1QBNA

Bovine trypsin 2-[amino(imino)methyl]-2-hydroxyphenoxy]-6-[3-(4,5-dihydro-1h-imidazol-2-yl)phenoxy]pyridine-4-carboxylic acid (zk-806688) complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qbnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qbnA02
5B6OA 1FY3A 5GDSH 4E06H 3ELAH 9LPRA 1O3EA 2BDAA 2I6QA 2GCHG 9ESTA 1H8IH 1XUJA 1CGHA 4AORA 4K8YA 4NWLA 1C5VA 1GCTC 2QXHA 1AN1E 1VITF 3Q77A 1QURH 3RXGA 1A5IA 1OPHB 2ZDKA 4K1EA 5E0GA 3ATWA 3PTNA 2EEKA 3PROA 2UWOA 2FWWA 2VIOA 2Z9KA 1HGTH 2NU1E 1XM1A 1WUNH 3SGQE 2PKSC 3E91A 1T31A 4FUDA 1NFUA 3UR9A 1K2I1 4ZROA 3RMLH 1G2LA 4B71A 1PPBH 3MO3A 3RXFA 2C8YB 2WYJA 1KLJH 2BY5X 4BAOB 4Q7ZA 1HDTH 1MU6B 4LZ1H 1C1TA 2FI4E 1Y3YA 5LGOA 4X1SU 5AHGH 1D6RA 1EB1H 1EPTC 1FDPA 3I78A 4B1TA 4Y0YE 2XC5A 1O3CA 3L3TA 1QA7A 1ELFA 1JOUB 3SNBA 2FS9A 4X8VH 1FN8A 1KXAA 2QYIA 2HALA 3PO1C 3SJIA 1GI5A 1O34A 4I32A 1JIMA 3RMMH 3ZVEA 1C2KA 1TWXB 1DUAA 1IQGA 1PYTC 1NFYA 3BTME 3MNCA 1SOTA 2LPRA 3LU9B 2BD8A 2BLWA 2WUCA 1J9CH 1EP6A 1TAWA 1XVOA 1GBHA 4A5TS 1FAKH 3P8GA 2W7UA 1TX7A 1ELGA 1CO7E 2F83A 3C27B 1GDNA 1T8NA 2F91A 1LVOA 2GT8A 1GBMA 4GCHF 4WWYA 2JH6D 1IQJA 3GDVA 2M5TA 4D8NA 1PJPA 2OXSA 2Y5FA 5PTPA 4Q2KA 5EGMA 3MNXA 1IHSH 1SSXA 1V2ST 3A84A 3JZ1B 4AYYB 2BX3A 2TRMA 2FYRA 1YBWA 2NU4E 1GMDG 1O0DH 2ZU1A 2FLBH 1TGCA 1EZUC 1JRTA 3OY5U 3ZVCA 3H7TA 1CGJE 3BTEE 2OQ5A 1W7GH 1MTNB 1ZGVA 4DVAU 1EKBB 2VWOA 8GCHF 4ABBA 2J38A 1C1VH 1SGRE 2ZI2H 3A82A 2HGTH 3MFJA 1MTSA 2SFAA 3VXEH 2YNBA 1BQYA 1MCTA 5JB9S 3SJKA 1BBRE 3TJUA 1BHXB 1IQIA 1A61H 5L2YH 1OS8A 5FPYA 4WXVA 1DWBH 5DP3A 2ZTZA 5DP9A 4K1TA 1TQ7B 3NCLA 3SHCH 2ZCKP 1TPOA 1ZPZA 2PKAA 3BV9B 4INHA 1DSTA 2W5EA 3KN2A 1AZZA 1FY8E 3NUMA 2ZGCA 3FVFB 3PLKA 5DP6A 5HM2A 2PLXA 3RDZA 3Q76A 2R2MB 1BOQA 3GY8A 1DX5M 5FCKA 2I6SA 4HGCA 1G3CA 2GVFA 3C1KA 1VCQA 1F7ZA 3ATLA 1NRNH 1KTSB 1SI5H 2TPIZ 3NKKA 1IQEA 1S83A 1O2MA 3UNSA 3TK9A 1G9IE 1MAXA 1QJ6B 4MPXA 2Y80A 1ZTJA 1CA0B 1HAVB 3HKJB 4XE4A 4BTUB 1JXPA 3VPKA 3E6PH 4GAWA 2BXUH 1HAXB 1LPGB 3LC5A 1O32A 3D65E 1TX6A 1SQTA 3ZZ7A 2AMQA 2CF9H 1C5UA 1XKBC 2ZGJA 2ZF0H 1JIRA 4XSKU 1TALA 1UVUH 2G4TA 4Y8YA 1V2MT 3EQ0H 1JWTA 2J94A 3KQEA 1GCTB 4WXIA 3HK3B 3EGKH 1TGSZ 2B5TB 1TGTA 2VB0A 2PGQB 1O2QA 4IC5A 3RU4E 3MU0A 1P01A 3AW0A 1RFNA 1AQ7A 1HPGA 1KXFA 3MO6A 2XBYA 5EXMA 3BEUA 1J14A 4K69A 1C2HA 4DGJA 3V3MA 1Y5UT 2W7SA 1EATA 1ANEA 3SN8A 2BD7A 3EAJA 2FOAA 5JBTA 3ZZ4A 2PKSB 2FX6A 4O3TA 1SQAA 1AUJA 2C4FH 4K8BA 1UJ1A 1P11E 4CRBA 1O2ZA 2G5NA 4NGAH 1F0RA 3PMBB 2QF0A 2ZO3H 3LGTA 4Y76A 1ZRBA 3E1XB 1BUIA 1TBRH 1W7XH 2UUYA 2Z3CA 3GY2A 1V2WT 1EPTB 1C5WB 5A8ZA 1SGTA 3KCGH 3E8LA 3MNSA 3NZIA 1BT7A 2BOHB 1KDQA 1O33A 1A5GH 1ELEE 2J34A 4OGYA 1PPFE 1T4VH 3M61U 2HPPH 4B2CA 2SGQE 5G4BA 4UONA 2FOCA 3PO1B 4DJZB 3A88A 2WPJS 2K1QA 4FUEA 4M7GA 1NT1A 1LHFH 1W0YH 1XXFA 2XTTB 2ZPSA 1HIAA 1W8BH 4LOYH 1O2LA 3SNCA 4XDEA 2VGCC 1GDUA 2G81E 1Z1JA 1C5QA 2ZIQH 4X1QU 3URCA 1NO9H 2FPZA 4JYTA 3SV7A 2FOHA 1FY4A 2ZA5A 3E3TA 4OS2A 3TGKE 1ESAA 1GJBB 3SU6A 5AF9H 3MMGA 2H9EH 3A8BA 5IYTA 2XNIA 2ZFQH 1SQOA 1AVWA 1QQUA 2ZGXH 3ZZAA 4O9VA 4OGXA 1T8LA 1RTLA 2ZHFH 3GY5A 1QGFA 2AGIX 2FOGA 3BTQE 4K2YA 4NWKA 1E36B 1EAXA 2FEQH 3LOXA 1TNJA 3O8BA 1THSH 3QN7A 3TJOA 1UVPA 2OP9A 2Y7ZA 5DJ7A 1T8OA 1GJCB 4FUIA 3UUZA 3UQVA 3B9FH 4MNWA 2G8TA 3Q00A 1GPZA 1OYQA 3PMAB 2HPQH 1QB6A 4YT7H 2ZCHP 1W13U 4KGAA 1GBCA 2OBQA 2OD3B 1SLWB 3RXVA 3VEQB 1F5RA 1PYTD 3FP7E 1W2KH 1V2PT 2AH4X 2HRVA 2UWLA 3CENA 6GCHF 1GMHF 1O5BB 1GHAF 1CHGA 1WSSH 1EZXC 2A45B 2D26C 2OUAA 1HAPH 3V13A 2SGDE 3OTJE 2Q6FA 5C20A 1INCA 1O2TA 5GCHG 3L33A 1MD7A 1O31A 1PPCE 3KNXA 3UNQA 4TWYA 2Q6GA 2D1JA 2HNTC 1O2JA 1GBBA 1UTLM 4Y0ZE 5ABWA 3TVJB 2CJIA 1C5NH 1DDJA 2HVXA 4NA8A 5E8EH 3LC3A 1BRCE 4WJG2 3GY7A 1OX1A 4E7RG 2FO9A 1HBTH 2PWXA 3VB5A 1AIXH 3PWBA 2W3KA 2QN5T 4XFQA 4BTIB 4Z6AH 3BSQA 1SLUB 3VB4A 2GMTC 4IN2A 1C1PA 1SGDE 1GHWH 3U9AH 4A7IB 2ZDAH 1IHTH 1Y5BT 2QC2A 2A31A 2XXLA 4YZUA 1LTOA 4YT6H 1ETRH 1G3EA 1Z8RA 1Z7KA 1AMHA 1ZZZA 1KXEA 5A8YA 5AVDA 1P2QA 1V2QT 3FZDA 3PMHB 4X6OA 2OC7A 3ZZ8A 4UE7H 3KEEA 3Q3KA 1V2OT 3UR6A 2R3YA 1O2PA 2VWNA 1O2OA 2QY0B 1SOZA 2AIPA 1WQVH 1HUTH 4O03A 4NFEA 4I7YH 4XBCA 3QUMP 5EQRA 4B73A 1K1PA 1O3HA 3CS0A 2P3FH 1E0FD 2B8OH 3TLOA 2ZEBA 1ANDA 3VXFH 1KYNA 2Z9IA 2QXJA 4O97A 3RXBA 1P03A 4HFPB 2GCHF 5T6GA 3E0NB 4MQAA 1F0TA 3P8FA 3U69H 2G5VA 4CBNA 1HJAC 2V0BA 3FP6E 1OWEA 2VIWA 3BTKE 1EZQA 2XC0A 1RTKA 1GHVH 2A4RA 2B7DH 2Y5GA 4J1YA 8LPRA 1GG6C 3F68H 3TGIE 5EPNA 3SU2A 3UY9A 2XYAA 3EA9A 2FI3E 4YLUA 3VFEA 2FESH 4OS4A 2C8ZB 1WQSA 3GICB 3BTTE 4UFFH 1GJDB 1O5GH 4YOJA 2BB4A 1ELCA 1ID5H 2ZC9H 5FX5A 1HCGA 1FIWA 2O8MA 1X7AC 2ZU5A 2YNAA 1H9LB 2XBWA 2A2QH 4FU9A 3BF6H 2WUBA 4RKJB 1LVMA 3URDA 3QLPH 2FMJA 5FPSA 4NIYA 1BBRK 4MG3A 1XUKA 6GCHG 3RXAA 4YLQH 1GMHG 1ZR0A 3UIRA 3MWIU 3S69A 2QGRA 2A4QA 4B76A 1D3PB 1Q3XA 4MLFB 2UWPA 1TGBA 4ZHAA 4QT8C 1YPHE 4BAHB 1KIGH 1BJUA 1GI4A 3D62A 5CMXH 2VGCB 3P70B 2BQWB 3JZ2B 4GSOA 3RXCA 1LMWB 1O2HA 4FUGA 5DKMA 4X2VA 2AGEX 1E35B 1FI8A 1EJAA 1HLTH 1GBFA 2R2WU 5DP4A 2C8XB 4K1SA 1Y5AT 1GVLA 1S85A 1E38B 3A81A 3DFJA 2F9PA 5A09A 