIXB 2Y7XA 3TPIZ 1A0HB 5EW2H 2GP9B 1QA0A 2BDHA 2GV6A 2FP7B 2Z9IA 4K60A 1C5MD 1O3CA 2AYWA 3P8NA 2A4QA 4A1TA 1BBRE 1KYNA 1Z6JH 4TYDA 1G32B 4DVAU 1EZUC 1XUFA 1E0FD 2XYAA 3UNRA 2F3CE 4HFPB 2CN0H 4B76A 2ANMH 3S9BA 1C5UA 1EZXC 3Q3YA 3RXGA 1TGCA 3PWBA 1S0QA 2G4UA 3GY5A 2RCEA 1T8NA 3PM3A 2R0LA 1TBZH 5J4SA 3ZZ3A 5FXLA 1OWHA 1CT2E 2QYIA 3LGYA 2VIPA 5I46H 4X8VH 1GL1A 1S84A 2NU3E 1IQNA 4ZKOU 5K7RA 1ZPBA 4X1QU 2PTCE 1G3EA 1PPCE 1ZPZA 1FY4A 3QDZB 1LHGH 1P01A 1ETSH 1O39A 3RMLH 2ZHFH 2VWLA 3M3TA 1DVAH 3BTHE 1AVGH 3GISB 3M5LA 1NPMA 1S82A 5L30H 1G9IE 1GDUA 1LPKB 2A7JA 3TIUA 3DA9B 5GXPA 3Q3XA 1HAZB 1LVYA 4I33A 4Y7BA 5LGOA 4GHQA 6GCHF 3RXFA 2IJOB 3TGKE 4OS2A 1AMHA 5LPFA 3AW1A 1C9PA 1TONA 4NIWA 4UDWH 1O5EH 2ULLA 2ANKH 3TNTA 1KXBA 2C93B 3GDSA 3QK1A 1Z8RA 4GPGA 1BITA 1SOTA 4MVNA 3DD2H 1C2GA 1PPEE 2K1QA 4CR9A 2ASUB 1J14A 1OYTH 5HXFA 1TE0A 1V2TT 3R0FA 4Z6AH 1EATA 2B8OH 1EAXA 1NO9H 4FUIA 2XBXA 2ZDLA 1FLEE 8GCHG 3EE0B 1QURH 1WUNH 3P8OA 3F1SB 1DDJA 1O2JA 4F49A 1Z7KA 1OP0A 4JMYA 1F0TA 3TGIE 3AVZA 2VGCC 4Y8XA 2QXJA 1EX3A 1FNIA 3PMJA 2FYQA 3URCA 1O2OA 1D3PB 1THSH 3MO3A 1XVMA 2AEIH 3RXKA 2BX3A 2R3YA 1GJ4H 3PMHB 1DUAA 2F9VA 3LDXH 5K0HA 1TNKA 1MZAA 1O2ZA 3GY6A 2HPQH 4BAKB 4B74A 3HATH 4AYVB 1DT2A 1QTFA 1ZRKA 3M5NA 4ISNA 4ASHA 1EPTC 2A4RA 1XXDA 3UOPA 1A7SA 4UFFH 1A5HA 1BHXF 4BAMB 2FZZA 4K2YA 5EGMA 1CQQA 1DWBH 4CRFA 4KP0A 3AASA 1PPBH 4WH6A 3SUFA 3KF2A 1XUJA 4KTSA 3U8TH 3VGCB 1HAOH 1GBHA 4A7IB 2BOKA 3RC6A 3SU5A 2ZDMA 3GY8A 1HLTH 5JBCS 2J34A 2AMPA 3RXAA 3A84A 3HK3B 3ZZAA 3MH6A 1CA8B 1OWKA 4K5ZA 1T8OA 1GBAA 4J2YB 2FODA 3A8BA 3DHKH 1AB9B 1MUEB 3M7QA 5B6OA 4Y76A 1BT7A 3PROA 2Y5FA 4SGBE 4THNH 1HJAC 3D23A 1C2JA 4Y10E 8LPRA 1VZQH 2BLVA 1K1LA 1GHVH 1G3CA 4LZ1H 2A7CA 5CHAB 4RKOB 1NZQH 3BF6H 2RA0A 3CENA 4OS6A 3ZVBA 3NXPA 1FN6A 1W13U 1TGTA 1AQ7A 4ABAA 1JOUB 1MMJN 2FLBH 2GCTC 1DFPA 1LQEA 1SLUB 4JK5A 4JK6A 4YTAA 4ZH8A 2SNVA 3SU6A 1O3FA 2W7SA 1SVPA 2Z94A 4BOHA 4WMFA 4CRGA 1DE7H 1AD8H 4IN2A 3ATKA 4SGAE 4UEHH 2BVRH 1ELDE 3RXTA 2QC2A 3M7UA 1L0ZA 3EAJA 3A7YA 3BTTE 3MNXA 1PPFE 1DWEH 3SJ8A 2J4IA 1SMFE 4XDEA 2EI7A 4F4OC 1CT0E 1SGTA 1QJ6B 2P16A 2ZU5A 3BN9A 2FYRA 4NCYA 3VB4A 1QB9A 2P94A 4FUCA 4E05H 2BDYA 1ZPCA 1C1QA 1L4DA 2P95A 2PR3A 4ESTE 1ANBA 4NIXA 1LO6A 4NWLA 1D3QB 3RXLA 1O2GH 1FDPA 3UY9A 4LXBH 1BTHH 3QO6A 4ZAEA 2ZGCA 1TGSZ 4IC5A 1Y8TA 2GZ8A 2C90B 1YPKH 4B73A 3PTNA 3HGNA 2FEQH 4X2YA 2TBSA 4HTCH 4AGKA 5AF9H 4BAOB 1ANDA 5DP8A 5ESTE 1LPZB 2ZIQH 1V2NT 2OC8A 4JZDH 2P8OB 5AVDA 1GGDC 1UK2A 1DY8A 1FQ3A 3ZYDA 1F0SA 1SGYE 2V0BA 2ZHDA 3RXUA 2GMTC 1GJAB 3UNQA 2GT8A 1C5YB 1W3CA 2J9NA 3M7TA 4A5TS 1FONA 3FP8E 1TBQH 4DT7B 1XVOA 3SO3A 2DE8A 1BZXE 2VWOA 1Y3YA 3A7VA 1QJ7B 1DS2E 3I78A 4CHAB 4AB9A 1T4VH 2F83A 2G81E 3TITA 3ZV9A 5EXNA 2VH6A 2F91A 3V7TA 3NUMA 1GI5A 5EU8A 4NIYA 1GCTB 2PLXA 4DOQA 1NFYA 1ZMLA 2BQ7B 1E34B 1EJMA 1P12E 1SI5H 2PSXA 1SFQB 3LC5A 3ZVFA 2Y7ZA 3PMAB 1GL0E 1LDTT 3RXSA 3GOVB 3RM0H 3ZVEA 1ACBE 1O2UA 5DP9A 2QA9E 1SGFG 2A32A 3RU4E 1Z1IA 4RSPA 5T6FA 1G30B 1OP8A 4ABHA 1TMBH 1TGBA 2A45B 2CHAB 1K21H 1P11E 3PLKA 4VGCC 1ZJDA 2QIQA 3B9FH 5A0AE 1IQMA 3QGJA 1O3IA 3GCNA 3MO9A 4K1SA 3RM2H 4R8TB 2F9UA 3VB3A 2GZ9A 3F9FA 1THPB 2Y5HA 1TABE 2Y80A 1P2JA 2Z9GA 3M61U 2UUFB 5AFYH 1NM6A 3OTJE 5CE1A 1QR3E 2XCNA 3KNXA 2WPKS 5JPMH 2BDGA 3BEUA 4K1EA 2FESH 1IHTH 5SGAE 1KXDA 1CHOF 1CU1A 1GI2A 3ODDA 3VB7A 1HAIH 2BD5A 2JKHA 5AHGH 4GAWA 1O5DH 4FUFA 1BIOA 1P8VC 1LQDB 3U1IB 2WPIS 1YPMH 3GY2A 1ZHMA 5TCCA 4X2WA 1O34A 4DIIH 3MFJA 1RIWB 4CREA 5LPRA 2GDDA 2ZDVH 1GDNA 1P2MA 1F0RA 4U32A 1NU9A 1BTZA 3ATWA 1H9HE 1NRRH 3UIRA 1ESTA 4GCHF 1C5WB 1YBWA 4AFQA 3RXHA 3UQOA 3RXMA 1SHYA 3F9GA 4AZ2B 2JH0D 2I6SA 1DSUA 4D9RA 1KIGH 5DP3A 