5PTPA

Structure of hydrolase (serine proteinase)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvent structure in crystals of trypsin determined by X-ray and neutron diffraction.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords BETA TRYPSIN
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ptpA02
2XWBI 3BTDE 1GBIA 3KHVA 4X6PA 1A3EH 1BT7A 2A2XH 2PSXA 2FLBH 4GHQA 3VB5A 2Q1JA 4ISLA 1RIWB 5F8XA 3ZZCA 3E8LA 1SGFA 1ZGVA 1QR3E 2F83A 1OWHA 2ZDAH 1WCZA 4BNRA 1EJMA 1YP9A 1GHWH 1O5EH 3GY2A 1TNIA 1FY1A 2W3IA 1XUFA 1AU8A 2AS9A 2ZPQA 2VNTA 3MO3A 2AGGX 4NSYA 2HPPH 1D3DB 4ABFA 1GG6B 3ZZ9A 3SUGA 1C5YB 1V2NT 3GY8A 3HATH 4K1TA 2OBOA 5DP4A 1CGJE 1Z8JB 1EASA 9ESTA 3TJVA 1FY8E 2ZU2A 2GVFA 5C67A 1PYTC 5ESBA 1UTJA 2VWMA 5E0GA 3MO9A 4RSPA 1JRTA 3BN9A 1BMNH 2KAIA 2QIQA 2P16A 1KYNA 2Y7ZA 2F9VA 5FAHA 1NC6A 1ZLRA 5JBCS 3RXJA 1DUEA 5GPIB 1T8OA 2P8OB 5FCRA 1GBDA 1A0HB 2FXRA 3SORA 4K8YA 3I29A 2EI6A 3A86A 1GMHG 2HGTH 1D3QB 1MTVA 3GY3A 3SUFA 1IQKA 2DE9A 5E0HA 4XBCA 5E2OA 7GCHF 2BLVA 1JIRA 1TX6A 2AERH 4H4FA 4X0WU 2R9PA 3DFLA 3FANA 2G4TA 1P01A 2GCTB 1UVOA 7ESTE 4XSKU 3EAJA 1TABE 1K9OE 1QJ6B 4AOQA 2QXHA 1IHSH 3RUOA 1QURH 2NU2E 3A87A 1F0SA 4JMYA 2BLWA 3A7TA 3SU3A 2AMPA 2W7SA 3MH7A 3U8OH 4ZUHA 4WXIA 1O31A 1IQNA 1E38B 1BBRE 2PWXA 4LXBH 2ZDNA 4NFFA 2P59A 3RM2H 3RXUA 2WINI 1GI1A 1TNJA 2VVCA 4I33A 5IDKA 3KL6A 1P03A 1FN8A 1XKAC 1SSXA 1EZXC 5HYOA 2A7CA 4IMZA 4UFDH 1TGNA 5DGJA 4YT6H 1OWKA 2DE8A 1O3LA 1V2LT 1SPJA 2STBE 4CRBA 2AGEX 1EAXA 1C4Y2 3SV9A 1ARCA 2TPIZ 1PPZA 4BXWA 1QB1A 3NPSA 5LPFA 1UK2A 3NZIA 2GMTB 4INKA 1W13U 2VIPA 2BY5X 3S7KB 2YOLA 1AFEH 1Z8RA 1CE5A 2GTBA 3URDA 1C2JA 3PO1B 3QZQA 3RXRA 1UVPA 4KTUA 1GI0A 1O32A 1OP2A 4LOYH 1J17T 1ELVA 3MOCA 3GCOA 2FO9A 1GMCG 1BITA 1CBWB 3PMBB 2B5TB 2FI3E 2PGQB 2FOMB 3C27B 3MNSA 1Y5UT 2ZFTA 3RP2A 5EODA 3I78A 5GJ4B 2GCTC 1BCUH 3EA9A 4GPGA 2BXTH 3RXKA 2UUYA 1GHZA 1M9UA 1ABIH 3EYDA 2FOBA 2OTVA 3FP7E 2H9HA 2G00A 4LZ1H 2C8YB 5TJXA 5FPSA 4BANB 4TPIZ 8GCHG 1SQTA 1TGCA 4GCHG 4H6TA 5EU8A 1GJDB 3OU0A 3SJ8A 1EX3A 3UQOA 3D65E 3C1KA 4D76A 2PKSC 1TFXA 3GY6A 2J92A 2P8OC 3FP6E 1SMFE 2J38A 3TH2H 5DP5A 3TGIE 1HAPH 2CHAC 4AG1A 5DO4H 1AO5A 3A8BA 2PTNA 2A5IA 1Y5BT 2WPKS 1A2CH 2A45B 3F9EA 3R3GB 1N6XA 4H42U 1P10A 3ZZ7A 4FVDA 2QXJA 2ZGXH 3BSQA 3E3TA 1P8VC 2ODQA 1SGDE 4GVUA 2VIOA 4QT8C 1G36A 2Z3DA 1AB9C 2W3KA 1O2NA 2VB0A 2ZDLA 3MH5A 1WSSH 4I8KA 1UO6A 3URCA 1GCTB 2HPQH 4OS5A 5GXPA 1EOJA 1TE0A 2TGPZ 1P02A 3PROA 4K1SA 3LPRA 3V12A 1QJ7B 4M7GA 1Y3XA 3PMAB 1UTLM 1ZPBA 4I8GA 2I6SA 2GZ7A 3LH3A 1G3EA 1NU9A 5B6OA 4THNH 3TJNA 1KXDA 3RLWH 1DICA 5EG4A 4ABGA 1Y3YA 2JETC 2ZWLH 4OGYA 4D7FA 1PPHE 1PPFE 3A8AA 3SN8A 3ZZ5A 4A92A 2Q6FA 1GJ5H 1DANH 3EE0B 3A85A 1P2IA 3UR9A 4INLA 2P3TB 1EAUA 2CHAB 1SGIB 1C5NH 2ZQ1A 1ZSKA 1CHOF 3GCTG 3KIDU 3SHCH 1BTUA 4FUEA 3ZVBA 2Z9GA 1BRCE 1JBUH 1J9CH 1L1NA 4F4OC 3DHKH 1W11U 2FDAA 2TGTA 1Z6JH 3SNAA 4A6LA 1DLKB 1NZQH 2SGQE 1ZSJA 3MTYA 4MTBA 4O03A 2J95A 3RMLH 3GY4A 2BVRH 4YOIA 2PW8H 4ZKOU 7LPRA 1HAXB 2QGRA 3E16B 4AFQA 2TGDA 1ZHMA 1P04A 2Y5GA 2D8WA 3HGNA 1ZR0A 3GDSA 4MPXA 4NWLA 2BLQA 8KME2 5DP3A 2V35A 4TYDA 1YLCA 2C3SA 1FY5A 2ZHWH 1LPZB 4BTUB 1K21H 2QY0B 1SFIA 3LJJA 3SUEA 1L4DA 1MAXA 1JOUB 1O33A 3SBKA 3KNXA 4KTCA 4IN2A 4NGAH 1DS2E 1UTPA 2EA3A 3SZNA 1S85A 1J14A 4IW4E 1VCQA 3H7OA 3A83A 1H8IH 1EOLA 3MWIU 1MTSA 1QRXA 3P8FA 1O3PB 1SGNE 4TY6A 3F9FA 2FIRH 2ZC9H 4X8SH 3SUDA 4TY7A 3MH4A 2ZEBA 3QX5H 3QDZB 1O2WA 4DURA 1Y59T 4DCDA 3LGWA 1HJ9A 2FOEA 1WBGB 4FUCA 1O2HA 1P9SA 1SBWA 2GKVE 3M37A 1ETSH 1QY6A 4AFZA 2HVXA 2J4IA 1VITH 4ZHAA 1C9TA 2QF3A 5C3NA 4CBNA 1UK3A 1A46H 1W7XH 1ELEE 1MKWK 3FZZA 4A5TS 1O3FA 1RFNA 1HB0B 2ZIQH 4DY7B 3ODDA 1OYTH 2PKAA 1F2SE 2HALA 2XC5A 3D62A 