3I29A

Crystal structure of a binary complex between an mutant trypsin inhibitor with bovine trypsin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Role of remote scaffolding residues in the inhibitory loop pre-organization, flexibility, rigidification and enzyme inhibition of serine protease inhibitors
pubmed doi rcsb
source organism Bos taurus
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i29A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i29A02
2BD9A 3TNTA 1SQTA 2PSYA 4YM9A 1TGCA 2NU2E 2AEIH 1HAZB 3GCTG 3MU1A 4UEHH 3ATWA 4PROA 1ABJH 4XDEA 2AMQA 1A7SA 1ELFA 3QWCH 2XYAA 5F6MA 1XKAC 2XCNA 4Y8YA 5LPRA 1TQ7B 1H8DH 3QGJA 5FPSA 5GIBA 3ZZDA 1AY6H 3E91A 4YLUA 4ZHLU 1K21H 1GBFA 2BLVA 1IQEA 4ZAEA 1SI5H 3Q3XA 1XUGA 2WPIS 3LC3A 1G37A 2TIOA 2UUKB 3QZRA 4B73A 1JIRA 4DVAU 5JYIA 5ESBA 5J4SA 1SSXA 1S0QA 2I6SA 3L3TA 1C5ZB 3MHWU 3SV7A 1C4U2 1W0ZU 4FUGA 2SGEE 1TA2A 1IQLA 4LOYH 1NS3A 3MNSA 8ESTE 3FP7E 2ZDNA 4NWLA 1SLUB 1SPJA 4MNWA 5E0JA 3S0NA 1QQUA 4XBCA 2FEQH 2ZTXA 1JXPA 2F9VA 1QBNA 1A3BH 1VITF 1VGCB 4BNRA 4ISOA 1W8BH 1TAWA 2Q6DA 3A86A 2QGRA 1LVOA 1P03A 1UJ1A 3RXEA 1EKBB 1MKXK 1XVOA 2TGPZ 3UNQA 2HRVA 2HWLB 2F83A 1ETTH 2EI8A 1SGEE 2GZ9A 3E1XB 1O2SA 1XUHA 2CXVA 4WH8A 5DP4A 2ZF0H 3U69H 1CBWC 1QB6A 4CH8B 2G55A 1GBJA 3SU6A 3EA9A 1UVTH 3T5FH 2ZHEH 1H9IE 4MPWA 3LH1A 2UUYA 2OXSA 2TGTA 1Y5BT 4ZKRU 1J16A 5FAHA 1CHGA 1EOJA 3QX5H 1HUTH 4TPYA 3RMLH 1P05A 1J17T 2PSXA 1L4ZA 1CBWB 1OWEA 1TALA 6ESTA 2QA9E 2Q1JA 1GDNA 1IHSH 1GMCG 2A45B 2XW9A 1ZZZA 4JCNA 7LPRA 1AVXA 4TPIZ 3RM0H 2BOHB 1AGJA 1OP2A 2BD8A 3M3SA 3AAUA 2Y5FA 2QY0B 3RXSA 2CMYA 2J94A 2PKSB 4FUHA 2FYRA 5CHAC 1P01A 2C4FH 1UTPA 1QL9A 3GCNA 2PHBA 1V2NT 1GMDG 1SGNE 1GJ6A 1BIOA 3F1SB 2BMGB 3K6ZA 2VVVA 1F0UA 5C1UA 3GY6A 1EAIA 2ULLA 3EDXB 1HCGA 3RDZA 1KIGH 3RMMH 2VVCA 3BEFB 3I29A 1TGBA 1PQ5A 8GCHG 4MNVA 1QCPA 3W94A 1Z1IA 4U30A 2J9NA 1DFPA 1Z8RA 3BTTE 4Y11E 1FQ3A 4OGYA 3FANA 3GYMA 2J4IA 4NIVA 1N6XA 1RFNA 3HGPA 2A5KA 4XSKU 4FU7A 2ZDLA 1O31A 2QF0A 1OP0A 1MTNC 1E35B 4F49A 1EQ9A 3LH3A 1BTZA 1IHTH 1OPHB 2BQ6B 3MU0A 5AFYH 1O3JA 1FY1A 3KEEA 4YT7H 1BBRK 1O37A 2A7CA 1EAXA 3GY3A 1ESBA 1FN8A 1OOKB 2FMJA 4D7GA 2HGTH 3PTBA 5AVDA 1UCYE 3SU3A 1ETSH 3U1IB 3SUDA 1BRCE 1LCYA 2GGVB 2BLQA 1DE7H 1V2TT 1NU7B 4CRDA 1YCPK 4FVBA 1BJUA 1SGIB 2GT7A 4D9QA 2Y80A 1O2ZA 2ZO3H 5BPEA 5GXPA 2BZ6H 2BD4A 1H8IH 3QTVH 2B9LA 1O2IA 4IMZA 2ZHWH 4X1QU 5A8ZA 2FM2A 2RA0A 2A4RA 2F9PA 1CT4E 3SUEA 3U8OH 4DW2U 2LNCA 2XBYA 1FIZA 3ZVFA 1V2UT 1GBHA 2ANMH 1PQAA 3E6PH 4MPXA 2ODPA 1S82A 3MWIU 3M7TA 3Q76A 2SFAA 1Z8GA 3MMGA 3MU4A 2AFQB 2XC5A 1FPCH 1XMNB 4H6TA 4B76A 1C1QA 1E38B 2GCHF 1GCTC 1QA0A 3JZ2B 1C5RA 1AFQC 3AW0A 5HYOA 1HPGA 4BXSA 1BTYA 5DP9A 1OYQA 2OCVB 3S9CA 1NROH 1X7AC 4IBLH 3TVJB 1RD3B 3RXRA 3SUFA 1Y3YA 4OS4A 5LH8A 1QB9A 3QTOH 1ANBA 1ARCA 3BG4C 1TGTA 2VU8E 3RXKA 2ZGCA 2YNAA 1B0EA 1AFQB 1O3DA 3K6YA 4FU9A 1N1LA 4ZMAH 1T31A 1AKSA 4JYVH 3RC5A 4OS6A 1HNEE 2WUCA 1J9CH 1FY3A 1Z8JB 1LDTT 3GDUA 2FOFA 3BIVH 4CREA 1AWFH 1P04A 2UWPA 5JBCS 1NTPA 4GCHG 1LHGH 1VR1H 1GMCF 3TGKE 1NRRH 3UY9A 2BTCE 1AUTC 2TGDA 1PYTC 5K0HA 4SGAE 5GCHF 1JRSA 2Y6TA 9ESTA 3ZVAA 1PPEE 4JYTA 2VWNA 1V2KT 1C5WB 4IC6A 3U8RH 1JIMA 4AG1A 1TPAE 1JBUH 3MTYA 3M37A 3B23B 3T28A 4B1TA 1OX1A 1SBWA 1ARBA 1GMDF 4NG9H 3ATIA 1G32B 4GAWA 1C5SA 2NU4E 2O9QA 3RP2A 1G30B 2QIQA 1XUKA 2JH5D 4BTUB 2ODQA 1TBZH 2AGGX 2VJ1A 4XE4A 1Y3UA 3OU0A 3GY5A 3UQVA 2WV4A 4TWYA 8GCHF 3KF2A 2PWXA 1MKWK 1O3CA 1DY9A 5JPMH 2ZGXH 1LMWB 1O2YA 4R0IA 4Y8ZA 3UFAA 1A46H 2ZU1A 1S85A 1PYTD 2BDCA 1C2HA 2ZQ1A 1V6DA 3M5OA 1GHAF 2VVUA 3HK3B 1O35A 2PTCE 3A81A 2XC4A 1UCYH 1Z8IB 1TE0A 1BTUA 2P16A 1GJDB 4Y10E 4CH2B 3GOVB 1LO6A 1A0HB 1MQ5A 1O2HA 1ZTJA 1EZSC 3BTME 2UUJB 4Y7AA 2FTLE 2A4GA 3ATMA 1A4WH 5BRRE 2GV7A 1P2MA 2BQWB 3MNCA 2IN2A 4JZIA 3ZZ9A 1F5KU 2ANKH 2VWOA 3D65E 2WV5A 1KLTA 1O5CB 4Y0ZE 3V12A 5DG6A 4DT7B 1DVAH 1O3OA 3VB5A 1W7GH 1JMOH 1G36A 3NKKA 1ZTLA 3MO9A 2J38A 2D8WA 1GHZA 1SFIA 1DXPA 1EAUA 1FMGA 3RXFA 5FBIA 4X1PU 3MH5A 4NSYA 2NWNA 1GJ5H 2EI6A 3H5CB 4MDSA 1Z1JA 3GCHB 1XUJA 4ABAA 5T6FA 1SC8U 2HPQH 1YPMH 1ANCA 1ZSKA 1NN6A 2ZI2H 1GBTA 4ABIA 1O33A 3LT3A 4NIXA 1HJ9A 3VFEA 4E7RG 1F0TA 1P02A 5DPAA 4ZKSU 1QA7A 4TY6A 1SG8B 5DP3A 1T8NA 1V2WT 4X2VA 1L0ZA 3RLYH 4CRCA 1SLVB 1GVZA 1YYY1 3TLOA 1CT0E 3ZV8A 1TRNA 1T8OA 1GGDC 3GY7A 3KQCA 3F9EA 1ESTA 3LU9B 2A5IA 3M35A 4WVPE 2PR3A 1OYTH 2TRMA 1GI6A 4WJG2 3UOPA 1F7ZA 2H1UA 3BEUA 3RXGA 2VIWA 2ZPQA 1MTVA 2ZP0H 1ELEE 1FLEE 2D26C 2OLGA 1AN1E 4MLFB 3RXDA 4UFFH 1DT2A 1HIAB 1PPGE 1W13U 1LPGB 3BTWE 3GDSA 4BAOB 1GGDB 2WPJS 4ABBA 4HTCH 1BMNH 1H4WA 1D6WA 2STBE 4NZLA 3BF6H 1QL7A 4X8UH 1ELDE 1H9HE 3BTHE 3MO3A 1NC6A 2FLRH 4INHA 1IQJA 3A87A 1GI1A 1T8LA 4U2WA 3TGIE 1O3LA 2ZFTA 3HKIB 4A1XA 1D6RA 4ASHA 1P12E 1W10U 2OINA 2FODA 3LONA 4J1YA 4AYYB 1HJ8A 2W5EA 4XBBA 1MZAA 1C5UA 4ZKOU 1F92A 1O0DH 1UTOA 1MU8B 3MOCA 1SL3A 3A82A 1BBRE 4X2XA 4BAMB 1BMAA 3RC6A 1YF4A 3N7OA 3RXAA 1B7XB 2A2QH 1TOCB 4YTAA 1TB6H 2R2WU 1EZUC 1FI8A 3A7WA 4Z0KA 3KQEA 1AE8H 4D76A 2FOGA 2AS9A 2STAE 4UE7H 1IAUA 3E0PB 3SJIA 5JBAS 2WYGA 2O8UA 5TCCA 1L1JA 2HPPH 