1HYLA 1UTJA 4X1NU 4OS1A 1TX6A 2HPPH 1UTLM 2SGFE 3FVFB 1UTKA 3S7KB 1P06A 5JBBS 4E7NA 1K9OE 1TNHA 1AKSB 3E3TA 4DG4A 3Q3KA 4ABBA 1WQSA 2AIQA 1K1PA 1V3XA 2CXVA 7GCHG 4OS4A 1H9IE 2BD2A 2P3FH 2VIQA 1QA7A 1ELBA 2WINI 4MLFB 2QGRA 2CJIA 3SHAH 1GVKB 1A4WH 3SBKA 1K1JA 1O2RA 2FTMA 2XWAA 7LPRA 1V2VT 2DE9A 3MU8A 1QQUA 1O2XA 1VJ9U 3V13A 1DOJA 1E35B 3BTDE 1FZZA 3GDVA 1BTYA 3OYPA 5F8TA 2ZC9H 3O8BA 3QUMP 4K3JA 1HAXB 1YCPM 3TU7H 2PV9B 4B2CA 1QHRB 1SLXB 4H6TA 2I6QA 1GMDG 1LVMA 1ELFA 3LPRA 4HGCA 1GJCB 3RMNH 3RLYH 1O3BA 4X2VA 3TLOA 1V2OT 1SLVB 4JYUH 1F5LA 1MTNB 3GY4A 1P10A 4GUXA 4UFEH 3IITA 4NZQA 2PUQH 4H4FA 1MZDA 3DT0H 1NN6A 3RU4D 1O2SA 1UHBB 2BVXH 4AB8A 1TRNA 1O0DH 3P8GA 3WY8A 2BVSH 1SHHB 1MBQA 1C1SA 2VH0A 1LTOA 1ANCA 2IN2A 3LH3A 1N8OB 1JXPA 2UWPA 4ZXYH 1OXGA 4Q7YA 4X2XA 1T8MA 4RKJB 1ORFA 2BB4A 3VGCC 3T29A 1QRWA 3KIDU 3JZ1B 4BAHB 5EQQA 1SGRE 3E0PB 5DP7A 1RJXB 1GHAF 3VFEA 3KEEA 5AFZH 3HPTB 4Q7ZA 3KL6A 4XOJA 1FPCH 1AB9C 5E0JA 2A2XH 4MPXA 4CRAA 1EOJA 1A3BH 1GHWH 1GI1A 3M35A 3OU0A 3NCLA 3U9AH 3SJIA 4WY3A 5CHAC 1Z1JA 3VEQB 1ZGVA 2A4OA 3RC4A
chains in the Genus database with same CATH superfamily
4D7GA 4M7GA 3ZVDA 1O2MA 2NU0E 1QL7A 1YKTA 3SUEA 2G5VA 1LPGB 3O8CA 3V0XA 2BDBA 4Y0ZE 1HPGA 1Z71A 1ZJKA 1SR5C 1ARCA 1O2TA 1XUGA 1OS8A 1Y5AT 1YLNA 1V2QT 4BXSA 3A7TA 3F9EA 5GDSH 2QF0A 4O97A 2UUYA 4WF8A 4OS5A 1UW7A 4UFDH 1GBCA 3SV8A 3ZV8A 2O8LA 5C3NA 3T2NA 1ABJH 2YNBA 1FY8E 3L33A 1ELCA 4OS7A 2RDEA 3A81A 4HG6A 2G5NA 1GMCG 2ZNKH 1CE5A 1C5ZB 4ABFA 1W8BH 2ZGHA 2VINA 2WV5A 3EA9A 1MD7A 1SG8B 1TA2A 1W11U 1BJVA 4WH8A 3SQEE 1C2KA 4NA9H 1INCA 2BD9A 1C4U2 1MTWA 2B0FA 4NA7A 1YPEH 1EZQA 1EUFA 1GHBG 1M9UA 1S0RA 1NT1A 2FI4E 4X8UH 3TJUA 4MTBA 3RXIA 2WYJA 3F0PA 3LKWA 4BTUB 3OE7D 5DG6A 1C1MA 4MNYA 5C94A 4FUBA 3D65E 5F03A 1O30A 1AZZA 5L2YH 1BDAA 2J2UA 1C1VH 1GI0A 4UE7H 2ZI2H 1AKSA 1TNGA 2JH6D 2C3SA 1BBRK 4X6MA 1S85A 2FPZA 4QT8C 1KXFA 4B6EA 4ZHMU 1NFWA 1V2MT 3ZZ7A 4KKDA 1MABB 1GI4A 1WCZA 5EODA 1O2QA 6ESTA 1MKXK 1QGFA 2ZP0H 5TCAA 2XTTB 4FU7A 3PWCA 1NS3A 2XRCA 4A6LA 3SZNA 2P8OC 3N7DA 1K0HA 4A1XA 2AGGX 2R9PA 3BIUH 5LH8A 5EW1H 1HRTH 1ZR0A 2H5DA 2ZPRA 2M2AA 3SNBA 3SZEA 2PKAB 2G00A 1ANEA 2BX4A 1IQIA 1DLKB 2GCHF 1S5SA 1CO7E 1ZOMA 4IC6A 1JRTA 2JH5D 4WXIA 2ZG0H 1LVBA 2SGEE 5GWZA 1C1PA 2XNIA 2FXRA 1O3OA 3A83A 4YM9A 1FPHH 2BTCE 3DSGA 2W3IA 1UHBA 2EEKA 3I29A 2IOTA 4ASUD 4XSKU 5F6MA 3SHCH 1GJ5H 4UONA 4U01A 4CHAC 4ZUHA 2FOCA 4NSYA 2FM2A 4YLUA 1IHSH 1V2WT 4ISOA 1RTLA 1K22H 2BHGA 3A86A 3BEFB 1GCTC 2M5TA 3RXCA 1QRZA 1CBWB 2J94A 3SU3A 2O8TA 1ETRH 3E0NB 3P6ZB 1OX1A 5F8XA 4H6SB 1ABIH 1O5FH 1IQFA 2BQ6B 2PHBA 2KCYA 1WTHD 2FOMB 4LZ4B 2C8XB 3BV9B 3NWUA 3UR6A 1FJSA 3KQEA 4AG2A 1T4UH 1BMAA 3TK5A 1IQKA 4TY7A 1CT4E 2CF8H 2WHXA 4GCHG 2F4LA 3GY7A 4AG1A 3Q77A 4JYVH 2CHAC 4M9FA 1F2SE 4ZCNA 2BY7X 1QL9A 1MAYA 3P17H 2OQUA 2W6JD 1YPJH 4P02A 2QAAA 1GVZA 2PP6A 2ZGJA 2QF3A 2THFB 3PRDA 4WXVA 1UJ1A 5A0BA 1W12U 6CHAB 5J4QA 3E1XB 3UB0A 2BY5X 1Z8IB 3ATLA 2GV7A 3RP2A 1GJ7B 4H42U 1T8LA 5IK2D 2ANYA 4DJZB 1N1LA 3QTVH 1EQ9A 2OXSA 2PUXB 3ZZCA 1HDTH 1HAPH 2F9PA 1SQTA 4K69A 2HVXA 1NRPH 1WU1A 3UTUH 3UR9A 1V2KT 5E2OA 4B1TA 1Q2WA 1G3DA 1P2IA 4ZXXH 2ANWA 1MCVA 2QXHA 5GCHG 3PTBA 1CGHA 1BMFD 1ZMNA 3VB6A 2FX4A 4AORA 1MU6B 1SLWB 1RIWC 3U8OH 1Q3XA 5JBTA 4ZROA 4U30A 2SGQE 3V12A 1F5RA 1LHCH 2FOAA 3LC3A 3MH7A 5JYIA 2OUAA 2WUBA 3DUXH 1SB1H 3UREA 3T28A 1TX8A 1C5XB 2Q6FA 4X1SU 4AOQA 2RG3A 1C2EA 1XXFA 5IYTA 2BLWA 1O2VA 1TIOA 2TGPZ 3RLWH 5DJ7A 1BRUP 1V2UT 1D3TB 3LJJA 1GBLA 1ID5H 2HLDD 2HOBA 1FMGA 1K2I1 2XC4A 1N6YA 2FOGA 3FOAA 3LGIA 3A7ZA 1O3GA 3SNAA 1BMMH 2ZDAH 2V6NA 1K1OA 1B7XB 4YOJA 4MNXA 4B6FA 4BANB 1T31A 4I8KA 2VIVA 4AFUA 4ZMAH 1P9UA 1QCPA 3FZDA 