5FPYA 3DFJA 3QWCH 4E06H 5TCAA 1CU1A 2AH4X 1L2EA 3BEIB 1EJNA 4MPVA 1DWCH 4UDWH 1SQOA 1V2KT 3V3MA 3M3VA 1ZYOA 1TQ7B 5EXNA 3KF2A 1KDQB 1C5PA 3RC5A 1SLUB 4I32A 4XDEA 1AMHA 1SC8U 4CR9A 2AMQA 5FX5A 1C2LA 1NFYA 2WUBA 3K6YA 4Y0ZE 1SVPA 1C5VA 3BTME 3TGKE 5G4BA 4FU7A 3T5FH 1GBLA 1TOCB 1DWBH 2QAAA 1JIMA 2H5DA 1IQEA 1O3IA 1YPLH 1BJVA 3P8GA 1DXWA 3RXMA 1OWIA 2F9PA 1FDPA 1TBZH 3S0NA 3SOSA 2GT7A 1C2KA 4DG4A 1O36A 1QRWA 3E90B 2FEQH 2HNTF 1BRBE 3BG8A 3A7ZA 4IN1A 1O5CB 4LZ4B 1TX8A 3M61U 1TRMA 1DVAH 1UK4A 3Q00A 1AFQB 5E2PA 1IQJA 1GCTC 4NCYA 3RMOH 1S83A 3ZZ6A 4GAWA 5C1YA 4B1TA 1P2MA 1AY6H 2A4QA 1ANDA 6GCHF 1GI9B 1BBRH 2XCNA 1AN1E 3RXVA 4CRCA 1A0LA 5L2YH 1SOTA 1KTSB 1K1MA 1CBWC 1N8OC 2K1QA 5C5NA 2AFQB 1W2KH 5A8XA 2B9LA 4ZKSU 3GDVA 1YYY1 3O8RA 1QBVH 2QA9E 2ZGJA 3PTNA 1P2OA 1WOFA 1O2OA 3P92A 3RXSA 1UTOA 3TLOA 2ZI2H 1SGTA 1AE5A 1AIXH 1IHTH 3M5MA 3M3TA 1BOQA 3S69A 1XM1A 3PMHB 2UWLA 1NS3A 1VGCC 3HK6B 5LPEA 2BQWB 1ZMLA 3RXGA 3RXQA 2ZFQH 1C2IA 3SNCA 3PLPA 4JZ1A 1O0DH 4B71A 5GDSH 3ENSB 4BAQB 4K69A 2GGVB 2BVXH 3SHAH 2VWNA 4X6OA 3DT0H 1P09A 4OS2A 3A81A 2NWNA 4CRGA 1YPKH 1B5GH 3JZ1B 1AI8H 2R0KA 2GD4B 1C5QA 1IAUA 4Y0YE 2G52A 2G4UA 1QB6A 2XYAA 1P06A 1G30B 1Z1IA 5AFZH 4WH8A 5DP6A 3UWIA 3Q76A 4JCNA 1YM0A 2ILNA 2I6QA 4JK6A 1CGIE 4WMFA 3LDXH 1HLTH 1V2RT 2NU0E 4DIHH 3EQ0H 2ZU1A 5F6MA 2BD4A 4B73A 3F9GA 2BM2A 3T2NA 2FX4A 2BOHB 1SHHB 5FX6A 1G3BA 4WMDA 1LHDH 1C5ZB 1P11E 1C4V2 2BD9A 2ZFPH 3GYLB 1GBHA 2FPZA 5EGMA 1DE7H 1BTXA 1E36B 1Q2WA 3BTTE 1AVWA 4Y8XA 1QB9A 2W26A 3PWBA 5CMXH 5T6FA 3BEUA 1XMNB 2GX4A 2BB4A 1C1RA 1UTKA 1QCPA 1UVTH 3RXIA 3RLYH 2PKAB 4DJZB 4CRAA 1EZSC 3SGQE 1GBAA 3BTGE 1XVOA 2FESH 2A0QB 1AGJA 3RM0H 1YPMH 3E6PH 1MQ5A 1SLXB 2XBVA 4ISIH 1GBEA 3SNEA 4AYYB 1HAYB 4GUXA 1WU1A 1KXEA 1VGCB 2ODYB 1O37A 1O5DH 3P8NA 1B7XB 2OCVB 1MTNB 1MZDA 1TMTH 3E91A 4Y8ZA 4DVAU 2PSYA 4U2WA 1A5HA 1GPZA 2GDDA 4KTSA 4FUIA 2EC9H 1P2QA 1F5KU 1DM4B 1UHBB 1H4WA 3SQHE 5EQQA 1ZMNA 3Q3KA 1C2FA 1YF4A 4Y8YA 2AYWA 1CHGA 1O3HA 3LGYA 2Y82A 2A7JA 2NU1E 3QN7A 5DG6A 2FOAA 1YGCH 2QXIA 3IITA 1GJ6A 5T6GA 3SGAE 1C2DA 5C1UA 1GJ9B 3B8JA 1L1JA 3MU4A 1HV7A 3T28A 4X2XA 3RU4E 1CA8B 1AZ8A 2QC2A 1TALA 1DFPA 3ODFA 2FOHA 1YPHC 2O8WA 3MU0A 2W5EA 1IQIA 1FQ3A 3VB3A 2LNCA 4OGXA 2V3HH 3UPEA 5J4SA 1GMCF 4ZKRU 2A2QH 4I8LA 2VIWA 4OS6A 1O30A 3EA7A 2A4RA 5FXLA 4NZLA 2CN0H 4ZAEA 1YPHE 2BX3A 2C8WB 1KXBA 3GDUA 5IYTA 1ARBA 2ZPSA 4VGCB 1HFDA 1TGTA 4IBLH 1C1WH 1PQAA 1K1LA 4Y10E 3TVJB 5A0CA 3TNSA 3SU0A 1MD8A 1O39A 4MPUA 5K0HA 2EI7A 2GZ9A 1KXFA 2O8UA 3PYHA 1LHEH 3F1SB 4OS7A 4U30A 1ZMJA 1ZTJA 3RU4D 2O8LA 3PB1E 1LO6A 1ZPZA 2Z3CA 1BTZA 1CQQA 7KMEH 2J94A 1P2KA 1LPGB 1IQMA 1TB6H 4FVBA 1VITG 5DPAA 1NFWA 3PTBA 4O97A 2A5AA 2R3UA 3EGKH 5BRRE 3RXCA 1XXDA 1KLTA 2OXSA 2V3OH 2OC8A 5F8ZA 1PYTD 3M35A 3TNTA 2SNWA 4NG9H 1BHXB 2ZGCA 3O8BA 1NM6A 1E35B 1XUJA 4NIVA 1O2RA 4BAKB 1QBOA 1O34A 4JYUH 4Q80A 3ATLA 1GVZA 2XTTB 2BD5A 2ANMH 2PV9B 3EDXB 1KY9A 1LHGH 1KXAA 2PTCE 3TK5A 1P9UA 3HK3B 2OINA 4NZQA 3TJOA 1EPTB 1K1JA 3BG4B 4XBBA 1FN6A 2TIOA 3MU5A 1C5RA 2ZDVH 1ZJDA 1GGDB 3ZVEA 1HIAB 1GL1A 3UREA 1Y3VA 3UR6A 3D23A 2BDGA 4X8VH 1HNEE 1RIWC 3P17H 1KSNA 4AFUA 5FCKA 1EP5A 4I31A 3MYWA 1C5WB 1F5RA 4WH6A 5F8TA 3WY8A 3RXBA 3ZVFA 2ZU4A 1AFQC 4BAOB 1ETTH 3RC6A 4ASHA 5A8ZA 1AHTH 1OSSA 3IG6B 3SNDA 3E0PB 4INHA 1DUAA 1TPAE 3P70B 4B2AA 1CVWH 1JWTA 2D2DA 1SQAA 2AGIX 2BY7X 1BMLA 1K2I1 3KQDA 3A8DA 3DUXH 5FHTA 2A4OA 1DDJA 1TPOA 4ABDA 3TGJE 2YNBA 4X1SU 4XFQA 4CH8B 2F91A 4X6MA 1VJ9U 1C4U2 1O2VA 3NWUA 3P6ZB 3QGJA 1Z8IB 3Q77A 4GSOA 3M5OA 5JYIA 3I77A 2Z9IA 4Y79A 1S0RA 1THPB 1C5MD 3NCLA 5DP9A 2G51A 1EZQA 4HTCH 2RDLA 3SV8A 7GCHG 1MQ6A 4E7RG 4UFEH 1OKXA 4U01A 1LTOA 3MFJA 4XOJA 1Y5AT 4ZHMU 4ZKNU 4MVNA 1MZAA 3LGIA 