5PTPA

Structure of hydrolase (serine proteinase)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA TRYPSIN
publication title Solvent structure in crystals of trypsin determined by X-ray and neutron diffraction.
pubmed doi rcsb
molecule tags Serine protease
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA02
3NKKA 1ESAA 1J9CH 1INCA 4FUFA 1RFNA 1W2KH 2RA3A 1GBHA 1GHBG 4Y10E 1FAXA 5J4SA 1HAGE 3ZZAA 1GG6B 4CBOA 1EUFA 3SNDA 3AW0A 4BAHB 2H5CA 4DT7B 1Z1IA 2G4TA 1O5DH 2HRVA 5A8ZA 2HALA 2PR3A 4O9VA 3FP7E 3QZQA 2ZKSA 1UTPA 1OWIA 1EATA 1GMCF 6GCHF 3KIDU 1O30A 3GY5A 5IYTA 3VXFH 3IITA 4ABAA 3Q00A 3VEQB 1O3CA 1UTMA 3D65E 2BOHB 4ABIA 1ID5H 3V7TA 1MTNC 4AG2A 1HXFH 1LPKB 3BEUA 5FPYA 2VIQA 3ZZ3A 1NS3A 5DP3A 2FI5E 2AGGX 2HWLB 1GBJA 4X6PA 2WUBA 1O2MA 1A2CH 1ESBA 5C20A 4IN1A 3I29A 2NWNA 1GJ9B 4XOJA 3M35A 2QXIA 4NWKA 5EQQA 3E8LA 3SI3H 1QTFA 4Q7YA 2SGFE 1G2MA 2XRCA 1D3TB 1T4UH 3M36A 2BDCA 1UCYK 1L1JA 4MG3A 1YP9A 4OS7A 2ZTZA 3KQEA 3RMOH 3T26A 4HI3A 2CF8H 4JYVH 1PQ7A 4B2CA 2ZDVH 3T25A 1P8VC 4X0WU 4GHQA 4X8TH 5JBTA 1T7CA 8LPRA 2PLXA 1SGQE 1O32A 2TGAA 3D49H 4J1YA 4YT7H 2P3FH 1GG6C 2B8OH 2GCTB 1WAYB 4MPXA 1LHDH 1QJ1B 5DKMA 5DP4A 1AU8A 2A2XH 3M3TA 3RXLA 5TCAA 1A0HB 2ZU1A 4CRBA 1WQVH 2BOKA 2ZDKA 3BEFB 1MAXA 2IJOB 3HK3B 5FXLA 1AE8H 1DWBH 1O2TA 2BD3A 3RXBA 1CGIE 4D9RA 2BD8A 4KTSA 4JZIA 4O03A 3LGWA 4JZ1A 1ZPCA 3SU6A 1HDTH 5FBEA 1GI3A 3EA7A 1V3XA 3TK9A 3MH7A 1EXFA 1GHVH 1H9HE 1BTUA 3UOUA 1TQ7B 1O3OA 3MU1A 1G3DA 4K2YA 4CRGA 2FOAA 1P12E 1QL9A 1V2LT 1PFXC 3N7OA 2O9QA 1QRZA 2AH4X 1XMNB 2THFB 2GX4A 4FUCA 3UWIA 1ELDE 1Z6JH 4YLQH 4U01A 5A8YA 1NRNH 1C5PA 1ZPBA 1RS0A 3LU9B 4K69A 1C2JA 4OS6A 3TGKE 1SGRE 1C4Y2 2FX4A 1YF4A 2FIRH 1O3NA 1ZRKA 3TJUA 3RXUA 7LPRA 2F9UA 9LPRA 2JH6D 4WJG2 2A7JA 1ANBA 1C1QA 1J14A 1VITH 1ZSKA 3UR6A 4UEHH 3JZ1B 2P94A 2HNTE 3ITIA 5C5OA 2A2QH 3TIUA 4AORA 1MQ5A 3NZIA 4ZXXH 3V3MA 4KGAA 2ZNKH 1EKBB 3BN9A 1QBNA 1V2JT 1Y3UA 3TK5A 5L2ZH 2QIQA 1K1MA 4HFPB 2Y5GA 1THPB 2ZWLH 4RN6A 1C1MA 2W26A 3LJOA 3EA8A 2OC0A 2GCTC 4AGJA 1VJAU 2WPMS 4DGJA 2Y5FA 1DSUA 1DWDH 1OXGA 2BLVA 3A7ZA 4WMEA 4YLUA 3Q3XA 3RXPA 1UJ1A 2C8YB 4WH6A 3U9AH 1GL0E 3RXKA 1OP8A 1O2GH 1DWCH 3RXEA 2FPZA 3BEIB 1K1PA 2ZPQA 1T31A 1MTUA 1FIZA 1MMJN 1BBRH 1MTWA 1A7SA 3A80A 4ABJA 4NFFA 3E3TA 1VCPA 1EAUA 1RIWB 2GCHG 3DD2H 2Y81A 1TMUH 1K1OA 2WV4A 1A46H 1JRTA 2FWWA 4YZUA 3BTQE 2F9NA 4AX9H 5JYIA 1C2MA 1SGFA 4H4FA 2BVSH 2FO9A 1UVPA 1CVWH 5I25A 2ZTXA 3PTBA 1IQLA 1EP5A 5EOKA 4DG4A 1MTSA 3B8JA 3A87A 2ZHWH 4JZFH 2WPHS 2BTCE 1GBTA 2CGAA 1GJAB 1Z8GA 2XCFA 4KELA 4Y6DA 2P16A 1SLXB 2Z7FE 3MH4A 3R0FA 3UQOA 1FV9A 4ZHMU 2YNAA 1SGPE 2GGVB 1O34A 3QTOH 3W95A 1BJVA 2AS9A 1IHSH 2WINI 3SN8A 2FX6A 1D3DB 3WY8A 3SNCA 2VVUA 4BXSA 4Y7AA 2QA9E 1CGJE 3BTGE 5JDUB 2ZI2H 1XVMA 2ZHEH 4M7GA 1Z1JA 1ZHPA 2R0LA 4MNWA 1P11E 1LQEA 1P57B 2BYAX 1TPPA 5AHGH 2SNVA 3QDZB 3NPSA 2ZCHP 1MH0A 1BTPA 3S7HB 4D8NA 2K1QA 3GY3A 4BANB 2Y7XA 2GV7A 3PWCA 4AGKA 4I8JA 5A0BA 1H8DH 3LGIA 1RIWC 1GJ4H 3ATWA 2YOLA 3FVFB 2ZHDA 1BZXE 4WWYA 1NM6A 1ELCA 2EI8A 3Q76A 1AE5A 2M5TA 4K8BA 1J15A 2BD2A 1TWXB 2PUQH 1CSOE 1T8MA 1TA6A 4MNYA 2Z9KA 1KLTA 3S69A 3URDA 1ZGVA 1O2LA 2Q1JA 3H7OA 1OWEA 1TBQH 1FY5A 4DY7B 1VITF 4AG1A 1UTQA 2ZPRA 3M37A 2O8LA 2RCEA 1GJ5H 2QN5T 1GJCB 6ESTA 2BY6X 1ABIH 3A83A 4ISHH 2J34A 3PO1B 1ZTLA 2ZDNA 4LZ1H 5E0JA 1GBMA 1GI7B 3VPKA 1GI6A 3UTUH 3MYWA 4OS2A 3MHWU 3V12A 3L3TA 1PYTC 1QQUA 3MU4A 1UHBB 4GSOA 3SUFA 2OUAA 3TJVA 1KIGH 1O2WA 4R0IA 2V3OH 3K2UA 1W7GH 2FTLE 4IMQA 1BMMH 1BTXA 4E05H 2AMQA 3SJ9A 4XBDA 3SORA 4U2WA 3F9GA 2XBWA 3H5CB 3RXHA 3MTYA 3GCNA 2GT8A 1BITA 1UHBA 4UD9H 1THSH 2VIOA 4K60A 3SQEE 5I46H 3VB6A 1BJUA 3S0NA 1TB6H 1DT2A 2BD9A 1LHCH 3GCOA 3E16B 3EDXB 1F2SE 1K1IA 4F4OC 1UTJA 4ESTE 1HAHH 4B74A 2W3KA 1G36A 2QV1A 2OC1A 1TOCB 1YLCA 2QGRA 3QN7A 5T6FA 1P2OA 5L30H 1ELFA 1UCYE 5DG6A 4UE7H 3LGYA 2FODA 3W94A 1S81A 3Q3YA 3SW2B 1DOJA 1O3AA 1FI8A 4MVNA 2Q6FA 1HXEH 3UNRA 3RXQA 1OWHA 5GXPA 1TABE 3EGKH 3SV6A 1H9IE 4J2YB 1S82A 1GVLA 3AAUA 1EP6A 1KTSB 2QCYA 4BTUB 1TNGA 1DX5M 2SGPE 2HGTH 5DP8A 4NIYA 2XCNA 3PO1C 1BQYA 3UIRA 3GOVB 4YESB 1GI1A 4CRDA 4A92A 1O3IA 8GCHG 1O3BA 1GHWH 3BTKE 1F0RA 1LVOA 4K1SA 3EA9A 3B9FH 1HGTH 1BTZA 3TITA 2OINA 4CR5A 4GPGA 2VVVA 5JBBS 4AYVB 3URCA 2VH6A 1GCDA 3M7UA 2QXGA 3ZZ9A 1ZTJA 3ZVDA 4NZLA 3UUZA 1AMHA 3PYHA 4IS5A 2ZU3A 1C5WB 3FZZA 1SLVB 1YPHC 4ZMAH 4AFQA 4BOHA 1QBVH 4AZ2B 3BTHE 2BLWA 1GBEA 4IC5A 3QUMP 4FU7A 1UTLM 2J2UA 2OXSA 1MKWH 4DIHH 1EASA 2AGIX 2ZC9H 2XWBI 1QB9A 1ELBA 1C1RA 2FYQA 1O2VA 5CHAB 3OY5U 1D6WA 1TALA 3LOXA 2Y7ZA 1SGNE 1ZMNA 2PSXA 4YOJA 3MO9A 4NSYA 1QCPA 1O2UA 4K5ZA 1ETRH 2ANKH 1HCGA 2CMYA 1DE7H 3TJNA 2VINA 3A86A 1ZMLA 1YPHE 1V2NT 3SJOA 1KXCA 1K1NA 1G3BA 2BZAA 1HAVB 1MD8A 3BG4B 1FZZA 2XW9A 2Z9GA 3SBKA 1ELVA 1MKXH 4IC6A 3QGJA 3SI4H 4FUJA 1W0ZU 1XUGA 1NROH 3SU3A 3PV4A 1SHHB 4JCNA 1OYQA 3S7KB 1HAVA 3RMMH 5HM9A 5DGJA 1QA7A 1K21H 2ZU4A 1ZOMA 1PPHE 3TH3H 1MZDA 1SQAA 4K3JA 1K9OE 1SC8U 1RD3B 1QY6A 3FAOA 2ZCKP 3MWIU 3A85A 5FCKA 2RG3A 3GYMA 3PTNA 3ZZ8A 3GCTG 4YOIA 4YTAA 3LC3A 1OKXA 4X1RU 2ZGJA 4FUDA 3BG8A 4JK5A 