2QXGA 3QDZB 1RIWC 3SO3A 1J16A 3TH3H 3KQDA 1EJNA 4CHAC 4I8GA 1HFDA 1O38A 1V2KT 1ZSKA 1SC8U 4JZIA 2OINA 2V35A 1W14U 1ZTKA 1C2DA 1TONA 3G01A 2HOBA 2GZ8A 1YYY1 3F9GA 2BZAA 2NWNA 5AFZH 1HYLA 1EZSC 2A32A 5EW2H 3RUOA 4BTTB 1QB9A 1ZRKA 2H1UA 1N8OC 4TPIZ 1AB9C 3TNTA 5C2ZA 1E34B 1B0EA 5DP8A 3RLWH 1EAIA 2CXVA 3RXEA 1N6XA 2QAAA 2GKVE 1A46H 5JYIA 4NSYA 1WTHD 3RMNH 4IC6A 1GMDF 1G3DA 2FXRA 4H6SB 1F0SA 2XBXA 3ZZ6A 3RM2H 2GCTC 5T6FA 1A3BH 2CV3A 1GVZA 1UTNA 2Z9LA 1C1WH 1G2MA 3GCOA 2STBE 4NA7A 2WINI 4Q7YA 2HNTF 3TJNA 5JBCS 1H1BA 1TNIA 4WVPE 3A83A 1EUFA 2VU8E 2JKHA 4D7GA 4MVNA 1TBQH 3H5CB 1J15A 4K5ZA 1A5HA 1HAVA 1P02A 2R9PA 3F6UH 4ABJA 2GMTB 1ARBA 3VGCC 2ODYB 3U1IB 3HKIB 3PYHA 1NC6A 2ZKSA 3E0PB 4CR9A 4ABFA 2OBOA 3Q3YA 1ETSH 2ODPA 1LPKB 1KLIH 2ZP0H 4GHTA 1ZPBA 1TNHA 4Y7AA 3T27A 2A5KA 4Y8XA 1O3IA 2H2ZA 1SR5C 5EW1H 2XWBI 1G36A 1A4WH 1RTFB 1XXDA 2FOMB 4CH8B 7KMEH 1A0LA 1ZOMA 3UNRA 1C5ZB 1G3BA 1TABE 2CHAC 1FLEE 3F9FA 2R3UA 3QWCH 4CRCA 4AN7A 1Z1IA 1V2NT 2Y81A 3MU5A 1IQHA 3P17H 1TBZH 2EI7A 1AI8H 2DE8A 1UTOA 5L2ZH 1UTJA 3OYPA 4X2WA 5A0BA 2XW9A 4ABDA 2C8WB 5I25A 2SGAA 1GI7B 1HAGE 3N7OA 1HJAB 3BTGE 3PMJA 3A8CA 1SHHB 1VZQH 4MDSA 1T7CA 1V2RT 1C1NA 1ZGIA 3SUFA 5EPYA 3M37A 1C1MA 1GG6B 1AVGH 3SI3H 1C2LA 4BAMB 4ABHA 4ZKRU 4FUHA 1DITH 2BD5A 3RC4A 1LKAA 1QTFA 1EPTA 2HWLB 8ESTE 1ZPCA 3P92A 1CSOE 1ORFA 5E2OA 3RXIA 2A5IA 3SV6A 2ZNKH 4Q7XA 4A1VA 2PSYA 3A7TA 3T25A 1GI8B 1GCDA 2FOEA 1DXPA 4X1NU 4WMEA 2Z3DA 3RXMA 1GMCG 5C1YA 1GBTA 3I77A 1WYKA 1FXYA 3GCNA 1SGYE 3A7ZA 2Q6DA 2AS9A 2OTVA 1MZDA 1ELVA 3LH1A 1CT0E 5E0HA 3Q3XA 3A85A 2ESTE 3RXJA 3M5NA 4NG9H 4ZKOU 1OWHA 1K21H 4Y79A 4ISLA 1LHCH 3TK6A 5E2PA 5L30H 1ZHPA 4D76A 2BD2A 1Y8TA 4A6LA 1V2LT 1TPSA 3LH3A 2FI5E 1UHBB 1A2CH 1O5FH 2BX4A 1QRWA 2VWLA 1O3NA 2BLQA 4IMZA 4JYVH 1P04A 1BBRH 3W94A 1KXCA 1RD3B 5HGGA 2STAE 4WMDA 2IOTA 4X8SH 4ZKSU 2C93B 1EAWA 1ACBE 4J2YB 4AOQA 1DWDH 5TCCA 3UWJH 1FQ3A 1AWHB 4WH6A 1ELTA 1SFQB 1RIWB 1CT4E 4CHAB 2IPHA 1BTZA 1UVSH 1HJ8A 2YOLA 2A4OA 3A8DA 1ZTLA 1K9OE 1L1JA 3SI4H 3SOSA 3DFLA 3HATH 1QNJA 3TJVA 1Z8IB 3K9XB 3DD2H 4X8TH 2G00A 1NN6A 1O30A 2P59A 1CA8B 2GP9B 2Z9JA 1F92A 2ZPRA 1FNIA 3M7TA 2ZDLA 1LQDB 1N8OB 1AB9B 1QL7A 3MH6A 4AG2A 1UK3A 2P93A 5F6MA 1C5TA 1ZHMA 5FBIA 2HLCA 1K1MA 2WV5A 1TOMH 5JDUB 3GOVB 3ZZ9A 3M5OA 3SU1A 2WPMS 3LT3A 1V3XA 2GCTB 1G32B 1OP8A 5C67A 4DW2U 1O2RA 2PHBA 5DK1A 5GCHF 5ESTE 2SGEE 1AFEH 1GI6A 3P8NA 4I8KA 1O37A 2EC9H 1YPLH 1O5AB 1UTKA 2ZFPH 3MH7A 2F9VA 4AX9H 1MH0A 1A0JA 4NZQA 4CRGA 1C5OH 1TNLA 3PWCA 4INLA 1UVTH 1MBMA 1YP9A 3RXKA 1CU1A 2ANMH 2WPIS 2F9NA 4OS7A 4U30A 2LNCA 1EXFA 3UTUH 1UCYE 2VWMA 3MU4A 2IN2A 3LGUA 1L2EA 2PSXA 3VGCB 1GWAA 1Q2WA 3A7WA 1A0HB 3R0FA 2ZZUH 1SPJA 5C1XA 2V6NA 4B75A 1DE7H 4BXWA 4K3JA 2ZQ1A 4OS6A 1E37B 1ESTA 2UUKB 3IWMA 1GHXH 2ZG0H 1GJ4H 4I33A 1TPPA 1BZXE 4YOIA 3SBKA 4DG4A 5DP7A 1GGDC 1HAZB 2CHAB 2GTBA 6CHAC 1QRXA 3BIVH 1V2JT 4ABAA 4A1TA 1FAXA 3RXHA 3TIUA 4F4OC 2CMYA 1Z8JB 1NRQH 1KSNA 1P8VC 3RXRA 1EAUA 3BTDE 4KELA 1K1IA 2Z94A 5BRRE 3RU4D 1FONA 1JMOH 1UTMA 3RXUA 3RXOA 4R0IA 4JK5A 4GVUA 3PLPA 1P09A 1C5XB 1QJ7B 1SGFG 1SVPA 1TMUH 5ETXA 4U2WA 3ESTA 3LGIA 3A7YA 1C5SA 1YPHC 2J92A 4FU7A 4A1XA 3LONA 1Y3VA 3SQHE 1OKXA 5LPEA 3FZZA 1BTYA 1CBWC 2O8WA 1P2JA 3DA9B 3QO6A 1C5PA 1EJMA 3B23B 3W95A 3ATIA 1MQ5A 1C5LH 4DIHH 1VGCC 1W0ZU 4DOQA 5GJ4B 1CT2E 3SV8A 3NPSA 2OCVB 3ODFA 4WF8A 1P2MA 1XMNB 5GIBA 2FX4A 1C5YB 4ZHMU 1C1QA 1DY8A 4ABGA 4VGCC 1TX8A 2A1DB 2R0KA 2JH0D 2RG3A 1XUIA 7GCHG 4Y6DA 1TIOA 1L0ZA 3LGYA 4UFEH 2FYQA 4IW4E 3QZRA 1K28D 1WAYB 3NWUA 1KXDA 2GV7A 4B2BA 4X6PA 1DLKB 4KTUA 2BY6X 1DPOA 2XBVA 2ZU3A 4JYUH 1EQ9A 4X6MA 1P2IA 3BEIB 4ISOA 2QXIA 1EOJA 3MNBA 3V12A 4FXGH 4O3UA 3B8JA 1GL0E 3STJA 5C1UA 3ENSB 2Z9GA 1W10U 4NA9H 1PFXC 5CHAC 1FPCH 3UWIA 1L4DA 1QQ4A 4Q80A 2QIQA 1DICA 4Y10E 4JCNA 5JPMH 5EXLA 2EI8A 2GDDA 2Y7XA 2GZ9A 2H9TH 3PB1E 5E0JA 5GPIB 1TNGA 2A5AA 3GYLB 3K6YA 1ZJDA 4CREA 2F9OA 1O5CB 4RN6A 1ELBA 1V2TT 1LO6A 3SU4A 4AZ2B 3TK5A 1AE5A 2VVUA 1RS0A 1SGPE 3UOPA 5CE1A 1IQLA 3GDSA 1GI1A 2NU0E 3AVZA 3BTFE 2GX4A 4NIWA 1H8DH 1P06A 2ANKH 5EQSA 1C2FA 2FTLE 1HXEH 2Y6TA 1ZSLA 1XVMA 4TWWA 2TGDA 1MQ6A 1ZSJA 4YTAA 1DSUA 2FDAA 3SW2B 1Y3WA 1HB0B 1MKXK 1TMBH 2ZTYA 3P95A 1B0FA 1H4WA 1SL3A 2BYAX 2F3CE 1LDTT 1RXPA 3O8CA 3SZNA 1O35A 3T62A 1YPEH 1PQ8A 2BY8X 3QGNB 4F49A 1ELDE 4AGJA 4FUFA 4KKDA 2D2DA 3RU4T 3ITIA 4I8JA 3TPIZ 1HAOH 4GPGA 1T32A 3U8RH 1CHOG 2THFB 2FOFA 1ZYOA 1MTWA 3A8AA 1BJVA 1WV7H 2BDHA 1C2JA 1JRSA 1N6YA 1SG8B 2VIDA 4YESB 4AFSA 4AG1A 3BG4C 1F5LA 4BNRA 3F1SB 3UQOA 4JZDH 1F5KU 1PPGE 3ZV9A 2ZGBH 3IITA 3S9BA 4TY7A 1XUGA 3HGNA 3CP7A 1SLVB 1MCVA 4JK6A 2AIQA 2BVRH 5DGJA 2A2XH 1VJ9U 1KTTB 5TJXA 1Y3UA 4CR5A 2BTCE 1OXGA 2CF8H 4JZFH 2BDYA 1IOEA 1MUEB 2UUJB 2AEIH 1GGDB 1ZLRA 3BIUH 4X2XA 3BTWE 2F9BH 3D49H 6CHAB 3LGWA 1EASA 3M7QA 4NIXA 3AAUA 4X1PU 1S0RA 3ZVBA 5F8ZA 1B5GH 5FX6A 1P05A 1BRBE 1QIXB 1THPB 2J2UA 1D3TB 1NPMA 1B7XB 1C1SA 1QRZA 4B2AA 1FY5A 1TLDA 1LHEH 3VB7A 1IAUA 3FP8E 1NZQH 2O8UA 3T26A 3SHAH 1BMMH 1GJ9B 3LKWA 1CBWB 2FLRH 2V3OH 3LPRA 1SGEE 1AU8A 1C1OA 2P16A 2QV1A 1NROH 