1QBNA

Bovine trypsin 2-[amino(imino)methyl]-2-hydroxyphenoxy]-6-[3-(4,5-dihydro-1h-imidazol-2-yl)phenoxy]pyridine-4-carboxylic acid (zk-806688) complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qbnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qbnA02
1ZSKA 1NN6A 5A0CA 2JH6D 5GWZA 5LPRA 1GHWH 5C2ZA 4B75A 1FN8A 1ZPBA 2BY7X 6GCHF 1BDAA 4BXSA 2ZC9H 1IQIA 4I7YH 3RM2H 3RXDA 3ATKA 1F5LA 3URCA 1KIGH 2NU3E 3RDZA 4X1PU 3M37A 2FODA 3GCNA 4K60A 1JRSA 2BB4A 1C1RA 4FUEA 1C2EA 5HM9A 3ZZ5A 1GJ9B 4YTAA 1HAIH 1WV7H 2P8OB 1DT2A 4CHAC 2HGTH 1C5UA 2Z9JA 1JWTA 2VIWA 1FV9A 1Q2WA 4RSPA 1SGFA 2VIOA 3UNSA 4CH2B 4CH8B 4O03A 1GMDG 4TY6A 3VB3A 1MTUA 1MU8B 1J16A 1MTWA 3BTME 2GZ9A 3HKIB 1NRQH 5L30H 1W12U 2Y7ZA 1BTZA 3LGUA 1TB6H 2QXGA 1C1SA 3KIDU 4OS7A 1DSTA 1D4PB 1QJ7B 1BT7A 3UNQA 3D49H 2CGAA 3E91A 3BTDE 1TLDA 4YZUA 2SGAA 1TAWA 1PFXC 3KQBA 2BY9X 2HPPH 1H8DH 2R9PA 5HM2A 4AOQA 3UUZA 3NXPA 1MQ6A 2QYIA 2OC0A 4Y79A 2ZDAH 1GGDB 1K1OA 4MG3A 5C1XA 3M5OA 5JB9S 2AGIX 4XBCA 1QURH 1EZXC 2Z7FE 1AFQC 1BITA 1B5GH 2BHGA 4ZXYH 3ATLA 3RXEA 3TH4H 1TGTA 1YGCH 1BRCE 4KTUA 2FMJA 4NIYA 2ZO3H 4AFUA 4WXVA 1KSNA 2EI7A 3P8FA 1P03A 2C8YB 2FOCA 2BY5X 2RCEA 1TNHA 4WVPE 2FESH 1O2WA 4LK4A 4SGAE 1GDUA 2ZDKA 1TPSA 3SU0A 1XUGA 1GHZA 2ANWA 5CHAC 5G4BA 4BTTB 3SU5A 3PROA 1LQEA 2J92A 3HATH 1QY6A 1GI8B 4I8LA 2XC4A 1BRAA 1NPMA 3TK9A 1C1OA 3TU7H 1AVGH 2KAIB 2TGTA 1ZOMA 1C1WH 1QGFA 3BTHE 5DPAA 3SJIA 4ZROA 1MAYA 1RXPA 1L4DA 2R0LA 4ZKRU 2BY6X 1VJAU 2G51A 3HGPA 4ABHA 1GMDF 1YPHE 5DP5A 1UTNA 5GIBA 3MO9A 2QAAA 4ZKNU 2A4GA 3M7QA 1B0EA 5AF9H 2P59A 2FI3E 2SGQE 1AWHB 1P01A 1EKBB 3A80A 1EASA 1TX6A 1UTPA 4JZEH 3F9FA 2STBE 1TWXB 1PJPA 1PPFE 1S6FA 3D65E 1L4ZA 3UNRA 1AN1E 4JYTA 1NO9H 2FI4E 2RA0A 1C5PA 1XUJA 1GDNA 1LHFH 4KTCA 1FAKH 2CXVA 3K6YA 4AORA 5J4SA 1GBCA 3BG8A 1UHBA 3DT0H 3M3TA 1EJNA 3A8BA 3BEUA 2ZNKH 2A1DB 1BMNH 1XVMA 1BTYA 1SQAA 3M35A 5DP7A 1HIAB 3V13A 1O2XA 1P2NA 3LGTA 2GZ7A 1ZHMA 3M3VA 4YLUA 4UE7H 1TRMA 1W13U 2ALPA 1ZPCA 2QXJA 3AVZA 3K65B 1SGCA 1O3AA 4KTSA 1G32B 5FBEA 4OS2A 4OGYA 1SG8B 1SVPA 4GAWA 4WMDA 2FI5E 1CGIE 3C1KA 1TONA 3P8OA 1THPB 4AX9H 4WH6A 2ZDVH 5A8YA 2ZHQH 3RU4D 3TGKE 3MTYA 1CBWC 2PSXA 2BD3A 3SJ8A 4I8GA 1DOJA 1RJXB 5T6DA 1YYY1 1SB1H 4RKJB 3TK6A 1CO7E 1UHBB 1T8NA 7KMEH 4IMQA 2BDCA 1A0JA 3OY6U 2F3CE 3RU4T 3FVFB 1AE8H 4IMZA 2ZPRA 1OWHA 1T32A 1QL9A 3VXFH 3O8RA 1BOQA 3A82A 1EOJA 3GCTG 1AUTC 1A5GH 5DP8A 1Y3VA 4WJG2 1RTFB 1O2UA 1IQLA 3SU3A 5JBAS 1MCTA 1DLEA 2F91A 3IWMA 3RXMA 4GVUA 1WU1A 1BRUP 1X7AC 2OC7A 3BTEE 2VH6A 4K5ZA 4A5TS 1PPEE 3AAUA 2AMQA 3SQEE 4H6TA 2ANYA 2A0QB 1O2MA 5F8ZA 1TBZH 1QR3E 5FBIA 3DD2H 2D1JA 3KF2A 4K2YA 2TGAA 2GD4B 4H42U 4X1SU 3SGQE 1GHBG 4FUFA 1OOKB 4ISIH 1V2QT 3OTJE 1F5KU 1C5MD 1O3NA 3SORA 3SNAA 2PW8H 2GCTB 3Q76A 1SHHB 4NG9H 4FU8A 2FZZA 3QDZB 1Z8RA 1LHDH 1O3OA 5H4IB 8LPRA 1P09A 3PLPA 3PMJA 1NM6A 1D3DB 2XYAA 2OQ5A 1SMFE 4X8UH 1IQKA 1SBWA 4XBDA 2VJ1A 4A1XA 4YOJA 4TPIZ 2F9VA 2H6MA 5K0HA 3UR6A 2ZHEH 1FAXA 3P17H 1F0RA 5DP3A 4H6SB 2RA3A 1B7XB 3K2UA 1YCPM 2FM2A 3SUEA 4ABJA 4LXBH 4F4OC 2VB0A 1MTSA 3LONA 5DP9A 2ZCKP 1CA0C 2G55A 1J17T 2ZWLH 1MKWK 5C1UA 1GHYH 5JBCS 3SUFA 1ELFA 1ELVA 4KP0A 2P94A 4AB9A 5GPIB 4ISNA 3PO1B 4ZMAH 3FZDA 1ELGA 1L1JA 3TGJE 1C1TA 1O3GA 1YC0A 1ELAA 4NA7A 1GI6A 2IJOB 3BIVH 3UFAA 5C67A 1C5WB 3UY9A 1THSH 1UVSH 2Y7XA 4Y10E 1XKAC 3CP7A 2ASUB 4QT8C 1ZYOA 2W7UA 5L6NH 1OYTH 1RGQA 1XMNB 2BDHA 1YM0A 1GHBF 1O3CA 2QXIA 3M61U 1S5SA 1V3XA 5GCHF 3TLOA 4NZLA 4ZXXH 4ABIA 3OSYA 3SQHE 1YPMH 1QL7A 2BLQA 5C3NA 3QN7A 3MH7A 3V12A 1PPBH 1UVTH 1P11E 2IPHA 1FONA 3LGWA 1ESAA 1GVZA 2OINA 1GI5A 2PV9B 1GJCB 2R2MB 2XXLA 3MYWA 1FZZA 2O8UA 1E37B 1HDTH 2JKHA 2PLXA 1C2FA 3MH4A 4XSKU 3F6UH 1DANH 3B9FH 4J2YB 1K1PA 5CMXH 7ESTE 2FWWA 3ATIA 3BEIB 5EGMA 1KLJH 1MTNC 2FTMA 4TPYA 1SGEE 3U8TH 1OWKA 3EDXB 2F9OA 2P8OC 1G9IE 1OKXA 4X6NA 1LPZB 4NIVA 3TH3H 5DGJA 3I29A 3ZV8A 4NWLA 1EOLA 1DM4B 1SHYA 3A7XA 1TNGA 1H1BA 4IN2A 4AYVB 2A2XH 3AAVA 4NZQA 1YCPH 1GMHG 3ZZBA 1P04A 3NK8A 3PMAB 4MQAA 1QL8A 1ARCA 2I6QA 2F9BH 1TX8A 1TABE 2HNTC 2VINA 2FS9A 3EE0B 2A5AA 1QA0A 1O33A 4AG2A 1FN6A 4UFFH 2NU2E 1FNIA 1E0FD 3LJOA 4HZHA 5E0HA 1EX3A 3CS0A 3MU5A 4J1YA 5I25A 1GJ6A 4NSYA 5LPEA 1GGDC 1YLDA 1O5CB 4MPXA 1V2WT 2ZFRH 3VB5A 4A7IB 3KQEA 2PSYA 1P9UA 2ZFFH 3KQDA 2GVFA 1P2IA 1Y3XA 3B8JA 1UTMA 2ZTZA 4AB8A 2AMDA 1QRZA 2QGRA 4K8BA 2C90B 2WPHS 2B0FA 1BRBE 1HJ8A 5IYTA 4D9QA 4XOJA 1SLVB 4MNVA 3WY8A 3NZIA 1KXAA 4UFGH 2ZGBH 1DXWA 1C2GA 1SQOA 1TOCB 4AFSA 1BIOA 3S9AA 2DUCA 2VIVA 2C8ZB 2OBQA 1QJ1B 3M36A 4Y0ZE 1KLTA 2A5IA 5LH8A 3ODDA 3E1XB 4OS4A 3A7VA 1VGCC 1O2YA 1GBHA 2V0BA 1GI7B 2HRVA 4NWKA 1GBTA 3ZZ4A 2BYAX 2Z94A 4AGKA 1RIWB 3KNXA 1C4Y2 4KELA 3SNCA 3GY6A 3VEQB 4JCNA 1O2NA 4ABFA 3LGVA 2GP9B 1H8IH 5C5NA 5JYIA 1GCTB 1EPTA 3SNEA 1RTKA 3RXJA 3RXFA 1FLEE 4B2CA 3F9GA 2P3TB 3RXKA 3T28A 3M7UA 4IBLH 1OS8A 4DJZB 3VB7A 6CHAB 2OCVB 2WPJS 3U1JB 3E0PB 1GJ5H 5JDUB 1P3CA 2XRCA 2J95A 1NT1A 1IQMA 1UTQA 2A7HA 4BTIB 5DK1A 1UK2A 2CMYA 3E8LA 1SQTA 1BTXA 1Z1IA 4BANB 1C5XB 1A3BH 4LZ4B 1DSUA 4O97A 1O5FH 1CT2E 5T3HA 6ESTA 1EUFA 1YP9A 