5PTPA

Structure of hydrolase (serine proteinase)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvent structure in crystals of trypsin determined by X-ray and neutron diffraction.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords BETA TRYPSIN
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA02
1GL1A 1TNIA 1UK4A 2ZTXA 1AD8H 2HVXA 3QUMP 3VB7A 4B73A 3SNDA 3A7YA 4D9QA 1V2ST 1D6RA 1LVBA 4A1VA 1MMJN 3TJOA 2AMQA 1VITF 1AVGH 1T31A 5A8YA 2XXLA 3UNSA 3CS0A 3SNEA 2Z94A 1C1QA 1ELFA 3GYMA 3IG6B 3LKWA 2FOGA 2ILNA 1W8BH 3MU5A 2AS9A 1G3DA 4B2BA 1W0ZU 2G4UA 1IQEA 3RXIA 2XCNA 2RG3A 5EQSA 1MAXA 1O37A 1SMFE 1ZPBA 2P95A 2PV9B 2V0BA 3KQBA 3NXPA 1GBEA 1BRBE 1GJCB 5GXPA 4X1QU 4AGKA 5DGJA 2F83A 1CA8B 5JYIA 2P3FH 4INLA 3RC6A 5GWZA 4RKJB 4XFQA 2QXIA 1E38B 1D6WA 1CBWB 1SGYE 5L2YH 1NROH 3P95A 3A7WA 2FM2A 1UVOA 3OY5U 3RDZA 1JOUB 1Y3UA 2JH6D 2W3IA 1TX7A 1Q31A 5DP4A 1GBTA 1GI8B 1C1MA 3BTME 1YF4A 1BJUA 1G36A 2C93B 3UFAA 3GDVA 3B23B 2XWBI 5AF9H 1MTSA 3UWIA 3KL6A 4ZHMU 5FCRA 1NRQH 1K1IA 1JBUH 1O31A 3RXRA 2ZHWH 2Y5HA 1FPHH 1AVXA 1C5SA 1LVOA 3ZZCA 2D2DA 3RUOA 2ULLA 3RXVA 5C1UA 2Z9KA 4AZ2B 2VINA 4MNWA 2ZDAH 3H7OA 3Q77A 2G51A 2NWNA 1SQOA 1MBMA 4DJZB 5DP9A 2AERH 3SN8A 3GCOA 1AB9C 3PWCA 4MNXA 1DSTA 1TFXA 1HUTH 3A8AA 5AVDA 2GZ7A 2SNWA 1C5UA 1EAXA 1DITH 1MKXH 1GG6B 3ATWA 2JH0D 3E0PB 3GYLB 4X8UH 2QC2A 3LONA 6CHAC 5DP8A 3I78A 4Y11E 5DK1A 1FNIA 5JDUB 1Z8RA 4ZMAH 5L2ZH 1DXWA 1SQAA 1P01A 3TK5A 4E7RG 1BHXF 1AVWA 3GOVB 1E34B 5IYTA 1V2QT 3QLPH 1GCTC 5PTPA 2NU3E 5EPNA 1RXPA 5K7RA 1OWEA 5E2OA 1TMBH 1S5SA 2FYRA 1D3PB 2VIOA 6GCHF 2HOBA 1XUJA 2A31A 1VITG 3R3GB 1DUAA 1K1PA 4X2WA 4FUIA 4I8LA 4NIVA 2BDBA 4X6MA 1C5XB 4CH8B 3RU4T 3SU3A 1GHZA 3SQHE 3W94A 2BX4A 3GISB 2WYGA 1BB0B 1UTNA 3MOCA 4MDSA 2Q6FA 2WPJS 4YZUA 3VB6A 1D3DB 3Q3XA 3HK6B 3LGIA 4UD9H 1KXEA 3MO9A 1RIWB 1IQLA 3BEUA 3UOPA 4TY7A 1HJ9A 5GJ4B 1NM6A 3L3TA 3M3VA 1KSNA 2PW8H 4XSKU 3S0NA 4NG9H 4CBOA 1CGIE 1HJ8A 1W12U 4CRFA 1C2DA 2ZPSA 1AN1E 1EPTC 3KQEA 1TIOA 2F9PA 4ASHA 4KP0A 3RXLA 3BG4B 1KYNA 4MQAA 1INCA 1DWDH 1EOJA 1OXGA 1GDUA 2W5EA 1CHOF 1GHXH 3NK8A 5LPRA 1J14A 1C9TA 5L30H 1OX1A 1BIOA 4Y8ZA 4IC5A 4WH6A 4ZKNU 3LGTA 1MU6B 1WSSH 3SV9A 1GVLA 4UDWH 4ISHH 1SSXA 2A2XH 1V2PT 4FU9A 3RC5A 2ESTE 3JZ1B 3ITIA 3ODDA 1N8OB 4OGYA 4I31A 3ZZ9A 1ZRKA 4ZHLU 2Y5GA 1PQ8A 1GI3A 4UE7H 1C1VH 1GMHG 3M36A 2ZA5A 1V2NT 1TQ0B 1O5BB 3SZNA 1GBCA 2C8XB 2KAIB 4OS6A 1GI6A 2GX4A 2A4GA 3D49H 2SGDE 5DP6A 1CGJE 2P93A 3A7XA 2XCFA 1QBVH 2ZNKH 4A6LA 2TGAA 2FO9A 2XBYA 2XBVA 5HM2A 1O5AB 1IQJA 1O2QA 2CF8H 2VU8E 4MPUA 1U6QA 2GCHF 5EXNA 1FONA 1C5QA 1NFUA 3KCGH 1C1NA 2V6NA 1VZQH 1AI8H 1KXBA 4MTBA 1OWJA 3O8CA 2AEIH 4FUFA 1SFQB 6ESTA 2PUXB 2BB4A 2BXUH 1TPAE 2ZWLH 3HGNA 4MG3A 1O3KA 2ZFRH 2HWLB 3SI4H 1L4DA 1TX8A 3U9AH 1FI8A 1S6HA 1TNGA 5CHAC 4ZHAA 2BLQA 1ZRBA 5TCAA 4K1TA 1QRWA 1BOQA 1TMUH 1ZGIA 4BTTB 1TB6H 2BD3A 3P70B 3SNAA 1GBLA 2OXSA 2ZDMA 5C2ZA 1XXFA 4GAWA 5ESTE 2BXTH 1ZPZA 3RXDA 4H6SB 2FIRH 1G9IE 1C1OA 1W10U 5L6NH 4A5TS 1HRTH 4NCYA 1SGIB 3P92A 1QBNA 1GBIA 3FANA 1H9LB 2BD2A 2EI6A 1IQMA 1F5RA 3ZVEA 1GMCF 3GCNA 2WPHS 5EG4A 1PPEE 5F8ZA 2ZI2H 3D23A 5F03A 5A0AE 1V2LT 2H2ZA 2FI5E 3PM3A 3HKIB 1V2OT 1DPOA 2BTCE 1TALA 1GHAG 2AGIX 3T28A 1RIWC 5HM9A 4X0WU 1O3IA 5A09A 4XE4A 4JZ1A 2TGDA 3M5LA 1LCYA 3KN2A 4K3JA 2XRCA 4X1NU 4IN2A 1O2OA 3V12A 3BEIB 2VWMA 1P11E 1O0DH 1O3LA 1UVTH 1P0SH 1C1SA 2OC8A 4ZXYH 1ELDE 1PYTD 1Z1JA 2FX4A 5EODA 1Z6EA 3LT3A 1W3CA 5DJ7A 4SGAE 3VB4A 2GP9B 3O8DA 3KGPA 3V0XA 1QNJA 4MPXA 5SGAE 1O5FH 1TONA 2ANWA 2STBE 3ATIA 5DO4H 1UTOA 4FU7A 1C2KA 1O34A 1HYLA 2H9TH 4DURA 4AN7A 1K1MA 5DP3A 1TPPA 4X6NA 3ZZDA 4E05H 1D9IA 2A7HA 1UTPA 1GI5A 1NT1A 1V2WT 4H42U 2XC0A 4KELA 1UTQA 1VCWA 1SGQE 2A4OA 1C2LA 3AAUA 3OTJE 1UO6A 3M3TA 1O2ZA 2HPQH 4ZXXH 4KGAA 1AHTH 3ZVBA 2H6MA 1KLTA 2BLVA 3GCTG 1C1UH 1ARBA 2H9EH 5EW2H 4O03A 2GMTC 4GUXA 3SBKA 4JYUH 1YLCA 1JRTA 2GCTB 1SB1H 1AQ7A 1C9PA 1T4UH 1OWDA 1TABE 2J34A 3GY3A 1HAVA 2KAIA 4IMQA 4MNVA 4D7GA 3BTDE 1DWCH 4DW2U 1J15A 4O97A 3TH3H 3QK1A 2THFB 2FOFA 3GY8A 4ABBA 5AFZH 1HNEE 2O8TA 2IN2A 1E0FD 3ZZ4A 2FODA 2ODYB 2ZTZA 2EC9H 3NCLA 3VGCC 1YCPH 2VIPA 1BJVA 1TBQH 1FY8E 4F4OC 5JBTA 3F68H 4BAQB 2H1UA 3ODFA 5E2PA 2GTBA 1MKWH 1W7XH 2Y7XA 4TPYA 3RMMH 2OQ5A 2PGQB 2PFEA 2UUFB 2WPIS 3K6YA 3LH1A 2GDDA 2A7CA 1YPGH 2BD5A 1RTKA 4ABGA 4SGBE 4BAHB 3RXGA 4DGJA 3MTYA 3SGBE 8GCHG 2GCTC 1BTHH 1N6YA 1VR1H 2VB0A 2Y5FA 1O39A 4PROA 1O2SA 2Y82A 1ZYOA 2RA3A 1SGDE 3LJJA 1QJ7B 4GVUA 1LDTT 5C1XA 4X8VH 1GHAF 1VCPA 2ANKH 4ESTE 1JWTA 1FIZA 3GCHB 5LPFA 4GCHF 2ZU2A 3RMNH 1UCYH 4I8GA 1O33A 3K9XB 2CMYA 2XWAA 5B6OA 4ISOA 5FPTA 3SU0A 1MTUA 1H4WA 5CHAB 2ASUB 7LPRA 2ZKSA 4TWYA 3TK6A 2UWOA 1EUFA 1BCUH 1GL0E 4YTAA 3QWCH 1T8LA 1W7GH 7ESTE 3ZYDA 1GCDA 3PV4A 4ZKOU 3UY9A 3KNXA 3M7UA 3TGIE 1O38A 1UK2A 1SG8B 2EI8A 3MFJA 2CHAB 4Y76A 3TLOA 4E06H 1BRUP 3UNRA 1NU9A 1GMHF 5FX6A 2BZ6H 2OP9A 3F9GA 1AKSA 1ELEE 2NU2E 2C4FH 4ABJA 1SI5H 3FZDA 2XTTB 2FWWA 4ABIA 3E16B 3SHAH 2BDYA 2BDAA 3LOXA 3TNSA 5JBCS 2C3SA 4BOHA 4WMEA 4YLQH 1C5PA 7KMEH 1ELGA 3VFEA 1V2KT 1LPKB 1Q3XA 3EDXB 1YPMH 