5PTPA

Structure of hydrolase (serine proteinase)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords BETA TRYPSIN
publication title Solvent structure in crystals of trypsin determined by X-ray and neutron diffraction.
pubmed doi rcsb
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA02
1AZZA 1GGDB 1O2LA 2BY7X 3A82A 7GCHF 1LKBA 1V2WT 3MI4A 1F92A 1MKXK 1GCDA 2ZFSA 1AB9B 1V2NT 2W7UA 4UFEH 3KIDU 1SQOA 1P9SA 1H8DH 3QUMP 2DUCA 4XFQA 1A3BH 2Y81A 1RRKA 2EC9H 3A8CA 1GMHF 1DANH 2EI6A 1HIAB 3Q00A 2BMGB 4WMEA 4A6LA 1IQKA 1O3OA 1ZGIA 2BD8A 3Q77A 4K1EA 3F9FA 1UTLM 5DP9A 2HRVA 1XUGA 1DLKB 1ESTA 5ESTE 2B9LA 4SGAE 1BTPA 3O8BA 1UVSH 1YM0A 4ABDA 5CMXH 4X6MA 1YPJH 1YLDA 4PROA 2GDEH 3PTBA 3B8JA 5AF9H 1NZQH 1HIAA 3QDZB 3URDA 1TX7A 1VJAU 1RJXB 1C1UH 4OS5A 1CGHA 2IN2A 2QIQA 5T3HA 2FPZA 4FUBA 1DXPA 1ELEE 1TNIA 1GBMA 1HFDA 4IN2A 1D6RA 1ZPBA 3MH6A 1MU8B 5C1XA 4CRCA 1MTWA 2P3UB 1LPKB 2V35A 5E2OA 2PUXB 2QYIA 2JETC 1AZ8A 1WUNH 2STAE 2ZCHP 2W3KA 4MG3A 3T28A 3U98H 5FCRA 1SGFG 1HYLA 2BZ6H 1OP0A 4A7IB 2QC2A 4YOJA 1T8OA 4B75A 3RXUA 1FN8A 2VWMA 1IHTH 3GCHB 2A7JA 1EB1H 1ZHPA 4H42U 1C5WB 2XC5A 1UJ1A 2XBWA 3SU2A 1HAVB 1DE7H 1WQSA 1J17T 2WV5A 1SGPE 1O5DH 4Z6AH 3M36A 4Y7BA 1GJDB 2XC4A 3B23B 1GJ7B 4WH6A 1O3IA 1BBRH 3ATWA 3QZRA 4CR5A 3MU8A 2TGDA 1EATA 1SFIA 4GUXA 3GDVA 3RM2H 2QV1A 4HFPB 3CS0A 3UIRA 1C1WH 1GMCG 3LGYA 2WPIS 4JMYA 3ZVDA 1V6DA 1O2OA 2ZFTA 1PPCE 1ZGVA 1GG6C 3U9AH 1UCYH 2BX3A 3BIUH 1EZUC 3UOUA 1MCVA 5DGJA 1IHSH 3RC4A 2BM2A 1TFXA 2F9PA 2OBOA 1O3JA 1QA0A 4FXGH 3KEEA 1QQUA 2TGTA 1FAXA 1GJBB 2SGAA 2J2UA 3TK6A 3UR9A 1KXAA 2FOMB 4U30A 2ESTE 2W26A 1GI5A 4A5TS 4DVAU 4JYTA 2GMTB 1C4V2 4ZXYH 4CRDA 1KXEA 3SUDA 5JBTA 1IQIA 1CHGA 1NRQH 1FY5A 1GMDG 2J34A 3E8LA 2ZDNA 1YPLH 1J9CH 3ZZ4A 2H6MA 5JBCS 2GZ8A 5E0JA 1G2MA 3H5CB 2C8ZB 2V0BA 4FUDA 3F9HA 5HM9A 1DX5M 1C9TA 1K1OA 1M9UA 4JCNA 1UVOA 1ETTH 1Z7KA 1BJVA 1T7CA 2C93B 3KHVA 4ZMAH 3V0XA 1ELBA 4KTCA 1ARBA 3K9XB 4ABEA 3GCTF 3GY3A 2GZ9A 2ZHDA 1NPMA 2A2XH 8KME2 3BTEE 1FI8A 1P2OA 5DPAA 1F2SE 2CF9H 1PFXC 3TK9A 5GPIB 1AFEH 1HAXB 2VGCC 3R3GB 1Y5AT 1GBAA 2HVXA 2WINI 2C4FH 4YLQH 1TGCA 1AUJA 2FESH 1KIGH 4IBLH 4X2YA 1CBWC 3OSYA 4WF8A 1AGJA 1F0SA 3ZYDA 1LVYA 2SNVA 3EDXB 2WPJS 4JK6A 1GJ4H 1AVWA 2ZFRH 2F91A 3RXVA 1DOJA 3RXCA 1UHBB 1YLCA 4A92A 1B0FA 1BCUH 1RGQA 1ESBA 1XVMA 4I32A 3UOPA 1NU9A 3KGPA 2A5IA 1TBQH 1QRWA 1F0UA 3SO3A 4ESTE 1W3CA 2CJIA 1ZSKA 3T26A 3RXJA 1UHBA 1OWIA 1MU6B 5C1UA 1TMTH 4OS7A 2XBYA 4CH8B 4I8GA 2BOKA 1SGEE 3C27B 3RLWH 1OWHA 4Y10E 5DP3A 2WPKS 1BTWA 1GBLA 1AD8H 1TMUH 2JH6D 3MU0A 4MPUA 4ZHAA 1LCYA 4AFSA 3M3SA 2XRCA 1BMLA 3BF6H 3MWIU 1W13U 1TGNA 2ZECA 3SV2H 1GHAG 1L1GA 4WH8A 4Q7ZA 1T4UH 3RXMA 8GCHG 1SR5C 1VGCC 1O32A 3QWCH 3HKIB 4AGJA 3D65E 4MPWA 2ZU2A 3BG8A 2A45B 3TNSA 2V6NA 2QF3A 1E38B 2O8WA 5F8TA 3O8CA 3SGBE 1V2QT 4INLA 4FUIA 4YESB 3ATMA 4KTSA 2XWAA 1Z8IB 4HZHA 1BTZA 1F5LA 2XC0A 3ESTA 4MPXA 1ANDA 1SL3A 3V7TA 3UTUH 1O30A 2FOAA 4DIIH 1EPTC 1OYQA 1LHFH 1O3NA 3VGCB 3UNRA 3GCNA 2ZGCA 1C5TA 2ZU1A 5A8YA 1FONA 4KELA 3UNSA 1Z6JH 1O34A 1A0HB 2ASUB 1MZAA 3BG4B 1QL9A 1MAYA 2PSXA 1PPEE 1BBRE 4YT6H 4WXIA 1C2HA 1UO6A 1O3PB 1O2JA 4OS4A 1OWEA 1O2WA 4YLUA 5C5NA 1C2JA 2D26C 2JKHA 2SGFE 2OTVA 2UUKB 4LXBH 1TRYA 1YC0A 2ODQA 2AMDA 2BQ6B 2BDAA 4FUGA 4X8UH 2CGAA 1Q31A 1UCYE 4X2VA 1NFUA 2PR3A 1HXFH 5F8XA 2OQUA 3FFGA 4B74A 2Q6GA 3SJOA 3SV9A 1IQLA 3NZIA 1S81A 1WCZA 2PKAB 2Z9JA 1DLEA 3LC3A 1GI0A 1Z71A 3QTOH 1ZTLA 5LGOA 1YPMH 2ZPSA 4I8HA 2ZI2H 4X8TH 3BEIB 4OGYA 4JK5A 1MUEB 1TGTA 1SHHB 3S9BA 5E0GA 1XVOA 1C5XB 3UNQA 1K1MA 1IQEA 1WBGB 3TGKE 2ZWLH 4X6NA 1ID5H 1KY9A 1DWCH 2FOBA 2ZFPH 3SI4H 3RXQA 1DS2E 1HCGA 4AYYB 1LPGB 1QY6A 3GCHC 3GICB 2VIOA 4ISIH 1BB0B 2BD9A 1QHRB 2H5CA 1ZPCA 1ANCA 1GI6A 1K21H 5T6FA 1MTNB 1HAOH 1XUJA 1GHYH 2IJOB 1S6HA 3MU5A 4XE4A 2XCNA 2ZCLP 1PQ7A 2ZO3H 5FHTA 4TYDA 3P6ZB 2FM2A 1HAZB 2GX4A 5L6NH 3I77A 2W3IA 3VB5A 1Q3XA 5AFZH 3HPTB 3P70B 1RXPA 1MKWK 1A46H 1C1QA 4BTIB 4JZ1A 3UFAA 3E1XB 2Y5FA 4QT8C 2BVSH 2NU4E 1UTKA 3ZZDA 4BAKB 2A4QA 2QCYA 4X1RU 3ATLA 4MTBA 2TPIZ 1C2KA 3SUFA 4K1TA 1HJAB 3E91A 2P3TB 2HPQH 4AN7A 1GVZA 1IAUA 4RSPA 2G81E 2PHBA 1ZJKA 3BTFE 1MQ5A 1QJ1B 3SUEA 3ZYEA 4E7NA 2FI5E 4NG9H 1K1LA 1NRSH 4HI3A 3KNXA 1GBFA 3AAUA 1KYNA 1AVXA 4JYVH 4AGKA 1CT0E 1NESE 2GCTB 1VITF 2NU3E 1WOFA 3SQHE 1GBJA 2P59A 3MH5A 1VCQA 3RC5A 3A7YA 5EW2H 1AHTH 1FZZA 1CU1A 1BTXA 1P57B 1O2ZA 4WMDA 1AWHB 2JH0D 3URCA 1J8AA 4TPIZ 2IOTA 2DE8A 4TY6A 1ETSH 1S82A 1TQ7B 2AMQA 1DICA 2FOHA 1SGQE 1O3HA 4BAOB 1Y3YA 1L4DA 1UVUH 1NFYA 1NS3A 3W94A 1J15A 1XUKA 1C1NA 2Q6DA 2XXLA 5C20A 3SU1A 1CA0C 2ZDVH 2A0QB 4YM9A 3PM3A 2EI7A 2STBE 1QFKH 1HRTH 4NWKA 5A0AE 1GBIA 2BLOA 5EGMA 4Q2KA 1OWDA 1TNLA 1V2RT 4H6TA 3OY6U 3LC5A 1Y5UT 1CE5A 4H4FA 4O03A 1W0ZU 1GI1A 1SGIB 5EW1H 3KQDA 3PWCA 4INHA 1A5HA 1AIXH 1O31A 3OU0A 3PO1B 3NUMA 1T32A 3P8GA 4NA9H 1GJAB 2D8WA 3SGAE 2SGPE 2D1JA 3TITA 3SV8A 1ZHRA 3ODDA 1YYY1 3VB4A 2OXSA 3S9AA 1NFXA 3BEFB 1DVAH 1T8MA 2Y5HA 1BQYA 4A1VA 5EG4A 2BXTH 3ZVGA 2KAIB 1V2JT 1TGBA 2ANKH 5ESBA 4TPYA 3MMGA 2R2MB 3TNTA 5I25A 1GBTA 3PLBA 1C1MA 1JOUB 