1ELAA 3L6PA 3LJJA 2ZTXA 2ZFFH 2BMGB 1VGCB 2XRCA 4H42U 4THNH 1GBDA 1O2WA 1BTWA 1FPHH 1O2VA 3SJ9A 2Y5HA 5EG4A 3MU1A 3RXQA 2Q1JA 4YO9A 4NIVA 2ZQ2A 3M5MA 3R3GB 4FUCA 1AKSB 3WY8A 2OC1A 4VGCB 4UEHH 1BMNH 4X1RU 1UHBA 4MNVA 3ZV8A 1GMCF 3OU0A 2A7HA 1OWIA 1NRSH 1C4V2 2V3HH 3QTVH 1MKWK 1CE5A 1C9PA 1FMGA 1PPZA 3SNDA 4MTBA 2CN0H 3FAOA 1YM0A 4PROA 3IG6B 5JBAS 3SORA 4XBBA 4U01A 1O3AA 1XUHA 1O36A 2NU3E 1UCYK 1LHGH 4UFGH 4E7NA 1U6QA 2BLOA 1UK4A 2W3IA 1KY9A 1V2VT 3QTOH 1BMAA 1W3CA 5CHAB 2TGPZ 5DG6A 4RKOB 1D4PB 1SGIB 4Y8ZA 5IDKA 3TU7H 1QL9A 1O2SA 2BHGA 1GJ8B 2PUQH 2UUFB 1OP0A 2PTCE 2H5DA 1ESBA 1UO6A 1UTPA 4MPWA 4JMYA 2O9QA 5LPFA 4JZ1A 5TCAA 1NRPH 5DP5A 1TRYA 1IQMA 1K1OA 1F0UA 4FVDA 1FV9A 2A4GA 4ZH8A 1ZMNA 1YPKH 1V6DA 3QK1A 4KP0A 7ESTE 2BVSH 1AFQC 2BQ7B 1WBGB 2ZCLP 5HYOA 3RXSA 1DUEA 1P3EA 1C1RA 1AD8H 4NFFA 1PPHE 1P12E 4U32A 1D6WA 4DT7B 1BDAA 4TPYA 1O3BA 2ZGHA 1LHDH 1A7SA 3EE0B 4JZEH 1IQFA 3ZYDA 5GXPA 3BTHE 3A89A 1K1JA 1DWEH 1J8AA 2ZU2A 1DT2A 3ZVDA 3UOUA 2P3TB 3UREA 2ALPA 1T8MA 1O39A 3F9EA 1O3KA 4E05H 4ZKNU 5JB8S 1Y59T 1SFIA 4AFQA 1ANBA 4DIIH 3KHVA 1SGNE 3RM0H 2BM2A 1MKXH 3LGVA 4I31A 2BD4A 3SQEE 1HV7A 2BXTH 1BMLA 1QHRB 3BN9A 4LK4A 3MHWU 5EU8A 5J4SA 3BG4B 3AW1A 1DM4B 2O8TA 1FN6A 1MMJN 3GYMA 4ZXYH 5F8TA 4BAQB 1NU7B 1AHTH 1UMAH 1O2GH 1YCPK 1QBNA 4K60A 1JBUH 1CGIE 2BZ6H 4BOHA 1BTPA 4Y11E 2JETC 1UTQA 3QZQA 1H9IE 1ZHRA 2Z7FE 5DPAA 2ALVA 2PUXB 1MTUA 2AYWA 4I8HA 1D3DB 1O3GA 3MU8A 1UVOA 1BITA 1C9TA 5GWZA 3U1JB 2G52A 3GY3A 3BG8A 2FIRH 3A80A 2VH6A 2AMPA 2TIOA 2BD9A 5ESBA 4AGKA 1CQQA 3A86A 3T5FH 1LQEA 3PLBA 3QGJA 1NESE 3DT0H 1BTHH 1GHBG 4Z0KA 2PR3A 1Q31A 5FPTA 4CRFA 1W11U 4AFUA 1SMFE 2H9HA 4AB9A 1BTUA 3ZZCA 1K1NA 2A7JA 5FXLA 4Y71A 2NU2E 3OY6U 2G51A 1P2OA 1TA2A 1HRTH 1YKTA 5FBEA 4CRDA 1QFKH 1TA6A 3OX7U 2W26A 2PV9B 2ULLA 1UK2A 1A3EH 1O2XA 3PV4A 2WYGA 1YLDA 1W12U 2H6MA 2GDEH 1TYNA 3M3TA 1V2UT 1MBQA 2BD3A 3HGPA 5LPRA 1YPMH 3AASA 1IQNA 2TGAA 1DXWA 4TY6A 5F8XA 5A0AE 1LVYA 1HAYB 2PFEA 1P9UA 2A7CA 1YC0A 1PPEE 1Z8GA 3T28A 4SGAE 3E16B 1BRUP 1O3OA 4H6TA 1O2UA 4AB8A 3T2NA 2BDIA 1GDQA 1D9IA 1DFPA 1TFXA 3EDXB 7GCHF 2P94A 1GJ5H 1LVBA 1TRNA 3OSYA 1ZMJA 3K6ZA 1BHXF 5A2MH 1VITG 5EXNA 3SUDA 3EYDA 4R8TB 2Z6BD 2J9NA 5AFYH 5I46H 4X0WU 2RA0A 3GDUA 3H7OA 3M36A 1GL1A 4LXBH 1THRH 1MKWH 4ISHH 2A0QB 2VINA 4X8UH 1NRRH 3KF2A 3FFGA 1T4UH 1TGNA 1TE0A 1QA0A 4D9QA 2QCYA 1HAHH 3NK8A 2VVVA 2FM2A 2ZDMA 4UFDH 2BQ6B 2ILNA 2VIVA 4DCDA 1O3JA 1LCYA 1SGCA 1UCYH 1S81A 3A87A 4WH8A 1TQ0B 3RMOH 3SU0A 1TNKA 2EI6A 1EB2A 3ZZDA 4YOGA 1HAIH 2BDBA 1BA8B 2ZWLH 1KLTA 2FS8A 2VH0A 1NFXA 2CGAA 2EA3A 4FUBA 2ZDVH 1AFQB 1IQKA 1YF4A 1YPGH 3GCTF 8KME2 3GCHC 3ZVAA 1ETTH 4CBOA 4WY3A 2SGPE 5C5NA 1PQAA 1ZJKA 2FTMA 1VCPA 3SV9A 2WPLS 4FVBA 1TB6H 2BOKA 1GI0A 4OS5A 2IJOB 1WOFA 1AWFH 1QCPA 2FP7B 4ZMAH 3TH4H 4GLYA 1ZMLA 1DS2E 2ZECA 1OWKA 5J4QA 2QA9E 2WPKS 1K22H 2GZ7A 3BEFB 4IN1A 1O2YA 3TH2H 2RDLA 2H5CA 1M9UA 1DVAH 1AZ8A 1O5EH 1GBLA 1RJXB 1TRMA 4WMFA 3MH4A 5JBBS 3MTYA 3ZZ3A 1FIZA 3LIWA 3V7TA 3SNEA 1CHOF 4HI3A 4GCHG 3SU3A 1O3PB 1TMTH 3GY4A 3ATMA 4MNXA 4HTCH 2XCNA 1YPJH 3SGBE 2ZHDA 1GVKB 3ZZ5A 2ZHWH 1AY6H 1MAYA 2JETB 2ANYA 3O8DA 3K65B 4GHQA 5EOKA 1O5DH 2XCFA 4DY7B 1PQ5A 3TNSA 1VJAU 3KL6A 1OWDA 3ZZBA 4FU8A 3CS7A 5F03A 4IMQA 3RC6A 1BRAA 8GCHG 3O8RA 2KAIA 1YCPH 1QB1A 3S9CA 3SV2H 1GI9B 1KXBA 4BANB 1Z71A 2ODQA 3SGAE 3S7HB 2VIPA 5EODA 1DWCH 3MOCA 3AAVA 1QR3E 4D9RA 3HK6B 3MI4A 1ARCA 2VVCA 1TPAE 2ZU4A 1AGJA 1VR1H 3MYWA 1O2IA 1O2KA 3RXDA 1NTPA 2ZHEH 1BB0B 3D23A 5BPEA 3KQBA 5FCRA 3P8OA 2J4IA 2O8LA 2P8OC 1QBVH 1NFWA 4TYDA 1G30B 3S9AA 3RP2A 5L6NH 1BCUH 1S6FA 1AKSA 2WV4A 3M5LA 1HJ9A 4A92A 2ZHQH 1ABIH 3EA8A 4NZLA 2F9UA 1S84A 1WU1A 1AO5A 5HMAA 4ABEA 4X2YA 2PKAB 1GBKA 2PW8H 3I29A 1LKBA 3KGPA 4AYVB 1NS3A 3SNAA 3UPEA 2AERH 2DUCA 3SJOA 2BDCA 4NCYA 2WPHS 2AMDA 2C3SA 2OLGA 4MPVA 2RCEA 1AE8H 1C5RA 2ZFTA 3GCTG 2GV6A 1BIOA 3S0NA 4UDWH 3RC5A 1BTXA 1FY1A 4XBDA 7LPRA 5DO4H 3GISB 2GD4B 5SGAE 1K1LA 5A0CA 5HXFA 4LZ4B 1VCWA 1EP5A 1P10A 2GT7A 2AGGX 3SUGA 1C2MA 1SGQE 2ZFSA 4H4FA 1FUJA 4IS5A 3U8TH 1H9HE 2Z3EA 4Y7BA 1L4ZA 1Y3XA 2J95A 3DUXH 2ZFRH 1P9SA 5K0HA 1AVXA 1DOJA 4I8LA 1EOLA 2B0FA 1J17T 4MPUA 4UD9H 3A7XA 2P95A 1WCZA 3A7VA 1P2NA 3SJ8A 1PQ7A 1CVWH 3V0XA 2XWAA 6LPRA 1F2SE 4D7FA 4YM9A 3UFAA 2OQUA 1LPZB 3RXPA 3MH5A 2XC4A 1L1GA 2TBSA 5K7RA 2G55A 3E90B 1YGCH 1EX3A 3M7UA 3GCHB 5FHTA 1YCPM 4KTCA 4FUJA 3LJOA 2BLVA 1SHYA 6ESTA 1P0SH 1C5MD 1OYTH 1WTGH 1DLEA 1DANH 1C2IA 2TGTA 3P6ZB 4ISIH 4BAKB 2BVXH 4GUXA 2Y82A 5C5OA 1QJ1B 2DE9A 4ZXXH 1O3FA 3M3VA 4RSPA 1MU8B 1XUFA 2BY7X 1MZAA 1FJSA 4INKA 3EA7A 3S7KB 1KDQB 3F9HA 5HM9A 1P3CA 2VIQA 1GI2A 3RXTA 3KIDU 2OC8A 1NM6A 1O3MA 3DHKH 3MO9A 1C2GA 3SU5A 1NY22 3M3SA 1HIAB 1O3LA 1C1UH 4KTSA 2QF3A 1MD8A 1Z6JH 4ABIA 3QX5H 1NU9A 1DY9A 2KAIB 4CRAA 1OP2A 4B74A 5C3NA 1MTVA 1AUTC 3FANA 3ODDA 4IBLH 2JH5D 2PGBB 4ZHLU 1QY6A 1OSSA 1GBAA 4X6NA 1C2EA 2VNTA 5FAHA 3PM3A 2FODA 1O2NA 5EQQA 1GHAG 2ANWA 2PTNA 2D8WA 4ASHA 4IGDA 3PTBA 4HZHA 4DURA 1OOKB 3ATKA 1GI3A 3VB3A 1SB1H 2VJ1A 1GJ7B 1GBJA 2BY9X 3SUEA 1A1RA 1GJ6A 3TITA 1SGFA 2FOBA 2SGFE 2R0LA 1GBEA 1O3DA 1QL8A 1GBIA 1MTNC 1SLXB 1QBOA 1GHZA 4SGBE 4BXSA 2AFQB 3TGJE 2SNWA 3VB6A 1G37A 3U98H 1ANCA 3M35A 3ZYEA 3LDXH 4MNYA 1SBWA 1S6HA 3RLYH 1GJAB 3HPTB 1N1LA 5T6DA 1RRKA 2SNVA 4CH2B 1GHBF 2G4UA 2P8OB 1P2KA 5A8XA 3RXLA 3NXPA 4AFZA 1S0QA 2C90B 3ZVFA 1Z6EA 3KQCA 2OC0A 2ASUB 1HXFH 1P57B 2P3UB 1OWJA 1HNEE 2RA3A 1XKAC 5LH8A 5T3HA 4ESTE 2B9LA 3STIA 5H4IB 4OS1A 1GHYH 3U8OH 2BDGA 2FZZA 1TOCB 1FZZA 2GGVB 3T29A 1RGQA 1C4U2 4ISNA 2ZDNA 1CA0C 1L1NA 3ZVGA 4NSVA 1D3QB 4ZAEA 1C4Y2 1ABJH 1VITH 2HNTE 3GY6A 1S82A 4ZUHA 1XX9A 4XOJA 3K2UA 1S5SA 1YLCA 2ZPQA
