3I29A

Crystal structure of a binary complex between an mutant trypsin inhibitor with bovine trypsin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Role of remote scaffolding residues in the inhibitory loop pre-organization, flexibility, rigidification and enzyme inhibition of serine protease inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i29A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i29A02
1YP9A 3ZYEA 2WUCA 3M7QA 1KLTA 1RXPA 2P16A 4E7NA 4BTTB 3SU2A 1W7XH 3T5FH 5AHGH 3GY2A 4THNH 1OOKB 2FZZA 4NA9H 1O2RA 1GJ9B 4GHTA 3B9FH 1L1GA 1ARBA 1LTOA 3U1IB 3RMLH 1O2PA 2ZCLP 1AQ7A 3O8BA 1VJ9U 4JK6A 2F91A 4B71A 1GJCB 1GL1A 1T8LA 2ZU1A 1DLEA 3EA8A 8ESTE 2ZU4A 5LPRA 1GI9B 2G81E 3Q3KA 2VU8E 2CJIA 1FY5A 3PB1E 1HLTH 1V3XA 1VITG 1AFEH 2A4RA 1ZR0A 3BTGE 3EYDA 2UUFB 3NCLA 1TMTH 1C2MA 1P2KA 1Z8RA 1DANH 1EAXA 3VB5A 1OXGA 4IGDA 4Y79A 1OWEA 4K3JA 4PROA 2W5EA 1D3DB 2C8WB 1E36B 4Q7YA 3SGBE 1Z6JH 1Z8IB 3O8DA 2O8TA 1O2VA 1O5CB 1P05A 2A2QH 1DUEA 1HRTH 2WUBA 2CN0H 4LK4A 4ZXYH 1YM0A 1XXFA 2AGGX 3ATMA 1ZTJA 3BIUH 5GCHG 3M61U 3U8OH 4ZKRU 3TH3H 4X8SH 1U6QA 1P8VC 2AEIH 1EZXC 5A8XA 4U30A 5JBAS 1MQ6A 2G4TA 1ESAA 2XBWA 3ZZDA 2OQUA 3VB6A 2ALVA 1DWCH 3NUMA 3S69A 4ZKSU 4AZ2B 1KYNA 3GY6A 1OP0A 5AVDA 1GCTC 1UTLM 5EGMA 1CBWB 2A7JA 4AORA 1A5GH 1SFQB 2GCHF 2ZGCA 2XRCA 3QZQA 1HXFH 3GY4A 1H9IE 2WPMS 4NIVA 2F9NA 4KTCA 4A6LA 1DY9A 1BT7A 3RXJA 3EQ0H 1DSUA 1C2EA 3RXEA 1TQ7B 1C5MD 2O8MA 4OS5A 4ZUHA 3SQHE 1L0ZA 4YLQH 1H8DH 4K1EA 1QQUA 4ZXXH 1SG8B 4ZHLU 4ESTE 2VVVA 1J15A 5DP7A 4GCHG 5E0GA 3BEUA 4DJZB 2R2MB 2ULLA 2A31A 2FI5E 4TWWA 5DGJA 1TOMH 4ZROA 3P95A 2OC1A 2TGPZ 1DFPA 1S6HA 1XUFA 4X1QU 1N1LA 1S0QA 3SUDA 2FLBH 5LPEA 1B0FA 2BDGA 2JH0D 1KSNA 1SHHB 3T62A 2WYGA 4FUGA 1C1PA 3BIVH 3GCNA 2G55A 3F6UH 1C9PA 5AFYH 2WPLS 1ETTH 2OP9A 1O39A 1C4V2 5E2PA 3QGNB 3KQDA 1A1RA 1V2UT 1FI8A 2BY8X 3RXUA 1HAVA 3A7YA 3EAJA 2I6SA 4FUFA 4JYUH 4GAWA 2BQ7B 1F5RA 5DP4A 1UVOA 1ELDE 2TBSA 1MCTA 1ZHRA 3ATLA 3MHWU 1BCUH 1HAPH 3A89A 3MO9A 3BTEE 2FOCA 1ANCA 1HAIH 1SBWA 4DURA 3WY8A 4YZUA 4IMQA 4UE7H 1TRYA 2QGRA 2PTNA 4J1YA 2AMDA 3LONA 3SNAA 1C1TA 3BTKE 4K1TA 4X1PU 1O2IA 1HBTH 4AGKA 5GWZA 2BD9A 1YF4A 3BG4B 3S9AA 1AVWA 1NO9H 1QFKH 3SU1A 3SV2H 3S7HB 1EZUC 3M5MA 2BTCE 4B2BA 3ZVFA 1XKBC 2WPKS 1CBWC 1HAVB 1H1BA 1Y5BT 1EP6A 4K69A 1BTZA 2AS9A 1NM6A 1B0EA 2BDAA 3TGIE 7KMEH 3RXKA 1BZXE 1ETSH 2XBXA 3ZVCA 2PUXB 1KIGH 1YKTA 1VR1H 2OTVA 3ZZ9A 1AN1E 4X0WU 1TAWA 4Z0KA 1VCQA 1GBIA 2HLCA 2GV6A 4LOYH 1O3IA 3BTTE 2OD3B 2BQWB 3VB4A 1BHXB 4IN2A 2GZ9A 5E0HA 1RS0A 5C5OA 5F6MA 1GI3A 1ESTA 1G36A 2SGPE 1TMBH 2ZPSA 5F8XA 3QGJA 1AFQB 1XUIA 1ETRH 4INKA 4CRAA 3SI4H 1TX6A 3U8RH 2Q1JA 4ISLA 5EPNA 1ELGA 4AG2A 1O3NA 2G00A 2ZZUH 2QF3A 1LVOA 2A7CA 1TB6H 2BY7X 4ZAEA 1D9IA 2AFQB 2WV4A 1O2NA 3M5OA 1C1OA 1HXEH 2BD4A 1A61H 2VH6A 1GJDB 2AERH 1P0SH 2QF0A 3UIRA 1TNKA 3RXHA 1IQGA 3SW2B 2OQ5A 5HYOA 3FFGA 4WJG2 1C1QA 3MO6A 3MH4A 1UK2A 3A88A 4B2AA 4OGYA 1EAIA 1NESE 2BDIA 2ZQ2A 4Z6AH 1ZZZA 1CT0E 4IN1A 3TK9A 4DIIH 5FPSA 1J17T 3A80A 3PMJA 2ZDAH 1V6DA 3FP6E 1Z71A 1O2GH 1KTTB 1E38B 2FXRA 1O3BA 1SGNE 2J38A 3SHCH 3BG4C 4NGAH 1BQYA 1EAUA 3TK6A 1QNJA 3Q77A 1SGIB 1W12U 1O32A 4B75A 1FN6A 3ZZBA 5FPYA 1C1NA 1DM4B 1A46H 5JB8S 2TGTA 1LVMA 1NFWA 1OWDA 5FBIA 4BANB 1O2LA 1MZDA 1SGPE 1TNHA 1TWXB 3AVZA 4Y0ZE 2V6NA 1AWHB 2DE9A 1UTOA 1O3EA 1LCYA 1PPZA 1V2NT 2XC4A 1Y3VA 1SGEE 1SGCA 3P8GA 3L3TA 1ELTA 1QHRB 1JRSA 1BRAA 5C1YA 1D3QB 2VH0A 2SGEE 1GMCF 1HAHH 3DT0H 4D7GA 2G5VA 3L6PA 1Z6EA 3RXOA 5L2YH 3GY7A 4GVUA 1T4VH 4Y8XA 1MD8A 1SQAA 1AFQC 1GHYH 1TFXA 1TBQH 3R3GB 4ISIH 3BSQA 4M7GA 2VVCA 3W95A 1HAYB 1GJ7B 2AGEX 1CA0B 1ZMLA 2ZDNA 1TE0A 5EPYA 2GT7A 3E1XB 1O3PB 2Z9LA 1P10A 2V3OH 2PHBA 3MFJA 1MZAA 1O3MA 1NY22 1FNIA 1FZZA 1KXBA 4AYVB 2PSYA 2OC0A 2BOKA 2G4UA 2BM2A 3D49H 1TGSZ 3SHAH 2ODYB 4BAOB 5J4QA 1HNEE 2G52A 3O8RA 2XC0A 2QCYA 1PJPA 1GJ4H 2PV9B 1GBMA 2IJOB 1VGCB 1FONA 2QV1A 2W7UA 1RRKA 2QXJA 4X8UH 4FUCA 1DVAH 1WU1A 1WAYB 3HGNA 2AH4X 3HK3B 2VIWA 1QJ7B 1AD8H 3PMAB 2ODPA 2IN2A 3RC5A 1S82A 2UWOA 4AYYB 1O3HA 5SGAE 1GI7B 4YO9A 3BEIB 4ZMAH 4O03A 3V0XA 2VIPA 4RSPA 4CBNA 2HGTH 3UUZA 5FXLA 1MKXH 1MTNB 4O3UA 1B7XB 1OP2A 3PYHA 1ZGVA 2OC7A 1O3FA 2Y7XA 1H4WA 2FOBA 2GTBA 2O9QA 1MTUA 1CGIE 1O3KA 1C2KA 4NG9H 4ABAA 1RFNA 2HPPH 1ZRKA 1D3TB 4GSOA 4Y8YA 5TJXA 3NKKA 5FHTA 1MKXK 2AMQA 2A7HA 1T32A 1EJAA 3LT3A 1UMAH 1KDQB 3OSYA 1Y5UT 4MPWA 3Q00A 4ABHA 4CRFA 2ZFTA 3BTME 1F5KU 2A4GA 5HGGA 1T8OA 2HWLB 3OTJE 4NZLA 4FUHA 1QJ6B 2ZF0H 1ZOMA 3URCA 1TNLA 2BD7A 1A0LA 4TY7A 1O2OA 1AB9C 1W7GH 4JYTA 4UFGH 1DS2E 4BTUB 1WUNH 1HDTH 3MU4A 1GBEA 2V3HH 1FY4A 1JXPA 4CRBA 3P8FA 1VITF 4XOJA 2ZCKP 2VWMA 4HGCA 1O5BB 4I8LA 1D6WA 1Q2WA 4ABFA 1DITH 1GVZA 4Y11E 1BTYA 1UTJA 5DP3A 3RC6A 1C5WB 4Y6DA 1EB2A 1C1WH 1V2LT 1GBAA 3MMGA 1WTGH 3E90B 4SGBE 4AN7A 1QA0A 2LPRA 9ESTA 1SQTA 4IC5A 1OPHB 5GCHF 2DUCA 3A8AA 4O3TA 2AGIX 5C2ZA 1VGCC 4TPYA 5I46H 1ACBE 3HPTB 1UTNA 2Z7FE 3ZV9A 3RU4D 5EW2H 1XUJA 2PKSB 5CHAC 1OWHA 5EQSA 2BD2A 2ALPA 1V2MT 3MTYA 3PWCA 2HNTE 4D76A 2J34A 3SUFA 1HCGA 3Q76A 4NFFA 1BTHH 3A86A 2GKVE 1THRH 1O3OA 1V2RT 