1KLJH 2FWWA 4K69A 3VEQB 1EJNA 1YBWA 2FS9A 3DD2H 2Z9GA 4X8SH 3W95A 1UMAH 3SW2B 4Y0ZE 5I46H 3A81A 2BHGA 4HTCH 3E0NB 3GOVB 3BIVH 1BMAA 2ZQ1A 2CMYA 2PKSC 6CHAC 1F0RA 1ACBE 5L2ZH 2ZGBH 4I8JA 1EZSC 2AGGX 4U01A 5C3NA 3SHCH 1ELCA 3TPIZ 6GCHG 2AIQA 1MCTA 2FEQH 4UE7H 5EPYA 1GHWH 3BTTE 3A8DA 5SGAE 3KCGH 5HMAA 1NRPH 2BDYA 2J92A 1RD3B 4BTTB 4GCHG 2PUQH 4UD9H 2AS9A 2OC0A 1HAIH 5E2PA 1H1BA 1O2KA 1GMHG 2ZEBA 2GVFA 1NM6A 1RS0A 4AZ2B 3HATH 5LPRA 1SGDE 1AKSB 1O2XA 2NWNA 1GVKB 1P2QA 2HALA 4ISOA 2AEIH 1C1OA 1Z6EA 1O37A 3DT0H 1ESAA 1UVTH 2ZU5A 1C5QA 1P10A 1TABE 3MO6A 1DWEH 2DE9A 2PTNA 1CHOF 4CRBA 1QGFA 4E06H 2VB0A 2VIVA 1K1JA 4X6OA 1L4ZA 2LNCA 3AVZA 1Y5BT 1SQTA 7KMEH 1AKSA 2A32A 4NSYA 4NZQA 3Q76A 2HWLB 1P8VC 1RIWB 3GY4A 2GCHG 1A0JA 4AB8A 5K7RA 3RXAA 4ZHLU 3M3VA 2VVCA 2H5DA 3BTGE 1Y3XA 3SNDA 1O3AA 1B0EA 2OUAA 2ZHEH 1A3EH 2EI8A 1TA2A 2AGIX 1ZOMA 2FIRH 4K3JA 5HGGA 2ZDKA 1IQGA 1UTMA 2UUYA 1ZMJA 3BV9B 1ZLRA 4K8BA 2JH5D 1ANBA 2Z6BD 3SV7A 1MTVA 1ABIH 2FZZA 2UWLA 3QGJA 1TE0A 1HPGA 1PPZA 1LVBA 4DURA 1C2LA 1GHBG 1EAWA 2Z9KA 1PYTD 2ZU4A 1NU7B 2OC1A 1O2HA 1B7XB 3FP8E 1YPGH 3A7VA 1QB6A 2FMJA 2OLGA 4FUHA 3EAJA 3P8NA 2FDAA 1O2YA 1O5EH 1ABJH 1YGCH 3MU4A 1RTKA 2QXHA 1PQ8A 3ZVEA 9LPRA 1HDTH 3O8DA 3S9CA 1BRBE 4CBOA 1Y59T 1A4WH 4I8KA 3SI3H 3TVJB 4NGAH 3L33A 4O9VA 1O2IA 2BB4A 2HLCA 1WV7H 4I33A 1QJ6B 1FY3A 4OS1A 1Z1JA 1S0RA 1P9UA 2Q6FA 3OX7U 3E3TA 7LPRA 3HKJB 2FS8A 1SPJA 3M7TA 4X2XA 3RXRA 1C5ZB 4Z0KA 3STJA 1G3BA 1HJAC 5AFYH 8LPRA 2F83A 2THFB 4BAHB 5CHAB 2OINA 1W11U 1OYTH 2BX4A 1EUFA 4Y8XA 2NU0E 1H4WA 3A7WA 2AFQB 1DFPA 2ZTYA 3BSQA 3TH2H 2EA3A 1BBRK 4RKOB 4NIXA 1Y8TA 1ZMNA 1T31A 3LOXA 1KTTB 2WUBA 3BTHE 3IWMA 1UK4A 1CT2E 1W2KH 4BANB 4IN1A 2B0FA 2ZTXA 4UFFH 4AFZA 1THSH 1U6QA 1QJ7B 3KL6A 1C9PA 3H7TA 3GCTG 2PWXA 1O3MA 1KTSB 2WYJA 2ZHQH 3P8OA 1BT7A 1UCYK 2QA9E 1ZZZA 2A5AA 3E16B 2ZZUH 3QK1A 1RTLA 4Y8YA 1SSXA 4Y11E 1QNJA 2GD4B 1GDUA 3K6ZA 4AFQA 1TX6A 1GMDF 1Z8RA 4ZKRU 1QA7A 5DJ7A 4D76A 2SFAA 4WY3A 4INKA 1SLWB 2ODYB 3SN8A 3LJJA 1PQAA 4MNWA 2F9UA 3OTJE 4FU8A 1O2TA 1YPKH 4ASHA 1D3DB 2HNTF 2O8MA 1Y3WA 2Z3CA 4B73A 2VWLA 1ZTKA 3BTME 1ELDE 1S83A 3U1JB 2IPHA 3EE0B 3TJNA 1TONA 3B9FH 1F5KU 3UQVA 2OC7A 4E7RG 4XBBA 3VB7A 2OP9A 3RXLA 4D7FA 2C3SA 4KP0A 3GCOA 4YT7H 5DP6A 6LPRA 1FJSA 2BOHB 5LH8A 4MNXA 3PO1C 1GHXH 2Y6TA 3RP2A 5HXFA 1JIRA 1K1NA 1AE5A 5H4IB 3D49H 1C5VA 1ZPZA 2J38A 1O2NA 1G3EA 3K65B 2BD3A 3M7UA 1SOTA 1W7XH 1BRUP 1AE8H 4AB9A 1PYTC 2CHAB 4GVUA 2FTMA 1BRCE 1BRAA 2QXIA 3PV4A 1VCPA 4IMZA 5TCCA 1AFQC 4GPGA 1WAYB 1C5RA 2WV4A 2ZGXH 1BOQA 2ZDAH 2FX6A 4E05H 1BMMH 3LGIA 5A8ZA 5J4SA 1PPGE 3RXDA 4O97A 2O8TA 3Q3YA 2FI3E 2ZHFH 3KQCA 4B1TA 3ENSB 3NK8A 4F49A 3U8RH 1GCTB 3TIUA 2F3CE 1F0TA 3A89A 2FYQA 3RDZA 1W12U 3FVFB 1T8NA 1YPHE 1MD8A 1V2OT 1CT4E 5FPTA 4AYVB 4R8TB 1LVOA 5A0BA 4YO9A 1C5SA 3SJIA 5CE1A 1TPAE 5K0HA 1GHZA 2FOCA 1OWKA 2Z94A 1TNKA 2FOEA 2XNIA 1XUFA 2YNBA 4ZKSU 2A7CA 1BUIA 4AG2A 1GHAF 2A5KA 2AERH 3BEUA 2C90B 5DP4A 3IITA 3DUXH 1GGDC 5PTPA 2BDGA 2ZP0H 1AY6H 1FN6A 3M37A 1MQ6A 1YCPM 3GY7A 4FU9A 3RLYH 4MLFB 1TBZH 1AB9C 1ELAA 1KLTA 4MNVA 5G4BA 1BDAA 1TBRH 4NSVA 2ULLA 1E34B 1C2EA 1FQ3A 2HNTC 1CGJE 1GJ6A 4FUFA 4JZIA 1A5GH 1G3DA 3T5FH 5FPYA 1SI5H 2C8WB 1H9IE 1BTUA 4Y0YE 3SUGA 2AH4X 1KXFA 3NXPA 2R2WU 2FODA 1GJCB 1FV9A 4FUJA 2P3FH 3RXGA 3RXEA 1HJ9A 2VIWA 2A1DB 2ZTZA 3M35A 1TPPA 1O2MA 3JZ2B 1C2IA 2BDCA 2BD2A 2LPRA 1O39A 3A85A 3U69H 1FPHH 1CA8B 1XXDA 3TK5A 3SNEA 2GGVB 1YPEH 2YNAA 3ZZ3A 1TYNA 4I31A 1ANEA 1EP6A 1E0FD 1MTSA 1EOJA 2CF8H 3A8AA 4SGBE 3RXOA 4MQAA 2GT8A 1S84A 1WSSH 1K9OE 1DT2A 4NFEA 3T29A 1OKXA 1SLUB 2A4OA 2R0LA 1GPZA 3RXIA 1N8OB 3RMMH 2OQ5A 3PB1E 3ITIA 1KXCA 1TNJA 2B8OH 2C8XB 3RXBA 3SU3A 2BQWB 3MH4A 1KSNA 2QXJA 2RCEA 1OX1A 2J95A 2JETB 2G4UA 1LMWB 3FAOA 3UY9A 1BITA 1O5CB 1SG8B 3FZZA 1LO6A 2ZGJA 1XKBC 3BTWE 2I6QA 1ZMLA 1V2LT 3P95A 1EASA 1OXGA 2G5NA 1S6FA 1V3XA 2ZU3A 1C5YB 5A0CA 1G2LA 5F03A 2Z3DA 1MAXA 2VWNA 1AU8A 2RA0A 2GZ7A 1C4U2 4RKJB 2RDLA 1GHVH 7ESTE 5L2YH 4ZHMU 2PGBB 3Q3XA 4FUCA 1ZJDA 2RG3A 5JYIA 1GI8B 3A80A 3A86A 4GHTA 1EAXA 1A2CH 2W5EA 1V2KT 1Z8JB 3G01A 4XBDA 3MH7A 4BAQB 2OC8A 4MVNA 3LGTA 1IQHA 2G00A 1OWJA 3MHWU 4THNH 3RUOA 3P17H 1GBBA 5F8ZA 4X6PA 1QBVH 2WPLS 1GG6B 2BY5X 2ZIQH 4CBNA 2TRMA 5E0HA 1O5FH 2ANWA 5FX6A 3T25A 1MD7A 1HUTH 1VITG 5CHAC 3BTQE 4Q7YA 1QB9A 1NFWA 2GMTC 2ZFQH 5JB8S 4X1QU 3VB6A 3ELAH 2B7DH 1FY4A 2ALVA 4VGCB 1EAUA 5GCHG 1DY9A 2XWBI 1SGRE 2ZCKP 3A87A 1O3DA 3M5LA 3UR6A 1GL0E 4Q7XA 5T6GA 4UDWH 1DITH 1FPCH 1ELTA 5ABWA 1L2EA 1G3CA 3PWBA 1LHCH 4RN6A 4BNRA 3RC6A 1LQDB 3SJKA 4WJG2 3C1KA 2Y7XA 4K1SA 2GV6A 4I8LA 4D9QA 3F68H 5JBBS 2FI4E 3D62A 2GDDA 2BTCE 2OBQA 1GI4A 3RMLH 3BTKE 2D2DA 1TAWA 3LGVA 1G37A 4YOGA 3SJ9A 1FLEE 1P06A 4XDEA 4DG4A 1YF4A 2K1QA 4AG1A 2PLXA 4ZAEA 1VCWA 1V2TT 5EU8A 1MBMA 1TPOA 1UK2A 1O2UA 1LHGH 1O3GA 1J16A 3R0FA 3F9GA 1P2JA 2P95A 2H9TH 1TGSZ 4R0IA 2ZPRA 5BPEA 5C1YA 2H9HA 1NN6A 2VGCB 3M61U 2YOLA 4J2YB 5EXMA 3VPKA 4MPVA 4HGCA 4BAMB 2FO9A 1HAPH 1CBWB 3SNAA 1MZDA 1C5PA 1Y3UA 1FAKH 2FOGA 4U2WA 1UTQA 1HNEE 2J4IA 4NA8A 5JB9S 4X1NU 1GDNA 2F9VA 1GL1A 