chains in the Genus database with same CATH superfamily
5B6OA 1FY3A 5GDSH 4E06H 3ELAH 9LPRA 1O3EA 2BDAA 2I6QA 2GCHG 9ESTA 1H8IH 1XUJA 1CGHA 4AORA 4K8YA 4NWLA 1C5VA 1GCTC 2QXHA 3PRDA 1AN1E 1VITF 3Q77A 1QURH 3RXGA 1A5IA 3AK5A 1OPHB 2ZDKA 4K1EA 5E0GA 3ATWA 3PTNA 2EEKA 3PROA 2UWOA 2FWWA 2VIOA 2Z9KA 1HGTH 2NU1E 1XM1A 5EJ1A 1WUNH 3SGQE 2PKSC 3E91A 1T31A 4FUDA 1NFUA 3UR9A 1K2I1 4ZROA 3RMLH 1G2LA 4B71A 2F43B 1PPBH 3MO3A 3RXFA 2C8YB 2WYJA 1KLJH 2BY5X 4BAOB 4Q7ZA 1HDTH 1MU6B 4LZ1H 1C1TA 2FI4E 4OM9A 1Y3YA 5LGOA 4X1SU 5AHGH 1D6RA 1EB1H 1EPTC 1FDPA 3I78A 4B1TA 4Y0YE 2XC5A 1O3CA 3L3TA 1QA7A 1ELFA 1JOUB 3SNBA 2FS9A 4X8VH 1FN8A 1KXAA 2QYIA 2HALA 3PO1C 3SJIA 1GI5A 1O34A 4I32A 1JIMA 3RMMH 3ZVEA 1C2KA 1TWXB 2KCPA 1DUAA 1IQGA 1PYTC 1NFYA 3BTME 3MNCA 1SOTA 2LPRA 3LU9B 2BD8A 2BLWA 2WUCA 4TT3D 1J9CH 1EP6A 1TAWA 1XVOA 1GBHA 4A5TS 1FAKH 3P8GA 2W7UA 1TX7A 1ELGA 1CO7E 2F83A 3C27B 1GDNA 1T8NA 2F91A 1LVOA 2GT8A 5F53A 1GBMA 4GCHF 4WWYA 2JH6D 1IQJA 4ACBA 2KFWA 3GDVA 2M5TA 4D8NA 1PJPA 2OXSA 2Y5FA 5PTPA 2IPQX 4Q2KA 3MNXA 1IHSH 1SSXA 1V2ST 3A84A 3JZ1B 5EGMA 2BX3A 4AYYB 2TRMA 2FYRA 1YBWA 2NU4E 1GMDG 1O0DH 2ZU1A 2FLBH 1TGCA 1EZUC 1JRTA 3OY5U 3ZVCA 3H7TA 1CGJE 2HVYB 3BTEE 2OQ5A 1W7GH 1MTNB 1ZGVA 4DVAU 1EKBB 2VWOA 8GCHF 4ABBA 2J38A 1C1VH 1SGRE 2ZI2H 3A82A 2HGTH 3MFJA 1MTSA 2SFAA 3VXEH 2YNBA 1BQYA 1MCTA 5JB9S 3SJKA 1BBRE 3TJUA 1BHXB 1IQIA 1A61H 5L2YH 1OS8A 5FPYA 4WXVA 1DWBH 5DP3A 2ZTZA 5DP9A 4K1TA 1TQ7B 3NCLA 3SHCH 3OTPA 2ZCKP 1TPOA 1ZPZA 2PKAA 3BV9B 4INHA 1DSTA 2W5EA 4RT0A 3KN2A 1AZZA 1FY8E 3NUMA 2ZGCA 3FVFB 3PLKA 5DP6A 5HM2A 2PLXA 3RDZA 3Q76A 2R2MB 1BOQA 3GY8A 1DX5M 5FCKA 2I6SA 4HGCA 1G3CA 2GVFA 3C1KA 1VCQA 1F7ZA 3ATLA 1NRNH 1KTSB 1SI5H 2TPIZ 3NKKA 1IQEA 1S83A 1O2MA 3UNSA 3TK9A 1G9IE 1MAXA 1QJ6B 4MPXA 3OAAD 2Y80A 1ZTJA 1CA0B 1HAVB 3HKJB 4XE4A 4BTUB 1JXPA 5CDFE 4B6EA 3VPKA 5C94A 3E6PH 4GAWA 2BXUH 1HAXB 1LPGB 3LC5A 1O32A 3D65E 1TX6A 1SQTA 3ZZ7A 2AMQA 2CF9H 1C5UA 1XKBC 2ZGJA 2ZF0H 1JIRA 4HG6A 4XSKU 1TALA 1UVUH 2G4TA 5EJZA 4Y8YA 1V2MT 3EQ0H 1JWTA 2J94A 3KQEA 1GCTB 4WXIA 3HK3B 3EGKH 1TGSZ 2B5TB 1TGTA 2VB0A 2PGQB 3DSOA 1O2QA 4IC5A 3RU4E 3MU0A 1P01A 3AW0A 1RFNA 1AQ7A 1HPGA 1KXFA 3MO6A 2XBYA 4P02A 5EXMA 3BEUA 1J14A 4K69A 1C2HA 4DGJA 3V3MA 1Y5UT 2W7SA 1EATA 1ANEA 3SN8A 2BD7A 3EAJA 2FOAA 2XOKD 5JBTA 3ZZ4A 2PKSB 2FX6A 4O3TA 1SQAA 1AUJA 2C4FH 4K8BA 1UJ1A 1P11E 4CRBA 1O2ZA 2G5NA 4NGAH 1F0RA 3PMBB 2QF0A 2ZO3H 3LGTA 3F0OA 4Y76A 1ZRBA 3E1XB 1BUIA 1TBRH 1W7XH 2UUYA 2Z3CA 3GY2A 1V2WT 1EPTB 1C5WB 5A8ZA 1SGTA 3KCGH 3E8LA 3MNSA 3NZIA 1BT7A 2BOHB 1KDQA 1O33A 1A5GH 1ELEE 2J34A 4OGYA 1PPFE 1T4VH 3M61U 2HPPH 4B2CA 2SGQE 5G4BA 4UONA 2FOCA 3PO1B 4DJZB 3A88A 2WPJS 2K1QA 4FUEA 4M7GA 1NT1A 1LHFH 2M2AA 1W0YH 1XXFA 2XTTB 2ZPSA 1HIAA 1W8BH 5KECA 4LOYH 1O2LA 3SNCA 4F48B 4XDEA 2VGCC 1GDUA 2G81E 1Z1JA 1C5QA 2ZIQH 4X1QU 3URCA 1NO9H 2FPZA 4JYTA 3SV7A 2FOHA 1FY4A 2ZA5A 3E3TA 4OS2A 3TGKE 1ESAA 1GJBB 3SU6A 5AF9H 3MMGA 2H9EH 3A8BA 5IYTA 2XNIA 2ZFQH 1SQOA 1AVWA 1QQUA 2ZGXH 3ZZAA 4O9VA 4OGXA 1T8LA 1RTLA 2ZHFH 3GY5A 1QGFA 2AGIX 2FOGA 3BTQE 4K2YA 4NWKA 1E36B 1EAXA 2FEQH 3LOXA 1TNJA 3KYFA 3O8BA 1THSH 3QN7A 3TJOA 1UVPA 2OP9A 2Y7ZA 5DJ7A 1T8OA 4XRNA 1GJCB 4FUIA 3UUZA 3UQVA 3B9FH 4MNWA 2G8TA 3Q00A 1GPZA 1OYQA 3PMAB 2HPQH 1QB6A 4YT7H 2ZCHP 1W13U 4KGAA 1GBCA 2OBQA 2OD3B 1SLWB 3RXVA 2LP6A 3VEQB 1F5RA 1PYTD 3FP7E 1W2KH 1V2PT 2AH4X 2HRVA 2UWLA 3CENA 6GCHF 1GMHF 1O5BB 1GHAF 1CHGA 1WSSH 1EZXC 2A45B 2D26C 2OUAA 1HAPH 3V13A 2SGDE 3OTJE 2Q6FA 5C20A 1INCA 1O2TA 5GCHG 3L33A 1MD7A 1O31A 1PPCE 3KNXA 3UNQA 4TWYA 2Q6GA 2D1JA 2HNTC 1O2JA 1GBBA 1UTLM 4Y0ZE 5ABWA 3TVJB 2CJIA 1C5NH 1DDJA 2HVXA 4NA8A 5E8EH 3LC3A 1BRCE 4WJG2 3GY7A 1OX1A 4E7RG 2FO9A 1HBTH 2PWXA 3VB5A 1AIXH 3PWBA 2W3KA 2QN5T 4XFQA 4ACAA 4BTIB 4Z6AH 3U28C 3BSQA 1SLUB 3VB4A 2GMTC 4IN2A 1C1PA 1SGDE 1GHWH 3U9AH 4A7IB 2ZDAH 1IHTH 1Y5BT 2QC2A 2A31A 2XXLA 4YZUA 1LTOA 4YT6H 1ETRH 1G3EA 1Z8RA 1Z7KA 1AMHA 1ZZZA 1KXEA 5A8YA 5AVDA 1P2QA 1V2QT 3FZDA 3PMHB 4X6OA 2OC7A 3ZZ8A 4UE7H 3KEEA 3Q3KA 1V2OT 3UR6A 2R3YA 1O2PA 2VWNA 1O2OA 2QY0B 1SOZA 2AIPA 1WQVH 1HUTH 4O03A 1VKYA 1YY3A 4NFEA 4I7YH 4XBCA 3QUMP 5EQRA 4B73A 1K1PA 1O3HA 3CS0A 2P3FH 1E0FD 2B8OH 3TLOA 2ZEBA 1ANDA 3VXFH 1KYNA 2Z9IA 2QXJA 4O97A 3N99A 3RXBA 1P03A 4HFPB 2GCHF 5T6GA 3E0NB 4MQAA 1F0TA 3P8FA 3U69H 2G5VA 4CBNA 1HJAC 2V0BA 3FP6E 3H09A 1OWEA 2K8IA 2VIWA 3BTKE 1EZQA 2XC0A 1RTKA 1GHVH 2A4RA 2B7DH 2Y5GA 4J1YA 8LPRA 1GG6C 3F68H 3TGIE 5EPNA 3SU2A 3UY9A 2XYAA 