2JH5D 2ZG0H 4NZQA 2P3TB 3QX5H 1QB6A 5EW1H 2NU1E 5GIBA 2A4QA 3RLWH 3BV9B 1V2RT 2J4IA 2VGCB 2A4OA 3RXMA 1TMBH 3O8RA 3K9XB 1IQJA 1O3PB 1S84A 4X6MA 2FMJA 4XBCA 4DIIH 5CHAC 2H9TH 2ZGXH 2PGBB 3NCLA 1ELGA 3ZVBA 5C1XA 2J94A 1O5CB 4HTCH 3SV7A 2ZCLP 4OS5A 1O2OA 1SQTA 3UNSA 1EAXA 1S0RA 4GCHG 1YKTA 1VCQA 1GMDG 1L4ZA 1D3QB 2SGEE 3LPRA 2AERH 3P17H 3M5MA 2PKSB 1HJ9A 3BG4C 2PSYA 2IOTA 1QFKH 3DHKH 4ABEA 1NFXA 3RMLH 3B23B 3LKWA 1PQAA 1FY3A 1BCUH 2STAE 3HPTB 1Y3WA 2BDBA 2UUYA 1VJ9U 1Y59T 2ZFPH 3A8BA 3ATLA 1BRAA 3I77A 3LGTA 2IPHA 2ODPA 8KME2 3KCGH 4UDWH 1C2LA 3P92A 4NIXA 1NTPA 1C5NH 2CF9H 5JBCS 5EG4A 1P0SH 1HFDA 4Q2KA 4X1SU 1ARCA 1C1VH 1MBMA 4X8SH 3RDZA 5K7RA 2V3HH 1MTVA 2OC7A 3FZDA 1G32B 3A89A 1PJPA 1UVSH 1V2VT 1BTYA 1O36A 1MU6B 1P2JA 4FU8A 1QHRB 3F68H 3RLYH 2WUCA 4I32A 2D2DA 3V0XA 2LPRA 1GVKB 1YCPH 1V2WT 6CHAB 2XBYA 3MO6A 1BA8B 1CHOG 2QY0B 3O8CA 1O5AB 2I6QA 2VVCA 4X2XA 1CA0C 1SGCA 2A5AA 4HZHA 3ZZ6A 2W5EA 2R3UA 2A0QB 2VGCC 2H9HA 3M7TA 3R3GB 5FCRA 1ANEA 1DY8A 1GJDB 3KQCA 1O3JA 4OS1A 1NU7B 2GTBA 3C27B 4CH8B 3BIVH 1S5SA 1SPJA 2TGDA 3UR9A 5EW2H 1IHTH 2G52A 1V2ST 4Y8XA 3RXJA 1A5HA 1O2NA 1GI8B 3PROA 3TPIZ 5AFYH 3RMNH 3SOSA 1MUEB 3JZ2B 2PKSC 4IMZA 1ZPZA 3RP2A 1C5LH 1TPAE 4TYDA 4QT8C 4TY7A 1AI8H 4Y11E 2A4RA 3PM3A 1AN1E 3NXPA 1YC0A 1G37A 4TY6A 1O35A 1SLWB 1BHXF 5GPIB 1ZSLA 2CHAC 1SVPA 2O8MA 3RXRA 3FANA 4AN7A 4INKA 3LJJA 3RU4E 3M61U 3A8AA 1BT7A 5AVDA 2D26C 3U1IB 5CE1A 4IGDA 4AB8A 1AVGH 4CRAA 1GI9B 1P02A 3VB5A 2NU3E 4CREA 3GY7A 1XKAC 4KTCA 3M5NA 2G00A 2FDAA 1GI2A 4YOGA 1AZZA 1PPBH 1QBOA 1T8NA 2ANWA 1FAKH 3MH6A 4H6SB 4Y0YE 2XBXA 5ETXA 5FX6A 3GCHB 3UREA 1GBKA 1KXEA 6CHAC 1C5QA 1TGCA 2VU8E 1GL1A 4I8KA 1RRKA 1C2HA 1BB0B 4ZH8A 2G81E 3ZZ5A 2G51A 1SGDE 3MOCA 1V2KT 2H9EH 4CH2B 1CO7E 1MBQA 4U30A 1TBZH 1OP0A 4RSPA 1YCPM 1GPZA 2AEIH 1BRCE 1F0UA 2FP7B 5H4IB 1O5FH 3SNEA 3TK6A 2B0FA 5HMAA 1O2YA 1DICA 2V0BA 3T29A 3O8DA 2BZ6H 1JOUB 2FESH 1L4DA 1AIXH 2HPPH 1ZR0A 2ZFTA 1EJAA 3PLPA 1TNIA 4K1EA 1ANDA 3SO3A 1SGFG 2EI6A 2OBOA 1GHAG 5G4BA 1Y5AT 2ULLA 5PTPA 4UONA 2WPIS 3P70B 4CHAB 2Z6BD 1LVYA 1G30B 5ESTE 1W0YH 1XKBC 1QA0A 2BLOA 2Z3EA 4GVUA 2Y5HA 1B5GH 2VIVA 2FI4E 3LT3A 3SU0A 1PPEE 2WPJS 1IQGA 3BTDE 2GKVE 1LMWB 1Y5BT 2O8TA 1FLEE 1VGCB 1E0FD 1AD8H 5BRRE 1C5VA 3PMBB 1CE5A 1ZYOA 4DCDA 1LO6A 1C2KA 3RXTA 4Z6AH 1E34B 1GHYH 3TNTA 1BMLA 3MFJA 4I7YH 3MNXA 5EQSA 1P06A 2AMPA 2BM2A 2BDHA 1C2IA 1J8AA 1YBWA 5K0HA 1FPHH 2B9LA 3GCHC 1HLTH 1XXDA 3OU0A 1TGNA 1UO6A 3RXCA 1PPGE 2FS9A 4X6OA 1Z71A 1EJMA 1JWTA 4CRFA 1Q31A 1P9SA 3OYPA 1LCYA 2QAAA 4NSVA 1C2FA 1DITH 3U98H 2W7SA 1FN8A 1JIMA 4Z0KA 2FS8A 4JZEH 4NGAH 2JKHA 2GP9B 3FP8E 7GCHG 3K6ZA 4I8LA 1WBGB 1UTKA 3GDSA 4I8GA 2B5TB 2QXJA 5EXNA 1HAOH 3ODDA 3I78A 2A5KA 4ISLA 2R3YA 4CHAC 3SNAA 1TX6A 5EQRA 1QL8A 1NN6A 3EE0B 2R2MB 3PMAB 4ZUHA 2BVXH 1TPSA 1OWDA 3MU0A 2BDIA 1RTLA 2OTVA 4U32A 1SGTA 1JIRA 1VGCC 2I6SA 2GT7A 2AMDA 1D4PB 5FPSA 1W13U 5EODA 2NU0E 3OY6U 2YNBA 2VJ1A 1DVAH 1C5MD 3SNBA 1F92A 1WSSH 1HYLA 2RA0A 1C1NA 3O8BA 1C5OH 1GGDB 1QL7A 1QURH 3MU5A 3SQHE 1XX9A 1AWHB 1P2QA 1SHYA 3BTME 4E7RG 5LPRA 3DFLA 2ZQ2A 1S0QA 3S9CA 1MAYA 4LXBH 1C1UH 2D1JA 3ZZ7A 1SOZA 1O2KA 3NWUA 2Z9IA 5E0HA 4DOQA 3T2NA 3KGPA 4GCHF 2XNIA 1GMDF 4HGCA 1IQKA 4LOYH 4UFFH 1D3PB 1GBLA 5L2YH 1P01A 1ZTKA 1JXPA 1GHBF 1YCPK 2HNTF 2ZP0H 3KN2A 3Q3KA 1OYTH 1KSNA 1Z8JB 2B7DH 4E7NA 3M3VA 2ESTE 2EEKA 3FFGA 4WY3A 4B2BA 3SV8A 5ESBA 2H6MA 4D7GA 3SGAE 1EZSC 1AO5A 3P8NA 1QIXB 1SG8B 1VR1H 3ODFA 1C1TA 1V2QT 2V35A 1GJ7B 2ZZUH 2A7CA 5GDSH 1ZZZA 2PWXA 1TFXA 5FX5A 4H42U 2A45B 1XM1A 1O2SA 2A5IA 4SGAE 1AKSB 3ELAH 1V2UT 1TX7A 3A84A 1EQ9A 1BMAA 2F9PA 1YPEH 1PQ5A 5EPNA 1QGFA 4NA9H 1JMOH 2PW8H 2ZO3H 4B1TA 1GDQA 3RUOA 1CGHA 3HATH 3HKIB 2AIPA 2PFEA 3KQBA 1LQDB 4X2YA 1AKSA 1NRSH 2PKAB 1GBIA 4Y79A 3VB7A 1O2XA 5JB8S 2Z94A 1EJNA 1GGDC 1QB1A 2BQ6B 1SL3A 2VIDA 4GUXA 5GCHG 4MNXA 1A5GH 1CQQA 1E36B 1DLKB 1KLJH 1UCYH 2PKAA 3SGQE 3L33A 2FOHA 2BY9X 3MNCA 1C5XB 3LGVA 5DP9A 1AGJA 4YT6H 4X6NA 2ZU2A 1ELEE 1OPHB 3TLOA 5FPTA 3TGJE 4MQAA 3GICB 3Q77A 3QZRA 4D7FA 1KXAA 3ZZBA 1HPGA 1W12U 2ZIQH 4BTTB 1P2IA 1J17T 4D76A 4KTUA 1YPLH 1YM0A 1Y3XA 3MI4A 3LC5A 3VB3A 4NCYA 1BHXB 2ZGCA 1NFYA 3M7QA 1HAIH 2BD7A 1D6RA 8ESTE 3SJIA 2ZFRH 4ABDA 1HIAB 1KLIH 3F9FA 2ZDLA 1HBTH 1C4V2 3EYDA 1OSSA 3P95A 2XC0A 4BTIB 2ZFSA 2BD4A 3EAJA 3DUXH 2LNCA 1MD7A 2GDEH 3PB1E 2C93B 2GVFA 1ELTA 1GI0A 1RGQA 1GI4A 2DE8A 2ZGBH 1IQEA 1O5BB 1HIAA 1KTTB 3A7TA 4MTBA 4YO9A 3TH4H 4B76A 1FY4A 3ZVFA 4XDEA 1MZAA 4R8TB 3M3SA 3NUMA 3STIA 1F5KU 1SMFE 1PQ8A 3SUGA 4OGXA 3T5FH 3UNQA 1A5IA 1O3FA 1GHAF 4YM9A 5F03A 1AFEH 1G3CA 2CXVA 1K28D 3PMHB 1F5RA 1BBRK 1B7XB 2KAIB 2XTTB 1O2QA 3UFAA 1V2MT 3GDUA 4MLFB 1P2KA 4X2VA 1OP2A 2PUXB 1A3BH 3GYLB 3QK1A 4A1XA 4D9QA 3OSYA 4FVBA 4OGYA 1LPZB 2A32A 3GY2A 2QXHA 4Y8YA 3LH3A 1QNJA 1NPMA 2H5DA 2KAIA 3NK8A 4B75A 4MDSA 2GDDA 2FXRA 3U69H 1N6YA 2PTCE 2C8XB 2XBVA 2BY5X 1BTHH 1IQMA 3D23A 5E2OA 1RTKA 1ZHMA 2GCHF 3LIWA 2WPKS 2FTMA 1AUJA 4DURA 3S9BA 1BUIA 1QRXA 1EOJA 1C9PA 2C3SA 2FM2A 1YPGH 2FZZA 2O8UA 3MNSA 3TH2H 2CN0H 4WMDA 2BQ7B 1KYNA 2VNTA 2ZTYA 1ELAA 