3I29A

Crystal structure of a binary complex between an mutant trypsin inhibitor with bovine trypsin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of remote scaffolding residues in the inhibitory loop pre-organization, flexibility, rigidification and enzyme inhibition of serine protease inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i29A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i29A02
1O5GH 3KL6A 1G2LA 2BTCE 4MPUA 1QBNA 4Y6DA 1JXPA 4XBDA 1Y3XA 3GY3A 1RIWC 5DP7A 3U8TH 3VFEA 1GBKA 1SLXB 2AGGX 1WQVH 3LGWA 1GMHG 5HGGA 2BDYA 3LIWA 3LOXA 3U69H 4LZ1H 4NCYA 5DPAA 2UWOA 1CT2E 1AB9B 4GHQA 4FUIA 2ANKH 3NPSA 2O8WA 3HPTB 4FUHA 4Y8YA 1XX9A 1D4PB 2WUCA 1ZYOA 1BHXF 4YTAA 2GV7A 4D76A 5C2ZA 1BJUA 2Y81A 4E7NA 1S83A 1NFUA 2C8WB 3P70B 4TY6A 1BBRK 2FS8A 3E1XB 3QO6A 1F92A 3CP7A 4OGXA 1IQNA 2GTBA 1D6WA 1JBUH 1BTXA 1G3CA 3M5LA 2R0KA 2UUKB 1FUJA 1PPCE 1QA7A 3T27A 4YOJA 1QY6A 3DFLA 4ZXYH 3UUZA 3UWJH 2ESTE 1EJNA 4HGCA 1L1GA 2TPIZ 1GBBA 4INKA 4AOQA 1O3OA 4Q7ZA 3TGIE 4Q80A 3RXMA 2PKAB 2P3TB 1E34B 3E16B 2BDCA 5AFYH 3IITA 2JH5D 5H4IB 4B2CA 4I8HA 1P06A 2BDBA 1BQYA 8GCHF 2OC1A 4NA9H 1NPMA 1JOUB 2WPIS 4UFFH 3MNSA 5E2PA 4AB9A 3M61U 3KQDA 2Y7XA 5DP9A 1GG6B 1EAWA 1XUIA 2EEKA 7ESTE 4Y7AA 4UE7H 1GI3A 1O3GA 3TJNA 1O3EA 4TYDA 4H6SB 1KXDA 1ELAA 4RKJB 2A7JA 2PLXA 3BF6H 3B8JA 1S0RA 2AGIX 3AASA 1P2NA 1OP8A 2Z3CA 3PROA 2BB4A 3NKKA 2TGDA 5TJXA 1C4V2 4BNRA 1LPZB 1G30B 1QBOA 1LKAA 1ZJDA 3SN8A 2CJIA 1DXPA 4JZFH 1JIRA 1O2OA 1TRMA 2FP7B 2THFB 4RN6A 1KSNA 1NRRH 1C5TA 1O2GH 4ABHA 1C9PA 4NIYA 3SJIA 1FY8E 3SO3A 3UQVA 4ZHMU 2QA9E 1ZLRA 4IC6A 1F5LA 2HNTC 4LZ4B 2Z9GA 3SNBA 5I46H 2ULLA 2A7HA 2VIPA 1O3CA 1ABIH 1GHZA 1QL8A 3H7OA 4I31A 1GL1A 1TMUH 3ZVEA 3HATH 3PTNA 4FU8A 1E37B 3D23A 3QGNB 1EZSC 1UK2A 4B2BA 1OWJA 1TPSA 4RKOB 2VINA 2GKVE 1ARCA 3OYPA 1HB0B 1YC0A 1GCTB 1YLDA 2FLRH 1FPCH 3E8LA 2A4RA 4IC5A 4TPYA 2QXHA 3G01A 1YPEH 5LH8A 2Z9JA 2RA0A 1C2FA 4MNXA 1EOLA 1XUJA 3SHAH 5AVDA 1V2VT 3MU1A 4AB8A 4J1YA 3PMAB 4A92A 2ZDNA 1SOTA 3FP7E 3F9FA 2G8TA 8ESTE 1O34A 3BTWE 5FCRA 3MU8A 1PPFE 1QGFA 2V6NA 5F8ZA 1O2TA 3BG8A 4D7GA 1GJ6A 1BOQA 1B7XB 3VB3A 1O2LA 1P8VC 1SR5C 1HAYB 1UK3A 3BTKE 3RXSA 1AWFH 1O3PB 1UMAH 2ZPSA 4KTCA 1VGCC 1JRSA 3P95A 1O5AB 3PMJA 5F03A 1GI0A 2ZDMA 4TPIZ 4AFZA 2F83A 1GJ8B 5B6OA 2OQ5A 1NU9A 1O3MA 4ISHH 3RLYH 1W11U 2KAIB 2O8LA 1Z6EA 3ZV9A 1DLEA 4THNH 1MQ5A 2ALPA 2OBQA 1TQ7B 2W3KA 1VJ9U 1P2KA 1T8OA 3RXOA 5J4SA 1AFQC 3ZZCA 1TALA 3A7TA 2PGQB 2ZGXH 2TBSA 1Y3YA 4KKDA 1IQHA 2XC4A 2PWXA 5LPFA 4NZQA 4OGYA 1UVOA 2R0LA 1P3CA 3ZVFA 2XBWA 2Z9KA 1VCWA 2SNVA 4LXBH 3WY8A 4Y8XA 1AMHA 1S6FA 1UTKA 1DITH 1Z8GA 3EDXB 1KYNA 5LPRA 1CHGA 2GT7A 2FOBA 1FIZA 2VWMA 4X8VH 1MTVA 1TGBA 1K1NA 2WYJA 3PV4A 3IWMA 1EP6A 2Z9IA 4PROA 3UFAA 1BA8B 1P2IA 1V2QT 2DE8A 2F9UA 1ESTA 1UHBB 1FY5A 5GIBA 4FXGH 1TONA 4BAKB 1QRXA 1GBMA 1CGJE 3ATLA 2ZDKA 3ZV8A 3RXCA 2XBVA 1SLVB 1LHCH 4H42U 4D7FA 4UD9H 2QC2A 1KLJH 1V2MT 3GY7A 1OPHB 1C1RA 1MCVA 1K1MA 1P3EA 2C93B 3MI4A 4ISLA 4NZLA 3EQ0H 1RRKA 4XOJA 1FXYA 2A5KA 2QXIA 1GHBG 1Y3WA 2XBXA 3GCTF 2PUXB 1TBQH 2F9VA 3LKWA 3TVJB 1QL7A 1Q31A 2FOFA 3FANA 2A5IA 3ENSB 3K6YA 1XVOA 2VJ1A 1UVUH 3GICB 3RXKA 2UWPA 1ZGVA 1MUEB 4JK5A 2BM2A 1V2KT 3ZZ8A 1UCYH 1BTHH 1ELFA 4X8SH 4CRDA 1QURH 1GBJA 3SUFA 1MKWK 3ZZDA 3V12A 1QTFA 4WMFA 3P8NA 1CU1A 3M5MA 1GI4A 2FOEA 1NY22 5T3HA 2BX4A 2ZGHA 1MKWH 4D9QA 1TGSZ 3BN9A 1HRTH 1YPGH 3ZVAA 3BTTE 2NWNA 5F6MA 1O3HA 2Q1JA 2STAE 3PWCA 1TOMH 2CMYA 2D26C 1MZDA 3SI3H 3A89A 3P92A 1GJ5H 1HIAB 3U8OH 2ZZUH 5K7RA 1GHBF 1O2SA 2BD3A 2ILNA 3W94A 2BLQA 3SU4A 1C2GA 3STJA 5HYOA 2I6SA 1VR1H 2VH6A 4CH2B 2ZP0H 3Q00A 4ISNA 1L0ZA 3TGJE 1YPJH 1G37A 1QA0A 4CRGA 1P12E 2VWOA 1W3CA 2JKHA 4I33A 3M36A 1A7SA 2EI6A 2ZF0H 2HLCA 1F0RA 1TABE 3SU1A 3UNRA 4DJZB 1C2LA 4DY7B 1D3QB 5EU8A 1ZSKA 5HXFA 1OSSA 3ZVDA 1ANBA 3LH1A 1Z71A 2OC0A 1GGDC 1YGCH 1IQKA 4MNWA 2ANWA 1V2JT 3SU3A 1W0YH 2P8OC 1BTWA 1PPZA 5DGJA 3P8OA 5EXMA 1C2JA 2FOGA 2VWNA 4B73A 3TGKE 4SGBE 1AI8H 2AFQB 3SV6A 1T4VH 2ZNKH 3SJKA 4ASHA 1IQFA 1EJMA 5EG4A 1O3BA 1P04A 1U6QA 1B5GH 3RXQA 4A1VA 2AYWA 4AG2A 5F8XA 2QXGA 1EZQA 2FTLE 4NGAH 3QLPH 4Y11E 1GGDB 4A5TS 1FZZA 1VGCB 4HZHA 1FPHH 1UTQA 1GHAG 1MAXA 5ESBA 3S69A 2Y5GA 2A0QB 2BDIA 2IJOB 1Q3XA 1HCGA 4R8TB 2UWLA 2R3YA 4CREA 4LK4A 4DOQA 1ANDA 4YZUA 2FI3E 4YLUA 3K9XB 5F8TA 1LQDB 2BVXH 2P8OB 9ESTA 2O8MA 2F9BH 1GBTA 2BXTH 4XFQA 1ZHRA 3KN2A 1YP9A 2GDEH 2ZTYA 2H2ZA 1GDUA 1TX8A 3RXBA 1A46H 1Z8IB 1C4Y2 1C5VA 1A0JA 1SHYA 1V2TT 4WMDA 1LMWB 1GCDA 1O35A 1AWHB 1FNIA 2V0BA 3BG4B 3T29A 1HV7A 2J95A 3KCGH 2ZC9H 5IYTA 1WV7H 3RUOA 1C5MD 4ZHAA 1C5XB 1FN6A 4FUCA 1O32A 4DIIH 1ZRBA 1O36A 1OWDA 4IMZA 3SU5A 5HM9A 1AZ8A 2Y5HA 1QR3E 3GDSA 1GHXH 1XUGA 2R2MB 5E0JA 3GDUA 1C2HA 1YPHC 5EQRA 3EAJA 1CT4E 1MD8A 4ZKNU 2H1UA 2GP9B 4AFQA 4CHAB 1RS0A 2ZGJA 4CH8B 1S5SA 1O5BB 4GAWA 3I77A 2HNTF 1P2JA 4X2XA 4KELA 1O2VA 1OWEA 1GI5A 5FBEA 1O2YA 2FOCA 2PUQH 1P09A 3LGYA 3QWCH 1SGDE 4Q2KA 1AZZA 4FUEA 3BSQA 3RXVA 1IAUA 1C1NA 3E0NB 1NRPH 2ZDVH 3A8AA 1SOZA 2WPMS 1EPTC 2OXSA 3KHVA 3NK8A 2UUYA 2ALVA 3ZZ3A 1LKBA 3GISB 3NXPA 1GBHA 3AW1A 