3SZNA 2FX4A 4AN7A 3RU4T 1CQQA 1QQ4A 1SGQE 1HAIH 4HFPB 3SV6A 3MU8A 3ZZBA 1C2IA 1OWHA 1ZPCA 4IMQA 1A0LA 1L2EA 1O3FA 1W2KH 2HVXA 3A7XA 2A31A 1J15A 2Z3EA 1EPTB 1MKXH 1ESAA 3FZZA 1UVOA 1ZHRA 1MH0A 2W7UA 3UR6A 1CT2E 3K9XB 4Y76A 4KTSA 1GG6C 4O3UA 5C5OA 3QLPH 1C5VA 2QXJA 4X6NA 4Z6AH 2THFB 1KXCA 4LZ4B 1K2I1 1NO9H 3PTNA 3ZZ4A 1MUEB 1RS0A 5EPNA 1GBLA 3NCLA 4CRAA 4UFDH 1HAHH 1SFQB 1HBTH 1RRKA 5EXLA 4DJZB 2ZGHA 2SGPE 1FY4A 4ZKNU 3RMNH 3BTFE 1DWEH 2WPHS 3RXLA 1ZMJA 3TPIZ 1CVWH 4K5ZA 1YPKH 1O2RA 3W95A 3SW2B 1UO6A 1EASA 1GHWH 2F9BH 1EZXC 1C2MA 3MO6A 2XWBI 4Q7YA 2BD3A 9LPRA 1WTHD 1P9SA 3LGWA 1LQEA 2BY7X 1O38A 2VIVA 2P93A 4ZUHA 2CF8H 3ZV9A 5LPEA 2AGEX 3WY8A 3QGNB 1WAYB 4KKDA 1UK4A 1TFXA 4WH6A 2XBWA 1GI5A 4BOHA 1EUFA 4AORA 1RJXB 1VGCC 1C1RA 1W0YH 5FPYA 3RUOA 2PGQB 4A92A 1KY9A 1BB0B 2C8YB 1GHBF 4R8TB 1Y3XA 2W3IA 3E90B 1PPBH 3L33A 3T26A 3LGYA 4ABFA 1Y3VA 4I8HA 4A7IB 4WF8A 3MH4A 1OSSA 1EOLA 7KMEH 2BD5A 3ZZ6A 1H1BA 1HV7A 2RDLA 3VXEH 2OP9A 1HJAB 3RXVA 1LHDH 3BIUH 2GCHG 4X1SU 2ANWA 2R3UA 5T3HA 4HZHA 1WBGB 1G2LA 4M7GA 1P0SH 3UNSA 1GBDA 4AYVB 1DXWA 1GI0A 1BBRH 4I33A 3PROA 2BDIA 1N8OB 5JBTA 3UWJH 3ENSB 2BD2A 4X8SH 3A85A 4K3JA 2V3OH 4AFUA 1W11U 5JBBS 4DIIH 1F0RA 3DHKH 4I8GA 1O3IA 3SBKA 2AIPA 2W26A 2F91A 1SOZA 2ZGBH 3QK1A 1PPHE 3A8DA 2FPZA 4NA8A 2PKSC 3TJVA 5JB8S 2B8OH 3GY2A 2O8LA 4E05H 2RCEA 5GJ4B 1O5DH 2FOMB 1W3CA 3SGAE 3ZVCA 1QBVH 1B0FA 1QRZA 3E0NB 4IN1A 1Z71A 3BTDE 1C5YB 1KLJH 3PWBA 2FZZA 3BTQE 1T7CA 1P2OA 2PUQH 2XBXA 3I77A 3JZ1B 3I78A 3OY5U 2R9PA 1RXPA 2Z7FE 2SGAA 5GCHG 5T6DA 3P17H 1O5AB 1DWCH 1DSUA 2NU1E 3UWIA 3KHVA 2VIDA 1O5GH 1NRQH 1JOUB 5DJ7A 3RXOA 4B2CA 7ESTE 5HM9A 1PJPA 2Z94A 3EYDA 5HGGA 3LDXH 2O8TA 1ZPZA 2LPRA 3S69A 5K7RA 2P3UB 2DE8A 1EJNA 2QXIA 3EGKH 3CS0A 5E0GA 2C93B 2FOHA 3FP6E 1ETRH 5C3NA 2BYAX 2PLXA 2KAIA 3TITA 1NRSH 3VB3A 2R0KA 4AGKA 3UOUA 1O2UA 5A09A 2Z3DA 2ZEBA 2AIQA 3GICB 1FV9A 2J92A 2SGDE 3A7TA 1UK3A 4FUDA 4ISLA 3FP8E 4YLQH 1GHAG 3PM3A 3SJKA 2FS8A 1TNHA 1WSSH 2EEKA 3A83A 4NWKA 1ZRBA 2ZCLP 5C1YA 4CHAB 3KIDU 4Q7ZA 3M36A 1P57B 1ELCA 1ID5H 1UTQA 2GTBA 2P94A 2ILNA 3SHCH 5JDUB 5J4QA 4X2YA 1MCTA 1XUFA 6CHAB 2OQ5A 1ZYOA 1ZTKA 2P3FH 3QDZB 1NY22 2A7JA 2VINA 1TPOA 1SGPE 1MBQA 4KTUA 5DKMA 4K1TA 4YOJA 2M5TA 3HGNA 2OC8A 1BCUH 3TNSA 3ZZ8A 4ABEA 1HRTH 5A8XA 1C1TA 1N6YA 1D4PB 4FUCA 3SJOA 1HXEH 1ZGIA 4THNH 1E0FD 2Y5GA 3V7TA 3E3TA 1XUIA 2VWMA 1GHXH 1MKWH 4ABHA 2ZTYA 1DX5M 1P2KA 1C1PA 1QRWA 1F2SE 2PW8H 3OX7U 2G51A 2R3YA 5I25A 1DWBH 4AB8A 1ZGVA 1QRXA 2FI4E 2EI7A 1ZHMA 3LGVA 4J2YB 1AZZA 1ORFA 2BXUH 3H7OA 1TRYA 3IG6B 3GY4A 1AB9B 1G3EA 5LGOA 3BV9B 2A1DB 2BB4A 2ZFFH 3PV4A 1V2LT 2QXHA 3TJUA 1A5IA 1WYKA 1GJ4H 3PMAB 2FOBA 3EE0B 4XFQA 1SLWB 1PPFE 1YPGH 4AX9H 3MYWA 1GVLA 2G52A 4YZUA 3SNDA 1C2DA 1CGHA 3PLKA 1WQVH 1H9LB 3LIWA 1TGSZ 2FOCA 2CGAA 1KXFA 1AI8H 3O8RA 2O8WA 4H6SB 2Y7ZA 4JZFH 3MNBA 1CGIE 1HB0B 3SOSA 1A3EH 1UMAH 2JH6D 1SGTA 3FFGA 2H5CA 1GJ9B 1Y8TA 5H4IB 2VIOA 1SQOA 4IC5A 1HIAA 1CA8B 1SGFG 4AFZA 1OWIA 1S83A 2ZHQH 2J95A 1UVSH 2ZDMA 4IW4E 1QIXB 3RMOH 2IOTA 4NFEA 5L30H 1EAWA 3HKJB 4CBNA 5FCKA 4B2BA 1GJ8B 2H5DA 1AU8A 3UUZA 3BEIB 3SGQE 1SGRE 4HGCA 4QT8C 4U32A 1TNLA 1AVWA 1TBRH 3D62A 4DY7B 2SGFE 1C5PA 2VB0A 2BVXH 3U98H 1KTTB 1S81A 2ZDAH 3ZVGA 3T2NA 3TJOA 1K1OA 2Z6BD 2WPKS 1GBKA 1WU1A 4CBOA 2FI5E 4MTBA 5GPIB 3ZVDA 3VXFH 2NU3E 1TMTH 3ITIA 1P06A 4MVNA 5ESTE 2DUCA 2JH0D 1TGNA 2ESTE 1UHBB 2H9EH 3T29A 3MFJA 1E36B 1TOMH 1M9UA 2Z9IA 2BVRH 3DD2H 1EPTA 1G3DA 1FONA 4X1RU 3ZVEA 4RKJB 1RTFB 1AQ7A 2Y7XA 1MD8A 2A2XH 3RU4E 3S7KB 1O3NA 5B6OA 2BY8X 1O3KA 3G01A 4WMEA 5EODA 2P3TB 4K8BA 5TJXA 1A5HA 1BOQA 4DCDA 2VWLA 2FOEA 4O3TA 1UTKA 1GVKB 1SGFA 1FIWA 3P8GA 1C1SA 3A80A 1BRAA 1C5OH 3D23A 2UWLA 1C5MD 4AFSA 1CA0B 1WOFA 4U01A 1ZOMA 3A7YA 1HXFH 4I8LA 1ZPBA 1K1PA 2GMTB 2ZG0H 2BM2A 3B9FH 3GCHC 1T8MA 1MTUA 3M5MA 2VIPA 1O30A 3A7VA 1QNJA 1OXGA 2CV3A 2ZA5A 4FXGH 1TABE 4CR5A 2SGQE 1AD8H 4NGAH 3U9AH 1C4Y2 2DE9A 4JMYA 3UQOA 1K22H 4VGCC 4KTCA 3MU5A 2YOLA 1AUJA 3SORA 1IQHA 2Q6FA 2OBOA 5EXMA 2TGAA 1QB1A 4MNXA 3LJOA 4O9VA 2RG3A 5EW1H 1GJBB 2ZNKH 4YOGA 4A6LA 4AFQA 2BX3A 2G5VA 1SGDE 1HAYB 3SI4H 1HAOH 3DT0H 1GJCB 3V0XA 3TK9A 4DG4A 1IQMA 2K1QA 1HAGE 4NFFA 1O2GH 1Q31A 4BAHB 1MU6B 4X6PA 3A8AA 4E06H 1DOJA 1XM1A 3OY6U 4VGCB 3SHAH 3IITA 2XWAA 1W12U 1LKAA 2UUFB 4ABGA 2JETC 4RSPA 5ABWA 1TNGA 5I46H 1SOTA 3FZDA 3C27B 4WXVA 2UWOA 1A5GH 1HAVB 1A61H 1C2JA 1ELGA 1GHBG 1T32A 4JYUH 4O97A 3M61U 1QJ6B 2GDDA 2RA3A 2ZU2A 1THRH 4CRFA 2QYIA 2ZECA 3GISB 3SN8A 3ZYEA 2V6NA 3RXUA 1LTOA 5HXFA 1DUEA 4K60A 4MQAA 4E7NA 3L6PA 3SU2A 1FN6A 1GBBA 2Z3CA 2AYWA 2GV6A 3ODFA 3RXJA 3SQHE 2ZU4A 2JETB 1GBMA 1HAXB 2BY6X 3F68H 2BLOA 2ZGJA 4Y71A 1CGJE 4NSVA 4BANB 3T25A 5FBEA 3SI3H 1GI2A 1QGFA 5EG4A 1QFKH 1GDUA 2OUAA 1K1NA 1BHXB 1EZQA 5E8EH 3FAOA 3AVZA 1TPPA 1PFXC 3BN9A 3OYPA 1FUJA 2BZAA 2AGIX 5E2OA 5IYTA 2A7HA 2VH0A 1CE5A 1ELAA 2QN5T 5CMXH 2ALPA 2XNIA 4Q2KA 2FXRA 1AKSB 1C1OA 4CRGA 3T62A 2GX4A 1Z7KA 2XRCA 3LC5A 1K1LA 3VGCB 3P95A 2OC1A 3URCA 1P11E 2FTMA 1ZSJA 1DY8A 5EQRA 1EPTC 2QV1A 1A0JA 1RTLA 3RC4A 3KN2A 1SMFE 1UTLM 2HNTC 2EA3A 1TQ0B 1AFEH 2WYJA 