4A5TS 4BNRA 4TWYA 1HAZB 1LPGB 4KP0A 3LONA 3SU5A 3ZV9A 2O8WA 1LVBA 1DLEA 2GZ7A 1EOLA 3TGIE 3QWCH 3ZZCA 4JK6A 2J95A 1CA0B 1TYNA 2G55A 3ZVEA 4ZKSU 2SNWA 1SI5H 1NC6A 1IQNA 1EZXC 7GCHF 3RC4A 1Z8IB 3LH1A 4SGBE 1TNHA 1P2NA 1P04A 1L1NA 2WPLS 1FUJA 1ZMJA 1DXWA 2WYGA 4X8UH 1YYY1 3KNXA 1H8IH 2PHBA 1FNIA 2ZF0H 1OS8A 4FVDA 4IW4E 3CS7A 5DPAA 2GZ9A 1ZSJA 1NT1A 2P95A 1P05A 5F8ZA 1SLUB 5C1UA 3GISB 1B0EA 3GY4A 1AQ7A 3LDXH 3K65B 1EB2A 1C2GA 3RM0H 4IBLH 2FOMB 1WV7H 1P2MA 5DP5A 1KDQB 1U6QA 2C8ZB 3MU8A 1EAWA 1A1RA 2HLCA 2CHAB 1ANCA 1P09A 3ENSB 3QTVH 3KHVA 1UVOA 4INLA 1CA8B 4NA7A 1TMTH 1G9IE 1VITG 1OWKA 2ZQ1A 4WF8A 1AVWA 3A8CA 1HJ8A 1LKBA 1O31A 2R2WU 2ASUB 1GI5A 3V13A 1HAXB 1KDQA 1NZQH 4JYTA 5E2PA 1P9UA 1FPCH 1V6DA 4MPWA 1XXFA 2GV6A 1GMHG 3TU7H 5ABWA 1ORFA 2G4UA 1O37A 4K8YA 2EC9H 1WQSA 1WTGH 2H1UA 1LHGH 4GLYA 2UUJB 1F5LA 1WCZA 4X2WA 5T6DA 2BLQA 3ZVCA 5FHTA 4B73A 3OTJE 5C1YA 1W10U 1Z7KA 1YLDA 3DT0H 1LHEH 2FOCA 1S85A 1DY9A 1KXDA 5F8XA 4ZKOU 1RTFB 4WXVA 3AAVA 1XUIA 5DP7A 4DW2U 4ZKNU 1Q3XA 3U8OH 2F9VA 1XVOA 1GDUA 1IQIA 4VGCB 1V2OT 1Z6EA 1SGYE 1CT0E 5T6GA 2FOGA 2XYAA 2ANMH 1C1WH 2Q6DA 1HJAC 4O97A 2RDLA 4IN2A 1ETTH 1G3EA 3LGUA 1TGSZ 1O3KA 2R9PA 4XSKU 1PPZA 2P3UB 3L6PA 1VZQH 1TNKA 2SFAA 2A7HA 3P8GA 1ETSH 5FBIA 1KY9A 1P03A 1ABJH 1TNJA 9ESTA 1ACBE 3EQ0H 1O2IA 3RXAA 1TOMH 1L2EA 2C90B 1C5UA 1EZUC 4CBNA 3RU4D 1SSXA 1THRH 4NG9H 4X1QU 1FXYA 2VWLA 3SZNA 1JBUH 3ATIA 5J4QA 3TVJB 2AYWA 4BAQB 5GCHF 5LH8A 4TPYA 1KXFA 4FUIA 1SGEE 1C1PA 1N1LA 2Z9JA 2GZ8A 3KEEA 1CHGA 2VB0A 3F9HA 2ZDAH 3BTTE 1FJSA 1O2ZA 1EZQA 2F9OA 4I8HA 3T27A 3ZVAA 1C4U2 3HK6B 1HAYB 3C1KA 5B6OA 2V6NA 3BTWE 3UY9A 4NIWA 4ZXYH 2ZDMA 1WU1A 5BPEA 4XE4A 1CT4E 2HNTC 2VH0A 1AUTC 2FOFA 1CT2E 2JH0D 3UQVA 1F0SA 2ILNA 4F49A 4WXIA 1AHTH 1S6HA 3PMJA 3SV2H 3F6UH 4ZKRU 8GCHF 1L0ZA 2G5NA 3UOPA 1UK2A 4VGCC 3RXSA 5HYOA 1MKWK 4ABHA 1SQOA 2H2ZA 1N8OB 3U1JB 4Y71A 1NO9H 1C9TA 4AB9A 2VIWA 1DANH 3AW1A 3TNSA 2EI7A 4FUEA 3ZZ4A 4DJZB 1C5ZB 1W3CA 3ZYEA 2QF3A 5GJ4B 1O0DH 2HPQH 4A6LA 1GCTB 4CR9A 1W7XH 1XUFA 5HM2A 4DVAU 3RXVA 2HVXA 3ATKA 1DPOA 1GJBB 1YPMH 1TQ0B 2GMTB 1LKAA 4LZ4B 3PLKA 3QO6A 2Z3DA 1NFWA 1SB1H 1UMAH 3HGPA 3A7XA 1LTOA 1MKXK 5EXLA 1TPOA 3QLPH 1X7AC 3QGNB 1AFQB 1UTNA 1O5EH 4ZROA 4ISIH 1LHFH 1Y3VA 2TGPZ 1TE0A 1AVXA 1C1SA 3BIUH 1C1OA 3RM2H 1S6FA 5IDKA 1FDPA 5F6MA 2P93A 2Z9LA 2VWNA 1O3GA 4I31A 1K22H 1SR5C 2ZPSA 5A09A 5SGAE 3M5OA 3PWBA 1A0LA 1BBRE 4K1TA 6LPRA 2ZFFH 3E6PH 1AZ8A 2BY7X 5HXFA 2UUFB 1C5SA 1CBWB 1C5YB 2R0KA 2BDYA 2QYIA 1O2HA 1AWFH 3DA9B 3VGCB 4Q7ZA 1B0FA 1ZRBA 3F1SB 1TONA 1SFQB 2ALVA 5TJXA 1SFIA 1ZLRA 1N8OC 2ZFQH 1NRQH 5L6NH 1P10A 2W3IA 4E06H 4ABFA 1FY8E 4ASHA 7ESTE 2OQ5A 3KL6A 2BDAA 3MO3A 5EU8A 5EGMA 4OS4A 1ZHRA 4FUGA 1O2JA 4O3TA 1MU8B 4RKOB 1TNLA 4AOQA 3RXFA 1DDJA 1ZGIA 2ZHQH 3GCTF 5A0AE 3BSQA 5FAHA 1TBRH 1VCWA 1GCTC 1MCTA 2OLGA 3SU4A 3U8RH 2ODYB 4FXGH 2ZA5A 4H6TA 2HOBA 1H1BA 1QJ7B 1O33A 3H7TA 2VIPA 2OQUA 1IQHA 1C5RA 3RC5A 2GMTC 3SHAH 2D8WA 1GBCA 1EX3A 5DJ7A 3E0PB 2OD3B 2P8OB 1NESE 4MPUA 1GVZA 3A81A 3A7YA 2NU2E 4BAKB 1XUHA 1AFQC 4Y76A 1QQ4A 2F83A 4X1PU 2A4GA 2XC5A 2BB4A 2P59A 1FY1A 1J16A 2Z3CA 4UFGH 1BMNH 2QC2A 2OBQA 2Y6TA 3S9AA 2XWAA 1D9IA 2BMGB 2F9BH 2F3CE 3P8OA 2SGDE 2UWLA 5T3HA 4WVPE 1DS2E 2FEQH 3SU1A 1GMCG 1TIOA 6GCHG 1LVMA 1DSTA 1DM4B 1HB0B 1CBWC 1W8BH 4NWLA 3STJA 5EXMA 3VGCC 5LPEA 1L1GA 2EA3A 2FYRA 3BTEE 1TRNA 4KKDA 1T8OA 1OWJA 3FP6E 2JETB 5GWZA 1H9LB 2ZEBA 3ZVGA 3UPEA 1T8LA 1A4WH 1YPJH 2FOBA 3VFEA 1Y8TA 4X1NU 4WH8A 5LGOA 1FN6A 1HUTH 1BTWA 1JRSA 4TWWA 2FLBH 1QRWA 1Y5UT 2FOEA 3RXOA 1Q2WA 1EB1H 1P3CA 1GMHF 1O2PA 3E90B 1ZJDA 1FIWA 1O39A 3T62A 2BDGA 1CHOF 3ZYDA 5CMXH 2VWMA 3E1XB 1DXPA 1H4WA 2DUCA 4FUBA 4AFUA 7KMEH 2CV3A 2PTNA 3A82A 1EAIA 1TA2A 3P6ZB 1GBBA 2P8OC 2NU4E 4Y0ZE 2G8TA 3DFJA 1NFUA 3HGNA 1HRTH 1UK3A 1C2DA 3KF2A 1PYTD 4UFDH 1AB9B 3SUEA 2STBE 3SJ8A 1DFPA 1V2TT 2Y80A 2FI3E 2PV9B 1M9UA 1TAWA 3GY6A 1GJ8B 3SV9A 1MCVA 3RXDA 2BX3A 1Y3YA 3SJKA 2ZU5A 2UUKB 5F8TA 1IOEA 1YPKH 3RC6A 4WMFA 1UK4A 4ISNA 1GBFA 2J92A 4XFQA 1P3EA 4NA8A 5E0GA 3GDVA 2TBSA 2QF0A 2G5VA 3TJOA 4Y8ZA 1NRPH 1FONA 1FMGA 1WOFA 5EPYA 1TGTA 1MQ6A 1ZJKA 4CRCA 1DUEA 1A61H 1HV7A 1IAUA 2BXUH 5A0CA 3T28A 4Q80A 4UFEH 1GHXH 1QR3E 2JETC 2J9NA 1XUKA 2Y82A 1ARBA 3ATMA 2ZGHA 3SUDA 3MH5A 4ABGA 1E38B 3BF6H 5AF9H 4FUHA 2C8WB 1O3EA 3A7WA 3U8TH 4JYUH 1NRRH 2SGAA 2WV5A 1A0JA 1F7ZA 3BTFE 3ZV8A 3CENA 1FQ3A 4B2AA 1EPTB 1WTHD 2BD5A 3G01A 1OOKB 1YGCH 2ALPA 1C5TA 3F9EA 1A3EH 3IWMA 1SOTA 1C2EA 2ODQA 3IG6B 3ZZDA 4BXWA 1BRUP 1BOQA 1OX1A 3GY8A 1KXBA 4GAWA 4B71A 4AFZA 5HGGA 4JZDH 2XC4A 3UWJH 5JB9S 1G2LA 3MNBA 2AGEX 1IQFA 1EPTA 2OP9A 1GJ6A 1AB9C 4THNH 4LK4A 5LPFA 3AVZA 1E37B 5A8XA 2BHGA 5E8EH 5C3NA 3MMGA 2OCVB 4ISOA 2BY8X 2A1DB 2UWPA 2UWOA 3D62A 1O3DA 3OX7U 2AFQB 1XUJA 4ZHLU 1K1LA 3E91A 5A2MH 4BAOB 1W14U 4MPVA 3HKJB 2VWOA 2OC8A 1BIOA 1O5GH 2BX4A 1UVUH 1T4VH 1GBAA 1T32A 2BQWB 4MNVA 1GDNA 5C2ZA 4PROA 2BVRH 4A1VA 5JBAS 4AYYB 2AIQA 4XBBA 1TRYA 5DO4H 1GHZA 2Q6GA 1WYKA 4Y7BA 3VXEH 5DK1A 5C5NA 4ZAEA 1O3HA 1PPCE 1GBDA 1TX8A 3A7VA 2ANYA 1RXPA 1V2PT 3CP7A 3P8FA 2TPIZ 1W11U 5C67A 2BXTH 1PPFE 1GWAA 1WUNH 4RKJB 4NIVA 2TRMA 4ZHAA 1O3MA 2DE9A 1EPTC 3M5LA 3RXIA 3ESTA 1CU1A 1TRMA 2ZECA 1RJXB 2GD4B 1SBWA 1LDTT 3CS0A 1BRBE 2W7UA 4Q7XA 4O3UA 1HAPH 3E0NB 2TIOA 1S83A 1SGIB 5AFZH 3SHCH 1BDAA 4NFEA 3KQDA 2J38A 1AY6H 4X8VH 4JMYA 4TPIZ 5DP6A 1F0TA 3PLBA 2TGTA 1MTNB 3K6YA 4I33A 4FU9A 1QJ6B 4ABBA 1DWEH 1NU9A 1O3LA 2CJIA 1NY22 2XXLA 1K1JA 1DUAA 3A8DA 5JPMH 1HJAB 1N6XA 1E35B 4A1TA 5TCCA 2F91A 3VB4A 2A31A 3SU2A 2SGQE 2WYJA 3RU4T 2IN2A 1UTOA 3SGBE 1TGBA 1TLDA 2ZHFH 1O2RA 2C4FH 4AFSA 1K2I1 3AASA 1ESTA 2FLRH 4BAMB 1UVTH 4A7IB 4GHTA 2PGQB 1Z8RA 3A88A 1O38A 1HNEE 3RXGA 4INHA