5AHGH 2Z3DA 1SLXB 1BRAA 1KXFA 3M37A 3TIUA 2GT7A 1QFKH 2PR3A 1HXFH 3EQ0H 1NN6A 4D76A 2F9BH 3TJVA 1O3EA 1C4V2 2P3UB 2O8WA 3EA9A 4YO9A 2VWNA 3B8JA 3IWMA 3QTOH 1NS3A 3E90B 4CR9A 2BYAX 5I25A 3P8NA 1C2FA 5E0JA 1TX6A 1T8OA 4CR5A 1PYTC 4B1TA 1OYTH 3UR6A 4M7GA 2ZGXH 1YCPK 4LXBH 3M5NA 1ETTH 1KDQB 1N6XA 1ZTKA 1S84A 4LOYH 1C5MD 1DY8A 1F5KU 1VGCB 3KEEA 3RM2H 1GBFA 4U30A 2QY0B 3Q76A 1GI4A 1F0RA 1FUJA 1AWHB 1EAIA 1MKWK 1P09A 1GWAA 2O8MA 2PWXA 4B71A 2QIQA 2W26A 2B5TB 6CHAB 5DKMA 4DVAU 5E8EH 1YYY1 2WPKS 2BDHA 3F1SB 3OY6U 4FUCA 2PKSB 3SUGA 1EZUC 2WUBA 4TWWA 1AGJA 1HJAB 1Y8TA 4X1PU 1EX3A 2ZPQA 5JPMH 4YOIA 5FHTA 4NA7A 1AUJA 4CREA 2SGEE 1QL8A 2GCHG 3ZVDA 3K6ZA 4Z6AH 2BLOA 1L1JA 1LHDH 4AOQA 5HXFA 2D8WA 4VGCC 2OD3B 1VJAU 3M7QA 1DLKB 3MU4A 2A5AA 3RXHA 3FFGA 1UTLM 1MUEB 2Y6TA 3UIRA 4TYDA 1UHBB 2ALPA 1E36B 3SJOA 3S9BA 2GMTB 5TCCA 1YC0A 4Y8XA 1UMAH 2VNTA 2HPPH 1BA8B 1QA7A 1Q2WA 1WTGH 4YOGA 1EB1H 1PPGE 4FUDA 3RXMA 5J4SA 2BX3A 2CJIA 4ZAEA 3RXTA 2FOBA 1IQHA 1EJMA 3QDZB 3RXOA 2DE9A 1G30B 3MNSA 1CA0C 1MZDA 2ZP0H 4O3UA 3ZVFA 4I8HA 1W0YH 1ETRH 1K1OA 3A85A 1C5NH 3ENSB 2XNIA 1KXCA 1GHWH 2XC5A 2Z3CA 4ISLA 3UWJH 2R9PA 1WTHD 1P2MA 1OP0A 3FZZA 1DE7H 1C2GA 2ZCLP 4THNH 3RP2A 1ZR0A 3VXEH 1FZZA 2A7JA 1A2CH 3ZVGA 1BMLA 1GMCG 5C20A 2HNTC 1H9HE 1O2WA 4MLFB 4B75A 2J95A 4HFPB 1SHHB 2AIQA 1LTOA 2P94A 5ABWA 3PMAB 1C5LH 4ABFA 4ISNA 2ZDVH 2A5KA 1BMNH 3GICB 4AX9H 1J16A 1TNLA 2CN0H 1FAXA 1GHBG 2QN5T 3RXPA 4Y7AA 1O3FA 3ZVCA 3U98H 3E1XB 3NZIA 3RM0H 1ANEA 1XUHA 5DP5A 1A5IA 3SW2B 1O2VA 1T8NA 1TYNA 1F2SE 1AFQC 2H5CA 2ZFSA 3SNCA 3U69H 1ESBA 2ZFTA 2ZTYA 3HKJB 3SO3A 3VEQB 3MNBA 1O2YA 1OP8A 4JYTA 1SHYA 3AVZA 1G32B 5JBBS 2F91A 5LGOA 3RXKA 4Y8YA 2FYQA 1QHRB 1SGFG 2C8YB 2P8OB 1P3EA 2NU1E 1F0TA 1TPSA 5JB8S 3QO6A 1O5DH 1SLVB 2NU0E 4UFGH 1ZSLA 3RMOH 1SBWA 3SV7A 3NKKA 1HCGA 2A45B 4FVBA 3S7HB 4TPIZ 1DOJA 5T6GA 1IQGA 2OQUA 4X8SH 1PPZA 1FJSA 1XUGA 1TOMH 3M7TA 3SU2A 8GCHF 1MD7A 3PROA 1C1RA 1W14U 5JB9S 1MTNB 2VH0A 2ODQA 3A8BA 2ZFQH 1IAUA 4AFSA 3MU0A 3QZRA 5K0HA 4BAKB 2QF0A 1SGPE 2BOKA 1GJ5H 4X1SU 3T62A 1O5EH 1THSH 3GY2A 1SOZA 3OYPA 1A5HA 1DS2E 2WINI 1HAYB 2DUCA 1C5ZB 1HAVB 1HBTH 1TGSZ 4OS4A 4TY6A 2O9QA 4AGJA 1KIGH 4D9RA 1SLWB 1GBBA 2ALVA 1TOCB 2A5IA 2ZCKP 3QGNB 4VGCB 1KDQA 2HRVA 3EYDA 4AB9A 1LVMA 3MNXA 1TPOA 3ESTA 3PMBB 4F49A 3SUDA 1OYQA 1XMNB 2R2MB 4Y10E 3BIVH 4UFEH 1GGDC 1AMHA 1AO5A 3ZZ6A 1F5LA 3A89A 1CU1A 3PMHB 4AYYB 1HV7A 1EZXC 3SUFA 1O2XA 3A8DA 3ATLA 1FQ3A 3UPEA 1O2PA 1YP9A 5FBIA 1T8MA 3DUXH 1A0HB 2ANMH 2A4QA 5DP7A 3M3SA 3GCHC 1ZTLA 3AAVA 2Y80A 1DVAH 1FLEE 2BHGA 2ODPA 3RC4A 2BLWA 1FN6A 3RXEA 4FVDA 1HPGA 1QGFA 1YPHC 2STAE 1YKTA 1GI9B 1THRH 1Z6JH 3L33A 1Z8IB 4X6OA 3U8TH 1TRYA 3ZV9A 5GDSH 1QRZA 4MNYA 4Q2KA 4UONA 2VIVA 2BQ7B 4GCHG 1N1LA 1UHBA 2QV1A 4INKA 2G55A 1DT2A 2ZU1A 1CT2E 1GJ8B 2FS8A 1SL3A 4NA9H 2BD7A 2WUCA 3UR9A 1RTFB 1UK3A 1YPHE 4JZDH 2O8LA 4ZROA 1DANH 1HAOH 1CA0B 3V3MA 1NESE 2VH6A 2FOAA 3SU6A 2G81E 4NGAH 3URCA 1A46H 3ZYEA 1L1GA 1DM4B 1P2IA 2B0FA 1FN8A 1T7CA 3QN7A 1PQAA 1WOFA 1ZHPA 2PSXA 5EGMA 2OTVA 2G52A 3T29A 2HGTH 1BQYA 5GCHF 1P3CA 1P12E 2F9VA 4I32A 3K2UA 1O3OA 4FUBA 1E35B 3U1JB 1PPCE 1TBRH 1O3MA 3PLKA 2WPLS 3M61U 3BG4C 1S6FA 3LPRA 3BTTE 4AYVB 1FDPA 1CBWC 4OS1A 5ESBA 4GHTA 3KQCA 5T3HA 1C2EA 1O3GA 2AIPA 1Y3YA 1ZMLA 2FLBH 1O3AA 5G4BA 3M35A 5AFYH 4JZIA 3LIWA 1OWIA 3MH4A 2PGBB 2SNVA 2V35A 1GBAA 3A88A 1FV9A 4Y79A 2WYJA 2ZQ2A 1EAWA 4FUGA 2B9LA 3A84A 1ACBE 4NSVA 1LKBA 2OC7A 4GSOA 1RGQA 4A1TA 1F92A 1LO6A 3H7TA 1O2RA 2HLCA 4K8YA 3RMLH 2PKSC 1YPKH 1P8VC 2BM2A 3UQOA 4Q80A 5HMAA 1GHVH 1S85A 2W7SA 1TNKA 2F9OA 1BMAA 1CHGA 5J4QA 1CE5A 1QQ4A 3TJNA 3ZV8A 4Q7ZA 1NPMA 3GY4A 1C1TA 3N7OA 1TWXB 1TLDA 2B8OH 3RXUA 3E8LA 2BQWB 2ZG0H 4H6TA 1LPZB 1DY9A 1P2OA 1FPCH 4JZFH 4K5ZA 5BPEA 3NWUA 1TGCA 2QA9E 4JZEH 3TGJE 1QB9A 3R0FA 1TNJA 2BD8A 4JMYA 2A0QB 4WY3A 4K69A 3A7VA 1MU8B 4Y0ZE 2SGQE 1FY4A 2GV7A 3SJIA 2GDEH 2WV5A 2FXRA 3UNQA 1YPJH 2R0KA 3PMJA 1P2JA 3BTKE 1QBOA 1LQEA 2ZU5A 2ZDKA 3BN9A 1K1JA 3MMGA 1Y59T 2PTNA 3ATKA 1HXEH 1MTVA 2QXHA 1HDTH 2GVFA 4AG1A 3ATMA 3RXSA 2F9NA 4LZ1H 2QXGA 1TGBA 2OLGA 1AWFH 1O3PB 1VITH 2FTLE 4KTCA 3EE0B 1IOEA 3TNTA 5GPIB 1Z8GA 2ZC9H 3VXFH 1ABIH 3A83A 4JCNA 1IQFA 1K1NA 2VVVA 1AZZA 2SGFE 4NWLA 1D3QB 1O5GH 4ABHA 2HNTF 2AMDA 1O3HA 2C8ZB 3AW1A 1BT7A 3I29A 1A4WH 5LH8A 4D8NA 1PQ5A 2BMGB 1GGDB 2ZF0H 1UTKA 3T26A 2AYWA 2BVXH 1DSUA 1MTWA 2VWLA 1A7SA 3SHCH 1TGTA 3TPIZ 1THPB 1C5RA 1SVPA 1JIMA 3BTEE 1HLTH 4BNRA 2ZFPH 1BUIA 1AE5A 2AGGX 3TJUA 3OU0A 1J17T 3PTNA 1GJBB 1O30A 1P03A 3Q00A 2FOMB 2ZHFH 4R0IA 2TIOA 1O3CA 1QR3E 5EQRA 4CRGA 4CH2B 1B7XB 1DICA 1W13U 2YNBA 4INHA 3BSQA 3BTQE 2FI3E 4IMZA 3WY8A 5EQQA 1FY1A 4UFDH 1HAHH 1C1PA 4AORA 3LJOA 2DE8A 1D4PB 9LPRA 3SORA 4BAOB 3SUEA 1LQDB 1QTFA 2QAAA 4ABAA 1TMTH 3KF2A 1ZZZA 3P8FA 1ELTA 4Z0KA 4XDEA 2VIQA 3NUMA 3O8BA 4AFZA 1Y3VA 4GLYA 1QURH 1Y3WA 2Y7ZA 1SGRE 1EZQA 4FUEA 1SGFA 2P16A 4H4FA 4WJG2 3T2NA 3LGYA 1XVMA 2CF9H 3U8OH 2TRMA 2BY5X 2ZHDA 1V2JT 2BY9X 3LU9B 5F8TA 3PLPA 1AY6H 1LHEH 4CRBA 1MKXK 3BTWE 3RXQA 1EAUA 1O2IA 5F6MA 2QXJA 4UFFH 1GI7B 1YBWA 3DD2H 