3AVZA 1O2UA 5AHGH 1C1WH 1Y59T 1GI8B 2WV4A 1G3EA 2Z6BD 1A5IA 4RSPA 1AFEH 1ELDE 1SQOA 3DFJA 2WINI 1INCA 3A7XA 4JZEH 3T2NA 3VB6A 1NS3A 4UDWH 1TFXA 2FOMB 1OP0A 1TRNA 2HRVA 5C20A 4WVPE 3QZQA 2XC5A 4X2YA 1MKXH 1SB1H 5A8XA 1E36B 4E7RG 1P0SH 4Z6AH 2BLVA 5A0AE 3EA7A 3LPRA 2KAIA 3PTBA 1CGHA 4FUGA 3UR9A 1T31A 1P9SA 1T4UH 1TWXB 5A0CA 2VGCC 1JWTA 2BLOA 2UUFB 1DUEA 3ZYEA 3F68H 4J2YB 2G4UA 3C1KA 3GY2A 2ANYA 1TNJA 3SJ8A 4AN7A 1ELTA 2BQ6B 1D9IA 1GJCB 3E91A 1GCTC 1BTPA 1M9UA 3BEUA 3SJ9A 2C8YB 1GMDF 2GCTB 4CBNA 4ZHLU 1VJAU 2ZHQH 4X2VA 1EX3A 1S85A 3FP8E 1ZGIA 3VXFH 1MKXK 5GPIB 1NRNH 1OWKA 3OSYA 2A31A 1TB6H 1EB2A 2ZFQH 4DG4A 2Z94A 2AIPA 3RMNH 1ZR0A 1ZMJA 1J15A 4GHTA 4GUXA 1AU8A 1BRCE 2FYQA 1KXCA 3LC3A 1O3IA 3PMHB 1SLWB 3MWIU 5DP8A 1ESBA 3L33A 3KGPA 5J4QA 3RLWH 3LONA 5ESTE 4A1TA 1SGTA 1O2RA 3TH2H 1EPTA 1C5NH 3ATIA 3MU0A 1ID5H 2BHGA 1RGQA 1Y3VA 2A7CA 1AKSB 5EXLA 2JH0D 5HMAA 1C5WB 2SGPE 5A8ZA 3P8FA 5FPSA 5LGOA 1O2ZA 2FODA 2OCVB 4YOIA 3SU6A 2CF9H 2FESH 2PKSB 1AN1E 4IS5A 1V2WT 4AG1A 3ATKA 3A7WA 2STBE 3ZYDA 1MBQA 1AFQB 1KXFA 1N8OC 4UFGH 1MU8B 3ZZAA 3DD2H 1UVSH 1ESAA 3FVFB 2QF3A 1O5FH 1Z6JH 1A3BH 4FVBA 1O2WA 4X0WU 3RXAA 4MPVA 3GCHC 2BMGB 1TNHA 4MDSA 2M5TA 4IN1A 1QL9A 3HKIB 1ELEE 2OINA 4NIWA 1V2OT 3LJJA 1ANEA 1ETRH 1FQ3A 2GD4B 2XXLA 2YNBA 1BTUA 2VVCA 1WTHD 6ESTA 3PO1B 1EZUC 3BTDE 1IQMA 3PWBA 2PTCE 4Y0ZE 1SGEE 4IGDA 3BV9B 3M3SA 2A4QA 1AB9C 3F9HA 3A86A 4BXWA 4ZUHA 3U9AH 3M7UA 1GVLA 3GYLB 4NWLA 5CHAC 4BAMB 2P3UB 4FU7A 4AGJA 1DWDH 4YT6H 5IDKA 5ABWA 4M7GA 2SNWA 3M37A 4O3UA 1NFYA 3DA9B 4BOHA 2ODPA 4A6LA 1AGJA 1F5RA 1N8OB 2OQUA 1GBFA 1KLIH 2Q6DA 2JETC 2GGVB 1GI2A 2ZHWH 2J9NA 1YKTA 1OKXA 1PJPA 4X1QU 3SNCA 1S82A 1DANH 1C5RA 4GLYA 4QT8C 2TGTA 5L2ZH 3A83A 1EQ9A 3LGVA 3TJVA 5C5NA 1ZSJA 2Y7ZA 3D65E 2ZU5A 3M7TA 3UNSA 2LPRA 3BEFB 1UCYE 4K3JA 4WMEA 2FOHA 3MNBA 3RXHA 2XTTB 3B23B 2FS9A 1DVAH 1GL0E 2Z3EA 1FJSA 1QJ1B 1IQIA 2ASUB 1EKBB 1C9TA 1T8NA 3SUGA 4ABFA 3UREA 1O37A 1QRZA 3FZZA 1ANCA 1NFXA 3KQEA 3T28A 1AVXA 2EI7A 1OWHA 3CENA 3TJUA 1PPEE 3HGPA 5EODA 2I6QA 1D3TB 5GWZA 4KTUA 5EQSA 4HI3A 1ORFA 1A61H 3RXIA 4GPGA 4AFUA 4Q7XA 3SJOA 1PYTD 3ODDA 3PLKA 2ZU4A 3URDA 2VU8E 3TJOA 3RU4E 3C27B 4DVAU 5A2MH 6GCHF 1C5SA 2XNIA 1FI8A 1HAXB 2O8TA 3BTGE 3KQCA 3L6PA 3TH3H 2ZQ2A 2H6MA 3SV8A 1HUTH 5JPMH 2PKSC 1PQAA 3STIA 1O0DH 1Y5UT 3ITIA 4MPWA 3FFGA 1THSH 3O8DA 3GYMA 4JZ1A 3RXDA 4BAOB 3PM3A 1QHRB 2QY0B 1W10U 3Q3KA 4CRAA 1NTPA 1SQTA 4ESTE 1CGIE 1AE8H 2YOLA 1DY8A 1H8IH 1JRTA 1KDQB 1LHDH 3FP6E 4BTUB 3NUMA 3RXPA 2JETB 4D9RA 3M7QA 3V3MA 5DP3A 3MH5A 1KXEA 2NU0E 1O2QA 1G3BA 2GX4A 1K28D 1LO6A 4IN2A 1FAXA 5A0BA 1A5HA 2HNTE 2AGEX 2XCNA 2PSXA 2PW8H 3ZZ9A 1C5OH 2AEIH 1ZPZA 2SGFE 1GJ9B 2BX3A 3FZDA 2BY8X 2ZPRA 3ATWA 3UNQA 1HIAA 4AGKA 1GBIA 4TWYA 3VGCB 2PKAA 2GMTB 4IBLH 4KTSA 4NSYA 2BD7A 3SZNA 3MHWU 1ETSH 2OLGA 3SGQE 5EXNA 6CHAB 5JBTA 1EOJA 2FI4E 2HGTH 3MMGA 1RFNA 3SU2A 4O9VA 1TA6A 2CF8H 2CV3A 3PLPA 4FVDA 2RG3A 1GBCA 1C1MA 2A2QH 2ZU3A 1LDTT 1W13U 8GCHG 4I8LA 5E0HA 1CBWC 2ZGCA 2LNCA 1D3DB 1Y8TA 1B0FA 1NROH 1C2DA 2ZIQH 4Y8ZA 2VH0A 1YM0A 3SNDA 3QZRA 3MNXA 2ZA5A 1O2XA 2AMDA 4O3TA 3LGTA 2W3IA 1K1LA 1VITG 2EC9H 1WCZA 1SGFG 3SNEA 1F0TA 1TQ0B 1FV9A 1O2HA 1ZRKA 3S0NA 2W7SA 4I32A 5EW1H 2O8UA 5GCHG 4HTCH 1ZMLA 2G51A 3O8BA 1C1SA 1GG6C 4WXIA 1G36A 2C3SA 1AVWA 1TE0A 1CBWB 4MG3A 1QQ4A 1ZOMA 1B0EA 1GJBB 1SBWA 2WYGA 2Q6GA 3K65B 5HM2A 3KF2A 2R2WU 3UPEA 2FYRA 1HAVA 4MQAA 2ZHDA 2NU3E 4YT7H 4U01A 2EI8A 2AMQA 5TCCA 4ABBA 4SGAE 4XSKU 1TNIA 1YCPM 3OY5U 4JZIA 3RC6A 1HJAC 4FUFA 4H6TA 2WV5A 3SQHE 3SOSA 5E2OA 1TX7A 3BIVH 2C4FH 1Z1JA 4UFDH 5DG6A 3TNSA 1BDAA 1WUNH 5FXLA 1G32B 4DT7B 3BTQE 3GCOA 1SGFA 1HXEH 1O2JA 3U98H 3T26A 1MZAA 1T7CA 4F4OC 6CHAC 3H5CB 1VITF 1YPKH 1CT0E 3RM2H 2XWBI 3MH6A 1WBGB 1EUFA 2J4IA 1ZJKA 1DWCH 1NFWA 3DHKH 3LC5A 1UVPA 4MNYA 4WF8A 2CHAC 1ZTKA 1O38A 5GCHF 2BOHB 1EAXA 1OS8A 3UQOA 1RIWB 1XKAC 3RMMH 4AYYB 2J34A 7GCHG 1ARBA 4JCNA 1WAYB 2HVXA 2BDAA 3P8GA 1FN8A 2C8XB 2RDLA 1DWEH 1BCUH 1W7GH 1G3DA 3LT3A 2ANMH 2BY9X 4X2WA 4AORA 3RC5A 3RXTA 1TOCB 1DM4B 1SHHB 1YYY1 1NT1A 1N6XA 2GV6A 1FMGA 3AAVA 4AYVB 2GCHF 4X6NA 3SGBE 2IOTA 4VGCB 1G2MA 3OY6U 3MO9A 2J38A 5DP5A 3A7VA 1BTZA 4Y76A 3TIUA 1DT2A 5FPYA 4WY3A 7KMEH 1GI9B 3GCNA 4BAQB 1TMTH 4K69A 2Z7FE 1HAZB 3T25A 3GDVA 4E06H 1TX6A 1IQLA 1AO5A 1GI7B 1FONA 2AERH 2P93A 1P02A 4OS5A 1J16A 2V3HH 1A0LA 1EAIA 1RJXB 5DK1A 1C2EA 1KLTA 2FTMA 2A4GA 4I8JA 3TH4H 4ABEA 4Y0YE 1P01A 3SHCH 2OP9A 1TMBH 1C5YB 2SGDE 3GY8A 2JH6D 4DCDA 1EAUA 2XBYA 4OS7A 2W5EA 3F6UH 1TYNA 1E35B 1RTLA 2YNAA 1AKSA 1L2EA 2BD4A 1W12U 4X1RU 4B71A 7GCHF 1FIWA 3K2UA 4BTTB 1BITA 4Y10E 1CA0B 1MTNB 1UJ1A 4JYTA 2BQ7B 2B7DH 4FU9A 2ZG0H 3TLOA 3RC4A 1TNGA 4OS2A 2ODYB 4R0IA 1BBRE 5FAHA 1A1RA 2G5NA 4JYVH 1FAKH 2B9LA 4MNVA 1O3AA 1GHWH 1V3XA 1ZHPA 4WWYA 2G55A 1OX1A 3RU4D 3PLBA 3ZZ4A 1HBTH 1DE7H 4X8TH 3SW2B 3K6ZA 2FOAA 2Y82A 1SFIA 1HAGE 1H4WA 2OC7A 2PFEA 2ZKSA 3V0XA 3ZZ7A 5JYIA 3BTEE 1SGYE 1GDQA 3ZVCA 1TRYA 2VNTA 3GOVB 1EXFA 4U30A 4ABDA 1HNEE 4GSOA 1ELBA 1MTSA 3S9CA 2ZO3H 4ABJA 1IHSH 1C1VH 4MPXA 1DXWA 5K0HA 2AIQA 1F0SA 1OXGA 3SV9A 1C1UH 