chains in the Genus database with same CATH superfamily
3NKKA 1ESAA 2WHXA 1J9CH 1INCA 4FUFA 1RFNA 1W2KH 2RA3A 1GBHA 1GHBG 4Y10E 1FAXA 5J4SA 1HAGE 3ZZAA 1WDIA 1GG6B 2KFWA 4CBOA 1EUFA 2JIZD 5DSFA 3SNDA 3AW0A 4BAHB 2KCAA 2H5CA 4DT7B 1Z1IA 2G4TA 3SYJA 1O5DH 2HRVA 3OEED 5A8ZA 2HALA 2PR3A 4O9VA 3FP7E 3QZQA 2ZKSA 1UTPA 1OWIA 1EATA 1GMCF 6GCHF 3KIDU 1O30A 3GY5A 5IYTA 3VXFH 3IITA 4ABAA 3Q00A 3VEQB 1O3CA 1UTMA 3D65E 2BOHB 4ABIA 1ID5H 3V7TA 1MTNC 4AG2A 1HXFH 3WWFA 1LPKB 3BEUA 5FPYA 2VIQA 3ZZ3A 1NS3A 5DP3A 3F3BA 2FI5E 2AGGX 2HWLB 1GBJA 4X6PA 2WUBA 1O2MA 1A2CH 1ESBA 5C20A 5C17A 4IN1A 3I29A 2NWNA 4ASUD 1GJ9B 4XOJA 3M35A 2QXIA 4NWKA 5EQQA 3E8LA 3SI3H 1QTFA 4Q7YA 2QF4A 2SGFE 1G2MA 2XRCA 1D3TB 1T4UH 3M36A 2BDCA 1UCYK 1L1JA 4MG3A 1YP9A 4OS7A 2ZTZA 3KQEA 5FL7D 3RMOH 3T26A 4HI3A 2CF8H 4JYVH 1PQ7A 3F0PA 4B2CA 2XOKD 2ZDVH 3T25A 1P8VC 4X0WU 4GHQA 4X8TH 5JBTA 1T7CA 8LPRA 2PLXA 1SGQE 1O32A 2TGAA 3D49H 4J1YA 4YT7H 2P3FH 1GG6C 2B8OH 2GCTB 1WAYB 2K0QA 4MPXA 1LHDH 1QJ1B 5DKMA 5DP4A 1AU8A 2A2XH 3M3TA 3RXLA 5TCAA 1A0HB 2ZU1A 4CRBA 1WQVH 2BOKA 2ZDKA 3BEFB 1MAXA 2IJOB 3HK3B 5FXLA 1AE8H 1DWBH 1O2TA 2BD3A 3RXBA 1CGIE 4D9RA 2BD8A 4KTSA 4JZIA 4O03A 3LGWA 4JZ1A 1ZPCA 2WZQA 3SU6A 1HDTH 5FBEA 1GI3A 3EA7A 1V3XA 3TK9A 3MH7A 1EXFA 1GHVH 1H9HE 1BTUA 3UOUA 1TQ7B 1O3OA 3MU1A 1G3DA 4K2YA 4CRGA 2FOAA 1P12E 1QL9A 1V2LT 1PFXC 3N7OA 2O9QA 1QRZA 2AH4X 1XMNB 2THFB 2GX4A 4FUCA 3UWIA 1ELDE 1Z6JH 4YLQH 4U01A 5A8YA 1NRNH 1C5PA 1ZPBA 1RS0A 3LU9B 4K69A 1C2JA 4OS6A 4DT4A 3TGKE 1SGRE 1C4Y2 2FX4A 1YF4A 2FIRH 1O3NA 1ZRKA 3TJUA 3RXUA 7LPRA 2F9UA 5KECA 9LPRA 2JH6D 4WJG2 2A7JA 1ANBA 1C1QA 1J14A 1VITH 1ZSKA 3UR6A 4UEHH 3JZ1B 2P94A 2HNTE 3ITIA 5C5OA 2A2QH 3TIUA 4AORA 1MQ5A 3NZIA 4ZXXH 3V3MA 4KGAA 2ZNKH 1EKBB 3BN9A 1QBNA 1V2JT 1Y3UA 3TK5A 5L2ZH 2QIQA 1K1MA 4HFPB 2Y5GA 1THPB 2ZWLH 4RN6A 1C1MA 2W26A 3LJOA 3EA8A 2OC0A 2GCTC 5DN6D 4AGJA 2AHME 1VJAU 4P00A 2WPMS 4DGJA 2Y5FA 4B6EA 1NBMD 1DSUA 1DWDH 1OXGA 2BLVA 3A7ZA 4WMEA 4YLUA 3Q3XA 3RXPA 1UJ1A 2C8YB 4WH6A 3U9AH 1GL0E 3RXKA 1OP8A 1O2GH 1DWCH 3RXEA 2FPZA 3BEIB 1K1PA 2ZPQA 1T31A 1MTUA 1FIZA 1MMJN 1BBRH 1MTWA 1A7SA 3A80A 4ABJA 2KZ4A 4NFFA 3E3TA 1VCPA 1EAUA 1RIWB 2GCHG 3DD2H 2Y81A 1TMUH 1K1OA 2WV4A 1A46H 1JRTA 2FWWA 4YZUA 3BTQE 2F9NA 4AX9H 5JYIA 1C2MA 1SGFA 4H4FA 2BVSH 2FO9A 1UVPA 1CVWH 5I25A 2ZTXA 3PTBA 1IQLA 1EP5A 5EOKA 1FX0B 4DG4A 1MTSA 3B8JA 3FOAA 3A87A 2ZHWH 4JZFH 5C0UA 2WPHS 2BTCE 1GBTA 2CGAA 1GJAB 1Z8GA 2L6OA 2XCFA 4KELA 4Y6DA 2P16A 1SLXB 1SKYE 2Z7FE 3MH4A 3R0FA 3UQOA 1FV9A 4ZHMU 2YNAA 1SGPE 2GGVB 1O34A 3QTOH 3W95A 1BJVA 2AS9A 1IHSH 2WINI 3SN8A 2FX6A 1D3DB 3WY8A 3SNCA 2VVUA 4BXSA 4Y7AA 2QA9E 1CGJE 3BTGE 5JDUB 4F55A 2ZI2H 1XVMA 2ZHEH 4M7GA 1Z1JA 1ZHPA 2R0LA 4MNWA 1P11E 1LQEA 1P57B 3F0OA 2BYAX 3UAIC 1TPPA 5AHGH 2SNVA 3QDZB 3NPSA 2ZCHP 1MH0A 1BTPA 3S7HB 4D8NA 2K1QA 3GY3A 4BANB 2Y7XA 2GV7A 3PWCA 4AGKA 4I8JA 5A0BA 1H8DH 3LGIA 1RIWC 1GJ4H 3ATWA 2YOLA 3FVFB 2ZHDA 1BZXE 4WWYA 1NM6A 1ELCA 2EI8A 3Q76A 1AE5A 2M5TA 4K8BA 1J15A 2BD2A 1TWXB 2PUQH 4TT3D 1CSOE 1T8MA 1TA6A 4MNYA 2Z9KA 5EJZA 1KLTA 3S69A 3URDA 3FN8A 1ZGVA 1O2LA 2Q1JA 3H7OA 1OWEA 1TBQH 1FY5A 4RT1A 1VITF 4DY7B 4AG1A 1UTQA 2ZPRA 3M37A 2O8LA 2RCEA 1GJ5H 2QN5T 1GJCB 6ESTA 2BY6X 1ABIH 3A83A 4ISHH 2J34A 3PO1B 1ZTLA 2ZDNA 4LZ1H 5E0JA 1GBMA 1GI7B 3VPKA 1GI6A 3UTUH 3MYWA 4OS2A 3MHWU 3V12A 3L3TA 1PYTC 1QQUA 3MU4A 1UHBB 4GSOA 3SUFA 2OUAA 3TJVA 1KIGH 1O2WA 4R0IA 2V3OH 3K2UA 1W7GH 2FTLE 4IMQA 1BMMH 1BTXA 2WV9A 4E05H 2AMQA 3SJ9A 4XBDA 2M2AA 3SORA 4U2WA 3F9GA 2XBWA 3H5CB 3RXHA 3MTYA 3GCNA 2GT8A 1BITA 1UHBA 4UD9H 1THSH 2VIOA 4K60A 3SQEE 5I46H 3VB6A 1BJUA 3S0NA 1TB6H 1DT2A 2BD9A 1LHCH 3GCOA 3E16B 3EDXB 1F2SE 4Z1MD 1K1IA 4F4OC 1UTJA 4ESTE 1HAHH 4ACAA 4B74A 2W3KA 1G36A 2QV1A 2OC1A 1TOCB 1YLCA 2QGRA 3QN7A 5T6FA 1P2OA 5L30H 1ELFA 1UCYE 5DG6A 4UE7H 3LGYA 2FODA 3W94A 1S81A 3Q3YA 3SW2B 1DOJA 1O3AA 1FI8A 4MVNA 2Q6FA 1HXEH 3UNRA 3RXQA 1OWHA 5GXPA 1TABE 3EGKH 3SV6A 1H9IE 4J2YB 1S82A 1GVLA 3AAUA 1EP6A 1KTSB 2QCYA 4BTUB 1TNGA 1DX5M 2SGPE 2HGTH 5DP8A 4NIYA 2XCNA 3PO1C 1BQYA 3UIRA 3GOVB 4YESB 1GI1A 4CRDA 4A92A 1O3IA 8GCHG 1O3BA 1GHWH 3BTKE 1F0RA 1LVOA 4K1SA 3EA9A 3B9FH 1HGTH 1BTZA 3TITA 2OINA 4CR5A 4GPGA 2VVVA 5JBBS 4AYVB 3URCA 2VH6A 2L74A 1GCDA 3M7UA 2QXGA 3ZZ9A 5IK2D 1ZTJA 3ZVDA 4NZLA 3UUZA 1AMHA 3PYHA 4IS5A 2ZU3A 1C5WB 3FZZA 1SLVB 1YPHC 4ZMAH 4AFQA 4BOHA 1QBVH 4AZ2B 3BTHE 2BLWA 1GBEA 4IC5A 3QUMP 4FU7A 1UTLM 2J2UA 2OXSA 1MKWH 4DIHH 