1NFYA 3AW0A 1DDJA 2R3UA 1O3DA 4QT8C 1ABJH 1BZXE 1SLUB 1XVOA 5C5NA 2G8TA 3FP6E 3GDSA 4YT6H 1NC6A 5CMXH 1C2HA 4GHQA 1UTMA 1K2I1 4A1XA 5FPYA 4IBLH 4IW4E 2BDGA 4J2YB 2Z7FE 3V13A 3KIDU 3SV6A 2ZO3H 1V2RT 2P3TB 3FVFB 2G5NA 4ZUHA 1C5YB 1V3XA 2OINA 5F8XA 5FBEA 1VJ9U 2D26C 1BITA 1GJ6A 3P8OA 1GI0A 1B5GH 3MU1A 2TGPZ 4U2WA 2SGPE 4YESB 7GCHG 1EP5A 2FEQH 2Z9LA 3H5CB 1DWEH 1AFEH 2AGEX 3VGCB 3CENA 3S69A 2Q1JA 2EA3A 1BTUA 1GJAB 1UVSH 1HFDA 3E0NB 1SPJA 1MQ5A 1PFXC 4ABEA 1NTPA 1V2MT 2CXVA 3LGVA 3PYHA 2J2UA 4YLUA 3MU8A 2J38A 3F6UH 3HK3B 1OKXA 1XUFA 3ELAH 3SQEE 2H9HA 1QL7A 3HGPA 4MVNA 1ESTA 1GPZA 4BXWA 1C2JA 1HAGE 3F9HA 3FP7E 4E7NA 2BDIA 4O3TA 1O36A 2FESH 4OS2A 2TGTA 3ZZ5A 1SC8U 5GCHG 4RKOB 5I46H 1QCPA 1GMDG 1PPBH 4WXVA 4NSYA 1BTPA 4WXIA 1KTTB 3TGKE 5E0HA 2OBOA 2VGCB 1PJPA 2ZECA 1GBHA 1YCPM 4BTUB 1QY6A 4MPVA 3U8RH 2ZGHA 1DUEA 2GT8A 4WF8A 3T27A 1B0FA 2XW9A 4DT7B 3PO1C 1V2VT 2XBXA 3ZVAA 4DG4A 4Q7XA 2TBSA 4I8KA 3SU5A 3O8RA 1H1BA 1KXDA 3LC5A 1Z7KA 1F7ZA 1SFIA 3BEFB 4WMDA 3Q3KA 3RXCA 3E6PH 3EA8A 1CSOE 3MH6A 2ZDNA 2G4TA 2F9UA 3MO6A 1MH0A 1NO9H 4NZLA 1QJ6B 4WVPE 2BOHB 1O2LA 1ZJKA 2FOCA 2JKHA 1MQ6A 3P17H 1T32A 4NWKA 1CGHA 1TNHA 1NZQH 2PTCE 4NFEA 1J8AA 2PHBA 3MHWU 4Y0YE 4A92A 1ARCA 4ZH8A 3VPKA 2Z9GA 2B7DH 1PQ7A 2FP7B 1FMGA 1MZAA 3C1KA 1ZOMA 1N8OC 1PPHE 1ZHMA 3NPSA 2ZZUH 2XYAA 3A87A 1GBMA 5EXMA 4XBCA 2ZHQH 1P05A 1KXAA 3SGQE 1LKAA 3FAOA 2BD9A 5A0BA 1ZGVA 1QB6A 1C5VA 2RCEA 4U32A 5A8ZA 5FCKA 1P06A 2FMJA 4NFFA 3OSYA 1K22H 2WPMS 1ORFA 5DG6A 4BTIB 4OS7A 2H5DA 1EKBB 2J4IA 4CHAC 1NRNH 1WAYB 1BBRK 1ESAA 5E0GA 2EI7A 1QIXB 3RXAA 2XC4A 7GCHF 3RU4E 1A61H 1D3TB 1EATA 1BBRE 1F0SA 5C1YA 4B2CA 4BXSA 4GPGA 1C4Y2 4K1SA 3DFJA 1EP6A 1TRNA 2JETB 3LC3A 1EB2A 1MD8A 1UTJA 5JBAS 1O2NA 4CBNA 2J94A 1WCZA 1P9SA 1A5GH 1L4ZA 4YOJA 3M5OA 1BDAA 1JMOH 1SGNE 1TA2A 2V3OH 3LGWA 4NZQA 3TK9A 1XM1A 2HALA 3SV2H 2ZHEH 3VB3A 5GIBA 3PWBA 1QRXA 3QZQA 2A4RA 1UVUH 1DLEA 1O5CB 4OS5A 4UEHH 1ANBA 1BTWA 3SU4A 1NFXA 2K1QA 4U01A 4B76A 2I6SA 1ANDA 4J1YA 1P2KA 1Y5AT 4X1RU 4YT7H 1OOKB 3QTVH 4JK5A 1ZJDA 2C90B 3MO3A 4CRCA 1EZSC 2OC0A 3A82A 2SFAA 2AFQB 2G00A 4XBBA 4YM9A 1C5TA 3GCTF 1XKBC 1UJ1A 1ZMNA 3RXJA 4AFQA 5BRRE 1K28D 3D62A 1ELAA 2QF3A 1YM0A 1JRSA 1E37B 1BHXB 1RFNA 2PSYA 4I8JA 2R0LA 4FUHA 1SQTA 4FXGH 1XUKA 1Z71A 1QA0A 1VCQA 1TA6A 1WBGB 1TAWA 1HAZB 1WQVH 2C8WB 4D7FA 2CHAC 4Y7BA 1C2IA 4NIWA 3A7TA 1WU1A 4O9VA 3UREA 5FAHA 3K65B 1OSSA 1M9UA 3U1IB 5HYOA 3A7ZA 1S83A 3QGJA 1NRSH 1Z8JB 2LPRA 1TQ7B 4HTCH 1G37A 2IJOB 1FAKH 2XBWA 1KTSB 3IITA 1MBQA 2J92A 2BVSH 4IGDA 4K1EA 3DHKH 1A0JA 1Y5BT 3GY5A 2QYIA 3KHVA 2VGCC 1GJ4H 1OWKA 4KTUA 2UUYA 1DXPA 1LHGH 2BZAA 2AH4X 1IHTH 1TE0A 4DY7B 1WV7H 3P8GA 3DA9B 1A3BH 2PKAA 3TVJB 3F9FA 2W7UA 2BY6X 3ZZ7A 2ZDLA 1PPFE 8ESTE 4B74A 3PO1B 2M5TA 1O2KA 2Q6GA 4KKDA 1AIXH 2A1DB 3STIA 1F0UA 1ZHRA 3E3TA 4IS5A 2VJ1A 2I6QA 2RDLA 2QGRA 1ZPCA 1DWBH 5TJXA 2NU4E 4I33A 1HGTH 2FPZA 3G01A 1ANCA 2GZ9A 1P2NA 1O2UA 1S0QA 2SGAA 5H4IB 1MCVA 1FXYA 3ZZAA 2P59A 2IPHA 4NIXA 1B0EA 2VVUA 2Z9JA 2AMPA 1EPTB 1G2LA 4HI3A 4X2XA 1VGCC 1EJNA 4IC6A 4WWYA 1ZLRA 3EA7A 1WUNH 2F3CE 1G2MA 2FX6A 3SJKA 3SOSA 3T25A 1Y5UT 1JXPA 1NFWA 3BV9B 1HAXB 1J9CH 4WH8A 3CS7A 5A0CA 2O8UA 2OCVB 1EXFA 3HATH 4DCDA 3A86A 4DOQA 2IOTA 4JYVH 1FY3A 1GBKA 2EEKA 2UUKB 3S9AA 1CT0E 1V6DA 2ZGJA 2ANYA 1O2TA 1CQQA 5A2MH 1ELVA 1GVKB 2W3KA 1ZSKA 1OWHA 2R3YA 3TU7H 1O2JA 1HAIH 1UVPA 1GHYH 3PLBA 1EQ9A 1HAPH 2FOEA 2ZQ1A 2VWOA 3UTUH 1OP2A 1SR5C 1EJAA 4HZHA 1Z1IA 1TGNA 4X2VA 2UWPA 5LPEA 1O3BA 1XXDA 1GJDB 2WV4A 1AB9B 1K9OE 1BTYA 3SJ9A 1ETSH 4R8TB 2BVRH 4AB8A 2JH5D 1O2HA 3SJ8A 1OPHB 1GI1A 2FZZA 3LDXH 3T5FH 1GG6C 3RLYH 1ZSJA 2BY8X 4BANB 4K2YA 3URDA 1QB1A 3D65E 3EGKH 1V2TT 2ZCHP 2FOHA 1XX9A 1YPLH 2HNTE 2RA0A 1C4U2 2J9NA 1ID5H 1LMWB 4CRAA 1UCYK 1RS0A 5EW1H 1X7AC 1QL9A 2QCYA 5EU8A 1WQSA 5CE1A 3EAJA 4XBDA 1RD3B 2FTMA 4FU8A 1LVYA 3VB5A 1GMDF 1P57B 4KTSA 2CV3A 4AG2A 2ZGCA 1YPEH 3SI3H 1O2MA 3UOUA 3GDUA 1C5WB 1NY22 1UCYE 2PUQH 4NA8A 1O32A 1A0LA 2V3HH 1BTZA 1AU8A 1O3NA 5DPAA 1KLJH 3UUZA 1C2MA 4DIHH 1KY9A 3RXBA 1SOTA 1HIAA 1IHSH 3TH2H 2UUJB 1AE8H 1SGEE 2ZEBA 2ZPRA 4MPWA 4ZKSU 5FX5A 1IQKA 3W95A 4FUJA 4ABDA 1P02A 1CO7E 3RXFA 3SNBA 1CHOG 3CP7A 5C67A 1HIAB 4ZKRU 3A8CA 1EPTA 4Y71A 3MI4A 5T6FA 5C5OA 2CGAA 3F9EA 1AZ8A 3TH4H 1AFQB 6GCHG 8LPRA 4ISIH 3I77A 3SU1A 2ZIQH 3PB1E 4B2AA 4CHAB 1YLDA 2BQ6B 1WYKA 4X6PA 3SGAE 1GJ9B 5EXLA 1CVWH 4IN1A 3RLWH 1JIRA 1ZMJA 1A3EH 3TITA 1RJXB 4WMFA 3BTFE 3B9FH 3A80A 1CT4E 4OGXA 1GJ7B 1O3JA 5ETXA 4RSPA 1HB0B 1T4VH 2P8OC 3MH7A 1GBDA 1S0RA 2FI4E 3V7TA 1A1RA 4AFUA 2GV6A 3MNCA 1SGCA 1BBRH 1BRCE 1ZTJA 2JETC 2YOLA 4RN6A 3STJA 1GI2A 1Y3XA 3L6PA 3RU4D 1QJ1B 1XKAC 3A81A 3DT0H 5FXLA 1H8IH 3OX7U 2VIDA 2BY7X 3PTBA 4K8BA 2ZGBH 3HPTB 1SGTA 1MCTA 1G3EA 3M5MA 1W2KH 2OBQA 1P2QA 5EPYA 1HJAC 3ZZBA 1KLIH 1MTNC 1EASA 2FS9A 3GY7A 4LZ4B 1H9IE 4XOJA 2TPIZ 4I7YH 2GKVE 2G5VA 2LNCA 1O2GH 1ELCA 1DFPA 1FIWA 1YGCH 3ZZ3A 2VVCA 1DX5M 1GVZA 1GHBF 1FY5A 1O35A 2Z3EA 1GCTB 2BD4A 2UWLA 3BF6H 5T6DA 2GD4B 1LHCH 1BTXA 2PLXA 1IQIA 3P6ZB 3BTHE 2ZU3A 4NIYA 4LK4A 5A8XA 2Y81A 2BDCA 5IDKA 1P9UA 4X2YA 4BAMB 1W11U 4DIIH 3MWIU 1V2UT 2VIWA 3SV8A 4A7IB 2YNAA 3LGUA 4Y6DA 2GZ8A 4CRDA 3S9CA 1H8DH 5C3NA 1C5OH 1G3CA 1TRMA 3LH3A 4JK6A 2D1JA 1LPGB 2FDAA 2Q6DA 3BG8A 3BTGE 3BIUH 5FPSA 6LPRA 4HGCA 4Q7YA 1ELBA 2FLRH 2R2WU 3Q3YA 3AASA 1RRKA 1GBJA 1NU7B 2Z6BD 3UQVA 1EOLA 1RTLA 1P04A 1GDQA 1L1NA 1C1WH 2ZU4A 3MH5A 3DFLA 3E91A 4K60A 1MAYA 2A2QH 2GGVB 1GDNA 1QQUA 1LHFH 1S82A 3MYWA 3C27B 2OUAA 1BMMH 1OS8A 3FP8E 8KME2 1AKSB 2A32A 3GY6A 1XUIA 3JZ2B 2ZFFH 1G3BA 5HGGA 1K1LA 3S7KB 1K21H 3KQDA 2OC1A 1TBZH 4X8TH 1P10A 2Z9IA 1L0ZA 2PKAB 9ESTA 1L2EA 3QX5H 1NRRH 1S81A 1NRPH 1IQNA 3ZZ8A 1AUTC 5EOKA