2FX4A 1C9PA 3RMOH 3RXAA 4MPWA 4LZ1H 2AMPA 3LPRA 1W7XH 5EPNA 1G36A 1W14U 3RMLH 1TNJA 4Y0YE 1N1LA 1EJAA 3GDSA 5A8ZA 5ESTE 3SI3H 4FUDA 2LNCA 1TPPA 1PQ7A 4I8HA 1SGPE 3SJ9A 2HWLB 1GBEA 1ELDE 1XVOA 3UTUH 3RXHA 1O0DH 3E3TA 2GV6A 1QRWA 5F8XA 1GHAG 1KYNA 4NCYA 1MAXA 1V6DA 1S84A 1K1JA 2AEIH 4X8SH 2BVXH 1YPLH 3F68H 2BX3A 3S7HB 4X8TH 1SGIB 4JZ1A 3P70B 1WAYB 1BBRH 5TCAA 4Y7AA 2XCNA 2A5KA 1MKXK 1GJ4H 1QA7A 1BHXB 1EJMA 3LDXH 3L6PA 1EQ9A 1V2UT 1NU9A 3FZZA 2ODQA 4DOQA 4ESTE 1B0FA 3GDVA 1JMOH 1T8OA 1QB6A 3A87A 2SGPE 1KLIH 1QCPA 3PMBB 4ABDA 1O2GH 4SGBE 1UTOA 3A83A 2WPIS 3RXCA 2PTNA 5ESBA 4ASHA 3DFJA 1INCA 4NFEA 5J4QA 3SGBE 2BZAA 1YPEH 1JXPA 1G3CA 1A7SA 2PKSB 1E36B 4RN6A 2GKVE 2F9PA 1GBMA 2Y82A 1S0RA 1P2MA 1BB0B 3SNDA 1EAXA 2GCTC 3ELAH 1Y5AT 3QGJA 5GJ4B 5T6FA 2FO9A 3DA9B 1QIXB 2BMGB 1EZUC 2GCHG 5K7RA 3TK5A 4D7GA 2G81E 5C5OA 2SGDE 1F2SE 1NFYA 2VGCB 1G3EA 1IQNA 2HNTF 5EG4A 5L2ZH 1D3QB 1RS0A 2I6SA 3O8BA 2BOHB 1W11U 5BRRE 3T29A 1GHAF 4ZKOU 3LGIA 4ISHH 4ABBA 3GY8A 3T2NA 1P8VC 1E35B 1C5YB 1E38B 2BD8A 1OSSA 2AYWA 1GHVH 1AB9B 1J8AA 1VCPA 1UTKA 1HAHH 1FPCH 1YPGH 1A0HB 4I8KA 4X8VH 5A2MH 2VVUA 2Z9IA 3ZVEA 1YPJH 2H5DA 3EQ0H 3QO6A 1D3TB 1HAGE 3U1IB 3DFLA 1V2TT 4IN1A 3ZZCA 3TNSA 1C1UH 3E0NB 1UVUH 1BTUA 1GBAA 2FOAA 1GMCG 4MTBA 1Y3YA 1P3EA 2CHAB 2BD7A 4INKA 2GDDA 1OWEA 2DE9A 3GY2A 3MNSA 3KL6A 1TBRH 1U6QA 5IDKA 2BQ7B 1EZQA 1K1IA 4CRBA 1ABJH 3SV7A 1SOZA 3NKKA 1XXFA 1O3JA 3QK1A 1K9OE 4HFPB 3M5LA 1HJAB 1HPGA 4FUCA 1VITH 2F83A 2GMTB 2CF8H 1K1MA 1ZHRA 2AGEX 3VFEA 4B1TA 3FANA 4DCDA 1Z8JB 3M7TA 1EAUA 2VWLA 3UQOA 3QLPH 1SFIA 5ETXA 3H7OA 3MOCA 3ODFA 3QX5H 1F7ZA 4K1SA 1UK4A 4CREA 4GLYA 1DWDH 5AFYH 2CV3A 4FUHA 4INHA 5T6GA 1QB1A 3SV2H 3QTOH 2ZDLA 1GVLA 2TRMA 1ZSLA 2C8XB 5FXLA 8KME2 4ISOA 3GCHC 3DUXH 3D23A 3SU2A 2J4IA 4CRCA 4CRDA 3A8CA 5FHTA 1EB2A 1TQ0B 2CN0H 1WSSH 2OD3B 2G52A 1PQAA 1T4UH 3ZZDA 2BXUH 1CHOG 1O2QA 4CRAA 1L1NA 4E05H 3BF6H 2R0KA 4GHTA 1Z6EA 3PTBA 1GMCF 1LHEH 3VB4A 1MH0A 4K8YA 2FP7B 3OY5U 4FU7A 3UWJH 2C4FH 1NTPA 3NPSA 1JRTA 2YNBA 4VGCC 1EAWA 1JIMA 4Y8YA 3STJA 2BDIA 1JOUB 2BD5A 3KGPA 2J38A 2ZFTA 2FXRA 3H5CB 3KN2A 3CENA 8ESTE 1WQSA 2EC9H 2OTVA 2ZA5A 3ZZ7A 2WPMS 5JB8S 2ZU3A 3SHAH 3Q3KA 3T26A 2DE8A 5F6MA 1V2LT 1MQ5A 4JZIA 3BSQA 1O5GH 2TGDA 1GI0A 1ANEA 8GCHG 1Z8GA 3GY3A 3GY4A 3TPIZ 5FPTA 2ZP0H 2WINI 1Z8IB 4MNWA 1H9IE 4PROA 3RC4A 2Y81A 1KTSB 1CGJE 1C5SA 1FPHH 1C5OH 1ZTJA 3L3TA 3RLWH 2FOGA 1VJ9U 9LPRA 2ULLA 4DY7B 1MKWH 1LTOA 5EODA 2FOMB 3FP6E 4X1QU 1NRPH 3Q00A 2QF3A 1P57B 1EATA 3T5FH 3SU1A 2B5TB 1AUJA 3RXSA 1C4U2 1YF4A 1GBFA 3HK6B 3BTKE 4UD9H 2XBYA 1AWFH 4AN7A 3SI4H 2NWNA 3MI4A 1PQ8A 1OX1A 5I46H 3BN9A 1W3CA 1Y3WA 1RIWC 3RLYH 1C5RA 3ZYDA 4U32A 2AERH 4GSOA 4O3TA 5FCRA 1MZAA 1ZZZA 1O3LA 4Y7BA 4A92A 4Y6DA 2ZGCA 1GCTC 4Q7XA 1N6XA 2ZIQH 1SFQB 1FIZA 1ANBA 3V7TA 5FPSA 4BOHA 4AGJA 2WV5A 1WUNH 3GY5A 4ABEA 2ZI2H 2ZQ2A 3VGCB 5A09A 3F9HA 3EA7A 1K1LA 3PLKA 4JMYA 4FVDA 1H4WA 1YLCA 3QZQA 4U01A 3BTTE 4FUBA 3RXGA 3PTNA 4CHAB 3D62A 4TWYA 4M7GA 3PMHB 1C5NH 1NFUA 3LC5A 4FU9A 2OQUA 5EPYA 3LKWA 2QXHA 1KXFA 5F03A 3GDUA 3GISB 3NUMA 4B74A 5A8XA 3W95A 4A1TA 1AZ8A 2XWAA 3T27A 3TJOA 1C2LA 1GG6B 2C8WB 5C1YA 3GCTF 2QC2A 3MNBA 1UCYE 1GHXH 1P0SH 3SU6A 3OX7U 1SGTA 3UPEA 4CBOA 1V2MT 2BQ6B 1D9IA 1KXEA 4CBNA 3SBKA 1QFKH 4YM9A 2XWBI 1C2JA 3SNBA 3TVJB 1DY9A 1FIWA 1O3HA 1GL1A 1EAIA 1RRKA 4X2YA 1HAVA 4BXWA 1W8BH 4B76A 2HOBA 5DKMA 3RXVA 1RTLA 2UWLA 1QRXA 3R3GB 1AFEH 4IC5A 2QF0A 1ZRBA 3RXBA 2OLGA 5EQSA 1ORFA 2PUXB 3B23B 2XC0A 1QBNA 1TQ7B 3FP7E 1MUEB 1F0TA 3VXEH 5DJ7A 3E6PH 3NCLA 1C9TA 3UREA 3C27B 1J9CH 2Q6DA 4E06H 1O2TA 2PKAA 2ZTXA 1WOFA 5CHAB 4NIXA 3SO3A 4NFFA 1G30B 2STAE 1QBOA 3ATWA 3NWUA 1TYNA 1XX9A 1GBJA 1O2ZA 1SGQE 4NGAH 1SOTA 2A4OA 5B6OA 1KDQA 1LPKB 2P3FH 1GJ8B 4KKDA 1V2ST 3TH2H 2ALVA 4U30A 4FUGA 5TJXA 2ZGJA 3KEEA 1GJDB 2BLOA 2GZ8A 4E7RG 1SSXA 3MNCA 4X0WU 1GCDA 1CVWH 1J15A 3HPTB 2J2UA 2C93B 1HNEE 3P95A 1O38A 3MWIU 4BNRA 2VWNA 3PB1E 1XKBC 3RXPA 1PPGE 2W3KA 9ESTA 1C5VA 1W0YH 4WF8A 2VGCC 2G8TA 3GCOA 2OXSA 1THRH 1ZRKA 1DICA 3I78A 1QTFA 3STIA 1Z7KA 5EXMA 1TMBH 1RD3B 1XM1A 1ZLRA 1C5ZB 1O2OA 1GWAA 2VVVA 5JBTA 3RXUA 5EOKA 2EEKA 3RXRA 3QZRA 1J14A 3MU8A 2RDLA 1TALA 4GPGA 2P95A 4AFQA 2ZGXH 4I32A 3SUDA 1ETTH 2VIPA 5FX6A 3LT3A 3HK3B 4IW4E 1SLWB 3R0FA 4NA8A 1O2JA 4BAQB 1N8OB 1LVBA 4FXGH 5LGOA 2FOEA 2ODPA 2FOFA 3EGKH 5GXPA 1FY5A 2V35A 4OS1A 3PV4A 3IITA 1CT4E 2H9EH 4UFDH 3MU4A 4DVAU 4NA9H 1K1NA 1ZTKA 2UUKB 4TWWA 2AFQB 1MD8A 1O3MA 2D8WA 2GX4A 1LHCH 2A45B 2VVCA 5BPEA 3UIRA 2ZFQH 2NU4E 1BZXE 1TX7A 3A8DA 3T62A 1HJAC 5E0GA 3P8NA 2GMTC 1YPHC 4Q80A 2ZU4A 2VNTA 2J34A 2Z9LA 1NFWA 3MO6A 1UCYK 2PR3A 1O2KA 3N7OA 2WV4A 2BQWB 2TIOA 4DW2U 1AY6H 1TMUH 4MNYA 4Y71A 2SNVA 4MLFB 1AVWA 4XE4A 4MVNA 3LH3A 1GMHF 1TNKA 2A4QA 1GBLA 1F0SA 4JYVH 1LDTT 1MMJN 4JK5A 1L1GA 2SGFE 2W26A 2BVRH 1QQ4A 1C5LH 1AE5A 1LMWB 4TY7A 3U8OH 3S9BA 1KXCA 2BXTH 2O8WA 1O2VA 1T4VH 3TIUA 1FUJA 1AMHA 3URDA 1CT0E 1VITG 2FIRH 1TE0A 2J9NA 1KY9A 1OYQA 2XNIA 1O37A 2GT7A 2XTTB 3M3SA 1TFXA 2QV1A 3L33A 1C2IA 1ESTA 1N6YA 4AYYB 2FYQA 3Q3YA 3VPKA 2LPRA 4JZFH 