4X2WA 3SUGA 1XKAC 4AGJA 3KL6A 4CBOA 1GI2A 3QDZB 3SQEE 1O35A 3OX7U 3UOPA 1MTNC 1OKXA 1T7CA 1C9TA 1HIAB 2BDCA 1W13U 2ESTE 2XC5A 1UVPA 1S85A 5A2MH 2ZFRH 1N6XA 4MNYA 2FMJA 2TGAA 3UWIA 2EC9H 1THSH 5ETXA 3GCTG 1HJ8A 2A2XH 5GDSH 5DPAA 1ABJH 1SGFG 3TITA 1F7ZA 3DUXH 1QTFA 2JKHA 2O8WA 1L4ZA 2OBOA 2SGQE 1RGQA 4GCHF 4I33A 3A81A 2BDBA 2OUAA 2R0KA 1LHEH 4X2YA 3LGVA 1D3PB 2V35A 1PPCE 3GOVB 3OYPA 2A1DB 5A0BA 1YPKH 4FVDA 1P9SA 1UCYH 1CU1A 3F9FA 2WPJS 3Q3YA 4K8BA 2GZ8A 2WPIS 1AIXH 2I6QA 2GDDA 3KQBA 1C1RA 4U2WA 4HFPB 1HFDA 1SGYE 2FYQA 2FLRH 1J8AA 1M9UA 1QA7A 1BMAA 1O3LA 2P3FH 4SGAE 3T28A 4BAHB 3B23B 3TK5A 1EX3A 3PWBA 2C8YB 4MVNA 3PLPA 4WY3A 1VCPA 1BB0B 2BX3A 1DWDH 1TRMA 7ESTE 3JZ2B 4MNWA 1C5TA 5JBBS 1TQ0B 2ZDVH 3SGQE 2H5DA 2FPZA 1IQKA 2V0BA 4UDWH 3DA9B 1DICA 1SB1H 4FU9A 2ZU5A 4I31A 1V2VT 2BX4A 3LPRA 2A5IA 3M3TA 2NU3E 4UFFH 2BVRH 3RXSA 5T6FA 4UONA 5EXMA 1YPMH 1PPFE 2PKSC 2GVFA 1C5XB 3ESTA 4Y76A 2VWOA 2ZKSA 2PR3A 2NU0E 1ORFA 3SU5A 3VXEH 4NSVA 4UFDH 3ZYDA 1OP8A 1BRBE 1EOJA 1XXDA 1ANEA 1N8OB 2WPHS 2PTCE 1HYLA 3MYWA 1X7AC 1O5FH 3MH5A 4ISNA 1FAKH 4A5TS 1MD7A 1TNJA 3TGKE 1AZZA 1AO5A 4WXIA 1SI5H 4Q2KA 3TLOA 1L2EA 1FY8E 4R8TB 2GMTC 1UHBA 5EQRA 1EXFA 2PKAA 5ESBA 5TCAA 5JDUB 1Q31A 2C93B 1ZSLA 1OYTH 3UPEA 4YOIA 1TGNA 4JMYA 3MOCA 3UNSA 3PM3A 7LPRA 1DXPA 1Y3UA 1Y3WA 3EE0B 5K7RA 3A8DA 1GBCA 1RD3B 3DFJA 3A83A 1P2QA 2F9PA 2RA3A 3M7UA 2CF8H 5L2ZH 2Y5GA 1MMJN 1ZMNA 5AF9H 5HM9A 3RXRA 2J92A 3G01A 2R0LA 1JWTA 3KF2A 3ZZ8A 1D6RA 1THPB 3CENA 2ZI2H 4X1RU 3FAOA 3SORA 1SOZA 2PKAB 3P8NA 3E8LA 2SNWA 2VJ1A 4U01A 2UWPA 1GMHG 4FUBA 5GPIB 6LPRA 1O2SA 3RLYH 1L4DA 3B8JA 1E0FD 2BLQA 1QGFA 3SN8A 3ZVBA 3OU0A 4OS1A 1DE7H 1KXAA 1LVBA 3AASA 4X6MA 4Q7XA 5T3HA 3RLWH 1KY9A 4CREA 3ZVGA 1A7SA 1DXWA 1QL9A 2GT8A 5C67A 3BTFE 1NPMA 2F9BH 3BN9A 1LPKB 4YOJA 2ANKH 4YLUA 1C5QA 1ZTLA 5AFZH 1V2KT 1NFXA 2P3TB 2Y80A 5F03A 5PTPA 1NRQH 4Q80A 5F8TA 4JZIA 1GHVH 3HGPA 5FCKA 1O38A 1HAOH 1MAYA 1LHGH 2A45B 3FZZA 2QYIA 2FI3E 3MNXA 2Z3EA 1V2WT 1ANBA 2XBYA 3TIUA 1DSTA 1QR3E 1HB0B 1N8OC 2R9PA 1SGDE 4J2YB 2ZO3H 1TONA 2ZP0H 2B8OH 1WV7H 1SGRE 4E06H 3ODDA 3I29A 1WSSH 1V2JT 3TJOA 4INHA 3SV6A 1P2IA 2FS9A 4E05H 1Q3XA 1P11E 1BRCE 3DHKH 3F68H 3UQOA 5A0CA 2FTMA 1TRNA 8GCHF 1UVSH 3TJNA 3SV8A 3SOSA 3ZZAA 1S5SA 2ZTXA 1P57B 3HKJB 4AOQA 2ASUB 3S9BA 1YYY1 1AUJA 2AIPA 4KTUA 4Y7BA 3RXAA 2Y5FA 3T2NA 1EP5A 1W11U 4FXGH 4H4FA 3F1SB 2C90B 5EXNA 1GPZA 3GCOA 1E37B 5EW1H 1NU9A 4ABGA 2UWLA 2WINI 1G9IE 4IC6A 3RM0H 1PQ8A 1YLCA 2TPIZ 1P06A 4MNXA 2VGCB 2AMPA 4D7FA 1ELBA 2FIRH 1WYKA 1PPBH 1P01A 1B5GH 1Y8TA 4CR9A 1ZTKA 4MNVA 1K9OE 4MDSA 1OX1A 4NIXA 1GBTA 4OS6A 1P2OA 1VITH 4NSYA 4F49A 4QT8C 4FVBA 1Y59T 3GY3A 3MNBA 1PQ5A 3MNSA 1SLWB 1ZJDA 3FVFB 2PWXA 1BIOA 1ZSJA 2XYAA 1YPHE 4BAMB 4XBCA 3GDSA 3LJJA 1CQQA 2H9EH 4IBLH 5HMAA 3UWJH 2B0FA 1ZSKA 2H6MA 1C5YB 3QX5H 3NWUA 5JPMH 1NZQH 2GDEH 2ZECA 4CR5A 1YC0A 3UNQA 4B1TA 1GDUA 1OWIA 1W8BH 1TNIA 1MBMA 4UEHH 1EAWA 2H1UA 2PFEA 3RXVA 4Y0YE 3M36A 5FX5A 1HAZB 3K2UA 3AAUA 3CP7A 2BY5X 4BAKB 6GCHG 2ZDMA 1SLXB 2EI7A 2FX6A 3ZZ7A 4X6PA 2RG3A 1O2KA 2K1QA 4OS7A 5FX6A 9LPRA 4BTIB 4B2CA 5I25A 3NZIA 2WYJA 3ODFA 4U32A 1FPCH 1W0ZU 2ZNKH 1QJ1B 5EXLA 3E3TA 1ZJKA 3BEFB 3SI3H 4CRCA 2FESH 3I77A 2BY9X 1F0TA 1J16A 1GJ5H 2KAIA 2BDHA 4OS4A 1ELFA 2ZFSA 4OS2A 1TLDA 4MG3A 3A7ZA 4NWKA 2A32A 3K6ZA 2ZDKA 4I8JA 2CHAB 8GCHG 4AFQA 1LVYA 2WV5A 4GUXA 2NU4E 3JZ1B 2ANYA 1P12E 2FP7B 2FTLE 3VXFH 1A0HB 5C3NA 1EJMA 2QY0B 1XM1A 3ZZ4A 3CS7A 4WF8A 2VGCC 2JETB 3V7TA 1XVOA 3D62A 2A5KA 3CS0A 4O9VA 4X2VA 1GHBF 3SU0A 1GL0E 1SLUB 4FUDA 1K2I1 1TA6A 1AHTH 3UQVA 5C5NA 5A0AE 3UOUA 1YPJH 2Z9GA 3GY8A 4MPUA 1FV9A 1GBFA 1EOLA 3BTHE 4D9RA 3P70B 1KXCA 5L30H 1BITA 3TH2H 1AE8H 3L33A 4K2YA 1T4UH 2HRVA 1O3GA 1GI0A 1JIMA 1H9HE 3K6YA 2CV3A 1Y3XA 1UVUH 1DWEH 4GPGA 4WVPE 1NTPA 2D8WA 3P8OA 2IPHA 1DUAA 1K1IA 4Y7AA 4ISHH 3MI4A 1BBRE 1UK4A 1P3CA 2G8TA 3KGPA 3SUEA 1GBJA 2BHGA 1P2JA 1C2IA 2ZTYA 1FLEE 5GJ4B 1LQEA 1CSOE 3LC5A 1TALA 4K5ZA 1G2LA 2YNBA 2P94A 1XUKA 3NXPA 1P02A 1AI8H 1MTSA 1NFUA 3U69H 4CHAB 2O8UA 4DCDA 1GBDA 4INLA 2ZQ1A 1TMUH 3RXFA 1JMOH 3OY5U 1ZHMA 3SU3A 2GZ7A 4XE4A 1CHOG 1INCA 2BQ6B 2FWWA 2ZTZA 1O2UA 1LO6A 1O2QA 3PLBA 1T31A 2XTTB 2W7SA 2BYAX 3GCTF 2W26A 4TYDA 2STBE 2BLOA 2FOGA 2HVXA 1FUJA 2Z94A 4BOHA 1SHYA 1C5NH 3GDUA 3N7OA 5JYIA 2C8ZB 1YCPM 3KN2A 1SGTA 2VIDA 3M7TA 2R3YA 1TIOA 5C20A 3E6PH 2Y81A 4NCYA 2J94A 3BTDE 1KXFA 3MO3A 3S0NA 2A0QB 1SGQE 1UCYE 3U1JB 2ZGBH 5CMXH 3RXMA 3RU4E 1F5LA 4MPXA 3ZV8A 1F92A 1GI4A 4UD9H 2Z3DA 1LHDH 1ZLRA 3ZVDA 4KP0A 4O97A 1S81A 3PTBA 3H7TA 1QIXB 3OY6U 2JETC 1QBOA 1L1NA 1RTFB 3M3VA 3A87A 2FO9A 4UFEH 4X2XA 1TBRH 4ZKOU 1XVMA 1F0UA 1V2TT 1CA0C 4K1SA 3KIDU 1NRRH 4ABEA 1BMMH 3GDVA 1AUTC 1GI8B 2XWAA 1LHFH 1K21H 2FM2A 3ATKA 3NK8A 3KQEA 1NC6A 1GHBG 3GY5A 1V2ST 1ZHPA 1S0RA 3IITA 5DJ7A 3RU4T 2J9NA 3URDA 1RTKA 1FPHH 1TYNA 1TOCB 1IQJA 2ZHFH 1EPTA 1KLJH 3HATH 1G32B 5DKMA 3RXLA 1FXYA 3GISB 1CGJE 1QRZA 3ATWA 1IQEA 4ABJA 3EA7A 2BLWA 2H9HA 1Z1IA 3A7WA 1BBRH 2ZA5A 5TCCA 4I32A 1XMNB 1A3BH 1GGDB 4FU7A 4CHAC 2Y5HA 1O2TA 4KGAA 1DPOA 1DX5M 4X1SU 3A82A 5GXPA 1BTPA 