3E6PH 2KCPA 3I77A 5T6DA 3RMOH 3M3SA 1T32A 1QB1A 4KTCA 1YF4A 2V3HH 2PKAA 1VJAU 2VBCA 1BRBE 1ZGIA 5C2ZA 3ZVAA 1AWHB 1E36B 4I7YH 2JJ1D 5E0GA 2AERH 2AS9A 4ZHLU 5CMXH 2HNTF 4ZKNU 4ABJA 2Z6BD 2BLQA 2GZ7A 1AFQB 3GCTF 5KEDA 3B23B 2RFKC 5FL7D 2SGPE 2J98B 2BDCA 1AUTC 2EA3A 2R0KA 2P3UB 4AX9H 2GKVE 3LGTA 5EG4A 1MTNC 4CBNA 3UQVA 3QGNB 2C8YB 5KECA 1GBJA 1YCPH 2OQ5A 2Z9LA 4HI3A 1P0SH 3STJA 3HKJB 4NA8A 1IQJA 3Q00A 3DFLA 2P59A 1O3NA 3ZZDA 4AFZA 1NTPA 2WPHS 1V6DA 3A8CA 3M37A 1DLEA 2AMQA 4B2BA 3P92A 1PPGE 4P00A 5L2ZH 1RRKA 2FOHA 1N8OC 2Y5GA 3HGPA 1Z8GA 5BRRE 1EKBB 2C8WB 1H9LB 1ZYOA 5L6NH 2JETB 5EJZA 4TT3D 3PV2A 3JZ2B 1DY9A 4Q2KA 1OWIA 2FOEA 4BTIB 2FI5E 2EI6A 4I8GA 1ARBA 2C8ZB 1HV7A 1LCYA 1OWDA 2J92A 1GVLA 5DP4A 2FS8A 1HAVB 3EGKH 1JIMA 1G2MA 2W3KA 2IPHA 3KGPA 3OFND 1DPOA 4DGJA 1TQ7B 4CH8B 3TNSA 4Q63A 3MU5A 1YCPK 4FUDA 1UTOA 1YYY1 4RI0A 2F9BH 1WV7H 3BSQA 1KXAA 1DWCH 2FIRH 2JIZD 4A92A 1VITH 4E06H 1TMUH 3BTWE 1ZHRA 1BCUH 3IWMA 3OY5U 3U8RH 2OBQA 4AGJA 3BEIB 4D9QA 1IQEA 1RFNA 3RXEA 2TPIZ 3RDZA 3SOSA 2YNAA 1ELTA 4MNWA 1O38A 1Y3UA 2VGCB 1SGPE 2FI3E 1BTUA 1P3CA 2D2DA 3BG4B 4YOIA 2G4TA 1UVTH 2ALPA 6GCHG 1KDQB 2O8UA 4Y0YE 2HWLB 2ESTE 1VCPA 3LGVA 3OTPA 3FN8A 1P2OA 1ESAA 3W94A 1CA0B 5H4IB 3VG8A 8ESTE 4LK4A 3CNRA 3OY6U 1O37A 3LU9B 2A4GA 1FY5A 1QBOA 1MBMA 1Y3VA 2PKSB 4YLQH 1UTMA 1GMHF 1IQGA 3ELAH 3VXFH 1ELGA 2ZHWH 2QN5T 4Q7XA 4IN1A 1EPTB 5T6GA 5DSFA 1JWTA 1OKXA 4XBCA 1IQHA 8KME2 2ZQ2A 4NG9H 3ZZ8A 4FXGH 1B0EA 1Y59T 1PYTD 1SL3A 5E0HA 1QNJA 1GJ9B 3QZQA 3SJOA 3EA7A 2STBE 5A8XA 1O35A 4WMEA 1K1NA 4K8YA 2WV9A 1BQYA 1SGDE 1O33A 2D8WA 3UWIA 2WPJS 2ZU2A 2ZPQA 1JMOH 1KLJH 2ZFTA 3FAOA 1GG6B 3UNSA 2VIDA 1GDQA 4D8NA 3UUZA 8GCHF 1BA8B 1UK4A 3E91A 1EJAA 1QBNA 2GX4A 3KYFA 1THRH 1LKBA 1A1RA 4IMQA 2R2MB 3ZVCA 2ZECA 1O3EA 1HAHH 3DFJA 3ENSB 5JDUB 1HIAB 1ZTKA 4YESB 1EP6A 1FY1A 1KLIH 2R3UA 3BTQE 4FUEA 2ZCKP 2TRMA 1UTNA 4AN7A 5LPEA 2TGDA 2SGAA 2BXUH 1S6HA 3MHWU 5T3HA 4DURA 3PV5A 1LMWB 4WJG2 2J95A 5HM9A 1FIZA 2J98A 2ZFPH 3L6PA 4DY7B 4JZEH 4X1PU 2ZHEH 1H8IH 4NWKA 2WPLS 1L1GA 1SQAA 2EC9H 1GI7B 3ODFA 1NBME 2ZGXH 3AAVA 4R0IA 5ABWA 2HLCA 3K2UA 3K6YA 2RA3A 2ZU4A 3KQ5A 4Z0KA 1YM0A 5JB8S 4DIHH 1WSSH 1ELVA 3C1KA 2H9TH 1MU8B 2G55A 4YZUA 2NU2E 5JB9S 1H4WA 1SQOA 2OD3B 1A5IA 2BZAA 2OCVB 1S6FA 2P93A 1GI3A 3Q76A 2VIWA 2ZFSA 4I8JA 3SU4A 4UD9H 1NC6A 1S6LA 2R2WU 1A2CH 1SKYE 1CHGA 3NPSA 2XOKD 4YXWD 1SGEE 1T7CA 2YMSB 4IGDA 4MPVA 1W0KD 1SPJA 2AGEX 1CBWC 5EOKA 1RTFB 5A8YA 3GCOA 1PFXC 3H7TA 2L6OA 1G2LA 1NROH 1GHXH 1GWAA 1UVSH 4IMZA 1J9CH 1FAXA 1V2PT 2B7DH 4JYTA 1Z8JB 3PMBB 1HAVA 2BOHB 2ZGBH 1QZ8A 1TX7A 4Y8ZA 4D7FA 4OM9A 6LPRA 1RD3B 2Q6DA 1DXPA 4FU8A 3W1EA 2V3OH 1OWJA 1EXFA 1O2PA 1OP2A 2G51A 1RTKA 1W0ZU 5HIYA 2QF4A 1HAYB 4JZ1A 4FVBA 1TYNA 4MNVA 6CHAC 1GJBB 3UOUA 3MTYA 3PO1B 1SGIB 5IDKA 1AVXA 1HFDA 1FV9A 1MKWK 1KDQA 4KGAA 5DGJA 1OOKB 1C4Y2 4YT7H 1SGFA 2FX6A 1L4ZA 2FDAA 1TWXB 3FP7E 1A3EH 3SNDA 1YLDA 4X8TH 3SJ9A 2OC7A 1XM1A 4TWYA 2AH4X 3M3VA 1GI6A 4CH2B 4DW2U 5DP5A 1PYTC 5FHTA 2ZTYA 4RN6A 1MH0A 3O8RA 1O36A 2ZFRH 2BDIA 3SNEA 2HGTH 1L1NA 3F2FA 2XNDD 1J8AA 1P02A 1UK3A 5B6LA 2H5CA 3TK9A 1Y5BT 2GGVB 1DSTA 2J38A 3FZZA 2DUCA 1XKAC 3A82A 1C5NH 1BTXA 5FX5A 3U98H 1O5GH 3MQKC 1TNLA 1F5KU 3D49H 5HMAA 1C5OH 1TPPA 2HALA 1A0JA 4FOUC 1UCYK 3SUDA 1AIXH 1HUTH 3BTGE 1BBRH 5A0CA 1K1IA 3A80A 3G01A 1C2FA 1UTPA 4FVDA 2LPRA 3SN8A 1LVOA 1MKXH 1C2DA 1KTTB 1XX9A 1ZLRA 1H8HD 3RC5A 4I8LA 1KXCA 1C1OA 3MH4A 1WYKA 4NZLA 3FANA 2BYAX 1IQLA 2KFWA 3M5OA 2L74A 1O2IA 1HIAA 3O8DA 5DKMA 1AFEH 3A85A 4AYYB 2HNTE 3MU0A 1BB0B 2GT7A 2Z9JA 1L1JA 3A7XA 1VITF 1NBMD 3A8DA 1HAGE 3AK5A 2PFEA 4HZHA 5A09A 1BRAA 2ZFQH 1AGJA 3URDA 2XBWA 1HGTH 1JRSA 1UO6A 4XBDA 