4MPVA 1G3DA 2ODYB 3GYLB 4FVBA 1G3BA 3MU0A 4CRGA 1V2RT 1ZMNA 3LU9B 1P9SA 1FJSA 3TJUA 5JBBS 1EPTB 2SNWA 3A7TA 1V2JT 2FLBH 6GCHG 1DITH 4X2XA 1Y3UA 1O2SA 1GBDA 2FTLE 4GHQA 2FOBA 1C1PA 2A2QH 3PWCA 1HFDA 1Z6JH 2VWOA 3SGAE 1LO6A 2Y5HA 3ZVAA 1ELEE 2Y5FA 5AHGH 2Y80A 1ZTLA 1OXGA 4GUXA 2OBOA 3IG6B 1ACBE 2THFB 4A1VA 1AHTH 1W10U 1BHXF 1FY8E 1A5IA 2D26C 3BTWE 2O8LA 3ZVGA 1S82A 2VH0A 1S81A 1T8MA 4ZHLU 3TJVA 4OS6A 1V2PT 3MNXA 4Q2KA 1P2JA 4NIWA 3FFGA 1ELCA 4BAMB 1BMMH 1JBUH 1MZDA 2ZF0H 2F9NA 2H5CA 4Y8XA 1SGFG 4FUIA 1LCYA 4ABAA 4D9RA 1O30A 2W5EA 1FDPA 3AASA 3MO3A 2XBXA 1LVYA 2ZCHP 2A31A 2OUAA 1VITF 1WQVH 3SU4A 2IOTA 4F49A 4YO9A 4DIHH 2BTCE 4UDWH 4WY3A 1C2KA 1DFPA 1DWEH 1C1NA 4GCHG 1O3BA 3JZ2B 3PYHA 4Q7ZA 4NSVA 2AH4X 5DG6A 3SHCH 4XFQA 2Z3EA 2VIDA 3BG4B 1BMLA 3Q3XA 2TGPZ 3UWIA 2BDGA 4ISLA 4THNH 3U98H 1F0UA 1ELBA 1WCZA 2V3HH 3RP2A 4YOGA 1HXFH 3SZNA 4DIIH 3V0XA 1Q31A 1BCUH 3E90B 4WWYA 1IQJA 1C5TA 1BUIA 2G00A 1K22H 2H2ZA 4Y11E 5HYOA 1O32A 3AW0A 1C2DA 3A88A 3VGCC 1C1VH 1UMAH 1Y59T 5HMAA 1MTNB 1P2OA 4ZKSU 2K1QA 3RMMH 1YBWA 1OWIA 4X1RU 3SOSA 1F92A 1NRRH 3I77A 2QA9E 1HXEH 2PTCE 3P92A 3M5MA 4IS5A 2HLCA 1BJVA 5PTPA 4K69A 3K6ZA 2FS8A 2ZTYA 5FPYA 4K3JA 1HB0B 2WYJA 1GG6C 1GVKB 4D76A 3BTFE 1NC6A 5A0BA 1D6RA 2G5NA 3A8AA 3ZVCA 1ESBA 1XXDA 2UUYA 3TNTA 2WYGA 4U2WA 3PO1C 1DUAA 4GCHF 3RXOA 3SN8A 3ZZAA 3M5NA 1LQDB 2M5TA 3LOXA 5EW2H 2JETB 1P2KA 1T31A 3F1SB 2B7DH 1BBRK 4O3UA 1Z1JA 2KAIA 1S0QA 3LIWA 2HNTE 1NY22 1ZSJA 3S7KB 4D8NA 1GPZA 4IGDA 2FDAA 1DY8A 2H1UA 1GI3A 4TYDA 2AS9A 1Q3XA 1QQUA 1D3PB 1SR5C 1O2IA 3P8GA 1DWCH 3LH1A 2GCHF 2XBWA 1S85A 1MCVA 4ABGA 2IN2A 2ZFPH 1CHGA 1GBIA 2Z3DA 1IAUA 1UK3A 1YPKH 3DHKH 3SUGA 1DWBH 1O2RA 2CF9H 1W0ZU 6LPRA 1WTGH 2V3OH 1O5AB 1LHGH 1A5HA 1O5DH 1CGHA 1EXFA 1A0LA 1H9LB 1OWJA 1VGCB 1P10A 1C1QA 1HJ9A 2JH5D 3ITIA 1NZQH 3LJJA 3TGIE 1BA8B 5EQQA 4A6LA 3RM0H 4AZ2B 2ANMH 1QB9A 2UUJB 3MU1A 2Y6TA 3ENSB 1FY3A 2F9UA 4B73A 1HIAA 1QJ6B 4BAOB 3MMGA 1P06A 2P3UB 4DURA 1NU7B 2UWOA 1FY4A 4X6OA 1ZR0A 4K1TA 4DG4A 2VIQA 3S9CA 1ELTA 4BTUB 2C3SA 2BLWA 1KTTB 4X6PA 3RXQA 1HBTH 1GJBB 1TPOA 2EA3A 7GCHG 1VCQA 3ZV9A 4WH8A 2QN5T 5DP6A 1XUKA 3KCGH 1A2CH 1GI1A 2ANKH 2P93A 3ZVFA 1DVAH 1NRSH 3VB6A 1HYLA 1DS2E 2PUQH 3ZVBA 2PHBA 1O2HA 3PWBA 2WUBA 3LC3A 1P05A 4Z6AH 4MNXA 3MH5A 1XUFA 4B71A 4Q7YA 3ZZ9A 1K21H 2BD4A 5AFZH 3A7ZA 1UO6A 2FLRH 1N8OC 4I33A 2XC5A 3W94A 4UEHH 1BTPA 2G5VA 5DP4A 2EI6A 1KXDA 4RKOB 3S0NA 3UQVA 4INLA 3O8CA 1AGJA 2SGEE 1D6WA 1W7GH 2ZECA 3A84A 1EZSC 5E2PA 1T8LA 4ZAEA 1HUTH 4AFZA 3PLBA 2WUCA 1M9UA 3EAJA 1JIRA 1LKAA 1VZQH 1HAPH 2ZG0H 4YESB 3KHVA 1HAYB 1O2PA 3SJKA 1O3KA 2ZFSA 2ZQ1A 1YKTA 2Z9GA 1CHOF 5L2YH 1SGYE 1ZMLA 5AVDA 2GT8A 1V2KT 5JPMH 1ZJKA 2Q6FA 2BOKA 3HGNA 1IQEA 5SGAE 1GDQA 7GCHF 3GOVB 1OWDA 3UOPA 3BTGE 1GL0E 1PPHE 2QCYA 4MDSA 1L0ZA 1TNIA 1UJ1A 1HAXB 3RXIA 3FAOA 3T25A 6CHAC 3EA9A 3BIUH 1QBVH 2PGBB 2W7SA 3QWCH 1GJ7B 5HXFA 3Q77A 1E34B 1XUIA 2XW9A 1O3EA 1AIXH 1P12E 2ESTE 1AZZA 8GCHF 2TPIZ 1LPGB 5GCHG 1ETRH 1Y5BT 4OS5A 1CU1A 1K2I1 1LKBA 3GYMA 2YNAA 1SGRE 1GJAB 1O3DA 1ZMJA 1TIOA 1TOMH 2A7JA 1NS3A 3UOUA 1EPTC 1AO5A 2R3UA 1PPZA 3RUOA 1Y5UT 2BY8X 1IHTH 2WPLS 2BZ6H 5FX5A 1PYTC 1Y8TA 1FXYA 1XUHA 2GGVB 2A4RA 2G4TA 2GTBA 2FX6A 2Y5GA 4Z0KA 1UTLM 3SJOA 1W2KH 1A46H 4HI3A 1MBQA 4JK6A 3RU4E 4R0IA 1HAOH 4UONA 7LPRA 4XDEA 5EXNA 1EB1H 2BLVA 2O9QA 2A7CA 2ZU5A 1AFQB 4DGJA 1C1MA 2XCFA 1O2LA 1A1RA 5FAHA 5CE1A 1O5EH 1C2HA 4X1NU 1AQ7A 3U69H 4BAKB 2FOHA 1O3IA 1PPCE 4ZHAA 5F8TA 1DDJA 2EI8A 1S83A 2A32A 1IQGA 2HALA 4Y76A 3SV6A 1MU6B 1AU8A 1NFXA 1TPAE 3K9XB 1FI8A 1SGNE 3FP8E 1GI4A 1O3FA 3S69A 1DX5M 3BEFB 5HGGA 2VWMA 2Q1JA 3A86A 3BG4C 4BAHB 1IHSH 1ABIH 2Q6GA 1V2VT 4R8TB 1HAVB 2GV7A 5GDSH 4YLQH 1IOEA 1GBKA 2Z9KA 3ZZ3A 1DPOA 2ZHDA 2SFAA 2PKSC 3MFJA 1ZPZA 4WMFA 4ZH8A 2BVSH 1WBGB 1CSOE 3A7YA 1A4WH 1SGDE 1TNLA 1C2MA 4X6MA 1UCYH 3MHWU 3RC6A 1BQYA 2FEQH 1NESE 2HVXA 2ZU1A 3A7WA 3BTQE 1SL3A 2PKAB 3EYDA 1S6HA 3SW2B 1HGTH 3GCHB 1FY1A 2YOLA 5E8EH 1O39A 1SLXB 1P02A 1A3EH 1K28D 1F5RA 1IQHA 1BJUA 1FQ3A 1WTHD 1O36A 3UR9A 2D2DA 1MTVA 2H9HA 1ETSH 1KDQB 3QUMP 4H4FA 1NRNH 2HPQH 3CS7A 2Z6BD 3RXTA 4E7NA 1AB9C 3ATMA 4JZDH 1P2QA 3A81A 1WYKA 4VGCB 2QY0B 2ZHFH 1TGBA 1TA6A 2AIQA 2CJIA 5FCKA 1ID5H 3ZZ6A 1VCWA 4FUJA 1AKSA 2BX4A 2ZDMA 2OC1A 1ANCA 2ZDNA 1QHRB 1VR1H 1ANDA 3AW1A 2UWPA 4AG1A 3TJNA 1TRNA 2CHAC 3BV9B 2JH0D 5EQRA 2JETC 3O8DA 1BTWA 1TBQH 1ZGVA 2PGQB 3ESTA 1PYTD 1T7CA 1SLUB 1CBWB 1IQFA 1TA2A 5E2OA 4I31A 1GI2A 2WPKS 4ZUHA 4CR9A 1UVOA 2ZGHA 3HKJB 2AGGX 1LVMA 2VU8E 3PM3A 1L2EA 2GDEH 5TCCA 2J94A 3OU0A 1OPHB 1HAZB 2H9TH 3MH6A 1LVOA 1HLTH 1SC8U 1O34A 5EU8A 5ABWA 3GICB 1AKSB 2W3IA 4YOIA 1ZHPA 3H7TA 1GI9B 1TMTH 2ILNA 1G2LA 1DLKB 2ZHWH 1MKXH 1OP8A 3RMNH 5EW1H 1TRYA 3P6ZB 2O8TA 4YT7H 1V2OT 2FYRA 2TBSA 1AD8H 1Z71A 1UVPA 4B2AA 1G2MA 3F9EA 4KGAA 2ZPQA 2BDAA 4HTCH 5DO4H 1HCGA 4IC6A 4O9VA 4D7FA 2FPZA 3JZ1B 3ZVDA 1BBRE 1QNJA 1ZGIA 4CR5A 2AIPA 4UFEH 1AVXA 1TGSZ 2BDYA 2O8MA 4JYUH 5EXLA 1YCPK 1V2NT 2B9LA 3U9AH 1EP5A 2PFEA 2ZU2A 1DE7H 4Y8ZA 2UUFB 1TGCA 1RFNA 3EA8A 2XBVA 2NU1E 4CRFA 1DUEA 2ZCLP 4WXIA 2P16A 1OP2A 4K1EA 1FMGA 1CE5A 3LGYA 1MBMA 1H9HE 1UTJA 1MD7A 3G01A 3OYPA 4XBBA 5LPFA 1KXBA 2R2WU 1ZJDA 2R3YA 2BD9A 3V3MA 2OP9A 4YT6H 1TGNA 1O35A 3GY7A 4WMEA 1BMAA 5C20A 1O3PB 3U8RH 3SV9A 5E0JA 1EP6A 3QGNB 1CA0B 1NROH 1G37A 1GBBA 2BM2A 2ZZUH 3TITA 3RC5A 5A0AE 2BDBA 3QTVH 1ARBA 3ZZ8A 3A89A 1BTHH 3KQCA 1O5BB 2NU0E 2ZKSA 3A85A 2PWXA 2OC8A 2G4UA 4LOYH 2QIQA 1AI8H 1CA8B 3SV8A 2RG3A 1A61H 4B2BA 1SPJA 1DXPA 4OGXA 2ZPSA 2ZEBA 3ZYEA 1HRTH 4X2WA 2Z3CA 2B8OH 2BD2A 1C5QA 3RXLA 4ZHMU 1O31A 2V6NA 4X2VA 4I8JA 1HV7A 3E16B 1SI5H 4DT7B 1OP0A 4HGCA 1CQQA 1PQ5A 1C4V2 4MPUA