4CRGA 3UR6A 3VB7A 2XXLA 1TA2A 1CVWH 4I8HA 1E34B 5C1XA 1ELAA 1BBRK 2JH5D 2ZFFH 7GCHF 1Z7KA 2XWBI 3KCGH 2Y82A 1C5VA 4DT7B 1EPTB 4DG4A 4FUIA 3KQCA 3LGYA 1YPEH 4XBBA 1C2FA 4YOGA 4GLYA 1O36A 3KEEA 3ELAH 2GX4A 2R3UA 3SU4A 1WQVH 1UTKA 2QA9E 4ISOA 1YGCH 2AYWA 1EZQA 1C2DA 1W14U 4ABDA 1TGBA 3V3MA 1A2CH 1H9LB 2ZCHP 1CHGA 5LPFA 2SFAA 3RXBA 4K8YA 2D2DA 1CE5A 1GMDF 3I78A 1TX7A 1F0SA 1GI6A 1MUEB 2F3CE 4BXWA 1JRTA 1GBKA 1GMHF 2D26C 3M3SA 2BZAA 2ANWA 2GCTB 5A8ZA 3MNCA 2HNTC 4B73A 3QZRA 3LH3A 3M37A 2BB4A 4AFZA 3LGTA 1P9UA 5BPEA 1UCYK 1DY8A 4TY6A 1L1JA 1SOTA 2H2ZA 1FJSA 1AWFH 3SGAE 2SNVA 2YOLA 1O2HA 1C1MA 1O3AA 2PSXA 3HKIB 1ZYOA 1CO7E 3M5NA 1AE5A 1UTPA 3F9GA 4IW4E 2FX4A 1BMNH 2BXTH 1O2YA 3GYMA 1G30B 4HI3A 4OGXA 2DE8A 4MQAA 4RKJB 3TGJE 1O33A 2Q6FA 1G3EA 1PYTC 2PLXA 2UUKB 1C1SA 3H5CB 1G2MA 4BAQB 1GGDC 3RXTA 2ZC9H 2A4OA 1DDJA 1O3JA 1QB1A 1PYTD 4XBDA 3UNRA 2UUYA 3PMHB 1ESBA 3LC3A 3RXGA 4AB9A 2XNIA 2C4FH 4D9QA 1GHAG 2CF9H 3D23A 3MU5A 4XDEA 1BHXF 1XUHA 5IDKA 1UO6A 1WBGB 3UR9A 3K9XB 2Y6TA 4AB8A 2VWNA 2B9LA 4ZHMU 2FODA 2FOMB 3BV9B 1AKSA 1IQHA 4WMFA 2VIOA 1EPTC 2F9OA 1SMFE 4X6OA 1YPGH 3BTQE 3PROA 4IMZA 2F9VA 3RXCA 3BF6H 5EU8A 4DIHH 1RJXB 3AAVA 7GCHG 1C5RA 1BOQA 1GHWH 2QC2A 4F4OC 5F8ZA 5E2OA 3QTOH 3A7VA 3GYLB 4NWLA 6CHAB 3FP8E 1GVKB 1P09A 2HPQH 4AX9H 5K0HA 5HM2A 1UJ1A 1FN8A 4NZQA 1FIZA 4KKDA 1LDTT 1EQ9A 4A7IB 4GHQA 3P17H 3P6ZB 1QCPA 2EI8A 2ODQA 5DP5A 4DVAU 1PQ7A 1PPGE 5EODA 2UUJB 3MU1A 1NRSH 1QL7A 3C27B 1AKSB 1QBNA 1TPPA 3D65E 2GCTC 1K1LA 3LGIA 3VFEA 2R2WU 4I7YH 3ZZ5A 1UHBB 5DP8A 1GMDG 1C2HA 3SU6A 3W94A 2EA3A 3ZZ6A 5ABWA 1N6YA 1EZSC 1AVXA 3LJOA 1ZPCA 2SGDE 1JBUH 3H7OA 1HAGE 1MKWH 1C5PA 1T8MA 2OINA 5FBEA 2J2UA 1O31A 1NS3A 3VEQB 5IYTA 1SVPA 5DG6A 5LH8A 1IQNA 2Z9JA 2VNTA 1LQDB 2M5TA 4AFSA 4BXSA 2ILNA 2QXGA 3E0PB 3LKWA 6GCHF 1ZPZA 1JIRA 3SNBA 2TGDA 2HOBA 1Y3YA 1MKWK 8LPRA 1O2MA 4IS5A 3KNXA 1C4Y2 1P04A 3FP7E 2FOHA 4CH8B 1S83A 3F9HA 2D1JA 2PGQB 1GBLA 1GDQA 1P2NA 4XSKU 1IQIA 2OBQA 2W3IA 1IHTH 3SNCA 3VGCB 3BG8A 1Z1JA 2STAE 2Z9KA 1IQFA 4H6TA 1O2JA 3MWIU 1GJ6A 5DP9A 3ITIA 1CT2E 3ATIA 2A5AA 1ELEE 3A8CA 5HXFA 1HJ9A 2FOFA 1IOEA 2PUQH 4JYVH 4LXBH 3T29A 1K1NA 1IQLA 4YT7H 1SL3A 2QXHA 2VIQA 1NRPH 1IAUA 4A92A 3UREA 1BTXA 1FAXA 1V2PT 3V12A 3A84A 1BJVA 2SGFE 2LNCA 2ZHWH 3VB3A 1EUFA 1KXEA 3RP2A 4D8NA 1A0JA 3M5LA 3RM2H 1AVGH 4JK5A 2BD3A 6CHAC 2RA0A 1GBBA 1GJBB 4JZFH 4RKOB 1A4WH 2H9TH 2OCVB 1YLDA 1C1UH 2W3KA 1W10U 2FEQH 1LKBA 1GI5A 2FS8A 3A8BA 5CE1A 1VZQH 1BUIA 1QB9A 4Y10E 3PO1B 4TWYA 1HV7A 2BOHB 3PMBB 5L6NH 3SZNA 3UTUH 4LZ4B 1MU6B 3TJVA 3U98H 2H5CA 4ABIA 1AU8A 1GG6B 1O34A 1OS8A 2GCHG 4X1NU 1J14A 1O30A 4WH6A 3RXPA 2ZG0H 2GP9B 3EDXB 2NU2E 1KLIH 6ESTA 1GDNA 1BMLA 4E7RG 1MU8B 3SBKA 3GCHB 4KTSA 4NA8A 1FY1A 3PLKA 4ZHAA 1FDPA 1QRXA 5J4SA 2AIQA 5FPTA 3E91A 1XUGA 5DK1A 1BTUA 4K60A 1OSSA 1O2XA 1KTSB 1QQ4A 3FZDA 1GJ8B 3S7KB 4WMDA 1GJAB 8KME2 2VVUA 3F9EA 1LHCH 1QB6A 1WOFA 2IOTA 1EASA 2ZU3A 3AW1A 1V2OT 1W3CA 1TBZH 1CHOF 2FOAA 2QAAA 1RTLA 3K65B 1MBQA 3Q3XA 1QURH 1MCVA 2Q6DA 2P59A 2FI4E 4ZH8A 2G51A 2PW8H 1ELVA 2Z9IA 1ZMJA 3LDXH 2CXVA 2P3UB 2HALA 3TNSA 3T25A 1HGTH 1MTWA 1OYQA 1O5GH 3VGCC 4H6SB 2BDYA 4FU8A 1W0YH 4NIWA 1AMHA 2BD8A 5BRRE 4WMEA 1P03A 1HJAB 2VIVA 3ZVAA 5A8YA 2QXIA 2VB0A 2YNAA 3C1KA 4CH2B 1O0DH 5E0JA 1SC8U 2BZ6H 3KHVA 2Y7ZA 3TVJB 3SNDA 3UY9A 4A1XA 3EGKH 2BVXH 1E35B 1NROH 1K1JA 1TX8A 2BMGB 3RDZA 5JBCS 3S9CA 1CA8B 2HNTF 1NN6A 3A7TA 2ZWLH 1Z8GA 2Z3CA 1HPGA 2XBVA 3P92A 1QBVH 1YCPH 2EEKA 1YPHC 1O2ZA 1T8NA 1FMGA 3MU0A 2JH6D 4MTBA 4RN6A 5JBTA 1XX9A 2XCNA 3LOXA 3STIA 3STJA 1K1OA 3QTVH 1WTHD 1PQAA 1CT4E 3NPSA 3SO3A 3RUOA 4VGCB 3ZZ3A 1ZGIA 2FOEA 1CGHA 3PO1C 1YCPK 1GHXH 1TPAE 3MH7A 1EKBB 1GVLA 1YBWA 1UTQA 1Y5AT 1TNGA 1BJUA 3QUMP 1PPHE 1RIWB 3SJKA 1A3EH 1UTMA 5E8EH 1GG6C 4LZ1H 1MH0A 1G37A 4WXVA 3LH1A 2ZFQH 3MU8A 3R0FA 1NT1A 5G4BA 2EI6A 2KAIB 1AB9B 2PGBB 1DOJA 1ID5H 3V13A 3GCHC 1C5LH 3IWMA 1C5UA 4KELA 4XFQA 4ABBA 1ARCA 3QN7A 2BXUH 1TPSA 1C5ZB 3AW0A 1P3EA 1EATA 4NA7A 1J9CH 2ZHEH 2P8OB 1G3DA 4ASHA 1HAXB 3U8TH 1QY6A 4MLFB 1D4PB 1WCZA 2RCEA 5B6OA 4DY7B 4YESB 2CMYA 1FY3A 5T6GA 4Y8ZA 4YM9A 1O5DH 3SJ9A 2RDLA 1G3CA 2ZU2A 1O3CA 2ZPRA 1C4U2 4JZEH 2FYRA 2TIOA 1K1MA 2GD4B 4DW2U 1MQ5A 4B76A 4DOQA 5JB9S 3HK6B 3SV9A 5CHAB 4ZKNU 1BA8B 2FDAA 4AFUA 1O37A 1HJAC 1KDQA 1BDAA 4Q7ZA 4HZHA 4JZDH 4Y71A 1K28D 2CGAA 2ZGXH 5EOKA 4NIYA 1O2WA 3UFAA 3RXQA 1AZ8A 3DFLA 4X8TH 4YT6H 2ZFPH 2P95A 3RXIA 2VWLA 1GCDA 1P2MA 3SJIA 1SPJA 2C8XB 2QIQA 1QRWA 1VCWA 3SNEA 1SLVB 3TU7H 5H4IB 1C5OH 1Z8JB 5A09A 1EB1H 4WWYA 2CHAC 1WQSA 4DGJA 2J95A 3RXDA 1HUTH 5FAHA 4A1TA 3QK1A 5T6DA 1GI1A 4VGCC 1O3DA 3A7XA 3RMNH 1GWAA 4X6NA 3E0NB 5EQQA 3GICB 2G5NA 4JZ1A 3ZZCA 4H42U 1LPZB 2BY6X 1DLKB 1H8IH 1RIWC 1QL8A 1LPGB 3QLPH 2ZIQH 1F0RA 5LGOA 3VPKA 1GHZA 1C1VH 2XCFA 1DT2A 1A5IA 3EA9A 3PV4A 4WH8A 3O8CA 3SV7A 3TH4H 5DP6A 1IQMA 4NFEA 3RMOH 2VINA 1PFXC 1LMWB 1YPLH 4R0IA 5ESTE 2C3SA 2ANMH 1OWKA 3LGWA 4CRDA 4B74A 1AY6H 1F2SE 2BLVA 2ZGJA 1ZRBA 1GMCG 5FCRA 2P8OC 1LKAA 1PPEE 1KXDA 3SJOA 1S6FA 1IHSH 3M35A 2O8LA 5DO4H 4AG1A 1K22H 2NWNA 1UVTH 1GHAF 2OC8A 3E16B 1C5SA 3BTWE 1BRUP 1HIAA 3DD2H 1MTVA 1GBHA 4FUJA 3ZVEA 2SGAA 1O5EH 1JOUB 2Z6BD 1O5AB 3ENSB 2Q6GA 2ZDLA 3RC4A 3LGUA 2F9UA 3IG6B 3SJ8A 2GGVB 3LIWA 2B5TB 3MH6A 3QWCH 1SFIA 3TPIZ 1NRNH 1TPOA 4I8GA 1C2GA 2OXSA 2B7DH 1NFYA 2ZGHA 1G3BA 2QN5T 3TJUA 1AGJA 1VJAU 4TPIZ 3T27A 1BTWA 2BVSH 1TGCA 4MPVA 3T26A 3U9AH 2THFB 1NU7B 2F83A 2OLGA 5EG4A 3QO6A 3TNTA 1SGFA 1TGTA 2P93A 2ZPQA 1FIWA 4A1VA 2GV7A 4JCNA 4HTCH 1GCTB 1SR5C 1C2LA 1S84A 1A5HA 4YTAA 1OWJA 4X8VH 1UK3A 1TABE 2ZEBA 3A85A 1ZPBA 2A4QA 1W2KH 1ELCA 2NU1E 1V2QT 4FUEA 1SQOA 2GMTB 1MAXA 5GIBA 1EJNA 1C2JA 4I8KA 2XW9A 5C1UA 2TRMA 3LU9B 3PTNA 1ABIH 1K1PA 2ZHDA 2J4IA 4BNRA 1ANDA 1SSXA 3FANA 1DWBH 2BD5A 2ZHQH 1FQ3A 3RMMH