5CDFE 1VR1H 1L2EA 1C1NA 3ZZ6A 2AGIX 4J1YA 1ZSJA 1FN8A 3S7HB 1LHDH 1W2KH 2WSSD 1AFQC 5C5NA 3TK6A 2NWNA 3HKIB 3GCHB 1A0LA 4WWYA 3K65B 3EA8A 3MNCA 3U1JB 1AN1E 1O2NA 1VCQA 2VVVA 1YP9A 2WYGA 3L3TA 3SU2A 5EJ1A 1O5BB 1PPHE 1P2NA 2H9HA 2BD4A 4X8SH 2G8TA 1GI8B 2B5TB 1O2WA 2BY8X 1AE5A 1GBFA 3SUGA 3SV2H 4B2AA 4ABGA 4Y79A 7ESTE 1GMHG 1KXEA 1P04A 1HXFH 2RDLA 2H1UA 3SU0A 3E8LA 1V2ST 4E7RG 1CHOG 1NRSH 1TOCB 2GVFA 2V7QD 2XBYA 2CMYA 1ZTJA 4Q80A 2JETC 3QN7A 3C27B 1BMLA 2IJD1 1E37B 1TNJA 4BXWA 1VGCB 1GJ8B 3MNBA 5GPIB 1TFXA 5BPEA 4NFFA 1KSNA 4WMDA 1F7ZA 2UWLA 2H6MA 1O3LA 3TGJE 4XBBA 3MI4A 5FBIA 3KN2A 5FPYA 1LHEH 4NGAH 3SGBE 1WXRA 1AO5A 5G4BA 3LH1A 3UPEA 3GS9A 2O8MA 1J16A 1J15A 3U28C 1AU8A 1O2YA 1SSXA 3KYGA 4TPIZ 5FBEA 3KQCA 1BJUA 5F8ZA 2GDEH 5FPTA 3FP6E 1BOQA 2Q6GA 1MAXA 3MU4A 2XWBI 1UVOA 1V2RT 2UUKB 2PSYA 1KY9A 1TPAE 3TJOA 2CF9H 1GJ6A 1KLTA 3D62A 4ABDA 1WBGB 2KR7A 2A1DB 3BG4C 1SOZA 3A8AA 2SFAA 4INKA 4ZKRU 3E16B 1FXYA 5EXLA 2BZ6H 2ZU1A 1CA0C 1G37A 2VVUA 2XBVA 1DITH 3ATMA 3OSYA 3T26A 3SGQE 1W0YH 1D6WA 1C2IA 2Z3CA 2PKSC 4MPWA 3T25A 1O2HA 2BD3A 1HNEE 4MPUA 2LP6A 1O3MA 1HBTH 3QZRA 3TH2H 2ODQA 1A61H 3QLPH 3FO8D 1P57B 1SGQE 1NY22 5I25A 4CRDA 3F68H 3M36A 3OEHD 3SV7A 1TPSA 1ETTH 3PRBA 1GI9B 5JBAS 2PWXA 1F92A 1AI8H 1GBBA 1W7GH 1AY6H 2W26A 1TAWA 1G3BA 2D26C 3W95A 3AAUA 4ISIH 3R3GB 2A31A 3ZZBA 1DX5M 2OINA 1O3JA 2TIOA 4B75A 3ZZ5A 2ZA5A 7GCHF 3ZZ4A 3IG6B 1P05A 1NFXA 3NZIA 2J5UA 1OPHB 1C5RA 4FUHA 2FO9A 2GD4B 1Y3WA 1YC0A 2TGAA 1QFKH 1GG6C 1K1MA 4D76A 1TGNA 2WPMS 1TOMH 2ILNA 1B0FA 1DANH 3U69H 3EDXB 2ZDKA 3F2GA 3GICB 4OGXA 1XMNB 4O3TA 4O3UA 1UTQA 2ZWLH 4WVPE 1GMDF 1C5TA 1O3HA 3S9AA 1FUJA 1OSSA 3LONA 2A5IA 3MOCA 1E1QD 1X7AC 2FOFA 1WAYB 2ZKSA 4X6OA 3UWJH 1EP5A 1QRXA 1PQ7A 1NRNH 5HM2A 3SNCA 1EAIA 2PTNA 3QWCH 1DUEA 2ZU3A 1S83A 1O5AB 3S9CA 1GHAG 2A5KA 3LJOA 1YPLH 4X1RU 1ESBA 2O9QA 1O2LA 2FLRH 2SNWA 3KQDA 4B71A 1EJNA 4CBOA 1SFIA 2OC1A 1RGQA 1BUIA 1TPOA 2EI8A 1C5QA 1V2JT 3RXRA 3HK6B 4GLYA 1OYQA 1GBMA 2V3MA 1YGCH 4TWWA 2BY9X 3GYMA 1C4V2 3QX5H 4YOGA 1EZSC 3OAAD 1YPHE 4FUGA 7KMEH 5FPSA 1P09A 2VVCA 1JBUH 4BTTB 1GBKA 4ISLA 4YT6H 1QY6A 1JIRA 2SGDE 2Y81A 2VWNA 1NRQH 1C5SA 3MYWA 1B5GH 3LOXA 2TGTA 2VU8E 3BIVH 3T27A 4FU9A 1D9IA 2D1JA 3BTFE 4INHA 1ELEE 1BTPA 1YLCA 1XKBC 2QY0B 2EQNA 1EB1H 1C9TA 1PQAA 1TRYA 5DO4H 2ZF0H 5DK1A 4BNRA 1O32A 3RXVA 2VJ1A 4RT1A 2UWOA 3RXBA 3F9HA 1HB0B 2ODPA 1C2MA 2P3TB 1Y3XA 4JZIA 1GBIA 1QB6A 5DP6A 1D6RA 1O2KA 1O3DA 3S0NA 2A5AA 3PO1C 1DICA 1MQ5A 3PLPA 2LELA 1OWEA 4IS5A 1W10U 1ZHPA 1VCWA 5HKKD 2XC0A 1QQ4A 1VITG 3H7OA 3LGUA 2KM0A 1C2HA 1PPZA 1EASA 3CP7A 1K28D 2KAIB 1E1RD 1G36A 1TMTH 2H2ZA 3FFGA 1GMCF 3MMGA 1W0JD 5EQRA 2ZCHP 1ZTLA 4DCDA 2A0QB 4GVUA 5EIYA 1BRCE 1NU7B 5FX6A 2BD7A 4KELA 5F53A 2HNTC 5EQSA 2G52A 4X0WU 1RXPA 5ETXA 1GPZA 2A2QH 4XD7D 2BM2A 3KCGH 1GHBF 3A88A 3RXDA 4GSOA 1P2QA 1QBVH 3BTEE 2XXLA 2GTBA 3MU1A 1IOEA 3P95A 1SBWA 4Y11E 3T5FH 3RXQA 3K9XB 5EPYA 4MG3A 4O03A 1DM4B 1C5LH 4X6NA 1HXEH 1TBRH 1FIWA 1C5VA 4AFSA 1A5GH 3NRLA 2BMGB 2ZFFH 3BG8A 1EAWA 5GJ4B 1DXWA 4Y8YA 1TA6A 3ZVGA 1Y5UT 1WOFA 3RUOA 5EXMA 3SQHE 2W7UA 3CS0A 3RXOA 2B9LA 1TALA 4IW4E 5PTPA 1F0UA 2GCHG 1IAUA 3TJVA 1GHYH 1XUHA 4A1VA 3EQ0H 1FAKH 2BXTH 3PB1E 2VIOA 2AFQB 5HYOA 1ZSKA 5C20A 1QJ1B 2XW9A 1YPGH 4ABIA 1D3DB 1TNIA 1BTWA 1O5CB 3AW0A 3UAIC 4MQAA 1S81A 4RT0A 1O3PB 4O9VA 2ZDNA 1GBTA 2ZO3H 1C1UH 3GYLB 9ESTA 1P9SA 1TLDA 3UFAA 1KTSB 3LGWA 2ZCLP 5FCRA 1GBDA 3BTME 3TH4H 4CR5A 5DPAA 3F6UH 4BAQB 3TH3H 1BMNH 2FWWA 2KCOA 1U6QA 2UUJB 1ZSLA 2BY6X 3S69A 3QTOH 2Y6TA 5HGGA 3ZYEA 1MQ6A 2C4FH 1ZMJA 1TRMA 3MO6A 4MDSA 1LKAA 4CRBA 1HJAB 2QXGA 2QV1A 3P70B 1EB2A 3GCHC 2Z9KA 1SC8U 1NFUA 2CGAA 5EPNA 5C67A 1KMHB 