chains in the Genus database with same CATH superfamily
1GL1A 1TNIA 1UK4A 2ZTXA 1AD8H 2HVXA 3QUMP 3VB7A 4B73A 3SNDA 3A7YA 4D9QA 1V2ST 1D6RA 1LVBA 4A1VA 1MMJN 3TJOA 2AMQA 1VITF 1AVGH 1T31A 5A8YA 2XXLA 3UNSA 3CS0A 3SNEA 2Z94A 1C1QA 1ELFA 3GYMA 2WZQA 3IG6B 3LKWA 2FOGA 3WWFA 2ILNA 1W8BH 3MU5A 2AS9A 1G3DA 4B2BA 1W0ZU 2IPQX 2G4UA 1IQEA 3RXIA 2XCNA 2RG3A 2L74A 3WW7A 5EQSA 1MAXA 1O37A 1SMFE 1ZPBA 2P95A 2PV9B 2V0BA 3KQBA 3NXPA 1GBEA 5GNDA 1BRBE 1GJCB 5GXPA 4X1QU 4AGKA 5DGJA 2F83A 1CA8B 5JYIA 2P3FH 4INLA 3RC6A 5GWZA 4RKJB 4XFQA 1FX0B 2QXIA 1E38B 1D6WA 3PV5A 1CBWB 1SGYE 5L2YH 1NROH 3P95A 3A7WA 3FO8D 2FM2A 1UVOA 3OY5U 3RDZA 1JOUB 1Y3UA 2JH6D 2W3IA 1TX7A 1Q31A 5DP4A 1GBTA 1GI8B 2EY4C 1C1MA 3BTME 1YF4A 1BJUA 1G36A 2C93B 4ACBA 3UFAA 3GDVA 3B23B 2XWBI 5AF9H 1MTSA 2HVYB 3UWIA 3KL6A 4ZHMU 5FCRA 2KCYA 1NRQH 1K1IA 3OE7D 1JBUH 1O31A 3RXRA 2ZHWH 2Y5HA 1FPHH 1AVXA 1C5SA 1LVOA 3ZZCA 2D2DA 3RUOA 2ULLA 3RXVA 5C1UA 2Z9KA 4AZ2B 2VINA 4MNWA 2ZDAH 3H7OA 3Q77A 2G51A 2NWNA 1SQOA 1MBMA 4DJZB 5DP9A 2AERH 3SN8A 3GCOA 1AB9C 3PWCA 4MNXA 1DSTA 1TFXA 1HUTH 3A8AA 5AVDA 2GZ7A 2SNWA 1C5UA 1EAXA 1DITH 1MKXH 1GG6B 3ATWA 2JH0D 3E0PB 4F48B 3GYLB 4X8UH 2QC2A 3LONA 6CHAC 5DP8A 3I78A 4Y11E 5DK1A 1FNIA 5JDUB 1Z8RA 4ZMAH 5L2ZH 1DXWA 1SQAA 1P01A 3TK5A 4E7RG 1BHXF 1AVWA 3GOVB 1E34B 5IYTA 1V2QT 3QLPH 1GCTC 5PTPA 2NU3E 5EPNA 1RXPA 5K7RA 1OWEA 5E2OA 1TMBH 1S5SA 2FYRA 1D3PB 2VIOA 6GCHF 2HOBA 1XUJA 1EFRD 2A31A 1VITG 3R3GB 1DUAA 1K1PA 4X2WA 4FUIA 4I8LA 4NIVA 4P00A 2BDBA 4X6MA 3ZIAD 1C5XB 4CH8B 3RU4T 3SU3A 1GHZA 3SQHE 3W94A 2BX4A 3GISB 2WYGA 1BB0B 1UTNA 3MOCA 5C0TA 4MDSA 2Q6FA 2WPJS 4YZUA 3VB6A 1D3DB 3Q3XA 3HK6B 3LGIA 4UD9H 1KXEA 3MO9A 4F55A 1RIWB 1IQLA 3BEUA 3UOPA 4TY7A 1HJ9A 5GJ4B 1NM6A 3L3TA 3M3VA 1KSNA 2PW8H 4XSKU 3S0NA 4NG9H 4CBOA 1CGIE 1HJ8A 1W12U 4CRFA 1C2DA 2ZPSA 1AN1E 1EPTC 3KQEA 1TIOA 2F9PA 3KQ5A 4ASHA 4KP0A 3RXLA 3BG4B 1KYNA 4MQAA 1INCA 1DWDH 1EOJA 1OXGA 1GDUA 2W5EA 1CHOF 1GHXH 3NK8A 5LPRA 1J14A 1C9TA 5L30H 1OX1A 1BIOA 2AHME 4Y8ZA 4IC5A 4WH6A 4ZKNU 3LGTA 1MU6B 1WSSH 3SV9A 1GVLA 4UDWH 4ISHH 1SSXA 2A2XH 1V2PT 4FU9A 3RC5A 2ESTE 3JZ1B 3ITIA 3ODDA 1N8OB 4OGYA 4I31A 3ZZ9A 1ZRKA 4ZHLU 2Y5GA 1PQ8A 1GI3A 4UE7H 1C1VH 1GMHG 3M36A 2ZA5A 1V2NT 1TQ0B 1O5BB 3SZNA 3OAAD 1GBCA 2C8XB 2KAIB 4OS6A 5B6LA 1GI6A 2GX4A 2A4GA 3D49H 2SGDE 5DP6A 1CGJE 4M9FA 2P93A 3A7XA 2XCFA 2F43B 1QBVH 2ZNKH 4A6LA 2TGAA 2FO9A 2V7QD 2XBYA 2XBVA 5HM2A 2K0QA 1O5AB 1IQJA 1O2QA 2CF8H 2VU8E 4MPUA 1U6QA 2GCHF 2RFKC 5EXNA 1FONA 1C5QA 1NFUA 3KCGH 1C1NA 2V6NA 1VZQH 1AI8H 1KXBA 4MTBA 1OWJA 3O8CA 2AEIH 4FUFA 1SFQB 6ESTA 2PUXB 2BB4A 2BXUH 1H8HD 1TPAE 2ZWLH 3F2FA 3HGNA 4MG3A 1O3KA 2ZFRH 2HWLB 3SI4H 5CDFE 1L4DA 1TX8A 3U9AH 1FI8A 1S6HA 1TNGA 5CHAC 1E1QD 4ZHAA 2BLQA 1ZRBA 5TCAA 4K1TA 1QRWA 1BOQA 1TMUH 1ZGIA 4BTTB 1TB6H 2BD3A 3P70B 3SNAA 1GBLA 2OXSA 2ZDMA 5C2ZA 1UW7A 2J98A 1XXFA 4GAWA 5ESTE 5KECA 3DCLA 2BXTH 1ZPZA 3RXDA 4H6SB 2FIRH 1G9IE 1C1OA 1W10U 5L6NH 4A5TS 1HRTH 4NCYA 1SGIB 4ZCNA 3P92A 1QBNA 1GBIA 3FANA 1H9LB 2BD2A 2EI6A 1IQMA 1F5RA 3ZVEA 1GMCF 3GCNA 2WPHS 5EG4A 1PPEE 5F8ZA 2ZI2H 3D23A 5F03A 5A0AE 1V2LT 2H2ZA 2FI5E 3PM3A 3HKIB 1V2OT 1DPOA 2BTCE 1TALA 1GHAG 2AGIX 1WDIA 1RIWC 3T28A 5HM9A 4X0WU 3W1EA 1O3IA 5A09A 4XE4A 4JZ1A 2TGDA 3M5LA 1LCYA 2W6ID 3KN2A 4K3JA 2XRCA 4X1NU 4IN2A 1O2OA 3V12A 3BEIB 5C94A 2VWMA 3U28C 1P11E 1O0DH 1O3LA 1UVTH 2XOKD 1P0SH 1C1SA 2OC8A 4ZXYH 1ELDE 1PYTD 1Z1JA 2FX4A 5EODA 1Z6EA 3LT3A 1W3CA 5DJ7A 4SGAE 3VB4A 2GP9B 3O8DA 3KGPA 3V0XA 1QNJA 4MPXA 2WPDD 5SGAE 1O5FH 1TONA 2ANWA 2STBE 3ATIA 5DO4H 1UTOA 4FU7A 1C2KA 1O34A 2RDEA 1HYLA 2H9TH 4DURA 4AN7A 1K1MA 5DP3A 1TPPA 4X6NA 3ZZDA 4E05H 1D9IA 2A7HA 1UTPA 1GI5A 1NT1A 1V2WT 4H42U 2XC0A 4KELA 1UTQA 1VCWA 1SGQE 2A4OA 1C2LA 3AAUA 3OTJE 1UO6A 3M3TA 1O2ZA 2HPQH 4ZXXH 4KGAA 4Q63A 4B6EA 1AHTH 3ZVBA 2H6MA 1KLTA 2BLVA 3GCTG 1C1UH 1ARBA 2H9EH 5EW2H 4O03A 2GMTC 4GUXA 3SBKA 4JYUH 1YLCA 1JRTA 2GCTB 5F53A 1SB1H 1AQ7A 1C9PA 1T4UH 1OWDA 1TABE 2J34A 3GY3A 1HAVA 2KAIA 4IMQA 4MNVA 4D7GA 3BTDE 1DWCH 4DW2U 1J15A 4O97A 3TH3H 3QK1A 2THFB 2FOFA 3FN8A 3GY8A 4ABBA 5AFZH 1HNEE 2O8TA 2IN2A 1E0FD 3ZZ4A 2FODA 2ODYB 4I86A 2ZTZA 2EC9H 3NCLA 3VGCC 1YCPH 4OM9A 2VIPA 1BJVA 1TBQH 1FY8E 4F4OC 5JBTA 3F68H 4BAQB 2H1UA 3ODFA 5E2PA 2GTBA 1MKWH 1W7XH 2Y7XA 4TPYA 3RMMH 2OQ5A 2PGQB 2PFEA 2UUFB 2V3MA 2WPIS 3K6YA 3LH1A 2GDDA 1KMHB 2A7CA 1YPGH 2BD5A 1RTKA 4ABGA 4SGBE 4BAHB 3RXGA 4DGJA 1OHHD 3MTYA 3SGBE 8GCHG 2YMSC 2GCTC 1BTHH 