chains in the Genus database with same CATH superfamily
5C17A 1YP9A 3ZYEA 2KR7A 2WUCA 3M7QA 1KLTA 1RXPA 2P16A 3OEED 1H8HD 4E7NA 4BTTB 4ASUD 3SU2A 1W7XH 3T5FH 5AHGH 3GY2A 4THNH 1OOKB 2FZZA 4NA9H 1O2RA 1GJ9B 4GHTA 3B9FH 1L1GA 1ARBA 1LTOA 3OAAD 3U1IB 3RMLH 2KFWA 1O2PA 2LP6A 1AQ7A 2ZCLP 3O8BA 1VJ9U 4JK6A 2F91A 4B71A 1GJCB 1GL1A 1T8LA 2ZU1A 1DLEA 2GJGA 2F43B 3EA8A 8ESTE 2ZU4A 5LPRA 1GI9B 2G81E 3Q3KA 2VU8E 2CJIA 1FY5A 3PB1E 1HLTH 1V3XA 1VITG 1AFEH 2A4RA 1ZR0A 3BTGE 3EYDA 2UUFB 3NCLA 1TMTH 1C2MA 1P2KA 1Z8RA 1DANH 1EAXA 3VB5A 1OXGA 4IGDA 4Y79A 1OWEA 4K3JA 4PROA 2W5EA 1D3DB 2C8WB 1E36B 4Q7YA 3SGBE 1Z6JH 1Z8IB 3O8DA 2O8TA 1O2VA 4TSFD 1O5CB 1P05A 2A2QH 1DUEA 1HRTH 2WUBA 2CN0H 4LK4A 4ZXYH 1YM0A 1XXFA 2AGGX 3ATMA 1ZTJA 3BIUH 5GCHG 3M61U 3U8OH 4ZKRU 3TH3H 4X8SH 1U6QA 1P8VC 2AEIH 1EZXC 5A8XA 4U30A 5JBAS 1MQ6A 2G4TA 1ESAA 2XBWA 3ZZDA 2OQUA 3VB6A 2ALVA 1DWCH 3NUMA 3S69A 4ZKSU 4AZ2B 1KYNA 3GY6A 1OP0A 5AVDA 1GCTC 1UTLM 5EGMA 1CBWB 2A7JA 4AORA 1A5GH 1SFQB 2GCHF 2ZGCA 2XRCA 3QZQA 1HXFH 3GY4A 1H9IE 2WPMS 4NIVA 2F9NA 4KTCA 4A6LA 5F53A 1DY9A 1BT7A 3RXJA 3EQ0H 1DSUA 1C2EA 3RXEA 1TQ7B 1C5MD 4YXWD 2O8MA 4OS5A 4ZUHA 3SQHE 1L0ZA 4YLQH 1H8DH 4K1EA 1QQUA 4ZXXH 1SG8B 4ZHLU 4ESTE 2VVVA 1J15A 5DP7A 4GCHG 5E0GA 3BEUA 4DJZB 2R2MB 2ULLA 2A31A 2FI5E 2QE7D 4TWWA 5DGJA 1TOMH 4ZROA 3P95A 2OC1A 2TGPZ 1DFPA 1S6HA 1XUFA 4X1QU 1N1LA 1S0QA 3SUDA 2FLBH 5LPEA 1B0FA 2BDGA 2JH0D 1KSNA 1SHHB 3T62A 2WYGA 4FUGA 1C1PA 3BIVH 3GCNA 1W0JD 2G55A 3F6UH 1C9PA 5AFYH 2WPLS 1ETTH 2OP9A 1O39A 1C4V2 5E2PA 3QGNB 3KQDA 1A1RA 1V2UT 1FI8A 2BY8X 3RXUA 1HAVA 3A7YA 3EAJA 2I6SA 4FUFA 4JYUH 4GAWA 2BQ7B 1F5RA 5DP4A 1UVOA 1ELDE 2TBSA 1MCTA 1ZHRA 3ATLA 5EIYA 3MHWU 1BCUH 3OE7D 1HAPH 1EFRD 3A89A 3MO9A 3BTEE 2FOCA 1ANCA 4XRNA 1HAIH 1SBWA 4DURA 3WY8A 4YZUA 4IMQA 4UE7H 1TRYA 2QGRA 2PTNA 4J1YA 2AMDA 3LONA 3SNAA 1C1TA 3BTKE 1SKYE 4K1TA 2M2AA 4X1PU 5KECA 1O2IA 1HBTH 4AGKA 5GWZA 2BD9A 1YF4A 3BG4B 3S9AA 1AVWA 1NO9H 1QFKH 3SU1A 3SV2H 3S7HB 1EZUC 3M5MA 2BTCE 4B2BA 3ZVFA 1XKBC 2WPKS 1CBWC 1HAVB 1H1BA 1Y5BT 1EP6A 4K69A 1BTZA 2AS9A 2HVYB 1NM6A 4ZCNA 1B0EA 3F2HA 2BDAA 3TGIE 7KMEH 3RXKA 1BZXE 1ETSH 2XBXA 3ZVCA 2PUXB 1KIGH 1YKTA 1VR1H 2OTVA 3ZZ9A 1AN1E 4X0WU 1TAWA 4DT4A 4Z0KA 1VCQA 1GBIA 2HLCA 2GV6A 4LOYH 1O3IA 3BTTE 2OD3B 3DSGA 2BQWB 3VB4A 1BHXB 4IN2A 2GZ9A 5E0HA 1RS0A 5C5OA 5F6MA 1GI3A 1ESTA 1BMFD 3FO8D 1G36A 2SGPE 1TMBH 2ZPSA 5F8XA 3QGJA 1AFQB 1XUIA 1ETRH 4INKA 4CRAA 3SI4H 1TX6A 3U8RH 2Q1JA 4ISLA 5EPNA 1ELGA 4AG2A 1O3NA 2G00A 2WZQA 2ZZUH 2QF3A 1LVOA 2A7CA 1TB6H 2BY7X 4ZAEA 1D9IA 2AFQB 2WV4A 1O2NA 5EJ1A 3M5OA 1C1OA 1HXEH 2BD4A 1A61H 3PRBA 2VH6A 1GJDB 2AERH 1P0SH 2QF0A 3UIRA 1TNKA 3RXHA 1IQGA 3SW2B 2OQ5A 5HYOA 2V3MA 3FFGA 4WJG2 1C1QA 3MO6A 3MH4A 1UK2A 3A88A 4B2AA 3KQ5A 4OGYA 1EAIA 1NESE 2BDIA 2ZQ2A 4Z6AH 4Z1MD 1ZZZA 1CT0E 4IN1A 3TK9A 4DIIH 5FPSA 1J17T 3A80A 3PMJA 2ZDAH 1V6DA 3FP6E 1Z71A 1O2GH 1KTTB 1E38B 2FXRA 1O3BA 1SGNE 2J38A 3SHCH 3BG4C 4NGAH 1BQYA 1EAUA 3TK6A 1QNJA 3Q77A 1SGIB 1W12U 1O32A 4B75A 1FN6A 2AHME 3ZZBA 5FPYA 1C1NA 2L74A 1DM4B 2QF4A 1A46H 5JB8S 2TGTA 1LVMA 1NFWA 1OWDA 5FBIA 4BANB 1O2LA 1MZDA 1SGPE 1TNHA 3KYFA 1TWXB 3AVZA 4Y0ZE 2V6NA 1AWHB 3KYGA 2DE9A 1UTOA 1O3EA 1LCYA 1PPZA 1V2NT 2XC4A 1Y3VA 1SGEE 3OFND 1SGCA 3P8GA 3L3TA 1ELTA 1QHRB 1JRSA 1BRAA 1NBME 5C1YA 1D3QB 2VH0A 2SGEE 1GMCF 1HAHH 3DT0H 4D7GA 2G5VA 3L6PA 1Z6EA 3RXOA 5L2YH 3GY7A 4GVUA 1T4VH 4Y8XA 1MD8A 1SQAA 1AFQC 1GHYH 1TFXA 1TBQH 3R3GB 4ISIH 1WDIA 3BSQA 5GNDA 4M7GA 2VVCA 3W95A 1HAYB 1GJ7B 3UAIC 2AGEX 1CA0B 1ZMLA 2ZDNA 1TE0A 5EPYA 2GT7A 3E1XB 1O3PB 2Z9LA 1P10A 2V3OH 2PHBA 3MFJA 1MZAA 1O3MA 1NY22 1FNIA 1FZZA 1KXBA 4AYVB 2PSYA 2OC0A 2BOKA 2G4UA 2BM2A 2KCPA 3D49H 1TGSZ 3SHAH 2ODYB 4BAOB 5J4QA 1HNEE 2G52A 3O8RA 2XC0A 2QCYA 1PJPA 1GJ4H 2PV9B 1GBMA 2IJOB 1VGCB 1FONA 2QV1A 2W7UA 1RRKA 2QXJA 4X8UH 4FUCA 1DVAH 1WU1A 1WAYB 3HGNA 2AH4X 3HK3B 2VIWA 1QJ7B 1AD8H 3PMAB 2ODPA 2IN2A 3RC5A 1S82A 2UWOA 4TT3D 3WWFA 1O3HA 4AYYB 5SGAE 1GI7B 4YO9A 3BEIB 1KMHB 4ZMAH 4O03A 3V0XA 2VIPA 4RSPA 4CBNA 2XOKD 2HGTH 3UUZA 2LELA 5FXLA 3U28C 1MKXH 1MTNB 4O3UA 1B7XB 1OP2A 3PYHA 1ZGVA 2OC7A 1O3FA 2Y7XA 1H4WA 2FOBA 2GTBA 2O9QA 1MTUA 1CGIE 1O3KA 1C2KA 4NG9H 4ABAA 1RFNA 2HPPH 1ZRKA 1D3TB 4GSOA 4Y8YA 1COWD 5TJXA 3NKKA 5FHTA 2W6ID 1MKXK 2AMQA 2A7HA 1T32A 1EJAA 3LT3A 1UMAH 1KDQB 3OSYA 1Y5UT 4MPWA 1QZ8A 3Q00A 4ABHA 4CRFA 2ZFTA 5HKKD 2KCOA 