3EA9A 2FI3E 4YLUA 1H8ED 4FETA 5HIYA 3VFEA 2FESH 4OS4A 2C8ZB 1WQSA 3GICB 3BTTE 4UFFH 1GJDB 1O5GH 4YOJA 2BB4A 1ELCA 1ID5H 2ZC9H 5FX5A 1HCGA 1FIWA 2O8MA 1X7AC 2ZU5A 2YNAA 1H9LB 2XBWA 2A2QH 4FU9A 3BF6H 2WUBA 4RKJB 1LVMA 3URDA 3QLPH 4ASUD 2FMJA 5FPSA 4NIYA 1BBRK 4MG3A 5DN6D 1XUKA 6GCHG 3RXAA 3DSPA 4YLQH 1GMHG 1ZR0A 3UIRA 3MWIU 3S69A 2QGRA 2A4QA 4B76A 1D3PB 1Q3XA 4MLFB 2UWPA 1TGBA 4ZHAA 4QT8C 1YPHE 4BAHB 1KIGH 1BJUA 1GI4A 3D62A 3UAIC 5CMXH 2VGCB 3P70B 4AC9A 2BQWB 3JZ2B 4GSOA 3RXCA 1LMWB 1O2HA 4FUGA 5DKMA 4X2VA 2AGEX 1E35B 1FI8A 1EJAA 1HLTH 1GBFA 2R2WU 5DP4A 2C8XB 4K1SA 1Y5AT 1GVLA 1S85A 2JJ1D 3W1EA 1E38B 3A81A 3DFJA 2F9PA 5A09A 2QXGA 3QDZB 1RIWC 3SO3A 1J16A 3TH3H 3KQDA 1EJNA 4CHAC 4I8GA 1HFDA 1O38A 1V2KT 1ZSKA 1SC8U 4JZIA 2OINA 3CNRA 2V35A 1W14U 3ZIAD 1ZTKA 1C2DA 2YMSC 1TONA 3G01A 2HOBA 2GZ8A 1YYY1 3F9GA 2BZAA 2NWNA 5AFZH 1HYLA 1EZSC 2A32A 2K0QA 5EW2H 3RUOA 4BTTB 1QB9A 1ZRKA 5KGOA 2H1UA 1N8OC 4TPIZ 1AB9C 3TNTA 5C2ZA 1E34B 1B0EA 5DP8A 3RLWH 1EAIA 2CXVA 3RXEA 1N6XA 2QAAA 2GKVE 1A46H 5JYIA 4NSYA 1WTHD 5IK2D 3RMNH 4IC6A 1GMDF 1G3DA 2FXRA 4H6SB 1F0SA 2XBXA 3ZZ6A 3RM2H 2GCTC 5T6FA 1A3BH 2CV3A 1GVZA 1UTNA 2Z9LA 1C1WH 1G2MA 2J98A 3GCOA 2STBE 4NA7A 2WINI 4Q7YA 2HNTF 3TJNA 5JBCS 1H1BA 1TNIA 4WVPE 3A83A 1EUFA 2VU8E 3F2GA 2JKHA 4D7GA 4MVNA 1TBQH 3H5CB 1J15A 4K5ZA 1A5HA 4I86A 1HAVA 1P02A 2R9PA 3F6UH 4ABJA 2GMTB 1ARBA 3KQ5A 3VGCC 2ODYB 3U1IB 3HKIB 3PYHA 1NC6A 2ZKSA 3E0PB 4CR9A 4ABFA 2OBOA 3Q3YA 1ETSH 2ODPA 1LPKB 1KLIH 2ZP0H 4GHTA 1ZPBA 1TNHA 4Y7AA 3T27A 2A5KA 4Y8XA 1O3IA 2H2ZA 1SR5C 5EW1H 2XWBI 1G36A 1A4WH 1RTFB 1XXDA 2FOMB 4CH8B 7KMEH 4ZCNA 1A0LA 1ZOMA 3DSGA 3UNRA 1C5ZB 1G3BA 4RT1A 1TABE 2CHAC 1FLEE 1FX0B 3F9FA 2R3UA 3QWCH 4CRCA 4AN7A 1Z1IA 1V2NT 2Y81A 3MU5A 1IQHA 3P17H 1TBZH 2EI7A 1AI8H 2DE8A 1UTOA 5L2ZH 1UTJA 3OYPA 4X2WA 5A0BA 2XW9A 4ABDA 2C8WB 5I25A 2SGAA 1GI7B 1HAGE 2V7QD 3N7OA 1HJAB 3BTGE 3PMJA 3A8CA 1SHHB 1VZQH 4MDSA 1T7CA 1V2RT 1C1NA 1ZGIA 3SUFA 5EPYA 3M37A 1C1MA 1GG6B 1AVGH 3SI3H 1C2LA 4BAMB 4ABHA 4ZKRU 4FUHA 1DITH 2BD5A 3RC4A 1LKAA 1QTFA 1EPTA 2HWLB 8ESTE 1ZPCA 3OE7D 3P92A 1CSOE 1ORFA 5E2OA 3RXIA 2A5IA 3SV6A 3VG8A 2ZNKH 4Q7XA 4A1VA 2PSYA 3A7TA 3T25A 1GI8B 1GCDA 2FOEA 1DXPA 4X1NU 4WMEA 2HLDD 2Z3DA 3RXMA 1GMCG 5C1YA 1GBTA 3I77A 1WYKA 1FXYA 3GCNA 1SGYE 3A7ZA 2Q6DA 2AS9A 2OTVA 1MZDA 1ELVA 3LH1A 1CT0E 5E0HA 3Q3XA 2CK3D 3A85A 2ESTE 3RXJA 2QF4A 3M5NA 4NG9H 4ZKOU 1OWHA 5GNDA 1K21H 1W0JD 4Y79A 3FOAA 4ISLA 1LHCH 3TK6A 5E2PA 5L30H 1ZHPA 4D76A 2BD2A 1Y8TA 4A6LA 1V2LT 1TPSA 3LH3A 2FI5E 1UHBB 1A2CH 1O5FH 2BX4A 1QRWA 2VWLA 1O3NA 2BLQA 4IMZA 4JYVH 1P04A 1BBRH 3W94A 1KXCA 1RD3B 5HGGA 2STAE 4WMDA 2IOTA 4X8SH 4ZKSU 2C93B 1EAWA 1ACBE 4J2YB 4AOQA 1DWDH 5TCCA 3UWJH 1FQ3A 1AWHB 4WH6A 1ELTA 1SFQB 1RIWB 1CT4E 3MQKC 2JIZD 4CHAB 2IPHA 1BTZA 1UVSH 1HJ8A 2YOLA 2A4OA 3A8DA 1ZTLA 1K9OE 1L1JA 3SI4H 3SOSA 3DFLA 3HATH 1QNJA 3TJVA 1Z8IB 3K9XB 3DD2H 2YMSB 4X8TH 2G00A 1W0KD 1NN6A 1O30A 2J98B 1CA8B 2P59A 2GP9B 2Z9JA 1F92A 2ZPRA 1FNIA 3M7TA 2ZDLA 1LQDB 1N8OB 1AB9B 1QL7A 3MH6A 4AG2A 1UK3A 2P93A 3F2FA 5F6MA 3SYJA 1C5TA 1ZHMA 5FBIA 2HLCA 1K1MA 2WV5A 3SZEA 1TOMH 5JDUB 3GOVB 3ZZ9A 3M5OA 3SU1A 2WPMS 3LT3A 1V3XA 2GCTB 1G32B 1OP8A 5C67A 4DW2U 1O2RA 2PHBA 5DK1A 5GCHF 5ESTE 1COWD 2SGEE 1AFEH 1GI6A 3P8NA 4I8KA 5KEDA 1O37A 2EC9H 1YPLH 1O5AB 1UTKA 2ZFPH 3MH7A 2F9VA 4AX9H 2YMSD 1MH0A 1A0JA 4NZQA 4CRGA 1C5OH 1TNLA 3PWCA 4INLA 1UVTH 1MBMA 1YP9A 3RXKA 1CU1A 2ANMH 2WPIS 2F9NA 2WZQA 4OS7A 4U30A 2LNCA 1EXFA 3UTUH 1UCYE 2VWMA 4DT4A 3MU4A 4Z1MD 2IN2A 3LGUA 1L2EA 2PSXA 3VGCB 1GWAA 1Q2WA 3A7WA 1A0HB 3R0FA 2ZZUH 1SPJA 5C1XA 2V6NA 4B75A 1DE7H 3WWBA 4BXWA 4K3JA 2ZQ1A 4OS6A 1E37B 1ESTA 2UUKB 3IWMA 4TSFD 1GHXH 2ZG0H 2AHME 1GJ4H 4I33A 3FO8D 1TPPA 1BZXE 4YOIA 3SBKA 4DG4A 5DP7A 1GGDC 1HAZB 2CHAB 2GTBA 6CHAC 1QRXA 2JDID 3BIVH 1V2JT 4ABAA 4A1TA 1FAXA 3RXHA 3TIUA 4F4OC 2CMYA 1Z8JB 1NRQH 1KSNA 1P8VC 1YWUA 3RXRA 1EAUA 3BTDE 4KELA 1K1IA 2Z94A 5BRRE 3RU4D 1FONA 1JMOH 1UTMA 3RXUA 3RXOA 4R0IA 4JK5A 4GVUA 3PLPA 1P09A 1C5XB 1QJ7B 1SGFG 1SVPA 1TMUH 5ETXA 1NBME 4U2WA 3ESTA 3LGIA 3A7YA 1C5SA 1YPHC 2J92A 4FU7A 4A1XA 3LONA 1Y3VA 1E1RD 3OEED 1H8HD 3SQHE 1OKXA 5LPEA 3FZZA 1BTYA 1WXRA 1CBWC 2O8WA 1P2JA 3DA9B 3QO6A 1C5PA 1EJMA 3B23B 3PV5A 3W95A 3ATIA 1MQ5A 1C5LH 4DIHH 1VGCC 1W0ZU 4DOQA 5GJ4B 1CT2E 3SV8A 3NPSA 2OCVB 3ODFA 4WF8A 1P2MA 1XMNB 5GIBA 2FX4A 1C5YB 4ZHMU 1C1QA 1DY8A 4ABGA 4VGCC 1TX8A 2A1DB 2R0KA 2JH0D 2RG3A 1XUIA 7GCHG 4Y6DA 1TIOA 1L0ZA 3LGYA 4UFEH 2FYQA 4IW4E 3QZRA 1K28D 1WAYB 3NWUA 1KXDA 2GV7A 4B2BA 4X6PA 1DLKB 4KTUA 2LELA 2BY6X 1DPOA 2XBVA 2ZU3A 4JYUH 1EQ9A 4X6MA 1P2IA 4Q4LA 3BEIB 4ISOA 2QXIA 1EOJA 3MNBA 3OEHD 3V12A 2WSSD 1QZ8A 4FXGH 4O3UA 1OHHD 3B8JA 1GL0E 3STJA 5C1UA 3ENSB 2Z9GA 1W10U 4NA9H 1PFXC 5CHAC 1FPCH 3UWIA 1L4DA 1QQ4A 4Q80A 2QIQA 1DICA 2WPDD 4Y10E 4JCNA 5JPMH 5EXLA 2EI8A 2GDDA 2Y7XA 2GZ9A 2H9TH 3PB1E 5E0JA 5GPIB 3N7DA 1TNGA 2A5AA 3GYLB 3K6YA 2EQNA 1ZJDA 4CREA 2F9OA 1O5CB 4RN6A 1ELBA 1V2TT 1LO6A 3SU4A 4AZ2B 2W6ID 1AE5A 3TK5A 2VVUA 1RS0A 1SGPE 3UOPA 5CE1A 1IQLA 3GDSA 1GI1A 2NU0E 