4GCHF 5JBCS 5C1UA 3HK6B 5JB8S 1UVTH 4NIVA 1QB1A 2P95A 2XWAA 2Y6TA 2FDAA 3OTJE 4MLFB 3FAOA 1W0ZU 2BD8A 3ZZ5A 4YO9A 1YBWA 3A8DA 1RTFB 2BOKA 3DUXH 2QN5T 4NFFA 4I8GA 3BIUH 1BZXE 1MH0A 4YESB 3VB4A 1UTJA 4E05H 1BRUP 4CR5A 2BD9A 4HFPB 4YOGA 1BMNH 2HALA 3E0PB 1IQJA 2ZFTA 3VB7A 5FHTA 4NA7A 2F9PA 2ZDLA 4AFSA 3UTUH 4NIXA 2ZWLH 4K5ZA 1OP2A 2H9HA 3CS7A 2HOBA 1XUKA 2SFAA 2ZECA 1BJVA 6GCHG 1Y5BT 3I78A 1F2SE 1FY3A 3MO3A 3UOUA 5T6GA 3F1SB 1MQ6A 1H1BA 2G00A 2VIDA 3MNCA 3JZ1B 4X1SU 1O3LA 5CMXH 1OWIA 4B76A 1C2MA 4GCHG 2FIRH 1ZMNA 1AVGH 3F9GA 5T6DA 1TGNA 2ZHFH 1HYLA 1MTUA 1C5PA 2WPLS 2PTNA 1O5DH 3LU9B 1DDJA 5E8EH 3TU7H 3V7TA 1EP5A 1KTTB 1IQGA 1EASA 1TPOA 4XDEA 1ACBE 2AH4X 3RXEA 1VCPA 1C2KA 2W7UA 1OYQA 1V2LT 2PHBA 2WPHS 2ZTXA 5DP4A 5C5OA 3M3TA 2BZ6H 3SUEA 1L4DA 3T62A 3KNXA 2P94A 1TPPA 1ABJH 1VZQH 4BTIB 1HLTH 2B8OH 3UY9A 1IOEA 1T8MA 2SGEE 1V6DA 2GT8A 3LJOA 3MYWA 4FUBA 3MTYA 3LGUA 1SVPA 3QGJA 2OUAA 1BMLA 1EATA 1Z1IA 1V2PT 4CBOA 1X7AC 1HGTH 1BT7A 1P57B 5AF9H 1GMCG 2FWWA 2EA3A 1IQEA 1K1JA 1MCTA 1QJ7B 3ZZ6A 3LDXH 4UEHH 4B1TA 3BEIB 1UTLM 4ZH8A 3DT0H 4NA8A 1C5LH 2NU1E 1V2RT 4ZROA 2VIQA 2ODQA 1KIGH 1O5EH 1NRQH 1BRBE 1FDPA 1TGTA 2XRCA 1BHXB 2NU2E 2ZFPH 3H7TA 3D49H 3PMBB 3IG6B 2GVFA 1OOKB 4WH8A 1THPB 5BPEA 2UUJB 1DUAA 1BUIA 2P59A 1O3DA 2PSYA 5G4BA 1H9HE 2ZTZA 1T8LA 1W2KH 2WUBA 2RCEA 1QIXB 1C5QA 2BDHA 5DO4H 1DSTA 2GMTC 1L4ZA 1GJAB 2VIVA 3PB1E 2F9OA 3QTOH 1O3JA 1RXPA 4B75A 1GMDG 1WOFA 4MTBA 3EGKH 1O31A 3ATMA 5C1XA 2DUCA 5ETXA 2QYIA 2BYAX 4ISOA 1Y3UA 3SV2H 2VIWA 3ELAH 3BTHE 3MFJA 1VITH 3OU0A 1TNLA 2FEQH 1PQ7A 2W26A 3M35A 5EGMA 2QF0A 3NZIA 3LGIA 2OC8A 1HAVB 2IPHA 4DGJA 3SV7A 1XM1A 1NRSH 1H9IE 1P10A 1ELVA 5C3NA 1SSXA 3VPKA 3ZVGA 4DW2U 2A5AA 4INLA 2TRMA 3QX5H 3RMLH 1O33A 3UIRA 1S84A 5PTPA 3A85A 5L2YH 3GY6A 1O3NA 3SUDA 4A7IB 1EB1H 1SI5H 1NU7B 1RTKA 1WQSA 2QIQA 3U8RH 3Q76A 4OS6A 6LPRA 3TK6A 1LHEH 1MU6B 1T32A 1TA2A 2OD3B 3RU4T 3EE0B 1P11E 3A8CA 2B5TB 5FCKA 1ETTH 1NC6A 3S7KB 3TITA 5T6FA 2QXJA 3RXJA 3VXEH 4K8YA 5JB9S 1XUHA 1FY4A 2BZAA 2J2UA 3CS0A 2V3OH 1J9CH 1O39A 2A2XH 3A88A 3OX7U 1TLDA 1O3KA 1P2QA 1W14U 1DSUA 1XMNB 1K1IA 2XYAA 3SI4H 1EPTB 3SU0A 2J92A 4XBCA 5CHAB 1KY9A 2P3FH 2GZ7A 4UONA 2GDDA 2V35A 1NM6A 1JIMA 2AMPA 2BXUH 2FLBH 1XKBC 3GY5A 1NO9H 3M3VA 3TK5A 1QQUA 4U2WA 1S0QA 2HWLB 3M5OA 1ZTJA 1DPOA 2Y80A 5FPTA 2G4TA 1LTOA 2A4OA 1LVMA 4K8BA 4ZKOU 5JBAS 4WH6A 1MTWA 2G5VA 2ZCKP 3KQBA 1JMOH 3RP2A 1HAPH 1NN6A 1TNKA 1QCPA 3GCTG 4FUDA 1Y5AT 4ISIH 2FPZA 1SL3A 4Y79A 5I25A 3RXRA 2H5DA 1GI6A 1AQ7A 1D3PB 2ZGBH 3HGNA 1ZZZA 2A1DB 2B0FA 2BD2A 3MOCA 4NG9H 1YCPH 4CRBA 5C1YA 1C1QA 2CN0H 1A2CH 1K9OE 2ZPQA 5BRRE 3A8BA 3JZ2B 1KDQA 2OTVA 4O97A 2XC0A 1QB6A 1N1LA 1HAHH 3QTVH 4UFEH 4BAHB 5CE1A 4Q7YA 1GVKB 3MU5A 1O2KA 2G52A 4B74A 1A4WH 4Y7BA 1CQQA 3A80A 2D8WA 1SGIB 1LHFH 1A0HB 1OYTH 3R0FA 3B9FH 1C5UA 1C2IA 2BQWB 5EW2H 4GVUA 1L1JA 4Z0KA 3TNTA 1ZTLA 3Q3XA 1AIXH 1ELGA 4K1TA 1HJ8A 1MAYA 1S6HA 1PPHE 3KIDU 3ZZBA 1UHBA 1GI1A 3SGAE 4XE4A 5A8YA 9LPRA 1GBEA 4K1SA 1LPGB 2ZEBA 1J8AA 1GDNA 2G81E 2VGCB 1ZSLA 4JYUH 1SQAA 4ABIA 1O2NA 2GZ8A 3GCHB 4ZMAH 1LVYA 1DX5M 2VB0A 1PQ5A 2K1QA 4YLQH 4FUJA 5EQQA 5EOKA 1DOJA 1GJ7B 2BD5A 1H8DH 1K1PA 4DIHH 1XVMA 3ESTA 4D8NA 3NWUA 3F9EA 1HAIH 2C8ZB 1GBDA 3M5NA 3PO1C 1C1PA 1GJ4H 1C1OA 1H9LB 2DE9A 2F91A 8LPRA 1DFPA 1IHTH 2BY5X 1P2OA 4A1XA 1BMMH 1ZPBA 4TWWA 3W95A 2ZFFH 1XXDA 5GXPA 3S7HB 1YF4A 4MVNA 2D1JA 2A32A 2IN2A 1O3FA 2VWLA 2BVRH 8KME2 3U1IB 1TAWA 1RD3B 5JBBS 4BXSA 5TCAA 1XXFA 1YPLH 2Y5FA 1Z7KA 1EJAA 4ZXXH 4CRFA 4ABGA 1F5KU 3E3TA 2R9PA 1S81A 4H4FA 3UOPA 4AX9H 3AAUA 2XW9A 1GBLA 2ZCHP 1GJDB 1GPZA 2CGAA 2FO9A 4IMQA 4OS1A 2P16A 2J94A 3U1JB 1BBRH 1SFQB 3VB5A 1TPAE 2HPQH 4DURA 1UO6A 2FM2A 1O2PA 1SGRE 3P6ZB 4U32A 1THRH 5EPNA 1KXBA 1GHYH 2D2DA 5C67A 3P17H 3QDZB 4I8KA 3BTME 1PPGE 1C1TA 1GMHF 1NZQH 3SQEE 1P9UA 1YCPK 7LPRA 1AD8H 1AUJA 1HFDA 5LPEA 2QCYA 1HJAB 1MD7A 4NWKA 2F9NA 2PGBB 1QB9A 1HXFH 1CHOF 1QJ6B 5DKMA 1GHAF 5FBIA 3T5FH 3RXUA 1YPHE 1GHVH 3N7OA 1DS2E 3SNAA 4AZ2B 3EYDA 2NU4E 2VVUA 1LQEA 5L6NH 1YLCA 3ZVBA 2VVVA 4X6PA 4ZKRU 3RXFA 1N6YA 1Z8JB 2FZZA 1EZXC 5GDSH 1O2MA 1QRWA 3QN7A 4NSVA 3URCA 1C5ZB 2RA3A 4VGCC 1K2I1 2FX6A 4CHAC 1FLEE 2TIOA 4ZKSU 4X8UH 1W7XH 3ODFA 5EPYA 5A09A 2FXRA 5DP6A 1SGPE 2FMJA 1UTPA 1D6RA 3LH3A 4F49A 3QUMP 2QV1A 4K2YA 1P03A 1V2UT 2PR3A 5E0GA 3RMOH 1P05A 1SC8U 1ZPCA 1P2MA 3E6PH 1PFXC 4X6MA 3QK1A 4TY7A 2WPKS 2TGAA 4IW4E 2BLWA 1O30A 4X1NU 4LOYH 1A3EH 2O9QA 4WJG2 1AHTH 3A84A 3HKJB 1YPMH 1DWBH 1MBMA 1TBRH 3MH7A 1QBVH 2GCTC 1GWAA 2Z3DA 1K21H 2FI5E 2H5CA 4ZAEA 3S9AA 1PYTC 1ZHMA 2ZFSA 1K1OA 3AW0A 3VGCC 2R3UA 5GJ4B 2BY6X 1CA8B 1UK4A 2Q6FA 1DICA 1WSSH 4ABAA 1PPBH 3BTFE 1Q2WA 4XBBA 1SGNE 4OS4A 3TK9A 3UR6A 1TBZH 1O2IA 3A7ZA 3RDZA 3SBKA 2VIOA 3R3GB 2ZU2A 1BB0B 3RXLA 1XUFA 1UTNA 1CO7E 4Y71A 2QAAA 1E38B 4BANB 1J17T 3O8RA 5AFZH 3VEQB 3A7YA 1SPJA 3I29A 2GCHG 1UCYK 2C90B 3RXGA 2PV9B 1CA0C 1MTNC 5FX5A 3MO6A 2TGPZ 3D62A 4JZDH 1V2NT 3Q77A 2AS9A 3E90B 1GVZA 1ELCA 2FX4A 1AY6H 3SORA 4JMYA 1LVBA 1O5CB 1LVOA 4K1EA 1BRAA 4JK6A 1E0FD 1G9IE 2CHAB 4X1PU 1CE5A 1FY1A 3L3TA 1SGCA 3Q3YA 1TIOA 1CVWH 5DJ7A 3RM0H 4WXVA 1V2ST 1SLUB 4CR9A 4B2AA 3NCLA 1LCYA 3V13A 1VCQA 2GZ9A 1DLKB 2CXVA 2SGAA 1SGQE 1C4U2 1MMJN 3S9BA 1KTSB 4INHA 3HK3B 1W8BH 4I7YH 3GY4A 3EA9A 2ZU1A 2XCFA 1QFKH 2QGRA 3A81A 1HJ9A 1L1NA 2BVSH 3UWIA 2BY7X 5JDUB 1SG8B 1TGCA 1DY9A 4CRCA 1HPGA 1KXAA 1UTMA 2H9TH 3A82A 1F0UA 1WTGH 1Z8RA 2ZCLP 1QNJA 2ZQ1A 3TPIZ 2A45B 1LHGH 1F7ZA 3A87A 1WU1A 2ZI2H 1A5GH 4O03A 2Z9LA 1J14A 1LPKB 1UTOA 2ZFRH 2OBOA 4KGAA 3O8CA 2ZDAH 2BDGA 5L30H 3MH4A 4YM9A 1HAOH 3BG4C 4K60A 1AUTC 1CSOE 1NESE 1HDTH 4NFEA 1BTYA 3KEEA 2HPPH 2WPJS 1SMFE 3EA8A 4KP0A 5SGAE 2SGQE 1GMCF 3MU4A 3PYHA 1AE5A 1K22H 1GBAA 2H9EH 2ZHEH 1WYKA 1BMAA 1CHOG 1BIOA 4X6OA 5FX6A 2F3CE 1PQ8A