1EASA 2AGIX 2ZC9H 2XWBI 1QB9A 1ELBA 1C1RA 2FYQA 1O2VA 5CHAB 3OY5U 1D6WA 1TALA 3LOXA 2Y7ZA 1SGNE 1ZMNA 2PSXA 4YOJA 3MO9A 4NSYA 1QCPA 2F4LA 1O2UA 4K5ZA 1ETRH 2ANKH 1HCGA 2CMYA 1DE7H 3TJNA 2VINA 3A86A 1ZMLA 1YPHE 1V2NT 3SJOA 1KXCA 3DCLA 1K1NA 1G3BA 2BZAA 3KYFA 1HAVB 1MD8A 3W1EA 3BG4B 1FZZA 2XW9A 2Z9GA 3SBKA 1ELVA 1MKXH 4IC6A 3QGJA 3SI4H 4FUJA 1W0ZU 1XUGA 1NROH 3SU3A 1SQRA 3PV4A 1SHHB 4JCNA 1OYQA 3S7KB 1HAVA 3RMMH 5HM9A 5DGJA 1QA7A 1K21H 2ZU4A 1ZOMA 1PPHE 3TH3H 4XRNA 1MZDA 1SQAA 4K3JA 1K9OE 1SC8U 1RD3B 5HIYA 1QY6A 3FAOA 2QE7D 2ZCKP 3MWIU 3A85A 5FCKA 2RG3A 3GYMA 3PTNA 3ZZ8A 3GCTG 4YOIA 4YTAA 3LC3A 1OKXA 4X1RU 2ZGJA 4FUDA 3BG8A 4JK5A 2JH5D 2ZG0H 4NZQA 2P3TB 3EE7A 3QX5H 1QB6A 5EW1H 2NU1E 5GIBA 2A4QA 3RLWH 3BV9B 2YMSD 1V2RT 2J4IA 2VGCB 2A4OA 3RXMA 1TMBH 3O8RA 3K9XB 1IQJA 1O3PB 1S84A 2IPQX 2FMJA 4X6MA 4XBCA 5CHAC 5C0TA 4DIIH 2H9TH 2ZGXH 2PGBB 3NCLA 1ELGA 3ZVBA 5C1XA 4FOUC 2J94A 1O5CB 4HTCH 3SV7A 2ZCLP 4OS5A 1O2OA 1SQTA 3UNSA 1EAXA 2HVYB 1S0RA 4GCHG 1YKTA 1VCQA 1GMDG 1L4ZA 1D3QB 2SGEE 3LPRA 2AERH 3P17H 3M5MA 1W0JD 2PKSB 1HJ9A 3BG4C 2PSYA 2IOTA 1QFKH 3DHKH 4ABEA 1NFXA 3RMLH 3B23B 3LKWA 1PQAA 1FY3A 1BCUH 2STAE 4B6FA 3HPTB 1Y3WA 2BDBA 2UUYA 1VJ9U 1Y59T 2ZFPH 3A8BA 3ATLA 1BRAA 3I77A 3LGTA 2IPHA 2ODPA 8KME2 3KCGH 4UDWH 1C2LA 3P92A 4NIXA 1NTPA 1C5NH 2CF9H 5JBCS 5EG4A 1P0SH 1HFDA 4Q2KA 4OM9A 4X1SU 1ARCA 1C1VH 1MBMA 4X8SH 3RDZA 5K7RA 2V3HH 1MTVA 2OC7A 3FZDA 1G32B 1EFRD 3A89A 1PJPA 1UVSH 1V2VT 1BTYA 1O36A 4ACBA 1MU6B 1P2JA 4FU8A 1QHRB 3F68H 3RLYH 2WUCA 4I32A 2D2DA 3V0XA 4Q63A 2LPRA 1GVKB 1YCPH 1V2WT 6CHAB 2XBYA 3MO6A 1BA8B 1CHOG 2QY0B 3O8CA 2GJGA 1O5AB 2I6QA 2VVCA 4X2XA 1CA0C 1SGCA 2A5AA 4HZHA 3ZZ6A 2W5EA 2R3UA 2A0QB 5KEDA 2VGCC 2H9HA 3M7TA 3R3GB 5FCRA 1ANEA 1DY8A 1GJDB 3KQCA 1O3JA 4OS1A 1NU7B 2GTBA 3C27B 4CH8B 3BIVH 1S5SA 3AK5A 1SPJA 2TGDA 3UR9A 5EW2H 1IHTH 2G52A 1V2ST 4Y8XA 3RXJA 1A5HA 1O2NA 1GI8B 3PROA 3TPIZ 5AFYH 3RMNH 3SOSA 1MUEB 3JZ2B 2PKSC 4IMZA 1ZPZA 3RP2A 1C5LH 1TPAE 4TYDA 4QT8C 4TY7A 1AI8H 4Y11E 2A4RA 3PM3A 1AN1E 3NXPA 1YC0A 3N99A 1G37A 4TY6A 1O35A 1SLWB 1BHXF 5GPIB 1ZSLA 2CHAC 1SVPA 2O8MA 1YLNA 3FANA 3RXRA 4AN7A 4INKA 3LJJA 3RU4E 3M61U 3A8AA 1BT7A 5AVDA 2D26C 3U1IB 5CE1A 4IGDA 4AB8A 1AVGH 4CRAA 1GI9B 1P02A 3VB5A 2NU3E 1COWD 4CREA 3GY7A 1XKAC 4KTCA 3M5NA 2G00A 2FDAA 1GI2A 4YOGA 1AZZA 1PPBH 1QBOA 1T8NA 2ANWA 1FAKH 2K8IA 3MH6A 4H6SB 4Y0YE 2XBXA 5ETXA 5FX6A 3GCHB 3UREA 1GBKA 1KXEA 6CHAC 1C5QA 1TGCA 2VU8E 1GL1A 4I8KA 5F53A 1RRKA 1C2HA 1BB0B 4ZH8A 2G81E 3ZZ5A 2G51A 1SGDE 3MOCA 1V2KT 2H9EH 4CH2B 1CO7E 1MBQA 4U30A 1TBZH 1OP0A 4RSPA 1YCPM 1GPZA 2AEIH 1BRCE 1F0UA 2FP7B 5H4IB 1O5FH 5B6LA 3SNEA 3TK6A 2B0FA 5HMAA 1O2YA 1DICA 2V0BA 3T29A 3O8DA 3ZIAD 2BZ6H 1JOUB 2FESH 1L4DA 1AIXH 2HPPH 1ZR0A 2ZFTA 1EJAA 3PLPA 1TNIA 4K1EA 1ANDA 3SO3A 1SGFG 2EI6A 2OBOA 1GHAG 5G4BA 2KR7A 1Y5AT 2ULLA 5PTPA 4UONA 2WPIS 3P70B 4CHAB 2Z6BD 1LVYA 1G30B 5ESTE 1W0YH 1XKBC 1QA0A 2BLOA 2Z3EA 4GVUA 2Y5HA 1B5GH 2VIVA 2FI4E 3LT3A 3SU0A 1PPEE 2WPJS 1IQGA 3BTDE 2GKVE 1LMWB 1Y5BT 1FLEE 1VGCB 2O8TA 1E0FD 1AD8H 5BRRE 1C5VA 3PMBB 1CE5A 1ZYOA 4DCDA 1LO6A 3U28C 1C2KA 3RXTA 4Z6AH 1E34B 1GHYH 3TNTA 5EJLA 1BMLA 3MFJA 4I7YH 3MNXA 5EQSA 1P06A 2AMPA 2BM2A 2BDHA 1C2IA 1J8AA 1YBWA 5K0HA 1NBME 1FPHH 3CNRA 2B9LA 3GCHC 1HLTH 1XXDA 3OU0A 1TGNA 1UO6A 3RXCA 1PPGE 2FS9A 4X6OA 1Z71A 4RT0A 4YXWD 1EJMA 1JWTA 4CRFA 1KMHB 1Q31A 1P9SA 3OYPA 1LCYA 2QAAA 4NSVA 1C2FA 1DITH 3U98H 2W7SA 1FN8A 1JIMA 4Z0KA 2FS8A 4JZEH 4NGAH 2JKHA 2GP9B 3FP8E 7GCHG 3K6ZA 4I8LA 1WBGB 1UTKA 3GDSA 4I8GA 2B5TB 2QXJA 5EXNA 1HAOH 3ODDA 3I78A 4AC9A 2A5KA 2J98B 4ISLA 2R3YA 4CHAC 3SNAA 2LP6A 1TX6A 5EQRA 1QL8A 1NN6A 3EE0B 2R2MB 3VG8A 3PMAB 4ZUHA 2BVXH 1TPSA 1OWDA 1S6LA 3MU0A 2BDIA 1RTLA 2OTVA 4U32A 1SGTA 1JIRA 2J98A 1VGCC 2I6SA 2GT7A 2AMDA 1D4PB 5FPSA 1W13U 4P02A 5EODA 2NU0E 3OY6U 2YNBA 2VJ1A 1DVAH 1C5MD 3SNBA 1F92A 1WSSH 1HYLA 2RA0A 1C1NA 3O8BA 1C5OH 1GGDB 1QL7A 1QURH 3MU5A 3SQHE 1XX9A 1AWHB 1P2QA 1SHYA 3BTME 4E7RG 5LPRA 3DFLA 2ZQ2A 1S0QA 3S9CA 1MAYA 4LXBH 1C1UH 2D1JA 3ZZ7A 1SOZA 1O2KA 3NWUA 2Z9IA 5E0HA 4DOQA 3T2NA 3KGPA 3OEHD 4GCHF 2XNIA 2KCYA 1GMDF 4HGCA 1IQKA 4LOYH 4UFFH 1D3PB 1GBLA 5L2YH 1P01A 1ZTKA 1JXPA 1GHBF 1YCPK 2HNTF 2ZP0H 3KN2A 3Q3KA 1OYTH 1KSNA 1Z8JB 2B7DH 4E7NA 3M3VA 2ESTE 2EEKA 3FFGA 4WY3A 4B2BA 3SV8A 5ESBA 2H6MA 4D7GA 3SGAE 1EZSC 1AO5A 3P8NA 1QIXB 1SG8B 1VR1H 3ODFA 1E1QD 1C1TA 1V2QT 2V35A 1GJ7B 2ZZUH 2A7CA 5GDSH 1ZZZA 2PWXA 1TFXA 5FX5A 4H42U 2A45B 1XM1A 1O2SA 2A5IA 4SGAE 4XD7D 1AKSB 3ELAH 1V2UT 1TX7A 3A84A 1EQ9A 1BMAA 2F9PA 1YPEH 1PQ5A 5EPNA 1QGFA 4NA9H 1JMOH 2PW8H 2ZO3H 4B1TA 1GDQA 3RUOA 1CGHA 3HATH 3HKIB 2AIPA 2PFEA 3OAAD 3KQBA 1LQDB 4X2YA 1AKSA 1NRSH 2PKAB 1GBIA 4Y79A 3VB7A 1O2XA 5JB8S 2EY4C 2Z94A 1EJNA 1GGDC 1QB1A 2BQ6B 1SL3A 2VIDA 3WWBA 4GUXA 5GCHG 4MNXA 1A5GH 1CQQA 1E36B 1DLKB 1KLJH 1UCYH 2PKAA 3SGQE 3L33A 2FOHA 2BY9X 3MNCA 1C5XB 3LGVA 5DP9A 1AGJA 4YT6H 4X6NA 2ZU2A 1ELEE 1OPHB 3TLOA 3GS9A 5FPTA 3TGJE 4MQAA 3GICB 3Q77A 3QZRA 4D7FA 1KXAA 3ZZBA 1HPGA 1W12U 2ZIQH 4BTTB 1P2IA 1J17T 4D76A 4KTUA 1YPLH 1YM0A 