3A7ZA 2Z9JA 1O2NA 4H4FA 3PMBB 1XX9A 3ATLA 2H9TH 1TX8A 4H42U 2G8TA 5DP8A 3URDA 1VCPA 1BRBE 2GKVE 3LGIA 2F9OA 1O39A 1YCPM 1D9IA 1GL0E 3MI4A 3P6ZB 4MPVA 1EJMA 1AHTH 1GI9B 2BDGA 1GWAA 2OC7A 3PO1B 4Y79A 4JZ1A 4Y0YE 1QBOA 1TYNA 1F0SA 1NRPH 3ZZ7A 2P59A 1GL1A 3SU4A 1PQ7A 2C8XB 1T4UH 2GZ8A 1SHYA 1Q2WA 1FNIA 1P9UA 3VPKA 5A0BA 4NIWA 5F03A 3PYHA 2ASUB 3SNAA 3SJ8A 1KDQB 3MH7A 5L2YH 1W7XH 2ZHDA 1K1JA 1K1IA 1NM6A 1GBCA 4SGBE 5G4BA 1O2VA 1C5LH 1V2MT 2ZFQH 4K1EA 1P2QA 1D3DB 2ZQ2A 2A0QB 2ZWLH 4Y8XA 1BTHH 3QUMP 2IPHA 5FXLA 1KXAA 1WQSA 1JWTA 3BG8A 2BQ7B 3CENA 1G2MA 1LPKB 2GDEH 1S84A 1VITH 4ABJA 2PKAB 2P8OC 1G3BA 2CF9H 4X6MA 4JZEH 3RXTA 4INKA 4AGJA 1SQAA 4GSOA 1TNJA 2HLCA 5A2MH 1VJAU 4FVDA 1EATA 1QR3E 1Y5UT 3DA9B 3SO3A 2FDAA 3TK5A 1O3MA 1C1UH 1V2PT 1HDTH 4ISIH 1HJAC 1LHFH 2BDHA 4O03A 2ZKSA 1ZMLA 2P8OB 2ZFPH 1DICA 4FUIA 8KME2 2PUXB 1BZXE 5SGAE 2AMDA 4A1VA 3TGJE 4YESB 1N8OC 4AZ2B 4I7YH 3BTEE 1QURH 4OGXA 1O32A 2V3HH 3SV9A 5C5NA 1YC0A 3SV8A 5EU8A 3QO6A 1DS2E 3UREA 1YLCA 4DIHH 2G5NA 1V2QT 3GDVA 5DP6A 5EPYA 3M5NA 1TWXB 1EJAA 3LOXA 4GHQA 4OS1A 4YO9A 1DITH 5FX6A 5A8YA 4MNYA 1WTGH 4GUXA 2SNVA 1ELTA 3H7TA 4UDWH 3A89A 2Y81A 1LQDB 3ELAH 1Z6JH 1P2JA 5T6GA 1ZJKA 4NIYA 1AVGH 1VJ9U 1WCZA 1ZJDA 2ZZUH 3M3VA 1GMHF 1MMJN 3T27A 3R3GB 3HPTB 4XOJA 1YCPH 4FUFA 1U6QA 3PMHB 3O8DA 5DO4H 1YPHE 2BY5X 1C9TA 4ABDA 4Q80A 1IQKA 2Q6GA 5EQQA 1E37B 3RLWH 3PLBA 4NA7A 6GCHF 3RXMA 3NZIA 1BRUP 1LHCH 2FP7B 1D3TB 4CRBA 2VGCC 3UNRA 3RU4D 1SGYE 1W14U 2CJIA 3EAJA 4FUEA 3QN7A 2GT8A 4ZHMU 3M7UA 1P2IA 3BSQA 4LXBH 1IQGA 4OS7A 8LPRA 1XKBC 4DGJA 1MBMA 1MCVA 1O2PA 1Q3XA 3D49H 4B75A 1Z6EA 2WUBA 4ESTE 3KNXA 2VGCB 1GBIA 3KL6A 3AAVA 3RXQA 3CS7A 1UVPA 4ZXYH 3SNCA 4OS5A 1WUNH 5FX5A 1KXBA 1GI7B 5A0CA 1Y3WA 4CHAC 4K69A 4ZH8A 1MD7A 5L2ZH 1D3PB 3ZVBA 1LHEH 5GDSH 3LGUA 1TPSA 4HI3A 3Q3KA 1INCA 1FAXA 1NFWA 3RXHA 3SU0A 2C3SA 5EGMA 5TCAA 6CHAC 1ZLRA 3KCGH 1K1MA 3U8TH 1EX3A 1O3BA 1G3CA 4IGDA 4A1TA 1DDJA 3MH6A 4Q7XA 3DUXH 1O2MA 5AFZH 4YOIA 4IS5A 1UHBA 2BOKA 1YLDA 2AMPA 2TBSA 1GHYH 2BLWA 1AO5A 1B5GH 3EA7A 3C1KA 2JKHA 1UK2A 3ZZAA 2ZDVH 1C2FA 1C1NA 1UTNA 1EP6A 1O2OA 4DOQA 2ZU3A 2H6MA 1HAPH 1QTFA 1ZRKA 1GI3A 3STJA 1EXFA 2FOAA 5F8XA 4FU8A 1KXEA 3ODDA 5CHAB 2W7SA 4BTIB 4RN6A 2V35A 1CO7E 3M5LA 4I8JA 5EW2H 5GWZA 1AIXH 1L4DA 4KELA 3STIA 1GBEA 1K9OE 1O34A 3FVFB 1ZMNA 1D3QB 2GZ7A 4B2AA 1Y5AT 1C9PA 3RXBA 2OQUA 3GCTF 4UFEH 1YGCH 1IQFA 1O3EA 2FYQA 1AB9C 3SUGA 2IJOB 2ZCHP 1THSH 1J14A 1OWJA 3RXPA 1O36A 4WMDA 5LPFA 1KTSB 2AH4X 4ISNA 1CHOG 2D2DA 4X0WU 1GHVH 1OKXA 1C5QA 2HNTE 1P10A 2BDYA 1ANDA 1BA8B 1MTNB 4I31A 2A5AA 1L1GA 3QZQA 2G81E 4FUBA 3IWMA 2C90B 4I32A 7GCHG 1J8AA 1PPCE 1YP9A 1BITA 1V2ST 4X6OA 4INLA 5C2ZA 3Q3YA 3KGPA 1YM0A 1NFXA 1ABIH 2QCYA 3ZYDA 1HAVA 2HOBA 4WY3A 1O3PB 3S9BA 4GVUA 2B5TB 1TX6A 2GP9B 4KP0A 2B7DH 4ZROA 3SGBE 1XXDA 4WMFA 3SQEE 5AF9H 1ACBE 1TRMA 2PGBB 1GDQA 3SU5A 1O2WA 1ZHPA 3MNXA 4BXWA 4AG2A 5EQSA 1YPJH 2Z9KA 4ZHAA 1C5NH 3TH3H 5HM2A 2BVSH 4DURA 1P09A 1XXFA 1FY5A 3O8CA 2F9NA 5L6NH 5PTPA 2Z9GA 1TLDA 1CSOE 2H2ZA 2ZHFH 1BTPA 3V3MA 4BAQB 1GCTB 3P8OA 1SLXB 1O5BB 1PQ8A 1NFYA 3NUMA 1RIWC 4JK6A 4K2YA 3NK8A 2ANYA 3P92A 3DFJA 1K28D 1O3AA 1FXYA 2ZFSA 3ATKA 3BTKE 2GCTC 3SV2H 2PFEA 2R2MB 3GYLB 1O5FH 3NPSA 1LKBA 1O2LA 3BG4B 5FCRA 2GVFA 5C1XA 1A2CH 1C2LA 1MTSA 1TBQH 3LGTA 4FUJA 3SU1A 2WPLS 1RIWB 1OP8A 3KQDA 1RTKA 1V2VT 1AZ8A 4LZ1H 3B8JA 3NXPA 1ANEA 3S7HB 4JZDH 3ZZ3A 3VB6A 1DM4B 2V0BA 1FPHH 1HGTH 2A4QA 1ZR0A 1CA0C 2GCTB 2BDBA 1MZDA 3M3TA 3Q77A 1KSNA 2ZDKA 2GMTC 1O3GA 1S5SA 3UIRA 2KAIB 2XBVA 2EC9H 3SJ9A 2XCFA 2FO9A 1BUIA 2OBQA 3CP7A 1QHRB 2CN0H 2PV9B 4ISHH 3SNEA 3TK6A 1BDAA 3VB4A 2J2UA 1BJVA 3K2UA 2OTVA 1FJSA 1KYNA 4I8KA 3BTGE 1HYLA 1KDQA 6LPRA 2R0LA 1QJ7B 3O8BA 1Y59T 5HMAA 2A4OA 4B74A 3Q00A 4GPGA 1HLTH 4LK4A 1YPHC 1BHXF 4XBDA 1DPOA 2BY9X 2F9UA 3PMJA 4WWYA 1BTXA 1IQNA 4MPUA 2XC0A 3OTJE 1FZZA 1HFDA 3PLPA 3PB1E 2C8ZB 4OS2A 4CR9A 1UVUH 1TMUH 1QJ1B 2YNBA 4MG3A 5EXNA 1O2XA 3EQ0H 3TIUA 4Y7BA 2Y5HA 1CHOF 2QAAA 2PKAA 1TIOA 5DP7A 5FHTA 2FWWA 1AMHA 3AASA 4GHTA 2FX6A 1C1MA 1FAKH 4IN2A 3S9AA 3DFLA 1C2GA 1LVBA 1UTJA 3KQBA 4AB9A 2QXGA 1DANH 3EA8A 4X2WA 1NU9A 2QF3A 7GCHF 3VEQB 1RGQA 1DLEA 1L1NA 1C5XB 1S0RA 4Y6DA 5IDKA 1S6HA 5F8ZA 3SNBA 4AOQA 3LPRA 3F6UH 1O2QA 5DGJA 1UTMA 2Y82A 4K1SA 3HATH 2HALA 3LKWA 1P3CA 2ZCKP 2G4UA 1BTWA 1FY8E 1DWDH 2O8MA 2OD3B 1DLKB 4TWWA 2B0FA 5FPTA 2BDAA 1GI4A 5DP5A 1SGCA 1TONA 1GCDA 1A1RA 1C2EA 1C5TA 1VCWA 2ZPRA 3LJJA 1MAXA 3GCOA 3PWCA 2PTNA 1SHHB 4D7FA 2ZTZA 4B71A 2HNTF 3ZZ5A 1AWHB 1YPLH 2H9HA 2ALVA 1IQIA 1F5LA 4NCYA 1O2KA 1DUAA 1G9IE 1P8VC 1QL8A 1C1VH 1TX7A 4NA9H 4D9RA 1VCQA 4TYDA 1F5RA 2ODYB 1SB1H 3RM2H 3UPEA 1GI8B 4YT6H 1S6FA 1IOEA 2FI3E 1O3HA 4RKOB 5E2PA 3VGCC 2SNWA 3UR9A 2CHAC 1TNKA 1C4V2 1NESE 1GMHG 1VITG 3UTUH 1NPMA 1TNIA 4BAKB 1BMMH 1MTWA 1TA6A 2ZU5A 1NRNH 1SVPA 4GLYA 3VB7A 2FLBH 2WINI 1LVMA 2J34A 3AW1A 1SR5C 1OWDA 1OWKA 4F4OC 5JB9S 3A8BA 3M7QA 1E34B 4X1NU 1EB2A 1ZSLA 3A8CA 1MQ6A 2FIRH 5F8TA 1ELBA 1CU1A 1UCYK 4UD9H 6GCHG 2WPMS 3U1JB 2XXLA 3OSYA 2VNTA 2CHAB 4X8TH 4GCHF 2G00A 1GJ7B 5C67A 2VH6A 3P8FA 2C8WB 2QC2A 1THPB 3PO1C 5A0AE 2Z9LA 1BMLA 2F3CE 1QY6A 3P8NA 2A32A 2BXTH 1O2TA 1YBWA 2P95A 3F9HA 1TMBH 1JRTA 1P2NA 2FS9A 3R0FA 3P70B 1V2RT 1KLIH 1KXDA 4D8NA 1WV7H 3ZZCA 2AERH 3RXIA 3TJNA 1DSTA 1T4VH 1V2OT 1NZQH 1V3XA 3E8LA 4K8YA 1YPEH 1AE5A 5DK1A 1VZQH 1V2JT 1ELVA 1GBAA 2VIQA 1EP5A 3HK6B 1NT1A 5C20A 1P3EA 3TH2H 4X8VH 1LVYA 4JK5A 5AHGH 3TU7H 4UONA 1LPZB 1PPZA 3ESTA 3V13A 4BTTB 2GD4B 4WXIA 3E16B 2TPIZ 4UFGH 1YKTA 1O2JA 3GY8A 1XVMA 1O5EH 2OC0A 5ETXA 3TH4H 1FDPA 2XTTB 2FESH 2NU0E 4NZQA 5CE1A 4TY7A 1NFUA 1OS8A 5EOKA 1BQYA 1EB1H 5E0HA 2ZFRH 4A5TS 2BD7A 2W3KA 4KGAA 1MAYA 2ZIQH 1GJAB 2I6QA 2G4TA 2ZC9H 3A88A 3A84A 4ZXXH 3NWUA 2ZPSA 2D1JA 3F9FA 3RXCA 1GPZA 1C1WH 1BT7A 1C2KA 2BHGA 3K65B 1GG6B 3F9GA 2BX4A