chains in the Genus database with same CATH superfamily
1O5GH 3KL6A 2EY4C 1G2LA 2BTCE 4MPUA 1QBNA 4Y6DA 1JXPA 4XBDA 1Y3XA 3GY3A 1RIWC 5DP7A 3U8TH 3VFEA 1GBKA 1SLXB 2AGGX 1WQVH 3LGWA 1GMHG 3UAIC 5HGGA 2WZQA 2BDYA 3LIWA 3LOXA 3U69H 4LZ1H 4NCYA 5DPAA 2UWOA 1CT2E 1AB9B 4GHQA 4FUIA 2ANKH 4ZCNA 3NPSA 2O8WA 3HPTB 4FUHA 4Y8YA 1XX9A 1D4PB 2WUCA 1ZYOA 1BHXF 3DCLA 4YTAA 2GV7A 4Q4LA 4D76A 5C2ZA 1BJUA 2Y81A 4E7NA 1S83A 1NFUA 2C8WB 3WWBA 3P70B 4TY6A 1BBRK 2FS8A 4ACBA 3E1XB 3QO6A 1F92A 3CP7A 4OGXA 1IQNA 2GTBA 1D6WA 1JBUH 2WV9A 1BTXA 1G3CA 3M5LA 2R0KA 2UUKB 1FUJA 1PPCE 1QA7A 3T27A 4YOJA 1QY6A 3DFLA 4ZXYH 3UUZA 3UWJH 2ESTE 1EJNA 4HGCA 1L1GA 2TPIZ 1GBBA 4INKA 2RFKC 4AOQA 1O3OA 4Q7ZA 1WXRA 3TGIE 3MQKC 4Q80A 3RXMA 2PKAB 2P3TB 2KCPA 1E34B 3E16B 2BDCA 5AFYH 3IITA 2JH5D 5H4IB 4B2CA 4I8HA 1P06A 2BDBA 1BQYA 8GCHF 2OC1A 4NA9H 1NPMA 1JOUB 2WPIS 4UFFH 3MNSA 5E2PA 4AB9A 3M61U 3KQDA 4P00A 2Y7XA 5DP9A 1GG6B 1EAWA 1XUIA 2EEKA 7ESTE 4Y7AA 4UE7H 1GI3A 1O3GA 3TJNA 1O3EA 4TYDA 4H6SB 1KXDA 1ELAA 4RKJB 2A7JA 2PLXA 3BF6H 3B8JA 1S0RA 2AGIX 3AASA 1P2NA 3WWFA 1OP8A 2Z3CA 3PROA 2BB4A 3NKKA 2TGDA 5TJXA 1C4V2 4BNRA 1LPZB 1G30B 4Z1MD 1QBOA 1LKAA 1ZJDA 3SN8A 2CJIA 1DXPA 4JZFH 1JIRA 1O2OA 1TRMA 2FP7B 2THFB 4RN6A 1KSNA 1NRRH 1C5TA 1O2GH 4ABHA 1C9PA 4NIYA 3SJIA 1FY8E 3SO3A 3UQVA 4ZHMU 2QA9E 1ZLRA 4IC6A 1F5LA 2HNTC 4LZ4B 2Z9GA 3SNBA 5I46H 2ULLA 2A7HA 2VIPA 1O3CA 1ABIH 1GHZA 1QL8A 3H7OA 4I31A 1GL1A 1TMUH 3ZVEA 3HATH 3PTNA 4FU8A 1K0HA 1E37B 3D23A 3QGNB 1EZSC 1UK2A 4B2BA 1OWJA 1TPSA 4RKOB 2VINA 2GKVE 1ARCA 3OYPA 1HB0B 3PRBA 1YC0A 1GCTB 1YLDA 2FLRH 1FPCH 3E8LA 2A4RA 4IC5A 4TPYA 2QXHA 3G01A 1VKYA 1YPEH 5LH8A 2Z9JA 2RA0A 1C2FA 4MNXA 1EOLA 1XUJA 3SHAH 5AVDA 1V2VT 3MU1A 4AB8A 4J1YA 3PMAB 4A92A 2ZDNA 1SOTA 3FP7E 3KYFA 5C0TA 3F9FA 2G8TA 8ESTE 1O34A 5KECA 3BTWE 5FCRA 3MU8A 1PPFE 1QGFA 2V6NA 5F8ZA 1O2TA 3BG8A 4D7GA 1GJ6A 1BOQA 1B7XB 3VB3A 1O2LA 1P8VC 1SR5C 1HAYB 1UK3A 3BTKE 3RXSA 1AWFH 1O3PB 1UMAH 2ZPSA 4KTCA 1VGCC 1JRSA 3P95A 1O5AB 3PMJA 5F03A 1GI0A 2ZDMA 4P02A 4TPIZ 4AFZA 4RT1A 2F83A 1GJ8B 5B6OA 2OQ5A 1NU9A 1O3MA 4ISHH 3RLYH 1W11U 2KAIB 2O8LA 1Z6EA 3ZV9A 1DLEA 4THNH 1MQ5A 2ALPA 2OBQA 1TQ7B 2W3KA 1VJ9U 1P2KA 1T8OA 3RXOA 5J4SA 1AFQC 3SYJA 3ZZCA 1TALA 3A7TA 2PGQB 2ZGXH 2TBSA 1Y3YA 4KKDA 1IQHA 2XC4A 2PWXA 5LPFA 4NZQA 4OGYA 1UVOA 2R0LA 1P3CA 3ZVFA 2XBWA 2Z9KA 1VCWA 2SNVA 4LXBH 3WY8A 4Y8XA 1AMHA 1S6FA 1UTKA 1DITH 1Z8GA 3EDXB 1KYNA 5LPRA 1CHGA 3PV2A 2GT7A 2FOBA 1FIZA 2VWMA 4X8VH 1MTVA 1TGBA 1K1NA 1NBME 2WYJA 3IWMA 1EP6A 2Z9IA 3PV4A 4PROA 3UFAA 1BA8B 1P2IA 1V2QT 2DE8A 2F9UA 1ESTA 1UHBB 1FY5A 5GIBA 4FXGH 4Q63A 2XOKD 1TONA 4BAKB 1QRXA 1GBMA 1CGJE 3ATLA 2ZDKA 3ZV8A 3RXCA 2XBVA 1SLVB 1LHCH 4H42U 4D7FA 4UD9H 2QC2A 1KLJH 1V2MT 3GY7A 1OPHB 1C1RA 1MCVA 1K1MA 1P3EA 2C93B 3MI4A 4ISLA 4NZLA 3EQ0H 1RRKA 2EQNA 4XOJA 1FXYA 2A5KA 2QXIA 1GHBG 1Y3WA 2XBXA 3GCTF 2PUXB 1TBQH 2F9VA 3LKWA 3TVJB 1QL7A 1Q31A 2FOFA 3FANA 2A5IA 3ENSB 3K6YA 5EJZA 1XVOA 2VJ1A 1UVUH 3GICB 3RXKA 2UWPA 1ZGVA 1MUEB 4JK5A 2BM2A 1V2KT 3ZZ8A 1UCYH 1BTHH 1ELFA 1YLNA 4X8SH 5HIYA 4CRDA 1QURH 1GBJA 3SUFA 1MKWK 3ZZDA 3V12A 1QTFA 4WMFA 3P8NA 1CU1A 3M5MA 1GI4A 2FOEA 1NY22 5T3HA 2BX4A 2ZGHA 1MKWH 4D9QA 1TGSZ 3BN9A 1HRTH 1YPGH 3ZVAA 3BTTE 2NWNA 5F6MA 1O3HA 3GS9A 2Q1JA 2STAE 3PWCA 1TOMH 3OAAD 2CMYA 2D26C 1MZDA 3SI3H 3A89A 3P92A 1GJ5H 1HIAB 3U8OH 2ZZUH 5K7RA 1GHBF 1O2SA 2BD3A 2ILNA 3W94A 2BLQA 3SU4A 1C2GA 3STJA 5HYOA 2I6SA 1VR1H 2VH6A 4CH2B 5EJLA 2ZP0H 3Q00A 4ISNA 1L0ZA 3TGJE 1YPJH 1G37A 1QA0A 4CRGA 1P12E 2VWOA 1W3CA 2V7QD 2JKHA 4I33A 3M36A 1A7SA 2EI6A 2ZF0H 2HLCA 1F0RA 1TABE 3SU1A 3UNRA 3N99A 4DJZB 1C2LA 4DY7B 1D3QB 5EU8A 1ZSKA 5HXFA 1OSSA 3ZVDA 1ANBA 3LH1A 1Z71A 5GNDA 2OC0A 1GGDC 1YGCH 1IQKA 4MNWA 2ANWA 1V2JT 3SU3A 1W0YH 4XRNA 2P8OC 1BTWA 1PPZA 5DGJA 3P8OA 5EXMA 1C2JA 2FOGA 2VWNA 3KYGA 4B73A 3TGKE 4SGBE 1AI8H 5CHBA 2AFQB 3SV6A 1WDIA 1T4VH 2ZNKH 3SJKA 4ASHA 1IQFA 4OM9A 5T1VA 1EJMA 5EG4A 1O3BA 1P04A 1U6QA 1B5GH 3RXQA 4A1VA 2AYWA 4AG2A 5F8XA 2QXGA 1EZQA 2FTLE 4NGAH 3QLPH 4Y11E 1GGDB 4A5TS 1FZZA 1VGCB 4HZHA 4TSFD 1FPHH 1UTQA 1GHAG 1MAXA 3EE7A 5ESBA 3S69A 2Y5GA 2A0QB 2BDIA 2IJOB 1Q3XA 1HCGA 4R8TB 2UWLA 2R3YA 4CREA 4LK4A 3OE7D 4DOQA 1ANDA 3CNRA 4YZUA 2FI3E 4YLUA 5C17A 3K9XB 5F8TA 1LQDB 2BVXH 2P8OB 9ESTA 2O8MA 2F9BH 1GBTA 2BXTH 4XFQA 1ZHRA 3KN2A 4XD7D 1H8ED 3H09A 3WW7A 1YP9A 2GDEH 2ZTYA 3F2FA 2H2ZA 1GDUA 