chains in the Genus database with same CATH superfamily
1ZSKA 1NN6A 5A0CA 2JH6D 5GWZA 5LPRA 1GHWH 5C2ZA 2RFKC 4B75A 1FN8A 1ZPBA 2XOKD 2BY7X 6GCHF 1BDAA 4BXSA 2ZC9H 1IQIA 4I7YH 3RM2H 3FN8A 3RXDA 3ATKA 1F5LA 1WXRA 3URCA 1KIGH 2NU3E 3RDZA 4X1PU 3M37A 2FODA 3GCNA 4K60A 1JRSA 2BB4A 1C1RA 4FUEA 1C2EA 5HM9A 3ZZ5A 1GJ9B 4YTAA 3NRLA 1HAIH 1WV7H 2P8OB 1DT2A 4CHAC 2HGTH 1C5UA 2Z9JA 1JWTA 2VIWA 1FV9A 1Q2WA 4RSPA 1SGFA 2VIOA 3UNSA 4CH2B 4CH8B 4O03A 1GMDG 4TY6A 3VB3A 1MTUA 1MU8B 1J16A 1MTWA 3DSPA 3BTME 2GZ9A 3HKIB 1NRQH 5L30H 1W12U 2Y7ZA 1BTZA 3LGUA 1TB6H 2QXGA 1C1SA 3KIDU 4OS7A 1DSTA 1D4PB 3WW7A 1QJ7B 1BT7A 3UNQA 3D49H 2CGAA 3E91A 3BTDE 1TLDA 4YZUA 2SGAA 1TAWA 1PFXC 3KQBA 2BY9X 2HPPH 1H8DH 2R9PA 5HM2A 4AOQA 5KEDA 3UUZA 3NXPA 1MQ6A 2QYIA 2OC0A 4Y79A 2ZDAH 1GGDB 1K1OA 4MG3A 5C1XA 3M5OA 4ACBA 2AGIX 4XBCA 5JB9S 1QURH 1EZXC 2Z7FE 1AFQC 1BITA 1B5GH 2BHGA 4ZXYH 3ATLA 3RXEA 3TH4H 1TGTA 1YGCH 1BRCE 4KTUA 2FMJA 4NIYA 2ZO3H 3UB0A 4AFUA 4WXVA 1KSNA 2EI7A 3P8FA 1P03A 2C8YB 2FOCA 2BY5X 2RCEA 1TNHA 4WVPE 2FESH 1O2WA 4LK4A 4SGAE 1GDUA 2ZDKA 1TPSA 3SU0A 1XUGA 1GHZA 2ANWA 5CHAC 5G4BA 4BTTB 3SU5A 3PROA 1LQEA 2J92A 3HATH 1QY6A 2EY4C 4OM9A 1GI8B 4I8LA 2XC4A 1BRAA 1NPMA 3PRDA 3TK9A 1C1OA 3TU7H 1AVGH 2KAIB 2TGTA 1ZOMA 1C1WH 1QGFA 3BTHE 5DPAA 3SJIA 4ZROA 1MAYA 2LP6A 1RXPA 1L4DA 2R0LA 4ZKRU 2BY6X 1VJAU 2G51A 3HGPA 4ABHA 1GMDF 1YPHE 5DP5A 2KX4A 1UTNA 2J97A 5GIBA 1H8HD 3MO9A 2QAAA 4ZKNU 2A4GA 3M7QA 1B0EA 5AF9H 2P59A 2FI3E 2SGQE 1AWHB 5C94A 1P01A 1EKBB 3A80A 1EASA 1TX6A 1UTPA 4JZEH 3F9FA 2STBE 1TWXB 1PJPA 1PPFE 1K0HA 1S6FA 3D65E 1L4ZA 3UNRA 1AN1E 4JYTA 2L6OA 1NO9H 2FI4E 2RA0A 1C5PA 1XUJA 1GDNA 1LHFH 4KTCA 4B6EA 1FAKH 2CXVA 3K6YA 4AORA 5J4SA 1GBCA 3OTPA 3BG8A 1UHBA 3DT0H 3M3TA 1EJNA 3A8BA 3BEUA 2ZNKH 2A1DB 1BMNH 1XVMA 1BTYA 1SQAA 3M35A 5DP7A 1HIAB 3V13A 1O2XA 1P2NA 3LGTA 2GZ7A 1ZHMA 3M3VA 4YLUA 4UE7H 1TRMA 1W13U 2ALPA 1ZPCA 2QXJA 3AVZA 3K65B 1SGCA 1O3AA 4KTSA 1G32B 5FBEA 4OS2A 4OGYA 1SG8B 1SVPA 2V3MA 4GAWA 4WMDA 2FI5E 1CGIE 3C1KA 1TONA 3P8OA 1THPB 4AX9H 4WH6A 2ZDVH 5A8YA 2ZHQH 3RU4D 3TGKE 3MTYA 1CBWC 2PSXA 2BD3A 3SJ8A 4I8GA 1DOJA 1RJXB 5T6DA 1YYY1 1SB1H 4RKJB 3TK6A 1CO7E 1UHBB 1T8NA 7KMEH 4IMQA 2BDCA 1A0JA 2WHXA 3OY6U 2F3CE 3RU4T 3FVFB 1AE8H 4IMZA 2ZPRA 1OWHA 1T32A 1QL9A 3VXFH 3O8RA 1BOQA 3F3BA 3A82A 3F0OA 1EOJA 3GCTG 1AUTC 1A5GH 5DP8A 1Y3VA 4WJG2 1RTFB 1O2UA 1IQLA 3SU3A 5JBAS 1MCTA 1DLEA 2F91A 3IWMA 3RXMA 4GVUA 1WU1A 1BRUP 1X7AC 2OC7A 1SQRA 3BTEE 2VH6A 4K5ZA 4A5TS 1PPEE 3AAUA 2AMQA 3SQEE 4H6TA 2ANYA 2A0QB 1O2MA 5F8ZA 1TBZH 1QR3E 5FBIA 3DD2H 3OEHD 2D1JA 3KF2A 4K2YA 2TGAA 2GD4B 4H42U 4X1SU 3SGQE 1GHBG 4FUFA 1OOKB 4ISIH 1V2QT 3OTJE 1F5KU 1C5MD 1O3NA 3SORA 3SNAA 2PW8H 2GCTB 3Q76A 1SHHB 1YLNA 2WZQA 4NG9H 4FU8A 2FZZA 3QDZB 1Z8RA 1LHDH 1O3OA 5H4IB 8LPRA 1P09A 3PLPA 3PMJA 1NM6A 1D3DB 3DCLA 2XYAA 2OQ5A 1SMFE 4X8UH 1IQKA 1SBWA 2GJGA 4XBDA 2VJ1A 2PP6A 4A1XA 4YOJA 4TPIZ 2F9VA 2H6MA 5K0HA 3UR6A 2ZHEH 1FAXA 3P17H 1F0RA 5DP3A 4H6SB 2RA3A 1B7XB 3K2UA 1YCPM 2FM2A 3SUEA 4ABJA 4LXBH 4F4OC 2VB0A 1H8ED 1MTSA 3LONA 5DP9A 2ZCKP 1CA0C 4YXWD 2G55A 3F0PA 1J17T 2ZWLH 1MKWK 5C1UA 1GHYH 5JBCS 3SUFA 1ELFA 1ELVA 4KP0A 2P94A 4AB9A 5GPIB 4ISNA 3PO1B 4ZMAH 3FZDA 1ELGA 1L1JA 3TGJE 1C1TA 1O3GA 1YC0A 1ELAA 4NA7A 1GI6A 2IJOB 3BIVH 3UFAA 5C67A 1C5WB 3UY9A 1THSH 1UVSH 2Y7XA 4Y10E 1XKAC 3CP7A 2ASUB 4QT8C 1ZYOA 2W7UA 5L6NH 1OYTH 1RGQA 1XMNB 2BDHA 1YM0A 1GHBF 1O3CA 2QXIA 3M61U 1S5SA 1V3XA 5GCHF 3TLOA 4NZLA 4ZXXH 4ABIA 3OSYA 3SQHE 1YPMH 1QL7A 2BLQA 5C3NA 5EJZA 3QN7A 3MH7A 3V12A 1PPBH 1UVTH 1P11E 2IPHA 1FONA 3LGWA 1ESAA 1GVZA 2OINA 1GI5A 2PV9B 1GJCB 2R2MB 2XXLA 3MYWA 1FZZA 2O8UA 1E37B 1HDTH 2JKHA 2PLXA 1C2FA 3MH4A 4XSKU 3F6UH 1DANH 3B9FH 4J2YB 1K1PA 3SZEA 5CMXH 7ESTE 2FWWA 3ATIA 3BEIB 5EGMA 1KLJH 1MTNC 2FTMA 4TPYA 5B6LA 1SGEE 2V7QD 3U8TH 1OWKA 3EDXB 2F9OA 2P8OC 1G9IE 1OKXA 4X6NA 1LPZB 4NIVA 3PV5A 3TH3H 5DGJA 3I29A 3ZV8A 4NWLA 1EOLA 1DM4B 1SHYA 3A7XA 1TNGA 1H1BA 4IN2A 4AYVB 2A2XH 3AAVA 4DT4A 4NZQA 1YCPH 1GMHG 3ZZBA 1P04A 3NK8A 3PMAB 4MQAA 1QL8A 1ARCA 2I6QA 2F9BH 1TX8A 1TABE 2HNTC 2VINA 2FS9A 3EE0B 2A5AA 1QA0A 1O33A 4AG2A 1FN6A 4UFFH 2NU2E 1FNIA 1E0FD 3LJOA 4HZHA 5E0HA 1EX3A 3CS0A 3MU5A 4J1YA 5I25A 1GJ6A 4NSYA 5LPEA 1GGDC 1YLDA 1O5CB 4MPXA 1V2WT 2M2AA 2ZFRH 3VB5A 1S6LA 4A7IB 3KQEA 2PSYA 1P9UA 2ZFFH 3KQDA 2GVFA 1P2IA 1Y3XA 3B8JA 1UTMA 2ZTZA 4AB8A 2AMDA 1QRZA 2QGRA 4K8BA 2C90B 2WPHS 2B0FA 1BRBE 2F4LA 1HJ8A 5IYTA 4D9QA 4XOJA 5CDFE 1SLVB 4MNVA 