chains in the Genus database with same CATH superfamily
2BD9A 3TNTA 1SQTA 2PSYA 4YM9A 1TGCA 2NU2E 2AEIH 1HAZB 3GCTG 3MU1A 4UEHH 3ATWA 4PROA 1ABJH 2KCAA 4XDEA 2AMQA 2J5UA 1A7SA 1ELFA 3QWCH 2XYAA 5F6MA 1XKAC 2XCNA 4Y8YA 1E1RD 5LPRA 1TQ7B 1H8DH 3QGJA 5FPSA 5GIBA 3ZZDA 5T1VA 1AY6H 3E91A 4YLUA 4ZHLU 1K21H 1GBFA 4ZCNA 2BLVA 1IQEA 4ZAEA 1SI5H 3Q3XA 1XUGA 2WPIS 3LC3A 1G37A 2TIOA 2UUKB 3QZRA 4B73A 1JIRA 4DVAU 5JYIA 5ESBA 5J4SA 1SSXA 1S0QA 1SKYE 2I6SA 3L3TA 1C5ZB 3FN8A 3EE7A 3MHWU 3SV7A 1C4U2 1W0ZU 4FUGA 2SGEE 1TA2A 1IQLA 4LOYH 1NS3A 3MNSA 8ESTE 3FP7E 2ZDNA 4NWLA 1SLUB 1SPJA 4MNWA 5E0JA 3S0NA 1QQUA 4XBCA 2FEQH 2ZTXA 1JXPA 2F9VA 1QBNA 1A3BH 1VITF 1VGCB 4BNRA 4ISOA 1W8BH 1TAWA 2Q6DA 3A86A 2QGRA 1LVOA 1P03A 1UJ1A 2CK3D 3RXEA 1EKBB 1MKXK 1XVOA 2TGPZ 3UNQA 2HRVA 2HWLB 2F83A 1ETTH 2EI8A 1SGEE 2GZ9A 3E1XB 1O2SA 1XUHA 2CXVA 4WH8A 5DP4A 2ZF0H 3U69H 1CBWC 1QB6A 4CH8B 2G55A 1GBJA 2HLDD 3SU6A 1E1QD 3EA9A 1UVTH 2KCPA 3T5FH 2ZHEH 1H9IE 4MPWA 3LH1A 2UUYA 2OXSA 2TGTA 1Y5BT 4ZKRU 4TSFD 1J16A 5FAHA 1CHGA 1EOJA 3QX5H 1HUTH 4TPYA 3RMLH 1P05A 1J17T 2PSXA 1L4ZA 1CBWB 1OWEA 1TALA 6ESTA 2QA9E 2Q1JA 1GDNA 1IHSH 1GMCG 2A45B 2XW9A 1ZZZA 4JCNA 7LPRA 1AVXA 4TPIZ 3RM0H 2BOHB 1AGJA 1OP2A 2BD8A 3M3SA 3AAUA 2Y5FA 2QY0B 3RXSA 2CMYA 2J94A 4FETA 2PKSB 4FUHA 2FYRA 5CHAC 1P01A 2C4FH 1UTPA 1QL9A 3GCNA 2PHBA 1V2NT 1GMDG 1SGNE 1GJ6A 1BIOA 3F1SB 2BMGB 2RDEA 3K6ZA 4FOUC 2VVVA 1F0UA 5C1UA 3GY6A 1EAIA 2ULLA 3EDXB 1HCGA 3RDZA 1KIGH 3RMMH 2VVCA 3BEFB 3I29A 1TGBA 1PQ5A 8GCHG 4MNVA 1QCPA 4YXWD 3W94A 1Z1IA 4U30A 2J9NA 1DFPA 1Z8RA 3BTTE 4Y11E 1FQ3A 4OGYA 3FANA 3GYMA 2J4IA 4NIVA 1N6XA 1RFNA 4DT4A 3HGPA 2A5KA 4XSKU 4FU7A 2ZDLA 1O31A 2QF0A 1OP0A 1MTNC 1E35B 4F49A 1EQ9A 3LH3A 1BTZA 1IHTH 1OPHB 2BQ6B 2V3MA 3F3BA 3MU0A 5AFYH 1O3JA 1FY1A 3KEEA 4YT7H 1BBRK 1O37A 2A7CA 1EAXA 3GY3A 1ESBA 1FN8A 1OOKB 3AK5A 2FMJA 4D7GA 2HGTH 3PTBA 5AVDA 1UCYE 3SU3A 1ETSH 3U1IB 3SUDA 1BRCE 1LCYA 2GGVB 2BLQA 1DE7H 1V2TT 1NU7B 4CRDA 1YCPK 4FVBA 1BJUA 1SGIB 2GT7A 5DN6D 4D9QA 2Y80A 1O2ZA 2ZO3H 5BPEA 5GXPA 2BZ6H 2BD4A 1H8IH 3QTVH 2B9LA 1O2IA 4IMZA 2ZHWH 4X1QU 5A8ZA 2FM2A 2RA0A 2A4RA 2F9PA 1CT4E 3SUEA 3U8OH 4DW2U 2LNCA 2XBYA 1FIZA 3ZVFA 1V2UT 4P00A 2JIZD 1GBHA 2ANMH 1PQAA 3E6PH 4ACAA 4MPXA 2ODPA 1S82A 3MWIU 3M7TA 3Q76A 2SFAA 1Z8GA 3MMGA 3MU4A 2AFQB 2XC5A 1FPCH 1XMNB 4H6TA 4B76A 1C1QA 1E38B 2GCHF 1GCTC 1QA0A 3JZ2B 1C5RA 1AFQC 3AW0A 5HYOA 1HPGA 4BXSA 1BTYA 5DP9A 1OYQA 2OCVB 3S9CA 1NROH 1X7AC 4IBLH 3TVJB 1RD3B 3RXRA 3SUFA 1Y3YA 4OS4A 5LH8A 1QB9A 3QTOH 1ANBA 1ARCA 3BG4C 1TGTA 2VU8E 3RXKA 2ZGCA 2YNAA 1B0EA 1AFQB 1O3DA 3K6YA 4FU9A 1N1LA 4ZMAH 1T31A 1AKSA 4JYVH 3RC5A 4OS6A 1HNEE 2WUCA 1J9CH 1FY3A 1Z8JB 1LDTT 3GDUA 2FOFA 3BIVH 4CREA 1AWFH 1P04A 2UWPA 5JBCS 1NTPA 4GCHG 1LHGH 1VR1H 1GMCF 3TGKE 4Q63A 1NRRH 3UY9A 2BTCE 1AUTC 2TGDA 1PYTC 5K0HA 4SGAE 5GCHF 1JRSA 2Y6TA 9ESTA 3ZVAA 1PPEE 4JYTA 2VWNA 1V2KT 1C5WB 4IC6A 3U8RH 1JIMA 4AG1A 1TPAE 1JBUH 3MTYA 3M37A 3B23B 3T28A 4B1TA 1OX1A 1SBWA 1ARBA 1GMDF 4NG9H 3ATIA 1G32B 4GAWA 1C5SA 2NU4E 2O9QA 3RP2A 1G30B 2QIQA 1XUKA 2JH5D 4BTUB 2ODQA 1TBZH 2AGGX 2VJ1A 4XE4A 1Y3UA 3OU0A 3GY5A 3UQVA 2WV4A 4TWYA 8GCHF 3KF2A 2PWXA 1MKWK 1O3CA 1DY9A 5JPMH 2ZGXH 1LMWB 1O2YA 4R0IA 4Y8ZA 3UFAA 1A46H 2ZU1A 1S85A 1PYTD 2BDCA 1C2HA 2ZQ1A 1V6DA 3M5OA 1GHAF 2HVYB 2VVUA 3HK3B 1O35A 2PTCE 3A81A 2XC4A 1UCYH 1Z8IB 1TE0A 1BTUA 5HIZA 3N7DA 2P16A 4B6EA 1GJDB 4Y10E 4CH2B 3GOVB 1LO6A 1A0HB 1MQ5A 1O2HA 1ZTJA 1EZSC 3BTME 2UUJB 4Y7AA 2FTLE 2A4GA 3ATMA 5KEDA 1A4WH 5BRRE 2GV7A 1P2MA 2BQWB 3MNCA 2IN2A 4JZIA 3ZZ9A 1F5KU 2ANKH 2VWOA 3D65E 2WV5A 1KLTA 1O5CB 4Y0ZE 3V12A 5DG6A 4DT7B 1DVAH 1O3OA 3VB5A 1W7GH 1JMOH 1G36A 3NKKA 1ZTLA 3MO9A 2J38A 2D8WA 1GHZA 3U28C 1SFIA 1DXPA 1EAUA 1FMGA 3RXFA 5FBIA 4X1PU 3MH5A 4NSYA 4ASUD 2NWNA 1GJ5H 2EI6A 3H5CB 4MDSA 1Z1JA 3GCHB 1XUJA 4ABAA 5T6FA 1SC8U 2HPQH 1YPMH 1ANCA 1ZSKA 1NN6A 2ZI2H 1GBTA 4ABIA 2KZ4A 1O33A 3LT3A 4NIXA 1HJ9A 3VFEA 4E7RG 1F0TA 1P02A 5DPAA 4ZKSU 2RFKC 1QA7A 4TY6A 1SG8B 5DP3A 1T8NA 1V2WT 4X2VA 1COWD 1L0ZA 3RLYH 4CRCA 1SLVB 1GVZA 1YYY1 3TLOA 1CT0E 3ZV8A 1TRNA 1T8OA 1GGDC 3GY7A 3KQCA 3F9EA 2JJ1D 1ESTA 3LU9B 2A5IA 3M35A 4WVPE 2PR3A 1OYTH 2TRMA 1GI6A 4WJG2 3UOPA 1F7ZA 2H1UA 3BEUA 1WXRA 3RXGA 2VIWA 2ZPQA 1MTVA 2ZP0H 1ELEE 1FLEE 2D26C 2OLGA 1AN1E 4MLFB 3RXDA 4UFFH 1DT2A 1HIAB 1PPGE 1W13U 1LPGB 3BTWE 3GDSA 2OK5A 