3BTME 3F0PA 1F5KU 2A4GA 5HGGA 1T8OA 2HWLB 3OTJE 4NZLA 4FUHA 1QJ6B 2ZF0H 1ZOMA 3URCA 1TNLA 2BD7A 1A0LA 4TY7A 1O2OA 1AB9C 1W7GH 4JYTA 4UFGH 1DS2E 3FKSD 4BTUB 1WUNH 1HDTH 3MU4A 5HIYA 1GBEA 2V3HH 1FY4A 1JXPA 4CRBA 3WW7A 3P8FA 1VITF 4XOJA 2RFKC 2ZCKP 2VWMA 4HGCA 1O5BB 2YMSB 4I8LA 2J98B 1D6WA 1Q2WA 4ABFA 1DITH 1GVZA 4Y11E 1BTYA 1UTJA 5DP3A 3RC6A 1C5WB 4Y6DA 1EB2A 1C1WH 1V2LT 1GBAA 3MMGA 1WTGH 3E90B 4SGBE 4AN7A 1QA0A 2LPRA 9ESTA 1SQTA 4IC5A 1OPHB 5GCHF 2DUCA 3A8AA 4O3TA 2AGIX 5C2ZA 1VGCC 4TPYA 5I46H 1ACBE 3HPTB 4M9FA 1UTNA 2Z7FE 3ZV9A 3RU4D 5EW2H 1XUJA 2PKSB 5CHAC 1OWHA 5EQSA 2BD2A 2ALPA 1V2MT 3MTYA 5DSFA 3PWCA 2HNTE 4D76A 2J34A 3SUFA 1HCGA 3Q76A 4NFFA 1BTHH 3A86A 2GKVE 1THRH 1O3OA 1V2RT 4X2WA 3SUGA 1XKAC 4AGJA 3KL6A 4CBOA 1GI2A 3QDZB 3SQEE 1O35A 3OX7U 3UOPA 1MTNC 1OKXA 1T7CA 1C9TA 1HIAB 2BDCA 1W13U 2ESTE 2XC5A 1UVPA 1S85A 5A2MH 2ZFRH 1N6XA 1H8ED 4MNYA 4P02A 2FMJA 2TGAA 3UWIA 2EC9H 3PV2A 1THSH 3WWBA 5ETXA 3GCTG 1HJ8A 2A2XH 5GDSH 5DPAA 1ABJH 1SGFG 3TITA 1F7ZA 3DUXH 1QTFA 2JKHA 2O8WA 1L4ZA 2OBOA 2SGQE 1RGQA 4GCHF 4I33A 3A81A 2BDBA 2OUAA 2R0KA 1LHEH 4X2YA 4ACBA 3LGVA 1D3PB 2V35A 1PPCE 3GOVB 3OYPA 2A1DB 4RT0A 5A0BA 1YPKH 4FVDA 1P9SA 1UCYH 1CU1A 3PV5A 3F9FA 2WPJS 3Q3YA 4K8BA 2GZ8A 2WPIS 1AIXH 2I6QA 2GDDA 3KQBA 1C1RA 4U2WA 4HFPB 1HFDA 1SGYE 2FYQA 2FLRH 1J8AA 1M9UA 1QA7A 1BMAA 1O3LA 2P3FH 4SGAE 3T28A 4BAHB 3B23B 2YMSC 3TK5A 1EX3A 3PWBA 2C8YB 4MVNA 3PLPA 4WY3A 1VCPA 1BB0B 2BX3A 1DWDH 1TRMA 7ESTE 2QF5A 2V7QD 3JZ2B 4MNWA 1C5TA 5JBBS 1TQ0B 2ZDVH 3SGQE 2H5DA 2FPZA 1IQKA 2V0BA 4UDWH 3DA9B 1DICA 1SB1H 4FU9A 2ZU5A 4I31A 1V2VT 2BX4A 3LPRA 2A5IA 3M3TA 2NU3E 4UFFH 2BVRH 3RXSA 5T6FA 4UONA 5EXMA 1YPMH 1PPFE 2PKSC 2GVFA 1C5XB 3ESTA 4Y76A 2VWOA 2ZKSA 2PR3A 2NU0E 1ORFA 3SU5A 3VXEH 4NSVA 4UFDH 3ZYDA 1OP8A 2IPQX 1BRBE 1EOJA 1XXDA 1ANEA 1N8OB 2WPHS 2PTCE 1HYLA 3MYWA 1X7AC 1O5FH 3MH5A 4ISNA 1FAKH 4A5TS 1MD7A 1TNJA 3TGKE 1AZZA 1AO5A 4WXIA 1E1RD 1SI5H 4Q2KA 3TLOA 1L2EA 1FY8E 4R8TB 2GMTC 1UHBA 5EQRA 1EXFA 2PKAA 5ESBA 5TCAA 5JDUB 1Q31A 2C93B 1ZSLA 1OYTH 3UPEA 4YOIA 1TGNA 4JMYA 3MOCA 3UNSA 3PM3A 7LPRA 1DXPA 1Y3UA 1Y3WA 3EE0B 5K7RA 3A8DA 1GBCA 1RD3B 3DFJA 3A83A 1P2QA 2F9PA 2RA3A 3M7UA 1YLNA 2CF8H 5L2ZH 2Y5GA 1MMJN 1ZMNA 5AF9H 5HM9A 3RXRA 2J92A 3G01A 2R0LA 1JWTA 3KF2A 3ZZ8A 1D6RA 1THPB 3CENA 2ZI2H 4X1RU 5FL7D 3FAOA 3SORA 1SOZA 2PKAB 3P8NA 3E8LA 2SNWA 2VJ1A 4U01A 2UWPA 1GMHG 4FUBA 5GPIB 6LPRA 1O2SA 3RLYH 1L4DA 1S6LA 3B8JA 1E0FD 2BLQA 1QGFA 3SN8A 4Q4LA 3ZVBA 3OU0A 4OS1A 1DE7H 1KXAA 1LVBA 3AASA 4X6MA 4Q7XA 5T3HA 3RLWH 1KY9A 4CREA 3ZVGA 1A7SA 1DXWA 1QL9A 2GT8A 5C67A 3BTFE 1NPMA 2F9BH 3BN9A 1LPKB 4YOJA 2ANKH 4YLUA 1C5QA 1ZTLA 5AFZH 1V2KT 1NFXA 2P3TB 2Y80A 5F03A 2KZ4A 5PTPA 1NRQH 4Q80A 5F8TA 4JZIA 1GHVH 3HGPA 5FCKA 1O38A 1HAOH 1MAYA 1LHGH 2A45B 3FZZA 2QYIA 2FI3E 2OK5A 3MNXA 2Z3EA 1V2WT 1ANBA 2XBYA 3TIUA 1DSTA 1QR3E 1HB0B 1N8OC 2R9PA 1SGDE 4J2YB 2ZO3H 1TONA 2ZP0H 2B8OH 1WV7H 1SGRE 4E06H 3ODDA 3I29A 1WSSH 1V2JT 3TJOA 4INHA 3SV6A 1P2IA 2FS9A 2KX4A 4E05H 1Q3XA 1P11E 1BRCE 3DHKH 3F68H 3UQOA 5A0CA 2FTMA 1TRNA 2XNDD 8GCHF 1UVSH 3TJNA 3SV8A 3SOSA 3ZZAA 1S5SA 2ZTXA 1P57B 3HKJB 4AOQA 2ASUB 3S9BA 1YYY1 1AUJA 2AIPA 4KTUA 4Y7BA 1YY3A 3RXAA 2Y5FA 3T2NA 1EP5A 1W11U 4FXGH 4H4FA 3F1SB 2C90B 5EXNA 1GPZA 3GCOA 1E37B 5EW1H 1NU9A 4ABGA 2UWLA 2WINI 1G9IE 4IC6A 3RM0H 1PQ8A 1YLCA 2TPIZ 1P06A 4MNXA 2VGCB 2AMPA 4D7FA 1ELBA 2FIRH 1WYKA 1PPBH 1P01A 1B5GH 1Y8TA 4CR9A 1ZTKA 4MNVA 1K9OE 4MDSA 1OX1A 2W6JD 4NIXA 1GBTA 4OS6A 1P2OA 1VITH 4NSYA 4F49A 4QT8C 4FVBA 1Y59T 3GY3A 3MNBA 1PQ5A 3MNSA 1SLWB 1ZJDA 3FVFB 2PWXA 1BIOA 1ZSJA 2XYAA 1YPHE 4BAMB 4XBCA 4OM9A 3GDSA 3LJJA 1CQQA 2H9EH 4IBLH 1K0HA 5HMAA 3UWJH 2B0FA 1ZSKA 2H6MA 1C5YB 3QX5H 3NWUA 5JPMH 1NZQH 2GDEH 2ZECA 4CR5A 1YC0A 3UNQA 4B1TA 1GDUA 1OWIA 1W8BH 1TNIA 1MBMA 4UEHH 1EAWA 2H1UA 2PFEA 3RXVA 4Y0YE 3M36A 5FX5A 1HAZB 2K0QA 3K2UA 3AAUA 3CP7A 2BY5X 3OEHD 4BAKB 2ZDMA 6GCHG 1SLXB 2EI7A 2FX6A 3ZZ7A 4X6PA 2RG3A 1O2KA 2K1QA 4OS7A 5FX6A 9LPRA 4BTIB 4B2CA 3MQKC 5I25A 3NZIA 2WYJA 3ODFA 4U32A 1FPCH 1W0ZU 2ZNKH 2JIZD 1QJ1B 5EXLA 3AK5A 3E3TA 1ZJKA 3BEFB 3SI3H 4CRCA 2FESH 3I77A 2BY9X 1F0TA 1J16A 1GJ5H 2KAIA 2BDHA 4OS4A 1ELFA 2ZFSA 4OS2A 1TLDA 2KCAA 4MG3A 3A7ZA 4NWKA 2A32A 3K6ZA 2ZDKA 4I8JA 2CHAB 8GCHG 4AFQA 1LVYA 2WV5A 4GUXA 2NU4E 3JZ1B 2ANYA 1P12E 2FP7B 2FTLE 3VXFH 1A0HB 5C3NA 1EJMA 2QY0B 1XM1A 3ZZ4A 3CS7A 4WF8A 2VGCC 2JETB 3V7TA 1XVOA 3D62A 2A5KA 3CS0A 4O9VA 4X2VA 1GHBF 3SU0A 1GL0E 1SLUB 4FOUC 1K2I1 1TA6A 1AHTH 4FUDA 5C5NA 5A0AE 3UOUA 1YPJH 2Z9GA 3GY8A 4MPUA 1FV9A 1GBFA 1EOLA 3BTHE 4D9RA 3P70B 1KXCA 5L30H 1BITA 3TH2H 1AE8H 3L33A 4K2YA 1T4UH 2HRVA 1O3GA 1GI0A 1JIMA 1H9HE 3K6YA 2CV3A 1Y3XA 1UVUH 1DWEH 4GPGA 4WVPE 1NTPA 2D8WA 3P8OA 2IPHA 1DUAA 1K1IA 2KM0A 4Y7AA 4ISHH 3MI4A 1BBRE 1UK4A 1P3CA 2G8TA 3KGPA 3SUEA 1GBJA 2BHGA 1P2JA 1C2IA 2ZTYA 1FLEE 5GJ4B 1LQEA 4B6FA 1CSOE 3LC5A 1TALA 4K5ZA 1G2LA 2YNBA 2P94A 1XUKA 3NXPA 1P02A 1AI8H 1MTSA 1NFUA 3U69H 4CHAB 2O8UA 4DCDA 1GBDA 4INLA 2ZQ1A 1TMUH 3RXFA 1JMOH 3OY5U 1ZHMA 3SU3A 2GZ7A 4XE4A 1CHOG 1INCA 2BQ6B 2FWWA 2ZTZA 1O2UA 