2BYAX 1V2MT 3LT3A 4IC5A 5DK1A 5IDKA 4GAWA 1C1PA 1EAIA 1HB0B 1Y3VA 3RXSA 2UUJB 5AVDA 3TLOA 5JDUB 4CHAB 1A0LA 2AYWA 2BD7A 1O35A 1QBOA 1SLVB 1XX9A 1L1JA 1BMNH 2QY0B 1IQMA 1QURH 3ZVBA 4CREA 1FY8E 4FVBA 3TGJE 1P2KA 2GV7A 1IOEA 4JZFH 1G36A 1O3LA 4MDSA 2ZC9H 2BZAA 1O5BB 3SQEE 4D7GA 3RU4D 3ZVFA 1O5AB 1P12E 2FP7B 5DP5A 4B2BA 1YCPH 3PMJA 1DM4B 5F6MA 3KQBA 1P0SH 3I78A 1K22H 4D9RA 1GJ8B 3NKKA 1AQ7A 2M5TA 2EEKA 3BN9A 1MKXH 3PLPA 3FANA 1MBQA 4KGAA 4TY7A 1TNGA 1GBKA 1A61H 1C5NH 3MO3A 4X2WA 4F4OC 1TQ0B 4A1XA 2H9EH 2ZPQA 3EQ0H 1NROH 7GCHG 1W8BH 1VGCB 5C67A 4DOQA 1INCA 1BHXB 4JZDH 4YZUA 3DFLA 2ZHWH 3LGUA 1EP5A 2ILNA 5GIBA 1THRH 1XKAC 1KDQA 3LH3A 3VGCC 4JZEH 4X1SU 1DUAA 1EZXC 3AW1A 8ESTE 4Y6DA 1IQFA 3GY8A 5EXNA 1D6WA 1QR3E 4ZKNU 1P05A 1O2VA 3BG4C 1EPTB 5GXPA 4B71A 1EZQA 1CHOG 3SOSA 3GYMA 3AAVA 5FBEA 1LHEH 2BVXH 1K1PA 4GCHF 1GJ9B 1B5GH 2F9OA 3A7ZA 1P11E 2SGEE 1XUIA 1GBCA 3OY5U 1SC8U 1C5OH 1Z8GA 1LKAA 1A5IA 1FMGA 3L6PA 1TMBH 3ZV9A 3UQOA 4X0WU 1EPTA 1NT1A 1OP8A 2W7SA 2I6SA 1EQ9A 2WPMS 4ISNA 4DIHH 2ZDMA 3QN7A 2P8OB 3RXTA 1TA6A 3TU7H 3SZNA 3WY8A 3V12A 1AVGH 4AFUA 3RXKA 3ZZ7A 1D9IA 1L1NA 5E8EH 1QBNA 2XTTB 1VITH 3FP7E 1NC6A 3MTYA 3CP7A 2Z9LA 3GISB 4OS6A 2GCHF 2ZNKH 1HJ8A 4CR9A 3A7TA 4XBCA 1S0QA 1D3PB 3M5OA 1DSTA 1ELVA 1N8OC 3STIA 1AUTC 1BTYA 3DA9B 3DFJA 2FLBH 1DDJA 1SHYA 3P92A 3TGIE 3QGNB 1DPOA 1N1LA 4U32A 2QXGA 3EGKH 3NPSA 3RXHA 3VXEH 5HYOA 5B6OA 5JBAS 3TH3H 2ANYA 2Y7ZA 3MOCA 2UWPA 4ZKOU 1UTOA 1MTNC 1P2IA 3EA9A 1PPHE 2UWOA 2VU8E 2ZGHA 2FXRA 4Y7AA 1C2GA 1QRZA 1C2DA 3V3MA 3LJOA 1EKBB 1GHBF 1OSSA 4TWWA 1LHDH 4YTAA 2NU2E 1GBEA 2R0KA 1IQNA 1CSOE 1X7AC 1JXPA 1O2SA 4UFDH 1JRTA 3DHKH 3A84A 3GY6A 5LPFA 3ZZ5A 3TH4H 1SBWA 5GDSH 3RM0H 1C5UA 4DT7B 1ELGA 3LH1A 5DP7A 1HAVA 1LDTT 1QRXA 1YP9A 4D8NA 4O3UA 2BY6X 1GMCF 2VWOA 3LONA 2BDHA 2PW8H 1FIWA 3UWIA 1O5GH 2J9NA 5EPNA 3NCLA 4UFGH 2B5TB 3TJVA 1C1SA 1RTFB 1GBDA 1NY22 4ABGA 1O2QA 3K6YA 3CS7A 2Z9IA 1T8LA 5DG6A 4M7GA 2GCTC 4VGCC 2WPHS 1QCPA 4NIYA 5EXLA 1W0YH 1WQVH 4IW4E 2PGQB 5JPMH 2VINA 2PTCE 4IC6A 1P04A 2VVVA 2XW9A 1TRNA 2XCFA 1KXDA 3PMBB 5C5OA 1BHXF 4B2AA 1BA8B 5FX5A 1O2PA 1W10U 2UUFB 2FOFA 4K60A 2Z3EA 3SBKA 3EA8A 4NZLA 3ATKA 2CV3A 5ETXA 1VR1H 2F9NA 1VJ9U 1FNIA 2VNTA 1HAHH 2BVRH 4DGJA 2Y80A 4Y8ZA 2XBXA 1QB1A 1JMOH 2G52A 3A88A 4AOQA 4LK4A 1TNHA 1LVMA 1RFNA 1DUEA 4ABJA 1JIMA 2G4TA 1CA0B 2QGRA 3CENA 1K1IA 1ZSJA 2CN0H 4DY7B 4H6SB 4K8YA 1O0DH 5GWZA 4NFFA 1XXFA 2BLWA 3MFJA 1O33A 3S69A 4GSOA 3SHAH 1OS8A 1C2FA 1SOZA 2AGEX 1GVLA 4I7YH 1AWFH 1EJMA 3MU1A 2F9BH 4NWLA 1HAYB 3KQEA 1HGTH 4CHAC 2ZFFH 1S85A 2FX4A 4Y76A 3PTNA 5IYTA 1G32B 4BXSA 1CGIE 3NWUA 1UTJA 1AN1E 5AHGH 1ZTJA 3PROA 1KXBA 1UTNA 2WUCA 3LDXH 1CVWH 3LGWA 3L3TA 2BQ7B 1SGCA 2A31A 2CXVA 1F7ZA 4NIWA 1V2VT 3E90B 3VFEA 2J94A 1JRSA 2PV9B 5A2MH 3HK6B 1DXWA 1MTUA 2OCVB 3SU6A 2FTLE 2P94A 3T2NA 3FP6E 1E36B 3KN2A 3QX5H 1D3QB 1H9LB 2Y5GA 3AASA 4XSKU 1SGNE 4IGDA 4ABAA 4ABIA 2GT7A 4GLYA 1WU1A 3SGQE 3VXFH 4AX9H 3LIWA 3MNSA 2ANMH 2VIDA 4X1PU 1P09A 1SQAA 3IG6B 1SB1H 1TRMA 1N6YA 2PKSB 2QF0A 4DCDA 6CHAB 1TOMH 1P2NA 1C4Y2 1Q2WA 3S7HB 2BY8X 1H8IH 3A8BA 2BD4A 1N6XA 2P93A 1GWAA 1HXEH 1FDPA 3M7QA 1IQJA 8GCHF 2ZQ2A 1C1VH 2RA3A 3JZ1B 1E37B 1ZYOA 3MYWA 2TGAA 5HM2A 4BOHA 3PLKA 2A2QH 3RMNH 2HOBA 1SLXB 4J1YA 1O36A 4NCYA 1SGYE 3ZVAA 1O3KA 1GDQA 1SGTA 3LPRA 3SNCA 1BTHH 1J14A 1PPFE 2Z7FE 1SMFE 4FVDA 1L0ZA 5DKMA 2V3HH 1O3EA 1GI7B 1GBHA 1A7SA 1TPSA 4KKDA 1BZXE 1RIWC 6ESTA 2AMPA 2R9PA 5EOKA 1EX3A 1P02A 2O8LA 3HGPA 1P2MA 2HPPH 1JBUH 2P8OC 4CH2B 2VH0A 2BY9X 2Y82A 2FYRA 2PFEA 1ORFA 2BLQA 3EYDA 2HGTH 4X8VH 1V2ST 1P01A 5A09A 2H2ZA 4LOYH 2TIOA 3MNBA 2G51A 2H1UA 4K2YA 4CRFA 1AI8H 5FBIA 4O3TA 1HV7A 1LTOA 4MNYA 4WMFA 1LPZB 2VVUA 1SFQB 3MNXA 1CQQA 3TJOA 3RU4T 4JYUH 4NIVA 1MH0A 3SORA 5L30H 1P3EA 3HK3B 3ZV8A 2GTBA 3QTVH 4DW2U 1MKWH 1XM1A 1WYKA 1ZRKA 4WVPE 3F6UH 4ZH8A 3U8OH 3UREA 2PKAA 2GKVE 2BDIA 3LKWA 3E0PB 2WYGA 3M5NA 3SU0A 3A7XA 1S5SA 3TJUA 2G55A 1P03A 5DO4H 3F1SB 1C5MD 1OP2A 4OGXA 5T6DA 3ZZ9A 3FZDA 1T4VH 3RU4E 4B76A 2ALPA 2ZKSA 1TLDA 3T27A 4ISHH 1TB6H 1NTPA 1HAGE 1NRRH 2Q1JA 3QLPH 2GP9B 1DWDH 3SNBA 3K2UA 1PPBH 3ZZ8A 3S7KB 1G9IE 3VB3A 2V3OH 1O3FA 4ISLA 9ESTA 2VIPA 3Q3KA 1ZR0A 3S0NA 1D4PB 4LZ4B 1QL8A 1YKTA 2XYAA 3ODFA 2QAAA 3ZZ6A 3U1IB 2A4GA 1A1RA 2R3UA 4CRGA 3BTDE 3UPEA 4YOIA 2BDBA 1QQ4A 4AORA 1EJAA 1V2PT 1WTHD 1KLIH 1FIZA 4UONA 1W7GH 1FUJA 5LPEA 1E35B 2G8TA 3MNCA 1OOKB 3N7OA 1FXYA 5TCAA 1DWBH 2QN5T 5C2ZA 2FLRH 1ELFA 1XUHA 1O3CA 1O2RA 1PJPA 1O3BA 1C2MA 1C5LH 1EOLA 2BD5A 1UK3A 1K28D 5GJ4B 3ZZBA 2XBVA 1QTFA 4WWYA 1AO5A 1JWTA 1CO7E 1DSUA 2ZF0H 2VIQA 1QIXB 1HLTH 1Z1IA 2A7HA 2O8UA 2ODPA 4B2CA 5GCHF 3P8FA 4IS5A 1AMHA 3PMHB 3M3TA 1DY8A 1VZQH 1BJUA 3EA7A 5TJXA 3GY2A 1GJ5H 1THPB 2O9QA 3F9EA 5A8XA 2ZDLA 1NO9H 5FCKA 3SJ8A 4ZUHA 4FU7A 1ZSLA 4IMQA 4WXVA 4ZXXH 4ZROA 4ABFA 1C1TA 5EQRA 3SU5A 4BTUB 1GI2A 2TGPZ 3UWJH 1FY1A 1HBTH 3GDUA 3QO6A 2OD3B 1F5RA 1QL7A 4OS2A 1GI9B 1TIOA 2R3YA 3RMOH 3O8RA 4Y79A 3RXPA 1G30B 5DP8A 1TOCB 4XOJA 3LU9B 2VH6A 3PYHA 4NA7A 1W14U 1TX8A 4GHQA 1H9HE 4TWYA 3A83A 1BIOA 3M5MA 2C8YB 1ZHMA 3GY5A 4Y71A 2NU1E 2CHAC 1O38A 5FAHA 1UTPA 3GYLB 2SGQE 3ZZAA 3QZQA 3PMAB 2BLVA 1PQ5A 3D23A 3V13A 2SGDE 3AW0A 4DJZB 3ATIA 4ABBA 2AIPA 1SVPA 1K2I1 5EODA 4UEHH 2ZG0H 3HGNA 2VJ1A 1XMNB 3UUZA 1C1RA 1EXFA 5EQQA 1LQEA 3SV6A 4K5ZA 2P16A 1D3TB 1SGFA 1AFQB 3E6PH 5BRRE 3ZZCA 1OPHB 1KDQB 1GCTC 2ZA5A 4ABHA 1WTGH 1P3CA 1NRNH 2G5VA 3GDSA 3OYPA 3U8TH 5FPSA 3ZVCA 4A1TA 1ZRBA 5EQSA 2KAIA 2TBSA 4LZ1H 3MO9A 1EB2A 5J4QA 1TWXB 1GI3A 1MMJN 4BXWA 2PSYA 4KTUA 1TALA 3RXFA 3SU4A 2SNWA 4FUEA 3I29A 5FXLA 3H7OA 3KF2A 3T62A 4Q80A 2BXUH 1O2GH 1YPHC 1V2UT 4CRAA 6GCHF 1UVPA 2A4RA 2HNTE 1YCPK 1ETRH 1ARCA