3WY8A 3NZIA 1KXAA 3EE7A 2RDEA 4UFGH 2ZGBH 1DXWA 1C2GA 1SQOA 1TOCB 4AFSA 1BIOA 3S9AA 2DUCA 2VIVA 2C8ZB 2OBQA 1QJ1B 3M36A 4Y0ZE 1KLTA 2A5IA 5LH8A 3ODDA 3OAAD 3E1XB 4OS4A 3A7VA 1VGCC 1O2YA 1GBHA 2V0BA 1GI7B 2HRVA 4NWKA 1GBTA 3ZZ4A 2BYAX 2Z94A 4AGKA 1RIWB 3KNXA 1C4Y2 4KELA 3SNCA 3GY6A 3VEQB 4JCNA 1O2NA 3ZIAD 4ABFA 3LGVA 2L74A 2GP9B 1H8IH 5C5NA 5JYIA 1GCTB 1EPTA 3SNEA 1RTKA 3RXJA 3RXFA 1FLEE 4B2CA 3F9GA 2P3TB 3RXKA 3T28A 3M7UA 4IBLH 1YY3A 3FOAA 1OS8A 4DJZB 3KQ5A 3VB7A 6CHAB 2OCVB 2HVYB 2WPJS 3U1JB 3E0PB 1GJ5H 5JDUB 1P3CA 2XRCA 2J95A 1NT1A 1IQMA 1UTQA 2A7HA 4BTIB 2KCOA 5DK1A 1UK2A 2CMYA 5EJ1A 3E8LA 1SQTA 1BTXA 1Z1IA 4BANB 1C5XB 1A3BH 4LZ4B 2XNDD 1DSUA 4O97A 1O5FH 1CT2E 5T3HA 6ESTA 1EUFA 1YP9A 5C0TA 2KCPA 2FX4A 1C9PA 3RMOH 1COWD 3RXAA 4MPWA 4LZ1H 2AMPA 3LPRA 1W7XH 5EPNA 1G36A 1W14U 3RMLH 1TNJA 4Y0YE 1N1LA 1EJAA 3GDSA 5A8ZA 5ESTE 3SI3H 4FUDA 2LNCA 1TPPA 1PQ7A 4I8HA 1SGPE 3SJ9A 2HWLB 1GBEA 1ELDE 1XVOA 3UTUH 3RXHA 1O0DH 3E3TA 2GV6A 1E1RD 1QRWA 5F8XA 2J5UA 2JDID 1QZ8A 1GHAG 1KYNA 4NCYA 1MAXA 1V6DA 1S84A 1K1JA 2AEIH 4X8SH 2BVXH 1YPLH 3F68H 2BX3A 3S7HB 4X8TH 5FL7D 1SGIB 4JZ1A 3P70B 1WAYB 1BBRH 5TCAA 4Y7AA 2XCNA 2A5KA 1MKXK 1GJ4H 1QA7A 1BHXB 1EJMA 3LDXH 3L6PA 1EQ9A 1V2UT 1NU9A 3FZZA 2ODQA 4DOQA 2KCYA 4ESTE 1B0FA 3GDVA 2KM0A 4TSFD 1JMOH 1T8OA 1QB6A 3A87A 2SGPE 1KLIH 1QCPA 3PMBB 4ABDA 1O2GH 4SGBE 1UTOA 3A83A 2WPIS 3RXCA 2PTNA 5ESBA 4ASHA 3DFJA 1INCA 4NFEA 5J4QA 3SGBE 2BZAA 1YPEH 1JXPA 1G3CA 1A7SA 2PKSB 1E36B 4RN6A 2GKVE 2F9PA 1GBMA 2Y82A 1S0RA 1P2MA 1BB0B 3SNDA 1EAXA 2GCTC 3ELAH 1Y5AT 3QGJA 5GJ4B 5T6FA 2FO9A 3DA9B 1QIXB 2BMGB 1EZUC 2GCHG 5K7RA 3TK5A 4D7GA 2G81E 5C5OA 2SGDE 1F2SE 5HIZA 1NFYA 2VGCB 1G3EA 1IQNA 2HNTF 5EG4A 3F2FA 5L2ZH 1D3QB 3CNRA 1RS0A 2I6SA 3O8BA 2BOHB 4ACAA 1W11U 5BRRE 5F53A 3T29A 1GHAF 2KR7A 4ZKOU 3LGIA 4ISHH 4ABBA 3GY8A 3T2NA 1P8VC 1E35B 1C5YB 1E38B 2BD8A 1OSSA 2AYWA 1GHVH 3MQKC 1AB9B 1J8AA 1VCPA 1UTKA 1HAHH 1FPCH 1YPGH 1A0HB 4I8KA 4X8VH 5A2MH 2VVUA 2Z9IA 3ZVEA 1YPJH 2H5DA 3EQ0H 3QO6A 1D3TB 1HAGE 3U1IB 3DFLA 3KYFA 1V2TT 4IN1A 3ZZCA 3TNSA 1C1UH 3E0NB 2HLDD 4Q63A 1UVUH 1BTUA 1GBAA 2FOAA 1GMCG 4MTBA 1Y3YA 1P3EA 2CHAB 2BD7A 4INKA 2GDDA 1OWEA 2DE9A 3GY2A 3MNSA 3KL6A 1TBRH 1U6QA 5IDKA 2BQ7B 1EZQA 1K1IA 4CRBA 1ABJH 3SV7A 1SOZA 3NKKA 1XXFA 1O3JA 3QK1A 1K9OE 4HFPB 3M5LA 1HJAB 1HPGA 4FUCA 1VITH 2F83A 2GMTB 2CF8H 1K1MA 1ZHRA 2AGEX 2F43B 3VFEA 4B1TA 3FANA 4DCDA 1Z8JB 3M7TA 1EAUA 2VWLA 3UQOA 3QLPH 1SFIA 4ASUD 5ETXA 3H7OA 3MOCA 3ODFA 3QX5H 1F7ZA 4K1SA 1UK4A 5CHBA 4CREA 4GLYA 1DWDH 5AFYH 2CV3A 4FUHA 4INHA 5T6GA 1QB1A 2LELA 3SV2H 3QTOH 2ZDLA 1GVLA 2TRMA 1ZSLA 2C8XB 5FXLA 8KME2 4ISOA 2VBCA 3GCHC 3DUXH 3D23A 3SU2A 2J4IA 4CRCA 4CRDA 3A8CA 5FHTA 1EB2A 1TQ0B 2CN0H 1WSSH 2OD3B 2G52A 1PQAA 1T4UH 3ZZDA 2JIZD 2BXUH 1CHOG 1O2QA 4CRAA 3F2HA 1L1NA 2YMSB 4E05H 3BF6H 2R0KA 4GHTA 1Z6EA 3PTBA 1GMCF 1LHEH 3VB4A 1MH0A 4K8YA 2FP7B 3OY5U 4FU7A 3UWJH 2C4FH 1NTPA 3NPSA 1JRTA 2YNBA 4VGCC 1EAWA 1JIMA 4Y8YA 3STJA 2BDIA 1JOUB 2BD5A 3KGPA 5GNDA 2J38A 4M9FA 2ZFTA 2FXRA 3H5CB 3KN2A 2K0QA 3CENA 8ESTE 1WQSA 2EC9H 2OTVA 2ZA5A 3ZZ7A 2WPMS 5JB8S 2ZU3A 3SHAH 3Q3KA 3T26A 2JJ2D 1MABB 2DE8A 5F6MA 1V2LT 1MQ5A 4JZIA 3BSQA 1O5GH 2TGDA 1GI0A 1ANEA 8GCHG 1Z8GA 3GY3A 3GY4A 3TPIZ 5FPTA 2ZP0H 2WINI 1Z8IB 4MNWA 1H9IE 4PROA 3RC4A 2Y81A 1KTSB 1CGJE 1C5SA 1FPHH 1C5OH 1ZTJA 3L3TA 3RLWH 2FOGA 2QF5A 1VJ9U 9LPRA 2ULLA 4DY7B 1MKWH 1LTOA 5EODA 2FOMB 3FP6E 4X1QU 1NRPH 3Q00A 2QF3A 1P57B 1EATA 3T5FH 3SU1A 2B5TB 2IJD1 1AUJA 1OHHD 4RT1A 3RXSA 1C4U2 1YF4A 1GBFA 3HK6B 3BTKE 4UD9H 2XBYA 1AWFH 4AN7A 3SI4H 2NWNA 3MI4A 1PQ8A 1OX1A 5I46H 3BN9A 1W3CA 1Y3WA 1RIWC 3RLYH 1C5RA 3ZYDA 2CK3D 4U32A 2AERH 4GSOA 4O3TA 5FCRA 1MZAA 1ZZZA 1O3LA 4Y7BA 4A92A 4Y6DA 2ZGCA 1GCTC 4Q7XA 1NBME 1N6XA 2ZIQH 1SFQB 1FIZA 1ANBA 3V7TA 5FPSA 4BOHA 4AGJA 2WV5A 1WUNH 3GY5A 4ABEA 2ZI2H 2ZQ2A 3VGCB 5A09A 3F9HA 4P02A 3EA7A 1K1LA 3PLKA 4JMYA 4FVDA 1H4WA 1YLCA 3QZQA 4U01A 3BTTE 4FUBA 3RXGA 3PTNA 4CHAB 3D62A 4TWYA 4M7GA 3PMHB 1C5NH 1NFUA 3FO8D 3LC5A 4FU9A 2OQUA 5EPYA 3LKWA 2QXHA 1KXFA 5F03A 3GDUA 3GISB 3NUMA 4B74A 5A8XA 2KCAA 3W95A 4A1TA 1AZ8A 2XWAA 3T27A 3TJOA 1C2LA 1GG6B 2C8WB 5C1YA 3GCTF 5KGOA 2QC2A 3MNBA 1W0JD 1UCYE 1GHXH 1P0SH 3SU6A 5HIYA 3OX7U 1EFRD 1SGTA 3UPEA 4CBOA 1V2MT 2BQ6B 1D9IA 2IPQX 1KXEA 4CBNA 3SBKA 1QFKH 3PV2A 4YM9A 2XWBI 1C2JA 3SNBA 3TVJB 1DY9A 1FIWA 1O3HA 1GL1A 1EAIA 1RRKA 4X2YA 1HAVA 4BXWA 1W8BH 3VG8A 4B76A 2HOBA 5DKMA 3RXVA 1RTLA 2UWLA 1QRXA 3R3GB 1AFEH 4IC5A 2QF0A 1ZRBA 3RXBA 2OLGA 5EQSA 1ORFA 2PUXB 3B23B 2K8IA 2XC0A 1QBNA 1TQ7B 3FP7E 1MUEB 1F0TA 3VXEH 5DJ7A 3E6PH 3NCLA 1C9TA 3UREA 3C27B 1J9CH 2Q6DA 4E06H 1O2TA 2PKAA 2ZTXA 1WOFA 5CHAB 4NIXA 3SO3A 4NFFA 3DSOA 1G30B 2STAE 1QBOA 3ATWA 3NWUA 1TYNA 1XX9A 1GBJA 1O2ZA 1SGQE 4NGAH 1SOTA 2A4OA 5B6OA 1KDQA 1LPKB 2P3FH 1GJ8B 4KKDA 1V2ST 3TH2H 2ALVA 4U30A 4FUGA 5TJXA 2ZGJA 3KEEA 2AHME 1GJDB 2BLOA 2GZ8A 4E7RG 1SSXA 3MNCA 4X0WU 1GCDA 1CVWH 1J15A 3HPTB 2J2UA 2C93B 1HNEE 3P95A 1O38A 3MWIU 4BNRA 2VWNA 3PB1E 1XKBC 3RXPA 1PPGE 2W3KA 9ESTA 1C5VA 1W0YH 4WF8A 2VGCC 