1TX8A 3RXBA 1A46H 1Z8IB 1C4Y2 1C5VA 1A0JA 1SHYA 1V2TT 4WMDA 1LMWB 1GCDA 1O35A 1AWHB 1FNIA 2V0BA 3BG4B 3T29A 1HV7A 2J95A 3KCGH 2ZC9H 5IYTA 5F53A 1WV7H 2KCAA 3RUOA 1C5MD 4ZHAA 1C5XB 1FN6A 4FUCA 1O32A 4DIIH 1ZRBA 1O36A 1OWDA 4IMZA 3SU5A 5HM9A 1AZ8A 2Y5HA 1QR3E 3GDSA 1GHXH 1XUGA 2R2MB 5E0JA 3GDUA 1C2HA 1YPHC 2M2AA 5EQRA 3EAJA 1CT4E 1MD8A 4ZKNU 2H1UA 2GP9B 4AFQA 4CHAB 1RS0A 2ZGJA 4CH8B 1S5SA 1O5BB 4GAWA 3I77A 2HNTF 1P2JA 4X2XA 4KELA 1O2VA 1OWEA 1GI5A 5FBEA 1UW7A 1O2YA 2FOCA 2PUQH 1P09A 3LGYA 3QWCH 3ZIAD 1SGDE 4Q2KA 1AZZA 4FUEA 3BSQA 3RXVA 1IAUA 1C1NA 3E0NB 3F0PA 1NRPH 2ZDVH 3A8AA 1SOZA 2WPMS 1EPTC 2WHXA 2OXSA 3KHVA 3NK8A 2UUYA 2ALVA 3ZZ3A 1LKBA 3GISB 3NXPA 1GBHA 3AW1A 3AVZA 1O2UA 5AHGH 1C1WH 1Y59T 1GI8B 2WV4A 1G3EA 2Z6BD 1A5IA 4RSPA 1AFEH 1ELDE 1SQOA 3DFJA 2WINI 1INCA 3A7XA 4JZEH 3T2NA 3VB6A 1NS3A 4UDWH 1TFXA 4YXWD 2FOMB 1OP0A 1TRNA 3F0OA 2HRVA 5C20A 4WVPE 2WSSD 3QZQA 2XC5A 4X2YA 1MKXH 1SB1H 5A8XA 1E36B 2V3MA 4E7RG 1P0SH 4Z6AH 2BLVA 5A0AE 3EA7A 3LPRA 2KAIA 3PTBA 1CGHA 4FUGA 3UR9A 1T31A 1P9SA 1T4UH 1TWXB 5A0CA 2VGCC 5EJ1A 1JWTA 2BLOA 2UUFB 1DUEA 3ZYEA 3F68H 4J2YB 2G4UA 3C1KA 3GY2A 2ANYA 1TNJA 3SJ8A 4AN7A 1ELTA 2BQ6B 1D9IA 1GJCB 3E91A 2YMSB 1GCTC 1BTPA 1M9UA 3BEUA 3SJ9A 2C8YB 1GMDF 2GCTB 4CBNA 4ZHLU 1VJAU 2ZHQH 4X2VA 1EX3A 1S85A 3FP8E 1ZGIA 3VXFH 1MKXK 5GPIB 1YY3A 2J97A 1NRNH 1OWKA 3OSYA 2A31A 1TB6H 1EB2A 2ZFQH 3U28C 4DG4A 2Z94A 2AIPA 3RMNH 1ZR0A 1ZMJA 1J15A 4GHTA 4GUXA 1AU8A 1BRCE 2FYQA 1KXCA 3LC3A 1QZ8A 1O3IA 3PMHB 1SLWB 3MWIU 5DP8A 1ESBA 3L33A 3KGPA 5J4QA 3RLWH 3LONA 5ESTE 4A1TA 2RDEA 1SGTA 1O2RA 3TH2H 1EPTA 1C5NH 3ATIA 3MU0A 1ID5H 2BHGA 1RGQA 1Y3VA 2A7CA 1AKSB 5EXLA 2JH0D 5HMAA 1C5WB 2SGPE 5A8ZA 3P8FA 5FPSA 4DT4A 5LGOA 1YWUA 1O2ZA 2FODA 2OCVB 4YOIA 3SU6A 2CF9H 2FESH 2PKSB 1AN1E 4IS5A 1V2WT 4AG1A 3ATKA 3A7WA 2KCYA 2STBE 3ZYDA 1MBQA 2YMSD 1AFQB 1KXFA 1N8OC 4UFGH 1MU8B 3ZZAA 3DD2H 1UVSH 1ESAA 3FVFB 2QF3A 1O5FH 1Z6JH 1A3BH 4FVBA 1O2WA 4X0WU 3RXAA 4MPVA 3GCHC 2BMGB 1TNHA 4MDSA 2M5TA 4IN1A 1QL9A 2JJ2D 1ELEE 2OINA 3HKIB 4NIWA 1V2OT 3LJJA 1ANEA 1ETRH 1FQ3A 2GD4B 3FO8D 2XXLA 2YNBA 1BTUA 2VVCA 1E1RD 1WTHD 6ESTA 3PO1B 1EZUC 3BTDE 1IQMA 3PWBA 2PTCE 4Y0ZE 1SGEE 4IGDA 3BV9B 3M3SA 2A4QA 1AB9C 3F9HA 3A86A 4BXWA 4ZUHA 3U9AH 2PP6A 3M7UA 1GVLA 3GYLB 4NWLA 5CHAC 4BAMB 2P3UB 4FU7A 4AGJA 1DWDH 4YT6H 5IDKA 5ABWA 4M7GA 2SNWA 3M37A 4O3UA 5DSFA 1NFYA 3DA9B 4BOHA 2ODPA 4A6LA 1AGJA 1F5RA 2K0QA 1N8OB 2OQUA 1GBFA 1KLIH 4ASUD 2Q6DA 2JETC 2GGVB 1GI2A 2ZHWH 2J9NA 2KZ4A 1YKTA 4F55A 1OKXA 1PJPA 4X1QU 3SNCA 1S82A 1DANH 1C5RA 4GLYA 4QT8C 2TGTA 5L2ZH 3A83A 1EQ9A 3LGVA 3TJVA 5C5NA 1ZSJA 2Y7ZA 3D65E 2ZU5A 3M7TA 3UNSA 2LPRA 3BEFB 1UCYE 4K3JA 4WMEA 2FOHA 3MNBA 3RXHA 2XTTB 3B23B 2FS9A 1DVAH 1GL0E 2Z3EA 1FJSA 1QJ1B 1IQIA 2ASUB 1EKBB 1C9TA 1T8NA 3SUGA 4ABFA 3UREA 1O37A 1QRZA 3FZZA 1ANCA 1NFXA 3KQEA 3T28A 1AVXA 2EI7A 2L74A 1OWHA 3CENA 3TJUA 1PPEE 3HGPA 5EODA 2I6QA 1D3TB 5GWZA 4KTUA 5EQSA 4HI3A 1ORFA 1A61H 3RXIA 4GPGA 4AFUA 4Q7XA 3SJOA 1PYTD 3ODDA 3PLKA 2ZU4A 3URDA 2VU8E 3TJOA 3RU4E 3C27B 4DVAU 5A2MH 6GCHF 1C5SA 2XNIA 1FI8A 1HAXB 2O8TA 3BTGE 3KQCA 3L6PA 3TH3H 2ZQ2A 2H6MA 3SV8A 1HUTH 5JPMH 2PKSC 1PQAA 3STIA 1O0DH 1Y5UT 3ITIA 4MPWA 3FFGA 1THSH 2OK5A 3O8DA 3GYMA 4JZ1A 3RXDA 4BAOB 3PM3A 1QHRB 2QY0B 1W10U 3Q3KA 5KGOA 4CRAA 4I86A 1NTPA 1SQTA 4ESTE 1CGIE 1AE8H 2KCOA 2YOLA 1DY8A 1H8IH 1JRTA 1KDQB 1LHDH 3FP6E 4BTUB 3NUMA 3RXPA 2JETB 4D9RA 3M7QA 3V3MA 5DP3A 3MH5A 1KXEA 2NU0E 1O2QA 1NBMD 1G3BA 2GX4A 1K28D 1LO6A 2QF5A 4IN2A 1FAXA 5A0BA 1A5HA 2HNTE 2AGEX 2PW8H 2PSXA 2XCNA 3ZZ9A 1C5OH 2AEIH 1ZPZA 2SGFE 1GJ9B 2BX3A 3FZDA 2BY8X 2ZPRA 3ATWA 2HLDD 3UNQA 1HIAA 4AGKA 2J98B 1GBIA 4TWYA 3VGCB 2PKAA 2GMTB 4IBLH 4KTSA 4NSYA 2BD7A 3SZNA 3MHWU 1ETSH 2OLGA 3SGQE 5EXNA 6CHAB 5JBTA 1EOJA 2FI4E 2HGTH 3MMGA 1RFNA 3SU2A 2LELA 4O9VA 1TA6A 2CF8H 2CV3A 3PLPA 4FVDA 2RG3A 1GBCA 1C1MA 2A2QH 2ZU3A 1LDTT 1W13U 8GCHG 4I8LA 5E0HA 1CBWC 2ZGCA 2LNCA 1D3DB 1Y8TA 1B0FA 1NROH 1C2DA 2ZIQH 4Y8ZA 2VH0A 1YM0A 3SNDA 3QZRA 3MNXA 2ZA5A 1O2XA 2AMDA 4O3TA 3LGTA 2W3IA 1K1LA 1VITG 2EC9H 1WCZA 1SGFG 1SKYE 3SNEA 1F0TA 1TQ0B 1FV9A 1O2HA 1ZRKA 3S0NA 2W7SA 4I32A 5EW1H 2O8UA 5GCHG 4HTCH 1ZMLA 2G51A 3O8BA 1C1SA 1GG6C 4WXIA 1G36A 2C3SA 1AVWA 1TE0A 1CBWB 4MG3A 1QQ4A 1ZOMA 1B0EA 1GJBB 2J5UA 1SBWA 2WYGA 2Q6GA 3K65B 5HM2A 3KF2A 2R2WU 3UPEA 2FYRA 1HAVA 4MQAA 2ZHDA 2NU3E 4YT7H 4U01A 2EI8A 2AMQA 3F2GA 5TCCA 4ABBA 4SGAE 4XSKU 1TNIA 1YCPM 3OY5U 4JZIA 2J98A 3RC6A 1HJAC 4FUFA 4H6TA 2WV5A 3SQHE 3SOSA 5E2OA 1H8HD 1TX7A 3BIVH 2C4FH 1Z1JA 3PV5A 4UFDH 5DG6A 3TNSA 1BDAA 1WUNH 5FXLA 3SZEA 1G32B 4DT7B 3BTQE 3N7EA 3GCOA 1SGFA 1HXEH 5IK2D 1O2JA 1W0KD 3U98H 3T26A 1MZAA 1T7CA 4F4OC 6CHAC 3H5CB 1VITF 1YPKH 1CT0E 3RM2H 2XWBI 3MH6A 1WBGB 1EUFA 2J4IA 1ZJKA 1DWCH 1NFWA 3DHKH 3LC5A 1FX0B 1UVPA 4MNYA 4WF8A 2CHAC 1ZTKA 1O38A 3OEED 5GCHF 2BOHB 4ACAA 1EAXA 1OS8A 3UQOA 1RIWB 1XKAC 3RMMH 4AYYB 2J34A 4B6FA 7GCHG 1ARBA 4JCNA 1WAYB 2HVXA 2BDAA 3P8GA 1FN8A 2K8IA 2C8XB 2RDLA 1DWEH 1BCUH 1W7GH 1G3DA 3LT3A 2ANMH 2BY9X 4X2WA 1W0JD 4AORA 3RC5A 3RXTA 1TOCB 1DM4B 1SHHB 1YYY1 