chains in the Genus database with same CATH superfamily
1AZZA 1GGDB 1O2LA 2BY7X 3A82A 7GCHF 1LKBA 1V2WT 3MI4A 5T1VA 1F92A 1MKXK 1GCDA 2ZFSA 1AB9B 1V2NT 2W7UA 4UFEH 3KIDU 1SQOA 1P9SA 1H8DH 3QUMP 2DUCA 4XFQA 1A3BH 2Y81A 1RRKA 2EC9H 3A8CA 1GMHF 4ACAA 1DANH 2EI6A 1HIAB 3F2HA 2BMGB 3Q00A 4WMEA 4A6LA 1IQKA 1O3OA 1ZGIA 2BD8A 3FN8A 3Q77A 4K1EA 3F9FA 1UTLM 5DP9A 2HRVA 1XUGA 1DLKB 1ESTA 5ESTE 2B9LA 2KFWA 4SGAE 1BTPA 3O8BA 1UVSH 1YM0A 4ABDA 5CMXH 4X6MA 1YPJH 1YLDA 4PROA 2GDEH 3PTBA 3B8JA 5AF9H 1NZQH 1HIAA 3QDZB 3URDA 1TX7A 4HG6A 4ZCNA 1VJAU 1RJXB 1C1UH 4OS5A 1CGHA 2IN2A 2QIQA 5T3HA 2FPZA 4FUBA 1DXPA 1ELEE 1TNIA 1GBMA 5HIZA 1HFDA 4IN2A 1D6RA 1ZPBA 3MH6A 1MU8B 5C1XA 4CRCA 4F55A 1MTWA 2P3UB 1LPKB 2V35A 5E2OA 2PUXB 2QYIA 2JETC 1AZ8A 1WUNH 2STAE 2ZCHP 2W3KA 4MG3A 3T28A 3U98H 5FCRA 1SGFG 1HYLA 2BZ6H 1OP0A 4A7IB 2QC2A 4YOJA 1T8OA 4B75A 3RXUA 1FN8A 2VWMA 1IHTH 3GCHB 2A7JA 1EB1H 1ZHPA 4H42U 1C5WB 2XC5A 1UJ1A 2XBWA 2YMSC 3SU2A 1HAVB 1DE7H 1WQSA 1J17T 2WV5A 1SGPE 1O5DH 4Z6AH 3M36A 4Y7BA 1GJDB 2XC4A 3B23B 1GJ7B 4WH6A 1O3IA 1BBRH 3ATWA 3QZRA 4CR5A 3MU8A 2TGDA 1EATA 1SFIA 4GUXA 3GDVA 3RM2H 2QV1A 4HFPB 3CS0A 3F2GA 3UIRA 1C1WH 1GMCG 3LGYA 2WPIS 4JMYA 5DSFA 3ZVDA 1V6DA 1O2OA 2ZFTA 1PPCE 1ZGVA 1GG6C 3U9AH 1UCYH 2BX3A 3BIUH 1EZUC 3UOUA 1MCVA 5DGJA 1IHSH 3RC4A 2BM2A 1TFXA 2F9PA 2OBOA 1O3JA 1QA0A 4FXGH 3KEEA 1QQUA 2TGTA 1FAXA 1GJBB 2SGAA 2J2UA 3TK6A 3UR9A 1KXAA 2FOMB 4U30A 2ESTE 2W26A 1GI5A 4A5TS 4DVAU 4JYTA 2GMTB 1C4V2 4ZXYH 4CRDA 1KXEA 3SUDA 5JBTA 3OEED 4RT0A 1IQIA 1CHGA 1NRQH 1FY5A 1GMDG 2J34A 3E8LA 2ZDNA 1YPLH 1J9CH 3ZZ4A 2H6MA 5JBCS 2GZ8A 5E0JA 1G2MA 3H5CB 2C8ZB 2V0BA 4FUDA 3F9HA 4I86A 5HM9A 4Q4LA 1DX5M 1C9TA 1K1OA 1M9UA 4JCNA 1UVOA 1ETTH 1Z7KA 1BJVA 1T7CA 2C93B 3KHVA 4ZMAH 4DT4A 3UB0A 3V0XA 1ELBA 4KTCA 1ARBA 3K9XB 4ABEA 3GCTF 3GY3A 2GZ9A 2ZHDA 1NPMA 2A2XH 8KME2 3BTEE 1FI8A 1P2OA 5DPAA 1F2SE 2CF9H 1PFXC 3TK9A 5GPIB 1AFEH 1HAXB 4XD7D 2VGCC 3R3GB 1Y5AT 1GBAA 2HVXA 2WINI 2C4FH 4YLQH 1TGCA 1AUJA 2FESH 1KIGH 4IBLH 4X2YA 1CBWC 3AK5A 3OSYA 4WF8A 1AGJA 1F0SA 3ZYDA 1LVYA 2SNVA 3EDXB 2WPJS 4JK6A 1GJ4H 1AVWA 2ZFRH 2F91A 3RXVA 1DOJA 3RXCA 1COWD 1UHBB 1YLCA 4A92A 1B0FA 1BCUH 1RGQA 1ESBA 1XVMA 2AHME 4I32A 3PRBA 4B6EA 3UOPA 1NU9A 3KGPA 2A5IA 1TBQH 1QRWA 1F0UA 3SO3A 5EJZA 4ESTE 1W3CA 2CJIA 1ZSKA 3T26A 3OTPA 3RXJA 1UHBA 1OWIA 1MU6B 5C1UA 1TMTH 4OS7A 2XBYA 4CH8B 4I8GA 2BOKA 1SGEE 3C27B 3RLWH 1OWHA 4Y10E 5DP3A 2WPKS 1BTWA 1GBLA 1AD8H 1TMUH 2JH6D 3MU0A 4MPUA 4ZHAA 1LCYA 4AFSA 3M3SA 2XRCA 1BMLA 3BF6H 3MWIU 1W13U 1TGNA 2ZECA 2LELA 3SV2H 1GHAG 1L1GA 4WH8A 4Q7ZA 1T4UH 3RXMA 8GCHG 1SR5C 1VGCC 1O32A 3QWCH 3HKIB 4AGJA 3D65E 4MPWA 2ZU2A 3BG8A 2A45B 4FOUC 3TNSA 2V6NA 2QF3A 1E38B 2O8WA 5F8TA 3O8CA 3SGBE 1V2QT 4INLA 4FUIA 2JIZD 3ATMA 4KTSA 2XWAA 4YESB 1Z8IB 4HZHA 1BTZA 1F5LA 2XC0A 3ESTA 4MPXA 1ANDA 1SL3A 3V7TA 3UTUH 1O30A 2FOAA 3OE7D 4DIIH 1EPTC 1OYQA 1LHFH 1O3NA 3VGCB 3UNRA 3GCNA 2ZGCA 1C5TA 2ZU1A 5A8YA 1FONA 4KELA 3UNSA 1Z6JH 1O34A 1A0HB 2ASUB 1MZAA 3BG4B 1QL9A 1MAYA 2PSXA 1PPEE 1BBRE 2W6JD 4YT6H 4WXIA 1C2HA 1UO6A 1O3PB 1O2JA 4OS4A 1OWEA 1O2WA 4YLUA 5C5NA 2J98B 1C2JA 2D26C 2JKHA 2SGFE 3ZIAD 2OTVA 2UUKB 4LXBH 1TRYA 1YC0A 2ODQA 2AMDA 2BQ6B 2BDAA 4FUGA 4X8UH 2CGAA 1Q31A 1UCYE 4X2VA 1NFUA 2PR3A 1HXFH 5F8XA 2OQUA 3FFGA 4B74A 2Q6GA 3SJOA 3WW7A 3SV9A 1IQLA 3NZIA 2J98A 1S81A 1WCZA 2PKAB 2Z9JA 1FX0B 1DLEA 3LC3A 1GI0A 1Z71A 3QTOH 1ZTLA 5LGOA 1YPMH 2HVYB 2ZPSA 4I8HA 2ZI2H 4X8TH 3BEIB 4OGYA 4JK5A 1MUEB 1TGTA 1SHHB 1YWUA 3S9BA 5E0GA 1XVOA 1C5XB 3UNQA 1K1MA 1IQEA 1WBGB 3TGKE 2ZWLH 4X6NA 1ID5H 1KY9A 1DWCH 2FOBA 2ZFPH 3SI4H 3RXQA 1DS2E 1HCGA 4AYYB 1LPGB 1QY6A 3GCHC 3GICB 2VIOA 4ISIH 1BB0B 2BD9A 4TT3D 5EJ1A 1QHRB 2H5CA 1ZPCA 1ANCA 1GI6A 1K21H 5T6FA 1MTNB 1HAOH 1XUJA 1GHYH 2IJOB 1S6HA 3MU5A 4XE4A 2XCNA 1S6LA 2ZCLP 1PQ7A 2ZO3H 5FHTA 4TYDA 3P6ZB 2FM2A 1HAZB 2GX4A 5L6NH 3I77A 2W3IA 3VB5A 2WSSD 1Q3XA 5AFZH 3HPTB 2RDEA 1RXPA 3P70B 1MKWK 2F4LA 2PP6A 1A46H 1C1QA 4BTIB 4JZ1A 3UFAA 3E1XB 2Y5FA 4QT8C 2BVSH 2NU4E 1UTKA 3ZZDA 5DN6D 4BAKB 2JJ1D 2A4QA 2QCYA 4X1RU 3ATLA 4MTBA 2TPIZ 1C2KA 3SUFA 4K1TA 1HJAB 3E91A 2P3TB 2WZQA 2HPQH 2EY4C 4AN7A 1GVZA 1IAUA 2M2AA 2G81E 4RSPA 1ZJKA 2PHBA 3BTFE 1MQ5A 1QJ1B 3SUEA 3ZYEA 3PRDA 2FI5E 4E7NA 4NG9H 1K1LA 1NRSH 4HI3A 3KNXA 1GBFA 3AAUA 1KYNA 1AVXA 4JYVH 4AGKA 1CT0E 1NESE 2GCTB 1VITF 2W6ID 2NU3E 1WOFA 3SQHE 1GBJA 2P59A 3MH5A 1VCQA 4M9FA 3RC5A 3A7YA 5EW2H 1AHTH 1FZZA 1CU1A 1BTXA 1P57B 1O2ZA 