1LO6A 1O2QA 3PLBA 1T31A 2XTTB 2W7SA 2BYAX 3GCTF 2W26A 4TYDA 2STBE 4ACAA 2BLOA 2FOGA 2HVXA 1FUJA 2Z94A 4BOHA 1SHYA 1C5NH 3GDUA 3N7OA 5JYIA 2C8ZB 1YCPM 3KN2A 1SGTA 2VIDA 3M7TA 2R3YA 1TIOA 5C20A 3E6PH 2Y81A 4NCYA 2J94A 3BTDE 1KXFA 3MO3A 3S0NA 2A0QB 1SGQE 1UCYE 3U1JB 2ZGBH 2VBCA 5CMXH 3RXMA 3RU4E 1F5LA 3NRLA 4MPXA 3ZV8A 1F92A 1GI4A 3F2GA 4UD9H 2Z3DA 2WV9A 1LHDH 1ZLRA 3ZVDA 4KP0A 4O97A 1S81A 3PTBA 3H7TA 1QIXB 2PP6A 3OY6U 2JETC 1QBOA 1L1NA 1RTFB 3M3VA 3A87A 2FO9A 4UFEH 4X2XA 1TBRH 4ZKOU 1XVMA 1F0UA 1V2TT 1CA0C 4K1SA 4F55A 5KEDA 3KIDU 1NRRH 4ABEA 1BMMH 3GDVA 1AUTC 1GI8B 2XWAA 1LHFH 1E1QD 1K21H 2FM2A 3ATKA 3NK8A 3KQEA 1NC6A 1GHBG 3GY5A 4XD7D 2IJD1 1V2ST 2JDID 1ZHPA 1S0RA 3IITA 5DJ7A 3RU4T 2J9NA 3URDA 1RTKA 1FPHH 1TYNA 1TOCB 1IQJA 2ZHFH 1EPTA 1KLJH 3HATH 1G32B 5DKMA 3RXLA 1FXYA 3GISB 1CGJE 1QRZA 3ATWA 1IQEA 4ABJA 3EA7A 2BLWA 2H9HA 1Z1IA 3A7WA 1BBRH 2ZA5A 5TCCA 4I32A 1XMNB 1A3BH 1GGDB 4FU7A 4CHAC 3N7DA 2Y5HA 1O2TA 4KGAA 1DPOA 1DX5M 4X1SU 3A82A 5GXPA 1BTPA 4CRGA 3UR6A 3VB7A 2XXLA 1TA2A 1CVWH 4I8HA 2RDEA 1E34B 5C1XA 1ELAA 1BBRK 2JH5D 2ZFFH 7GCHF 4F48B 1Z7KA 2XWBI 3KCGH 2Y82A 1C5VA 4DT7B 1EPTB 4DG4A 4FUIA 3KQCA 3LGYA 1YPEH 4XBBA 1C2FA 4YOGA 4GLYA 1O36A 3KEEA 3ELAH 2GX4A 2R3UA 3SU4A 1WQVH 1UTKA 2QA9E 4ISOA 1YGCH 2AYWA 1EZQA 1C2DA 1W14U 4ABDA 1TGBA 3V3MA 1A2CH 2J5UA 4FETA 1H9LB 2ZCHP 1CHGA 3W1EA 5LPFA 2SFAA 3RXBA 4K8YA 2D2DA 1CE5A 3F3BA 1GMDF 3I78A 1TX7A 1F0SA 1GI6A 1MUEB 2F3CE 4BXWA 1JRTA 1GBKA 1GMHF 2D26C 3M3SA 2BZAA 2ANWA 2GCTB 5A8ZA 3MNCA 2HNTC 4B73A 3QZRA 3LH3A 3M37A 2BB4A 4AFZA 3LGTA 1P9UA 5BPEA 1UCYK 1DY8A 4TY6A 1L1JA 1SOTA 1YWUA 2H2ZA 1FJSA 1AWFH 3SGAE 2WSSD 2SNVA 2YOLA 1O2HA 1C1MA 1O3AA 2YMSD 2PSXA 4I86A 3HKIB 1ZYOA 1CO7E 3M5NA 5C0UA 1AE5A 1UTPA 3F9GA 4IW4E 2FX4A 1BMNH 2BXTH 1O2YA 3GYMA 1G30B 4HI3A 4OGXA 2DE8A 4MQAA 4RKJB 3TGJE 1O33A 2Q6FA 1G3EA 1PYTC 2PLXA 2UUKB 1C1SA 3H5CB 1G2MA 4BAQB 1GGDC 3RXTA 2ZC9H 2A4OA 1DDJA 1O3JA 1QB1A 1PYTD 4XBDA 3UNRA 2UUYA 3PMHB 1ESBA 3LC3A 3RXGA 4AB9A 2XNIA 2C4FH 4D9QA 1GHAG 2CF9H 3D23A 3MU5A 4XDEA 1BHXF 1XUHA 5IDKA 1UO6A 1WBGB 3UR9A 3K9XB 2Y6TA 4AB8A 2VWNA 2B9LA 4ZHMU 2FODA 2FOMB 3BV9B 1AKSA 1IQHA 4WMFA 2VIOA 5B6LA 1EPTC 2F9OA 1SMFE 4X6OA 1YPGH 3BTQE 2CK3D 3PROA 4IMZA 2F9VA 3RXCA 3BF6H 5EU8A 5T1VA 4DIHH 1RJXB 3AAVA 2J97A 7GCHG 1C5RA 1BOQA 1GHWH 2QC2A 4F4OC 5F8ZA 5E2OA 3QTOH 3A7VA 3GYLB 4NWLA 6CHAB 3FP8E 1GVKB 1P09A 2HPQH 4AX9H 5K0HA 5HM2A 2EQNA 1UJ1A 1FN8A 4NZQA 1FIZA 2K8IA 1LDTT 4KKDA 1EQ9A 4A7IB 3N7EA 4GHQA 3P17H 3P6ZB 1QCPA 2EI8A 2ODQA 5DP5A 4DVAU 1PQ7A 1PPGE 5EODA 2UUJB 3MU1A 3OTPA 1NRSH 1QL7A 3C27B 1AKSB 1QBNA 1TPPA 3D65E 2GCTC 1K1LA 3LGIA 3VFEA 2R2WU 5HIZA 4I7YH 3ZZ5A 1UHBB 5DP8A 1GMDG 1C2HA 3SU6A 3W94A 2EA3A 3ZZ6A 5ABWA 1N6YA 1EZSC 1AVXA 3LJOA 1ZPCA 2SGDE 1JBUH 3H7OA 1HAGE 1MKWH 1C5PA 1T8MA 2OINA 5FBEA 2J2UA 3FN8A 1O31A 1NS3A 3VEQB 5IYTA 1SVPA 5DG6A 5LH8A 1IQNA 2Z9JA 3N99A 2VNTA 1LQDB 2M5TA 4AFSA 4BXSA 2ILNA 2QXGA 3E0PB 3LKWA 6GCHF 1ZPZA 1JIRA 3SNBA 2TGDA 2HOBA 1Y3YA 1MKWK 2JJ2D 8LPRA 1O2MA 4IS5A 3KNXA 1C4Y2 1P04A 3FP7E 2FOHA 4CH8B 1S83A 3F9HA 2D1JA 2PGQB 1GBLA 1GDQA 1P2NA 4XSKU 1IQIA 3UQVA 2OBQA 2W3IA 1IHTH 3SNCA 3VGCB 3BG8A 5C94A 1Z1JA 2STAE 2Z9KA 1IQFA 4H6TA 1O2JA 3MWIU 1GJ6A 5DP9A 3ITIA 1CT2E 3ATIA 2A5AA 1ELEE 3A8CA 5HXFA 1HJ9A 2FOFA 1IOEA 2PUQH 4JYVH 4LXBH 3T29A 1K1NA 1IQLA 4YT7H 1SL3A 2QXHA 3PRDA 2VIQA 1NRPH 1IAUA 4A92A 3UREA 1BTXA 1FAXA 1V2PT 3V12A 4RT1A 3A84A 2WHXA 1BJVA 2SGFE 2LNCA 2WPDD 2ZHWH 3VB3A 1EUFA 1KXEA 3RP2A 4D8NA 1A0JA 3M5LA 3RM2H 1AVGH 4JK5A 2BD3A 6CHAC 2RA0A 1GBBA 1GJBB 4JZFH 4RKOB 1A4WH 2H9TH 2OCVB 1YLDA 1C1UH 2W3KA 1W10U 2FEQH 1LKBA 1GI5A 2FS8A 3A8BA 5CE1A 1VZQH 1BUIA 1QB9A 4Y10E 3PO1B 4TWYA 1W0KD 1HV7A 2BOHB 3PMBB 5L6NH 3SZNA 3UB0A 3UTUH 4LZ4B 1MU6B 3TJVA 3U98H 2H5CA 4ABIA 1AU8A 1GG6B 1O34A 1OS8A 2GCHG 4X1NU 1J14A 1O30A 4WH6A 4AC9A 3RXPA 4B6EA 2ZG0H 2JJ1D 2GP9B 3EDXB 2NU2E 2F4LA 1KLIH 6ESTA 1GDNA 1BMLA 4E7RG 5DN6D 1MU8B 3SBKA 3GCHB 4KTSA 4NA8A 1FY1A 3PLKA 4ZHAA 1FDPA 1QRXA 5J4SA 3F0OA 2HLDD 2AIQA 5FPTA 3E91A 1XUGA 4RI0A 5DK1A 1BTUA 4K60A 1OSSA 1O2XA 1KTSB 1QQ4A 3FZDA 1GJ8B 3S7KB 4WMDA 1GJAB 8KME2 2VVUA 3F9EA 1LHCH 1QB6A 1WOFA 2IOTA 1EASA 2ZU3A 3AW1A 5CDFE 1V2OT 1W3CA 1TBZH 1CHOF 2FOAA 2QAAA 1RTLA 3K65B 1MBQA 3Q3XA 1QURH 1MCVA 2Q6DA 2P59A 2FI4E 4ZH8A 2G51A 2PW8H 1ELVA 2Z9IA 1ZMJA 3LDXH 2CXVA 2P3UB 2HALA 3TNSA 3T25A 1HGTH 1MTWA 1OYQA 1O5GH 3VGCC 4H6SB 2BDYA 4FU8A 1W0YH 4NIWA 1AMHA 2BD8A 5BRRE 4WMEA 1P03A 1HJAB 2VIVA 3ZVAA 5A8YA 2QXIA 2VB0A 2YNAA 3C1KA 4CH2B 1O0DH 5E0JA 3GS9A 1SC8U 2BZ6H 3KHVA 2Y7ZA 3TVJB 3SNDA 3UY9A 4A1XA 5EJLA 3EGKH 2BVXH 1E35B 1NROH 1K1JA 1TX8A 2BMGB 3RDZA 5JBCS 1MABB 3S9CA 1CA8B 2HNTF 1NN6A 3CNRA 3A7TA 2ZWLH 1Z8GA 1SQRA 2Z3CA 1HPGA 3SYJA 2XBVA 3P92A 1QBVH 4Q63A 1YCPH 2EEKA 1YPHC 1O2ZA 1T8NA 1FMGA 3MU0A 2JH6D 4MTBA 4RN6A 5JBTA 1XX9A 2XCNA 3LOXA 3STIA 3STJA 1K1OA 3QTVH 1WTHD 1PQAA 1CT4E 3NPSA 3SO3A 3RUOA 4VGCB 3ZZ3A 1ZGIA 2FOEA 1CGHA 3PO1C 1YCPK 1GHXH 1TPAE 3MH7A 1EKBB 1GVLA 1YBWA 1UTQA 1Y5AT 1TNGA 1BJUA 3QUMP 1PPHE 1RIWB 3SJKA 1A3EH 1UTMA 5E8EH 