3LGVA 1O2UA 1QL8A 1WQVH 1LDTT 1ESAA 2ODPA 1X7AC 2CF8H 1A5GH 4DGJA 5E0JA 2DUCA 2JETB 3SJ9A 1T31A 1FPCH 3BIUH 1XUKA 1EP6A 2VJ1A 3PV4A 1RD3B 1PJPA 3SV6A 3A7XA 3MMGA 1SL3A 2BQ6B 3VFEA 1LMWB 1A1RA 4AYVB 1HPGA 1SOZA 1UCYE 5JB9S 1FY4A 1K1NA 3A7VA 5AHGH 1GBTA 1GJAB 1XUHA 2A32A 3M3SA 4AG2A 5T6DA 2ZU3A 1Z6EA 2PFEA 4FU9A 4CRFA 1BBRK 1JRSA 1GL0E 1VZQH 1NRNH 3OY5U 4BAMB 1INCA 1HIAA 1BUIA 1KXCA 3ELAH 1O3MA 2F9BH 4MPWA 4B75A 2Q6DA 2G55A 3ZVAA 3NKKA 3TK6A 1GMHF 3AVZA 2VH6A 2ANWA 5FPTA 3ZV9A 4FUBA 2OUAA 1DLEA 1GI4A 3M5LA 3PMJA 3GCNA 2ZPRA 4AB9A 5JBBS 1DY8A 1Z71A 3TH4H 1GBMA 1HAVB 2XXLA 1ESTA 4YO9A 1TMUH 1IQHA 1HJ8A 1ZGIA 2VGCB 2Y80A 3K2UA 1P0SH 1HXFH 3VXFH 1FY3A 5PTPA 4R0IA 1MH0A 1AWHB 1YPJH 5ESTE 1HAIH 1GHAG 1TMBH 2FOGA 4Y7AA 1DWDH 2C93B 1NFXA 1ZTKA 1GDQA 1G2LA 5DP8A 2JH0D 3ZV8A 4X8TH 1JXPA 1EB2A 3MNCA 1W12U 3SJIA 1QGFA 2NU4E 3VPKA 1GJ7B 1WV7H 4NA9H 5DJ7A 1ETRH 3VB4A 1ELTA 1MMJN 1MU8B 5L2ZH 4ZMAH 4GCHF 1QL9A 3UFAA 1MTWA 4B2CA 3UTUH 3BEFB 5T3HA 2FS8A 2G81E 3OYPA 2GZ8A 1THSH 4FUDA 1GI7B 2FWWA 3PO1C 1HRTH 4ABBA 5A0AE 2Y81A 2BY9X 2PLXA 1PPEE 4OS4A 2HNTC 4MDSA 1SR5C 2SGFE 2PUQH 3STIA 1F0TA 1MCVA 5H4IB 1O2GH 4YOGA 3LC5A 1EXFA 3KN2A 1CT0E 3RMMH 3L33A 1W10U 3BG4C 1BDAA 1GDNA 1WTHD 2FYQA 4D8NA 3FVFB 1ZHPA 3FFGA 1ELGA 1DSUA 1UTQA 1XUGA 4I7YH 2CV3A 1Q3XA 2XBXA 1OP8A 3KEEA 2OBQA 1VCWA 2H9TH 3AAVA 2FX6A 4Y6DA 2BD8A 1D6RA 1VITF 2UUFB 1W7GH 4X6NA 2VH0A 5C2ZA 1GHBG 1HDTH 1QQ4A 2BMGB 3T27A 5K7RA 3SQEE 1EQ9A 2R0LA 3P95A 3U98H 4MLFB 1GHVH 4I8HA 5A2MH 4D9QA 1T4VH 2BY6X 2UWOA 3E1XB 5E8EH 1H9LB 1O3NA 4O9VA 1O38A 5A09A 2ZCLP 1BJUA 5LPRA 1V2TT 2CMYA 2JH5D 2BD3A 1AKSA 2UWPA 1LKAA 1ZRBA 1O2LA 2STAE 1AWFH 1J16A 3LKWA 1OXGA 1K1PA 1NRPH 2HRVA 1IQLA 4DT7B 1EUFA 3AAUA 1W8BH 3UNQA 4I8JA 3BTKE 4B2BA 2BDIA 3U1JB 4JZFH 4IC5A 3ZYEA 1IQGA 1CT4E 2ZFRH 5JDUB 1FUJA 1BTYA 3KCGH 3UY9A 3UIRA 1C1QA 3M7UA 1MCTA 2F9NA 1AQ7A 3S9CA 5A0BA 3ZZ8A 1B0FA 3E0NB 1O3EA 3GY5A 1O2QA 3A84A 1C1UH 4WVPE 1LVYA 5JPMH 2PHBA 2H1UA 1Z8GA 4F49A 2RA3A 3TPIZ 3U9AH 2QN5T 3UNRA 1G2MA 3M7QA 4KELA 3STJA 4AB8A 3O8DA 1O3BA 4X1PU 1TWXB 2ZO3H 1V3XA 2ALPA 1HBTH 1L0ZA 3B23B 3U8RH 3CENA 1LPKB 5BPEA 1P05A 1XKBC 1TPPA 3F68H 1OOKB 1O2KA 2A4GA 2O8MA 2XC0A 1ORFA 1DOJA 4ZXXH 5LGOA 1FI8A 2ZHEH 1BTPA 2B8OH 1THRH 1GVKB 1AE8H 4NA7A 2SGPE 1SGPE 3MU1A 1GBJA 1ZPCA 2WV5A 4CREA 3A7WA 4X1RU 1SB1H 1AD8H 4Z6AH 4DIIH 1BRAA 3U1IB 2OQ5A 3UNSA 1O5FH 1GCDA 4JYTA 3F9HA 3T25A 1HAGE 1C2MA 4AZ2B 3SJOA 3TIUA 2BDAA 2J34A 2ZQ2A 1ABJH 1C5OH 1EAIA 1FIZA 1BRUP 1OYQA 3MNXA 1SGFG 2ANYA 1Y8TA 3L3TA 3KGPA 3ESTA 5I25A 4NIYA 2P94A 1GMDG 1CSOE 1V2OT 1WAYB 2ZNKH 2C4FH 3DA9B 3RXDA 1O5AB 1C1TA 2OQUA 5HGGA 3N7OA 1FMGA 4K5ZA 1A7SA 2IJOB 1EJAA 1T7CA 1NN6A 4FUGA 1EZUC 1Y3UA 5FBIA 5C20A 1FV9A 3LT3A 1K1IA 1C1OA 1TRYA 4K60A 4ISOA 1TIOA 3NK8A 1PPCE 3FZDA 1OPHB 2Z3EA 2ZP0H 3T62A 2ZTZA 2HOBA 3JZ2B 2GP9B 2PR3A 2ALVA 3PLBA 3LU9B 4U32A 1UCYK 2R3YA 4JZDH 5DK1A 3S7HB 3IWMA 1C5TA 1MUEB 3A82A 1ELFA 4UD9H 2VGCC 2IN2A 1FAXA 4RKOB 1K28D 4ISNA 1K22H 2WPMS 3W95A 2Z9KA 4JK5A 1G32B 2XCFA 1LVBA 1RTKA 4BTIB 4AGJA 2SGAA 1DX5M 5CHAB 2G5VA 3S9BA 2FMJA 3OTJE 1VJAU 4Q7YA 1TLDA 3LC3A 5CE1A 2FM2A 2O8TA 3TJUA 1SFQB 1OP0A 1LHFH 2ZGHA 4ZHLU 1HJAC 4D9RA 6ESTA 4YESB 2Z94A 1GHAF 1SLVB 2Y5HA 1H9IE 3ZZBA 3H7TA 3OY6U 1EKBB 3L6PA 1DWEH 1ANCA 2B0FA 1O5BB 4DOQA 3RXTA 3SV7A 1YCPM 4BXSA 4OS1A 1C1MA 1JMOH 1V2WT 4NFEA 1QRZA 1SG8B 1BQYA 1XXFA 4E05H 3RXOA 3D49H 4J1YA 2CJIA 6GCHG 1CT2E 1KLJH 1Y3WA 4WY3A 1TAWA 3FP8E 1DITH 1TBQH 2OC1A 5ABWA 5SGAE 3OX7U 2ZECA 5TCCA 1BB0B 1EAWA 2ZA5A 1WTGH 1L1GA 1ZSLA 2WPLS 1YLDA 2AEIH 3TITA 4UONA 1T8MA 3RMNH 4FUJA 3AW0A 2V0BA 1W3CA 4Y11E 4ZH8A 3HKJB 5HM9A 2ZCKP 3MI4A 4JZEH 1C5UA 1GBKA 1Z7KA 3RXLA 1VR1H 1ZTLA 