2G8TA 3GCOA 2OXSA 3WWBA 1THRH 1ZRKA 1DICA 3I78A 1QTFA 3STIA 1Z7KA 5EXMA 2JJ1D 1TMBH 1RD3B 1XM1A 1ZLRA 1C5ZB 1O2OA 1GWAA 2VVVA 5JBTA 3RXUA 5EOKA 2EEKA 3RXRA 3QZRA 1J14A 3MU8A 2RDLA 1TALA 4GPGA 2P95A 4AFQA 2ZGXH 4I32A 3SUDA 1ETTH 2VIPA 3H09A 5FX6A 3LT3A 3HK3B 3N7DA 1SLWB 4IW4E 3R0FA 4NA8A 1O2JA 4BAQB 1N8OB 1LVBA 4FXGH 5LGOA 2FOEA 2ODPA 2FOFA 3EGKH 5GXPA 1FY5A 2V35A 4OS1A 3PV4A 3IITA 1CT4E 2H9EH 4UFDH 3MU4A 4DVAU 4NA9H 1K1NA 1ZTKA 2UUKB 4TWWA 2AFQB 1MD8A 1O3MA 2D8WA 2GX4A 1LHCH 2A45B 2VVCA 5BPEA 3UIRA 2ZFQH 2NU4E 1BZXE 1TX7A 3A8DA 3T62A 1HJAC 5E0GA 3P8NA 2GMTC 1YPHC 4Q80A 2QF4A 2ZU4A 2VNTA 2J34A 2Z9LA 1NFWA 3MO6A 1UCYK 4XD7D 2PR3A 1O2KA 3N7OA 2WV4A 2BQWB 2TIOA 4DW2U 4AC9A 1AY6H 1TMUH 4MNYA 4Y71A 2SNVA 4MLFB 1AVWA 4XE4A 4MVNA 3LH3A 1GMHF 1TNKA 2A4QA 1GBLA 1F0SA 4JYVH 1LDTT 1MMJN 4JK5A 1L1GA 2SGFE 2W26A 2BVRH 1QQ4A 1C5LH 1AE5A 1LMWB 4TY7A 3U8OH 3S9BA 1KXCA 2BXTH 2O8WA 1O2VA 1T4VH 3TIUA 1FUJA 1AMHA 3URDA 1CT0E 1VITG 2FIRH 1TE0A 2J9NA 1KY9A 4Q4LA 1OYQA 2XNIA 1O37A 2GT7A 2XTTB 3M3SA 1TFXA 3WWFA 2QV1A 3L33A 1C2IA 1ESTA 1N6YA 4AYYB 2FYQA 3Q3YA 3VPKA 4RI0A 2LPRA 4JZFH 2WSSD 4MPVA 2YMSC 1G3DA 2ODYB 3GYLB 4FVBA 1G3BA 3MU0A 4CRGA 1V2RT 1ZMNA 3LU9B 1P9SA 1FJSA 3TJUA 5JBBS 1EPTB 2SNWA 3A7TA 1V2JT 2FLBH 6GCHG 1DITH 1FX0B 1Y3UA 3GS9A 4X2XA 1O2SA 1GBDA 2FTLE 4GHQA 2FOBA 1C1PA 2A2QH 3PWCA 1HFDA 1Z6JH 2VWOA 3SGAE 1LO6A 2Y5HA 3ZVAA 1ELEE 2Y5FA 5AHGH 2Y80A 1ZTLA 1OXGA 4GUXA 2OBOA 3IG6B 1ACBE 2THFB 4A1VA 1AHTH 1W10U 1BHXF 1FY8E 1A5IA 2D26C 3BTWE 2O8LA 3ZVGA 1S82A 2VH0A 1S81A 1T8MA 4ZHLU 3TJVA 4OS6A 1V2PT 3MNXA 4Q2KA 1P2JA 4NIWA 3FFGA 1ELCA 4BAMB 1BMMH 1JBUH 1MZDA 2ZF0H 2F9NA 2H5CA 4Y8XA 1SGFG 4FUIA 1LCYA 4ABAA 4D9RA 1O30A 2W5EA 1FDPA 3AASA 3MO3A 2XBXA 4F55A 1LVYA 2ZCHP 2A31A 2OUAA 1VITF 1WQVH 3N7EA 2IOTA 3SU4A 4F49A 4YO9A 4DIHH 2BTCE 4UDWH 4WY3A 1C2KA 1DFPA 1DWEH 1C1NA 4GCHG 1O3BA 3JZ2B 3PYHA 4Q7ZA 4NSVA 2AH4X 5DG6A 3SHCH 4XFQA 2Z3EA 2VIDA 3BG4B 1BMLA 3Q3XA 2TGPZ 3UWIA 2BDGA 4ISLA 4THNH 3U98H 1F0UA 1ELBA 1WCZA 2V3HH 3RP2A 4YOGA 1HXFH 3SZNA 4DIIH 3V0XA 4TT3D 1Q31A 1BCUH 3E90B 4WWYA 1IQJA 2QE7D 1C5TA 1BUIA 2G00A 1K22H 2H2ZA 4Y11E 5HYOA 1O32A 3AW0A 1C2DA 3A88A 3VGCC 1C1VH 1UMAH 1Y59T 1W0KD 5HMAA 1MTNB 1P2OA 4ZKSU 2K1QA 3RMMH 1YBWA 1OWIA 4X1RU 3SOSA 1F92A 1NRRH 3I77A 2QA9E 1HXEH 2PTCE 3P92A 3M5MA 4IS5A 2HLCA 1BJVA 5PTPA 4K69A 3K6ZA 2FS8A 2ZTYA 5FPYA 4K3JA 1HB0B 2WYJA 1GG6C 1GVKB 4D76A 3BTFE 1NC6A 2YMSD 5A0BA 1D6RA 2G5NA 3A8AA 3ZVCA 1ESBA 1XXDA 2UUYA 3TNTA 2WYGA 4U2WA 3PO1C 1DUAA 4GCHF 3RXOA 3SN8A 3ZZAA 3M5NA 1UW7A 1LQDB 2M5TA 3LOXA 5EW2H 2JETB 1P2KA 1T31A 3F1SB 2B7DH 1BBRK 4O3UA 1Z1JA 2KAIA 1S0QA 3LIWA 2HNTE 1NY22 1ZSJA 3S7KB 4D8NA 1GPZA 4IGDA 2FDAA 1DY8A 2H1UA 1GI3A 4TYDA 2AS9A 1Q3XA 1QQUA 1D3PB 4XRNA 1SR5C 1O2IA 3P8GA 1DWCH 1E79D 3LH1A 2GCHF 2XBWA 1S85A 1MCVA 4ABGA 2IN2A 2ZFPH 1CHGA 1GBIA 2Z3DA 1IAUA 1UK3A 1YPKH 3DHKH 3SUGA 1DWBH 3U28C 1O2RA 2CF9H 1W0ZU 6LPRA 1VKYA 1WTGH 2V3OH 1O5AB 1LHGH 1A5HA 1O5DH 1CGHA 1EXFA 1A0LA 5EJLA 1H9LB 1OWJA 1VGCB 1P10A 1C1QA 1HJ9A 2JH5D 3N99A 3ITIA 1NZQH 3LJJA 3TGIE 1BA8B 2EQNA 5EQQA 4A6LA 5HKKD 3RM0H 4AZ2B 2ANMH 1YWUA 1QB9A 2UUJB 3MU1A 3W1EA 2Y6TA 3ENSB 1NBMD 1FY3A 2F9UA 4B73A 1HIAA 1QJ6B 4BAOB 3MMGA 1P06A 2P3UB 4DURA 1NU7B 2UWOA 1FY4A 4X6OA 4Z1MD 1ZR0A 4K1TA 4DG4A 2VIQA 3KYGA 3S9CA 1ELTA 4BTUB 2C3SA 2BLWA 1KTTB 4X6PA 3RXQA 1HBTH 1GJBB 1TPOA 2EA3A 7GCHG 1VCQA 3ZV9A 4WH8A 1WDIA 2QN5T 5DP6A 1XUKA 3KCGH 1A2CH 1GI1A 1E1QD 2ANKH 2P93A 3ZVFA 1DVAH 1NRSH 3VB6A 1HYLA 1DS2E 2PUQH 3ZVBA 2PHBA 1O2HA 3PWBA 2WUBA 3LC3A 1P05A 4Z6AH 4MNXA 3MH5A 1XUFA 4B71A 4Q7YA 3ZZ9A 1K21H 2BD4A 5AFZH 3A7ZA 1BMFD 1UO6A 2FLRH 1N8OC 4I33A 2XC5A 3W94A 4RT0A 4UEHH 1BTPA 2G5VA 5DP4A 2EI6A 1KXDA 4RKOB 3S0NA 3UQVA 4INLA 3O8CA 3OEED 1AGJA 2SGEE 1D6WA 1W7GH 2ZECA 3A84A 1EZSC 5E2PA 1T8LA 4ZAEA 1HUTH 4AFZA 3PLBA 5DN6D 2WUCA 1M9UA 3EAJA 1JIRA 1LKAA 1VZQH 1HAPH 2ZG0H 4YESB 3KHVA 1HAYB 1O2PA 3SJKA 1O3KA 2ZFSA 2ZQ1A 1YKTA 2Z9GA 1CHOF 5L2YH 4I86A 3SYJA 1SGYE 1ZMLA 5AVDA 2GT8A 1V2KT 3OE7D 5JPMH 1ZJKA 2Q6FA 2BOKA 3HGNA 1IQEA 5SGAE 4F48B 1GDQA 7GCHF 3GOVB 1OWDA 3UOPA 3BTGE 1GL0E 1PPHE 2QCYA 4MDSA 4B6FA 1L0ZA 1TNIA 1UJ1A 1HAXB 3RXIA 3FAOA 3F2GA 3T25A 6CHAC 3EA9A 3BIUH 1QBVH 2PGBB 2W7SA 3QWCH 1GJ7B 5HXFA 3Q77A 1E34B 5C17A 1XUIA 2XW9A 1O3EA 1AIXH 1P12E 2ESTE 1AZZA 8GCHF 2TPIZ 1LPGB 5GCHG 1ETRH 1Y5BT 4OS5A 1CU1A 1K2I1 1LKBA 3GYMA 2YNAA 1SGRE 1GJAB 1O3DA 1ZMJA 1TIOA 1TOMH 2A7JA 1NS3A 3UOUA 1EPTC 1AO5A 2R3UA 1PPZA 3RUOA 1Y5UT 2BY8X 1IHTH 2WPLS 2BZ6H 5FX5A 1PYTC 1Y8TA 1FXYA 1XUHA 2GGVB 2A4RA 2G4TA 2GTBA 2FX6A 2Y5GA 4Z0KA 1UTLM 3SJOA 1W2KH 1A46H 4HI3A 1MBQA 4JK6A 3RU4E 4R0IA 1HAOH 4UONA 7LPRA 4XDEA 5IK2D 5EXNA 2WPDD 1EB1H 2BLVA 2O9QA 2A7CA 2ZU5A 1AFQB 4DGJA 1C1MA 2XCFA 1O2LA 1A1RA 5FAHA 5CE1A 1O5EH 1C2HA 4X1NU 1AQ7A 3U69H 4BAKB 2FOHA 1O3IA 1PPCE 4ZHAA 5F8TA 1DDJA 2EI8A 1S83A 2A32A 1IQGA 2HALA 4Y76A 3SV6A 1MU6B 1AU8A 1NFXA 1TPAE 3K9XB 1FI8A 1SGNE 3FP8E 1GI4A 1O3FA 3S69A 1DX5M 3BEFB 5HGGA 2VWMA 2Q1JA 3A86A 3BG4C 4BAHB 1IHSH 1ABIH 2Q6GA 1V2VT 4R8TB 1HAVB 