4WMDA 1AWHB 2JH0D 3URCA 1J8AA 4TPIZ 1NBMD 2IOTA 2DE8A 4TY6A 1ETSH 1S82A 1TQ7B 2AMQA 1DICA 2FOHA 1SGQE 1O3HA 4BAOB 1Y3YA 1L4DA 1UVUH 1NFYA 1NS3A 3W94A 1J15A 1XUKA 1C1NA 2Q6DA 2XXLA 5C20A 3SU1A 1CA0C 2ZDVH 2A0QB 4YM9A 3PM3A 2EI7A 2STBE 1QFKH 1HRTH 4NWKA 5A0AE 1WDIA 1GBIA 2BLOA 5EGMA 4Q2KA 1OWDA 1TNLA 1V2RT 4H6TA 3OY6U 3LC5A 1Y5UT 1CE5A 4H4FA 4O03A 1W0ZU 1GI1A 1SGIB 5EW1H 3KQDA 3PWCA 4INHA 1A5HA 1AIXH 1O31A 2VBCA 3OU0A 3PO1B 3NUMA 1T32A 3P8GA 4NA9H 1GJAB 2D8WA 3SGAE 2SGPE 2D1JA 2YMSD 3TITA 3SV8A 1ZHRA 3ODDA 1YYY1 3VB4A 2OXSA 3S9AA 1NFXA 3BEFB 1DVAH 1T8MA 4TSFD 2Y5HA 1BQYA 4A1VA 5EG4A 2BXTH 3ZVGA 2KAIB 1V2JT 1TGBA 2ANKH 5ESBA 4TPYA 3MMGA 2R2MB 3TNTA 5I25A 1GBTA 1WXRA 3PLBA 1C1MA 1JOUB 1E1RD 1KLJH 2FWWA 4K69A 3VEQB 1EJNA 1YBWA 2FS9A 3DD2H 2Z9GA 4X8SH 3W95A 1UMAH 3SW2B 4Y0ZE 5I46H 3A81A 2BHGA 4HTCH 3E0NB 3GOVB 3BIVH 1BMAA 2ZQ1A 2CMYA 2PKSC 6CHAC 1F0RA 3N99A 1ACBE 5L2ZH 2ZGBH 4I8JA 1EZSC 2AGGX 4U01A 5C3NA 2KR7A 3SHCH 1ELCA 3TPIZ 6GCHG 2AIQA 1MCTA 2FEQH 4UE7H 5EPYA 1GHWH 3BTTE 3A8DA 5SGAE 3KCGH 5HMAA 1NRPH 2BDYA 2J92A 1RD3B 4BTTB 4GCHG 2PUQH 4UD9H 2AS9A 2OC0A 1HAIH 5E2PA 1H1BA 1O2KA 1GMHG 2ZEBA 2GVFA 1NM6A 1RS0A 4AZ2B 3HATH 5LPRA 1SGDE 1AKSB 1O2XA 2NWNA 1GVKB 1P2QA 2HALA 4ISOA 2AEIH 1C1OA 1Z6EA 3WWFA 1O37A 3DT0H 1ESAA 1UVTH 2ZU5A 3U28C 1C5QA 1P10A 1TABE 3MO6A 1DWEH 2DE9A 2PTNA 1CHOF 4CRBA 1QGFA 4E06H 2VB0A 2VIVA 1K1JA 4X6OA 1L4ZA 2LNCA 3AVZA 1Y5BT 1SQTA 7KMEH 1AKSA 2A32A 4NSYA 4NZQA 3Q76A 2HWLB 1P8VC 1RIWB 3GY4A 2GCHG 1OHHD 1A0JA 4AB8A 5K7RA 3RXAA 4ZHLU 3M3VA 2VVCA 2H5DA 3UAIC 3BTGE 1Y3XA 3SNDA 1O3AA 1B0EA 2OUAA 2ZHEH 1A3EH 2EI8A 1TA2A 2AGIX 1ZOMA 2J5UA 2FIRH 4K3JA 5HGGA 2ZDKA 1IQGA 1UTMA 2UUYA 1ZMJA 3BV9B 1ZLRA 4K8BA 2JH5D 1ANBA 2Z6BD 3SV7A 1MTVA 1ABIH 2FZZA 2UWLA 3QGJA 1TE0A 1HPGA 1PPZA 1LVBA 4DURA 1C2LA 1GHBG 1EAWA 2Z9KA 1PYTD 3KYFA 2ZU4A 1NU7B 2OC1A 1O2HA 1B7XB 3FP8E 1YPGH 3A7VA 1QB6A 2FMJA 2OLGA 4FUHA 3EAJA 3P8NA 1VKYA 2FDAA 1H8ED 1O2YA 1O5EH 1ABJH 1YGCH 3MU4A 1RTKA 2QXHA 1PQ8A 3ZVEA 9LPRA 1HDTH 3O8DA 3S9CA 1BRBE 4CBOA 1Y59T 1A4WH 4I8KA 3SI3H 3TVJB 4NGAH 3L33A 4O9VA 5EJLA 1O2IA 2BB4A 2HLCA 1WV7H 4I33A 1QJ6B 1FY3A 4OS1A 1Z1JA 1S0RA 1P9UA 2Q6FA 3OX7U 3E3TA 7LPRA 3HKJB 2FS8A 1SPJA 3M7TA 4X2XA 3RXRA 3F0PA 1C5ZB 4Z0KA 3STJA 1G3BA 1HJAC 5AFYH 8LPRA 4B6FA 2F83A 2HLDD 2THFB 4BAHB 5CHAB 2OINA 1W11U 1OYTH 2BX4A 1EUFA 4Y8XA 2NU0E 1H4WA 2V7QD 2AFQB 3A7WA 1DFPA 2ZTYA 3BSQA 3TH2H 2EA3A 1BBRK 4RKOB 4NIXA 1Y8TA 1ZMNA 1T31A 3LOXA 1KTTB 1YLNA 2WUBA 3BTHE 3IWMA 1UK4A 1CT2E 1W2KH 4BANB 3NRLA 4IN1A 2B0FA 2ZTXA 4UFFH 4AFZA 1THSH 1U6QA 1QJ7B 3KL6A 1C9PA 2K0QA 3H7TA 1W0KD 5FL7D 3GCTG 2PWXA 1O3MA 1KTSB 2WYJA 2ZHQH 3P8OA 1BT7A 1UCYK 2QA9E 3OEHD 1ZZZA 2A5AA 3E16B 2ZZUH 3QK1A 1RTLA 4Y8YA 1SSXA 4Y11E 1QNJA 2GD4B 1GDUA 5GNDA 3K6ZA 4AFQA 1TX6A 1GMDF 1Z8RA 4ZKRU 1QA7A 5DJ7A 4D76A 2SFAA 4WY3A 3CNRA 4INKA 1SLWB 2ODYB 3SN8A 3LJJA 1PQAA 4MNWA 2F9UA 3OTJE 4FU8A 1O2TA 1YPKH 4ASHA 1D3DB 2HNTF 2O8MA 1Y3WA 2Z3CA 4B73A 2VWLA 2V3MA 1ZTKA 3BTME 1ELDE 1S83A 3U1JB 2IPHA 3EE0B 3TJNA 1TONA 3B9FH 1F5KU 3UQVA 2OC7A 4E7RG 4XBBA 3VB7A 2OP9A 3RXLA 4D7FA 2C3SA 4KP0A 3GCOA 4YT7H 5DP6A 6LPRA 1FJSA 2BOHB 5LH8A 4MNXA 3PO1C 1GHXH 2Y6TA 3RP2A 5HXFA 1JIRA 1K1NA 1AE5A 5H4IB 2JDID 3D49H 1C5VA 1ZPZA 2J38A 1O2NA 1G3EA 4Q63A 3K65B 2BD3A 3M7UA 1SOTA 1W7XH 1BRUP 1AE8H 4AB9A 1PYTC 2CHAB 4GVUA 2FTMA 1BRCE 1BRAA 2QXIA 3PV4A 1VCPA 4IMZA 5TCCA 1BMFD 1AFQC 4GPGA 1WAYB 1C5RA 2WV4A 2ZGXH 1BOQA 2ZDAH 2FX6A 4E05H 1BMMH 3LGIA 5A8ZA 5J4SA 1PPGE 3RXDA 4O97A 2O8TA 3Q3YA 2FI3E 2ZHFH 3KQCA 4B1TA 3ENSB 3N7EA 5HIYA 3NK8A 4F49A 3U8RH 1GCTB 3TIUA 2F3CE 1F0TA 3A89A 2FYQA 3RDZA 1W12U 3FVFB 1T8NA 1YPHE 1MD8A 1V2OT 1CT4E 5FPTA 4AYVB 4R8TB 1LVOA 5A0BA 4YO9A 1C5SA 3SJIA 5CE1A 1TPAE 5K0HA 1GHZA 4RT1A 2FOCA 1OWKA 2Z94A 1TNKA 2FOEA 2XNIA 1XUFA 2YNBA 4ZKSU 4ACBA 2A7CA 1BUIA 4AG2A 1GHAF 2A5KA 2AERH 3BEUA 2C90B 5DP4A 3IITA 3DUXH 1GGDC 5PTPA 2BDGA 2ZP0H 1AY6H 1FN6A 3M37A 1MQ6A 2KM0A 1YCPM 3GY7A 4FU9A 3RLYH 4MLFB 1TBZH 1AB9C 1ELAA 1KLTA 4MNVA 5G4BA 1BDAA 1TBRH 4NSVA 2ULLA 1E34B 1C2EA 1NBME 1FQ3A 2HNTC 1CGJE 1GJ6A 4FUFA 4JZIA 1A5GH 1G3DA 3T5FH 5FPYA 1SI5H 5IK2D 2C8WB 1H9IE 1BTUA 4Y0YE 3SUGA 2AH4X 1KXFA 3NXPA 2R2WU 2FODA 1GJCB 1FV9A 4FUJA 2P3FH 3RXGA 3RXEA 1HJ9A 2QF4A 2A1DB 2VIWA 2ZTZA 3M35A 1TPPA 1O2MA 3JZ2B 1C2IA 2BDCA 2BD2A 2LPRA 1O39A 3A85A 3U69H 5C0TA 1FPHH 1CA8B 1XXDA 3TK5A 3SNEA 2GGVB 1YPEH 2YNAA 3ZZ3A 1TYNA 4I31A 1ANEA 1EP6A 1E0FD 1MTSA 1EOJA 5KEDA 2CF8H 3A8AA 4SGBE 3RXOA 4MQAA 2XNDD 2GT8A 1S84A 1WSSH 1K9OE 1DT2A 4NFEA 3T29A 1OKXA 1SLUB 2A4OA 2R0LA 2WHXA 1GPZA 3RXIA 1N8OB 3RMMH 2OQ5A 3PB1E 3ITIA 1KXCA 1TNJA 2B8OH 2C8XB 3RXBA 3SU3A 2BQWB 3MH4A 1KSNA 2QXJA 2RCEA 1OX1A 2J95A 2JETB 2G4UA 1LMWB 3FAOA 3UY9A 1BITA 1O5CB 1SG8B 3FZZA 1LO6A 2ZGJA 1XKBC 3BTWE 2I6QA 1ZMLA 1V2LT 3P95A 1EASA 1OXGA 2G5NA 1S6FA 1V3XA 2ZU3A 1C5YB 5A0CA 1G2LA 5F03A 2Z3DA 1MAXA 2VWNA 2YMSB 1AU8A 2RA0A 2GZ7A 5KGOA 1C4U2 4RKJB 3FO8D 2RDLA 1GHVH 7ESTE 5L2YH 4ZHMU 1E1QD 2PGBB 3Q3XA 4FUCA 1ZJDA 2RG3A 5JYIA 1GI8B 3A80A 3A86A 4GHTA 1EAXA 1A2CH 