4BAOB 4B6FA 1GGDB 5CHBA 2WPJS 4ABBA 4HTCH 1BMNH 1H4WA 1D6WA 2STBE 4NZLA 3F2FA 3BF6H 1QL7A 4X8UH 1ELDE 1H9HE 3BTHE 3MO3A 3F0PA 1NC6A 2FLRH 4INHA 1IQJA 3A87A 1GI1A 1T8LA 4U2WA 3TGIE 1O3LA 2ZFTA 3HKIB 4A1XA 1D6RA 4ASHA 1P12E 1W10U 2OINA 2FODA 3LONA 4J1YA 4AYYB 1HJ8A 2W5EA 4XBBA 1MZAA 1C5UA 4ZKOU 1F92A 1O0DH 1UTOA 1MU8B 3MOCA 1SL3A 3A82A 1BBRE 4X2XA 4BAMB 1BMAA 3RC6A 1YF4A 3N7OA 3RXAA 1B7XB 2A2QH 1TOCB 4YTAA 1TB6H 2R2WU 1EZUC 1FI8A 3A7WA 4Z0KA 3KQEA 1AE8H 4RT1A 4D76A 2FOGA 2AS9A 2STAE 4UE7H 1IAUA 1VKYA 3E0PB 3SJIA 5JBAS 2WYGA 2O8UA 5TCCA 1L1JA 2HPPH 3SZNA 2FX4A 3OAAD 4AN7A 3RU4T 1CQQA 1QQ4A 1SGQE 1HAIH 4HFPB 3SV6A 3MQKC 3MU8A 3ZZBA 1C2IA 1OWHA 1ZPCA 4IMQA 1A0LA 1L2EA 1O3FA 1W2KH 2HVXA 3A7XA 2A31A 1J15A 2Z3EA 1EPTB 1MKXH 1ESAA 3FZZA 1UVOA 1ZHRA 1MH0A 2W7UA 3UR6A 1CT2E 3K9XB 4Y76A 4KTSA 1GG6C 4O3UA 5C5OA 3QLPH 1C5VA 2QXJA 4X6NA 4Z6AH 2THFB 1KXCA 4LZ4B 1K2I1 1NO9H 3PTNA 3ZZ4A 1MUEB 1RS0A 5EPNA 1GBLA 3NCLA 4CRAA 4UFDH 1HAHH 1SFQB 1HBTH 1RRKA 4TT3D 5EXLA 4DJZB 2ZGHA 2SGPE 1FY4A 4ZKNU 3RMNH 2WZQA 3BTFE 1DWEH 2WPHS 3RXLA 1ZMJA 3TPIZ 1CVWH 4K5ZA 1YPKH 1O2RA 3W95A 3SW2B 1UO6A 1EASA 1GHWH 2F9BH 1EZXC 1C2MA 3MO6A 2XWBI 4Q7YA 1S6LA 2BD3A 9LPRA 1WTHD 1P9SA 3LGWA 1LQEA 2BY7X 1O38A 2VIVA 2P93A 4ZUHA 2CF8H 3ZV9A 5LPEA 4XRNA 1FX0B 3WW7A 2AGEX 3WY8A 3QGNB 1WAYB 3UB0A 4KKDA 1UK4A 1TFXA 4WH6A 2XBWA 1GI5A 4BOHA 1EUFA 4AORA 1RJXB 1VGCC 1C1RA 1W0YH 5FPYA 3RUOA 2PGQB 4A92A 1KY9A 2EY4C 1BB0B 2C8YB 1GHBF 4R8TB 1Y3XA 1H8HD 2W3IA 3E90B 1PPBH 3L33A 3T26A 3F0OA 3LGYA 4ABFA 1Y3VA 4I8HA 4A7IB 4WF8A 3MH4A 1OSSA 1EOLA 7KMEH 2BD5A 3ZZ6A 1H1BA 1HV7A 2RDLA 3VXEH 2OP9A 1HJAB 3RXVA 1LHDH 3BIUH 2GCHG 4X1SU 2ANWA 2R3UA 5T3HA 4HZHA 1WBGB 1G2LA 4M7GA 1P0SH 3UNSA 1GBDA 4AYVB 1DXWA 1GI0A 1BBRH 4I33A 3PROA 2BDIA 1N8OB 5JBTA 3UWJH 3ENSB 2BD2A 4X8SH 3A85A 4K3JA 2V3OH 4AFUA 1W11U 5JBBS 4DIIH 2J98B 1F0RA 3DHKH 4I8GA 1O3IA 3SBKA 2AIPA 2W26A 2F91A 1SOZA 2ZGBH 3QK1A 1PPHE 3A8DA 2FPZA 4NA8A 2PKSC 3TJVA 2IPQX 5JB8S 2B8OH 3GY2A 2O8LA 4E05H 2RCEA 5GJ4B 1O5DH 2FOMB 1W3CA 3SGAE 3ZVCA 2KFWA 1QBVH 1B0FA 1QRZA 3E0NB 4IN1A 1Z71A 3BTDE 1C5YB 1KLJH 3PWBA 2FZZA 3BTQE 1T7CA 1P2OA 2PUQH 2XBXA 3I77A 3JZ1B 3I78A 3OY5U 2R9PA 1RXPA 2Z7FE 2SGAA 5GCHG 5T6DA 3P17H 1O5AB 1DWCH 5C94A 1DSUA 2NU1E 3UWIA 3KHVA 2VIDA 2W6JD 3WWBA 1O5GH 1NRQH 1JOUB 5DJ7A 3RXOA 4B2CA 7ESTE 5HM9A 1PJPA 2Z94A 3EYDA 5HGGA 3LDXH 2O8TA 1ZPZA 1W0JD 2LPRA 3S69A 5K7RA 2P3UB 3SZEA 2DE8A 1EJNA 2QXIA 3EGKH 3CS0A 5E0GA 2C93B 2FOHA 3FP6E 1ETRH 5C3NA 2BYAX 2PLXA 2KAIA 3TITA 1NRSH 3VB3A 2R0KA 4AGKA 3UOUA 1O2UA 5A09A 2Z3DA 2ZEBA 2AIQA 3GICB 1FV9A 2J92A 2SGDE 3A7TA 1UK3A 4FUDA 4ISLA 3FP8E 4YLQH 3DSPA 1GHAG 3PM3A 3SJKA 2FS8A 1TNHA 5EJ1A 1WSSH 2EEKA 3A83A 4NWKA 1ZRBA 2ZCLP 5C1YA 4CHAB 3KIDU 4Q7ZA 3M36A 1P57B 1ELCA 1ID5H 1UTQA 2GTBA 2P94A 3H09A 2ILNA 3SHCH 5JDUB 5J4QA 4X2YA 1MCTA 1XUFA 6CHAB 2OQ5A 1ZYOA 1ZTKA 2P3FH 3QDZB 1NY22 2A7JA 2VINA 1TPOA 1SGPE 1MBQA 4KTUA 5DKMA 4K1TA 4YOJA 2M5TA 3HGNA 2OC8A 1BCUH 3TNSA 3ZZ8A 4ABEA 1HRTH 5A8XA 1C1TA 5F53A 1N6YA 1D4PB 4FUCA 3SJOA 1HXEH 1ZGIA 4THNH 1E0FD 2Y5GA 3V7TA 3E3TA 1XUIA 2VWMA 1GHXH 1MKWH 4ABHA 2ZTYA 1DX5M 3PV5A 1P2KA 1C1PA 1QRWA 1F2SE 2PW8H 3OX7U 2G51A 2R3YA 5I25A 1DWBH 4AB8A 1ZGVA 1QRXA 2FI4E 5FL7D 2EI7A 1ZHMA 3LGVA 4J2YB 1AZZA 1ORFA 2BXUH 3H7OA 1TRYA 3IG6B 3GY4A 2QF5A 5HKKD 1AB9B 1G3EA 5LGOA 2YMSB 3BV9B 2A1DB 2BB4A 2ZFFH 3PV4A 1V2LT 2QXHA 3TJUA 1A5IA 1WYKA 1GJ4H 3PMAB 2FOBA 3EE0B 4XFQA 1SLWB 1PPFE 1YPGH 4AX9H 3MYWA 1GVLA 2G52A 3OEED 4YZUA 3SNDA 1C2DA 1CGHA 3PLKA 1WQVH 1H9LB 3LIWA 3SYJA 1TGSZ 2FOCA 2CGAA 1KXFA 1AI8H 3O8RA 2O8WA 4H6SB 2Y7ZA 4JZFH 3MNBA 1CGIE 1HB0B 3SOSA 1A3EH 1UMAH 2JH6D 4OM9A 1SGTA 3ZIAD 3OEHD 3FFGA 2H5CA 1GJ9B 1Y8TA 5H4IB 2VIOA 1SQOA 4IC5A 1HIAA 1CA8B 1SGFG 4AFZA 4XD7D 1OWIA 1S83A 5EJLA 2ZHQH 2J95A 1UVSH 2ZDMA 4IW4E 1QIXB 3RMOH 2IOTA 4NFEA 5L30H 1EAWA 3HKJB 4CBNA 5FCKA 4B2BA 1GJ8B 2H5DA 1AU8A 3UUZA 3BEIB 3SGQE 1SGRE 2EQNA 4HGCA 4QT8C 4U32A 1TNLA 1AVWA 1TBRH 3D62A 2K0QA 4DY7B 2SGFE 1C5PA 2VB0A 2BVXH 3U98H 1KTTB 1S81A 1H8ED 2ZDAH 3ZVGA 3T2NA 3TJOA 1K1OA 3KQ5A 2Z6BD 2WPKS 1GBKA 1WU1A 1SQRA 4CBOA 2FI5E 4MTBA 5GPIB 1KMHB 3ZVDA 3VXFH 2NU3E 1TMTH 3ITIA 1P06A 4MVNA 5ESTE 2DUCA 2JH0D 1TGNA 2ESTE 1UHBB 4F48B 2H9EH 3T29A 2L74A 3MFJA 1E36B 1TOMH 1M9UA 2Z9IA 2BVRH 3DD2H 1EPTA 1G3DA 1FONA 4X1RU 3ZVEA 1UW7A 4RKJB 1RTFB 1AQ7A 2Y7XA 1MD8A 2A2XH 3RU4E 3S7KB 1O3NA 5B6OA 2BY8X 1O3KA 3G01A 4WMEA 5EODA 2P3TB 4K8BA 5TJXA 1A5HA 1BOQA 4DCDA 2VWLA 2FOEA 4O3TA 1UTKA 1GVKB 1SGFA 1FIWA 3P8GA 1C1SA 3A80A 1BRAA 1C5OH 3D23A 2UWLA 1C5MD 4AFSA 1CA0B 1WOFA 4U01A 1ZOMA 3A7YA 1HXFH 4I8LA 1ZPBA 1K1PA 2GMTB 2ZG0H 2BM2A 3B9FH 3GCHC 1T8MA 1MTUA 3M5MA 2VIPA 1O30A 3A7VA 1QNJA 1OXGA 2CV3A 2ZA5A 4FXGH 1TABE 4CR5A 2SGQE 1AD8H 4NGAH 3U9AH 1C4Y2 2DE9A 4JMYA 3UQOA 1K22H 4VGCC 4KTCA 3MU5A 2YOLA 1AUJA 3SORA 1IQHA 2Q6FA 2OBOA 5EXMA 2TGAA 1QB1A 4MNXA 3LJOA 4O9VA 2RG3A 1YY3A 5EW1H 1GJBB 2ZNKH 4YOGA 4A6LA 4AFQA 2BX3A 2G5VA 1SGDE 1HAYB 3SI4H 1HAOH 3DT0H 1GJCB 3V0XA 3TK9A 4DG4A 1IQMA 2K1QA 1HAGE 4NFFA 1O2GH 1Q31A 4BAHB 1MU6B 4X6PA 3A8AA 4E06H 