2GV7A 5GDSH 4YLQH 1IOEA 1GBKA 2Z9KA 3ZZ3A 1DPOA 2ZHDA 2SFAA 2PKSC 3MFJA 1ZPZA 4WMFA 4ZCNA 4ZH8A 2BVSH 1WBGB 1CSOE 3A7YA 1A4WH 1SGDE 1TNLA 1C2MA 4X6MA 1UCYH 3MHWU 3RC6A 1BQYA 2FEQH 1NESE 4FETA 2HVXA 5KECA 2ZU1A 3A7WA 3BTQE 1SL3A 2PKAB 3EYDA 1S6HA 3SW2B 1HGTH 3GCHB 1FY1A 2YOLA 5E8EH 1O39A 1SLXB 1P02A 1A3EH 1K28D 1F5RA 1IQHA 1BJUA 1FQ3A 1WTHD 1O36A 3UR9A 4HG6A 1SKYE 1KMHB 2D2DA 1MTVA 2H9HA 1ETSH 1KDQB 3QUMP 4H4FA 1NRNH 2HPQH 3CS7A 2Z6BD 3RXTA 4E7NA 1AB9C 3ATMA 4JZDH 1P2QA 3A81A 3OFND 1WYKA 4VGCB 2QY0B 2ZHFH 1TGBA 1TA6A 2AIQA 2CJIA 5FCKA 1ID5H 3ZZ6A 1VCWA 2WV9A 4FUJA 1AKSA 2BX4A 2ZDMA 2OC1A 1ANCA 2ZDNA 1QHRB 1VR1H 1ANDA 3AW1A 2UWPA 4AG1A 3TJNA 1TRNA 2CHAC 3BV9B 2JH0D 5EQRA 2JETC 3O8DA 1BTWA 1TBQH 1ZGVA 2PGQB 3ESTA 1PYTD 1T7CA 1SLUB 4FOUC 1CBWB 1IQFA 1TA2A 5E2OA 4I31A 1GI2A 2WPKS 4ZUHA 4CR9A 1UVOA 2KFWA 2ZGHA 3HKJB 2AGGX 1LVMA 2VU8E 3PM3A 1L2EA 2GDEH 5TCCA 2J94A 3OU0A 1OPHB 3PRBA 1HAZB 2H9TH 3MH6A 1LVOA 1HLTH 1SC8U 1O34A 5EU8A 5ABWA 3GICB 1AKSB 2W3IA 4YOIA 1ZHPA 3H7TA 1GI9B 1TMTH 2J98A 2ILNA 1G2LA 1DLKB 2ZHWH 1MKXH 1OP8A 3RMNH 5EW1H 3UAIC 1TRYA 3P6ZB 2O8TA 4YT7H 1V2OT 2FYRA 2TBSA 1AD8H 1Z71A 1UVPA 4B2AA 1G2MA 3F9EA 4KGAA 2ZPQA 2BDAA 4HTCH 5DO4H 1HCGA 4IC6A 4O9VA 5T1VA 4D7FA 2FPZA 3JZ1B 4P00A 3ZVDA 1BBRE 1QNJA 1ZGIA 4CR5A 2AIPA 4UFEH 1AVXA 1TGSZ 2BDYA 2O8MA 4JYUH 5EXLA 1YCPK 1V2NT 2W6JD 2B9LA 3U9AH 1EP5A 2PFEA 2ZU2A 2OK5A 1DE7H 4Y8ZA 2UUFB 1TGCA 1RFNA 3EA8A 2XBVA 2J98B 2NU1E 4CRFA 1DUEA 2ZCLP 4WXIA 2P16A 5DSFA 1OP2A 4K1EA 1FMGA 1CE5A 3LGYA 1MBMA 2W6ID 1H9HE 1UTJA 1MD7A 3G01A 3OYPA 4XBBA 5LPFA 1KXBA 3DSGA 2R2WU 1ZJDA 2R3YA 2BD9A 3V3MA 2OP9A 5C0UA 4YT6H 1TGNA 1O35A 3GY7A 4WMEA 1BMAA 5C20A 3AK5A 1O3PB 3FKSD 3U8RH 3SV9A 5E0JA 1EP6A 2KZ4A 3QGNB 1CA0B 1NROH 1G37A 1GBBA 2BM2A 2ZZUH 3TITA 3RC5A 5A0AE 2BDBA 3QTVH 1ARBA 3ZZ8A 3A89A 1BTHH 3KQCA 1O5BB 2NU0E 2ZKSA 3A85A 2PWXA 2OC8A 2G4UA 4LOYH 2QIQA 1AI8H 1CA8B 3SV8A 2RG3A 1A61H 4B2BA 1SPJA 1DXPA 4OGXA 5EIYA 2ZPSA 2ZEBA 3ZYEA 1HRTH 4X2WA 2Z3CA 2B8OH 2BD2A 1C5QA 3RXLA 4ZHMU 1O31A 2V6NA 4X2VA 4I8JA 1HV7A 3E16B 1SI5H 4DT7B 1OP0A 4HGCA 1CQQA 1PQ5A 1C4V2 4MPUA
chains in the Genus database with same CATH topology
1ZSKA 1NN6A 5A0CA 2JH6D 5GWZA 5LPRA 1GHWH 5C2ZA 4B75A 1FN8A 1ZPBA 2BY7X 6GCHF 1BDAA 4BXSA 2ZC9H 1IQIA 4I7YH 3RM2H 3RXDA 3ATKA 1F5LA 3URCA 1KIGH 2NU3E 3RDZA 4X1PU 3M37A 2FODA 3GCNA 4K60A 1JRSA 2BB4A 1C1RA 4FUEA 1C2EA 5HM9A 3ZZ5A 1GJ9B 4YTAA 1HAIH 1WV7H 2P8OB 1DT2A 4CHAC 2HGTH 1C5UA 2Z9JA 1JWTA 2VIWA 1FV9A 1Q2WA 4RSPA 1SGFA 2VIOA 3UNSA 4CH2B 4CH8B 4O03A 1GMDG 4TY6A 3VB3A 1MTUA 1MU8B 1J16A 1MTWA 3BTME 2GZ9A 3HKIB 1NRQH 5L30H 1W12U 2Y7ZA 1BTZA 3LGUA 1TB6H 2QXGA 1C1SA 3KIDU 4OS7A 1DSTA 1D4PB 1QJ7B 1BT7A 3UNQA 3D49H 2CGAA 3E91A 3BTDE 1TLDA 4YZUA 2SGAA 1TAWA 1PFXC 3KQBA 2BY9X 2HPPH 1H8DH 2R9PA 5HM2A 4AOQA 3UUZA 3NXPA 1MQ6A 2QYIA 2OC0A 4Y79A 2ZDAH 1GGDB 1K1OA 4MG3A 5C1XA 3M5OA 5JB9S 2AGIX 4XBCA 1QURH 1EZXC 2Z7FE 1AFQC 1BITA 1B5GH 2BHGA 4ZXYH 3ATLA 3RXEA 3TH4H 1TGTA 1YGCH 1BRCE 4KTUA 2FMJA 4NIYA 2ZO3H 4AFUA 4WXVA 1KSNA 2EI7A 3P8FA 1P03A 2C8YB 2FOCA 2BY5X 2RCEA 1TNHA 4WVPE 2FESH 1O2WA 4LK4A 4SGAE 1GDUA 2ZDKA 1TPSA 3SU0A 1XUGA 1GHZA 2ANWA 5CHAC 5G4BA 4BTTB 3SU5A 3PROA 1LQEA 2J92A 3HATH 1QY6A 1GI8B 4I8LA 2XC4A 1BRAA 1NPMA 3TK9A 1C1OA 3TU7H 1AVGH 2KAIB 2TGTA 1ZOMA 1C1WH 1QGFA 3BTHE 5DPAA 3SJIA 4ZROA 1MAYA 1RXPA 1L4DA 2R0LA 4ZKRU 2BY6X 1VJAU 2G51A 3HGPA 4ABHA 1GMDF 1YPHE 5DP5A 1UTNA 5GIBA 3MO9A 2QAAA 4ZKNU 2A4GA 3M7QA 1B0EA 5AF9H 2P59A 2FI3E 2SGQE 1AWHB 1P01A 1EKBB 3A80A 1EASA 1TX6A 1UTPA 4JZEH 3F9FA 2STBE 1TWXB 1PJPA 1PPFE 1S6FA 3D65E 1L4ZA 3UNRA 1AN1E 4JYTA 1NO9H 2FI4E 2RA0A 1C5PA 1XUJA 1GDNA 1LHFH 4KTCA 1FAKH 2CXVA 3K6YA 4AORA 5J4SA 1GBCA 3BG8A 1UHBA 3DT0H 3M3TA 1EJNA 3A8BA 3BEUA 2ZNKH 2A1DB 1BMNH 1XVMA 1BTYA 1SQAA 3M35A 5DP7A 1HIAB 3V13A 1O2XA 1P2NA 3LGTA 2GZ7A 1ZHMA 3M3VA 4YLUA 4UE7H 1TRMA 1W13U 2ALPA 1ZPCA 2QXJA 3AVZA 3K65B 1SGCA 1O3AA 4KTSA 1G32B 5FBEA 4OS2A 4OGYA 1SG8B 1SVPA 4GAWA 4WMDA 2FI5E 1CGIE 3C1KA 1TONA 3P8OA 1THPB 4AX9H 4WH6A 2ZDVH 5A8YA 2ZHQH 3RU4D 3TGKE 3MTYA 1CBWC 2PSXA 2BD3A 3SJ8A 4I8GA 1DOJA 1RJXB 5T6DA 1YYY1 1SB1H 4RKJB 3TK6A 1CO7E 1UHBB 1T8NA 7KMEH 4IMQA 2BDCA 1A0JA 3OY6U 2F3CE 3RU4T 3FVFB 1AE8H 4IMZA 2ZPRA 1OWHA 1T32A 1QL9A 3VXFH 3O8RA 1BOQA 3A82A 1EOJA 3GCTG 1AUTC 1A5GH 5DP8A 1Y3VA 4WJG2 1RTFB 1O2UA 1IQLA 3SU3A 5JBAS 1MCTA 1DLEA 2F91A 3IWMA 3RXMA 4GVUA 1WU1A 1BRUP 1X7AC 2OC7A 3BTEE 2VH6A 4K5ZA 4A5TS 1PPEE 3AAUA 2AMQA 3SQEE 4H6TA 2ANYA 2A0QB 1O2MA 5F8ZA 1TBZH 1QR3E 5FBIA 3DD2H 2D1JA 3KF2A 4K2YA 2TGAA 2GD4B 4H42U 4X1SU 3SGQE 1GHBG 4FUFA 1OOKB 4ISIH 1V2QT 3OTJE 1F5KU 1C5MD 1O3NA 3SORA 3SNAA 2PW8H 2GCTB 3Q76A 1SHHB 4NG9H 4FU8A 2FZZA 3QDZB 1Z8RA 1LHDH 1O3OA 5H4IB 8LPRA 1P09A 3PLPA 3PMJA 1NM6A 1D3DB 2XYAA 2OQ5A 1SMFE 4X8UH 1IQKA 1SBWA 4XBDA 2VJ1A 4A1XA 4YOJA 4TPIZ 2F9VA 2H6MA 5K0HA 3UR6A 2ZHEH 1FAXA 3P17H 1F0RA 5DP3A 4H6SB 2RA3A 1B7XB 3K2UA 1YCPM 2FM2A 3SUEA 4ABJA 4LXBH 4F4OC 2VB0A 1MTSA 3LONA 5DP9A 2ZCKP 1CA0C 2G55A 1J17T 2ZWLH 1MKWK 5C1UA 1GHYH 5JBCS 3SUFA 1ELFA 