1Y3XA 3MI4A 3LC5A 3VB3A 4NCYA 1BHXB 2ZGCA 1NFYA 3M7QA 1HAIH 2BD7A 1D6RA 8ESTE 3SJIA 2ZFRH 4ABDA 1HIAB 1KLIH 3F9FA 2ZDLA 1HBTH 1C4V2 3EYDA 1OSSA 3P95A 2XC0A 4BTIB 2ZFSA 2BD4A 2KM0A 3EAJA 5EJ1A 3DUXH 2LNCA 1MD7A 2GDEH 3PB1E 2C93B 2GVFA 1ELTA 1GI0A 2IJD1 1RGQA 1GI4A 2DE8A 2ZGBH 1IQEA 1O5BB 1HIAA 1KTTB 3A7TA 4MTBA 4YO9A 3TH4H 4B76A 1FY4A 3ZVFA 4XDEA 1MZAA 4R8TB 3M3SA 3NUMA 3STIA 1F5KU 1SMFE 1PQ8A 3SUGA 4OGXA 3T5FH 3UNQA 1A5IA 1O3FA 1GHAF 4YM9A 5F03A 1AFEH 1G3CA 2CXVA 1K28D 3PMHB 1F5RA 1BBRK 1B7XB 2KAIB 2XTTB 1O2QA 3UFAA 1V2MT 3GDUA 4MLFB 1P2KA 4X2VA 1OP2A 2PUXB 1A3BH 3GYLB 3QK1A 4A1XA 4D9QA 3OSYA 4FVBA 4OGYA 1LPZB 2A32A 3GY2A 2QXHA 4Y8YA 3LH3A 1QNJA 1NPMA 3KYGA 2H5DA 2KAIA 3NK8A 4B75A 4MDSA 2GDDA 2FXRA 3U69H 1N6YA 2PTCE 2C8XB 2XBVA 2BY5X 1BTHH 1IQMA 3D23A 5E2OA 1RTKA 1ZHMA 2GCHF 3LIWA 2WPKS 2FTMA 1AUJA 4DURA 3S9BA 1BUIA 1QRXA 2V7QD 1EOJA 1C9PA 2C3SA 2FM2A 1YPGH 2FZZA 2O8UA 3MNSA 3TH2H 2CN0H 4WMDA 2BQ7B 1KYNA 2VBCA 2VNTA 2ZTYA 1ELAA 4A5TS 4BNRA 4TWYA 2JJ2D 1HAZB 1LPGB 3F2HA 4KP0A 3LONA 3SU5A 3ZV9A 2O8WA 1LVBA 1DLEA 2GZ7A 1EOLA 3TGIE 3QWCH 3ZZCA 4JK6A 2J95A 1CA0B 1TYNA 2G55A 3ZVEA 2HLDD 4ZKSU 2SNWA 1SI5H 1NC6A 1IQNA 1EZXC 3OTPA 7GCHF 3RC4A 1Z8IB 2J5UA 3LH1A 4SGBE 1TNHA 1P2NA 1P04A 1L1NA 2WPLS 3PV5A 1FUJA 1ZMJA 1DXWA 2WYGA 4X8UH 1YYY1 3KNXA 1H8IH 5KGOA 2PHBA 1FNIA 2ZF0H 1OS8A 4FVDA 4IW4E 2LELA 3CS7A 5DPAA 2GZ9A 1ZSJA 1NT1A 2P95A 1P05A 5F8ZA 1SLUB 5C1UA 3GISB 1B0EA 3GY4A 1AQ7A 3LDXH 3K65B 1EB2A 1C2GA 3RM0H 4IBLH 2FOMB 1WV7H 1P2MA 5DP5A 1KDQB 1U6QA 4I86A 2C8ZB 3MU8A 1EAWA 1A1RA 2HLCA 2CHAB 1ANCA 1P09A 3ENSB 3QTVH 3KHVA 1UVOA 4INLA 1CA8B 4NA7A 1TMTH 1G9IE 2W6ID 1VITG 1OWKA 2ZQ1A 4WF8A 1AVWA 3A8CA 1HJ8A 1LKBA 1O31A 2R2WU 2ASUB 1GI5A 3V13A 1HAXB 1KDQA 1NZQH 4JYTA 5E2PA 1P9UA 1FPCH 1V6DA 4MPWA 1XXFA 2GV6A 1GMHG 3TU7H 5ABWA 1ORFA 2G4UA 1O37A 4K8YA 2EC9H 1WQSA 1WTGH 2H1UA 1LHGH 4GLYA 2UUJB 1F5LA 1WCZA 4X2WA 5T6DA 2BLQA 3ZVCA 5FHTA 4B73A 3OTJE 5C1YA 1W10U 1Z7KA 1YLDA 2KX4A 3DT0H 1LHEH 2FOCA 1S85A 1DY9A 1KXDA 5F8XA 4ZKOU 1RTFB 4WXVA 3AAVA 1XUIA 5DP7A 3FKSD 4ZKNU 4DW2U 1Q3XA 3U8OH 2F9VA 1XVOA 1GDUA 2F43B 1IQIA 4VGCB 1V2OT 1Z6EA 1SGYE 1CT0E 5T6GA 2FOGA 2XYAA 2ANMH 1C1WH 2Q6DA 1HJAC 4O97A 2RDLA 4IN2A 1ETTH 1G3EA 3LGUA 1TGSZ 1O3KA 2R9PA 4XSKU 1PPZA 2P3UB 3L6PA 1VZQH 1TNKA 2SFAA 2A7HA 3P8GA 1ETSH 5FBIA 1KY9A 1P03A 1ABJH 1TNJA 3DSOA 9ESTA 1ACBE 3EQ0H 1O2IA 3RXAA 1TOMH 1L2EA 2C90B 1C5UA 1EZUC 3SZEA 4CBNA 3RU4D 1SSXA 1THRH 4NG9H 3PRDA 4X1QU 2W6JD 1FXYA 2VWLA 3SZNA 1JBUH 3ATIA 5J4QA 3TVJB 2AYWA 4BAQB 5GCHF 5LH8A 4TPYA 1KXFA 4FUIA 2KCOA 1SGEE 1C1PA 1N1LA 2Z9JA 2GZ8A 3KEEA 1CHGA 2VB0A 2XNDD 3F9HA 2ZDAH 3BTTE 1FJSA 1O2ZA 1EZQA 2F9OA 4I8HA 3T27A 3ZVAA 1C4U2 3HK6B 1HAYB 1K0HA 3C1KA 5B6OA 2V6NA 3BTWE 3UY9A 4NIWA 4ZXYH 2ZDMA 1WU1A 5BPEA 4XE4A 1CT4E 2HNTC 2VH0A 1AUTC 2FOFA 1CT2E 2JH0D 3UQVA 1F0SA 2ILNA 4F49A 4WXIA 3WW7A 1AHTH 4Q4LA 1S6HA 3PMJA 3SV2H 3F6UH 4ZKRU 8GCHF 1L0ZA 2G5NA 3UOPA 1UK2A 4VGCC 3RXSA 5HYOA 1MKWK 4ABHA 1SQOA 2H2ZA 1N8OB 3U1JB 4Y71A 1NO9H 1C9TA 4AB9A 2VIWA 1DANH 4RI0A 2JDID 3AW1A 3TNSA 2EI7A 4FUEA 3ZZ4A 1YY3A 4DJZB 1C5ZB 1W3CA 3ZYEA 2QF3A 5GJ4B 1O0DH 2HPQH 4A6LA 1OHHD 1GCTB 4CR9A 5C94A 1W7XH 1XUFA 5HM2A 4DVAU 1UW7A 3RXVA 2HVXA 3ATKA 1DPOA 1GJBB 1YPMH 1TQ0B 2GMTB 1LKAA 4LZ4B 3PLKA 3QO6A 2Z3DA 1NFWA 1SB1H 3PV2A 1UMAH 3HGPA 3A7XA 1LTOA 1MKXK 3UB0A 5EXLA 1TPOA 3QLPH 1X7AC 3QGNB 1AFQB 1UTNA 1O5EH 4ZROA 4ISIH 1LHFH 1Y3VA 2TGPZ 1TE0A 1AVXA 1C1SA 3BIUH 1C1OA 3RM2H 1H8ED 1S6FA 5IDKA 1FDPA 5F6MA 2P93A 2Z9LA 4M9FA 2VWNA 1O3GA 4I31A 1K22H 1SR5C 2ZPSA 5A09A 5SGAE 3M5OA 3PWBA 1A0LA 1BBRE 3OFND 4K1TA 6LPRA 2ZFFH 3E6PH 1AZ8A 2BY7X 5HXFA 2UUFB 1C5SA 1CBWB 1C5YB 2R0KA 2BDYA 2QYIA 1O2HA 1AWFH 3DA9B 3VGCB 4Q7ZA 1B0FA 1ZRBA 3F1SB 1E1RD 1SFQB 1TONA 2ALVA 5TJXA 4HG6A 1SFIA 1ZLRA 1N8OC 2ZFQH 1NRQH 5L6NH 1P10A 2W3IA 2J97A 4E06H 4ABFA 1FY8E 4ASHA 7ESTE 2OQ5A 3KL6A 2BDAA 2QF5A 3MO3A 5EGMA 5EU8A 4OS4A 1ZHRA 4FUGA 1O2JA 4O3TA 1MU8B 4RKOB 1TNLA 4AOQA 3RXFA 1DDJA 1ZGIA 2ZHQH 3GCTF 5A0AE 3BSQA 5FAHA 1TBRH 1VCWA 1GCTC 1MCTA 2OLGA 3SU4A 2RDEA 3U8RH 2ODYB 4FXGH 2ZA5A 4H6TA 2HOBA 1H1BA 1QJ7B 1O33A 3H7TA 2VIPA 2OQUA 1IQHA 1C5RA 3RC5A 2GMTC 3SHAH 2D8WA 1GBCA 1EX3A 5DJ7A 3E0PB 2OD3B 2P8OB 1NESE 4MPUA 4F48B 1GVZA 3A81A 3A7YA 2NU2E 4BAKB 1XUHA 1AFQC 4Y76A 1QQ4A 2F83A 4X1PU 2A4GA 2EQNA 2BB4A 2P59A 2XC5A 1FY1A 1J16A 2Z3CA 4UFGH 4ZCNA 1BMNH 2QC2A 2OBQA 2Y6TA 3S9AA 2RFKC 2XWAA 1D9IA 2BMGB 2F9BH 2F3CE 3P8OA 3N7EA 2SGDE 2UWLA 3DSPA 5T3HA 4WVPE 1DS2E 2FEQH 3SU1A 1GMCG 1TIOA 6GCHG 1LVMA 1DSTA 4TSFD 1DM4B 2OK5A 1HB0B 1CBWC 1W8BH 4NWLA 3STJA 5EXMA 3VGCC 5LPEA 3FO8D 1L1GA 2EA3A 2FYRA 3BTEE 1TRNA 4KKDA 1T8OA 1OWJA 3FP6E 2JETB 5GWZA 1H9LB 2ZEBA 3ZVGA 3UPEA 1T8LA 1A4WH 1YPJH 2FOBA 3VFEA 1Y8TA 4X1NU 4WH8A 5LGOA 1FN6A 1HUTH 1BTWA 1JRSA 4TWWA 2FLBH 1QRWA 1Y5UT 2FOEA 3RXOA 1Q2WA 1EB1H 1P3CA 2CK3D 1GMHF 1O2PA 3E90B 3KQ5A 1ZJDA 1FIWA 1O39A 3T62A 2BDGA 1CHOF 3ZYDA 5CMXH 2VWMA 3E1XB 1DXPA 1H4WA 2DUCA 4FUBA 4AFUA 7KMEH 2CV3A 2PTNA 3A82A 1EAIA 1TA2A 1YWUA 1GBBA 3P6ZB 2P8OC 2NU4E 4FETA 