1GG6C 4LZ1H 1MH0A 1G37A 4WXVA 3LH1A 2ZFQH 3MU8A 3R0FA 1NT1A 5G4BA 2EI6A 2KAIB 1AB9B 2PGBB 1DOJA 1ID5H 3V13A 3GCHC 1C5LH 3IWMA 1C5UA 4KELA 4XFQA 4ABBA 1ARCA 3QN7A 2BXUH 1TPSA 1C5ZB 3AW0A 1P3EA 4P00A 1EATA 1E79D 4NA7A 1J9CH 2ZHEH 2P8OB 1G3DA 4ASHA 1HAXB 3ZIAD 3U8TH 1QY6A 4MLFB 1D4PB 1WCZA 2L6OA 2RCEA 5B6OA 4DY7B 4YESB 2CMYA 1FY3A 5T6GA 5KGOA 4Y8ZA 4YM9A 3EE7A 5IK2D 1O5DH 3SJ9A 2RDLA 1G3CA 2ZU2A 1O3CA 2ZPRA 1C4U2 3F2FA 4JZEH 2FYRA 2TIOA 1K1MA 2GD4B 4DW2U 1MQ5A 4B76A 4DOQA 5JB9S 3HK6B 3SV9A 5CHAB 4ZKNU 1BA8B 2FDAA 4AFUA 1O37A 1HJAC 1KDQA 1NBMD 1BDAA 4Q7ZA 1OHHD 4HZHA 4JZDH 4Y71A 1K28D 5C0TA 2CGAA 2ZGXH 5EOKA 4NIYA 1O2WA 3UFAA 3RXQA 1AZ8A 3DFLA 4X8TH 4YT6H 2ZFPH 2P95A 3RXIA 2VWLA 1GCDA 1P2MA 3SJIA 1SPJA 2C8XB 2QIQA 1QRWA 1VCWA 3SNEA 1UW7A 1SLVB 3TU7H 5H4IB 1C5OH 1Z8JB 5A09A 1EB1H 4WWYA 2CHAC 1WQSA 4DGJA 2J95A 3RXDA 1HUTH 5FAHA 3VG8A 4A1TA 3QK1A 5T6DA 2J98A 1GI1A 4VGCC 1O3DA 3A7XA 3RMNH 1GWAA 4X6NA 3E0NB 5EQQA 3GICB 2G5NA 4JZ1A 3ZZCA 4H42U 1LPZB 2BY6X 1DLKB 1H8IH 1RIWC 1QL8A 1LPGB 3QLPH 2ZIQH 3DSOA 1F0RA 5LGOA 2EY4C 1VKYA 3VPKA 1GHZA 1C1VH 2XCFA 1DT2A 1A5IA 3EA9A 3PV4A 4WH8A 3O8CA 3SV7A 3TH4H 5DP6A 1IQMA 4NFEA 5EJZA 3RMOH 2VINA 1PFXC 1LMWB 1YPLH 4R0IA 5ESTE 2C3SA 2ANMH 1OWKA 3LGWA 4CRDA 4B74A 1AY6H 1F2SE 3DCLA 2BLVA 2ZGJA 1ZRBA 1GMCG 5FCRA 2P8OC 1LKAA 1PPEE 1KXDA 3SJOA 1S6FA 1IHSH 3M35A 2O8LA 1FX0B 5DO4H 4AG1A 3SZEA 1K22H 4HG6A 2NWNA 1UVTH 1GHAF 2OC8A 3E16B 1WXRA 1C5SA 3BTWE 1BRUP 1HIAA 3DD2H 1MTVA 1GBHA 4FUJA 3ZVEA 2SGAA 1O5EH 1JOUB 2Z6BD 1O5AB 3ENSB 2Q6GA 2ZDLA 3RC4A 3LGUA 2F9UA 3IG6B 3SJ8A 2GGVB 3LIWA 3FOAA 2B5TB 3MH6A 3QWCH 1SFIA 3TPIZ 1NRNH 1TPOA 4I8GA 1C2GA 2OXSA 2B7DH 1NFYA 2ZGHA 1G3BA 2QN5T 3TJUA 2KCYA 1AGJA 1VJAU 4TPIZ 3T27A 1BTWA 2BVSH 1TGCA 4MPVA 3T26A 3U9AH 2THFB 1NU7B 2F83A 2OLGA 5EG4A 3QO6A 3TNTA 1SGFA 1TGTA 2P93A 2ZPQA 1FIWA 4A1VA 2GV7A 4JCNA 4HTCH 1GCTB 1SR5C 1C2LA 1S84A 3H09A 1A5HA 4YTAA 1OWJA 4X8VH 1UK3A 1TABE 2ZEBA 3A85A 1ZPBA 2A4QA 1W2KH 1ELCA 2NU1E 1V2QT 4FUEA 1SQOA 2GMTB 1MAXA 5GIBA 1EJNA 1C2JA 4I8KA 2XW9A 5C1UA 2TRMA 3LU9B 3PTNA 1ABIH 1K1PA 5CHBA 2ZHDA 2J4IA 4BNRA 1ANDA 1SSXA 3FANA 1DWBH 2BD5A 2ZHQH 1FQ3A 3DSPA 3RMMH
chains in the Genus database with same CATH topology
1YP9A 3ZYEA 2WUCA 3M7QA 1KLTA 1RXPA 2P16A 4E7NA 4BTTB 3SU2A 1W7XH 3T5FH 5AHGH 3GY2A 4THNH 1OOKB 2FZZA 4NA9H 1O2RA 1GJ9B 4GHTA 3B9FH 1L1GA 1ARBA 1LTOA 3U1IB 3RMLH 1O2PA 2ZCLP 1AQ7A 3O8BA 1VJ9U 4JK6A 2F91A 4B71A 1GJCB 1GL1A 1T8LA 2ZU1A 1DLEA 3EA8A 8ESTE 2ZU4A 5LPRA 1GI9B 2G81E 3Q3KA 2VU8E 2CJIA 1FY5A 3PB1E 1HLTH 1V3XA 1VITG 1AFEH 2A4RA 1ZR0A 3BTGE 3EYDA 2UUFB 3NCLA 1TMTH 1C2MA 1P2KA 1Z8RA 1DANH 1EAXA 3VB5A 1OXGA 4IGDA 4Y79A 1OWEA 4K3JA 4PROA 2W5EA 1D3DB 2C8WB 1E36B 4Q7YA 3SGBE 1Z6JH 1Z8IB 3O8DA 2O8TA 1O2VA 1O5CB 1P05A 2A2QH 1DUEA 1HRTH 2WUBA 2CN0H 4LK4A 4ZXYH 1YM0A 1XXFA 2AGGX 3ATMA 1ZTJA 3BIUH 5GCHG 3M61U 3U8OH 4ZKRU 3TH3H 4X8SH 1U6QA 1P8VC 2AEIH 1EZXC 5A8XA 4U30A 5JBAS 1MQ6A 2G4TA 1ESAA 2XBWA 3ZZDA 2OQUA 3VB6A 2ALVA 1DWCH 3NUMA 3S69A 4ZKSU 4AZ2B 1KYNA 3GY6A 1OP0A 5AVDA 1GCTC 1UTLM 5EGMA 1CBWB 2A7JA 4AORA 1A5GH 1SFQB 2GCHF 2ZGCA 2XRCA 3QZQA 1HXFH 3GY4A 1H9IE 2WPMS 4NIVA 2F9NA 4KTCA 4A6LA 1DY9A 1BT7A 3RXJA 3EQ0H 1DSUA 1C2EA 3RXEA 1TQ7B 1C5MD 2O8MA 4OS5A 4ZUHA 3SQHE 1L0ZA 4YLQH 1H8DH 4K1EA 1QQUA 4ZXXH 1SG8B 4ZHLU 4ESTE 2VVVA 1J15A 5DP7A 4GCHG 5E0GA 3BEUA 4DJZB 2R2MB 2ULLA 2A31A 2FI5E 4TWWA 5DGJA 1TOMH 4ZROA 3P95A 2OC1A 2TGPZ 1DFPA 1S6HA 1XUFA 4X1QU 1N1LA 1S0QA 3SUDA 2FLBH 5LPEA 1B0FA 2BDGA 2JH0D 1KSNA 1SHHB 3T62A 2WYGA 4FUGA 1C1PA 3BIVH 3GCNA 2G55A 3F6UH 1C9PA 5AFYH 2WPLS 1ETTH 2OP9A 1O39A 1C4V2 5E2PA 3QGNB 3KQDA 1A1RA 1V2UT 1FI8A 2BY8X 3RXUA 1HAVA 3A7YA 3EAJA 2I6SA 4FUFA 4JYUH 4GAWA 2BQ7B 1F5RA 5DP4A 1UVOA 1ELDE 2TBSA 1MCTA 1ZHRA 3ATLA 3MHWU 1BCUH 1HAPH 3A89A 3MO9A 3BTEE 2FOCA 1ANCA 1HAIH 1SBWA 4DURA 3WY8A 4YZUA 4IMQA 4UE7H 1TRYA 2QGRA 2PTNA 4J1YA 2AMDA 3LONA 3SNAA 1C1TA 3BTKE 4K1TA 4X1PU 1O2IA 1HBTH 4AGKA 5GWZA 2BD9A 1YF4A 3BG4B 3S9AA 1AVWA 1NO9H 1QFKH 3SU1A 3SV2H 3S7HB 1EZUC 3M5MA 2BTCE 4B2BA 3ZVFA 1XKBC 2WPKS 1CBWC 1HAVB 1H1BA 1Y5BT 1EP6A 4K69A 1BTZA 2AS9A 1NM6A 1B0EA 2BDAA 3TGIE 7KMEH 3RXKA 1BZXE 1ETSH 2XBXA 3ZVCA 2PUXB 1KIGH 1YKTA 1VR1H 2OTVA 3ZZ9A 1AN1E 4X0WU 1TAWA 4Z0KA 1VCQA 1GBIA 2HLCA 2GV6A 4LOYH 1O3IA 3BTTE 2OD3B 2BQWB 3VB4A 1BHXB 4IN2A 2GZ9A 5E0HA 1RS0A 5C5OA 5F6MA 1GI3A 1ESTA 1G36A 2SGPE 1TMBH 2ZPSA 5F8XA 3QGJA 1AFQB 1XUIA 1ETRH 4INKA 4CRAA 3SI4H 1TX6A 3U8RH 2Q1JA 4ISLA 5EPNA 1ELGA 4AG2A 1O3NA 2G00A 2ZZUH 2QF3A 1LVOA 2A7CA 1TB6H 2BY7X 4ZAEA 1D9IA 2AFQB 2WV4A 1O2NA 3M5OA 1C1OA 1HXEH 2BD4A 1A61H 2VH6A 1GJDB 2AERH 1P0SH 2QF0A 3UIRA 1TNKA 3RXHA 1IQGA 3SW2B 2OQ5A 5HYOA 3FFGA 4WJG2 1C1QA 3MO6A 3MH4A 1UK2A 3A88A 4B2AA 4OGYA 1EAIA 1NESE 2BDIA 2ZQ2A 4Z6AH 1ZZZA 1CT0E 4IN1A 3TK9A 4DIIH 5FPSA 1J17T 3A80A 3PMJA 2ZDAH 1V6DA 3FP6E 1Z71A 1O2GH 1KTTB 1E38B 2FXRA 1O3BA 1SGNE 2J38A 3SHCH 3BG4C 4NGAH 1BQYA 1EAUA 3TK6A 1QNJA 3Q77A 1SGIB 1W12U 1O32A 4B75A 1FN6A 3ZZBA 5FPYA 1C1NA 1DM4B 1A46H 5JB8S 2TGTA 1LVMA 1NFWA 1OWDA 5FBIA 4BANB 1O2LA 1MZDA 