2W5EA 1V2KT 1Z8JB 3G01A 4XBDA 3MH7A 4BAQB 2OC8A 4MVNA 3LGTA 3OAAD 1IQHA 2G00A 1OWJA 3MHWU 4THNH 3RUOA 3P17H 1GBBA 5F8ZA 4X6PA 1QBVH 2WPLS 1GG6B 2BY5X 2ZIQH 4CBNA 2TRMA 5E0HA 1O5FH 2ANWA 5FX6A 3T25A 1MD7A 1HUTH 1VITG 5CHAC 3BTQE 4Q7YA 1QB9A 1NFWA 2GMTC 2ZFQH 5JB8S 4X1QU 3VB6A 3ELAH 2B7DH 1FY4A 2ALVA 4VGCB 1EAUA 5GCHG 1DY9A 2XWBI 1SGRE 2ZCKP 4RI0A 3A87A 1O3DA 3DCLA 3M5LA 3UR6A 1GL0E 1K0HA 4Q7XA 5IDKA 5T6GA 4UDWH 1DITH 1FPCH 1ELTA 5ABWA 1L2EA 1G3CA 3PWBA 1LHCH 4RN6A 4BNRA 3RC6A 1LQDB 3SJKA 4WJG2 3C1KA 2Y7XA 4K1SA 2GV6A 4I8LA 4D9QA 3F68H 5JBBS 2FI4E 3D62A 2GDDA 2BTCE 2OBQA 1GI4A 3RMLH 3BTKE 2D2DA 1TAWA 3WWBA 3LGVA 1G37A 4YOGA 3SJ9A 1FLEE 1P06A 4XDEA 4DG4A 1YF4A 2K1QA 4AG1A 2PLXA 4ZAEA 1VCWA 1V2TT 5EU8A 1MBMA 1TPOA 1UK2A 2KCYA 1O2UA 1LHGH 2L6OA 1O3GA 5C94A 1J16A 3R0FA 3F9GA 1P2JA 2P95A 2H9TH 1TGSZ 4R0IA 2ZPRA 5BPEA 5C1YA 2H9HA 1NN6A 2VGCB 3M61U 2YOLA 4OM9A 4J2YB 5EXMA 3VPKA 4MPVA 4HGCA 4BAMB 2FO9A 1HAPH 1CBWB 3SNAA 1MZDA 1C5PA 1Y3UA 1FAKH 2FOGA 4U2WA 1UTQA 1HNEE 2J4IA 4NA8A 5JB9S 4X1NU 1GDNA 2F9VA 1GL1A 2BYAX 1V2MT 3LT3A 4IC5A 5DK1A 3KYGA 4GAWA 1C1PA 2EQNA 1EAIA 1HB0B 1Y3VA 3RXSA 2UUJB 5AVDA 3TLOA 5JDUB 4CHAB 1A0LA 2AYWA 2BD7A 1O35A 1QBOA 1SLVB 2JJ2D 1XX9A 1L1JA 1BMNH 2QY0B 1IQMA 1QURH 3ZVBA 1EFRD 1FY8E 4FVBA 4CREA 3TGJE 1P2KA 2GV7A 1IOEA 4JZFH 1G36A 1O3LA 4MDSA 2ZC9H 2BZAA 1O5BB 3SQEE 4D7GA 2K8IA 3RU4D 3ZVFA 1O5AB 1P12E 2KCPA 3OFND 2FP7B 5DP5A 4B2BA 1YCPH 3PMJA 1DM4B 5F6MA 3KQBA 1P0SH 3I78A 1K22H 4D9RA 1GJ8B 3NKKA 1AQ7A 2M5TA 2EEKA 3BN9A 1MKXH 3PLPA 4F48B 3FANA 1MBQA 4KGAA 4TY7A 1TNGA 1GBKA 1A61H 1C5NH 3MO3A 4X2WA 4F4OC 1TQ0B 4A1XA 2H9EH 2ZPQA 3EQ0H 1NROH 7GCHG 1W8BH 1VGCB 3GS9A 5C67A 4DOQA 1INCA 3F0OA 1BHXB 4JZDH 4YZUA 3DFLA 2ZHWH 3LGUA 1EP5A 3F2FA 2ILNA 5GIBA 1THRH 1XKAC 1KDQA 3LH3A 3VGCC 4JZEH 1MABB 4X1SU 1DUAA 1EZXC 3AW1A 3N7DA 8ESTE 4Y6DA 1IQFA 1E79D 3GY8A 5EXNA 1D6WA 1QR3E 4ZKNU 1P05A 1O2VA 2QF5A 1EPTB 3BG4C 5GXPA 4B71A 1EZQA 1CHOG 3SOSA 3GYMA 3AAVA 5FBEA 1LHEH 2BVXH 1K1PA 2F43B 4GCHF 1GJ9B 1B5GH 2F9OA 3A7ZA 1P11E 2SGEE 1XUIA 1GBCA 4P00A 3OY5U 1SC8U 1C5OH 1Z8GA 1LKAA 1A5IA 1YY3A 1FMGA 3L6PA 1TMBH 3ZV9A 3UQOA 4X0WU 1EPTA 1NT1A 1OP8A 2W7SA 2I6SA 1EQ9A 2WPMS 4ISNA 2KX4A 4DIHH 2ZDMA 3FKSD 3QN7A 2P8OB 3RXTA 1TA6A 3TU7H 3SZNA 3WY8A 3V12A 1AVGH 4AFUA 3RXKA 3ZZ7A 1D9IA 1L1NA 5E8EH 1QBNA 2XTTB 1VITH 3FP7E 1NC6A 3MTYA 3CP7A 2Z9LA 3GISB 4OS6A 2GCHF 1H8HD 2ZNKH 1HJ8A 4CR9A 3A7TA 4XBCA 1S0QA 1D3PB 3M5OA 1DSTA 1ELVA 1N8OC 3STIA 1AUTC 1BTYA 3DA9B 3DFJA 2FLBH 1DDJA 1SHYA 3P92A 3DSOA 3TGIE 3QGNB 1DPOA 1N1LA 4U32A 2QXGA 3EGKH 3NPSA 3RXHA 3VXEH 3PV5A 5B6OA 5HYOA 5JBAS 3TH3H 2ANYA 2Y7ZA 3MOCA 2UWPA 4ZKOU 1UTOA 1MTNC 1P2IA 3EA9A 1PPHE 2UWOA 2VU8E 2ZGHA 2FXRA 4Y7AA 1C2GA 1QRZA 1C2DA 3V3MA 3LJOA 3SZEA 1EKBB 1GHBF 1OSSA 4TWWA 1LHDH 4YTAA 2NU2E 1GBEA 3MQKC 2R0KA 2KCOA 1IQNA 1CSOE 1X7AC 1JXPA 1O2SA 4UFDH 1JRTA 3DHKH 3A84A 3GY6A 5LPFA 3ZZ5A 3TH4H 1SBWA 5GDSH 3RM0H 1C5UA 3F3BA 4DT7B 1ELGA 3LH1A 2LP6A 5DP7A 1HAVA 2XOKD 1LDTT 1QRXA 1YP9A 4D8NA 4O3UA 2BY6X 1GMCF 2VWOA 3LONA 2BDHA 2PW8H 1FIWA 3UWIA 1O5GH 2J9NA 5EPNA 3NCLA 4UFGH 2B5TB 3TJVA 1C1SA 1RTFB 1GBDA 1NY22 4ABGA 3FOAA 1O2QA 3K6YA 3CS7A 2Z9IA 1T8LA 5DG6A 1SKYE 4M7GA 2GCTC 4VGCC 2WPHS 1QCPA 4NIYA 5EXLA 1W0YH 1WQVH 4IW4E 2PGQB 5JPMH 2VINA 2PTCE 4FETA 4IC6A 1P04A 2VVVA 2XW9A 1TRNA 2XCFA 1KXDA 3PMBB 5C5OA 1BHXF 4B2AA 1BA8B 5FX5A 1O2PA 1W10U 3SYJA 2UUFB 2FOFA 2KCAA 4K60A 2Z3EA 3SBKA 3EA8A 4NZLA 3ATKA 2CV3A 5ETXA 1VR1H 2IJD1 2F9NA 1VJ9U 1FNIA 2VNTA 1HAHH 2BVRH 4DGJA 2Y80A 4Y8ZA 2XBXA 1QB1A 4Z1MD 1JMOH 2G52A 3A88A 2KZ4A 4AOQA 4LK4A 1TNHA 1LVMA 1RFNA 4P02A 1DUEA 4ABJA 1JIMA 2G4TA 1KMHB 1CA0B 2QGRA 2QE7D 3CENA 1K1IA 1ZSJA 2CN0H 4DY7B 4H6SB 4K8YA 5C17A 1O0DH 5GWZA 4NFFA 1XXFA 2BLWA 3MFJA 1O33A 1W0JD 3S69A 4GSOA 3SHAH 1OS8A 1C2FA 1SOZA 2AGEX 1GVLA 4I7YH 1AWFH 1EJMA 3MU1A 2F9BH 4NWLA 1HAYB 3KQEA 1HGTH 4CHAC 2ZFFH 3H09A 1S85A 2FX4A 4Y76A 3PTNA 5IYTA 1G32B 4BXSA 1CGIE 3NWUA 1UTJA 1AN1E 5AHGH 1ZTJA 3PROA 1KXBA 1UTNA 2WUCA 3LDXH 1CVWH 3LGWA 3L3TA 2BQ7B 1SGCA 2A31A 2CXVA 1F7ZA 4NIWA 1V2VT 3E90B 3VFEA 2J94A 1JRSA 2PV9B 5A2MH 3HK6B 1DXWA 1MTUA 2OCVB 3SU6A 2FTLE 2P94A 3T2NA 3FP6E 3VG8A 1E36B 3KN2A 3QX5H 1D3QB 1H9LB 2Y5GA 3AASA 4XSKU 1SGNE 4IGDA 4ABAA 4ABIA 2GT7A 4GLYA 1WU1A 3SGQE 3VXFH 4AX9H 3LIWA 3MNSA 2ANMH 2VIDA 4X1PU 1P09A 1SQAA 3IG6B 1SB1H 1TRMA 1N6YA 2PKSB 2QF0A 4DCDA 6CHAB 2RFKC 1TOMH 1P2NA 1C4Y2 1Q2WA 3S7HB 2BY8X 1H8IH 3A8BA 2BD4A 5C0UA 1N6XA 2P93A 2WV9A 1GWAA 1HXEH 1FDPA 3M7QA 1IQJA 8GCHF 2ZQ2A 1C1VH 2RA3A 3JZ1B 2WPDD 1E37B 1ZYOA 3KQ5A 3MYWA 2TGAA 5HM2A 4BOHA 3PLKA 2A2QH 3RMNH 2HOBA 1SLXB 4J1YA 1O36A 4NCYA 1SGYE 3ZVAA 1O3KA 1GDQA 1SGTA 3LPRA 3SNCA 1BTHH 1J14A 1PPFE 2Z7FE 1SMFE 4FVDA 1L0ZA 5DKMA 2V3HH 1O3EA 1GI7B 1GBHA 1A7SA 1TPSA 4KKDA 1BZXE 1RIWC 6ESTA 2AMPA 2R9PA 5EOKA 1EX3A 1P02A 2O8LA 3HGPA 1P2MA 2HPPH 1JBUH 2P8OC 4CH2B 2VH0A 2BY9X 3W1EA 2Y82A 2FYRA 2PFEA 1ORFA 2BLQA 3EYDA 2HGTH 4X8VH 1V2ST 1P01A 5A09A 2H2ZA 4LOYH 2TIOA 3MNBA 2G51A 2H1UA 4K2YA 4CRFA 1AI8H 5FBIA 4O3TA 1HV7A 1LTOA 4MNYA 