2UUJB 1MKWH 1O3OA 3SU2A 2ZZUH 4KGAA 1GBFA 1Z1JA 2BD2A 3VGCB 3M36A 1O2IA 1NRQH 3K6ZA 1GHYH 2AIQA 3V0XA 3U8TH 2A7HA 3ZVGA 2TBSA 3KQCA 4MG3A 4XE4A 4YOJA 4CRDA 5EOKA 1GI5A 2BD7A 1LQEA 4YLUA 5EQRA 4A1VA 5A8YA 6LPRA 5EPYA 1HUTH 3AASA 3SU6A 3T26A 2FI5E 2OC7A 5HXFA 1FZZA 1NFUA 1N8OB 2WYGA 5EQSA 4FUFA 1NPMA 1GI6A 1TQ0B 2Y6TA 2RG3A 1GVLA 1KDQA 1QTFA 1Q31A 1GGDC 1H9HE 4ABIA 3UUZA 3ZZDA 3CP7A 1B0EA 3QGNB 3SI3H 1UTMA 5EW1H 3GISB 1J8AA 1O3AA 2BZ6H 2QF0A 1VCPA 1D3PB 3T29A 3V7TA 1LVMA 3LJOA 2ZTYA 1HAHH 4J2YB 3QTVH 1G3DA 1GI8B 5ETXA 1ANEA 4A1XA 1GI2A 2G8TA 1C1NA 1S5SA 4UFGH 4CHAC 1O3KA 3ZYDA 1V2UT 1NROH 3NXPA 5L30H 5GIBA 4O3TA 2FZZA 5AVDA 1MKXK 1RTFB 1YCPK 3SU5A 2CXVA 1BMMH 3GCHB 4B76A 1ESBA 2Z6BD 3K9XB 1A5IA 1EPTC 4Y7BA 3RDZA 2H2ZA 1UTNA 5HMAA 4Y76A 1FONA 3EA8A 2QV1A 2GDEH 2A5KA 2OLGA 2C8XB 1SGEE 1E37B 2F3CE 2ASUB 4BOHA 2KAIB 2ZHDA 4YT7H 1RRKA 1NT1A 5I46H 2ZHQH 2OC0A 4AX9H 2M5TA 8ESTE 3ZVCA 4TPYA 1G37A 3QO6A 4HFPB 4YM9A 1GJBB 1O2YA 3VEQB 4GLYA 1DXPA 4WMEA 3V13A 1C5LH 2JH6D 1GMDF 1MD7A 1SGCA 1CHOG 2EI8A 2VINA 1IOEA 3GCTF 4XBDA 2BXUH 2C8ZB 1RXPA 4B74A 2WPHS 4K8BA 4ABEA 3CS7A 6CHAB 4A1TA 2VWOA 2NU3E 4NIWA 4X8UH 3TU7H 1S6FA 2IPHA 2BDCA 1TOMH 2ZGBH 4MNYA 3RXHA 4LK4A 4X2WA 2ZU5A 1T32A 1CA0C 4X1QU 4Q2KA 2FOFA 2AMDA 3OSYA 3BTEE 1C5XB 1LQDB 1O2PA 2VVVA 1GJ4H 2GMTC 3LH1A 4A7IB 3HGPA 1RJXB 4FUHA 2Z7FE 3SNBA 4NWKA 1F5LA 1ZJKA 2OD3B 1QNJA 1MAYA 1G9IE 4SGAE 3VB6A 1W0YH 2SNVA 3S9AA 3GCHC 1A4WH 1HJAB 1QL7A 3A7YA 2LPRA 3P8OA 4JYVH 1LHCH 3BV9B 1ACBE 3AW1A 4ABAA 2VWLA 1O3JA 1TPSA 3UOUA 1TYNA 1TA6A 1P2NA 6CHAC 2P93A 2H9EH 4CR5A 1O2ZA 3SO3A 2ZKSA 1D4PB 4NSVA 4WWYA 3SW2B 1OWJA 1C1PA 1PQ5A 2C90B 3HPTB 2BDBA 1V6DA 4NIXA 1P3EA 2P95A 2R2MB 2GCHF 3BIVH 1ELBA 1V2ST 2H6MA 2FTLE 2Y7XA 4WF8A 5LH8A 1BTWA 2ESTE 1T4UH 1GBBA 3RXFA 2FTMA 2ZDKA 1ELCA 1DSTA 1SGRE 1O5GH 4K1EA 3W94A 3UWJH 2ZCHP 1S82A 2WPJS 4MQAA 1MTUA 5JBTA 2BYAX 3TH3H 1KTTB 4IC6A 1E0FD 1NY22 2BX4A 3PLKA 3CS0A 5GCHF 4ABHA 1S0QA 1SLWB 3BTWE 4WXVA 1AVXA 1O2JA 1OWEA 3BTHE 4IMQA 3ZZAA 5EXLA 2SGDE 1KIGH 1YPEH 2GV7A 1BMAA 3Q3YA 4HGCA 2WPIS 3SI4H 2F9UA 1AUTC 2BDHA 3LOXA 8LPRA 1PFXC 2B7DH 2PGBB 1WUNH 3F6UH 3QZRA 2ZG0H 1GI3A 3LIWA 1QBNA 3ZVDA 5DP7A 1PPGE 3MNBA 1ZHRA 2XW9A 1V2MT 2RCEA 4BTTB 5EW2H 3VGCC 2R2WU 1P3CA 3ZZ4A 1F0RA 2HLCA 1G3CA 3BTFE 4FXGH 4MNVA 4WJG2 3H5CB 2PKSB 1ELAA 1YPGH 2ZDMA 4O3UA 1O3CA 2IOTA 2QCYA 4PROA 5F03A 2FYRA 1BTHH 1XVMA 2Y5FA 4E7NA 1SHYA 3G01A 1BZXE 2TRMA 8GCHF 1C1SA 3GY7A 3QTOH 5JB8S 1J15A 3LGTA 3R0FA 1NTPA 1MU6B 4UEHH 2BDYA 4ABJA 4DW2U 1BIOA 4AGKA 1YC0A 1V2QT 3LONA 1A3BH 2OP9A 3KQEA 1HCGA 1O2XA 2JKHA 2J9NA 3VXEH 4VGCC 2D1JA 1NRSH 1N1LA 1RS0A 1EPTA 2FI4E 9LPRA 4BAHB 3SGBE 3A89A 3GYMA 1YBWA 1QJ1B 2WYJA 4K3JA 1TGSZ 3DD2H 2BLOA 1D9IA 3UOPA 3MU8A 2GT8A 3ATIA 3VB7A 1YKTA 3RC4A 4NA8A 1ZOMA 2FP7B 1U6QA 4YLQH 1UVUH 3HKIB 1XUIA 1D6WA 5CHAC 4D7GA 1NESE 1CGHA 4X2VA 1FXYA 1HAOH 4Y71A 3RXPA 1LKBA 1GJ8B 2VVUA 2VIDA 5J4QA 1V2VT 2WV4A 2PUXB 1H1BA 1AKSB 1F0UA 1O2MA 1QA7A 2BY8X 2XBWA 1TNGA 4KKDA 1MKXH 3A88A 5EPNA 4GHTA 3B9FH 3SJKA 3M5NA 4FU8A 2CF9H 4X1NU 1C9PA 1SGYE 4CH2B 1WQSA 3A8CA 2ZFFH 2SGEE 1BA8B 2H5CA 3ZZ3A 3UQVA 2RA0A 1UCYH 1FPHH 1C1VH 3RXEA 1OX1A 2HNTE 4RN6A 2FODA 4YZUA 3NUMA 3SU4A 3QK1A 3GOVB 2ZFSA 4JZIA 1N6YA 2ANKH 4YTAA 1TBRH 2A31A 1KLIH 2SFAA 2YNAA 2ZTXA 1W0ZU 1FNIA 2QYIA 4RKJB 1PQ7A 1QIXB 3A80A 4UE7H 4TWYA 2BVSH 4CHAB 1HYLA 3Q3XA 3MO6A 1WYKA 4Z0KA 3RU4T 1AZZA 5AFYH 3BF6H 1MBMA 1UMAH 3BTQE 1AVGH 1F92A 1O3GA 3ATKA 3ATWA 1NRRH 2BOKA 2BTCE 1TGBA 5GCHG 4CBOA 5JBAS 1S81A 2ZF0H 1DPOA 2UUKB 1DY9A 1UHBA 1O2SA 2FLRH 2THFB 2WUCA 1P57B 1CA0B 5FBEA 4KP0A 2QXGA 2GV6A 4MNWA 1FJSA 2TGAA 2XNIA 3QUMP 1FLEE 2BZAA 1GDUA 4ISHH 2VU8E 1H8DH 2V6NA 1T8NA 