1DOJA 1XM1A 3OY6U 4VGCB 3SHAH 5KGOA 4Q4LA 3IITA 2XWAA 1W12U 1LKAA 2UUFB 4ABGA 2JETC 4RSPA 3DSOA 1TNGA 5ABWA 1SOTA 5I46H 3FZDA 3C27B 4WXVA 2UWOA 1A5GH 1HAVB 3PRDA 3KYFA 1A61H 2PP6A 5B6LA 1C2JA 1ELGA 1GHBG 1T32A 4JYUH 4O97A 3FKSD 3M61U 1QJ6B 2GDDA 2RA3A 2ZU2A 1THRH 4CRFA 2QYIA 2ZECA 3GISB 5C17A 3SN8A 3ZYEA 2V6NA 3RXUA 1LTOA 5HXFA 1DUEA 4K60A 4MQAA 4E7NA 3L6PA 3SU2A 1FN6A 1GBBA 2Z3CA 2AYWA 2GV6A 3ODFA 3RXJA 3SQHE 2ZU4A 2JETB 1GBMA 1HAXB 2BY6X 3F68H 3UAIC 2BLOA 2ZGJA 4Y71A 1CGJE 4NSVA 4BANB 3T25A 5FBEA 3SI3H 1GI2A 1QGFA 2M2AA 5EG4A 1QFKH 1GDUA 2OUAA 1K1NA 1BHXB 1EZQA 5E8EH 3FAOA 3AVZA 5C0TA 1TPPA 1PFXC 3BN9A 3OYPA 1FUJA 2BZAA 2AGIX 5E2OA 5IYTA 2A7HA 2VH0A 1CE5A 2J98A 1ELAA 2QN5T 5CMXH 2ALPA 2XNIA 4Q2KA 2FXRA 1AKSB 2WPDD 2AHME 1C1OA 4CRGA 1BMFD 3T62A 2GX4A 1Z7KA 2XRCA 3LC5A 1K1LA 3VGCB 3P95A 2OC1A 3URCA 1P11E 2FTMA 1ZSJA 1DY8A 5EQRA 1EPTC 2QV1A 1A0JA 2VBCA 1RTLA 3RC4A 3KN2A 1SMFE 4ACBA 1NBMD 1UTLM 2HNTC 2EA3A 1TQ0B 1AFEH 2WYJA 3A7ZA 2Z9JA 1O2NA 4H4FA 3PMBB 1XX9A 3ATLA 2H9TH 1TX8A 4H42U 2G8TA 5DP8A 3URDA 1VCPA 1BRBE 2GKVE 3LGIA 2F9OA 1O39A 1YCPM 1D9IA 1GL0E 3MI4A 3P6ZB 4MPVA 1EJMA 1AHTH 1GI9B 2BDGA 1GWAA 2OC7A 3PO1B 4Y79A 4JZ1A 4Y0YE 1QBOA 1TYNA 1F0SA 1NRPH 3ZZ7A 2P59A 1GL1A 3SU4A 1PQ7A 2C8XB 1T4UH 2GZ8A 1SHYA 1Q2WA 1FNIA 1P9UA 3VPKA 5A0BA 4NIWA 5F03A 3PYHA 2ASUB 3SNAA 3SJ8A 1KDQB 3MH7A 5L2YH 2L6OA 1W7XH 2ZHDA 1K1JA 1K1IA 1NM6A 1GBCA 5EIYA 4SGBE 5G4BA 1O2VA 1C5LH 3OTPA 1V2MT 2ZFQH 4K1EA 1P2QA 1D3DB 2ZQ2A 2A0QB 2ZWLH 4Y8XA 1BTHH 3QUMP 2IPHA 5FXLA 1KXAA 1WQSA 1JWTA 3BG8A 3GS9A 2BQ7B 3CENA 4P02A 1G2MA 1LPKB 2GDEH 1S84A 1VITH 2J97A 4ABJA 2PKAB 2P8OC 1G3BA 2CF9H 4X6MA 4JZEH 3RXTA 4INKA 4AGJA 1SQAA 4GSOA 1TNJA 2HLCA 5A2MH 1VJAU 4FVDA 5CDFE 1EATA 1QR3E 2WSSD 1Y5UT 3DA9B 2V7QD 3SO3A 2FDAA 3TK5A 1O3MA 1C1UH 1V2PT 1HDTH 4ISIH 4AC9A 1HJAC 1LHFH 2BDHA 4O03A 2ZKSA 1ZMLA 2P8OB 2ZFPH 1DICA 4FUIA 8KME2 2PUXB 1BZXE 5SGAE 2AMDA 4A1VA 3TGJE 4YESB 1N8OC 4AZ2B 4I7YH 3BTEE 1QURH 4OGXA 1O32A 2V3HH 3SV9A 5C5NA 1YC0A 3SV8A 2F4LA 5EU8A 3QO6A 1DS2E 3UREA 1YLCA 4DIHH 2G5NA 1V2QT 3GDVA 5DP6A 5EPYA 3M5NA 1TWXB 1EJAA 3LOXA 4GHQA 4OS1A 4YO9A 1DITH 5FX6A 1QZ8A 5A8YA 4MNYA 1WTGH 4GUXA 2SNVA 1ELTA 3H7TA 4UDWH 3A89A 2Y81A 1LQDB 3ELAH 1Z6JH 1P2JA 5T6GA 1ZJKA 3DSGA 4NIYA 1AVGH 1VJ9U 1WCZA 1ZJDA 2ZZUH 3M3VA 1GMHF 2KM0A 1MMJN 3T27A 3R3GB 3HPTB 2XOKD 4XOJA 2W6ID 1YCPH 4FUFA 1U6QA 4HG6A 3PMHB 3O8DA 5DO4H 1YPHE 2BY5X 1C9TA 4ABDA 4Q80A 1IQKA 2Q6GA 5EQQA 1E37B 3RLWH 3PLBA 4NA7A 6GCHF 3RXMA 3NZIA 1BRUP 1LHCH 2FP7B 1D3TB 4CRBA 2VGCC 2QE7D 3UNRA 3RU4D 1SGYE 1W14U 3N99A 2CJIA 3EAJA 4FUEA 3QN7A 2GT8A 5HIYA 4ZHMU 3M7UA 1P2IA 3BSQA 4LXBH 1IQGA 4OS7A 3VG8A 8LPRA 1XKBC 4DGJA 1MBMA 1MCVA 1O2PA 1Q3XA 3D49H 4B75A 1Z6EA 2WUBA 4ESTE 3KNXA 2VGCB 1GBIA 3KL6A 3AAVA 3RXQA 3CS7A 1UVPA 4ZXYH 3SNCA 4OS5A 1WUNH 5FX5A 1KXBA 1GI7B 5A0CA 1Y3WA 4CHAC 4K69A 4ZH8A 1MD7A 5L2ZH 1D3PB 3ZVBA 2KR7A 1LHEH 5GDSH 3LGUA 1TPSA 2K8IA 4HI3A 3Q3KA 1INCA 1FAXA 1NFWA 3RXHA 3SU0A 2C3SA 5EGMA 5TCAA 6CHAC 1ZLRA 3KCGH 1K1MA 3U8TH 1EX3A 1O3BA 1G3CA 4IGDA 4A1TA 1DDJA 3MH6A 4Q7XA 3DUXH 1O2MA 5AFZH 4YOIA 4IS5A 2KX4A 1UHBA 2BOKA 1YLDA 2AMPA 2TBSA 3NRLA 1GHYH 2BLWA 1AO5A 1B5GH 3EA7A 3C1KA 2JKHA 1UK2A 3ZZAA 2JDID 2ZDVH 1C2FA 1C1NA 1UTNA 1EP6A 1O2OA 4DOQA 2ZU3A 2H6MA 1HAPH 1QTFA 1ZRKA 1GI3A 3STJA 1EXFA 2FOAA 5F8XA 4FU8A 1KXEA 3ODDA 5CHAB 2W7SA 2LP6A 4BTIB 1NBME 4RN6A 2V35A 1CO7E 3M5LA 4I8JA 5EW2H 4Z1MD 2QF4A 5GWZA 1AIXH 1L4DA 4KELA 3STIA 1GBEA 1K9OE 1O34A 3FVFB 1ZMNA 1D3QB 2GZ7A 4B2AA 1Y5AT 1C9PA 3N7EA 3RXBA 2OQUA 3GCTF 4UFEH 1YGCH 1IQFA 1O3EA 2FYQA 1AB9C 3SUGA 2YMSC 2IJOB 2ZCHP 1THSH 1J14A 1OWJA 3RXPA 1O36A 4WMDA 5LPFA 1KTSB 2AH4X 4ISNA 1CHOG 2D2DA 4X0WU 1GHVH 1OKXA 2XNDD 1C5QA 2HNTE 1P10A 2BDYA 1ANDA 1BA8B 1MTNB 4I31A 2A5AA 1L1GA 3QZQA 2G81E 5C0UA 4FUBA 2LELA 3IWMA 2C90B 4I32A 7GCHG 1J8AA 3FO8D 1PPCE 1YP9A 1BITA 2YMSD 1V2ST 4X6OA 4INLA 5C2ZA 3Q3YA 3KGPA 1YM0A 1NFXA 1ABIH 2QCYA 3ZYDA 1HAVA 2HOBA 4WY3A 1O3PB 3S9BA 4GVUA 2B5TB 2GJGA 1TX6A 2GP9B 4KP0A 2B7DH 4ZROA 5IK2D 3SGBE 1XXDA 4WMFA 3SQEE 3OE7D 5AF9H 1ACBE 1YWUA 1TRMA 2PGBB 1GDQA 3SU5A 1O2WA 1ZHPA 3MNXA 4BXWA 4AG2A 5EQSA 1YPJH 2Z9KA 4ZHAA 1C5NH 5EJZA 3TH3H 5HM2A 2BVSH 4DURA 1P09A 1XXFA 1FY5A 3O8CA 2F9NA 5L6NH 5PTPA 2Z9GA 1TLDA 1CSOE 2H2ZA 2ZHFH 1BTPA 3V3MA 4BAQB 1GCTB 3P8OA 1SLXB 1O5BB 1PQ8A 1NFYA 3NUMA 1RIWC 4JK6A 4K2YA 3NK8A 2ANYA 3P92A 3DFJA 1K28D 1O3AA 1FXYA 2ZFSA 3ATKA 3BTKE 2GCTC 3SV2H 2PFEA 2R2MB 3GYLB 1O5FH 3NPSA 3FOAA 1LKBA 1O2LA 3BG4B 5FCRA 2GVFA 5C1XA 1A2CH 1C2LA 1MTSA 1TBQH 3LGTA 4FUJA 3SU1A 2WPLS 1RIWB 1OP8A 3KQDA 1RTKA 1V2VT 1AZ8A 4LZ1H 3B8JA 3NXPA 1ANEA 3S7HB 1K0HA 4JZDH 3ZZ3A 3VB6A 5DSFA 1DM4B 2V0BA 1FPHH 1HGTH 2A4QA 1ZR0A 1CA0C 2GCTB 2BDBA 1MZDA 3M3TA 3Q77A 1KSNA 2ZDKA 2GMTC 1O3GA 1S5SA 3UIRA 2KAIB 2XBVA 2EC9H 3SJ9A 2XCFA 1E79D 2FO9A 1BUIA 2OBQA 3CP7A 1QHRB 2CN0H 2PV9B 4ISHH 3SNEA 3TK6A 1BDAA 3VB4A 2J2UA 1BJVA 3K2UA 2OTVA 1FJSA 1KYNA 4I8KA 3BTGE 1HYLA 1KDQA 4I86A 6LPRA 2R0LA 1QJ7B 3O8BA 1Y59T 5HMAA 2A4OA 4B74A 3Q00A 1WDIA 4GPGA 1HLTH 4LK4A 1YPHC 2JJ2D 1BHXF 