4Y0ZE 2G8TA 3DFJA 1NFUA 3HGNA 1HRTH 1UK3A 1C2DA 3F2GA 3KF2A 1PYTD 4UFDH 1AB9B 3SUEA 2STBE 3SJ8A 1DFPA 1V2TT 2Y80A 2FI3E 2PV9B 5CDFE 1M9UA 1TAWA 3GY6A 1GJ8B 3SV9A 1MCVA 3RXDA 3MQKC 2BX3A 1MABB 1Y3YA 3SJKA 2ZU5A 2UUKB 5F8TA 1IOEA 1YPKH 3RC6A 4WMFA 1UK4A 2PP6A 4ISNA 1GBFA 2J92A 4XFQA 1P3EA 4NA8A 5E0GA 3GDVA 2TBSA 2QF0A 2G5VA 3TJOA 4Y8ZA 1NRPH 1FONA 1FMGA 1WOFA 5EPYA 1TGTA 1MQ6A 1ZJKA 5CHBA 4CRCA 1DUEA 1A61H 1HV7A 1IAUA 2BXUH 5A0CA 3T28A 4Q80A 4UFEH 1GHXH 1QR3E 2JETC 2J9NA 1XUKA 2Y82A 1ARBA 3ATMA 2ZGHA 3SUDA 3MH5A 4ABGA 1E38B 3BF6H 3OE7D 5AF9H 4FUHA 2C8WB 5GNDA 1O3EA 3A7WA 3U8TH 3H09A 1NRRH 2SGAA 4JYUH 2WV5A 5HIZA 1A0JA 1F7ZA 3BTFE 3ZV8A 3DSGA 3CENA 1FQ3A 4B2AA 1EPTB 1WTHD 2BD5A 3G01A 1OOKB 1YGCH 1H8HD 2ALPA 1C5TA 3F9EA 1A3EH 3IWMA 1SOTA 1C2EA 2ODQA 3IG6B 3ZZDA 4BXWA 1BRUP 1BOQA 2WPDD 1OX1A 3GY8A 1KXBA 3PRBA 2YMSB 4GAWA 4B71A 4AFZA 5HGGA 4JZDH 2XC4A 3UWJH 5JB9S 1G2LA 3MNBA 2AGEX 1IQFA 1EPTA 2OP9A 1GJ6A 1AB9C 4THNH 4LK4A 5LPFA 1BMFD 3AVZA 1E37B 5A8XA 2BHGA 5E8EH 5C3NA 3MMGA 2OCVB 4ISOA 2BY8X 2A1DB 2UWPA 2UWOA 2KCPA 3D62A 1O3DA 3OX7U 2AFQB 1XUJA 4ZHLU 1K1LA 3E91A 5A2MH 4BAOB 1W14U 4MPVA 3HKJB 2VWOA 2OC8A 1BIOA 1O5GH 2BX4A 1UVUH 1T4VH 1GBAA 1T32A 2BQWB 1W0KD 4MNVA 1GDNA 5C2ZA 4PROA 2BVRH 4A1VA 5JBAS 2JJ1D 4AYYB 2AIQA 4XBBA 1E79D 3NRLA 5EIYA 1TRYA 5DO4H 1GHZA 2WSSD 2Q6GA 1WYKA 4Y7BA 3VXEH 5DK1A 5C5NA 4ZAEA 1O3HA 1PPCE 1GBDA 1TX8A 3A7VA 2ANYA 1RXPA 1V2PT 3CP7A 1QZ8A 5T1VA 3P8FA 2TPIZ 1W11U 5C67A 2BXTH 1PPFE 1GWAA 1WUNH 4RKJB 4NIVA 2TRMA 4ZHAA 1O3MA 2DE9A 1EPTC 3M5LA 3RXIA 3ESTA 2V3MA 1CU1A 1TRMA 2ZECA 1RJXB 2GD4B 1SBWA 1LDTT 3CS0A 1BRBE 2W7UA 1WXRA 2YMSC 1VKYA 4Q7XA 3F2FA 4O3UA 1HAPH 3E0NB 2TIOA 1S83A 1SGIB 5AFZH 3SHCH 1BDAA 4NFEA 3KQDA 2J38A 1AY6H 4X8VH 4JMYA 4TPIZ 5DP6A 1F0TA 3PLBA 2TGTA 1MTNB 3K6YA 4I33A 4FU9A 1QJ6B 4ABBA 1DWEH 1NU9A 1O3LA 2CJIA 1NY22 2XXLA 5HKKD 1K1JA 1DUAA 3N7DA 3A8DA 5JPMH 1HJAB 1N6XA 1E35B 4A1TA 5TCCA 2F91A 3VB4A 2A31A 3SU2A 2SGQE 2WYJA 3RU4T 2IN2A 1UTOA 3SGBE 1TGBA 1TLDA 2ZHFH 1O2RA 2C4FH 4AFSA 1K2I1 3AASA 1ESTA 2FLRH 4BAMB 1UVTH 4A7IB 4GHTA 2PGQB 1Z8RA 3A88A 1O38A 1HNEE 3RXGA 4INHA
chains in the Genus database with same CATH topology
3NKKA 1ESAA 1J9CH 1INCA 4FUFA 1RFNA 1W2KH 2RA3A 1GBHA 1GHBG 4Y10E 1FAXA 5J4SA 1HAGE 3ZZAA 1GG6B 4CBOA 1EUFA 3SNDA 3AW0A 4BAHB 2H5CA 4DT7B 1Z1IA 2G4TA 1O5DH 2HRVA 5A8ZA 2HALA 2PR3A 4O9VA 3FP7E 3QZQA 2ZKSA 1UTPA 1OWIA 1EATA 1GMCF 6GCHF 3KIDU 1O30A 3GY5A 5IYTA 3VXFH 3IITA 4ABAA 3Q00A 3VEQB 1O3CA 1UTMA 3D65E 2BOHB 4ABIA 1ID5H 3V7TA 1MTNC 4AG2A 1HXFH 1LPKB 3BEUA 5FPYA 2VIQA 3ZZ3A 1NS3A 5DP3A 2FI5E 2AGGX 2HWLB 1GBJA 4X6PA 2WUBA 1O2MA 1A2CH 1ESBA 5C20A 4IN1A 3I29A 2NWNA 1GJ9B 4XOJA 3M35A 2QXIA 4NWKA 5EQQA 3E8LA 3SI3H 1QTFA 4Q7YA 2SGFE 1G2MA 2XRCA 1D3TB 1T4UH 3M36A 2BDCA 1UCYK 1L1JA 4MG3A 1YP9A 4OS7A 2ZTZA 3KQEA 3RMOH 3T26A 4HI3A 2CF8H 4JYVH 1PQ7A 4B2CA 2ZDVH 3T25A 1P8VC 4X0WU 4GHQA 4X8TH 5JBTA 1T7CA 8LPRA 2PLXA 1SGQE 1O32A 2TGAA 3D49H 4J1YA 4YT7H 2P3FH 1GG6C 2B8OH 2GCTB 1WAYB 4MPXA 1LHDH 1QJ1B 5DKMA 5DP4A 1AU8A 2A2XH 3M3TA 3RXLA 5TCAA 1A0HB 2ZU1A 4CRBA 1WQVH 2BOKA 2ZDKA 3BEFB 1MAXA 2IJOB 3HK3B 5FXLA 1AE8H 1DWBH 1O2TA 2BD3A 3RXBA 1CGIE 4D9RA 2BD8A 4KTSA 4JZIA 4O03A 3LGWA 4JZ1A 1ZPCA 3SU6A 1HDTH 5FBEA 1GI3A 3EA7A 1V3XA 3TK9A 3MH7A 1EXFA 1GHVH 1H9HE 1BTUA 3UOUA 1TQ7B 1O3OA 3MU1A 1G3DA 4K2YA 4CRGA 2FOAA 1P12E 1QL9A 1V2LT 1PFXC 3N7OA 2O9QA 1QRZA 2AH4X 1XMNB 2THFB 2GX4A 4FUCA 3UWIA 1ELDE 1Z6JH 4YLQH 4U01A 5A8YA 1NRNH 1C5PA 1ZPBA 1RS0A 3LU9B 4K69A 1C2JA 4OS6A 3TGKE 1SGRE 1C4Y2 2FX4A 1YF4A 2FIRH 1O3NA 1ZRKA 3TJUA 3RXUA 7LPRA 2F9UA 9LPRA 2JH6D 4WJG2 2A7JA 1ANBA 1C1QA 1J14A 1VITH 1ZSKA 3UR6A 4UEHH 3JZ1B 2P94A 2HNTE 3ITIA 5C5OA 2A2QH 3TIUA 4AORA 1MQ5A 3NZIA 4ZXXH 3V3MA 4KGAA 2ZNKH 1EKBB 3BN9A 1QBNA 1V2JT 1Y3UA 3TK5A 5L2ZH 2QIQA 1K1MA 4HFPB 2Y5GA 1THPB 2ZWLH 4RN6A 1C1MA 2W26A 3LJOA 3EA8A 2OC0A 2GCTC 4AGJA 1VJAU 2WPMS 4DGJA 2Y5FA 1DSUA 1DWDH 1OXGA 2BLVA 3A7ZA 4WMEA 4YLUA 3Q3XA 3RXPA 1UJ1A 2C8YB 4WH6A 3U9AH 1GL0E 3RXKA 1OP8A 1O2GH 1DWCH 3RXEA 2FPZA 3BEIB 1K1PA 2ZPQA 1T31A 1MTUA 1FIZA 1MMJN 1BBRH 1MTWA 1A7SA 3A80A 4ABJA 4NFFA 3E3TA 1VCPA 1EAUA 1RIWB 2GCHG 3DD2H 2Y81A 1TMUH 1K1OA 2WV4A 1A46H 1JRTA 2FWWA 4YZUA 3BTQE 2F9NA 4AX9H 5JYIA 1C2MA 1SGFA 4H4FA 2BVSH 2FO9A 1UVPA 1CVWH 5I25A 2ZTXA 3PTBA 1IQLA 1EP5A 5EOKA 4DG4A 1MTSA 3B8JA 3A87A 2ZHWH 4JZFH 2WPHS 2BTCE 1GBTA 2CGAA 1GJAB 1Z8GA 2XCFA 4KELA 4Y6DA 2P16A 1SLXB 2Z7FE 3MH4A 3R0FA 3UQOA 1FV9A 4ZHMU 2YNAA 1SGPE 2GGVB 1O34A 3QTOH 3W95A 1BJVA 2AS9A 1IHSH 2WINI 3SN8A 2FX6A 1D3DB 3WY8A 3SNCA 2VVUA 4BXSA 4Y7AA 2QA9E 1CGJE 3BTGE 5JDUB 2ZI2H 1XVMA 2ZHEH 4M7GA 1Z1JA 1ZHPA 2R0LA 4MNWA 1P11E 1LQEA 1P57B 2BYAX 1TPPA 5AHGH 2SNVA 3QDZB 3NPSA 2ZCHP 1MH0A 1BTPA 3S7HB 4D8NA 2K1QA 3GY3A 4BANB 2Y7XA 2GV7A 3PWCA 4AGKA 4I8JA 5A0BA 1H8DH 3LGIA 1RIWC 1GJ4H 3ATWA 2YOLA 3FVFB 2ZHDA 1BZXE 4WWYA 1NM6A 1ELCA 2EI8A 3Q76A 1AE5A 2M5TA 4K8BA 1J15A 2BD2A 1TWXB 2PUQH 1CSOE 1T8MA 1TA6A 4MNYA 2Z9KA 1KLTA 3S69A 3URDA 1ZGVA 1O2LA 2Q1JA 3H7OA 1OWEA 1TBQH 1FY5A 4DY7B 1VITF 4AG1A 