1NT1A 1N6XA 2KM0A 2GV6A 1FMGA 3AAVA 4AYVB 2GCHF 4X6NA 3SGBE 2IOTA 4VGCB 1G2MA 3OY6U 3MO9A 2J38A 5DP5A 3A7VA 1BTZA 4Y76A 3TIUA 2KX4A 1DT2A 5FPYA 4WY3A 7KMEH 3AK5A 1GI9B 3GCNA 4BAQB 1TMTH 4K69A 2Z7FE 1HAZB 3T25A 1MABB 3GDVA 4E06H 1TX6A 1IQLA 1AO5A 1GI7B 1FONA 2AERH 2P93A 1P02A 4OS5A 1J16A 2V3HH 1A0LA 1EAIA 1RJXB 5DK1A 1C2EA 1KLTA 2FTMA 2A4GA 4I8JA 3TH4H 4ABEA 4Y0YE 1P01A 3SHCH 2OP9A 1TMBH 1C5YB 2SGDE 3GY8A 2JH6D 4DCDA 1EAUA 2XBYA 4OS7A 2W5EA 3F6UH 1TYNA 1E35B 1RTLA 5KEDA 2YNAA 1AKSA 1L2EA 2BD4A 1W12U 4X1RU 4B71A 7GCHF 1FIWA 3K2UA 4BTTB 1BITA 4Y10E 1CA0B 1MTNB 1UJ1A 4JYTA 2BQ7B 2B7DH 4FU9A 2ZG0H 3TLOA 3RC4A 1TNGA 4OS2A 2ODYB 4R0IA 1BBRE 5FAHA 1A1RA 2G5NA 4JYVH 1FAKH 2B9LA 4MNVA 1O3AA 1GHWH 1V3XA 1ZHPA 4WWYA 2G55A 1OX1A 3RU4D 3PLBA 3ZZ4A 1HBTH 1DE7H 4X8TH 3SW2B 3K6ZA 2FOAA 2Y82A 3F2HA 3FKSD 1SFIA 1HAGE 1H4WA 2WPDD 5C94A 2OC7A 2PFEA 2ZKSA 3V0XA 3ZZ7A 5JYIA 3BTEE 1SGYE 1GDQA 2KFWA 3ZVCA 1TRYA 2VNTA 1E79D 3GOVB 1EXFA 4U30A 4ABDA 1HNEE 4GSOA 1ELBA 3OEHD 1MTSA 3S9CA 2ZO3H 4ABJA 1IHSH 1C1VH 4FOUC 4MPXA 1DXWA 5K0HA 2AIQA 1F0SA 1OXGA 3SV9A 1C1UH 4GCHF 5JBCS 5C1UA 3HK6B 5JB8S 1UVTH 4NIVA 1QB1A 2P95A 2XWAA 2Y6TA 2FDAA 3OTJE 4MLFB 3FAOA 5C0UA 5HKKD 1W0ZU 2BD8A 3ZZ5A 4YO9A 1YBWA 3A8DA 1RTFB 2BOKA 3DUXH 2QN5T 4NFFA 3W1EA 4I8GA 3BIUH 1BZXE 1MH0A 4YESB 3VB4A 1UTJA 3UB0A 1BRUP 4E05H 4CR5A 2BD9A 4HFPB 4YOGA 1BMNH 2HALA 3E0PB 1IQJA 2ZFTA 3VB7A 5FHTA 4NA7A 2F9PA 2ZDLA 3FOAA 4AFSA 3UTUH 4NIXA 2ZWLH 4K5ZA 1OP2A 2H9HA 3CS7A 2HOBA 1XUKA 2SFAA 2ZECA 4F48B 1BJVA 6GCHG 1Y5BT 3I78A 1F2SE 1FY3A 3MO3A 2IJD1 3UOUA 5T6GA 3F1SB 1MQ6A 1H1BA 2G00A 3FN8A 2VIDA 3MNCA 3JZ1B 4X1SU 1O3LA 5CMXH 1OWIA 4B76A 1C2MA 4GCHG 2FIRH 1ZMNA 1AVGH 3F9GA 5T6DA 1TGNA 4AC9A 2ZHFH 1HYLA 1MTUA 1C5PA 2WPLS 2PTNA 1O5DH 3LU9B 1DDJA 5E8EH 3TU7H 3V7TA 1EP5A 1KTTB 1IQGA 1EASA 1TPOA 4XDEA 1ACBE 2AH4X 3RXEA 1VCPA 1C2KA 2W7UA 1OYQA 1V2LT 2PHBA 2WPHS 2ZTXA 5DP4A 5C5OA 3M3TA 2BZ6H 2F4LA 3SUEA 1L4DA 3T62A 3KNXA 2P94A 1TPPA 1ABJH 1VZQH 4BTIB 1HLTH 2B8OH 3UY9A 1IOEA 1T8MA 2SGEE 1V6DA 2GT8A 3LJOA 3MYWA 4FUBA 3MTYA 3LGUA 1SVPA 3QGJA 2OUAA 1BMLA 1EATA 2JJ1D 1Z1IA 1COWD 1V2PT 4CBOA 1X7AC 1HGTH 1BT7A 1P57B 5AF9H 1GMCG 2FWWA 2EA3A 1IQEA 1K1JA 1MCTA 1QJ7B 3PRDA 3ZZ6A 3LDXH 4UEHH 4B1TA 3BEIB 1UTLM 4ZH8A 3DT0H 4NA8A 1C5LH 2NU1E 1V2RT 4ZROA 2VIQA 2ODQA 1KIGH 1O5EH 1NRQH 1BRBE 1FDPA 1TGTA 2XRCA 2KR7A 1BHXB 2NU2E 2ZFPH 3H7TA 3D49H 3PMBB 3IG6B 2GVFA 1OOKB 4WH8A 1THPB 3KQ5A 5BPEA 2UUJB 1DUAA 1BUIA 2P59A 1O3DA 2PSYA 5G4BA 1H9HE 2ZTZA 1T8LA 1W2KH 1QIXB 2RCEA 2BDHA 1C5QA 2WUBA 5DO4H 1DSTA 2GMTC 1L4ZA 1GJAB 2VIVA 3PB1E 2F9OA 3QTOH 1O3JA 1RXPA 4B75A 1GMDG 1WOFA 4MTBA 3EGKH 1O31A 3ATMA 5C1XA 2DUCA 5ETXA 2QYIA 2BYAX 4ISOA 1Y3UA 3SV2H 2VIWA 3ELAH 3BTHE 3MFJA 1VITH 3OU0A 1TNLA 2FEQH 1PQ7A 2W26A 3M35A 5EGMA 2QF0A 2HVYB 1S6LA 3NZIA 3LGIA 2OC8A 1HAVB 2IPHA 4DGJA 3SV7A 1XM1A 1NRSH 1H9IE 1P10A 1BMFD 1ELVA 5C3NA 1SSXA 3VPKA 3ZVGA 4DW2U 1OHHD 2A5AA 4INLA 2TRMA 2F43B 3QX5H 3RMLH 1O33A 3UIRA 1S84A 5PTPA 3A85A 5L2YH 3GY6A 1O3NA 3SUDA 4A7IB 1EB1H 1SI5H 1NU7B 1RTKA 1WQSA 2QIQA 3U8RH 4HG6A 3Q76A 4OS6A 6LPRA 2YMSC 3TK6A 1LHEH 1MU6B 1T32A 1TA2A 2OD3B 3RU4T 3EE0B 1P11E 3A8CA 2B5TB 5FCKA 1ETTH 1NC6A 3S7KB 3TITA 5T6FA 2QXJA 3RXJA 3VXEH 4K8YA 5JB9S 1XUHA 1FY4A 2BZAA 2J2UA 3CS0A 2V3OH 1J9CH 1O39A 2A2XH 3A88A 3OX7U 1TLDA 1O3KA 1P2QA 1W14U 1DSUA 1XMNB 1K1IA 2XYAA 3SI4H 1EPTB 3SU0A 2J92A 4XBCA 5CHAB 1KY9A 2P3FH 2GZ7A 3N7DA 2GDDA 4UONA 2V35A 1NM6A 1JIMA 2AMPA 2BXUH 2FLBH 1XKBC 3GY5A 1NO9H 3M3VA 3TK5A 1QQUA 4U2WA 1S0QA 2HWLB 3M5OA 1ZTJA 1DPOA 2Y80A 5FPTA 2G4TA 1LTOA 2A4OA 1LVMA 4K8BA 4ZKOU 5JBAS 4WH6A 1MTWA 2G5VA 2ZCKP 3DSGA 1JMOH 3KQBA 3RP2A 1HAPH 3F3BA 1NN6A 1TNKA 1QCPA 3GCTG 4FUDA 2XNDD 1Y5AT 4ISIH 2FPZA 1SL3A 4Y79A 5I25A 3RXRA 2H5DA 1GI6A 1AQ7A 1D3PB 2ZGBH 3HGNA 1ZZZA 2A1DB 2B0FA 2BD2A 3MOCA 4NG9H 1YCPH 4CRBA 5C1YA 1C1QA 2CN0H 1A2CH 1K9OE 2ZPQA 5BRRE 3A8BA 3JZ2B 1KDQA 2OTVA 4O97A 2XC0A 1QB6A 1N1LA 1HAHH 3QTVH 4UFEH 4BAHB 5CE1A 4Q7YA 1GVKB 3MU5A 1O2KA 2G52A 4B74A 1A4WH 4Y7BA 1CQQA 3A80A 2D8WA 1SGIB 1LHFH 1A0HB 1OYTH 3R0FA 3B9FH 1C5UA 5CDFE 1C2IA 2BQWB 5EW2H 4GVUA 1L1JA 4Z0KA 3TNTA 2LP6A 1ZTLA 3Q3XA 1AIXH 1ELGA 4K1TA 1HJ8A 1MAYA 1S6HA 1PPHE 3KIDU 3ZZBA 1UHBA 3DSPA 1GI1A 3SGAE 4XE4A 5A8YA 9LPRA 1GBEA 4K1SA 1LPGB 2ZEBA 1J8AA 1GDNA 2G81E 2VGCB 1ZSLA 4JYUH 1SQAA 4ABIA 1O2NA 2GZ8A 3GCHB 4ZMAH 5EIYA 1LVYA 1DX5M 2VB0A 1PQ5A 2K1QA 4YLQH 4FUJA 5EQQA 5EOKA 1DOJA 1GJ7B 2BD5A 1H8DH 1K1PA 4DIHH 1XVMA 2L6OA 3ESTA 4D8NA 3NWUA 1KMHB 3F9EA 1HAIH 2C8ZB 1GBDA 3M5NA 3PO1C 1C1PA 1GJ4H 1C1OA 1H9LB 2JDID 2DE9A 2F91A 8LPRA 1DFPA 1IHTH 2BY5X 1P2OA 4A1XA 1BMMH 1ZPBA 4TWWA 3W95A 2ZFFH 1XXDA 5GXPA 3S7HB 1YF4A 4MVNA 2D1JA 2A32A 2IN2A 1O3FA 2VWLA 2BVRH 8KME2 3U1IB 1TAWA 1RD3B 5JBBS 4BXSA 5TCAA 1XXFA 1YPLH 1EFRD 2Y5FA 1Z7KA 1EJAA 4ZXXH 4CRFA 4ABGA 1F5KU 3E3TA 2R9PA 1S81A 4H4FA 4TT3D 3UOPA 4AX9H 3AAUA 2XW9A 1GBLA 3OFND 2ZCHP 1GJDB 1GPZA 2CGAA 2FO9A 4IMQA 4OS1A 2P16A 2J94A 3U1JB 1BBRH 1SFQB 3VB5A 1TPAE 2HPQH 4DURA 1UO6A 2FM2A 1O2PA 1SGRE 3P6ZB 4U32A 1THRH 5EPNA 1KXBA 