1N6YA 1VR1H 2VB0A 2Y5FA 1O39A 4PROA 1O2SA 2Y82A 1ZYOA 2RA3A 1SGDE 3LJJA 1QJ7B 4GVUA 1LDTT 5C1XA 4X8VH 1GHAF 1VCPA 2ANKH 4ESTE 1JWTA 1FIZA 3GCHB 5LPFA 4GCHF 2ZU2A 3PRBA 1UCYH 3RMNH 4I8GA 1O33A 3K9XB 2CMYA 2XWAA 5B6OA 4ISOA 5FPTA 3SU0A 1MTUA 1H4WA 5CHAB 2ASUB 7LPRA 2ZKSA 4TWYA 3TK6A 2UWOA 1EUFA 1BCUH 1GL0E 4YTAA 3QWCH 1T8LA 1W7GH 3FKSD 7ESTE 3ZYDA 1GCDA 3PV4A 4ZKOU 3UY9A 3KNXA 5C17A 3M7UA 3TGIE 1O38A 1UK2A 1SG8B 2EI8A 3MFJA 2CHAB 4Y76A 3TLOA 4E06H 1BRUP 3UNRA 1NU9A 1GMHF 5FX6A 2BZ6H 2OP9A 3F9GA 1AKSA 1ELEE 2NU2E 2C4FH 4ABJA 1SI5H 3FZDA 2XTTB 2FWWA 4ABIA 3E16B 3SHAH 2BDYA 2BDAA 3LOXA 3TNSA 5JBCS 2C3SA 4BOHA 4WMEA 4YLQH 1C5PA 7KMEH 1ELGA 3VFEA 1V2KT 1LPKB 1Q3XA 3EDXB 1YPMH 5AHGH 2Z3DA 1SLXB 1BRAA 1KXFA 3M37A 2XNDD 3TIUA 2GT7A 1QFKH 2PR3A 1HXFH 3EQ0H 1NN6A 4D76A 2F9BH 3TJVA 1O3EA 1C4V2 2P3UB 2O8WA 3EA9A 4YO9A 2VWNA 3B8JA 3IWMA 3QTOH 1NS3A 3E90B 4CR9A 2BYAX 5I25A 3P8NA 1C2FA 5E0JA 1TX6A 1T8OA 1YWUA 5KEDA 4CR5A 1PYTC 4B1TA 1OYTH 3UR6A 4M7GA 2ZGXH 1YCPK 4LXBH 3M5NA 1ETTH 1KDQB 1N6XA 1ZTKA 1S84A 4LOYH 1C5MD 5EJLA 1DY8A 1F5KU 1VGCB 3KEEA 3RM2H 1GBFA 4U30A 2QY0B 3Q76A 1GI4A 1F0RA 1FUJA 1AWHB 1EAIA 2EQNA 1MKWK 1P09A 1GWAA 2O8MA 2PWXA 4B71A 2QIQA 2W26A 2B5TB 6CHAB 5DKMA 4DVAU 5E8EH 1YYY1 2WPKS 2BDHA 3F1SB 3OY6U 4FUCA 2PKSB 3SUGA 1EZUC 2WUBA 4TWWA 1AGJA 1HJAB 1Y8TA 4X1PU 1EX3A 2ZPQA 5JPMH 4YOIA 5FHTA 4NA7A 1AUJA 4CREA 2SGEE 1QL8A 2GCHG 3ZVDA 3K6ZA 4Z6AH 2BLOA 1L1JA 1LHDH 4AOQA 5HXFA 2D8WA 4VGCC 5EJ1A 2OD3B 1VJAU 3M7QA 1DLKB 3MU4A 2A5AA 3RXHA 3FFGA 1UTLM 1MUEB 2Y6TA 3UIRA 4TYDA 1UHBB 2ALPA 1E36B 4TT3D 3SJOA 3S9BA 2GMTB 5TCCA 1YC0A 4Y8XA 1UMAH 2HPPH 2VNTA 1BA8B 1QA7A 1Q2WA 1WTGH 4YOGA 1EB1H 1PPGE 4FUDA 3RXMA 5J4SA 2BX3A 2CJIA 4ZAEA 3RXTA 2FOBA 3OEHD 1IQHA 1EJMA 3QDZB 3RXOA 2DE9A 1G30B 3MNSA 1CA0C 1MZDA 2ZP0H 4O3UA 3ZVFA 4I8HA 1MABB 1W0YH 1SQRA 1ETRH 1K1OA 3A85A 1C5NH 3ENSB 2XNIA 1KXCA 1GHWH 2XC5A 2Z3CA 4ISLA 3UWJH 2R9PA 1WTHD 1P2MA 1OP0A 3FZZA 1DE7H 1C2GA 2YMSD 2ZCLP 2JIZD 4THNH 1ZR0A 3RP2A 3VXEH 1FZZA 2A7JA 1A2CH 3ZVGA 1BMLA 1GMCG 5HIZA 5C20A 2HNTC 1H9HE 1O2WA 4MLFB 1E79D 4B75A 2J95A 4HFPB 1SHHB 2AIQA 1LTOA 2P94A 5ABWA 3F0OA 3PMAB 1C5LH 4ABFA 4ISNA 2ZDVH 2A5KA 1BMNH 3GICB 4AX9H 1J16A 3DSGA 1TNLA 2CN0H 1FAXA 1GHBG 2QN5T 3RXPA 4Y7AA 1O3FA 3ZVCA 3U98H 3E1XB 3NZIA 3RM0H 1ANEA 1XUHA 5DP5A 1A5IA 3SW2B 1O2VA 1T8NA 1TYNA 1F2SE 1AFQC 2H5CA 2ZFSA 3SNCA 3U69H 1ESBA 2ZFTA 3AK5A 2QE7D 2ZTYA 3HKJB 3SO3A 3VEQB 3MNBA 1O2YA 1OP8A 4JYTA 1SHYA 3AVZA 4P02A 1G32B 5JBBS 2F91A 5LGOA 3RXKA 4Y8YA 2FYQA 1QHRB 1SGFG 3MQKC 2C8YB 2P8OB 1P3EA 2NU1E 1F0TA 1TPSA 5JB8S 3QO6A 1O5DH 1SLVB 4RI0A 2NU0E 4UFGH 1ZSLA 3RMOH 1SBWA 3SV7A 3NKKA 1HCGA 2A45B 4FVBA 3S7HB 4TPIZ 1DOJA 5T6GA 1IQGA 2OQUA 4X8SH 1PPZA 1FJSA 4RT1A 1XUGA 1TOMH 3M7TA 3SU2A 8GCHF 1MD7A 3PROA 1C1RA 1W14U 5JB9S 1MTNB 2VH0A 2ODQA 3A8BA 2ZFQH 1IAUA 4AFSA 3MU0A 3QZRA 5K0HA 4BAKB 2QF0A 1SGPE 2BOKA 1GJ5H 4X1SU 3T62A 3N99A 1O5EH 1THSH 3GY2A 1SOZA 3OYPA 1A5HA 1DS2E 2WINI 1HAYB 2DUCA 1QZ8A 1C5ZB 1HAVB 2KFWA 1HBTH 1TGSZ 4OS4A 4TY6A 2O9QA 4AGJA 1KIGH 4D9RA 1SLWB 1GBBA 2ALVA 1TOCB 2A5IA 2ZCKP 3QGNB 4VGCB 1KDQA 2HRVA 3EYDA 4AB9A 1LVMA 3MNXA 1TPOA 3ESTA 3PMBB 4F49A 3SUDA 1OYQA 1XMNB 2R2MB 4Y10E 3BIVH 4UFEH 1GGDC 1AMHA 1AO5A 3ZZ6A 1F5LA 3A89A 1CU1A 3PMHB 4AYYB 1HV7A 1EZXC 3SUFA 1O2XA 3A8DA 2KCAA 3ATLA 1FQ3A 3UPEA 1O2PA 1YP9A 5FBIA 1T8MA 3DUXH 1A0HB 2ANMH 2WHXA 2LELA 2A4QA 5DP7A 3M3SA 3GCHC 1ZTLA 3AAVA 2Y80A 1DVAH 1FLEE 2BHGA 2ODPA 3RC4A 2BLWA 1FN6A 3RXEA 4FVDA 1HPGA 1QGFA 5FL7D 1YPHC 2STAE 1YKTA 1GI9B 1THRH 1Z6JH 3L33A 1Z8IB 4X6OA 3U8TH 1TRYA 3ZV9A 5GDSH 1QRZA 4MNYA 4Q2KA 4UONA 2VIVA 1W0KD 2BQ7B 4GCHG 1N1LA 1UHBA 2QV1A 1BMFD 4INKA 2G55A 1DT2A 2ZU1A 1CT2E 1GJ8B 2FS8A 1SL3A 4NA9H 2BD7A 2WUCA 3UR9A 1RTFB 1UK3A 1YPHE 4JZDH 2O8LA 4ZROA 1DANH 1HAOH 1CA0B 3V3MA 1NESE 2VH6A 2FOAA 3SU6A 2G81E 4NGAH 3URCA 1A46H 3ZYEA 1L1GA 1DM4B 1YLNA 1P2IA 2B0FA 1FN8A 1T7CA 3QN7A 1PQAA 3SZEA 1WOFA 1ZHPA 2PSXA 5EGMA 2OTVA 2G52A 3T29A 2HGTH 2IJD1 1BQYA 5GCHF 1P3CA 1P12E 2F9VA 4I32A 3K2UA 1O3OA 4FUBA 4AC9A 1E35B 3U1JB 1PPCE 1TBRH 1O3MA 3PLKA 2WPLS 3M61U 3BG4C 1S6FA 3LPRA 3BTTE 4AYVB 1FDPA 1CBWC 4OS1A 5ESBA 4GHTA 3KQCA 5T3HA 2KM0A 1C2EA 1O3GA 2AIPA 1Y3YA 1ZMLA 2FLBH 1O3AA 5G4BA 3M35A 5AFYH 4JZIA 3LIWA 1OWIA 3MH4A 2PGBB 2SNVA 2V35A 1GBAA 2WV9A 4XRNA 3A88A 1FV9A 4Y79A 2WYJA 2ZQ2A 1EAWA 4FUGA 2B9LA 3A84A 1ACBE 4NSVA 1LKBA 2OC7A 4GSOA 1RGQA 4A1TA 1F92A 1LO6A 3H7TA 1O2RA 2HLCA 4K8YA 3RMLH 2PKSC 1YPKH 1P8VC 2BM2A 3UQOA 4Q80A 5HMAA 1GHVH 1S85A 2W7SA 1TNKA 2F9OA 1BMAA 1CHGA 5J4QA 1CE5A 1QQ4A 3TJNA 3ZV8A 4Q7ZA 1NPMA 3GY4A 1C1TA 3N7OA 1TWXB 1TLDA 2B8OH 3RXUA 3E8LA 2BQWB 2ZG0H 4Z1MD 4H6TA 1LPZB 1DY9A 1P2OA 1FPCH 4JZFH 4K5ZA 5BPEA 3NWUA 1TGCA 2QA9E 4JZEH 3TGJE 1QB9A 3R0FA 1TNJA 2BD8A 4JMYA 2A0QB 4WY3A 4K69A 3A7VA 1MU8B 4Y0ZE 2SGQE 1FY4A 2GV7A 3SJIA 2GDEH 2WV5A 2FXRA 3UNQA 1YPJH 2R0KA 3PMJA 1P2JA 3PRDA 3BTKE 1QBOA 1LQEA 2GJGA 2ZU5A 2ZDKA 3BN9A 1K1JA 3MMGA 1Y59T 2PTNA 3ATKA 1HXEH 1MTVA 2QXHA 1HDTH 2GVFA 4AG1A 3ATMA 3RXSA 2F9NA 4LZ1H 2QXGA 1TGBA 2OLGA 