1UTQA 2ZPRA 3M37A 2O8LA 2RCEA 1GJ5H 2QN5T 1GJCB 6ESTA 2BY6X 1ABIH 3A83A 4ISHH 2J34A 3PO1B 1ZTLA 2ZDNA 4LZ1H 5E0JA 1GBMA 1GI7B 3VPKA 1GI6A 3UTUH 3MYWA 4OS2A 3MHWU 3V12A 3L3TA 1PYTC 1QQUA 3MU4A 1UHBB 4GSOA 3SUFA 2OUAA 3TJVA 1KIGH 1O2WA 4R0IA 2V3OH 3K2UA 1W7GH 2FTLE 4IMQA 1BMMH 1BTXA 4E05H 2AMQA 3SJ9A 4XBDA 3SORA 4U2WA 3F9GA 2XBWA 3H5CB 3RXHA 3MTYA 3GCNA 2GT8A 1BITA 1UHBA 4UD9H 1THSH 2VIOA 4K60A 3SQEE 5I46H 3VB6A 1BJUA 3S0NA 1TB6H 1DT2A 2BD9A 1LHCH 3GCOA 3E16B 3EDXB 1F2SE 1K1IA 4F4OC 1UTJA 4ESTE 1HAHH 4B74A 2W3KA 1G36A 2QV1A 2OC1A 1TOCB 1YLCA 2QGRA 3QN7A 5T6FA 1P2OA 5L30H 1ELFA 1UCYE 5DG6A 4UE7H 3LGYA 2FODA 3W94A 1S81A 3Q3YA 3SW2B 1DOJA 1O3AA 1FI8A 4MVNA 2Q6FA 1HXEH 3UNRA 3RXQA 1OWHA 5GXPA 1TABE 3EGKH 3SV6A 1H9IE 4J2YB 1S82A 1GVLA 3AAUA 1EP6A 1KTSB 2QCYA 4BTUB 1TNGA 1DX5M 2SGPE 2HGTH 5DP8A 4NIYA 2XCNA 3PO1C 1BQYA 3UIRA 3GOVB 4YESB 1GI1A 4CRDA 4A92A 1O3IA 8GCHG 1O3BA 1GHWH 3BTKE 1F0RA 1LVOA 4K1SA 3EA9A 3B9FH 1HGTH 1BTZA 3TITA 2OINA 4CR5A 4GPGA 2VVVA 5JBBS 4AYVB 3URCA 2VH6A 1GCDA 3M7UA 2QXGA 3ZZ9A 1ZTJA 3ZVDA 4NZLA 3UUZA 1AMHA 3PYHA 4IS5A 2ZU3A 1C5WB 3FZZA 1SLVB 1YPHC 4ZMAH 4AFQA 4BOHA 1QBVH 4AZ2B 3BTHE 2BLWA 1GBEA 4IC5A 3QUMP 4FU7A 1UTLM 2J2UA 2OXSA 1MKWH 4DIHH 1EASA 2AGIX 2ZC9H 2XWBI 1QB9A 1ELBA 1C1RA 2FYQA 1O2VA 5CHAB 3OY5U 1D6WA 1TALA 3LOXA 2Y7ZA 1SGNE 1ZMNA 2PSXA 4YOJA 3MO9A 4NSYA 1QCPA 1O2UA 4K5ZA 1ETRH 2ANKH 1HCGA 2CMYA 1DE7H 3TJNA 2VINA 3A86A 1ZMLA 1YPHE 1V2NT 3SJOA 1KXCA 1K1NA 1G3BA 2BZAA 1HAVB 1MD8A 3BG4B 1FZZA 2XW9A 2Z9GA 3SBKA 1ELVA 1MKXH 4IC6A 3QGJA 3SI4H 4FUJA 1W0ZU 1XUGA 1NROH 3SU3A 3PV4A 1SHHB 4JCNA 1OYQA 3S7KB 1HAVA 3RMMH 5HM9A 5DGJA 1QA7A 1K21H 2ZU4A 1ZOMA 1PPHE 3TH3H 1MZDA 1SQAA 4K3JA 1K9OE 1SC8U 1RD3B 1QY6A 3FAOA 2ZCKP 3MWIU 3A85A 5FCKA 2RG3A 3GYMA 3PTNA 3ZZ8A 3GCTG 4YOIA 4YTAA 3LC3A 1OKXA 4X1RU 2ZGJA 4FUDA 3BG8A 4JK5A 2JH5D 2ZG0H 4NZQA 2P3TB 3QX5H 1QB6A 5EW1H 2NU1E 5GIBA 2A4QA 3RLWH 3BV9B 1V2RT 2J4IA 2VGCB 2A4OA 3RXMA 1TMBH 3O8RA 3K9XB 1IQJA 1O3PB 1S84A 4X6MA 2FMJA 4XBCA 4DIIH 5CHAC 2H9TH 2ZGXH 2PGBB 3NCLA 1ELGA 3ZVBA 5C1XA 2J94A 1O5CB 4HTCH 3SV7A 2ZCLP 4OS5A 1O2OA 1SQTA 3UNSA 1EAXA 1S0RA 4GCHG 1YKTA 1VCQA 1GMDG 1L4ZA 1D3QB 2SGEE 3LPRA 2AERH 3P17H 3M5MA 2PKSB 1HJ9A 3BG4C 2PSYA 2IOTA 1QFKH 3DHKH 4ABEA 1NFXA 3RMLH 3B23B 3LKWA 1PQAA 1FY3A 1BCUH 2STAE 3HPTB 1Y3WA 2BDBA 2UUYA 1VJ9U 1Y59T 2ZFPH 3A8BA 3ATLA 1BRAA 3I77A 3LGTA 2IPHA 2ODPA 8KME2 3KCGH 4UDWH 1C2LA 3P92A 4NIXA 1NTPA 1C5NH 2CF9H 5JBCS 5EG4A 1P0SH 1HFDA 4Q2KA 4X1SU 1ARCA 1C1VH 1MBMA 4X8SH 3RDZA 5K7RA 2V3HH 1MTVA 2OC7A 3FZDA 1G32B 3A89A 1PJPA 1UVSH 1V2VT 1BTYA 1O36A 1MU6B 1P2JA 4FU8A 1QHRB 3F68H 3RLYH 2WUCA 4I32A 2D2DA 3V0XA 2LPRA 1GVKB 1YCPH 1V2WT 6CHAB 2XBYA 3MO6A 1BA8B 1CHOG 2QY0B 3O8CA 1O5AB 2I6QA 2VVCA 4X2XA 1CA0C 1SGCA 2A5AA 4HZHA 3ZZ6A 2W5EA 2R3UA 2A0QB 2VGCC 2H9HA 3M7TA 3R3GB 5FCRA 1ANEA 1DY8A 1GJDB 3KQCA 1O3JA 4OS1A 1NU7B 2GTBA 3C27B 4CH8B 3BIVH 1S5SA 1SPJA 2TGDA 3UR9A 5EW2H 1IHTH 2G52A 1V2ST 4Y8XA 3RXJA 1A5HA 1O2NA 1GI8B 3PROA 3TPIZ 5AFYH 3RMNH 3SOSA 1MUEB 3JZ2B 2PKSC 4IMZA 1ZPZA 3RP2A 1C5LH 1TPAE 4TYDA 4QT8C 4TY7A 1AI8H 4Y11E 2A4RA 3PM3A 1AN1E 3NXPA 1YC0A 1G37A 4TY6A 1O35A 1SLWB 1BHXF 5GPIB 1ZSLA 2CHAC 1SVPA 2O8MA 3RXRA 3FANA 4AN7A 4INKA 3LJJA 3RU4E 3M61U 3A8AA 1BT7A 5AVDA 2D26C 3U1IB 5CE1A 4IGDA 4AB8A 1AVGH 4CRAA 1GI9B 1P02A 3VB5A 2NU3E 4CREA 3GY7A 1XKAC 4KTCA 3M5NA 2G00A 2FDAA 1GI2A 4YOGA 1AZZA 1PPBH 1QBOA 1T8NA 2ANWA 1FAKH 3MH6A 4H6SB 4Y0YE 2XBXA 5ETXA 5FX6A 3GCHB 3UREA 1GBKA 1KXEA 6CHAC 1C5QA 1TGCA 2VU8E 1GL1A 4I8KA 1RRKA 1C2HA 1BB0B 4ZH8A 2G81E 3ZZ5A 2G51A 1SGDE 3MOCA 1V2KT 2H9EH 4CH2B 1CO7E 1MBQA 4U30A 1TBZH 1OP0A 4RSPA 1YCPM 1GPZA 2AEIH 1BRCE 1F0UA 2FP7B 5H4IB 1O5FH 3SNEA 3TK6A 2B0FA 5HMAA 1O2YA 1DICA 2V0BA 3T29A 3O8DA 2BZ6H 1JOUB 2FESH 1L4DA 1AIXH 2HPPH 1ZR0A 2ZFTA 1EJAA 3PLPA 1TNIA 4K1EA 1ANDA 3SO3A 1SGFG 2EI6A 2OBOA 1GHAG 5G4BA 1Y5AT 2ULLA 5PTPA 4UONA 2WPIS 3P70B 4CHAB 2Z6BD 1LVYA 1G30B 5ESTE 1W0YH 1XKBC 1QA0A 2BLOA 2Z3EA 4GVUA 2Y5HA 1B5GH 2VIVA 2FI4E 3LT3A 3SU0A 1PPEE 2WPJS 1IQGA 3BTDE 2GKVE 1LMWB 1Y5BT 2O8TA 1FLEE 1VGCB 1E0FD 1AD8H 5BRRE 1C5VA 3PMBB 1CE5A 1ZYOA 4DCDA 1LO6A 1C2KA 3RXTA 4Z6AH 1E34B 1GHYH 3TNTA 1BMLA 3MFJA 4I7YH 3MNXA 5EQSA 1P06A 2AMPA 2BM2A 2BDHA 1C2IA 1J8AA 1YBWA 5K0HA 1FPHH 2B9LA 3GCHC 1HLTH 1XXDA 3OU0A 1TGNA 1UO6A 3RXCA 1PPGE 2FS9A 4X6OA 1Z71A 1EJMA 1JWTA 4CRFA 1Q31A 1P9SA 3OYPA 1LCYA 2QAAA 4NSVA 1C2FA 1DITH 3U98H 2W7SA 1FN8A 1JIMA 4Z0KA 2FS8A 4JZEH 4NGAH 2JKHA 2GP9B 3FP8E 7GCHG 3K6ZA 4I8LA 1WBGB 1UTKA 3GDSA 4I8GA 2B5TB 2QXJA 5EXNA 1HAOH 3ODDA 3I78A 2A5KA 4ISLA 2R3YA 4CHAC 3SNAA 1TX6A 5EQRA 1QL8A 1NN6A 3EE0B 2R2MB 3PMAB 4ZUHA 2BVXH 1TPSA 1OWDA 3MU0A 2BDIA 1RTLA 2OTVA 4U32A 1SGTA 1JIRA 1VGCC 2I6SA 2GT7A 2AMDA 1D4PB 5FPSA 1W13U 5EODA 2NU0E 3OY6U 2YNBA 2VJ1A 1DVAH 1C5MD 3SNBA 1F92A 1WSSH 1HYLA 2RA0A 1C1NA 3O8BA 1C5OH 1GGDB 1QL7A 1QURH 3MU5A 3SQHE 1XX9A 1AWHB 1P2QA 1SHYA 3BTME 4E7RG 5LPRA 3DFLA 2ZQ2A 1S0QA 3S9CA 1MAYA 4LXBH 1C1UH 2D1JA 3ZZ7A 1SOZA 1O2KA 3NWUA 2Z9IA 5E0HA 4DOQA 3T2NA 3KGPA 4GCHF 2XNIA