1RTLA 1SI5H 2VIVA 3MH6A 4UFFH 1LVOA 2XRCA 1EB1H 1HAZB 1UJ1A 3QLPH 2BQ7B 1CO7E 1TRNA 2P3FH 1NO9H 1C2EA 1O2TA 2VIQA 1GHXH 1A0JA 3K65B 1QHRB 5AF9H 1GWAA 4HI3A 1TONA 2GCHG 1TNHA 4Q7XA 2J2UA 4Q7ZA 1DT2A 2XBYA 1F7ZA 1GHBF 3PM3A 1P12E 2HWLB 2Z9LA 1QA0A 1OS8A 1IQFA 4ESTE 3TK9A 1T8LA 1ZRKA 1C5SA 1HXEH 3ATMA 1AUJA 1GBCA 1L4ZA 1V2JT 1MTNC 1S84A 1LCYA 4K2YA 5C1XA 2W7UA 2XWAA 1PPBH 3PWCA 1GJCB 1BHXF 2ULLA 2G5NA 1EATA 2FOCA 1A61H 3LGUA 1V2PT 4R8TB 1PQ8A 4MNXA 1ELDE 4H6SB 1W14U 4ZROA 5EXMA 1SGQE 4IS5A 1HAVA 1UVSH 3SU1A 5GWZA 1FAKH 1TNLA 2XC4A 4AORA 3GICB 1FIWA 2D26C 1HGTH 1O35A 2ZHFH 4TWWA 1C2GA 4AFSA 2BHGA 1GG6C 5DKMA 3U69H 1K1OA 2P3UB 1P2JA 3KQBA 1RGQA 3ITIA 4X2YA 1AB9B 4AN7A 1D3TB 2AIPA 1OWDA 1O3DA 3O8CA 2CGAA 2Z9JA 1XX9A 1TNKA 5HM2A 1ID5H 4ZXYH 1QQUA 5C5OA 1E34B 2F9OA 5L6NH 3MHWU 4SGBE 1ZZZA 4HZHA 1ANBA 1MBQA 3SV2H 2EEKA 3M7TA 2Q6GA 1TX7A 1S6HA 3FAOA 3RXAA 2O9QA 1C2HA 1QFKH 2FS9A 4IGDA 1TA2A 1YCPH 2A1DB 1NU7B
chains in the Genus database with same CATH superfamily
2XWBI 3BTDE 1GBIA 3KHVA 1S6LA 4X6PA 1A3EH 1BT7A 2A2XH 2PSXA 2FLBH 4P00A 4GHQA 3VB5A 2Q1JA 4ISLA 1RIWB 5F8XA 3ZZCA 4ASUD 3E8LA 1SGFA 1ZGVA 1QR3E 2JJ2D 2F83A 1OWHA 2ZDAH 1WCZA 4BNRA 1EJMA 1YP9A 1GHWH 1O5EH 3GY2A 1TNIA 1FY1A 2W3IA 1XUFA 1AU8A 2AS9A 2ZPQA 2VNTA 3MO3A 2AGGX 4NSYA 2HPPH 1D3DB 4ABFA 1GG6B 3ZZ9A 4RT1A 3SUGA 1C5YB 1V2NT 3GY8A 3HATH 4K1TA 2OBOA 5DP4A 1CGJE 1Z8JB 1EASA 9ESTA 3TJVA 1FY8E 2ZU2A 2QF4A 2GVFA 5C67A 1PYTC 5ESBA 1UTJA 2VWMA 5E0GA 3MO9A 4RSPA 1JRTA 3BN9A 1BMNH 2KAIA 2QIQA 2P16A 1KYNA 2Y7ZA 2F9VA 5FAHA 1NC6A 1ZLRA 5JBCS 3RXJA 1DUEA 5GPIB 1T8OA 2P8OB 5FCRA 1GBDA 1A0HB 2FXRA 3SORA 4K8YA 3I29A 2EI6A 3A86A 1GMHG 2HGTH 1D3QB 1MTVA 3GY3A 3SUFA 1IQKA 2DE9A 5E0HA 4XBCA 5E2OA 7GCHF 2BLVA 1JIRA 1TX6A 2AERH 4H4FA 4X0WU 2R9PA 3DFLA 3FANA 2G4TA 3N7DA 1P01A 2GCTB 1UVOA 7ESTE 4XSKU 3EAJA 1TABE 1K9OE 1QJ6B 4AOQA 2QXHA 1IHSH 3RUOA 1QURH 2NU2E 3A87A 1F0SA 4JMYA 2BLWA 3A7TA 3SU3A 2AMPA 2W7SA 3MH7A 3U8OH 4ZUHA 4WXIA 1O31A 1IQNA 1E38B 1BBRE 2PWXA 4LXBH 2ZDNA 4NFFA 2P59A 3RM2H 3RXUA 2WINI 1GI1A 1TNJA 2VVCA 4I33A 5IDKA 3KL6A 1P03A 1FN8A 1XKAC 1SSXA 1EZXC 5HYOA 2A7CA 4IMZA 4UFDH 1TGNA 5DGJA 2VBCA 4YT6H 1OWKA 2DE8A 1O3LA 1KMHB 1V2LT 1SPJA 2STBE 4CRBA 2AGEX 1EAXA 1C4Y2 3SV9A 1ARCA 2TPIZ 1PPZA 4BXWA 1QB1A 3NPSA 5LPFA 1UK2A 3NZIA 2GMTB 4INKA 1W13U 2VIPA 2BY5X 3S7KB 2YOLA 1AFEH 1Z8RA 1CE5A 2GTBA 3FO8D 3URDA 1C2JA 3PO1B 3QZQA 3RXRA 1UVPA 4KTUA 1GI0A 1O32A 1OP2A 2KM0A 4LOYH 1J17T 1ELVA 3MOCA 3GCOA 2FO9A 1GMCG 1BITA 1CBWB 3PMBB 2B5TB 2FI3E 2PGQB 2FOMB 3C27B 3MNSA 1Y5UT 2ZFTA 3RP2A 5EODA 3I78A 3WWBA 5GJ4B 2GCTC 1BCUH 3EA9A 5GNDA 4GPGA 2BXTH 3RXKA 2UUYA 1GHZA 1M9UA 1ABIH 3EYDA 2FOBA 2OTVA 3FP7E 2H9HA 2G00A 4LZ1H 2C8YB 5TJXA 5FPSA 4BANB 4TPIZ 8GCHG 1SQTA 1TGCA 4GCHG 4H6TA 5EU8A 1GJDB 3OU0A 3SJ8A 1EX3A 3UQOA 3D65E 3C1KA 4D76A 2PKSC 1TFXA 3GY6A 2J92A 2P8OC 3FP6E 1SMFE 2J38A 3TH2H 5DP5A 3TGIE 1HAPH 2CHAC 4AG1A 5DO4H 1AO5A 4P02A 3A8BA 2PTNA 2A5IA 1Y5BT 2WPKS 1A2CH 2A45B 3F9EA 3N7EA 3R3GB 1N6XA 4H42U 1P10A 3ZZ7A 4FVDA 2QXJA 2ZGXH 3BSQA 4I86A 3E3TA 1P8VC 2ODQA 1SGDE 3VG8A 4GVUA 2VIOA 4QT8C 1G36A 2Z3DA 1AB9C 2W3KA 1O2NA 2VB0A 2ZDLA 3MH5A 1WSSH 4I8KA 1UO6A 3URCA 1GCTB 2HPQH 4OS5A 2WZQA 5GXPA 1EOJA 1TE0A 2TGPZ 1P02A 3PROA 4K1SA 3LPRA 3V12A 1QJ7B 4M7GA 1Y3XA 3PMAB 1UTLM 1ZPBA 4I8GA 2I6SA 2GZ7A 3LH3A 4Q63A 1G3EA 1NU9A 5B6OA 4THNH 3TJNA 1KXDA 3RLWH 1DICA 5EG4A 4ABGA 1Y3YA 2JETC 2ZWLH 4OGYA 4D7FA 1PPHE 1PPFE 3A8AA 3SN8A 3ZZ5A 4A92A 2Q6FA 1GJ5H 1DANH 3EE0B 3A85A 1P2IA 3UR9A 4INLA 2P3TB 1EAUA 2CHAB 3F3BA 1SGIB 1C5NH 2ZQ1A 1ZSKA 1CHOF 3GCTG 3DSGA 3KIDU 3SHCH 1BTUA 4FUEA 3ZVBA 2Z9GA 1BRCE 1JBUH 1J9CH 1L1NA 2PP6A 4F4OC 3DHKH 1W11U 2FDAA 2TGTA 