1AWFH 1O3PB 1VITH 2FTLE 4KTCA 3EE0B 1IOEA 3TNTA 5GPIB 1Z8GA 2ZC9H 3VXFH 1ABIH 3A83A 4JCNA 1IQFA 1K1NA 2VVVA 1AZZA 2SGFE 4NWLA 1D3QB 1O5GH 4ABHA 2HNTF 5EIYA 2AMDA 1O3HA 2C8ZB 3AW1A 1BT7A 3I29A 5CHBA 1A4WH 5LH8A 4D8NA 1PQ5A 2BMGB 2LP6A 1GGDB 2ZF0H 1UTKA 3T26A 2AYWA 2BVXH 1DSUA 1MTWA 2VWLA 3F0PA 1A7SA 3SHCH 1TGTA 3TPIZ 1THPB 1C5RA 1SVPA 1JIMA 3KYFA 3BTEE 1HLTH 4BNRA 2ZFPH 1BUIA 1AE5A 2AGGX 3TJUA 3OU0A 1J17T 3PTNA 3F2HA 1GJBB 1O30A 1P03A 3Q00A 2FOMB 2ZHFH 4R0IA 2TIOA 1O3CA 1QR3E 5EQRA 4CRGA 4CH2B 5EJZA 1B7XB 1DICA 2KZ4A 1W13U 2YNBA 4INHA 2J97A 3BSQA 3BTQE 2FI3E 4IMZA 3WY8A 5EQQA 1FY1A 3F2GA 4UFDH 3DSPA 1HAHH 1C1PA 4AORA 3LJOA 2DE8A 1D4PB 9LPRA 3SORA 4BAOB 3SUEA 1LQDB 1QTFA 2QAAA 4ABAA 1TMTH 3KF2A 1ZZZA 3P8FA 1ELTA 4Z0KA 4XDEA 2VIQA 3NUMA 3O8BA 4AFZA 1Y3VA 4GLYA 1QURH 1Y3WA 2Y7ZA 1SGRE 1EZQA 4FUEA 1SGFA 4TSFD 2P16A 4H4FA 4WJG2 3T2NA 3LGYA 1XVMA 2CF9H 3U8OH 2TRMA 2BY5X 2ZHDA 1V2JT 2BY9X 3LU9B 1COWD 5F8TA 3PLPA 1AY6H 1VKYA 1LHEH 4CRBA 3N7EA 1MKXK 3BTWE 3RXQA 1EAUA 1O2IA 5F6MA 2QXJA 4UFFH 1GI7B 1YBWA 3DD2H 1NFYA 2K8IA 3AW0A 1DDJA 2R3UA 1O3DA 4QT8C 1ABJH 1BZXE 1SLUB 1XVOA 5C5NA 2G8TA 3FP6E 3GDSA 4YT6H 1NC6A 5CMXH 1C2HA 1E1RD 4GHQA 1UTMA 1K0HA 1K2I1 4A1XA 5FPYA 4IBLH 4IW4E 2BDGA 3OTPA 4J2YB 2Z7FE 3V13A 3KIDU 3SV6A 2ZO3H 1V2RT 2P3TB 3FVFB 2G5NA 4ZUHA 1C5YB 1V3XA 2OINA 5F8XA 2W6JD 5FBEA 1VJ9U 2D26C 1BITA 1GJ6A 3P8OA 1GI0A 1B5GH 3MU1A 2TGPZ 4U2WA 2SGPE 4YESB 7GCHG 1EP5A 2FEQH 2Z9LA 3H5CB 1DWEH 1AFEH 2AGEX 3VGCB 3CENA 3S69A 2Q1JA 2EA3A 1BTUA 1GJAB 1UVSH 1HFDA 3E0NB 1SPJA 1MQ5A 1PFXC 4ABEA 1NTPA 1V2MT 2CXVA 3LGVA 3PYHA 2J2UA 4YLUA 3MU8A 2J38A 3F6UH 3HK3B 1OKXA 1XUFA 3ELAH 3SQEE 2H9HA 1QL7A 3HGPA 2QF5A 4MVNA 1ESTA 1GPZA 4BXWA 1C2JA 1HAGE 3F9HA 3FP7E 4E7NA 2BDIA 4O3TA 1O36A 2FESH 4OS2A 2TGTA 3ZZ5A 1SC8U 5GCHG 4RKOB 5I46H 1QCPA 2J5UA 1GMDG 1PPBH 2YMSB 4WXVA 4NSYA 1BTPA 4WXIA 1KTTB 3TGKE 5E0HA 2OBOA 2VGCB 1PJPA 2ZECA 1GBHA 1YCPM 4BTUB 1QY6A 4MPVA 3U8RH 2ZGHA 1DUEA 2GT8A 4WF8A 3T27A 1B0FA 2XW9A 4DT7B 3PO1C 1V2VT 2XBXA 3ZVAA 4DG4A 4Q7XA 2TBSA 4I8KA 5KGOA 3SU5A 3O8RA 1H1BA 1KXDA 3LC5A 4FOUC 1Z7KA 2OK5A 1F7ZA 1SFIA 3BEFB 4WMDA 3Q3KA 3RXCA 3E6PH 3EA8A 1CSOE 3MH6A 2ZDNA 2G4TA 2F9UA 3MO6A 1MH0A 1NO9H 4NZLA 1QJ6B 4WVPE 2BOHB 1O2LA 1ZJKA 2FOCA 2JKHA 1MQ6A 3P17H 1T32A 4NWKA 1CGHA 1TNHA 1NZQH 2PTCE 4NFEA 1J8AA 2PHBA 3MHWU 4Y0YE 4A92A 1ARCA 4ZH8A 3VPKA 5T1VA 2Z9GA 2B7DH 1PQ7A 2FP7B 1FMGA 1MZAA 3C1KA 1ZOMA 1N8OC 1PPHE 1ZHMA 3NPSA 2ZZUH 2XYAA 3A87A 1GBMA 5EXMA 4XBCA 2ZHQH 1P05A 1KXAA 3SGQE 1LKAA 3FAOA 2BD9A 5A0BA 1ZGVA 3SYJA 1QB6A 1C5VA 2RCEA 4U32A 5A8ZA 5FCKA 1P06A 2FMJA 4NFFA 3OSYA 1K22H 2WPMS 1ORFA 3VG8A 5DG6A 4BTIB 4OS7A 2H5DA 1EKBB 2J4IA 2KCOA 4CHAC 3NRLA 1NRNH 1WAYB 1BBRK 1ESAA 3OEED 5E0GA 2EI7A 1QIXB 3RXAA 2XC4A 7GCHF 3RU4E 1A61H 1D3TB 2WSSD 1EATA 1BBRE 1F0SA 5C1YA 4B2CA 4ASUD 4GPGA 1C4Y2 4BXSA 5DSFA 2QF4A 4K1SA 4B6FA 2F4LA 3DFJA 1EP6A 1TRNA 2JETB 3LC3A 1EB2A 1MD8A 1UTJA 5JBAS 1O2NA 4CBNA 2J94A 1WCZA 1P9SA 1A5GH 1L4ZA 4YOJA 3M5OA 1BDAA 1JMOH 1SGNE 1TA2A 2V3OH 2M2AA 3LGWA 4NZQA 3TK9A 1XM1A 2HALA 3SV2H 2ZHEH 3VB3A 5GIBA 3PWBA 1QRXA 3QZQA 2A4RA 1UVUH 1DLEA 1O5CB 4OS5A 4UEHH 1ANBA 1BTWA 3SU4A 2JJ2D 1NFXA 2K1QA 4U01A 4B76A 2I6SA 1ANDA 4J1YA 1P2KA 1Y5AT 4X1RU 4YT7H 1OOKB 3QTVH 4JK5A 1ZJDA 2C90B 3MO3A 4CRCA 1EZSC 2OC0A 3A82A 4Q4LA 2SFAA 2AFQB 2G00A 4XBBA 4YM9A 1C5TA 3GCTF 1XKBC 1UJ1A 1ZMNA 3RXJA 4AFQA 5BRRE 1K28D 3D62A 1ELAA 2QF3A 1YM0A 1JRSA 1E37B 1BHXB 1RFNA 2PSYA 4I8JA 2R0LA 4FUHA 1SQTA 4FXGH 1XUKA 1Z71A 1QA0A 1VCQA 1TA6A 1WBGB 1TAWA 1HAZB 1WQVH 2C8WB 4D7FA 2CHAC 4Y7BA 1C2IA 3F3BA 4NIWA 3A7TA 5HKKD 1WU1A 4O9VA 3UREA 5FAHA 3K65B 1OSSA 1M9UA 3U1IB 5HYOA 3A7ZA 2J98B 1S83A 3QGJA 1NRSH 1Z8JB 2LPRA 1TQ7B 4HTCH 1G37A 2IJOB 1FAKH 2XBWA 1KTSB 3IITA 1MBQA 2J92A 2BVSH 4IGDA 4K1EA 3DHKH 1A0JA 1Y5BT 3GY5A 2QYIA 3KHVA 1GJ4H 1OWKA 2VGCC 3CNRA 2UUYA 4KTUA 1DXPA 1LHGH 2BZAA 2AH4X 1IHTH 1TE0A 4DY7B 1WV7H 3P8GA 3DA9B 1A3BH 2PKAA 3TVJB 3F9FA 2W7UA 2BY6X 3ZZ7A 2ZDLA 1PPFE 8ESTE 4B74A 3PO1B 2M5TA 1O2KA 2Q6GA 4KKDA 1AIXH 2A1DB 3STIA 1F0UA 1ZHRA 3E3TA 4IS5A 2VJ1A 3H09A 1SKYE 2I6QA 2QGRA 1ZPCA 1DWBH 2KR7A 2RDLA 5TJXA 2NU4E 4I33A 1HGTH 2FPZA 3G01A 1ANCA 2GZ9A 1P2NA 1W0JD 1O2UA 1S0QA 2SGAA 5H4IB 2CK3D 1MCVA 1FXYA 3ZZAA 2P59A 2IPHA 4NIXA 1B0EA 2VVUA 2Z9JA 2AMPA 1EPTB 1G2LA 4HI3A 4X2XA 1VGCC 1EJNA 4IC6A 4WWYA 4XD7D 3KYGA 1ZLRA 3EA7A 1WUNH 2F3CE 5HIYA 1G2MA 2FX6A 3SJKA 3SOSA 3T25A 1Y5UT 1JXPA 1NFWA 3BV9B 1HAXB 1J9CH 4WH8A 3CS7A 5A0CA 2O8UA 2OCVB 1EXFA 3HATH 4DCDA 3A86A 3FOAA 4DOQA 2IOTA 4JYVH 1FY3A 1GBKA 2EEKA 3EE7A 4YXWD 2UUKB 3S9AA 1CT0E 1V6DA 2ZGJA 2ANYA 1O2TA 1CQQA 1S6LA 5A2MH 1ELVA 1GVKB 2W3KA 1ZSKA 1OWHA 3N7DA 2R3YA 1WXRA 3TU7H 1O2JA 1HAIH 1UVPA 1GHYH 3PLBA 1EQ9A 1HAPH 2FOEA 2ZQ1A 2VWOA 3UTUH 1OP2A 1SR5C 1EJAA 4HZHA 1Z1IA 1TGNA 4X2VA 2UWPA 5LPEA 1O3BA 1XXDA 1GJDB 2WV4A 1AB9B 1K9OE 1BTYA 1H8ED 3SJ9A 2L6OA 1ETSH 2BVRH 4R8TB 2JH5D 4AB8A 5IK2D 1O2HA 3SJ8A 1OPHB 1GI1A 2FZZA 3LDXH 3T5FH 1GG6C 3RLYH 1ZSJA 2BY8X 4BANB 4K2YA 3URDA 1QB1A 3D65E 3EGKH 1V2TT 2ZCHP 2FOHA 