4WMFA 1LPZB 2VVUA 1SFQB 3MNXA 1CQQA 3TJOA 3RU4T 4JYUH 4NIVA 1MH0A 3SORA 5L30H 1P3EA 3HK3B 3ZV8A 2GTBA 3QTVH 4DW2U 1MKWH 1XM1A 1WYKA 1ZRKA 4WVPE 3F6UH 4ZH8A 3U8OH 5CDFE 3UREA 2PKAA 2GKVE 2BDIA 3LKWA 3E0PB 2WYGA 3M5NA 3SU0A 3A7XA 1S5SA 3TJUA 2G55A 1P03A 5DO4H 1UW7A 3F1SB 1C5MD 1OP2A 4OGXA 5T6DA 3ZZ9A 3FZDA 1T4VH 3RU4E 4B76A 2ALPA 2ZKSA 1TLDA 3T27A 4ISHH 1TB6H 1NTPA 1HAGE 1NRRH 2Q1JA 3QLPH 2GP9B 1DWDH 3SNBA 3K2UA 1PPBH 3ZZ8A 3S7KB 1G9IE 3VB3A 2V3OH 1O3FA 4ISLA 9ESTA 2VIPA 3Q3KA 1ZR0A 3S0NA 1D4PB 2J97A 4LZ4B 1QL8A 1YKTA 2XYAA 3ODFA 2GJGA 2QAAA 3ZZ6A 3U1IB 3EE7A 2A4GA 1A1RA 2R3UA 4CRGA 3BTDE 3UPEA 4YOIA 2BDBA 1QQ4A 5CHBA 1EJAA 4AORA 1V2PT 1WTHD 1KLIH 5F53A 1FIZA 1QZ8A 4UONA 1W7GH 1FUJA 5LPEA 1E35B 2G8TA 3MNCA 1OOKB 3N7OA 1FXYA 5TCAA 1DWBH 2QN5T 5C2ZA 2FLRH 3DSPA 1ELFA 5HKKD 1XUHA 1O3CA 1O2RA 1PJPA 1O3BA 2OK5A 1C2MA 1C5LH 1EOLA 2BD5A 1UK3A 1K28D 5GJ4B 3ZZBA 2CK3D 2XBVA 1QTFA 4WWYA 1AO5A 1JWTA 1CO7E 1DSUA 2ZF0H 2VIQA 4YXWD 1QIXB 2L74A 1HLTH 1Z1IA 2A7HA 2O8UA 2ODPA 4B2CA 5GCHF 3P8FA 4IS5A 1AMHA 3PMHB 3M3TA 1DY8A 1VZQH 1BJUA 4XRNA 3EA7A 5TJXA 3GY2A 1GJ5H 1THPB 2O9QA 3F9EA 5A8XA 5KECA 2ZDLA 1NO9H 5FCKA 3SJ8A 4ZUHA 4FU7A 1ZSLA 4IMQA 4WXVA 4ZXXH 4ZROA 4ABFA 1C1TA 5EQRA 3SU5A 4BTUB 4ASUD 1GI2A 2TGPZ 3UWJH 1FY1A 1HBTH 3GDUA 3QO6A 2OD3B 1F5RA 1QL7A 4OS2A 1GI9B 1TIOA 1SQRA 2R3YA 3RMOH 3O8RA 4Y79A 3RXPA 1G30B 5DP8A 1TOCB 4XOJA 3LU9B 2VH6A 3PYHA 4NA7A 2IPQX 5B6LA 1W14U 1TX8A 4GHQA 1H9HE 4TWYA 3A83A 1BIOA 3M5MA 2C8YB 1ZHMA 3GY5A 4Y71A 2NU1E 2CHAC 1O38A 5FAHA 1UTPA 3GYLB 2SGQE 3ZZAA 3QZQA 3PMAB 2BLVA 1PQ5A 3D23A 3V13A 2SGDE 3AW0A 4DJZB 3ATIA 4ABBA 2AIPA 1SVPA 1K2I1 5EODA 4UEHH 2ZG0H 3HGNA 2VJ1A 1XMNB 3UUZA 1C1RA 1EXFA 4AC9A 5EQQA 1LQEA 3SV6A 4K5ZA 2P16A 1D3TB 1SGFA 1AFQB 3E6PH 5BRRE 3ZZCA 1OPHB 1KDQB 1GCTC 2ZA5A 4ABHA 1WTGH 1P3CA 1NRNH 2G5VA 3GDSA 3OYPA 3U8TH 5FPSA 3ZVCA 4A1TA 1ZRBA 5EQSA 5EIYA 2KAIA 2TBSA 3DSGA 4LZ1H 3MO9A 1EB2A 5J4QA 3PV2A 1TWXB 1GI3A 1MMJN 4BXWA 2PSYA 4KTUA 1TALA 3RXFA 3SU4A 2SNWA 4FUEA 3I29A 5FXLA 3H7OA 3KF2A 3T62A 4Q80A 2BXUH 1O2GH 1YPHC 1V2UT 4CRAA 6GCHF 1UVPA 2A4RA 2HNTE 1YCPK 1ETRH 1ARCA
chains in the Genus database with same CATH topology
1AZZA 1GGDB 1O2LA 2BY7X 3A82A 7GCHF 1LKBA 1V2WT 3MI4A 1F92A 1MKXK 1GCDA 2ZFSA 1AB9B 1V2NT 2W7UA 4UFEH 3KIDU 1SQOA 1P9SA 1H8DH 3QUMP 2DUCA 4XFQA 1A3BH 2Y81A 1RRKA 2EC9H 3A8CA 1GMHF 1DANH 2EI6A 1HIAB 3Q00A 2BMGB 4WMEA 4A6LA 1IQKA 1O3OA 1ZGIA 2BD8A 3Q77A 4K1EA 3F9FA 1UTLM 5DP9A 2HRVA 1XUGA 1DLKB 1ESTA 5ESTE 2B9LA 4SGAE 1BTPA 3O8BA 1UVSH 1YM0A 4ABDA 5CMXH 4X6MA 1YPJH 1YLDA 4PROA 2GDEH 3PTBA 3B8JA 5AF9H 1NZQH 1HIAA 3QDZB 3URDA 1TX7A 1VJAU 1RJXB 1C1UH 4OS5A 1CGHA 2IN2A 2QIQA 5T3HA 2FPZA 4FUBA 1DXPA 1ELEE 1TNIA 1GBMA 1HFDA 4IN2A 1D6RA 1ZPBA 3MH6A 1MU8B 5C1XA 4CRCA 1MTWA 2P3UB 1LPKB 2V35A 5E2OA 2PUXB 2QYIA 2JETC 1AZ8A 1WUNH 2STAE 2ZCHP 2W3KA 4MG3A 3T28A 3U98H 5FCRA 1SGFG 1HYLA 2BZ6H 1OP0A 4A7IB 2QC2A 4YOJA 1T8OA 4B75A 3RXUA 1FN8A 2VWMA 1IHTH 3GCHB 2A7JA 1EB1H 1ZHPA 4H42U 1C5WB 2XC5A 1UJ1A 2XBWA 3SU2A 1HAVB 1DE7H 1WQSA 1J17T 2WV5A 1SGPE 1O5DH 4Z6AH 3M36A 4Y7BA 1GJDB 2XC4A 3B23B 1GJ7B 4WH6A 1O3IA 1BBRH 3ATWA 3QZRA 4CR5A 3MU8A 2TGDA 1EATA 1SFIA 4GUXA 3GDVA 3RM2H 2QV1A 4HFPB 3CS0A 3UIRA 1C1WH 1GMCG 3LGYA 2WPIS 4JMYA 3ZVDA 1V6DA 1O2OA 2ZFTA 1PPCE 1ZGVA 1GG6C 3U9AH 1UCYH 2BX3A 3BIUH 1EZUC 3UOUA 1MCVA 5DGJA 1IHSH 3RC4A 2BM2A 1TFXA 2F9PA 2OBOA 1O3JA 1QA0A 4FXGH 3KEEA 1QQUA 2TGTA 1FAXA 1GJBB 2SGAA 2J2UA 3TK6A 3UR9A 1KXAA 2FOMB 4U30A 2ESTE 2W26A 1GI5A 4A5TS 4DVAU 4JYTA 2GMTB 1C4V2 4ZXYH 4CRDA 1KXEA 3SUDA 5JBTA 1IQIA 1CHGA 1NRQH 1FY5A 1GMDG 2J34A 3E8LA 2ZDNA 1YPLH 1J9CH 3ZZ4A 2H6MA 5JBCS 2GZ8A 5E0JA 1G2MA 3H5CB 2C8ZB 2V0BA 4FUDA 3F9HA 5HM9A 1DX5M 1C9TA 1K1OA 1M9UA 4JCNA 1UVOA 1ETTH 1Z7KA 1BJVA 1T7CA 2C93B 3KHVA 4ZMAH 3V0XA 1ELBA 4KTCA 1ARBA 3K9XB 4ABEA 3GCTF 3GY3A 2GZ9A 2ZHDA 1NPMA 2A2XH 8KME2 3BTEE 1FI8A 1P2OA 5DPAA 1F2SE 2CF9H 1PFXC 3TK9A 5GPIB 1AFEH 1HAXB 2VGCC 3R3GB 1Y5AT 1GBAA 2HVXA 2WINI 2C4FH 4YLQH 1TGCA 1AUJA 2FESH 1KIGH 4IBLH 4X2YA 1CBWC 3OSYA 4WF8A 1AGJA 1F0SA 3ZYDA 1LVYA 2SNVA 3EDXB 2WPJS 4JK6A 1GJ4H 1AVWA 2ZFRH 2F91A 3RXVA 1DOJA 3RXCA 1UHBB 1YLCA 4A92A 1B0FA 1BCUH 1RGQA 1ESBA 1XVMA 4I32A 3UOPA 1NU9A 3KGPA 2A5IA 1TBQH 1QRWA 1F0UA 3SO3A 4ESTE 1W3CA 2CJIA 1ZSKA 3T26A 3RXJA 1UHBA 1OWIA 1MU6B 5C1UA 1TMTH 4OS7A 2XBYA 4CH8B 4I8GA 2BOKA 1SGEE 3C27B 3RLWH 1OWHA 4Y10E 5DP3A 2WPKS 1BTWA 1GBLA 1AD8H 1TMUH 2JH6D 3MU0A 4MPUA 4ZHAA 1LCYA 4AFSA 3M3SA 2XRCA 1BMLA 3BF6H 3MWIU 1W13U 1TGNA 2ZECA 3SV2H 1GHAG 1L1GA 4WH8A 4Q7ZA 1T4UH 3RXMA 8GCHG 1SR5C 1VGCC 1O32A 3QWCH 3HKIB 4AGJA 3D65E 4MPWA 2ZU2A 3BG8A 2A45B 3TNSA 2V6NA 2QF3A 1E38B 2O8WA 5F8TA 3O8CA 3SGBE 1V2QT 4INLA 4FUIA 4YESB 3ATMA 4KTSA 2XWAA 1Z8IB 4HZHA 1BTZA 1F5LA 2XC0A 3ESTA 4MPXA 1ANDA 1SL3A 3V7TA 3UTUH 1O30A 2FOAA 4DIIH 1EPTC 1OYQA 1LHFH 1O3NA 3VGCB 3UNRA 3GCNA 2ZGCA 1C5TA 2ZU1A 5A8YA 1FONA 4KELA 3UNSA 1Z6JH 1O34A 1A0HB 2ASUB 1MZAA 3BG4B 1QL9A 1MAYA 2PSXA 1PPEE 1BBRE 4YT6H 4WXIA 1C2HA 1UO6A 1O3PB 1O2JA 4OS4A 1OWEA 1O2WA 4YLUA 5C5NA 