1Z6JH 3SNAA 4A6LA 1DLKB 1NZQH 2SGQE 1ZSJA 3MTYA 4MTBA 4O03A 2J95A 3RMLH 3GY4A 2BVRH 4YOIA 2PW8H 4ZKOU 7LPRA 1HAXB 5EJ1A 2QGRA 3E16B 4AFQA 2TGDA 2J5UA 1ZHMA 1P04A 3OE7D 2Y5GA 2D8WA 3HGNA 1ZR0A 3GDSA 4MPXA 4NWLA 2BLQA 8KME2 5DP3A 2V35A 4TYDA 1YLCA 2C3SA 1FY5A 2ZHWH 1LPZB 5T1VA 4BTUB 1K21H 4YXWD 2QY0B 1SFIA 3LJJA 3SUEA 1L4DA 1MAXA 1JOUB 1O33A 3SBKA 3KNXA 4KTCA 4IN2A 4NGAH 1DS2E 1UTPA 2EA3A 3SZNA 1S85A 1J14A 4IW4E 1VCQA 3H7OA 3A83A 3F0OA 2OK5A 1H8IH 1EOLA 3MWIU 1MTSA 1QRXA 3P8FA 1O3PB 1SGNE 4TY6A 3F9FA 2FIRH 2ZC9H 4X8SH 3SUDA 4TY7A 3MH4A 2ZEBA 3QX5H 3QDZB 1O2WA 4DURA 1Y59T 4DCDA 3LGWA 1HJ9A 2FOEA 1WBGB 4FUCA 1O2HA 2J97A 1P9SA 1SBWA 2GKVE 3M37A 1ETSH 1QY6A 4AFZA 2HVXA 2J4IA 1VITH 4ZHAA 1C9TA 2QF3A 5C3NA 4CBNA 1UK3A 1A46H 1W7XH 1ELEE 1MKWK 3FZZA 1W0JD 1O3FA 1RFNA 4A5TS 1HB0B 2ZIQH 4DY7B 3ODDA 1OYTH 2PKAA 1F2SE 2HALA 2XC5A 3D62A 5FPYA 3DFJA 3QWCH 4E06H 5TCAA 1CU1A 2AH4X 1L2EA 3BEIB 1EJNA 4MPVA 1DWCH 4UDWH 1SQOA 1V2KT 3V3MA 3M3VA 1ZYOA 1TQ7B 5EXNA 3KF2A 1KDQB 1C5PA 3RC5A 1SLUB 4I32A 4XDEA 1AMHA 1SC8U 4CR9A 2AMQA 5FX5A 1EFRD 1C2LA 1NFYA 2WUBA 3K6YA 4Y0ZE 1SVPA 1C5VA 3BTME 3TGKE 5G4BA 4FU7A 3T5FH 2XOKD 1GBLA 1TOCB 3PV2A 1DWBH 2QAAA 1JIMA 2H5DA 1IQEA 2KCOA 1O3IA 1YPLH 1BJVA 3P8GA 4RI0A 1DXWA 3RXMA 1OWIA 2F9PA 1FDPA 3NRLA 1TBZH 3S0NA 3SOSA 2GT7A 1C2KA 4DG4A 1O36A 1QRWA 3E90B 2FEQH 2HNTF 1BRBE 3BG8A 2RFKC 3A7ZA 4IN1A 1O5CB 4LZ4B 1TX8A 3M61U 1TRMA 1UW7A 2LELA 1DVAH 1UK4A 3Q00A 1AFQB 5E2PA 1IQJA 1GCTC 1YWUA 4NCYA 3RMOH 1S83A 3ZZ6A 4GAWA 5C1YA 4B1TA 1P2MA 2KR7A 1AY6H 2A4QA 1ANDA 6GCHF 1GI9B 1BBRH 2XCNA 1AN1E 3RXVA 4CRCA 1A0LA 5L2YH 1SOTA 1KTSB 1K1MA 1CBWC 1N8OC 2K1QA 5C5NA 2AFQB 1W2KH 5A8XA 2B9LA 4ZKSU 3GDVA 1YYY1 5KEDA 3O8RA 1QBVH 2QA9E 2ZGJA 3PTNA 1P2OA 3FN8A 1WOFA 1O2OA 3P92A 3RXSA 1UTOA 3TLOA 2ZI2H 1SGTA 1AE5A 1AIXH 1IHTH 3M5MA 3M3TA 1BOQA 3S69A 1XM1A 3PMHB 2UWLA 1NS3A 1VGCC 3HK6B 5LPEA 2BQWB 1ZMLA 3RXGA 3RXQA 2ZFQH 1C2IA 3SNCA 3PLPA 4JZ1A 1O0DH 4B71A 5GDSH 3ENSB 4BAQB 4K69A 2GGVB 2BVXH 3SHAH 2VWNA 4X6OA 3DT0H 1P09A 4OS2A 3A81A 2NWNA 4CRGA 1YPKH 1B5GH 3JZ1B 1AI8H 2R0KA 2GD4B 1C5QA 1IAUA 4Y0YE 2G52A 2G4UA 1QB6A 2XYAA 1P06A 1G30B 3KQ5A 1Z1IA 5AFZH 4WH8A 5DP6A 3UWIA 3Q76A 4JCNA 1YM0A 2ILNA 2I6QA 4JK6A 1CGIE 4WMFA 3LDXH 1HLTH 1V2RT 2NU0E 4DIHH 3EQ0H 3DCLA 2ZU1A 5F6MA 2BD4A 4B73A 3F9GA 2BM2A 2JJ1D 3T2NA 2FX4A 2BOHB 1SHHB 5FX6A 1G3BA 3F0PA 4WMDA 1LHDH 1C5ZB 1P11E 1C4V2 2BD9A 2ZFPH 3GYLB 1GBHA 2FPZA 5EGMA 1DE7H 1BTXA 1E36B 1Q2WA 3BTTE 1AVWA 4Y8XA 1QB9A 2W26A 3PWBA 5CMXH 5T6FA 3BEUA 1XMNB 2GX4A 2BB4A 1C1RA 1UTKA 1QCPA 1UVTH 3RXIA 3RLYH 2PKAB 4DJZB 4CRAA 1EZSC 3SGQE 1GBAA 1NBME 2KX4A 3BTGE 1XVOA 2FESH 2A0QB 1AGJA 3RM0H 1YPMH 2L6OA 3F2GA 3E6PH 1MQ5A 1SLXB 2XBVA 5HIYA 4ISIH 1GBEA 3SNEA 1H8HD 1HAYB 4GUXA 4AYYB 1WU1A 1KXEA 1VGCB 2ODYB 1O37A 1O5DH 3P8NA 2K0QA 1B7XB 2OCVB 1MTNB 1MZDA 1TMTH 3E91A 4Y8ZA 3ZIAD 2WSSD 4DVAU 2PSYA 4U2WA 1A5HA 1GPZA 2GDDA 4KTSA 4FUIA 2EC9H 1P2QA 1F5KU 1DM4B 1UHBB 1H4WA 3SQHE 5EQQA 1ZMNA 3Q3KA 1C2FA 1YF4A 4Y8YA 2AYWA 1CHGA 1O3HA 1H8ED 3LGYA 4ZCNA 2Y82A 2A7JA 2NU1E 3QN7A 5DG6A 4Q4LA 2FOAA 1YGCH 2QXIA 3IITA 1GJ6A 5T6GA 3SGAE 1C2DA 3SYJA 5C1UA 1GJ9B 3B8JA 1L1JA 3MU4A 3KYFA 1HV7A 3T28A 4X2XA 3RU4E 2AHME 1CA8B 1AZ8A 2JIZD 2QC2A 1TALA 1DFPA 3ODFA 2FOHA 1YPHC 2O8WA 3MU0A 2W5EA 1IQIA 1FQ3A 3VB3A 2LNCA 4OGXA 2HVYB 3GS9A 2V3HH 3UPEA 5J4SA 1GMCF 4ZKRU 2A2QH 3PRBA 4I8LA 2VIWA 4OS6A 1O30A 3EA7A 2A4RA 5FXLA 4NZLA 2CN0H 4ZAEA 1YPHE 2BX3A 2C8WB 1KXBA 3GDUA 5IYTA 1ARBA 2ZPSA 4VGCB 1HFDA 5DSFA 1TGTA 4IBLH 1C1WH 1PQAA 1K1LA 4Y10E 3TVJB 2V3MA 3PRDA 2HLDD 5A0CA 3TNSA 3SU0A 1MD8A 1O39A 4MPUA 5K0HA 2EI7A 2GZ9A 1KXFA 2O8UA 3PYHA 1LHEH 3F1SB 4OS7A 4U30A 1ZMJA 1ZTJA 2J98B 3RU4D 