3AVZA 3BTFE 2GX4A 3KYGA 4NIWA 1H8DH 1P06A 2ANKH 5EQSA 1C2FA 5FL7D 2FTLE 1HXEH 2Y6TA 1ZSLA 1XVMA 4TWWA 2TGDA 1MQ6A 1ZSJA 4YTAA 1DSUA 2FDAA 3SW2B 1Y3WA 1HB0B 1MKXK 1TMBH 2ZTYA 3P95A 1B0FA 1H4WA 1SL3A 2BYAX 2F3CE 1LDTT 1RXPA 3O8CA 3SZNA 1O35A 3T62A 1YPEH 1PQ8A 2BY8X 3QGNB 3PV2A 4F49A 1ELDE 4AGJA 5C0UA 4FUFA 4KKDA 2D2DA 3RU4T 3ITIA 4I8JA 3TPIZ 1HAOH 4GPGA 1T32A 3U8RH 1CHOG 2THFB 2FOFA 1ZYOA 1MTWA 3A8AA 1BJVA 1WV7H 2BDHA 1C2JA 1JRSA 1N6YA 1SG8B 2VIDA 4YESB 4AFSA 4AG1A 3BG4C 1F5LA 4BNRA 3F1SB 3UQOA 4JZDH 1F5KU 1PPGE 3WW7A 3ZV9A 2ZGBH 3IITA 3S9BA 4TY7A 1XUGA 3HGNA 3CP7A 1SLVB 1MCVA 4JK6A 2AIQA 2BVRH 5DGJA 3UB0A 2A2XH 1VJ9U 1KTTB 5TJXA 1Y3UA 1K0HA 4CR5A 2BTCE 1OXGA 2CF8H 4JZFH 2BDYA 1IOEA 1MUEB 2UUJB 5EIYA 2AEIH 1GGDB 1ZLRA 3BIUH 4X2XA 3BTWE 2F9BH 3D49H 6CHAB 3LGWA 1EASA 2RDEA 3M7QA 4NIXA 3WWFA 3AAUA 4X1PU 1S0RA 3ZVBA 5F8ZA 1B5GH 5FX6A 1P05A 1BRBE 1QIXB 1THPB 2J2UA 1D3TB 1NPMA 1B7XB 4P00A 4FOUC 1C1SA 1QRZA 4B2AA 1FY5A 1TLDA 1LHEH 3VB7A 1IAUA 3FP8E 1NZQH 2O8UA 3T26A 3SHAH 1BMMH 1GJ9B 3LKWA 1CBWB 2FLRH 2V3OH 3LPRA 1SGEE 1AU8A 1C1OA 2P16A 2QV1A 1NROH 1ELAA 3L6PA 3LJJA 2ZTXA 2ZFFH 2BMGB 1VGCB 2XRCA 4H42U 4THNH 1GBDA 1O2WA 1BTWA 1FPHH 1O2VA 3SJ9A 2Y5HA 5EG4A 3MU1A 2OK5A 3RXQA 2Q1JA 4YO9A 4NIVA 2ZQ2A 4YXWD 3M5MA 3R3GB 4FUCA 1AKSB 3F3BA 3WY8A 1E1QD 2OC1A 4VGCB 4UEHH 4Q63A 1BMNH 4X1RU 1UHBA 4MNVA 3ZV8A 1GMCF 3OU0A 2A7HA 1OWIA 1NRSH 1C4V2 2V3HH 3QTVH 1MKWK 1UW7A 1CE5A 1C9PA 1FMGA 1PPZA 3SNDA 4MTBA 2CN0H 3FAOA 1YM0A 4PROA 3IG6B 5JBAS 3SORA 4XBBA 4U01A 1O3AA 1XUHA 1O36A 2NU3E 1UCYK 1LHGH 4UFGH 4E7NA 1U6QA 2BLOA 1UK4A 2W3IA 1KY9A 1V2VT 3QTOH 1BMAA 1W3CA 5CHAB 2TGPZ 5DG6A 4RKOB 1D4PB 1SGIB 4Y8ZA 5IDKA 3TU7H 1QL9A 3OFND 1O2SA 2BHGA 1GJ8B 2PUQH 2UUFB 1OP0A 2PTCE 2H5DA 1ESBA 1UO6A 1UTPA 4MPWA 4JMYA 2O9QA 5LPFA 4JZ1A 5TCAA 1NRPH 5DP5A 1TRYA 1IQMA 1K1OA 1F0UA 4FVDA 1FV9A 2A4GA 4ZH8A 1ZMNA 1YPKH 1V6DA 3QK1A 4KP0A 7ESTE 2BVSH 2KM0A 1AFQC 2BQ7B 1WBGB 2ZCLP 1KMHB 5HYOA 3RXSA 1DUEA 1P3EA 1C1RA 1AD8H 2KR7A 4NFFA 3EE7A 1PPHE 1P12E 4U32A 1D6WA 2W6JD 4DT7B 1BDAA 4TPYA 1O3BA 2ZGHA 1LHDH 1A7SA 3EE0B 4JZEH 1IQFA 3ZYDA 5GXPA 1E79D 3BTHE 3A89A 1K1JA 1DWEH 1J8AA 2ZU2A 1DT2A 3ZVDA 3UOUA 2P3TB 3UREA 2ALPA 1T8MA 1O39A 3F9EA 1O3KA 4E05H 4ZKNU 5JB8S 1Y59T 1SFIA 4AFQA 1ANBA 4DIIH 3KHVA 1SGNE 3RM0H 2BM2A 1MKXH 3LGVA 4I31A 2BD4A 5EJLA 3SQEE 1HV7A 2BXTH 1BMLA 1QHRB 3BN9A 4LK4A 3MHWU 5EU8A 5J4SA 3BG4B 3AW1A 1DM4B 2O8TA 1FN6A 1MMJN 3GYMA 4ZXYH 5F8TA 4BAQB 1NU7B 1AHTH 1UMAH 1O2GH 1YCPK 1QBNA 4K60A 1JBUH 1CGIE 5B6LA 2BZ6H 4BOHA 1BTPA 4Y11E 2JETC 1UTQA 3QZQA 1H9IE 1ZHRA 2Z7FE 5DPAA 2ALVA 2PUXB 1MTUA 2AYWA 4I8HA 1D3DB 1O3GA 3MU8A 1UVOA 1BITA 1C9TA 5GWZA 3U1JB 2G52A 3GY3A 3BG8A 2FIRH 3A80A 5DSFA 2VH6A 2AMPA 2TIOA 2BD9A 5ESBA 4AGKA 1CQQA 3A86A 3T5FH 1LQEA 3PLBA 3QGJA 1NESE 3DT0H 1BTHH 3F2HA 1GHBG 4Z0KA 2PR3A 1Q31A 5FPTA 4CRFA 1W11U 4AFUA 1SMFE 2H9HA 4AB9A 1BTUA 3ZZCA 1K1NA 2A7JA 5FXLA 4Y71A 2NU2E 3OY6U 2V3MA 2G51A 1P2OA 1TA2A 1HRTH 4F55A 1YKTA 5FBEA 4CRDA 1QFKH 1TA6A 3OX7U 2W26A 2PV9B 2ULLA 1UK2A 1A3EH 1O2XA 3PV4A 2WYGA 1YLDA 1W12U 2H6MA 2GDEH 1TYNA 3M3TA 1V2UT 1MBQA 2BD3A 3HGPA 5LPRA 1YPMH 3AASA 1IQNA 2TGAA 2L74A 1DXWA 4TY6A 5F8XA 5A0AE 1LVYA 1HAYB 2PFEA 1P9UA 2A7CA 1YC0A 1PPEE 1Z8GA 3T28A 4SGAE 3E16B 1BRUP 1O3OA 4H6TA 1O2UA 2XNDD 4AB8A 3T2NA 2BDIA 1GDQA 1D9IA 1DFPA 1TFXA 3EDXB 7GCHF 2P94A 1GJ5H 1LVBA 1TRNA 3OSYA 1ZMJA 2J97A 5HIZA 3F0PA 3K6ZA 1BHXF 5A2MH 1VITG 5EXNA 3SUDA 3EYDA 4R8TB 2Z6BD 2J9NA 5AFYH 5I46H 3FKSD 4X0WU 2RA0A 3GDUA 3H7OA 3M36A 1GL1A 4LXBH 1THRH 1MKWH 4ISHH 2A0QB 2VINA 4X8UH 1NRRH 3KF2A 3FFGA 1T4UH 1TGNA 1TE0A 1QA0A 4D9QA 2QCYA 3NRLA 1HAHH 3NK8A 2VVVA 2FM2A 2ZDMA 4UFDH 2BQ6B 2ILNA 2VIVA 4DCDA 1O3JA 1LCYA 1SGCA 1UCYH 1S81A 3A87A 4WH8A 1TQ0B 2WV9A 3RMOH 3SU0A 1TNKA 2EI6A 1EB2A 3ZZDA 4YOGA 1HAIH 2BDBA 1BA8B 2ZWLH 1BMFD 1KLTA 2FS8A 2VH0A 1NFXA 2CGAA 2EA3A 4FUBA 2ZDVH 1AFQB 4M9FA 1IQKA 1YF4A 1YPGH 3GCTF 8KME2 3GCHC 3ZVAA 1ETTH 4CBOA 4WY3A 2SGPE 5C5NA 2KX4A 1PQAA 1ZJKA 2FTMA 1VCPA 3SV9A 2WPLS 4FVBA 1TB6H 2BOKA 1GI0A 4OS5A 2IJOB 1WOFA 1AWFH 1QCPA 2FP7B 4ZMAH 3TH4H 4GLYA 1ZMLA 1DS2E 2ZECA 1OWKA 5J4QA 5T1VA 2QA9E 2WPKS 1K22H 2GZ7A 3BEFB 4IN1A 1O2YA 3TH2H 2RDLA 2VBCA 2H5CA 1M9UA 1DVAH 1AZ8A 3GS9A 1O5EH 1GBLA 1RJXB 1TRMA 4WMFA 3MH4A 5JBBS 2KZ4A 1MABB 3MTYA 3ZZ3A 1FIZA 3LIWA 1EFRD 3V7TA 3SNEA 1CHOF 4HI3A 4GCHG 3SU3A 1O3PB 1TMTH 3GY4A 1WDIA 3ATMA 4MNXA 4HTCH 2XCNA 1YPJH 3DCLA 3SGBE 2ZHDA 1GVKB 3ZZ5A 2WHXA 2ZHWH 1AY6H 2JETB 1MAYA 2ANYA 3O8DA 3K65B 4GHQA 5EOKA 1O5DH 2XCFA 4DY7B 4B6FA 1PQ5A 3TNSA 1VJAU 3KL6A 1OWDA 3ZZBA 4FU8A 3CS7A 5F03A 4IMQA 3RC6A 1BRAA 8GCHG 3O8RA 5CHBA 2KAIA 1YCPH 1QB1A 3S9CA 3SV2H 1GI9B 1KXBA 4BANB 1Z71A 2ODQA 3SGAE 3S7HB 2VIPA 2EY4C 5EODA 1DWCH 3MOCA 3AAVA 1NBMD 1QR3E 4D9RA 3HK6B 3MI4A 1ARCA 2VVCA 1TPAE 2ZU4A 1AGJA 1VR1H 3MYWA 1O2IA 1O2KA 3RXDA 1NTPA 2ZHEH 1BB0B 3D23A 5BPEA 3KQBA 5FCRA 3P8OA 2J4IA 2O8LA 2GJGA 1QBVH 2P8OC 1NFWA 4TYDA 1G30B 3S9AA 3RP2A 5L6NH 1BCUH 1S6FA 1AKSA 2WV4A 3M5LA 1HJ9A 4A92A 3PRBA 2ZHQH 1ABIH 3EA8A 4NZLA 2F9UA 