1GHYH 2D2DA 5C67A 3P17H 3QDZB 4I8KA 3BTME 4RI0A 1PPGE 1C1TA 1GMHF 1NZQH 3SQEE 1P9UA 1YCPK 2QF4A 7LPRA 1AD8H 1AUJA 1HFDA 5LPEA 2QCYA 1HJAB 1MD7A 4NWKA 2F9NA 2PGBB 1QB9A 1HXFH 1CHOF 2W6ID 1QJ6B 5DKMA 1GHAF 5FBIA 3T5FH 3RXUA 1YPHE 1GHVH 5HIZA 3N7OA 1DS2E 3SNAA 4AZ2B 3EYDA 2NU4E 2VVUA 1LQEA 5L6NH 1YLCA 3ZVBA 2VVVA 4X6PA 4ZKRU 3RXFA 1N6YA 1Z8JB 2FZZA 1EZXC 5GDSH 1O2MA 1QRWA 3QN7A 4NSVA 3URCA 1C5ZB 2RA3A 4VGCC 1K2I1 2FX6A 4CHAC 1FLEE 2TIOA 4ZKSU 4X8UH 1W7XH 3ODFA 5EPYA 5A09A 2FXRA 5DP6A 1SGPE 2FMJA 1UTPA 1D6RA 3LH3A 4F49A 3QUMP 2QV1A 2W6JD 4K2YA 1E1QD 1P03A 1V2UT 2PR3A 5E0GA 3VG8A 3RMOH 1P05A 1SC8U 1ZPCA 2IPQX 1P2MA 3E6PH 4B6EA 1PFXC 4X6MA 3QK1A 4TY7A 2WPKS 2TGAA 4IW4E 2BLWA 1O30A 4X1NU 4LOYH 1A3EH 2O9QA 4WJG2 1AHTH 2VBCA 3A84A 3HKJB 5FL7D 1YPMH 1DWBH 1MBMA 1TBRH 3MH7A 1QBVH 2GCTC 1GWAA 2Z3DA 5B6LA 1K21H 2FI5E 2H5CA 4ZAEA 2GJGA 1PYTC 1ZHMA 3S9AA 2ZFSA 1K1OA 3AW0A 3VGCC 3DSOA 2R3UA 5GJ4B 2BY6X 1CA8B 1UK4A 2Q6FA 1DICA 1WSSH 4ABAA 1PPBH 3BTFE 1Q2WA 4XBBA 1SGNE 4OS4A 3TK9A 3UR6A 1TBZH 1O2IA 3A7ZA 3RDZA 2QE7D 3SBKA 2VIOA 3R3GB 3OTPA 2ZU2A 1BB0B 3RXLA 3NRLA 1XUFA 1UTNA 1CO7E 4Y71A 2QAAA 1E38B 4BANB 1J17T 3O8RA 5AFZH 3VEQB 3A7YA 1SPJA 3I29A 2GCHG 1UCYK 2C90B 3RXGA 2PV9B 1CA0C 1MTNC 5FX5A 3MO6A 2TGPZ 3D62A 4JZDH 1V2NT 3Q77A 2AS9A 3E90B 1GVZA 1ELCA 2FX4A 1AY6H 3SORA 4JMYA 1LVBA 1O5CB 1LVOA 4K1EA 4RT0A 1BRAA 4JK6A 1E0FD 1G9IE 2CHAB 4X1PU 1CE5A 1FY1A 3L3TA 1SGCA 3Q3YA 2AHME 4M9FA 1TIOA 1CVWH 5DJ7A 3RM0H 4WXVA 1V2ST 1SLUB 4CR9A 4B2AA 3NCLA 1LCYA 3V13A 1VCQA 2GZ9A 1DLKB 2CXVA 2SGAA 1SGQE 1C4U2 1MMJN 3S9BA 1KTSB 4INHA 3HK3B 1W8BH 4FETA 3GY4A 4I7YH 3EA9A 2ZU1A 2XCFA 1QFKH 2QGRA 3A81A 1HJ9A 1L1NA 2BVSH 3UWIA 2BY7X 5JDUB 1SG8B 1TGCA 5DN6D 1DY9A 2JIZD 4CRCA 1HPGA 1KXAA 1UTMA 2H9TH 3A82A 1F0UA 1WTGH 1Z8RA 2ZCLP 1QNJA 2ZQ1A 3TPIZ 2A45B 1LHGH 1F7ZA 3A87A 1WU1A 2ZI2H 1A5GH 4O03A 2Z9LA 1J14A 1LPKB 1UTOA 2ZFRH 2OBOA 4KGAA 3O8CA 2ZDAH 2BDGA 5L30H 3MH4A 4YM9A 1HAOH 3BG4C 1SQRA 4K60A 1AUTC 1CSOE 1NESE 1HDTH 4NFEA 2CK3D 1BTYA 3KEEA 2HPPH 2WPJS 1SMFE 3EA8A 4KP0A 5SGAE 2SGQE 1GMCF 3MU4A 3PYHA 1AE5A 1K22H 1GBAA 2H9EH 2ZHEH 1WYKA 1BMAA 1CHOG 1BIOA 4X6OA 5FX6A 2F3CE 1PQ8A
chains in the Genus database with same CATH topology
1O5GH 3KL6A 1G2LA 2BTCE 4MPUA 1QBNA 4Y6DA 1JXPA 4XBDA 1Y3XA 3GY3A 1RIWC 5DP7A 3U8TH 3VFEA 1GBKA 1SLXB 2AGGX 1WQVH 3LGWA 1GMHG 5HGGA 2BDYA 3LIWA 3LOXA 3U69H 4LZ1H 4NCYA 5DPAA 2UWOA 1CT2E 1AB9B 4GHQA 4FUIA 2ANKH 3NPSA 2O8WA 3HPTB 4FUHA 4Y8YA 1XX9A 1D4PB 2WUCA 1ZYOA 1BHXF 4YTAA 2GV7A 4D76A 5C2ZA 1BJUA 2Y81A 4E7NA 1S83A 1NFUA 2C8WB 3P70B 4TY6A 1BBRK 2FS8A 3E1XB 3QO6A 1F92A 3CP7A 4OGXA 1IQNA 2GTBA 1D6WA 1JBUH 1BTXA 1G3CA 3M5LA 2R0KA 2UUKB 1FUJA 1PPCE 1QA7A 3T27A 4YOJA 1QY6A 3DFLA 4ZXYH 3UUZA 3UWJH 2ESTE 1EJNA 4HGCA 1L1GA 2TPIZ 1GBBA 4INKA 4AOQA 1O3OA 4Q7ZA 3TGIE 4Q80A 3RXMA 2PKAB 2P3TB 1E34B 3E16B 2BDCA 5AFYH 3IITA 2JH5D 5H4IB 4B2CA 4I8HA 1P06A 2BDBA 1BQYA 8GCHF 2OC1A 4NA9H 1NPMA 1JOUB 2WPIS 4UFFH 3MNSA 5E2PA 4AB9A 3M61U 3KQDA 2Y7XA 5DP9A 1GG6B 1EAWA 1XUIA 2EEKA 7ESTE 4Y7AA 4UE7H 1GI3A 1O3GA 3TJNA 1O3EA 4TYDA 4H6SB 1KXDA 1ELAA 4RKJB 2A7JA 2PLXA 3BF6H 3B8JA 1S0RA 2AGIX 3AASA 1P2NA 1OP8A 2Z3CA 3PROA 2BB4A 3NKKA 2TGDA 5TJXA 1C4V2 4BNRA 1LPZB 1G30B 1QBOA 1LKAA 1ZJDA 3SN8A 2CJIA 1DXPA 4JZFH 1JIRA 1O2OA 1TRMA 2FP7B 2THFB 4RN6A 1KSNA 1NRRH 1C5TA 1O2GH 4ABHA 1C9PA 4NIYA 3SJIA 1FY8E 3SO3A 3UQVA 4ZHMU 2QA9E 1ZLRA 4IC6A 1F5LA 2HNTC 4LZ4B 2Z9GA 3SNBA 5I46H 2ULLA 2A7HA 2VIPA 1O3CA 1ABIH 1GHZA 1QL8A 3H7OA 4I31A 1GL1A 1TMUH 3ZVEA 3HATH 3PTNA 4FU8A 1E37B 3D23A 3QGNB 1EZSC 1UK2A 4B2BA 1OWJA 1TPSA 4RKOB 2VINA 2GKVE 1ARCA 3OYPA 1HB0B 1YC0A 1GCTB 1YLDA 2FLRH 1FPCH 3E8LA 2A4RA 4IC5A 4TPYA 2QXHA 3G01A 1YPEH 5LH8A 2Z9JA 2RA0A 1C2FA 4MNXA 1EOLA 1XUJA 3SHAH 5AVDA 1V2VT 3MU1A 4AB8A 4J1YA 3PMAB 4A92A 2ZDNA 1SOTA 3FP7E 3F9FA 2G8TA 8ESTE 1O34A 3BTWE 5FCRA 3MU8A 1PPFE 1QGFA 2V6NA 5F8ZA 1O2TA 3BG8A 4D7GA 1GJ6A 1BOQA 1B7XB 3VB3A 1O2LA 1P8VC 1SR5C 1HAYB 1UK3A 3BTKE 3RXSA 1AWFH 1O3PB 1UMAH 2ZPSA 4KTCA 1VGCC 1JRSA 3P95A 1O5AB 3PMJA 5F03A 1GI0A 2ZDMA 4TPIZ 4AFZA 2F83A 1GJ8B 5B6OA 2OQ5A 1NU9A 1O3MA 4ISHH 3RLYH 1W11U 2KAIB 2O8LA 1Z6EA 3ZV9A 1DLEA 4THNH 1MQ5A 2ALPA 2OBQA 1TQ7B 2W3KA 1VJ9U 1P2KA 1T8OA 3RXOA 5J4SA 1AFQC 3ZZCA 1TALA 3A7TA 2PGQB 2ZGXH 2TBSA 1Y3YA 4KKDA 1IQHA 2XC4A 2PWXA 5LPFA 4NZQA 4OGYA 1UVOA 2R0LA 1P3CA 3ZVFA 2XBWA 2Z9KA 1VCWA 2SNVA 4LXBH 3WY8A 4Y8XA 1AMHA 1S6FA 1UTKA 1DITH 1Z8GA 3EDXB 1KYNA 5LPRA 1CHGA 2GT7A 2FOBA 1FIZA 2VWMA 4X8VH 1MTVA 1TGBA 1K1NA 2WYJA 3PV4A 3IWMA 1EP6A 2Z9IA 4PROA 3UFAA 1BA8B 1P2IA 1V2QT 2DE8A 2F9UA 1ESTA 1UHBB 1FY5A 5GIBA 4FXGH 1TONA 4BAKB 1QRXA 1GBMA 1CGJE 3ATLA 2ZDKA 3ZV8A 3RXCA 2XBVA 1SLVB 1LHCH 4H42U 4D7FA 4UD9H 2QC2A 1KLJH 1V2MT 3GY7A 1OPHB 1C1RA 1MCVA 1K1MA 1P3EA 2C93B 3MI4A 4ISLA 4NZLA 3EQ0H 1RRKA 4XOJA 1FXYA 2A5KA 2QXIA 1GHBG 1Y3WA 2XBXA 3GCTF 2PUXB 1TBQH 2F9VA 3LKWA 3TVJB 1QL7A 1Q31A 2FOFA 3FANA 2A5IA 3ENSB 3K6YA 1XVOA 2VJ1A 1UVUH 3GICB 3RXKA 2UWPA 1ZGVA 1MUEB 4JK5A 2BM2A 1V2KT 3ZZ8A 1UCYH 1BTHH 1ELFA 4X8SH 4CRDA 1QURH 1GBJA 3SUFA 