2O8LA 3PB1E 1LO6A 1SQRA 1ZPZA 2Z3CA 1BTZA 3OTPA 1CQQA 7KMEH 2J94A 1P2KA 1LPGB 1IQMA 1TB6H 4FVBA 1VITG 5DPAA 1NFWA 3PTBA 4O97A 1SKYE 2A5AA 3F2HA 2R3UA 3EGKH 5BRRE 3RXCA 1XXDA 1KLTA 2OXSA 2V3OH 2OC8A 5F8ZA 1PYTD 3M35A 3TNTA 2SNWA 4NG9H 1BHXB 2ZGCA 3O8BA 1NM6A 1E35B 1XUJA 4NIVA 1O2RA 3DSOA 4BAKB 1QBOA 1O34A 4JYUH 4Q80A 3ATLA 1GVZA 2XTTB 2BD5A 3MQKC 2ANMH 2PV9B 3EDXB 1KY9A 1LHGH 1KXAA 2PTCE 3TK5A 1P9UA 3HK3B 2OINA 4NZQA 3TJOA 1EPTB 1K1JA 3BG4B 4XBBA 1FN6A 2TIOA 3MU5A 1C5RA 2ZDVH 1ZJDA 1GGDB 3ZVEA 1HIAB 1GL1A 3UREA 1Y3VA 3UR6A 3D23A 2BDGA 4X8VH 1HNEE 1RIWC 1YY3A 3P17H 1KSNA 1VKYA 4AFUA 5FCKA 1EP5A 4I31A 3MYWA 1C5WB 1F5RA 4WH6A 5F8TA 2YMSD 3WY8A 3RXBA 3ZVFA 2ZU4A 1AFQC 4BAOB 1ETTH 3RC6A 4ASHA 5A8ZA 1AHTH 1OSSA 3IG6B 3SNDA 3E0PB 5HIZA 4INHA 1DUAA 1TPAE 3P70B 4B2AA 1CVWH 1JWTA 2D2DA 1SQAA 2AGIX 2BY7X 1BMLA 1K2I1 3W1EA 3KQDA 3A8DA 3DUXH 5FHTA 2A4OA 1DDJA 1TPOA 4ABDA 3TGJE 2YNBA 4X1SU 4XFQA 4CH8B 2F91A 4X6MA 1VJ9U 1C4U2 1O2VA 3NWUA 3P6ZB 3QGJA 1Z8IB 3Q77A 4GSOA 3M5OA 5JYIA 5F53A 3I77A 2Z9IA 4Y79A 1S0RA 1THPB 1C5MD 3NCLA 5DP9A 2G51A 1EZQA 4HTCH 2RDLA 3SV8A 7GCHG 1MQ6A 4E7RG 4UFEH 1OKXA 4U01A 1LTOA 3MFJA 4XOJA 1Y5AT 4ZHMU 4ZKNU 4MVNA 1MZAA 3LGIA 3LGVA 1O2UA 1QL8A 3CNRA 1WQVH 1LDTT 1ESAA 2ODPA 1X7AC 2CF8H 1A5GH 4DGJA 5E0JA 2DUCA 2JETB 3SJ9A 1T31A 1FPCH 3BIUH 1XUKA 1EP6A 2VJ1A 3PV4A 1RD3B 1PJPA 3SV6A 3A7XA 5EIYA 3MMGA 1SL3A 1NBMD 2BQ6B 3VFEA 1LMWB 1A1RA 4AYVB 1HPGA 1SOZA 1UCYE 5JB9S 1FY4A 4RT0A 1K1NA 3A7VA 5AHGH 3AK5A 1GBTA 1GJAB 2KZ4A 1XUHA 2A32A 3M3SA 4AG2A 5T6DA 2ZU3A 1Z6EA 2PFEA 4FU9A 4CRFA 1BBRK 1JRSA 1GL0E 1VZQH 1NRNH 3OY5U 4BAMB 1INCA 1HIAA 1BUIA 1KXCA 3ELAH 1O3MA 2F9BH 4MPWA 4B75A 2Q6DA 2G55A 3ZVAA 3NKKA 3TK6A 1GMHF 3AVZA 2VH6A 3EE7A 2ANWA 5FPTA 3ZV9A 4FUBA 2OUAA 1DLEA 1GI4A 3M5LA 3PMJA 3GCNA 2ZPRA 4AB9A 5JBBS 1DY8A 1Z71A 3TH4H 1GBMA 1HAVB 2XXLA 1ESTA 4YO9A 1TMUH 1IQHA 1HJ8A 1ZGIA 2VGCB 2Y80A 3K2UA 1P0SH 1HXFH 3VXFH 1FY3A 2WV9A 5PTPA 4R0IA 1MH0A 1AWHB 1YPJH 5ESTE 1HAIH 1GHAG 1TMBH 2FOGA 4Y7AA 1DWDH 2C93B 1NFXA 1ZTKA 1GDQA 1G2LA 5DP8A 2JH0D 3ZV8A 4X8TH 1JXPA 1EB2A 3MNCA 1W12U 3SJIA 1QGFA 2NU4E 3VPKA 1GJ7B 1WV7H 4NA9H 5DJ7A 1ETRH 3VB4A 1ELTA 1MMJN 5CHBA 1MU8B 5L2ZH 4ZMAH 4GCHF 1QL9A 3UFAA 2QF5A 1MTWA 4B2CA 3UTUH 3BEFB 5T3HA 2FS8A 2G81E 3OYPA 2GZ8A 1THSH 4FUDA 1GI7B 2FWWA 3PO1C 1HRTH 4ABBA 5A0AE 2Y81A 5B6LA 2BY9X 2PLXA 1PPEE 4OS4A 2HNTC 4MDSA 5EJLA 1SR5C 2SGFE 2PUQH 3STIA 1F0TA 1MCVA 5H4IB 1O2GH 4YOGA 3LC5A 1EXFA 3KN2A 1CT0E 3RMMH 3L33A 1W10U 3BG4C 1BDAA 1GDNA 1WTHD 2FYQA 4D8NA 3FVFB 1ZHPA 3FFGA 1ELGA 1DSUA 1UTQA 1XUGA 4I7YH 2CV3A 1Q3XA 2XBXA 1OP8A 3KEEA 2OBQA 1VCWA 2H9TH 3AAVA 2FX6A 4Y6DA 2BD8A 1D6RA 2K8IA 3SZEA 1VITF 2UUFB 1W7GH 1MABB 4X6NA 2VH0A 5C2ZA 1GHBG 1HDTH 1QQ4A 2BMGB 3T27A 5K7RA 3SQEE 1EQ9A 2R0LA 3P95A 3U98H 4MLFB 1GHVH 4I8HA 5A2MH 4D9QA 1T4VH 2BY6X 2UWOA 3E1XB 5E8EH 1H9LB 1O3NA 1K0HA 4O9VA 5IK2D 1O38A 5A09A 2ZCLP 1BJUA 5LPRA 1V2TT 2CMYA 2JH5D 2BD3A 2L74A 1AKSA 2UWPA 1LKAA 1ZRBA 1O2LA 2STAE 1AWFH 1J16A 3LKWA 1OXGA 1K1PA 1NRPH 2HRVA 1IQLA 4DT7B 1EUFA 3AAUA 1W8BH 3UNQA 4I8JA 3BTKE 4B2BA 2BDIA 3U1JB 4JZFH 4IC5A 3ZYEA 1IQGA 1CT4E 5C94A 2ZFRH 5JDUB 1FUJA 1BTYA 3KCGH 3UY9A 3UIRA 1C1QA 3M7UA 1MCTA 2F9NA 1AQ7A 4FOUC 3S9CA 5A0BA 3ZZ8A 1B0FA 3E0NB 1O3EA 3GY5A 1O2QA 3A84A 1C1UH 4WVPE 2KCPA 1QZ8A 1LVYA 5JPMH 2PHBA 2H1UA 1Z8GA 4F49A 2RA3A 3TPIZ 3U9AH 2QN5T 3UNRA 1G2MA 3M7QA 4KELA 3STJA 4AB8A 3O8DA 1O3BA 4X1PU 1TWXB 2ZO3H 1V3XA 2ALPA 1HBTH 1L0ZA 3B23B 3U8RH 3CENA 1LPKB 5BPEA 1P05A 1XKBC 1TPPA 3F68H 1OOKB 1O2KA 2A4GA 2O8MA 2XC0A 1ORFA 1DOJA 4ZXXH 5LGOA 1FI8A 2ZHEH 1BTPA 2B8OH 1THRH 1GVKB 1AE8H 4NA7A 2SGPE 1SGPE 3MU1A 1GBJA 1ZPCA 2WV5A 4CREA 3A7WA 4X1RU 1SB1H 1AD8H 