1SGPE 1TNHA 1TWXB 3AVZA 4Y0ZE 2V6NA 1AWHB 2DE9A 1UTOA 1O3EA 1LCYA 1PPZA 1V2NT 2XC4A 1Y3VA 1SGEE 1SGCA 3P8GA 3L3TA 1ELTA 1QHRB 1JRSA 1BRAA 5C1YA 1D3QB 2VH0A 2SGEE 1GMCF 1HAHH 3DT0H 4D7GA 2G5VA 3L6PA 1Z6EA 3RXOA 5L2YH 3GY7A 4GVUA 1T4VH 4Y8XA 1MD8A 1SQAA 1AFQC 1GHYH 1TFXA 1TBQH 3R3GB 4ISIH 3BSQA 4M7GA 2VVCA 3W95A 1HAYB 1GJ7B 2AGEX 1CA0B 1ZMLA 2ZDNA 1TE0A 5EPYA 2GT7A 3E1XB 1O3PB 2Z9LA 1P10A 2V3OH 2PHBA 3MFJA 1MZAA 1O3MA 1NY22 1FNIA 1FZZA 1KXBA 4AYVB 2PSYA 2OC0A 2BOKA 2G4UA 2BM2A 3D49H 1TGSZ 3SHAH 2ODYB 4BAOB 5J4QA 1HNEE 2G52A 3O8RA 2XC0A 2QCYA 1PJPA 1GJ4H 2PV9B 1GBMA 2IJOB 1VGCB 1FONA 2QV1A 2W7UA 1RRKA 2QXJA 4X8UH 4FUCA 1DVAH 1WU1A 1WAYB 3HGNA 2AH4X 3HK3B 2VIWA 1QJ7B 1AD8H 3PMAB 2ODPA 2IN2A 3RC5A 1S82A 2UWOA 4AYYB 1O3HA 5SGAE 1GI7B 4YO9A 3BEIB 4ZMAH 4O03A 3V0XA 2VIPA 4RSPA 4CBNA 2HGTH 3UUZA 5FXLA 1MKXH 1MTNB 4O3UA 1B7XB 1OP2A 3PYHA 1ZGVA 2OC7A 1O3FA 2Y7XA 1H4WA 2FOBA 2GTBA 2O9QA 1MTUA 1CGIE 1O3KA 1C2KA 4NG9H 4ABAA 1RFNA 2HPPH 1ZRKA 1D3TB 4GSOA 4Y8YA 5TJXA 3NKKA 5FHTA 1MKXK 2AMQA 2A7HA 1T32A 1EJAA 3LT3A 1UMAH 1KDQB 3OSYA 1Y5UT 4MPWA 3Q00A 4ABHA 4CRFA 2ZFTA 3BTME 1F5KU 2A4GA 5HGGA 1T8OA 2HWLB 3OTJE 4NZLA 4FUHA 1QJ6B 2ZF0H 1ZOMA 3URCA 1TNLA 2BD7A 1A0LA 4TY7A 1O2OA 1AB9C 1W7GH 4JYTA 4UFGH 1DS2E 4BTUB 1WUNH 1HDTH 3MU4A 1GBEA 2V3HH 1FY4A 1JXPA 4CRBA 3P8FA 1VITF 4XOJA 2ZCKP 2VWMA 4HGCA 1O5BB 4I8LA 1D6WA 1Q2WA 4ABFA 1DITH 1GVZA 4Y11E 1BTYA 1UTJA 5DP3A 3RC6A 1C5WB 4Y6DA 1EB2A 1C1WH 1V2LT 1GBAA 3MMGA 1WTGH 3E90B 4SGBE 4AN7A 1QA0A 2LPRA 9ESTA 1SQTA 4IC5A 1OPHB 5GCHF 2DUCA 3A8AA 4O3TA 2AGIX 5C2ZA 1VGCC 4TPYA 5I46H 1ACBE 3HPTB 1UTNA 2Z7FE 3ZV9A 3RU4D 5EW2H 1XUJA 2PKSB 5CHAC 1OWHA 5EQSA 2BD2A 2ALPA 1V2MT 3MTYA 3PWCA 2HNTE 4D76A 2J34A 3SUFA 1HCGA 3Q76A 4NFFA 1BTHH 3A86A 2GKVE 1THRH 1O3OA 1V2RT 4X2WA 3SUGA 1XKAC 4AGJA 3KL6A 4CBOA 1GI2A 3QDZB 3SQEE 1O35A 3OX7U 3UOPA 1MTNC 1OKXA 1T7CA 1C9TA 1HIAB 2BDCA 1W13U 2ESTE 2XC5A 1UVPA 1S85A 5A2MH 2ZFRH 1N6XA 4MNYA 2FMJA 2TGAA 3UWIA 2EC9H 1THSH 5ETXA 3GCTG 1HJ8A 2A2XH 5GDSH 5DPAA 1ABJH 1SGFG 3TITA 1F7ZA 3DUXH 1QTFA 2JKHA 2O8WA 1L4ZA 2OBOA 2SGQE 1RGQA 4GCHF 4I33A 3A81A 2BDBA 2OUAA 2R0KA 1LHEH 4X2YA 3LGVA 1D3PB 2V35A 1PPCE 3GOVB 3OYPA 2A1DB 5A0BA 1YPKH 4FVDA 1P9SA 1UCYH 1CU1A 3F9FA 2WPJS 3Q3YA 4K8BA 2GZ8A 2WPIS 1AIXH 2I6QA 2GDDA 3KQBA 1C1RA 4U2WA 4HFPB 1HFDA 1SGYE 2FYQA 2FLRH 1J8AA 1M9UA 1QA7A 1BMAA 1O3LA 2P3FH 4SGAE 3T28A 4BAHB 3B23B 3TK5A 1EX3A 3PWBA 2C8YB 4MVNA 3PLPA 4WY3A 1VCPA 1BB0B 2BX3A 1DWDH 1TRMA 7ESTE 3JZ2B 4MNWA 1C5TA 5JBBS 1TQ0B 2ZDVH 3SGQE 2H5DA 2FPZA 1IQKA 2V0BA 4UDWH 3DA9B 1DICA 1SB1H 4FU9A 2ZU5A 4I31A 1V2VT 2BX4A 3LPRA 2A5IA 3M3TA 2NU3E 4UFFH 2BVRH 3RXSA 5T6FA 4UONA 5EXMA 1YPMH 1PPFE 2PKSC 2GVFA 1C5XB 3ESTA 4Y76A 2VWOA 2ZKSA 2PR3A 2NU0E 1ORFA 3SU5A 3VXEH 4NSVA 4UFDH 3ZYDA 1OP8A 1BRBE 1EOJA 1XXDA 1ANEA 1N8OB 2WPHS 2PTCE 1HYLA 3MYWA 1X7AC 1O5FH 3MH5A 4ISNA 1FAKH 4A5TS 1MD7A 1TNJA 3TGKE 1AZZA 1AO5A 4WXIA 1SI5H 4Q2KA 3TLOA 1L2EA 1FY8E 4R8TB 2GMTC 1UHBA 5EQRA 1EXFA 2PKAA 5ESBA 5TCAA 5JDUB 1Q31A 2C93B 1ZSLA 1OYTH 3UPEA 4YOIA 1TGNA 4JMYA 3MOCA 3UNSA 3PM3A 7LPRA 1DXPA 1Y3UA 1Y3WA 3EE0B 5K7RA 3A8DA 1GBCA 1RD3B 3DFJA 3A83A 1P2QA 2F9PA 2RA3A 3M7UA 2CF8H 5L2ZH 2Y5GA 1MMJN 1ZMNA 5AF9H 5HM9A 3RXRA 2J92A 3G01A 2R0LA 1JWTA 3KF2A 3ZZ8A 1D6RA 1THPB 3CENA 2ZI2H 4X1RU 3FAOA 3SORA 1SOZA 2PKAB 3P8NA 3E8LA 2SNWA 2VJ1A 4U01A 2UWPA 1GMHG 4FUBA 5GPIB 6LPRA 1O2SA 3RLYH 1L4DA 3B8JA 1E0FD 2BLQA 1QGFA 3SN8A 3ZVBA 3OU0A 4OS1A 1DE7H 1KXAA 1LVBA 3AASA 4X6MA 4Q7XA 5T3HA 3RLWH 1KY9A 4CREA 3ZVGA 1A7SA 1DXWA 1QL9A 2GT8A 5C67A 3BTFE 1NPMA 2F9BH 3BN9A 1LPKB 4YOJA 2ANKH 4YLUA 1C5QA 1ZTLA 5AFZH 1V2KT 1NFXA 2P3TB 2Y80A 5F03A 5PTPA 1NRQH 4Q80A 5F8TA 4JZIA 1GHVH 3HGPA 5FCKA 1O38A 1HAOH 1MAYA 1LHGH 2A45B 3FZZA 2QYIA 2FI3E 3MNXA 2Z3EA 1V2WT 1ANBA 2XBYA 3TIUA 1DSTA 1QR3E 1HB0B 1N8OC 2R9PA 1SGDE 4J2YB 2ZO3H 1TONA 2ZP0H 2B8OH 1WV7H 1SGRE 4E06H 3ODDA 3I29A 1WSSH 1V2JT 3TJOA 4INHA 3SV6A 1P2IA 2FS9A 4E05H 1Q3XA 1P11E 1BRCE 3DHKH 3F68H 3UQOA 5A0CA 2FTMA 1TRNA 8GCHF 1UVSH 3TJNA 3SV8A 3SOSA 3ZZAA 1S5SA 2ZTXA 1P57B 3HKJB 4AOQA 2ASUB 3S9BA 1YYY1 1AUJA 2AIPA 4KTUA 4Y7BA 3RXAA 2Y5FA 3T2NA 1EP5A 1W11U 4FXGH 4H4FA 3F1SB 2C90B 5EXNA 1GPZA 3GCOA 1E37B 5EW1H 1NU9A 4ABGA 2UWLA 2WINI 1G9IE 4IC6A 3RM0H 1PQ8A 1YLCA 2TPIZ 1P06A 4MNXA 2VGCB 2AMPA 4D7FA 1ELBA 2FIRH 1WYKA 1PPBH 1P01A 1B5GH 1Y8TA 4CR9A 1ZTKA 4MNVA 1K9OE 4MDSA 1OX1A 4NIXA 1GBTA 4OS6A 1P2OA 1VITH 4NSYA 4F49A 4QT8C 4FVBA 1Y59T 3GY3A 3MNBA 1PQ5A 3MNSA 1SLWB 1ZJDA 3FVFB 2PWXA 1BIOA 1ZSJA 2XYAA 1YPHE 4BAMB 4XBCA 3GDSA 3LJJA 1CQQA 2H9EH 4IBLH 5HMAA 3UWJH 2B0FA 1ZSKA 2H6MA 1C5YB 3QX5H 3NWUA 5JPMH 1NZQH 2GDEH 2ZECA 4CR5A 1YC0A 3UNQA 4B1TA 1GDUA 1OWIA 1W8BH 1TNIA 1MBMA 4UEHH 1EAWA 2H1UA 2PFEA 3RXVA 4Y0YE 3M36A 5FX5A 1HAZB 3K2UA 3AAUA 3CP7A 2BY5X 4BAKB 6GCHG 2ZDMA 1SLXB 2EI7A 2FX6A 3ZZ7A 4X6PA 2RG3A 1O2KA 2K1QA 4OS7A 5FX6A 9LPRA 4BTIB 4B2CA 5I25A 3NZIA 2WYJA 3ODFA 4U32A 1FPCH 1W0ZU 2ZNKH 1QJ1B 5EXLA 3E3TA 1ZJKA 3BEFB 3SI3H 4CRCA 2FESH 3I77A 2BY9X 1F0TA 1J16A 1GJ5H 2KAIA 2BDHA 4OS4A 1ELFA 2ZFSA 4OS2A