1MKWK 3ZZDA 3V12A 1QTFA 4WMFA 3P8NA 1CU1A 3M5MA 1GI4A 2FOEA 1NY22 5T3HA 2BX4A 2ZGHA 1MKWH 4D9QA 1TGSZ 3BN9A 1HRTH 1YPGH 3ZVAA 3BTTE 2NWNA 5F6MA 1O3HA 2Q1JA 2STAE 3PWCA 1TOMH 2CMYA 2D26C 1MZDA 3SI3H 3A89A 3P92A 1GJ5H 1HIAB 3U8OH 2ZZUH 5K7RA 1GHBF 1O2SA 2BD3A 2ILNA 3W94A 2BLQA 3SU4A 1C2GA 3STJA 5HYOA 2I6SA 1VR1H 2VH6A 4CH2B 2ZP0H 3Q00A 4ISNA 1L0ZA 3TGJE 1YPJH 1G37A 1QA0A 4CRGA 1P12E 2VWOA 1W3CA 2JKHA 4I33A 3M36A 1A7SA 2EI6A 2ZF0H 2HLCA 1F0RA 1TABE 3SU1A 3UNRA 4DJZB 1C2LA 4DY7B 1D3QB 5EU8A 1ZSKA 5HXFA 1OSSA 3ZVDA 1ANBA 3LH1A 1Z71A 2OC0A 1GGDC 1YGCH 1IQKA 4MNWA 2ANWA 1V2JT 3SU3A 1W0YH 2P8OC 1BTWA 1PPZA 5DGJA 3P8OA 5EXMA 1C2JA 2FOGA 2VWNA 4B73A 3TGKE 4SGBE 1AI8H 2AFQB 3SV6A 1T4VH 2ZNKH 3SJKA 4ASHA 1IQFA 1EJMA 5EG4A 1O3BA 1P04A 1U6QA 1B5GH 3RXQA 4A1VA 2AYWA 4AG2A 5F8XA 2QXGA 1EZQA 2FTLE 4NGAH 3QLPH 4Y11E 1GGDB 4A5TS 1FZZA 1VGCB 4HZHA 1FPHH 1UTQA 1GHAG 1MAXA 5ESBA 3S69A 2Y5GA 2A0QB 2BDIA 2IJOB 1Q3XA 1HCGA 4R8TB 2UWLA 2R3YA 4CREA 4LK4A 4DOQA 1ANDA 4YZUA 2FI3E 4YLUA 3K9XB 5F8TA 1LQDB 2BVXH 2P8OB 9ESTA 2O8MA 2F9BH 1GBTA 2BXTH 4XFQA 1ZHRA 3KN2A 1YP9A 2GDEH 2ZTYA 2H2ZA 1GDUA 1TX8A 3RXBA 1A46H 1Z8IB 1C4Y2 1C5VA 1A0JA 1SHYA 1V2TT 4WMDA 1LMWB 1GCDA 1O35A 1AWHB 1FNIA 2V0BA 3BG4B 3T29A 1HV7A 2J95A 3KCGH 2ZC9H 5IYTA 1WV7H 3RUOA 1C5MD 4ZHAA 1C5XB 1FN6A 4FUCA 1O32A 4DIIH 1ZRBA 1O36A 1OWDA 4IMZA 3SU5A 5HM9A 1AZ8A 2Y5HA 1QR3E 3GDSA 1GHXH 1XUGA 2R2MB 5E0JA 3GDUA 1C2HA 1YPHC 5EQRA 3EAJA 1CT4E 1MD8A 4ZKNU 2H1UA 2GP9B 4AFQA 4CHAB 1RS0A 2ZGJA 4CH8B 1S5SA 1O5BB 4GAWA 3I77A 2HNTF 1P2JA 4X2XA 4KELA 1O2VA 1OWEA 1GI5A 5FBEA 1O2YA 2FOCA 2PUQH 1P09A 3LGYA 3QWCH 1SGDE 4Q2KA 1AZZA 4FUEA 3BSQA 3RXVA 1IAUA 1C1NA 3E0NB 1NRPH 2ZDVH 3A8AA 1SOZA 2WPMS 1EPTC 2OXSA 3KHVA 3NK8A 2UUYA 2ALVA 3ZZ3A 1LKBA 3GISB 3NXPA 1GBHA 3AW1A 3AVZA 1O2UA 5AHGH 1C1WH 1Y59T 1GI8B 2WV4A 1G3EA 2Z6BD 1A5IA 4RSPA 1AFEH 1ELDE 1SQOA 3DFJA 2WINI 1INCA 3A7XA 4JZEH 3T2NA 3VB6A 1NS3A 4UDWH 1TFXA 2FOMB 1OP0A 1TRNA 2HRVA 5C20A 4WVPE 3QZQA 2XC5A 4X2YA 1MKXH 1SB1H 5A8XA 1E36B 4E7RG 1P0SH 4Z6AH 2BLVA 5A0AE 3EA7A 3LPRA 2KAIA 3PTBA 1CGHA 4FUGA 3UR9A 1T31A 1P9SA 1T4UH 1TWXB 5A0CA 2VGCC 1JWTA 2BLOA 2UUFB 1DUEA 3ZYEA 3F68H 4J2YB 2G4UA 3C1KA 3GY2A 2ANYA 1TNJA 3SJ8A 4AN7A 1ELTA 2BQ6B 1D9IA 1GJCB 3E91A 1GCTC 1BTPA 1M9UA 3BEUA 3SJ9A 2C8YB 1GMDF 2GCTB 4CBNA 4ZHLU 1VJAU 2ZHQH 4X2VA 1EX3A 1S85A 3FP8E 1ZGIA 3VXFH 1MKXK 5GPIB 1NRNH 1OWKA 3OSYA 2A31A 1TB6H 1EB2A 2ZFQH 4DG4A 2Z94A 2AIPA 3RMNH 1ZR0A 1ZMJA 1J15A 4GHTA 4GUXA 1AU8A 1BRCE 2FYQA 1KXCA 3LC3A 1O3IA 3PMHB 1SLWB 3MWIU 5DP8A 1ESBA 3L33A 3KGPA 5J4QA 3RLWH 3LONA 5ESTE 4A1TA 1SGTA 1O2RA 3TH2H 1EPTA 1C5NH 3ATIA 3MU0A 1ID5H 2BHGA 1RGQA 1Y3VA 2A7CA 1AKSB 5EXLA 2JH0D 5HMAA 1C5WB 2SGPE 5A8ZA 3P8FA 5FPSA 5LGOA 1O2ZA 2FODA 2OCVB 4YOIA 3SU6A 2CF9H 2FESH 2PKSB 1AN1E 4IS5A 1V2WT 4AG1A 3ATKA 3A7WA 2STBE 3ZYDA 1MBQA 1AFQB 1KXFA 1N8OC 4UFGH 1MU8B 3ZZAA 3DD2H 1UVSH 1ESAA 3FVFB 2QF3A 1O5FH 1Z6JH 1A3BH 4FVBA 1O2WA 4X0WU 3RXAA 4MPVA 3GCHC 2BMGB 1TNHA 4MDSA 2M5TA 4IN1A 1QL9A 3HKIB 1ELEE 2OINA 4NIWA 1V2OT 3LJJA 1ANEA 1ETRH 1FQ3A 2GD4B 2XXLA 2YNBA 1BTUA 2VVCA 1WTHD 6ESTA 3PO1B 1EZUC 3BTDE 1IQMA 3PWBA 2PTCE 4Y0ZE 1SGEE 4IGDA 3BV9B 3M3SA 2A4QA 1AB9C 3F9HA 3A86A 4BXWA 4ZUHA 3U9AH 3M7UA 1GVLA 3GYLB 4NWLA 5CHAC 4BAMB 2P3UB 4FU7A 4AGJA 1DWDH 4YT6H 5IDKA 5ABWA 4M7GA 2SNWA 3M37A 4O3UA 1NFYA 3DA9B 4BOHA 2ODPA 4A6LA 1AGJA 1F5RA 1N8OB 2OQUA 1GBFA 1KLIH 2Q6DA 2JETC 2GGVB 1GI2A 2ZHWH 2J9NA 1YKTA 1OKXA 1PJPA 4X1QU 3SNCA 1S82A 1DANH 1C5RA 4GLYA 4QT8C 2TGTA 5L2ZH 3A83A 1EQ9A 3LGVA 3TJVA 5C5NA 1ZSJA 2Y7ZA 3D65E 2ZU5A 3M7TA 3UNSA 2LPRA 3BEFB 1UCYE 4K3JA 4WMEA 2FOHA 3MNBA 3RXHA 2XTTB 3B23B 2FS9A 1DVAH 1GL0E 2Z3EA 1FJSA 1QJ1B 1IQIA 2ASUB 1EKBB 1C9TA 1T8NA 3SUGA 4ABFA 3UREA 1O37A 1QRZA 3FZZA 1ANCA 1NFXA 3KQEA 3T28A 1AVXA 2EI7A 1OWHA 3CENA 3TJUA 1PPEE 3HGPA 5EODA 2I6QA 1D3TB 5GWZA 4KTUA 5EQSA 4HI3A 1ORFA 1A61H 3RXIA 4GPGA 4AFUA 4Q7XA 3SJOA 1PYTD 3ODDA 3PLKA 2ZU4A 3URDA 2VU8E 3TJOA 3RU4E 3C27B 4DVAU 5A2MH 6GCHF 1C5SA 2XNIA 1FI8A 1HAXB 2O8TA 3BTGE 3KQCA 3L6PA 3TH3H 2ZQ2A 2H6MA 3SV8A 1HUTH 5JPMH 2PKSC 1PQAA 3STIA 1O0DH 1Y5UT 3ITIA 4MPWA 3FFGA 1THSH 3O8DA 3GYMA 4JZ1A 3RXDA 4BAOB 3PM3A 1QHRB 2QY0B 1W10U 3Q3KA 4CRAA 1NTPA 1SQTA 4ESTE 1CGIE 1AE8H 2YOLA 1DY8A 1H8IH 1JRTA 1KDQB 1LHDH 3FP6E 4BTUB 3NUMA 3RXPA 2JETB 4D9RA 3M7QA 3V3MA 5DP3A 3MH5A 1KXEA 2NU0E 1O2QA 1G3BA 2GX4A 1K28D 1LO6A 4IN2A 1FAXA 5A0BA 1A5HA 2HNTE 2AGEX 2XCNA 2PSXA 2PW8H 3ZZ9A 1C5OH 2AEIH 1ZPZA 2SGFE 1GJ9B 2BX3A 3FZDA 2BY8X 2ZPRA 3ATWA 3UNQA 1HIAA 4AGKA 1GBIA 4TWYA 3VGCB 2PKAA 2GMTB 4IBLH 4KTSA 4NSYA 2BD7A 3SZNA 3MHWU 1ETSH 2OLGA 3SGQE 5EXNA 6CHAB 5JBTA 1EOJA 2FI4E 2HGTH 3MMGA 1RFNA 3SU2A 4O9VA 1TA6A 2CF8H 2CV3A 3PLPA 4FVDA 2RG3A 1GBCA 1C1MA 2A2QH 2ZU3A 1LDTT 1W13U 8GCHG 4I8LA 5E0HA 1CBWC 2ZGCA 2LNCA 1D3DB 1Y8TA 1B0FA 1NROH 1C2DA 2ZIQH 4Y8ZA 2VH0A 1YM0A 3SNDA 3QZRA 3MNXA 2ZA5A 1O2XA 2AMDA 4O3TA 3LGTA 2W3IA 1K1LA 1VITG 2EC9H 1WCZA 1SGFG 3SNEA 1F0TA 1TQ0B 1FV9A 1O2HA 1ZRKA 3S0NA 2W7SA 4I32A 5EW1H 2O8UA 5GCHG 4HTCH 1ZMLA 2G51A 3O8BA 1C1SA 1GG6C