3SI3H 2GCTB 3T62A 3VXEH 2Q1JA 1C1TA 2AIPA 1RS0A 2QF5A 3B8JA 5GIBA 1PQ8A 3SJKA 1FY3A 5C1XA 4OGYA 5E8EH 1WTGH 3P8FA 1O31A 3WWBA 1CGIE 1HCGA 3RXPA 4I8HA 3N7OA 1XUIA 3ATIA 3MWIU 2OC0A 4ZHAA 2FMJA 1ZRBA 1NESE 2QCYA 2WV4A 3GY3A 3ITIA 1N6XA 3KQBA 1BHXB 4LOYH 3STIA 5A8ZA 2AMDA 1SGNE 5E2PA 2Y82A 1C2LA 3V3MA 1VGCC 4Y71A 3NKKA 3ESTA 1AWFH 1HJ8A 1MKWH 2Z3EA 2QXIA 1C5PA 1Q31A 4XFQA 5A2MH 1LHFH 4PROA 4Q4LA 3VB5A 2FS9A 3A89A 3SV9A 3OX7U 1TB6H 1AHTH 2ZTXA 2ZTZA 2HRVA 2OLGA 2OBOA 1DWDH 2HVYB 2O8WA 4Z1MD 4TSFD 4U2WA 2STAE 3SW2B 2F9NA 3RU4T 2KAIA 2XC5A 2ZQ1A 2ODYB 1XUKA 5GCHF 4INLA 1EFRD 3VPKA 1AE8H 4ABEA 1UVUH 2W5EA 4K8BA 2V35A 5TJXA 1D4PB 2VB0A 4K1TA 1FI8A 2BDAA 3E90B 5CHBA 2YOLA 2BD8A 3A87A 3NK8A 4TPYA 5FCKA 1MCTA 2ALVA 1GHZA 1O3KA 4UFGH 1GBEA 1W14U 2NU4E 2BQWB 4KTUA 3ZZ9A 1MTUA 4YO9A 1GGDB 1P03A 4JZFH 3KHVA 3PYHA 1UCYH 4I32A 2GMTB 2OP9A 3GDUA 3RMMH 3CS7A 3M5MA 3K6ZA 1V2LT 2Z3DA 2A7HA 1EOLA 5ESBA 3LT3A 1ZZZA 1UVPA 5FAHA 2PGQB 1AVWA 2ZHQH 2FTLE 1J17T 1HJ9A 3BTKE 3PLBA 3PV4A 1CGJE 3LIWA 1MTVA 5C1YA 1Z6EA 3RXJA 1UMAH 2NU1E 5C5OA 4XE4A 4FUJA 4Y6DA 2H9EH 2WUCA 3SORA 3N99A 1P2KA 1AZ8A 1EPTA 3SI4H 3GCTG 4NSVA 1MTSA 4Y7AA 5T1VA 3F0OA 2ZZUH 1UCYE 1TQ0B 1PJPA 2Z7FE 3SGAE 3TVJB 3EYDA 1GJDB 9LPRA 3SV6A 3TJNA 5C1UA 4JCNA 4TY6A 2ZEBA 3MNSA 1CVWH 1GCDA 4X6PA 4IBLH 1CSOE 2FOBA 2CV3A 5C17A 1QL8A 2PW8H 1E38B 1H1BA 1P3EA 1A46H 4NIVA 2BLOA 4GHTA 1SGCA 2F9OA 1AUJA 1PQ5A 1C1WH 2F43B 3H5CB 1YPHC 4ZKSU 2VWMA 2XCFA 1O3AA 1ELAA 1WQVH 3MH5A 4ISHH 3SU1A 3A7WA 2VNTA 2PGBB 4VGCB 2LNCA 2OTVA 2ZPSA 1H8DH 4I31A 4CRCA 1C1RA 1MD8A 1EAUA 1W7XH 4NFEA 1QIXB 2Y7XA 3TPIZ 1A0HB 5EW2H 2GP9B 1QA0A 2BDHA 2GV6A 2FP7B 2Z9IA 4K60A 1C5MD 1O3CA 2AYWA 3P8NA 2A4QA 4AC9A 4A1TA 1BBRE 1KYNA 1Z6JH 4TYDA 1G32B 4DVAU 1EZUC 1XUFA 1E0FD 2XYAA 3UNRA 2F3CE 4HFPB 2CN0H 4B76A 2ANMH 3S9BA 1C5UA 1EZXC 3Q3YA 3RXGA 1TGCA 3PWBA 1S0QA 2G4UA 3GY5A 2RCEA 1T8NA 3PM3A 2R0LA 1TBZH 4F55A 5J4SA 3ZZ3A 5FXLA 1OWHA 1CT2E 2QYIA 3LGYA 2VIPA 5I46H 4X8VH 1GL1A 1S84A 2NU3E 1IQNA 4ZKOU 5K7RA 1ZPBA 4X1QU 2PTCE 1G3EA 1PPCE 1ZPZA 1FY4A 3QDZB 1LHGH 1P01A 1ETSH 1O39A 3RMLH 2ZHFH 2VWLA 3M3TA 1DVAH 3BTHE 1AVGH 3GISB 3M5LA 1NPMA 1S82A 2EY4C 1G9IE 1GDUA 2K8IA 5L30H 1LPKB 2A7JA 3TIUA 3DA9B 5GXPA 1E79D 1HAZB 1LVYA 3Q3XA 3DCLA 4I33A 4Y7BA 5LGOA 4GHQA 6GCHF 3RXFA 2IJOB 3TGKE 4OS2A 1AMHA 5LPFA 3AW1A 1C9PA 1TONA 4NIWA 4UDWH 1O5EH 2GJGA 3DSOA 2ULLA 2ANKH 3TNTA 1KXBA 2C93B 3GDSA 3QK1A 2YMSD 1Z8RA 4GPGA 2WZQA 1BITA 1SOTA 4MVNA 3DD2H 1C2GA 1PPEE 2K1QA 4CR9A 2ASUB 1J14A 1OYTH 5HXFA 1TE0A 1V2TT 3R0FA 4Z6AH 1EATA 2B8OH 1EAXA 1NO9H 3N7EA 4FUIA 2XBXA 2ZDLA 1FLEE 1YY3A 8GCHG 3ZIAD 1H8ED 1QURH 3EE0B 1WUNH 3P8OA 3F1SB 1DDJA 1O2JA 4F49A 1Z7KA 1OP0A 4JMYA 1F0TA 3TGIE 3AVZA 2VGCC 4Y8XA 2QXJA 1EX3A 1FNIA 3PMJA 2FYQA 3URCA 1O2OA 1D3PB 1THSH 2KZ4A 3MO3A 1XVMA 2AEIH 3RXKA 2BX3A 2R3YA 1GJ4H 3PMHB 1DUAA 2F9VA 3LDXH 5K0HA 1TNKA 1MZAA 1O2ZA 3GY6A 2HPQH 2KCAA 4BAKB 4B74A 3HATH 4AYVB 1DT2A 1QTFA 2J97A 1ZRKA 3M5NA 4ISNA 4ASHA 1EPTC 2A4RA 1XXDA 4I86A 3UOPA 1A7SA 4UFFH 1A5HA 1BHXF 4BAMB 2FZZA 4K2YA 5EGMA 1CQQA 1DWBH 4CRFA 4KP0A 3AASA 1PPBH 4WH6A 3SUFA 3KF2A 1XUJA 4KTSA 3U8TH 3VGCB 1HAOH 5C0TA 1GBHA 4A7IB 2BOKA 3RC6A 3SU5A 2ZDMA 2QE7D 3GY8A 1HLTH 5JBCS 2J34A 2AMPA 3RXAA 3A84A 3HK3B 3ZZAA 3MH6A 1CA8B 1OWKA 4K5ZA 1T8OA 1GBAA 4J2YB 3F2HA 2FODA 3A8BA 3DHKH 1AB9B 1MUEB 3M7QA 5B6OA 4Y76A 1BT7A 3PROA 2Y5FA 4SGBE 4THNH 1HJAC 3D23A 1C2JA 4Y10E 8LPRA 1VZQH 2BLVA 1K1LA 1GHVH 1G3CA 4LZ1H 2A7CA 5CHAB 4RKOB 1NZQH 3BF6H 2RA0A 3CENA 4OS6A 3ZVBA 3NXPA 1FN6A 1W13U 3WW7A 1TGTA 1AQ7A 4ABAA 1JOUB 1MMJN 2FLBH 2GCTC 1DFPA 1LQEA 1SLUB 4JK5A 4JK6A 4YTAA 4ZH8A 2SNVA 3SU6A 1O3FA 2W7SA 1SVPA 