1XX9A 1YPLH 2HNTE 2RA0A 1C4U2 2J9NA 2KCPA 1ID5H 4HG6A 1LMWB 4CRAA 4FETA 1UCYK 1RS0A 5EW1H 1X7AC 1QL9A 2QCYA 5EU8A 1WQSA 1YY3A 5CE1A 5C0UA 3EAJA 4XBDA 1RD3B 2FTMA 4FU8A 1LVYA 3VB5A 1GMDF 3OFND 1P57B 4KTSA 2CV3A 4AG2A 2ZGCA 1YPEH 3SI3H 2PP6A 1O2MA 2JDID 3UOUA 3GDUA 2JJ1D 1C5WB 1NY22 1UCYE 2PUQH 4NA8A 1O32A 1A0LA 2V3HH 1BTZA 1AU8A 1O3NA 3UAIC 5DPAA 1KLJH 3UUZA 1C2MA 4DIHH 1KY9A 3RXBA 1SOTA 1HIAA 1IHSH 3TH2H 2UUJB 1AE8H 1SGEE 2ZEBA 2ZPRA 4MPWA 4ZKSU 5FX5A 1IQKA 3W95A 4FUJA 4ABDA 1P02A 1CO7E 3RXFA 3SNBA 1CHOG 3CP7A 5C67A 1HIAB 4ZKRU 5DN6D 4DT4A 3A8CA 1EPTA 4Y71A 3MI4A 5T6FA 5C5OA 1NBMD 2CGAA 1AZ8A 3F9EA 1AFQB 3TH4H 6GCHG 8LPRA 4ISIH 3I77A 1NBME 3SU1A 2ZIQH 3PB1E 4B2AA 4CHAB 1YLDA 2BQ6B 1WYKA 4X6PA 3SGAE 1GJ9B 5EXLA 1CVWH 4IN1A 3RLWH 1JIRA 1ZMJA 1A3EH 3TITA 1RJXB 4WMFA 3BTFE 3B9FH 3A80A 1CT4E 4OGXA 1GJ7B 1O3JA 5ETXA 4RSPA 1HB0B 1T4VH 2P8OC 3MH7A 1GBDA 1S0RA 2FI4E 3V7TA 1A1RA 4AFUA 2GV6A 3MNCA 1SGCA 1BBRH 1BRCE 1ZTJA 2JETC 2YOLA 4RN6A 3STJA 1GI2A 1Y3XA 3L6PA 3RU4D 1QJ1B 1XKAC 3A81A 3DT0H 5FXLA 1H8IH 3OX7U 2VIDA 2BY7X 3PTBA 4K8BA 2ZGBH 3HPTB 1SGTA 1MCTA 1G3EA 3M5MA 1W2KH 2OBQA 1P2QA 5EPYA 1HJAC 3ZZBA 1KLIH 1MTNC 1EASA 2FS9A 3GY7A 4LZ4B 1H9IE 4XOJA 2TPIZ 4I7YH 2GKVE 2G5VA 2LNCA 1O2GH 4ACAA 1ELCA 1DFPA 1FIWA 1YGCH 3ZZ3A 2VVCA 1DX5M 2HLDD 1GVZA 1GHBF 1FY5A 1O35A 2Z3EA 1GCTB 2BD4A 2UWLA 3BF6H 5T6DA 2GD4B 1LHCH 1BTXA 2PLXA 1IQIA 3P6ZB 3BTHE 2ZU3A 4NIYA 4LK4A 5A8XA 2Y81A 2BDCA 5IDKA 1P9UA 4X2YA 4BAMB 1W11U 4DIIH 3MWIU 1V2UT 2VIWA 3SV8A 4A7IB 2YNAA 3LGUA 4Y6DA 2GZ8A 4CRDA 3S9CA 1H8DH 5C3NA 1C5OH 1G3CA 1TRMA 3LH3A 4JK6A 2D1JA 1LPGB 2FDAA 2Q6DA 3BG8A 3BTGE 3GS9A 3BIUH 5FPSA 2KX4A 6LPRA 4HGCA 4Q7YA 3WWBA 1ELBA 2FLRH 2VBCA 2R2WU 3Q3YA 3AASA 1RRKA 3UB0A 1GBJA 1NU7B 2Z6BD 3UQVA 1EOLA 3DSOA 1RTLA 1P04A 1GDQA 1L1NA 1C1WH 2ZU4A 3MH5A 3DFLA 3E91A 4K60A 1MAYA 2A2QH 2GGVB 1GDNA 1QQUA 1LHFH 1S82A 3MYWA 3C27B 2OUAA 1BMMH 1OS8A 3FP8E 8KME2 1AKSB 2A32A 3GY6A 1XUIA 3JZ2B 2ZFFH 1G3BA 5HGGA 1K1LA 3S7KB 1K21H 3KQDA 2OC1A 1TBZH 4X8TH 1P10A 2Z9IA 1L0ZA 2PKAB 3PV2A 9ESTA 1L2EA 3QX5H 1NRRH 1S81A 4RT0A 1NRPH 1IQNA 3ZZ8A 1AUTC 5EOKA
chains in the Genus database with same CATH topology
1GL1A 1TNIA 1UK4A 2ZTXA 1AD8H 2HVXA 3QUMP 3VB7A 4B73A 3SNDA 3A7YA 4D9QA 1V2ST 1D6RA 1LVBA 4A1VA 1MMJN 3TJOA 2AMQA 1VITF 1AVGH 1T31A 5A8YA 2XXLA 3UNSA 3CS0A 3SNEA 2Z94A 1C1QA 1ELFA 3GYMA 3IG6B 3LKWA 2FOGA 2ILNA 1W8BH 3MU5A 2AS9A 1G3DA 4B2BA 1W0ZU 2G4UA 1IQEA 3RXIA 2XCNA 2RG3A 5EQSA 1MAXA 1O37A 1SMFE 1ZPBA 2P95A 2PV9B 2V0BA 3KQBA 3NXPA 1GBEA 1BRBE 1GJCB 5GXPA 4X1QU 4AGKA 5DGJA 2F83A 1CA8B 5JYIA 2P3FH 4INLA 3RC6A 5GWZA 4RKJB 4XFQA 2QXIA 1E38B 1D6WA 1CBWB 1SGYE 5L2YH 1NROH 3P95A 3A7WA 2FM2A 1UVOA 3OY5U 3RDZA 1JOUB 1Y3UA 2JH6D 2W3IA 1TX7A 1Q31A 5DP4A 1GBTA 1GI8B 1C1MA 3BTME 1YF4A 1BJUA 1G36A 2C93B 3UFAA 3GDVA 3B23B 2XWBI 5AF9H 1MTSA 3UWIA 3KL6A 4ZHMU 5FCRA 1NRQH 1K1IA 1JBUH 1O31A 3RXRA 2ZHWH 2Y5HA 1FPHH 1AVXA 1C5SA 1LVOA 3ZZCA 2D2DA 3RUOA 2ULLA 3RXVA 5C1UA 2Z9KA 4AZ2B 2VINA 4MNWA 2ZDAH 3H7OA 3Q77A 2G51A 2NWNA 1SQOA 1MBMA 4DJZB 5DP9A 2AERH 3SN8A 3GCOA 1AB9C 3PWCA 4MNXA 1DSTA 1TFXA 1HUTH 3A8AA 5AVDA 2GZ7A 2SNWA 1C5UA 1EAXA 1DITH 1MKXH 1GG6B 3ATWA 2JH0D 3E0PB 3GYLB 4X8UH 2QC2A 3LONA 6CHAC 5DP8A 3I78A 4Y11E 5DK1A 1FNIA 5JDUB 1Z8RA 4ZMAH 5L2ZH 1DXWA 1SQAA 1P01A 3TK5A 4E7RG 1BHXF 1AVWA 3GOVB 1E34B 5IYTA 1V2QT 3QLPH 1GCTC 5PTPA 2NU3E 5EPNA 1RXPA 5K7RA 1OWEA 5E2OA 1TMBH 1S5SA 2FYRA 1D3PB 2VIOA 6GCHF 2HOBA 1XUJA 2A31A 1VITG 3R3GB 1DUAA 1K1PA 4X2WA 4FUIA 4I8LA 4NIVA 2BDBA 4X6MA 1C5XB 4CH8B 3RU4T 3SU3A 1GHZA 3SQHE 3W94A 2BX4A 3GISB 2WYGA 1BB0B 1UTNA 3MOCA 4MDSA 2Q6FA 2WPJS 4YZUA 3VB6A 1D3DB 3Q3XA 3HK6B 3LGIA 4UD9H 1KXEA 3MO9A 1RIWB 1IQLA 3BEUA 3UOPA 4TY7A 1HJ9A 5GJ4B 1NM6A 3L3TA 3M3VA 1KSNA 2PW8H 4XSKU 3S0NA 4NG9H 4CBOA 1CGIE 1HJ8A 1W12U 4CRFA 1C2DA 2ZPSA 1AN1E 1EPTC 3KQEA 1TIOA 2F9PA 4ASHA 4KP0A 3RXLA 3BG4B 1KYNA 4MQAA 1INCA 1DWDH 1EOJA 1OXGA 1GDUA 2W5EA 1CHOF 1GHXH 3NK8A 5LPRA 1J14A 1C9TA 5L30H 1OX1A 1BIOA 4Y8ZA 4IC5A 4WH6A 4ZKNU 3LGTA 1MU6B 1WSSH 3SV9A 1GVLA 4UDWH 4ISHH 1SSXA 2A2XH 1V2PT 4FU9A 3RC5A 2ESTE 3JZ1B 3ITIA 3ODDA 1N8OB 4OGYA 4I31A 3ZZ9A 1ZRKA 4ZHLU 2Y5GA 1PQ8A 1GI3A 4UE7H 1C1VH 1GMHG 3M36A 2ZA5A 1V2NT 1TQ0B 1O5BB 3SZNA 1GBCA 2C8XB 2KAIB 4OS6A 1GI6A 2GX4A 2A4GA 3D49H 2SGDE 5DP6A 1CGJE 2P93A 3A7XA 2XCFA 1QBVH 2ZNKH 4A6LA 2TGAA 2FO9A 2XBYA 2XBVA 5HM2A 1O5AB 1IQJA 1O2QA 2CF8H 2VU8E 4MPUA 1U6QA 2GCHF 5EXNA 1FONA 1C5QA 1NFUA 3KCGH 1C1NA 2V6NA 1VZQH 1AI8H 1KXBA 4MTBA 1OWJA 3O8CA 2AEIH 4FUFA 1SFQB 6ESTA 2PUXB 2BB4A 2BXUH 1TPAE 2ZWLH 3HGNA 4MG3A 1O3KA 2ZFRH 2HWLB 3SI4H 1L4DA 1TX8A 3U9AH 1FI8A 1S6HA 1TNGA 5CHAC 4ZHAA 2BLQA 1ZRBA 5TCAA 4K1TA 1QRWA 1BOQA 1TMUH 1ZGIA 4BTTB 1TB6H 2BD3A 3P70B 3SNAA 1GBLA 2OXSA 2ZDMA 5C2ZA 1XXFA 4GAWA 5ESTE 2BXTH 1ZPZA 3RXDA 4H6SB 2FIRH 1G9IE 1C1OA 1W10U 5L6NH 4A5TS 1HRTH 4NCYA 1SGIB 3P92A 1QBNA 1GBIA 3FANA 1H9LB 2BD2A 2EI6A 1IQMA 1F5RA 3ZVEA 1GMCF 3GCNA 2WPHS 5EG4A 1PPEE 5F8ZA 2ZI2H 3D23A 5F03A 5A0AE 1V2LT 2H2ZA 2FI5E 3PM3A 3HKIB 1V2OT 1DPOA 2BTCE 1TALA 