4XBDA 1DPOA 2BY9X 2F9UA 3PMJA 4WWYA 1BTXA 1IQNA 4MPUA 2XC0A 3OTJE 1FZZA 1HFDA 3PLPA 3PB1E 2C8ZB 4OS2A 4CR9A 1UVUH 4RI0A 1TMUH 1QJ1B 2YNBA 4MG3A 5EXNA 1O2XA 3EQ0H 3TIUA 4Y7BA 2Y5HA 4RT0A 1CHOF 2QAAA 2PKAA 1TIOA 5DP7A 5FHTA 2FWWA 1AMHA 1MABB 3AASA 4GHTA 2FX6A 3F2HA 1C1MA 1FAKH 4IN2A 3WWFA 3S9AA 3DFLA 1C2GA 1LVBA 1UTJA 3KQBA 4AB9A 2QXGA 1DANH 3EA8A 4X2WA 1NU9A 2QF3A 7GCHF 3VEQB 1RGQA 1DLEA 1L1NA 1C5XB 1S0RA 4Y6DA 5IDKA 1S6HA 5F8ZA 3SNBA 4AOQA 3LPRA 3F6UH 1O2QA 5DGJA 1UTMA 2Y82A 4K1SA 3HATH 2HALA 3LKWA 1P3CA 2ZCKP 2G4UA 1BTWA 1FY8E 1DWDH 2O8MA 2OD3B 1DLKB 4TWWA 2B0FA 5FPTA 2BDAA 1GI4A 5DP5A 1SGCA 1TONA 1GCDA 1A1RA 1C2EA 1C5TA 1VCWA 2ZPRA 3LJJA 1MAXA 3GCOA 3PWCA 2PTNA 1SHHB 4D7FA 2ZTZA 4B71A 2HNTF 3ZZ5A 1AWHB 1YPLH 2H9HA 2ALVA 1IQIA 1F5LA 4NCYA 1O2KA 1DUAA 1G9IE 1P8VC 1QL8A 1C1VH 1TX7A 4NA9H 4D9RA 1VCQA 2KCYA 1F5RA 2ODYB 1SB1H 4TYDA 3RM2H 1GI8B 3UPEA 4YT6H 1S6FA 1IOEA 2FI3E 1O3HA 4RKOB 5E2PA 3VGCC 2SNWA 3UR9A 2CHAC 1TNKA 1C4V2 1NESE 1GMHG 1VITG 3UTUH 1NPMA 1TNIA 4BAKB 1BMMH 1YLNA 5GNDA 5KECA 1MTWA 1EFRD 1TA6A 2ZU5A 1NRNH 3KYGA 1SVPA 4GLYA 1W0KD 3VB7A 2FLBH 2WINI 1LVMA 2J34A 3AW1A 1SR5C 1OWDA 1OWKA 2WHXA 4F4OC 5JB9S 3A8BA 3M7QA 1E34B 4X1NU 1EB2A 1ZSLA 3A8CA 1MQ6A 2FIRH 5F8TA 1ELBA 1CU1A 1UCYK 4UD9H 6GCHG 2WPMS 3U1JB 2XXLA 3OSYA 2VNTA 2CHAB 4X8TH 4GCHF 2G00A 1GJ7B 4F55A 5C67A 2VH6A 3P8FA 2C8WB 2KCOA 2QC2A 1THPB 3PO1C 5A0AE 2Z9LA 1BMLA 2F3CE 1QY6A 3P8NA 2A32A 2BXTH 1O2TA 1YBWA 2P95A 3F9HA 1TMBH 1JRTA 1P2NA 2FS9A 3R0FA 3PV2A 3P70B 1V2RT 1KLIH 1KXDA 4D8NA 2WV9A 1WV7H 3ZZCA 2AERH 3RXIA 3W1EA 3TJNA 1DSTA 1T4VH 1V2OT 1NZQH 4M9FA 1V3XA 3E8LA 1OHHD 4K8YA 1YPEH 1AE5A 5DK1A 1VZQH 1V2JT 1ELVA 1GBAA 2VIQA 1EP5A 3F2GA 1NT1A 3HK6B 5C20A 1P3EA 3CNRA 3TH2H 4X8VH 1LVYA 3DCLA 4JK5A 5AHGH 3TU7H 4UONA 1LPZB 1PPZA 3ESTA 3V13A 4BTTB 2GD4B 4WXIA 3E16B 2TPIZ 4UFGH 1YKTA 1O2JA 3GY8A 1XVMA 1O5EH 2OC0A 5ETXA 3TH4H 1FDPA 2XTTB 2FESH 2NU0E 4NZQA 5CE1A 2F43B 4TY7A 1NFUA 1OS8A 5EOKA 1BQYA 1EB1H 5E0HA 2ZFRH 4A5TS 2BD7A 2W3KA 4KGAA 1MAYA 2ZIQH 2IJD1 1GJAB 3OFND 2I6QA 2G4TA 2ZC9H 3A88A 3A84A 4ZXXH 3NWUA 2ZPSA 2D1JA 3F9FA 3RXCA 1GPZA 1C1WH 3PRBA 1BT7A 1C2KA 2BHGA 3K65B 1GG6B 3F9GA 2BX4A
chains in the Genus database with same CATH topology
2BD9A 3TNTA 1SQTA 2PSYA 4YM9A 1TGCA 2NU2E 2AEIH 1HAZB 3GCTG 3MU1A 4UEHH 3ATWA 4PROA 1ABJH 4XDEA 2AMQA 1A7SA 1ELFA 3QWCH 2XYAA 5F6MA 1XKAC 2XCNA 4Y8YA 5LPRA 1TQ7B 1H8DH 3QGJA 5FPSA 5GIBA 3ZZDA 1AY6H 3E91A 4YLUA 4ZHLU 1K21H 1GBFA 2BLVA 1IQEA 4ZAEA 1SI5H 3Q3XA 1XUGA 2WPIS 3LC3A 1G37A 2TIOA 2UUKB 3QZRA 4B73A 1JIRA 4DVAU 5JYIA 5ESBA 5J4SA 1SSXA 1S0QA 2I6SA 3L3TA 1C5ZB 3MHWU 3SV7A 1C4U2 1W0ZU 4FUGA 2SGEE 1TA2A 1IQLA 4LOYH 1NS3A 3MNSA 8ESTE 3FP7E 2ZDNA 4NWLA 1SLUB 1SPJA 4MNWA 5E0JA 3S0NA 1QQUA 4XBCA 2FEQH 2ZTXA 1JXPA 2F9VA 1QBNA 1A3BH 1VITF 1VGCB 4BNRA 4ISOA 1W8BH 1TAWA 2Q6DA 3A86A 2QGRA 1LVOA 1P03A 1UJ1A 3RXEA 1EKBB 1MKXK 1XVOA 2TGPZ 3UNQA 2HRVA 2HWLB 2F83A 1ETTH 2EI8A 1SGEE 2GZ9A 3E1XB 1O2SA 1XUHA 2CXVA 4WH8A 5DP4A 2ZF0H 3U69H 1CBWC 1QB6A 4CH8B 2G55A 1GBJA 3SU6A 3EA9A 1UVTH 3T5FH 2ZHEH 1H9IE 4MPWA 3LH1A 2UUYA 2OXSA 2TGTA 1Y5BT 4ZKRU 1J16A 5FAHA 1CHGA 1EOJA 3QX5H 1HUTH 4TPYA 3RMLH 1P05A 1J17T 2PSXA 1L4ZA 1CBWB 1OWEA 1TALA 6ESTA 2QA9E 2Q1JA 1GDNA 1IHSH 1GMCG 2A45B 2XW9A 1ZZZA 4JCNA 7LPRA 1AVXA 4TPIZ 3RM0H 2BOHB 1AGJA 1OP2A 2BD8A 3M3SA 3AAUA 2Y5FA 2QY0B 3RXSA 2CMYA 2J94A 2PKSB 4FUHA 2FYRA 5CHAC 1P01A 2C4FH 1UTPA 1QL9A 3GCNA 2PHBA 1V2NT 1GMDG 1SGNE 1GJ6A 1BIOA 3F1SB 2BMGB 3K6ZA 2VVVA 1F0UA 5C1UA 3GY6A 1EAIA 2ULLA 3EDXB 1HCGA 3RDZA 1KIGH 3RMMH 2VVCA 3BEFB 3I29A 1TGBA 1PQ5A 8GCHG 4MNVA 1QCPA 3W94A 1Z1IA 4U30A 2J9NA 1DFPA 1Z8RA 3BTTE 4Y11E 1FQ3A 4OGYA 3FANA 3GYMA 2J4IA 4NIVA 1N6XA 1RFNA 3HGPA 2A5KA 4XSKU 4FU7A 2ZDLA 1O31A 2QF0A 1OP0A 1MTNC 1E35B 4F49A 1EQ9A 3LH3A 1BTZA 1IHTH 1OPHB 2BQ6B 3MU0A 5AFYH 1O3JA 1FY1A 3KEEA 4YT7H 1BBRK 1O37A 2A7CA 1EAXA 3GY3A 1ESBA 1FN8A 1OOKB 2FMJA 4D7GA 2HGTH 3PTBA 5AVDA 1UCYE 3SU3A 1ETSH 3U1IB 3SUDA 1BRCE 1LCYA 2GGVB 2BLQA 1DE7H 1V2TT 1NU7B 4CRDA 1YCPK 4FVBA 1BJUA 1SGIB 2GT7A 4D9QA 2Y80A 1O2ZA 2ZO3H 5BPEA 5GXPA 2BZ6H 2BD4A 1H8IH 3QTVH 2B9LA 1O2IA 4IMZA 2ZHWH 4X1QU 5A8ZA 2FM2A 2RA0A 2A4RA 2F9PA 1CT4E 3SUEA 3U8OH 4DW2U 2LNCA 2XBYA 1FIZA 3ZVFA 1V2UT 1GBHA 2ANMH 1PQAA 3E6PH 4MPXA 2ODPA 1S82A 3MWIU 3M7TA 3Q76A 2SFAA 1Z8GA 3MMGA 3MU4A 2AFQB 2XC5A 1FPCH 1XMNB 4H6TA 4B76A 1C1QA 1E38B 2GCHF 1GCTC 1QA0A 3JZ2B 1C5RA 1AFQC 3AW0A 5HYOA 1HPGA 4BXSA 1BTYA 5DP9A 1OYQA 2OCVB 3S9CA 1NROH 1X7AC 4IBLH 3TVJB 1RD3B 3RXRA 3SUFA 1Y3YA 4OS4A 5LH8A 1QB9A 3QTOH 1ANBA 1ARCA 3BG4C 1TGTA 2VU8E 3RXKA 2ZGCA 2YNAA 1B0EA 1AFQB 1O3DA 3K6YA 4FU9A 1N1LA 4ZMAH 1T31A 1AKSA 4JYVH 3RC5A 4OS6A 1HNEE 2WUCA 1J9CH 1FY3A 1Z8JB 1LDTT 3GDUA 2FOFA 3BIVH 4CREA 1AWFH 1P04A 2UWPA 5JBCS 1NTPA 4GCHG 1LHGH 1VR1H 1GMCF 3TGKE 1NRRH 3UY9A 2BTCE 1AUTC 2TGDA 1PYTC 5K0HA 4SGAE 5GCHF 1JRSA 2Y6TA 9ESTA 3ZVAA 1PPEE 4JYTA 2VWNA 1V2KT 1C5WB 4IC6A 3U8RH 1JIMA 4AG1A 1TPAE 1JBUH 3MTYA 3M37A 3B23B 3T28A 4B1TA 1OX1A 1SBWA 1ARBA 1GMDF 4NG9H 3ATIA 1G32B 4GAWA 1C5SA 2NU4E 2O9QA 3RP2A 