2Z94A 4BOHA 4WMFA 1WDIA 1OHHD 4CRGA 1DE7H 1AD8H 4IN2A 3ATKA 4SGAE 3DSPA 2BVRH 4UEHH 1ELDE 3RXTA 2QC2A 3M7UA 1L0ZA 3EAJA 3A7YA 3BTTE 3MNXA 1PPFE 1DWEH 3SJ8A 2J4IA 1SMFE 2OK5A 4XDEA 5EJLA 2EI7A 4F4OC 1CT0E 1SGTA 1QJ6B 2P16A 2ZU5A 3BN9A 2FYRA 4NCYA 3VB4A 1QB9A 2P94A 2YMSC 4FUCA 3WWFA 4E05H 2BDYA 1ZPCA 1C1QA 1L4DA 2P95A 2PR3A 4ESTE 1ANBA 4NIXA 1LO6A 4NWLA 1D3QB 3RXLA 1O2GH 1FDPA 3UY9A 1SQRA 3F3BA 4LXBH 1BTHH 1COWD 3QO6A 4ZAEA 2ZGCA 1TGSZ 4IC5A 1Y8TA 2GZ8A 2C90B 1YPKH 4B73A 4DT4A 3PTNA 3HGNA 2FEQH 4X2YA 2TBSA 4HTCH 4AGKA 5AF9H 4BAOB 1ANDA 5DP8A 5ESTE 1LPZB 2ZIQH 1V2NT 2OC8A 4JZDH 2P8OB 5AVDA 3SYJA 1GGDC 1UK2A 1DY8A 1FQ3A 2AHME 3ZYDA 1F0SA 1SGYE 2V0BA 2ZHDA 3RXUA 2GMTC 1GJAB 3UNQA 2GT8A 5C0UA 1C5YB 1W3CA 2JDID 2J9NA 3M7TA 4A5TS 1FONA 3FP8E 1TBQH 4DT7B 1XVOA 3SO3A 2DE8A 1BZXE 2VWOA 1Y3YA 3A7VA 1QJ7B 1DS2E 3I78A 4CHAB 4AB9A 1T4VH 2F83A 2G81E 3TITA 3ZV9A 5EXNA 2VH6A 2F91A 3V7TA 3NUMA 1GI5A 5EU8A 4NIYA 1GCTB 2PLXA 4DOQA 1NFYA 1ZMLA 2BQ7B 1E34B 1EJMA 1P12E 1SI5H 2PSXA 2WPDD 1SFQB 3LC5A 3ZVFA 2Y7ZA 3PMAB 1GL0E 1LDTT 3RXSA 3GOVB 3RM0H 3ZVEA 1ACBE 1O2UA 2KX4A 5DP9A 2QA9E 1SGFG 2A32A 3RU4E 1Z1IA 4RSPA 4F48B 5T6FA 1G30B 1OP8A 4ABHA 1TMBH 1TGBA 2A45B 2JJ2D 2CHAB 1K21H 1P11E 3PLKA 4VGCC 1ZJDA 2QIQA 3B9FH 5A0AE 1IQMA 3QGJA 1O3IA 3GCNA 3MO9A 4K1SA 3RM2H 4R8TB 2F9UA 3VB3A 2GZ9A 3F9FA 1THPB 2Y5HA 1TABE 2Y80A 1P2JA 2Z9GA 3M61U 2UUFB 4ACAA 5AFYH 1NM6A 3OTJE 5CE1A 1QR3E 2XCNA 3KNXA 2WPKS 5JPMH 2BDGA 3BEUA 4K1EA 2FESH 5KGOA 1IHTH 5SGAE 1KXDA 1CHOF 1CU1A 1GI2A 5GNDA 3ODDA 3VB7A 1HAIH 2BD5A 2JKHA 5AHGH 3H09A 4GAWA 1O5DH 4FUFA 1BIOA 1P8VC 1LQDB 4ACBA 3U1IB 2WPIS 1YPMH 2K0QA 3GY2A 1ZHMA 5TCCA 4X2WA 1O34A 4DIIH 3MFJA 1RIWB 4CREA 5LPRA 2GDDA 2ZDVH 1GDNA 1P2MA 1F0RA 5HIZA 4U32A 1NU9A 1BTZA 3ATWA 1H9HE 4FETA 1NRRH 3UIRA 1ESTA 4GCHF 1C5WB 1YBWA 4AFQA 3RXHA 3UQOA 3RXMA 1SHYA 3F9GA 4AZ2B 2JH0D 2I6SA 1DSUA 4D9RA 1KIGH 5DP3A 1HYLA 1UTJA 4X1NU 4OS1A 1TX6A 2HPPH 1UTLM 2SGFE 3FVFB 1UTKA 1VKYA 3S7KB 1P06A 5JBBS 2IPQX 4E7NA 1K9OE 1TNHA 1AKSB 3E3TA 4DG4A 3EE7A 3Q3KA 4ABBA 1WQSA 2AIQA 1K1PA 1V3XA 2CXVA 7GCHG 4OS4A 1H9IE 2BD2A 1YWUA 2P3FH 2VIQA 1QA7A 1ELBA 2WINI 4MLFB 2QGRA 2CJIA 3SHAH 1GVKB 1A4WH 3SBKA 1K1JA 1O2RA 2FTMA 2XWAA 7LPRA 1V2VT 2DE9A 3MU8A 1QQUA 1O2XA 1VJ9U 3V13A 1DOJA 1E35B 3BTDE 1FZZA 3GDVA 1BTYA 3OYPA 5F8TA 2ZC9H 3O8BA 3QUMP 4K3JA 1HAXB 1YCPM 3TU7H 2PV9B 2CK3D 4B2CA 1QHRB 1SLXB 4H6TA 2I6QA 1GMDG 1LVMA 1ELFA 3LPRA 4HGCA 1GJCB 3RMNH 3RLYH 1O3BA 4X2VA 3TLOA 1V2OT 1SLVB 4JYUH 1F5LA 1MTNB 3GY4A 1P10A 4GUXA 4UFEH 3IITA 4NZQA 2PUQH 4H4FA 1MZDA 3DT0H 1NN6A 3RU4D 1O2SA 1UHBB 3FKSD 2BVXH 4AB8A 1TRNA 1O0DH 3P8GA 3WY8A 1FX0B 2BVSH 1SHHB 1MBQA 1C1SA 2VH0A 1LTOA 1ANCA 2IN2A 3LH3A 4XRNA 1N8OB 5DN6D 1JXPA 2UWPA 4ZXYH 1OXGA 4Q7YA 4X2XA 1T8MA 4RKJB 1ORFA 2BB4A 3VGCC 3T29A 1QRWA 3KIDU 3JZ1B 4BAHB 5EQQA 1SGRE 3OEED 3E0PB 5DP7A 1RJXB 1GHAF 3VFEA 3KEEA 5AFZH 2W6ID 3HPTB 4Q7ZA 3KL6A 4XOJA 1FPCH 1AB9C 5E0JA 2A2XH 4MPXA 4CRAA 1EOJA 1A3BH 1GHWH 1GI1A 3M35A 3OU0A 3NCLA 3U9AH 3SJIA 4WY3A 5CHAC 1Z1JA 3VEQB 1ZGVA 2A4OA 3RC4A
chains in the Genus database with same CATH topology