1GHAG 2AGIX 3T28A 1RIWC 5HM9A 4X0WU 1O3IA 5A09A 4XE4A 4JZ1A 2TGDA 3M5LA 1LCYA 3KN2A 4K3JA 2XRCA 4X1NU 4IN2A 1O2OA 3V12A 3BEIB 2VWMA 1P11E 1O0DH 1O3LA 1UVTH 1P0SH 1C1SA 2OC8A 4ZXYH 1ELDE 1PYTD 1Z1JA 2FX4A 5EODA 1Z6EA 3LT3A 1W3CA 5DJ7A 4SGAE 3VB4A 2GP9B 3O8DA 3KGPA 3V0XA 1QNJA 4MPXA 5SGAE 1O5FH 1TONA 2ANWA 2STBE 3ATIA 5DO4H 1UTOA 4FU7A 1C2KA 1O34A 1HYLA 2H9TH 4DURA 4AN7A 1K1MA 5DP3A 1TPPA 4X6NA 3ZZDA 4E05H 1D9IA 2A7HA 1UTPA 1GI5A 1NT1A 1V2WT 4H42U 2XC0A 4KELA 1UTQA 1VCWA 1SGQE 2A4OA 1C2LA 3AAUA 3OTJE 1UO6A 3M3TA 1O2ZA 2HPQH 4ZXXH 4KGAA 1AHTH 3ZVBA 2H6MA 1KLTA 2BLVA 3GCTG 1C1UH 1ARBA 2H9EH 5EW2H 4O03A 2GMTC 4GUXA 3SBKA 4JYUH 1YLCA 1JRTA 2GCTB 1SB1H 1AQ7A 1C9PA 1T4UH 1OWDA 1TABE 2J34A 3GY3A 1HAVA 2KAIA 4IMQA 4MNVA 4D7GA 3BTDE 1DWCH 4DW2U 1J15A 4O97A 3TH3H 3QK1A 2THFB 2FOFA 3GY8A 4ABBA 5AFZH 1HNEE 2O8TA 2IN2A 1E0FD 3ZZ4A 2FODA 2ODYB 2ZTZA 2EC9H 3NCLA 3VGCC 1YCPH 2VIPA 1BJVA 1TBQH 1FY8E 4F4OC 5JBTA 3F68H 4BAQB 2H1UA 3ODFA 5E2PA 2GTBA 1MKWH 1W7XH 2Y7XA 4TPYA 3RMMH 2OQ5A 2PGQB 2PFEA 2UUFB 2WPIS 3K6YA 3LH1A 2GDDA 2A7CA 1YPGH 2BD5A 1RTKA 4ABGA 4SGBE 4BAHB 3RXGA 4DGJA 3MTYA 3SGBE 8GCHG 2GCTC 1BTHH 1N6YA 1VR1H 2VB0A 2Y5FA 1O39A 4PROA 1O2SA 2Y82A 1ZYOA 2RA3A 1SGDE 3LJJA 1QJ7B 4GVUA 1LDTT 5C1XA 4X8VH 1GHAF 1VCPA 2ANKH 4ESTE 1JWTA 1FIZA 3GCHB 5LPFA 4GCHF 2ZU2A 3RMNH 1UCYH 4I8GA 1O33A 3K9XB 2CMYA 2XWAA 5B6OA 4ISOA 5FPTA 3SU0A 1MTUA 1H4WA 5CHAB 2ASUB 7LPRA 2ZKSA 4TWYA 3TK6A 2UWOA 1EUFA 1BCUH 1GL0E 4YTAA 3QWCH 1T8LA 1W7GH 7ESTE 3ZYDA 1GCDA 3PV4A 4ZKOU 3UY9A 3KNXA 3M7UA 3TGIE 1O38A 1UK2A 1SG8B 2EI8A 3MFJA 2CHAB 4Y76A 3TLOA 4E06H 1BRUP 3UNRA 1NU9A 1GMHF 5FX6A 2BZ6H 2OP9A 3F9GA 1AKSA 1ELEE 2NU2E 2C4FH 4ABJA 1SI5H 3FZDA 2XTTB 2FWWA 4ABIA 3E16B 3SHAH 2BDYA 2BDAA 3LOXA 3TNSA 5JBCS 2C3SA 4BOHA 4WMEA 4YLQH 1C5PA 7KMEH 1ELGA 3VFEA 1V2KT 1LPKB 1Q3XA 3EDXB 1YPMH 5AHGH 2Z3DA 1SLXB 1BRAA 1KXFA 3M37A 3TIUA 2GT7A 1QFKH 2PR3A 1HXFH 3EQ0H 1NN6A 4D76A 2F9BH 3TJVA 1O3EA 1C4V2 2P3UB 2O8WA 3EA9A 4YO9A 2VWNA 3B8JA 3IWMA 3QTOH 1NS3A 3E90B 4CR9A 2BYAX 5I25A 3P8NA 1C2FA 5E0JA 1TX6A 1T8OA 4CR5A 1PYTC 4B1TA 1OYTH 3UR6A 4M7GA 2ZGXH 1YCPK 4LXBH 3M5NA 1ETTH 1KDQB 1N6XA 1ZTKA 1S84A 4LOYH 1C5MD 1DY8A 1F5KU 1VGCB 3KEEA 3RM2H 1GBFA 4U30A 2QY0B 3Q76A 1GI4A 1F0RA 1FUJA 1AWHB 1EAIA 1MKWK 1P09A 1GWAA 2O8MA 2PWXA 4B71A 2QIQA 2W26A 2B5TB 6CHAB 5DKMA 4DVAU 5E8EH 1YYY1 2WPKS 2BDHA 3F1SB 3OY6U 4FUCA 2PKSB 3SUGA 1EZUC 2WUBA 4TWWA 1AGJA 1HJAB 1Y8TA 4X1PU 1EX3A 2ZPQA 5JPMH 4YOIA 5FHTA 4NA7A 1AUJA 4CREA 2SGEE 1QL8A 2GCHG 3ZVDA 3K6ZA 4Z6AH 2BLOA 1L1JA 1LHDH 4AOQA 5HXFA 2D8WA 4VGCC 2OD3B 1VJAU 3M7QA 1DLKB 3MU4A 2A5AA 3RXHA 3FFGA 1UTLM 1MUEB 2Y6TA 3UIRA 4TYDA 1UHBB 2ALPA 1E36B 3SJOA 3S9BA 2GMTB 5TCCA 1YC0A 4Y8XA 1UMAH 2VNTA 2HPPH 1BA8B 1QA7A 1Q2WA 1WTGH 4YOGA 1EB1H 1PPGE 4FUDA 3RXMA 5J4SA 2BX3A 2CJIA 4ZAEA 3RXTA 2FOBA 1IQHA 1EJMA 3QDZB 3RXOA 2DE9A 1G30B 3MNSA 1CA0C 1MZDA 2ZP0H 4O3UA 3ZVFA 4I8HA 1W0YH 1ETRH 1K1OA 3A85A 1C5NH 3ENSB 2XNIA 1KXCA 1GHWH 2XC5A 2Z3CA 4ISLA 3UWJH 2R9PA 1WTHD 1P2MA 1OP0A 3FZZA 1DE7H 1C2GA 2ZCLP 4THNH 3RP2A 1ZR0A 3VXEH 1FZZA 2A7JA 1A2CH 3ZVGA 1BMLA 1GMCG 5C20A 2HNTC 1H9HE 1O2WA 4MLFB 4B75A 2J95A 4HFPB 1SHHB 2AIQA 1LTOA 2P94A 5ABWA 3PMAB 1C5LH 4ABFA 4ISNA 2ZDVH 2A5KA 1BMNH 3GICB 4AX9H 1J16A 1TNLA 2CN0H 1FAXA 1GHBG 2QN5T 3RXPA 4Y7AA 1O3FA 3ZVCA 3U98H 3E1XB 3NZIA 3RM0H 1ANEA 1XUHA 5DP5A 1A5IA 3SW2B 1O2VA 1T8NA 1TYNA 1F2SE 1AFQC 2H5CA 2ZFSA 3SNCA 3U69H 1ESBA 2ZFTA 2ZTYA 3HKJB 3SO3A 3VEQB 3MNBA 1O2YA 1OP8A 4JYTA 1SHYA 3AVZA 1G32B 5JBBS 2F91A 5LGOA 3RXKA 4Y8YA 2FYQA 1QHRB 1SGFG 2C8YB 2P8OB 1P3EA 2NU1E 1F0TA 1TPSA 5JB8S 3QO6A 1O5DH 1SLVB 2NU0E 4UFGH 1ZSLA 3RMOH 1SBWA 3SV7A 3NKKA 1HCGA 2A45B 4FVBA 3S7HB 4TPIZ 1DOJA 5T6GA 1IQGA 2OQUA 4X8SH 1PPZA 1FJSA 1XUGA 1TOMH 3M7TA 3SU2A 8GCHF 1MD7A 3PROA 1C1RA 1W14U 5JB9S 1MTNB 2VH0A 2ODQA 3A8BA 2ZFQH 1IAUA 4AFSA 3MU0A 3QZRA 5K0HA 4BAKB 2QF0A 1SGPE 2BOKA 1GJ5H 4X1SU 3T62A 1O5EH 1THSH 3GY2A 1SOZA 3OYPA 1A5HA 1DS2E 2WINI 1HAYB 2DUCA 1C5ZB 1HAVB 1HBTH 1TGSZ 4OS4A 4TY6A 2O9QA 4AGJA 1KIGH 4D9RA 1SLWB 1GBBA 2ALVA 1TOCB 2A5IA 2ZCKP 3QGNB 4VGCB 1KDQA 2HRVA 3EYDA 4AB9A 1LVMA 3MNXA 1TPOA 3ESTA 3PMBB 4F49A 3SUDA 1OYQA 1XMNB 2R2MB 4Y10E 3BIVH 4UFEH 1GGDC 1AMHA 1AO5A 3ZZ6A 1F5LA 3A89A 1CU1A 3PMHB 4AYYB 1HV7A 1EZXC 3SUFA 1O2XA 3A8DA 3ATLA 1FQ3A 3UPEA 1O2PA 1YP9A 5FBIA 1T8MA 3DUXH 1A0HB 2ANMH 2A4QA 5DP7A 3M3SA 3GCHC 1ZTLA 3AAVA 2Y80A 1DVAH 1FLEE 2BHGA 2ODPA 3RC4A 2BLWA 1FN6A 3RXEA 4FVDA 1HPGA 1QGFA 1YPHC 2STAE 1YKTA 1GI9B 1THRH 1Z6JH 3L33A 1Z8IB 4X6OA 3U8TH 1TRYA 3ZV9A 5GDSH 1QRZA 4MNYA 4Q2KA 4UONA 2VIVA 2BQ7B 4GCHG 1N1LA 1UHBA 2QV1A 4INKA 2G55A 1DT2A 2ZU1A 1CT2E 1GJ8B 2FS8A 1SL3A 4NA9H 2BD7A 2WUCA 3UR9A 1RTFB 1UK3A 1YPHE 4JZDH 2O8LA 4ZROA 1DANH 1HAOH 1CA0B 3V3MA 1NESE 2VH6A 2FOAA 3SU6A 2G81E 4NGAH 3URCA 1A46H 3ZYEA 1L1GA 1DM4B 1P2IA 2B0FA 1FN8A 1T7CA 3QN7A 1PQAA 1WOFA 1ZHPA 2PSXA 5EGMA 2OTVA 2G52A 3T29A 2HGTH 1BQYA 5GCHF 1P3CA 1P12E 2F9VA 4I32A 3K2UA 1O3OA 4FUBA 1E35B 3U1JB 1PPCE 1TBRH 1O3MA 3PLKA 2WPLS 3M61U 3BG4C 1S6FA 3LPRA 3BTTE