1S84A 1WU1A 1AO5A 5HMAA 4ABEA 4X2YA 2PKAB 1GBKA 2PW8H 3I29A 1LKBA 2KCOA 3KGPA 4AYVB 1NS3A 3SNAA 3UPEA 2AERH 2DUCA 3SJOA 2BDCA 4NCYA 2WPHS 2AMDA 2C3SA 2OLGA 4MPVA 2RCEA 3FN8A 1AE8H 1C5RA 2ZFTA 3GCTG 2GV6A 1BIOA 3S0NA 4UDWH 3RC5A 1BTXA 1FY1A 4XBDA 7LPRA 5DO4H 3GISB 2GD4B 5SGAE 1K1LA 5A0CA 5HXFA 4LZ4B 1VCWA 1EP5A 1P10A 2GT7A 2AGGX 3SUGA 1C2MA 1SGQE 2ZFSA 4H4FA 1FUJA 4IS5A 3U8TH 1H9HE 2Z3EA 2QE7D 1L4ZA 1Y3XA 4Y7BA 2J95A 3DUXH 2ZFRH 1P9SA 5K0HA 1AVXA 1DOJA 2IJD1 4I8LA 1EOLA 2B0FA 1J17T 4MPUA 4UD9H 3A7XA 2P95A 1WCZA 3A7VA 1P2NA 3SJ8A 1PQ7A 1CVWH 3V0XA 2XWAA 6LPRA 1F2SE 4D7FA 4YM9A 3UFAA 2QF5A 2OQUA 1LPZB 3RXPA 3MH5A 2XC4A 1L1GA 2TBSA 5K7RA 2G55A 3E90B 1YGCH 2RFKC 1S6LA 1EX3A 3M7UA 3GCHB 5FHTA 1SQRA 1YCPM 4KTCA 4FUJA 3LJOA 2BLVA 1SHYA 6ESTA 1P0SH 4XD7D 1C5MD 1OYTH 1WTGH 1DLEA 1DANH 1C2IA 2TGTA 3P6ZB 4ISIH 4BAKB 2BVXH 4GUXA 2Y82A 5C5OA 1QJ1B 1YLNA 2DE9A 5C0TA 4ZXXH 1O3FA 3M3VA 4RSPA 1MU8B 1XUFA 2BY7X 1MZAA 1FJSA 4INKA 3EA7A 3S7KB 1KDQB 3F9HA 5HM9A 1P3CA 2VIQA 1GI2A 3RXTA 3KIDU 2JJ2D 2OC8A 1NM6A 1O3MA 3DHKH 3MO9A 1C2GA 3SU5A 1NY22 3M3SA 1HIAB 1O3LA 1C1UH 4KTSA 2QF3A 1MD8A 1Z6JH 4ABIA 3QX5H 1NU9A 1DY9A 2KAIB 4CRAA 1OP2A 4B74A 5C3NA 1MTVA 1AUTC 3FANA 3ODDA 4IBLH 2JH5D 2PGBB 4ZHLU 1QY6A 1OSSA 1GBAA 4X6NA 1C2EA 2VNTA 5FAHA 3PM3A 2FODA 1O2NA 5EQQA 1GHAG 2ANWA 2PTNA 5HKKD 2D8WA 4ASHA 4IGDA 3PTBA 4HZHA 4DURA 1OOKB 3ATKA 1GI3A 3VB3A 2KCYA 1SB1H 1GJ7B 1GBJA 2VJ1A 2BY9X 2F4LA 1A1RA 1GJ6A 3SUEA 1SGFA 3TITA 2FOBA 2SGFE 2R0LA 1GBEA 1O3DA 1QL8A 2PP6A 1GBIA 1MTNC 1SLXB 1QBOA 1GHZA 4SGBE 4BXSA 2AFQB 3TGJE 2SNWA 3VB6A 1G37A 3U98H 1ANCA 3M35A 3ZYEA 3LDXH 4MNYA 1SBWA 1S6HA 3RLYH 1GJAB 3HPTB 1N1LA 5T6DA 1RRKA 2SNVA 4CH2B 1GHBF 2KCAA 3N7EA 2G4UA 2P8OB 1P2KA 2J5UA 5A8XA 3RXLA 3NXPA 4AFZA 1S0QA 2C90B 3ZVFA 1Z6EA 3KQCA 2OC0A 2ASUB 1HXFH 1P57B 2P3UB 1OWJA 1HNEE 2RA3A 1XKAC 5LH8A 5T3HA 4ESTE 2B9LA 5C17A 3STIA 5H4IB 4RI0A 4OS1A 1GHYH 3U8OH 2BDGA 2FZZA 1TOCB 1FZZA 2GGVB 3T29A 1RGQA 1C4U2 1SKYE 4ISNA 2ZDNA 1CA0C 1L1NA 3ZVGA 4NSVA 1D3QB 4ZAEA 1C4Y2 1ABJH 1VITH 2HNTE 3GY6A 1S82A 4ZUHA 1XX9A 4XOJA 3K2UA 1S5SA 2L6OA 1YLCA 2ZPQA
chains in the Genus database with same CATH topology
5B6OA 1FY3A 5GDSH 4E06H 3ELAH 9LPRA 1O3EA 2BDAA 2I6QA 2GCHG 9ESTA 1H8IH 1XUJA 1CGHA 4AORA 4K8YA 4NWLA 1C5VA 1GCTC 2QXHA 1AN1E 1VITF 3Q77A 1QURH 3RXGA 1A5IA 1OPHB 2ZDKA 4K1EA 5E0GA 3ATWA 3PTNA 2EEKA 3PROA 2UWOA 2FWWA 2VIOA 2Z9KA 1HGTH 2NU1E 1XM1A 1WUNH 3SGQE 2PKSC 3E91A 1T31A 4FUDA 1NFUA 3UR9A 1K2I1 4ZROA 3RMLH 1G2LA 4B71A 1PPBH 3MO3A 3RXFA 2C8YB 2WYJA 1KLJH 2BY5X 4BAOB 4Q7ZA 1HDTH 1MU6B 4LZ1H 1C1TA 2FI4E 1Y3YA 5LGOA 4X1SU 5AHGH 1D6RA 1EB1H 1EPTC 1FDPA 3I78A 4B1TA 4Y0YE 2XC5A 1O3CA 3L3TA 1QA7A 1ELFA 1JOUB 3SNBA 2FS9A 4X8VH 1FN8A 1KXAA 2QYIA 2HALA 3PO1C 3SJIA 1GI5A 1O34A 4I32A 1JIMA 3RMMH 3ZVEA 1C2KA 1TWXB 1DUAA 1IQGA 1PYTC 1NFYA 3BTME 3MNCA 1SOTA 2LPRA 3LU9B 2BD8A 2BLWA 2WUCA 1J9CH 1EP6A 1TAWA 1XVOA 1GBHA 4A5TS 1FAKH 3P8GA 2W7UA 1TX7A 1ELGA 1CO7E 2F83A 3C27B 1GDNA 1T8NA 2F91A 1LVOA 2GT8A 1GBMA 4GCHF 4WWYA 2JH6D 1IQJA 3GDVA 2M5TA 4D8NA 1PJPA 2OXSA 2Y5FA 5PTPA 4Q2KA 5EGMA 3MNXA 1IHSH 1SSXA 1V2ST 3A84A 3JZ1B 4AYYB 2BX3A 2TRMA 2FYRA 1YBWA 2NU4E 1GMDG 1O0DH 2ZU1A 2FLBH 1TGCA 1EZUC 1JRTA 3OY5U 3ZVCA 3H7TA 1CGJE 3BTEE 2OQ5A 1W7GH 1MTNB 1ZGVA 4DVAU 1EKBB 2VWOA 8GCHF 4ABBA 2J38A 1C1VH 1SGRE 2ZI2H 3A82A 2HGTH 3MFJA 1MTSA 2SFAA 3VXEH 2YNBA 1BQYA 1MCTA 5JB9S 3SJKA 1BBRE 3TJUA 1BHXB 1IQIA 1A61H 5L2YH 1OS8A 5FPYA 4WXVA 1DWBH 5DP3A 2ZTZA 5DP9A 4K1TA 1TQ7B 3NCLA 3SHCH 2ZCKP 1TPOA 1ZPZA 2PKAA 3BV9B 4INHA 1DSTA 2W5EA 3KN2A 1AZZA 1FY8E 3NUMA 2ZGCA 3FVFB 3PLKA 5DP6A 5HM2A 2PLXA 3RDZA 3Q76A 2R2MB 1BOQA 3GY8A 1DX5M 5FCKA 2I6SA 4HGCA 1G3CA 2GVFA 3C1KA 1VCQA 1F7ZA 3ATLA 1NRNH 1KTSB 1SI5H 2TPIZ 3NKKA 1IQEA 1S83A 1O2MA 3UNSA 3TK9A 1G9IE 1MAXA 1QJ6B 4MPXA 2Y80A 1ZTJA 1CA0B 1HAVB 3HKJB 4XE4A 4BTUB 1JXPA 3VPKA 3E6PH 4GAWA 2BXUH 1HAXB 1LPGB 3LC5A 1O32A 3D65E 1TX6A 1SQTA 3ZZ7A 2AMQA 2CF9H 1C5UA 1XKBC 2ZGJA 2ZF0H 1JIRA 4XSKU 1TALA 1UVUH 2G4TA 4Y8YA 1V2MT 3EQ0H 1JWTA 2J94A 3KQEA 1GCTB 4WXIA 3HK3B 3EGKH 1TGSZ 2B5TB 1TGTA 2VB0A 2PGQB 1O2QA 4IC5A 3RU4E 3MU0A 1P01A 3AW0A 1RFNA 1AQ7A 1HPGA 1KXFA 3MO6A 2XBYA 5EXMA 3BEUA 1J14A 4K69A 1C2HA 4DGJA 3V3MA 1Y5UT 2W7SA 1EATA 1ANEA 3SN8A 2BD7A 3EAJA 2FOAA 5JBTA 3ZZ4A 2PKSB 2FX6A 4O3TA 1SQAA 1AUJA 2C4FH 4K8BA 1UJ1A 1P11E 4CRBA 1O2ZA 2G5NA 4NGAH 1F0RA 3PMBB 2QF0A 2ZO3H 3LGTA 4Y76A 1ZRBA 3E1XB 1BUIA 1TBRH 1W7XH 2UUYA 2Z3CA 3GY2A 1V2WT 1EPTB 1C5WB 5A8ZA 1SGTA 3KCGH 3E8LA 3MNSA 3NZIA 1BT7A 2BOHB 1KDQA 1O33A 1A5GH 1ELEE 2J34A 4OGYA 1PPFE 1T4VH 3M61U 2HPPH 4B2CA 2SGQE 5G4BA 4UONA 2FOCA 3PO1B 4DJZB 3A88A 2WPJS 2K1QA 4FUEA 4M7GA 1NT1A 1LHFH 1W0YH 1XXFA 2XTTB 2ZPSA 1HIAA 1W8BH 4LOYH 1O2LA 3SNCA 4XDEA 2VGCC 1GDUA 2G81E 1Z1JA 1C5QA 2ZIQH 4X1QU 3URCA 1NO9H 2FPZA 4JYTA 3SV7A 2FOHA 1FY4A 2ZA5A 3E3TA 4OS2A 3TGKE 1ESAA 1GJBB 3SU6A 5AF9H 3MMGA 2H9EH 3A8BA 5IYTA 2XNIA 2ZFQH 1SQOA 1AVWA 1QQUA 2ZGXH 3ZZAA 4O9VA 4OGXA 1T8LA 1RTLA 2ZHFH 3GY5A 1QGFA 2AGIX 2FOGA 3BTQE 4K2YA 4NWKA 1E36B 1EAXA 