4D7GA 4M7GA 3ZVDA 1O2MA 2NU0E 1QL7A 1YKTA 3SUEA 2G5VA 1LPGB 3O8CA 3V0XA 2BDBA 4Y0ZE 1HPGA 1Z71A 1ZJKA 1SR5C 1ARCA 1O2TA 1XUGA 1OS8A 1Y5AT 1V2QT 4BXSA 3A7TA 3F9EA 5GDSH 2QF0A 4O97A 2UUYA 4WF8A 4OS5A 4UFDH 1GBCA 3SV8A 3ZV8A 2O8LA 5C3NA 3T2NA 1ABJH 2YNBA 1FY8E 3L33A 1ELCA 4OS7A 3A81A 2G5NA 1GMCG 2ZNKH 1CE5A 1C5ZB 4ABFA 1W8BH 2ZGHA 2VINA 2WV5A 3EA9A 1MD7A 1SG8B 1TA2A 1W11U 1BJVA 4WH8A 3SQEE 1C2KA 4NA9H 1INCA 2BD9A 1C4U2 1MTWA 2B0FA 4NA7A 1YPEH 1EZQA 1EUFA 1GHBG 1M9UA 1S0RA 1NT1A 2FI4E 4X8UH 3TJUA 4MTBA 3RXIA 2WYJA 3LKWA 4BTUB 5DG6A 1C1MA 4MNYA 4FUBA 3D65E 5F03A 1O30A 1AZZA 5L2YH 1BDAA 2J2UA 1C1VH 1GI0A 4UE7H 2ZI2H 1AKSA 1TNGA 2JH6D 2C3SA 1BBRK 4X6MA 1S85A 2FPZA 4QT8C 1KXFA 4ZHMU 1NFWA 1V2MT 3ZZ7A 4KKDA 5EODA 1GI4A 1WCZA 1O2QA 6ESTA 1MKXK 1QGFA 2ZP0H 5TCAA 2XTTB 4FU7A 3PWCA 1NS3A 2XRCA 4A6LA 3SZNA 2P8OC 4A1XA 2AGGX 2R9PA 3BIUH 5LH8A 5EW1H 1HRTH 1ZR0A 2H5DA 2ZPRA 3SNBA 2PKAB 2G00A 1ANEA 2BX4A 1IQIA 1DLKB 2GCHF 1S5SA 1CO7E 1ZOMA 4IC6A 1JRTA 2JH5D 4WXIA 2ZG0H 1LVBA 2SGEE 5GWZA 1C1PA 2XNIA 2FXRA 1O3OA 3A83A 4YM9A 1FPHH 2BTCE 2W3IA 1UHBA 2EEKA 3I29A 2IOTA 4XSKU 5F6MA 3SHCH 1GJ5H 4UONA 4U01A 4CHAC 4ZUHA 2FOCA 4NSYA 2FM2A 4YLUA 1IHSH 1V2WT 4ISOA 1RTLA 1K22H 2BHGA 3A86A 3BEFB 1GCTC 2M5TA 3RXCA 1QRZA 1CBWB 2J94A 3SU3A 2O8TA 1ETRH 3E0NB 3P6ZB 1OX1A 5F8XA 4H6SB 1ABIH 1O5FH 1IQFA 2BQ6B 2PHBA 1WTHD 2FOMB 4LZ4B 2C8XB 3BV9B 3NWUA 3UR6A 1FJSA 3KQEA 4AG2A 1T4UH 1BMAA 3TK5A 1IQKA 4TY7A 1CT4E 2CF8H 4GCHG 3GY7A 4AG1A 3Q77A 4JYVH 2CHAC 1F2SE 2BY7X 1QL9A 1MAYA 3P17H 2OQUA 1YPJH 2QAAA 1GVZA 2ZGJA 2QF3A 2THFB 4WXVA 1UJ1A 5A0BA 1W12U 6CHAB 5J4QA 3E1XB 2BY5X 1Z8IB 3ATLA 2GV7A 3RP2A 1GJ7B 4H42U 1T8LA 2ANYA 4DJZB 1N1LA 3QTVH 1EQ9A 2OXSA 2PUXB 3ZZCA 1HDTH 1HAPH 2F9PA 1SQTA 4K69A 2HVXA 1NRPH 1WU1A 3UTUH 3UR9A 1V2KT 5E2OA 4B1TA 1Q2WA 1G3DA 1P2IA 4ZXXH 2ANWA 1MCVA 2QXHA 5GCHG 3PTBA 1CGHA 1ZMNA 3VB6A 2FX4A 4AORA 1MU6B 1SLWB 1RIWC 3U8OH 1Q3XA 5JBTA 4ZROA 4U30A 2SGQE 3V12A 1F5RA 1LHCH 2FOAA 3LC3A 3MH7A 5JYIA 2OUAA 2WUBA 3DUXH 1SB1H 3UREA 3T28A 1TX8A 1C5XB 2Q6FA 4X1SU 4AOQA 2RG3A 1C2EA 1XXFA 5IYTA 2BLWA 1O2VA 1TIOA 2TGPZ 3RLWH 5DJ7A 1BRUP 1V2UT 1D3TB 3LJJA 1GBLA 1ID5H 2HOBA 1FMGA 1K2I1 2XC4A 1N6YA 2FOGA 3LGIA 3A7ZA 1O3GA 3SNAA 1BMMH 2ZDAH 2V6NA 1K1OA 1B7XB 4YOJA 4MNXA 4BANB 1T31A 4I8KA 2VIVA 4AFUA 4ZMAH 1P9UA 1QCPA 3FZDA 3E6PH 3I77A 5T6DA 3RMOH 3M3SA 1T32A 1QB1A 4KTCA 1YF4A 2V3HH 2PKAA 1VJAU 1BRBE 1ZGIA 5C2ZA 3ZVAA 1AWHB 1E36B 4I7YH 5E0GA 2AERH 2AS9A 4ZHLU 5CMXH 2HNTF 4ZKNU 4ABJA 2Z6BD 2BLQA 2GZ7A 1AFQB 3GCTF 3B23B 2SGPE 2BDCA 1AUTC 2EA3A 2R0KA 2P3UB 4AX9H 2GKVE 3LGTA 5EG4A 1MTNC 4CBNA 3UQVA 3QGNB 2C8YB 1GBJA 1YCPH 2OQ5A 2Z9LA 4HI3A 1P0SH 3STJA 3HKJB 4NA8A 1IQJA 3Q00A 3DFLA 2P59A 1O3NA 3ZZDA 4AFZA 1NTPA 2WPHS 1V6DA 3A8CA 3M37A 1DLEA 2AMQA 4B2BA 3P92A 1PPGE 5L2ZH 1RRKA 2FOHA 1N8OC 2Y5GA 3HGPA 1Z8GA 5BRRE 1EKBB 2C8WB 1H9LB 1ZYOA 5L6NH 2JETB 3JZ2B 1DY9A 4Q2KA 1OWIA 2FOEA 4BTIB 2FI5E 2EI6A 4I8GA 1ARBA 2C8ZB 1HV7A 1LCYA 1OWDA 2J92A 1GVLA 5DP4A 2FS8A 1HAVB 3EGKH 1JIMA 1G2MA 2W3KA 2IPHA 3KGPA 1DPOA 4DGJA 1TQ7B 4CH8B 3TNSA 3MU5A 1YCPK 4FUDA 1UTOA 1YYY1 2F9BH 1WV7H 3BSQA 1KXAA 1DWCH 2FIRH 4A92A 1VITH 4E06H 1TMUH 3BTWE 1ZHRA 1BCUH 3IWMA 3OY5U 3U8RH 2OBQA 4AGJA 3BEIB 4D9QA 1IQEA 1RFNA 3RXEA 2TPIZ 3RDZA 3SOSA 2YNAA 1ELTA 4MNWA 1O38A 1Y3UA 2VGCB 1SGPE 2FI3E 1BTUA 1P3CA 2D2DA 3BG4B 4YOIA 2G4TA 1UVTH 2ALPA 6GCHG 1KDQB 2O8UA 4Y0YE 2HWLB 2ESTE 1VCPA 3LGVA 1P2OA 1ESAA 3W94A 1CA0B 5H4IB 8ESTE 4LK4A 3OY6U 1O37A 3LU9B 2A4GA 1FY5A 1QBOA 1MBMA 1Y3VA 2PKSB 4YLQH 1UTMA 1GMHF 1IQGA 3ELAH 3VXFH 1ELGA 2ZHWH 2QN5T 4Q7XA 4IN1A 1EPTB 5T6GA 1JWTA 1OKXA 4XBCA 1IQHA 8KME2 2ZQ2A 4NG9H 3ZZ8A 4FXGH 1B0EA 1Y59T 1PYTD 1SL3A 5E0HA 1QNJA 1GJ9B 3QZQA 3SJOA 3EA7A 2STBE 5A8XA 1O35A 4WMEA 1K1NA 4K8YA 1BQYA 1SGDE 1O33A 2D8WA 3UWIA 2WPJS 2ZU2A 2ZPQA 1JMOH 1KLJH 2ZFTA 3FAOA 1GG6B 3UNSA 2VIDA 1GDQA 4D8NA 3UUZA 8GCHF 1BA8B 1UK4A 3E91A 1EJAA 1QBNA 2GX4A 1THRH 1LKBA 1A1RA 4IMQA 2R2MB 3ZVCA 2ZECA 1O3EA 1HAHH 3DFJA 3ENSB 5JDUB 1HIAB 1ZTKA 4YESB 1EP6A 1FY1A 1KLIH 2R3UA 3BTQE 4FUEA 2ZCKP 2TRMA 1UTNA 4AN7A 5LPEA 2TGDA 2SGAA 2BXUH 1S6HA 3MHWU 5T3HA 4DURA 1LMWB 4WJG2 2J95A 5HM9A 1FIZA 2ZFPH 3L6PA 4DY7B 4JZEH 4X1PU 2ZHEH 1H8IH 