1G30B 2QIQA 1XUKA 2JH5D 4BTUB 2ODQA 1TBZH 2AGGX 2VJ1A 4XE4A 1Y3UA 3OU0A 3GY5A 3UQVA 2WV4A 4TWYA 8GCHF 3KF2A 2PWXA 1MKWK 1O3CA 1DY9A 5JPMH 2ZGXH 1LMWB 1O2YA 4R0IA 4Y8ZA 3UFAA 1A46H 2ZU1A 1S85A 1PYTD 2BDCA 1C2HA 2ZQ1A 1V6DA 3M5OA 1GHAF 2VVUA 3HK3B 1O35A 2PTCE 3A81A 2XC4A 1UCYH 1Z8IB 1TE0A 1BTUA 2P16A 1GJDB 4Y10E 4CH2B 3GOVB 1LO6A 1A0HB 1MQ5A 1O2HA 1ZTJA 1EZSC 3BTME 2UUJB 4Y7AA 2FTLE 2A4GA 3ATMA 1A4WH 5BRRE 2GV7A 1P2MA 2BQWB 3MNCA 2IN2A 4JZIA 3ZZ9A 1F5KU 2ANKH 2VWOA 3D65E 2WV5A 1KLTA 1O5CB 4Y0ZE 3V12A 5DG6A 4DT7B 1DVAH 1O3OA 3VB5A 1W7GH 1JMOH 1G36A 3NKKA 1ZTLA 3MO9A 2J38A 2D8WA 1GHZA 1SFIA 1DXPA 1EAUA 1FMGA 3RXFA 5FBIA 4X1PU 3MH5A 4NSYA 2NWNA 1GJ5H 2EI6A 3H5CB 4MDSA 1Z1JA 3GCHB 1XUJA 4ABAA 5T6FA 1SC8U 2HPQH 1YPMH 1ANCA 1ZSKA 1NN6A 2ZI2H 1GBTA 4ABIA 1O33A 3LT3A 4NIXA 1HJ9A 3VFEA 4E7RG 1F0TA 1P02A 5DPAA 4ZKSU 1QA7A 4TY6A 1SG8B 5DP3A 1T8NA 1V2WT 4X2VA 1L0ZA 3RLYH 4CRCA 1SLVB 1GVZA 1YYY1 3TLOA 1CT0E 3ZV8A 1TRNA 1T8OA 1GGDC 3GY7A 3KQCA 3F9EA 1ESTA 3LU9B 2A5IA 3M35A 4WVPE 2PR3A 1OYTH 2TRMA 1GI6A 4WJG2 3UOPA 1F7ZA 2H1UA 3BEUA 3RXGA 2VIWA 2ZPQA 1MTVA 2ZP0H 1ELEE 1FLEE 2D26C 2OLGA 1AN1E 4MLFB 3RXDA 4UFFH 1DT2A 1HIAB 1PPGE 1W13U 1LPGB 3BTWE 3GDSA 4BAOB 1GGDB 2WPJS 4ABBA 4HTCH 1BMNH 1H4WA 1D6WA 2STBE 4NZLA 3BF6H 1QL7A 4X8UH 1ELDE 1H9HE 3BTHE 3MO3A 1NC6A 2FLRH 4INHA 1IQJA 3A87A 1GI1A 1T8LA 4U2WA 3TGIE 1O3LA 2ZFTA 3HKIB 4A1XA 1D6RA 4ASHA 1P12E 1W10U 2OINA 2FODA 3LONA 4J1YA 4AYYB 1HJ8A 2W5EA 4XBBA 1MZAA 1C5UA 4ZKOU 1F92A 1O0DH 1UTOA 1MU8B 3MOCA 1SL3A 3A82A 1BBRE 4X2XA 4BAMB 1BMAA 3RC6A 1YF4A 3N7OA 3RXAA 1B7XB 2A2QH 1TOCB 4YTAA 1TB6H 2R2WU 1EZUC 1FI8A 3A7WA 4Z0KA 3KQEA 1AE8H 4D76A 2FOGA 2AS9A 2STAE 4UE7H 1IAUA 3E0PB 3SJIA 5JBAS 2WYGA 2O8UA 5TCCA 1L1JA 2HPPH 3SZNA 2FX4A 4AN7A 3RU4T 1CQQA 1QQ4A 1SGQE 1HAIH 4HFPB 3SV6A 3MU8A 3ZZBA 1C2IA 1OWHA 1ZPCA 4IMQA 1A0LA 1L2EA 1O3FA 1W2KH 2HVXA 3A7XA 2A31A 1J15A 2Z3EA 1EPTB 1MKXH 1ESAA 3FZZA 1UVOA 1ZHRA 1MH0A 2W7UA 3UR6A 1CT2E 3K9XB 4Y76A 4KTSA 1GG6C 4O3UA 5C5OA 3QLPH 1C5VA 2QXJA 4X6NA 4Z6AH 2THFB 1KXCA 4LZ4B 1K2I1 1NO9H 3PTNA 3ZZ4A 1MUEB 1RS0A 5EPNA 1GBLA 3NCLA 4CRAA 4UFDH 1HAHH 1SFQB 1HBTH 1RRKA 5EXLA 4DJZB 2ZGHA 2SGPE 1FY4A 4ZKNU 3RMNH 3BTFE 1DWEH 2WPHS 3RXLA 1ZMJA 3TPIZ 1CVWH 4K5ZA 1YPKH 1O2RA 3W95A 3SW2B 1UO6A 1EASA 1GHWH 2F9BH 1EZXC 1C2MA 3MO6A 2XWBI 4Q7YA 2BD3A 9LPRA 1WTHD 1P9SA 3LGWA 1LQEA 2BY7X 1O38A 2VIVA 2P93A 4ZUHA 2CF8H 3ZV9A 5LPEA 2AGEX 3WY8A 3QGNB 1WAYB 4KKDA 1UK4A 1TFXA 4WH6A 2XBWA 1GI5A 4BOHA 1EUFA 4AORA 1RJXB 1VGCC 1C1RA 1W0YH 5FPYA 3RUOA 2PGQB 4A92A 1KY9A 1BB0B 2C8YB 1GHBF 4R8TB 1Y3XA 2W3IA 3E90B 1PPBH 3L33A 3T26A 3LGYA 4ABFA 1Y3VA 4I8HA 4A7IB 4WF8A 3MH4A 1OSSA 1EOLA 7KMEH 2BD5A 3ZZ6A 1H1BA 1HV7A 2RDLA 3VXEH 2OP9A 1HJAB 3RXVA 1LHDH 3BIUH 2GCHG 4X1SU 2ANWA 2R3UA 5T3HA 4HZHA 1WBGB 1G2LA 4M7GA 1P0SH 3UNSA 1GBDA 4AYVB 1DXWA 1GI0A 1BBRH 4I33A 3PROA 2BDIA 1N8OB 5JBTA 3UWJH 3ENSB 2BD2A 4X8SH 3A85A 4K3JA 2V3OH 4AFUA 1W11U 5JBBS 4DIIH 1F0RA 3DHKH 4I8GA 1O3IA 3SBKA 2AIPA 2W26A 2F91A 1SOZA 2ZGBH 3QK1A 1PPHE 3A8DA 2FPZA 4NA8A 2PKSC 3TJVA 5JB8S 2B8OH 3GY2A 2O8LA 4E05H 2RCEA 5GJ4B 1O5DH 2FOMB 1W3CA 3SGAE 3ZVCA 1QBVH 1B0FA 1QRZA 3E0NB 4IN1A 1Z71A 3BTDE 1C5YB 1KLJH 3PWBA 2FZZA 3BTQE 1T7CA 1P2OA 2PUQH 2XBXA 3I77A 3JZ1B 3I78A 3OY5U 2R9PA 1RXPA 2Z7FE 2SGAA 5GCHG 5T6DA 3P17H 1O5AB 1DWCH 1DSUA 2NU1E 3UWIA 3KHVA 2VIDA 1O5GH 1NRQH 1JOUB 5DJ7A 3RXOA 4B2CA 7ESTE 5HM9A 1PJPA 2Z94A 3EYDA 5HGGA 3LDXH 2O8TA 1ZPZA 2LPRA 3S69A 5K7RA 2P3UB 2DE8A 1EJNA 2QXIA 3EGKH 3CS0A 5E0GA 2C93B 2FOHA 3FP6E 1ETRH 5C3NA 2BYAX 2PLXA 2KAIA 3TITA 1NRSH 3VB3A 2R0KA 4AGKA 3UOUA 1O2UA 5A09A 2Z3DA 2ZEBA 2AIQA 3GICB 1FV9A 2J92A 2SGDE 3A7TA 1UK3A 4FUDA 4ISLA 3FP8E 4YLQH 1GHAG 3PM3A 3SJKA 2FS8A 1TNHA 1WSSH 2EEKA 3A83A 4NWKA 1ZRBA 2ZCLP 5C1YA 4CHAB 3KIDU 4Q7ZA 3M36A 1P57B 1ELCA 1ID5H 1UTQA 2GTBA 2P94A 2ILNA 3SHCH 5JDUB 5J4QA 4X2YA 1MCTA 1XUFA 6CHAB 2OQ5A 1ZYOA 1ZTKA 2P3FH 3QDZB 1NY22 2A7JA 2VINA 1TPOA 1SGPE 1MBQA 4KTUA 5DKMA 4K1TA 4YOJA 2M5TA 3HGNA 2OC8A 1BCUH 3TNSA 3ZZ8A 4ABEA 1HRTH 5A8XA 1C1TA 1N6YA 1D4PB 4FUCA 3SJOA 1HXEH 1ZGIA 4THNH 1E0FD 2Y5GA 3V7TA 3E3TA 1XUIA 2VWMA 1GHXH 1MKWH 4ABHA 2ZTYA 1DX5M 1P2KA 1C1PA 1QRWA 1F2SE 2PW8H 3OX7U 2G51A 2R3YA 5I25A 1DWBH 4AB8A 1ZGVA 1QRXA 2FI4E 2EI7A 1ZHMA 3LGVA 4J2YB 1AZZA 1ORFA 2BXUH 3H7OA 1TRYA 3IG6B 3GY4A 1AB9B 1G3EA 5LGOA 3BV9B 2A1DB 2BB4A 2ZFFH 3PV4A 1V2LT 2QXHA 3TJUA 1A5IA 1WYKA 1GJ4H 3PMAB 2FOBA 3EE0B 4XFQA 1SLWB 1PPFE 1YPGH 4AX9H 3MYWA 1GVLA 2G52A 4YZUA 3SNDA 1C2DA 1CGHA 3PLKA 1WQVH 1H9LB 3LIWA 1TGSZ 2FOCA 2CGAA 1KXFA 1AI8H 3O8RA 2O8WA 4H6SB 2Y7ZA 4JZFH 3MNBA 1CGIE 1HB0B 3SOSA 1A3EH 1UMAH 2JH6D 1SGTA 3FFGA 2H5CA 1GJ9B 1Y8TA 5H4IB 2VIOA 1SQOA 4IC5A 1HIAA 1CA8B 1SGFG 4AFZA 1OWIA 1S83A 2ZHQH 2J95A 1UVSH 2ZDMA 4IW4E 1QIXB 3RMOH 2IOTA 4NFEA 5L30H 1EAWA 3HKJB 4CBNA 5FCKA 4B2BA 1GJ8B 2H5DA 1AU8A 3UUZA 3BEIB 3SGQE 1SGRE 4HGCA 4QT8C 4U32A 1TNLA 1AVWA 1TBRH 3D62A 4DY7B 2SGFE 1C5PA 2VB0A 2BVXH 3U98H 1KTTB 1S81A 2ZDAH 3ZVGA 3T2NA 3TJOA 1K1OA 2Z6BD 2WPKS 1GBKA 1WU1A 4CBOA 2FI5E 4MTBA 5GPIB 3ZVDA 3VXFH 2NU3E