2FEQH 3LOXA 1TNJA 3O8BA 1THSH 3QN7A 3TJOA 1UVPA 2OP9A 2Y7ZA 5DJ7A 1T8OA 1GJCB 4FUIA 3UUZA 3UQVA 3B9FH 4MNWA 2G8TA 3Q00A 1GPZA 1OYQA 3PMAB 2HPQH 1QB6A 4YT7H 2ZCHP 1W13U 4KGAA 1GBCA 2OBQA 2OD3B 1SLWB 3RXVA 3VEQB 1F5RA 1PYTD 3FP7E 1W2KH 1V2PT 2AH4X 2HRVA 2UWLA 3CENA 6GCHF 1GMHF 1O5BB 1GHAF 1CHGA 1WSSH 1EZXC 2A45B 2D26C 2OUAA 1HAPH 3V13A 2SGDE 3OTJE 2Q6FA 5C20A 1INCA 1O2TA 5GCHG 3L33A 1MD7A 1O31A 1PPCE 3KNXA 3UNQA 4TWYA 2Q6GA 2D1JA 2HNTC 1O2JA 1GBBA 1UTLM 4Y0ZE 5ABWA 3TVJB 2CJIA 1C5NH 1DDJA 2HVXA 4NA8A 5E8EH 3LC3A 1BRCE 4WJG2 3GY7A 1OX1A 4E7RG 2FO9A 1HBTH 2PWXA 3VB5A 1AIXH 3PWBA 2W3KA 2QN5T 4XFQA 4BTIB 4Z6AH 3BSQA 1SLUB 3VB4A 2GMTC 4IN2A 1C1PA 1SGDE 1GHWH 3U9AH 4A7IB 2ZDAH 1IHTH 1Y5BT 2QC2A 2A31A 2XXLA 4YZUA 1LTOA 4YT6H 1ETRH 1G3EA 1Z8RA 1Z7KA 1AMHA 1ZZZA 1KXEA 5A8YA 5AVDA 1P2QA 1V2QT 3FZDA 3PMHB 4X6OA 2OC7A 3ZZ8A 4UE7H 3KEEA 3Q3KA 1V2OT 3UR6A 2R3YA 1O2PA 2VWNA 1O2OA 2QY0B 1SOZA 2AIPA 1WQVH 1HUTH 4O03A 4NFEA 4I7YH 4XBCA 3QUMP 5EQRA 4B73A 1K1PA 1O3HA 3CS0A 2P3FH 1E0FD 2B8OH 3TLOA 2ZEBA 1ANDA 3VXFH 1KYNA 2Z9IA 2QXJA 4O97A 3RXBA 1P03A 4HFPB 2GCHF 5T6GA 3E0NB 4MQAA 1F0TA 3P8FA 3U69H 2G5VA 4CBNA 1HJAC 2V0BA 3FP6E 1OWEA 2VIWA 3BTKE 1EZQA 2XC0A 1RTKA 1GHVH 2A4RA 2B7DH 2Y5GA 4J1YA 8LPRA 1GG6C 3F68H 3TGIE 5EPNA 3SU2A 3UY9A 2XYAA 3EA9A 2FI3E 4YLUA 3VFEA 2FESH 4OS4A 2C8ZB 1WQSA 3GICB 3BTTE 4UFFH 1GJDB 1O5GH 4YOJA 2BB4A 1ELCA 1ID5H 2ZC9H 5FX5A 1HCGA 1FIWA 2O8MA 1X7AC 2ZU5A 2YNAA 1H9LB 2XBWA 2A2QH 4FU9A 3BF6H 2WUBA 4RKJB 1LVMA 3URDA 3QLPH 2FMJA 5FPSA 4NIYA 1BBRK 4MG3A 1XUKA 6GCHG 3RXAA 4YLQH 1GMHG 1ZR0A 3UIRA 3MWIU 3S69A 2QGRA 2A4QA 4B76A 1D3PB 1Q3XA 4MLFB 2UWPA 1TGBA 4ZHAA 4QT8C 1YPHE 4BAHB 1KIGH 1BJUA 1GI4A 3D62A 5CMXH 2VGCB 3P70B 2BQWB 3JZ2B 4GSOA 3RXCA 1LMWB 1O2HA 4FUGA 5DKMA 4X2VA 2AGEX 1E35B 1FI8A 1EJAA 1HLTH 1GBFA 2R2WU 5DP4A 2C8XB 4K1SA 1Y5AT 1GVLA 1S85A 1E38B 3A81A 3DFJA 2F9PA 5A09A 2QXGA 3QDZB 1RIWC 3SO3A 1J16A 3TH3H 3KQDA 1EJNA 4CHAC 4I8GA 1HFDA 1O38A 1V2KT 1ZSKA 1SC8U 4JZIA 2OINA 2V35A 1W14U 1ZTKA 1C2DA 1TONA 3G01A 2HOBA 2GZ8A 1YYY1 3F9GA 2BZAA 2NWNA 5AFZH 1HYLA 1EZSC 2A32A 5EW2H 3RUOA 4BTTB 1QB9A 1ZRKA 2H1UA 1N8OC 4TPIZ 1AB9C 3TNTA 5C2ZA 1E34B 1B0EA 5DP8A 3RLWH 1EAIA 2CXVA 3RXEA 1N6XA 2QAAA 2GKVE 1A46H 5JYIA 4NSYA 1WTHD 3RMNH 4IC6A 1GMDF 1G3DA 2FXRA 4H6SB 1F0SA 2XBXA 3ZZ6A 3RM2H 2GCTC 5T6FA 1A3BH 2CV3A 1GVZA 1UTNA 2Z9LA 1C1WH 1G2MA 3GCOA 2STBE 4NA7A 2WINI 4Q7YA 2HNTF 3TJNA 5JBCS 1H1BA 1TNIA 4WVPE 3A83A 1EUFA 2VU8E 2JKHA 4D7GA 4MVNA 1TBQH 3H5CB 1J15A 4K5ZA 1A5HA 1HAVA 1P02A 2R9PA 3F6UH 4ABJA 2GMTB 1ARBA 3VGCC 2ODYB 3U1IB 3HKIB 3PYHA 1NC6A 2ZKSA 3E0PB 4CR9A 4ABFA 2OBOA 3Q3YA 1ETSH 2ODPA 1LPKB 1KLIH 2ZP0H 4GHTA 1ZPBA 1TNHA 4Y7AA 3T27A 2A5KA 4Y8XA 1O3IA 2H2ZA 1SR5C 5EW1H 2XWBI 1G36A 1A4WH 1RTFB 1XXDA 2FOMB 4CH8B 7KMEH 1A0LA 1ZOMA 3UNRA 1C5ZB 1G3BA 1TABE 2CHAC 1FLEE 3F9FA 2R3UA 3QWCH 4CRCA 4AN7A 1Z1IA 1V2NT 2Y81A 3MU5A 1IQHA 3P17H 1TBZH 2EI7A 1AI8H 2DE8A 1UTOA 5L2ZH 1UTJA 3OYPA 4X2WA 5A0BA 2XW9A 4ABDA 2C8WB 5I25A 2SGAA 1GI7B 1HAGE 3N7OA 1HJAB 3BTGE 3PMJA 3A8CA 1SHHB 1VZQH 4MDSA 1T7CA 1V2RT 1C1NA 1ZGIA 3SUFA 5EPYA 3M37A 1C1MA 1GG6B 1AVGH 3SI3H 1C2LA 4BAMB 4ABHA 4ZKRU 4FUHA 1DITH 2BD5A 3RC4A 1LKAA 1QTFA 1EPTA 2HWLB 8ESTE 1ZPCA 3P92A 1CSOE 1ORFA 5E2OA 3RXIA 2A5IA 3SV6A 2ZNKH 4Q7XA 4A1VA 2PSYA 3A7TA 3T25A 1GI8B 1GCDA 2FOEA 1DXPA 4X1NU 4WMEA 2Z3DA 3RXMA 1GMCG 5C1YA 1GBTA 3I77A 1WYKA 1FXYA 3GCNA 1SGYE 3A7ZA 2Q6DA 2AS9A 2OTVA 1MZDA 1ELVA 3LH1A 1CT0E 5E0HA 3Q3XA 3A85A 2ESTE 3RXJA 3M5NA 4NG9H 4ZKOU 1OWHA 1K21H 4Y79A 4ISLA 1LHCH 3TK6A 5E2PA 5L30H 1ZHPA 4D76A 2BD2A 1Y8TA 4A6LA 1V2LT 1TPSA 3LH3A 2FI5E 1UHBB 1A2CH 1O5FH 2BX4A 1QRWA 2VWLA 1O3NA 2BLQA 4IMZA 4JYVH 1P04A 1BBRH 3W94A 1KXCA 1RD3B 5HGGA 2STAE 4WMDA 2IOTA 4X8SH 4ZKSU 2C93B 1EAWA 1ACBE 4J2YB 4AOQA 1DWDH 5TCCA 3UWJH 1FQ3A 1AWHB 4WH6A 1ELTA 1SFQB 1RIWB 1CT4E 4CHAB 2IPHA 1BTZA 1UVSH 1HJ8A 2YOLA 2A4OA 3A8DA 1ZTLA 1K9OE 1L1JA 3SI4H 3SOSA 3DFLA 3HATH 1QNJA 3TJVA 1Z8IB 3K9XB 3DD2H 4X8TH 2G00A 1NN6A 1O30A 2P59A 1CA8B 2GP9B 2Z9JA 1F92A 2ZPRA 1FNIA 3M7TA 2ZDLA 1LQDB 1N8OB 1AB9B 1QL7A 3MH6A 4AG2A 1UK3A 2P93A 5F6MA 1C5TA 1ZHMA 5FBIA 2HLCA 1K1MA 2WV5A 1TOMH 5JDUB 3GOVB 3ZZ9A 3M5OA 3SU1A 2WPMS 3LT3A 1V3XA 2GCTB 1G32B 1OP8A 5C67A 4DW2U 1O2RA 2PHBA 5DK1A 5GCHF 5ESTE 2SGEE 1AFEH 1GI6A 3P8NA 4I8KA 1O37A 2EC9H 1YPLH 1O5AB 1UTKA 2ZFPH 3MH7A 2F9VA 4AX9H 1MH0A 1A0JA 4NZQA 4CRGA 1C5OH 1TNLA 3PWCA 4INLA 1UVTH 1MBMA 1YP9A 3RXKA 1CU1A 2ANMH 2WPIS 2F9NA 4OS7A 4U30A 2LNCA 1EXFA 3UTUH 1UCYE 2VWMA 3MU4A 2IN2A 3LGUA 1L2EA 2PSXA 3VGCB 1GWAA 1Q2WA 3A7WA 1A0HB 3R0FA 2ZZUH 1SPJA 5C1XA 2V6NA 4B75A 1DE7H 4BXWA 4K3JA 2ZQ1A 4OS6A 1E37B 1ESTA 2UUKB 3IWMA 1GHXH 2ZG0H 1GJ4H 4I33A 1TPPA 1BZXE 4YOIA 3SBKA 4DG4A 5DP7A 1GGDC 1HAZB 2CHAB 2GTBA 6CHAC 1QRXA 3BIVH 1V2JT 4ABAA 4A1TA 1FAXA 3RXHA 3TIUA 4F4OC 2CMYA 1Z8JB 1NRQH 1KSNA 1P8VC 3RXRA 1EAUA 3BTDE 4KELA 1K1IA 2Z94A 5BRRE 3RU4D 1FONA 1JMOH 1UTMA 3RXUA 3RXOA 4R0IA 4JK5A 4GVUA 3PLPA 1P09A 1C5XB 1QJ7B 1SGFG 1SVPA 1TMUH 5ETXA 4U2WA 3ESTA 3LGIA 3A7YA 1C5SA 1YPHC