4NWKA 2WPLS 1L1GA 1SQAA 2EC9H 1GI7B 3ODFA 2ZGXH 3AAVA 4R0IA 5ABWA 2HLCA 3K2UA 3K6YA 2RA3A 2ZU4A 4Z0KA 1YM0A 5JB8S 4DIHH 1WSSH 1ELVA 3C1KA 2H9TH 1MU8B 2G55A 4YZUA 2NU2E 5JB9S 1H4WA 1SQOA 2OCVB 1A5IA 2BZAA 2OD3B 1S6FA 2P93A 1GI3A 3Q76A 2VIWA 2ZFSA 4I8JA 3SU4A 4UD9H 1NC6A 2R2WU 1A2CH 1CHGA 3NPSA 1SGEE 1T7CA 4IGDA 4MPVA 1SPJA 2AGEX 1CBWC 5EOKA 1RTFB 5A8YA 3GCOA 1PFXC 3H7TA 1G2LA 1NROH 1GHXH 1GWAA 1UVSH 4IMZA 1J9CH 1FAXA 1V2PT 2B7DH 4JYTA 1Z8JB 3PMBB 1HAVA 2BOHB 2ZGBH 1TX7A 4Y8ZA 4D7FA 6LPRA 1RD3B 2Q6DA 1DXPA 4FU8A 2V3OH 1OWJA 1EXFA 1O2PA 1OP2A 2G51A 1RTKA 1W0ZU 1HAYB 4JZ1A 4FVBA 1TYNA 4MNVA 6CHAC 1GJBB 3UOUA 3MTYA 3PO1B 1SGIB 5IDKA 1AVXA 1HFDA 1FV9A 1MKWK 1KDQA 4KGAA 5DGJA 1OOKB 1C4Y2 4YT7H 1SGFA 2FX6A 1L4ZA 2FDAA 1TWXB 3FP7E 1A3EH 3SNDA 1YLDA 4X8TH 3SJ9A 2OC7A 1XM1A 4TWYA 2AH4X 3M3VA 1GI6A 4CH2B 4DW2U 5DP5A 1PYTC 5FHTA 2ZTYA 4RN6A 1MH0A 3O8RA 1O36A 2ZFRH 2BDIA 3SNEA 2HGTH 1L1NA 1J8AA 1P02A 1UK3A 2H5CA 3TK9A 1Y5BT 2GGVB 1DSTA 2J38A 3FZZA 2DUCA 1XKAC 3A82A 1C5NH 1BTXA 5FX5A 3U98H 1O5GH 1TNLA 1F5KU 3D49H 5HMAA 1C5OH 1TPPA 2HALA 1A0JA 1UCYK 3SUDA 1AIXH 1HUTH 3BTGE 1BBRH 5A0CA 1K1IA 3A80A 3G01A 1C2FA 1UTPA 4FVDA 2LPRA 3SN8A 1LVOA 1MKXH 1C2DA 1KTTB 1XX9A 1ZLRA 3RC5A 4I8LA 1KXCA 1C1OA 3MH4A 1WYKA 4NZLA 3FANA 2BYAX 1IQLA 3M5OA 1O2IA 1HIAA 3O8DA 5DKMA 1AFEH 3A85A 4AYYB 2HNTE 3MU0A 1BB0B 2GT7A 2Z9JA 1L1JA 3A7XA 1VITF 3A8DA 1HAGE 2PFEA 4HZHA 5A09A 1BRAA 2ZFQH 1AGJA 3URDA 2XBWA 1HGTH 1JRSA 1UO6A 4XBDA 1VR1H 1L2EA 1C1NA 3ZZ6A 2AGIX 4J1YA 1ZSJA 1FN8A 3S7HB 1LHDH 1W2KH 1AFQC 5C5NA 3TK6A 2NWNA 3HKIB 3GCHB 1A0LA 4WWYA 3K65B 3EA8A 3MNCA 3U1JB 1AN1E 1O2NA 1VCQA 2VVVA 1YP9A 2WYGA 3L3TA 3SU2A 1O5BB 1PPHE 1P2NA 2H9HA 2BD4A 4X8SH 2G8TA 1GI8B 2B5TB 1O2WA 2BY8X 1AE5A 1GBFA 3SUGA 3SV2H 4B2AA 4ABGA 4Y79A 7ESTE 1GMHG 1KXEA 1P04A 1HXFH 2RDLA 2H1UA 3SU0A 3E8LA 1V2ST 4E7RG 1CHOG 1NRSH 1TOCB 2GVFA 2XBYA 2CMYA 1ZTJA 4Q80A 2JETC 3QN7A 3C27B 1BMLA 4BXWA 1E37B 1TNJA 1VGCB 1GJ8B 3MNBA 5GPIB 1TFXA 5BPEA 4NFFA 1KSNA 4WMDA 1F7ZA 2UWLA 2H6MA 1O3LA 3TGJE 4XBBA 3MI4A 5FBIA 3KN2A 5FPYA 1LHEH 4NGAH 3SGBE 1AO5A 5G4BA 3LH1A 3UPEA 2O8MA 1J16A 1J15A 1AU8A 1O2YA 1SSXA 4TPIZ 5FBEA 3KQCA 1BJUA 5F8ZA 2GDEH 5FPTA 3FP6E 1BOQA 2Q6GA 1MAXA 3MU4A 2XWBI 1UVOA 1V2RT 2UUKB 2PSYA 1KY9A 1TPAE 3TJOA 2CF9H 1GJ6A 1KLTA 3D62A 4ABDA 1WBGB 2A1DB 3BG4C 1SOZA 3A8AA 2SFAA 4INKA 4ZKRU 3E16B 1FXYA 5EXLA 2BZ6H 2ZU1A 1CA0C 1G37A 2VVUA 2XBVA 1DITH 3ATMA 3OSYA 3T26A 3SGQE 1W0YH 1D6WA 1C2IA 2Z3CA 2PKSC 4MPWA 3T25A 1O2HA 2BD3A 1HNEE 4MPUA 1O3MA 1HBTH 3QZRA 3TH2H 2ODQA 1A61H 3QLPH 1P57B 1SGQE 1NY22 5I25A 4CRDA 3F68H 3M36A 3SV7A 1TPSA 1ETTH 1GI9B 5JBAS 2PWXA 1F92A 1AI8H 1GBBA 1W7GH 1AY6H 2W26A 1TAWA 1G3BA 2D26C 3W95A 3AAUA 4ISIH 3R3GB 2A31A 3ZZBA 1DX5M 2OINA 1O3JA 2TIOA 4B75A 3ZZ5A 2ZA5A 7GCHF 3ZZ4A 3IG6B 1P05A 1NFXA 3NZIA 1OPHB 1C5RA 4FUHA 2FO9A 2GD4B 1Y3WA 1YC0A 2TGAA 1QFKH 1GG6C 1K1MA 4D76A 1TGNA 2WPMS 1TOMH 2ILNA 1B0FA 1DANH 3U69H 3EDXB 2ZDKA 3GICB 4OGXA 1XMNB 4O3TA 4O3UA 1UTQA 2ZWLH 4WVPE 1GMDF 1C5TA 1O3HA 3S9AA 1FUJA 1OSSA 3LONA 2A5IA 3MOCA 1X7AC 2FOFA 1WAYB 2ZKSA 4X6OA 3UWJH 1EP5A 1QRXA 1PQ7A 1NRNH 5HM2A 3SNCA 1EAIA 2PTNA 3QWCH 1DUEA 2ZU3A 1S83A 1O5AB 3S9CA 1GHAG 2A5KA 3LJOA 1YPLH 4X1RU 1ESBA 2O9QA 1O2LA 2FLRH 2SNWA 3KQDA 4B71A 1EJNA 4CBOA 1SFIA 2OC1A 1RGQA 1BUIA 1TPOA 2EI8A 1C5QA 1V2JT 3RXRA 3HK6B 4GLYA 1OYQA 1GBMA 1YGCH 4TWWA 2BY9X 3GYMA 1C4V2 3QX5H 4YOGA 1EZSC 1YPHE 4FUGA 7KMEH 5FPSA 1P09A 2VVCA 1JBUH 4BTTB 1GBKA 4ISLA 4YT6H 1QY6A 1JIRA 2SGDE 2Y81A 2VWNA 1NRQH 1C5SA 3MYWA 1B5GH 3LOXA 2TGTA 2VU8E 3BIVH 3T27A 4FU9A 1D9IA 2D1JA 3BTFE 4INHA 1ELEE 1BTPA 1YLCA 1XKBC 2QY0B 1EB1H 1C9TA 1PQAA 1TRYA 5DO4H