1C2JA 2D26C 2JKHA 2SGFE 2OTVA 2UUKB 4LXBH 1TRYA 1YC0A 2ODQA 2AMDA 2BQ6B 2BDAA 4FUGA 4X8UH 2CGAA 1Q31A 1UCYE 4X2VA 1NFUA 2PR3A 1HXFH 5F8XA 2OQUA 3FFGA 4B74A 2Q6GA 3SJOA 3SV9A 1IQLA 3NZIA 1S81A 1WCZA 2PKAB 2Z9JA 1DLEA 3LC3A 1GI0A 1Z71A 3QTOH 1ZTLA 5LGOA 1YPMH 2ZPSA 4I8HA 2ZI2H 4X8TH 3BEIB 4OGYA 4JK5A 1MUEB 1TGTA 1SHHB 3S9BA 5E0GA 1XVOA 1C5XB 3UNQA 1K1MA 1IQEA 1WBGB 3TGKE 2ZWLH 4X6NA 1ID5H 1KY9A 1DWCH 2FOBA 2ZFPH 3SI4H 3RXQA 1DS2E 1HCGA 4AYYB 1LPGB 1QY6A 3GCHC 3GICB 2VIOA 4ISIH 1BB0B 2BD9A 1QHRB 2H5CA 1ZPCA 1ANCA 1GI6A 1K21H 5T6FA 1MTNB 1HAOH 1XUJA 1GHYH 2IJOB 1S6HA 3MU5A 4XE4A 2XCNA 2ZCLP 1PQ7A 2ZO3H 5FHTA 4TYDA 3P6ZB 2FM2A 1HAZB 2GX4A 5L6NH 3I77A 2W3IA 3VB5A 1Q3XA 5AFZH 3HPTB 3P70B 1RXPA 1MKWK 1A46H 1C1QA 4BTIB 4JZ1A 3UFAA 3E1XB 2Y5FA 4QT8C 2BVSH 2NU4E 1UTKA 3ZZDA 4BAKB 2A4QA 2QCYA 4X1RU 3ATLA 4MTBA 2TPIZ 1C2KA 3SUFA 4K1TA 1HJAB 3E91A 2P3TB 2HPQH 4AN7A 1GVZA 1IAUA 4RSPA 2G81E 2PHBA 1ZJKA 3BTFE 1MQ5A 1QJ1B 3SUEA 3ZYEA 4E7NA 2FI5E 4NG9H 1K1LA 1NRSH 4HI3A 3KNXA 1GBFA 3AAUA 1KYNA 1AVXA 4JYVH 4AGKA 1CT0E 1NESE 2GCTB 1VITF 2NU3E 1WOFA 3SQHE 1GBJA 2P59A 3MH5A 1VCQA 3RC5A 3A7YA 5EW2H 1AHTH 1FZZA 1CU1A 1BTXA 1P57B 1O2ZA 4WMDA 1AWHB 2JH0D 3URCA 1J8AA 4TPIZ 2IOTA 2DE8A 4TY6A 1ETSH 1S82A 1TQ7B 2AMQA 1DICA 2FOHA 1SGQE 1O3HA 4BAOB 1Y3YA 1L4DA 1UVUH 1NFYA 1NS3A 3W94A 1J15A 1XUKA 1C1NA 2Q6DA 2XXLA 5C20A 3SU1A 1CA0C 2ZDVH 2A0QB 4YM9A 3PM3A 2EI7A 2STBE 1QFKH 1HRTH 4NWKA 5A0AE 1GBIA 2BLOA 5EGMA 4Q2KA 1OWDA 1TNLA 1V2RT 4H6TA 3OY6U 3LC5A 1Y5UT 1CE5A 4H4FA 4O03A 1W0ZU 1GI1A 1SGIB 5EW1H 3KQDA 3PWCA 4INHA 1A5HA 1AIXH 1O31A 3OU0A 3PO1B 3NUMA 1T32A 3P8GA 4NA9H 1GJAB 2D8WA 3SGAE 2SGPE 2D1JA 3TITA 3SV8A 1ZHRA 3ODDA 1YYY1 3VB4A 2OXSA 3S9AA 1NFXA 3BEFB 1DVAH 1T8MA 2Y5HA 1BQYA 4A1VA 5EG4A 2BXTH 3ZVGA 2KAIB 1V2JT 1TGBA 2ANKH 5ESBA 4TPYA 3MMGA 2R2MB 3TNTA 5I25A 1GBTA 3PLBA 1C1MA 1JOUB 1KLJH 2FWWA 4K69A 3VEQB 1EJNA 1YBWA 2FS9A 3DD2H 2Z9GA 4X8SH 3W95A 1UMAH 3SW2B 4Y0ZE 5I46H 3A81A 2BHGA 4HTCH 3E0NB 3GOVB 3BIVH 1BMAA 2ZQ1A 2CMYA 2PKSC 6CHAC 1F0RA 1ACBE 5L2ZH 2ZGBH 4I8JA 1EZSC 2AGGX 4U01A 5C3NA 3SHCH 1ELCA 3TPIZ 6GCHG 2AIQA 1MCTA 2FEQH 4UE7H 5EPYA 1GHWH 3BTTE 3A8DA 5SGAE 3KCGH 5HMAA 1NRPH 2BDYA 2J92A 1RD3B 4BTTB 4GCHG 2PUQH 4UD9H 2AS9A 2OC0A 1HAIH 5E2PA 1H1BA 1O2KA 1GMHG 2ZEBA 2GVFA 1NM6A 1RS0A 4AZ2B 3HATH 5LPRA 1SGDE 1AKSB 1O2XA 2NWNA 1GVKB 1P2QA 2HALA 4ISOA 2AEIH 1C1OA 1Z6EA 1O37A 3DT0H 1ESAA 1UVTH 2ZU5A 1C5QA 1P10A 1TABE 3MO6A 1DWEH 2DE9A 2PTNA 1CHOF 4CRBA 1QGFA 4E06H 2VB0A 2VIVA 1K1JA 4X6OA 1L4ZA 2LNCA 3AVZA 1Y5BT 1SQTA 7KMEH 1AKSA 2A32A 4NSYA 4NZQA 3Q76A 2HWLB 1P8VC 1RIWB 3GY4A 2GCHG 1A0JA 4AB8A 5K7RA 3RXAA 4ZHLU 3M3VA 2VVCA 2H5DA 3BTGE 1Y3XA 3SNDA 1O3AA 1B0EA 2OUAA 2ZHEH 1A3EH 2EI8A 1TA2A 2AGIX 1ZOMA 2FIRH 4K3JA 5HGGA 2ZDKA 1IQGA 1UTMA 2UUYA 1ZMJA 3BV9B 1ZLRA 4K8BA 2JH5D 1ANBA 2Z6BD 3SV7A 1MTVA 1ABIH 2FZZA 2UWLA 3QGJA 1TE0A 1HPGA 1PPZA 1LVBA 4DURA 1C2LA 1GHBG 1EAWA 2Z9KA 1PYTD 2ZU4A 1NU7B 2OC1A 1O2HA 1B7XB 3FP8E 1YPGH 3A7VA 1QB6A 2FMJA 2OLGA 4FUHA 3EAJA 3P8NA 2FDAA 1O2YA 1O5EH 1ABJH 1YGCH 3MU4A 1RTKA 2QXHA 1PQ8A 3ZVEA 9LPRA 1HDTH 3O8DA 3S9CA 1BRBE 4CBOA 1Y59T 1A4WH 4I8KA 3SI3H 3TVJB 4NGAH 3L33A 4O9VA 1O2IA 2BB4A 2HLCA 1WV7H 4I33A 1QJ6B 1FY3A 4OS1A 1Z1JA 1S0RA 1P9UA 2Q6FA 3OX7U 3E3TA 7LPRA 3HKJB 2FS8A 1SPJA 3M7TA 4X2XA 3RXRA 1C5ZB 4Z0KA 3STJA 1G3BA 1HJAC 5AFYH 8LPRA 2F83A 2THFB 4BAHB 5CHAB 2OINA 1W11U 1OYTH 2BX4A 1EUFA 4Y8XA 2NU0E 1H4WA 3A7WA 2AFQB 1DFPA 2ZTYA 3BSQA 3TH2H 2EA3A 1BBRK 4RKOB 4NIXA 1Y8TA 1ZMNA 1T31A 3LOXA 1KTTB 2WUBA 3BTHE 3IWMA 1UK4A 1CT2E 1W2KH 4BANB 4IN1A 2B0FA 2ZTXA 4UFFH 4AFZA 1THSH 1U6QA 1QJ7B 3KL6A 1C9PA 3H7TA 3GCTG 2PWXA 1O3MA 1KTSB 2WYJA 2ZHQH 3P8OA 1BT7A 1UCYK 2QA9E 1ZZZA 2A5AA 3E16B 2ZZUH 3QK1A 1RTLA 4Y8YA 1SSXA 4Y11E 1QNJA 2GD4B 1GDUA 3K6ZA 4AFQA 1TX6A 1GMDF 1Z8RA 4ZKRU 1QA7A 5DJ7A 4D76A 2SFAA 4WY3A 4INKA 1SLWB 2ODYB 3SN8A 3LJJA 1PQAA 4MNWA 2F9UA 3OTJE 4FU8A 1O2TA 1YPKH 4ASHA 1D3DB 2HNTF 2O8MA 1Y3WA 2Z3CA 4B73A 2VWLA 1ZTKA 3BTME 1ELDE 1S83A 3U1JB 2IPHA 3EE0B 3TJNA 1TONA 3B9FH 1F5KU 3UQVA 2OC7A 4E7RG 4XBBA 3VB7A 2OP9A 3RXLA 4D7FA 2C3SA 4KP0A 3GCOA 4YT7H 5DP6A 6LPRA 1FJSA 2BOHB 5LH8A 4MNXA 3PO1C 1GHXH 2Y6TA 3RP2A 5HXFA 1JIRA 1K1NA 1AE5A 5H4IB 3D49H 1C5VA 1ZPZA 2J38A 1O2NA 1G3EA 3K65B 2BD3A 3M7UA 1SOTA 1W7XH 1BRUP 1AE8H 4AB9A 1PYTC 2CHAB 4GVUA 2FTMA 1BRCE 1BRAA 2QXIA 3PV4A 1VCPA 4IMZA 5TCCA 1AFQC 4GPGA 1WAYB 1C5RA 2WV4A 2ZGXH 1BOQA 2ZDAH 2FX6A 4E05H 1BMMH 3LGIA 5A8ZA 5J4SA 1PPGE 3RXDA 4O97A 2O8TA 3Q3YA 2FI3E 2ZHFH 3KQCA 4B1TA 3ENSB 3NK8A 4F49A 3U8RH 1GCTB 3TIUA 2F3CE 1F0TA 3A89A 2FYQA 3RDZA 1W12U 3FVFB 1T8NA 1YPHE 1MD8A 1V2OT 1CT4E 5FPTA 4AYVB 4R8TB 1LVOA 5A0BA 4YO9A 1C5SA 3SJIA 5CE1A 1TPAE 5K0HA 1GHZA 2FOCA 1OWKA 2Z94A 1TNKA 2FOEA 2XNIA 1XUFA 2YNBA 4ZKSU 2A7CA 1BUIA 4AG2A 1GHAF 2A5KA 2AERH 3BEUA 2C90B 5DP4A 3IITA 3DUXH 1GGDC 5PTPA 2BDGA 2ZP0H 1AY6H 1FN6A 3M37A 1MQ6A 1YCPM 3GY7A 4FU9A 3RLYH 4MLFB 1TBZH 1AB9C 1ELAA 1KLTA 4MNVA 5G4BA 1BDAA 1TBRH 4NSVA 2ULLA 1E34B 1C2EA 1FQ3A 2HNTC 1CGJE 1GJ6A 4FUFA 4JZIA 1A5GH 1G3DA