1ELVA 4KP0A 2P94A 4AB9A 5GPIB 4ISNA 3PO1B 4ZMAH 3FZDA 1ELGA 1L1JA 3TGJE 1C1TA 1O3GA 1YC0A 1ELAA 4NA7A 1GI6A 2IJOB 3BIVH 3UFAA 5C67A 1C5WB 3UY9A 1THSH 1UVSH 2Y7XA 4Y10E 1XKAC 3CP7A 2ASUB 4QT8C 1ZYOA 2W7UA 5L6NH 1OYTH 1RGQA 1XMNB 2BDHA 1YM0A 1GHBF 1O3CA 2QXIA 3M61U 1S5SA 1V3XA 5GCHF 3TLOA 4NZLA 4ZXXH 4ABIA 3OSYA 3SQHE 1YPMH 1QL7A 2BLQA 5C3NA 3QN7A 3MH7A 3V12A 1PPBH 1UVTH 1P11E 2IPHA 1FONA 3LGWA 1ESAA 1GVZA 2OINA 1GI5A 2PV9B 1GJCB 2R2MB 2XXLA 3MYWA 1FZZA 2O8UA 1E37B 1HDTH 2JKHA 2PLXA 1C2FA 3MH4A 4XSKU 3F6UH 1DANH 3B9FH 4J2YB 1K1PA 5CMXH 7ESTE 2FWWA 3ATIA 3BEIB 5EGMA 1KLJH 1MTNC 2FTMA 4TPYA 1SGEE 3U8TH 1OWKA 3EDXB 2F9OA 2P8OC 1G9IE 1OKXA 4X6NA 1LPZB 4NIVA 3TH3H 5DGJA 3I29A 3ZV8A 4NWLA 1EOLA 1DM4B 1SHYA 3A7XA 1TNGA 1H1BA 4IN2A 4AYVB 2A2XH 3AAVA 4NZQA 1YCPH 1GMHG 3ZZBA 1P04A 3NK8A 3PMAB 4MQAA 1QL8A 1ARCA 2I6QA 2F9BH 1TX8A 1TABE 2HNTC 2VINA 2FS9A 3EE0B 2A5AA 1QA0A 1O33A 4AG2A 1FN6A 4UFFH 2NU2E 1FNIA 1E0FD 3LJOA 4HZHA 5E0HA 1EX3A 3CS0A 3MU5A 4J1YA 5I25A 1GJ6A 4NSYA 5LPEA 1GGDC 1YLDA 1O5CB 4MPXA 1V2WT 2ZFRH 3VB5A 4A7IB 3KQEA 2PSYA 1P9UA 2ZFFH 3KQDA 2GVFA 1P2IA 1Y3XA 3B8JA 1UTMA 2ZTZA 4AB8A 2AMDA 1QRZA 2QGRA 4K8BA 2C90B 2WPHS 2B0FA 1BRBE 1HJ8A 5IYTA 4D9QA 4XOJA 1SLVB 4MNVA 3WY8A 3NZIA 1KXAA 4UFGH 2ZGBH 1DXWA 1C2GA 1SQOA 1TOCB 4AFSA 1BIOA 3S9AA 2DUCA 2VIVA 2C8ZB 2OBQA 1QJ1B 3M36A 4Y0ZE 1KLTA 2A5IA 5LH8A 3ODDA 3E1XB 4OS4A 3A7VA 1VGCC 1O2YA 1GBHA 2V0BA 1GI7B 2HRVA 4NWKA 1GBTA 3ZZ4A 2BYAX 2Z94A 4AGKA 1RIWB 3KNXA 1C4Y2 4KELA 3SNCA 3GY6A 3VEQB 4JCNA 1O2NA 4ABFA 3LGVA 2GP9B 1H8IH 5C5NA 5JYIA 1GCTB 1EPTA 3SNEA 1RTKA 3RXJA 3RXFA 1FLEE 4B2CA 3F9GA 2P3TB 3RXKA 3T28A 3M7UA 4IBLH 1OS8A 4DJZB 3VB7A 6CHAB 2OCVB 2WPJS 3U1JB 3E0PB 1GJ5H 5JDUB 1P3CA 2XRCA 2J95A 1NT1A 1IQMA 1UTQA 2A7HA 4BTIB 5DK1A 1UK2A 2CMYA 3E8LA 1SQTA 1BTXA 1Z1IA 4BANB 1C5XB 1A3BH 4LZ4B 1DSUA 4O97A 1O5FH 1CT2E 5T3HA 6ESTA 1EUFA 1YP9A 2FX4A 1C9PA 3RMOH 3RXAA 4MPWA 4LZ1H 2AMPA 3LPRA 1W7XH 5EPNA 1G36A 1W14U 3RMLH 1TNJA 4Y0YE 1N1LA 1EJAA 3GDSA 5A8ZA 5ESTE 3SI3H 4FUDA 2LNCA 1TPPA 1PQ7A 4I8HA 1SGPE 3SJ9A 2HWLB 1GBEA 1ELDE 1XVOA 3UTUH 3RXHA 1O0DH 3E3TA 2GV6A 1QRWA 5F8XA 1GHAG 1KYNA 4NCYA 1MAXA 1V6DA 1S84A 1K1JA 2AEIH 4X8SH 2BVXH 1YPLH 3F68H 2BX3A 3S7HB 4X8TH 1SGIB 4JZ1A 3P70B 1WAYB 1BBRH 5TCAA 4Y7AA 2XCNA 2A5KA 1MKXK 1GJ4H 1QA7A 1BHXB 1EJMA 3LDXH 3L6PA 1EQ9A 1V2UT 1NU9A 3FZZA 2ODQA 4DOQA 4ESTE 1B0FA 3GDVA 1JMOH 1T8OA 1QB6A 3A87A 2SGPE 1KLIH 1QCPA 3PMBB 4ABDA 1O2GH 4SGBE 1UTOA 3A83A 2WPIS 3RXCA 2PTNA 5ESBA 4ASHA 3DFJA 1INCA 4NFEA 5J4QA 3SGBE 2BZAA 1YPEH 1JXPA 1G3CA 1A7SA 2PKSB 1E36B 4RN6A 2GKVE 2F9PA 1GBMA 2Y82A 1S0RA 1P2MA 1BB0B 3SNDA 1EAXA 2GCTC 3ELAH 1Y5AT 3QGJA 5GJ4B 5T6FA 2FO9A 3DA9B 1QIXB 2BMGB 1EZUC 2GCHG 5K7RA 3TK5A 4D7GA 2G81E 5C5OA 2SGDE 1F2SE 1NFYA 2VGCB 1G3EA 1IQNA 2HNTF 5EG4A 5L2ZH 1D3QB 1RS0A 2I6SA 3O8BA 2BOHB 1W11U 5BRRE 3T29A 1GHAF 4ZKOU 3LGIA 4ISHH 4ABBA 3GY8A 3T2NA 1P8VC 1E35B 1C5YB 1E38B 2BD8A 1OSSA 2AYWA 1GHVH 1AB9B 1J8AA 1VCPA 1UTKA 1HAHH 1FPCH 1YPGH 1A0HB 4I8KA 4X8VH 5A2MH 2VVUA 2Z9IA 3ZVEA 1YPJH 2H5DA 3EQ0H 3QO6A 1D3TB 1HAGE 3U1IB 3DFLA 1V2TT 4IN1A 3ZZCA 3TNSA 1C1UH 3E0NB 1UVUH 1BTUA 1GBAA 2FOAA 1GMCG 4MTBA 1Y3YA 1P3EA 2CHAB 2BD7A 4INKA 2GDDA 1OWEA 2DE9A 3GY2A 3MNSA 3KL6A 1TBRH 1U6QA 5IDKA 2BQ7B 1EZQA 1K1IA 4CRBA 1ABJH 3SV7A 1SOZA 3NKKA 1XXFA 1O3JA 3QK1A 1K9OE 4HFPB 3M5LA 1HJAB 1HPGA 4FUCA 1VITH 2F83A 2GMTB 2CF8H 1K1MA 1ZHRA 2AGEX 3VFEA 4B1TA 3FANA 4DCDA 1Z8JB 3M7TA 1EAUA 2VWLA 3UQOA 3QLPH 1SFIA 5ETXA 3H7OA 3MOCA 3ODFA 3QX5H 1F7ZA 4K1SA 1UK4A 4CREA 4GLYA 1DWDH 5AFYH 2CV3A 4FUHA 4INHA 5T6GA 1QB1A 3SV2H 3QTOH 2ZDLA 1GVLA 2TRMA 1ZSLA 2C8XB 5FXLA 8KME2 4ISOA 3GCHC 3DUXH 3D23A 3SU2A 2J4IA 4CRCA 4CRDA 3A8CA 5FHTA 1EB2A 1TQ0B 2CN0H 1WSSH 2OD3B 2G52A 1PQAA 1T4UH 3ZZDA 2BXUH 1CHOG 1O2QA 4CRAA 1L1NA 4E05H 3BF6H 2R0KA 4GHTA 1Z6EA 3PTBA 1GMCF 1LHEH 3VB4A 1MH0A 4K8YA 2FP7B 3OY5U 4FU7A 3UWJH 2C4FH 1NTPA 3NPSA 1JRTA 2YNBA 4VGCC 1EAWA 1JIMA 4Y8YA 3STJA 2BDIA 1JOUB 2BD5A 3KGPA 2J38A 2ZFTA 2FXRA 3H5CB 3KN2A 3CENA 8ESTE 1WQSA 2EC9H 2OTVA 2ZA5A 3ZZ7A 2WPMS 5JB8S 2ZU3A 3SHAH 3Q3KA 3T26A 2DE8A 5F6MA 1V2LT 1MQ5A 4JZIA 3BSQA 1O5GH 2TGDA 1GI0A 1ANEA 8GCHG 1Z8GA 3GY3A 3GY4A 3TPIZ 5FPTA 2ZP0H 2WINI 1Z8IB 4MNWA 1H9IE 4PROA 3RC4A 2Y81A 1KTSB 1CGJE 1C5SA 1FPHH 1C5OH 1ZTJA 3L3TA 3RLWH 2FOGA 1VJ9U 9LPRA 2ULLA 4DY7B 1MKWH 1LTOA 5EODA 2FOMB 3FP6E 4X1QU 1NRPH 3Q00A 2QF3A 1P57B 1EATA 3T5FH 3SU1A 2B5TB 1AUJA 3RXSA 1C4U2 1YF4A 1GBFA 3HK6B 3BTKE 4UD9H 2XBYA 1AWFH 4AN7A 3SI4H 2NWNA 3MI4A 1PQ8A 1OX1A 5I46H 3BN9A 1W3CA 1Y3WA 1RIWC 3RLYH 1C5RA 3ZYDA 4U32A 2AERH 4GSOA 4O3TA 5FCRA 1MZAA 1ZZZA 1O3LA 4Y7BA 4A92A 4Y6DA 2ZGCA 1GCTC 4Q7XA 1N6XA 2ZIQH 1SFQB 1FIZA 1ANBA 3V7TA 5FPSA 4BOHA 4AGJA 2WV5A 1WUNH 3GY5A 4ABEA 2ZI2H 2ZQ2A 3VGCB 5A09A 3F9HA 3EA7A 1K1LA 3PLKA 4JMYA 4FVDA 1H4WA 1YLCA 3QZQA 4U01A 3BTTE 4FUBA 3RXGA 3PTNA 4CHAB 3D62A 4TWYA 4M7GA 3PMHB 1C5NH 1NFUA 3LC5A 4FU9A 2OQUA 5EPYA 3LKWA 2QXHA 1KXFA 5F03A 3GDUA 3GISB 3NUMA 4B74A 5A8XA 3W95A 4A1TA 1AZ8A 2XWAA 3T27A 3TJOA 1C2LA 1GG6B 2C8WB