4Z6AH 4DIIH 4ACAA 1BRAA 3U1IB 2OQ5A 3UNSA 1O5FH 1GCDA 4JYTA 3F9HA 3T25A 1HAGE 1C2MA 4AZ2B 3SJOA 3TIUA 2BDAA 2J34A 2ZQ2A 1ABJH 1C5OH 1EAIA 1FIZA 1BRUP 1OYQA 3MNXA 1SGFG 2ANYA 1Y8TA 3L3TA 3KGPA 3ESTA 5I25A 4NIYA 2P94A 1GMDG 1CSOE 1V2OT 1WAYB 2ZNKH 2C4FH 4B6EA 3DA9B 3RXDA 1O5AB 1C1TA 2OQUA 5HGGA 3N7OA 1FMGA 4K5ZA 1A7SA 2IJOB 1EJAA 1T7CA 2KCYA 1NN6A 2F4LA 4FUGA 1EZUC 1Y3UA 5FBIA 5C20A 1FV9A 3LT3A 1K1IA 1C1OA 1TRYA 4K60A 5C0UA 4ISOA 5KGOA 1TIOA 3NK8A 1PPCE 3FZDA 1OPHB 2Z3EA 2ZP0H 3T62A 2ZTZA 2HOBA 3JZ2B 2GP9B 2PR3A 2ALVA 3PLBA 3LU9B 4U32A 4AC9A 1UCYK 2R3YA 4JZDH 5DK1A 3S7HB 3IWMA 1C5TA 1MUEB 3A82A 1ELFA 3PV5A 4UD9H 2VGCC 2IN2A 1FAXA 4RKOB 1K28D 4ISNA 1K22H 2WPMS 3W95A 2Z9KA 4JK5A 3U28C 1G32B 3FKSD 2XCFA 1LVBA 1RTKA 4BTIB 4AGJA 2SGAA 1DX5M 5CHAB 2G5VA 3S9BA 2FMJA 3OTJE 1VJAU 4Q7YA 1TLDA 3LC3A 5CE1A 2FM2A 2O8TA 3TJUA 1SFQB 1OP0A 1LHFH 2ZGHA 4ZHLU 1HJAC 4D9RA 6ESTA 4YESB 5DN6D 2Z94A 1GHAF 1SLVB 2Y5HA 1H9IE 3ZZBA 3H7TA 3OY6U 1EKBB 3L6PA 1DWEH 1ANCA 2B0FA 1O5BB 4DOQA 3RXTA 3SV7A 1YCPM 4BXSA 4OS1A 1C1MA 1JMOH 1V2WT 4NFEA 1QRZA 1SG8B 1BQYA 1XXFA 5HKKD 4E05H 3RXOA 3D49H 4J1YA 2CJIA 6GCHG 1CT2E 1KLJH 1Y3WA 4WY3A 2F43B 1TAWA 4DT4A 3FP8E 1DITH 1TBQH 2OC1A 5ABWA 5C17A 5SGAE 1BMFD 3OX7U 4B6FA 2ZECA 5TCCA 1BB0B 1EAWA 2ZA5A 1WTGH 1L1GA 1ZSLA 2WPLS 1YLDA 2AEIH 3TITA 4UONA 1T8MA 3RMNH 4FUJA 3AW0A 2V0BA 1YLNA 1W3CA 4Y11E 4ZH8A 3HKJB 5HM9A 2ZCKP 3MI4A 4JZEH 1C5UA 1GBKA 1Z7KA 3RXLA 1VR1H 4M9FA 1ZTLA 2UUJB 1MKWH 1O3OA 3SU2A 2ZZUH 4KGAA 1GBFA 1Z1JA 2BD2A 3VGCB 3M36A 1O2IA 1NRQH 3K6ZA 1GHYH 2AIQA 3V0XA 3U8TH 2A7HA 3ZVGA 5EJZA 2TBSA 3KQCA 4MG3A 4XE4A 4YOJA 2JDID 4CRDA 5EOKA 1GI5A 2BD7A 1LQEA 4YLUA 5EQRA 4A1VA 5A8YA 6LPRA 5EPYA 1HUTH 3AASA 3SU6A 3T26A 2FI5E 2OC7A 4HG6A 5HXFA 2LP6A 1FZZA 1NFUA 1N8OB 2WYGA 5EQSA 4FUFA 1NPMA 1GI6A 1TQ0B 5CDFE 2RG3A 1GVLA 1KDQA 1QTFA 2IPQX 1E1RD 1Q31A 1GGDC 2Y6TA 1H9HE 3OEHD 4ABIA 3UUZA 3ZZDA 3CP7A 1B0EA 3QGNB 3SI3H 1UTMA 5EW1H 3GISB 4TT3D 1J8AA 1O3AA 2BZ6H 2QF0A 1VCPA 1D3PB 3UAIC 3T29A 3WW7A 3V7TA 1LVMA 3LJOA 2ZTYA 1HAHH 4J2YB 3QTVH 1G3DA 1GI8B 5ETXA 1ANEA 4A1XA 1GI2A 2G8TA 1C1NA 1S5SA 4UFGH 4CHAC 1O3KA 3ZYDA 1V2UT 1NROH 3NXPA 5L30H 5GIBA 4O3TA 2FZZA 5AVDA 1MKXK 1RTFB 1YCPK 3SU5A 2CXVA 1BMMH 3GCHB 4B76A 1ESBA 2Z6BD 3K9XB 1A5IA 1EPTC 4Y7BA 3RDZA 2H2ZA 1UTNA 5HMAA 4Y76A 1FONA 3EA8A 2QV1A 4OM9A 2GDEH 2A5KA 2OLGA 2C8XB 1SGEE 1E37B 2EQNA 2F3CE 2ASUB 4BOHA 2KAIB 2ZHDA 4YT7H 1RRKA 1NT1A 2IJD1 5I46H 2ZHQH 2OC0A 4AX9H 2M5TA 8ESTE 3ZVCA 4TPYA 1G37A 3QO6A 4HFPB 4YM9A 1GJBB 1O2YA 3VEQB 4GLYA 1DXPA 4WMEA 3V13A 1C5LH 2JH6D 1GMDF 1MD7A 1SGCA 1CHOG 2EI8A 1IOEA 2VINA 3GCTF 4XBDA 2BXUH 4XD7D 2C8ZB 1RXPA 4B74A 2WPHS 4XRNA 4K8BA 4ABEA 3CS7A 6CHAB 4A1TA 2VWOA 2NU3E 4NIWA 4X8UH 3TU7H 1S6FA 2IPHA 2BDCA 1TOMH 2ZGBH 4MNYA 3RXHA 4LK4A 4X2WA 2ZU5A 1T32A 1CA0C 4X1QU 4Q2KA 2FOFA 2AMDA 3OSYA 3BTEE 1C5XB 1LQDB 1O2PA 2VVVA 1GJ4H 2GMTC 3LH1A 4A7IB 3HGPA 1RJXB 4FUHA 2Z7FE 3SNBA 4NWKA 1F5LA 3DSPA 1ZJKA 2OD3B 1QNJA 1MAYA 1G9IE 4SGAE 3VB6A 1W0YH 2SNVA 3S9AA 3GCHC 2GJGA 1A4WH 1HJAB 1QL7A 3A7YA 2LPRA 3P8OA 4JYVH 1LHCH 3BV9B 1ACBE 3AW1A 4ABAA 2V7QD 2VWLA 1O3JA 1TPSA 3UOUA 1TYNA 1TA6A 1P2NA 6CHAC 2P93A 2H9EH 1WXRA 4CR5A 1O2ZA 2YMSC 3SO3A 2ZKSA 1D4PB 3N99A 4NSVA 4WWYA 3SW2B 1OWJA 1C1PA 1PQ5A 2C90B 3HPTB 3OEED 2BDBA 1V6DA 4NIXA 1P3EA 2P95A 2R2MB 2GCHF 3BIVH 1ELBA 1V2ST 2H6MA 3UB0A 2FTLE 2Y7XA 4WF8A 5LH8A 1BTWA 2ESTE 1T4UH 1GBBA 3RXFA 2FTMA 2ZDKA 3KYGA 1ELCA 1DSTA 1SGRE 1O5GH 4K1EA 3W94A 3UWJH 3FOAA 2ZCHP 1S82A 2WPJS 4MQAA 1MTUA 5JBTA 2BYAX 3OFND 3TH3H 1KTTB 4IC6A 1E0FD 1NY22 2BX4A 3PLKA 2CK3D 3CS0A 5GCHF 4ABHA 1S0QA 1SLWB 2XNDD 3BTWE 4WXVA 1AVXA 1O2JA 1OWEA 3BTHE 4IMQA 1E1QD 3ZZAA 5EXLA 2SGDE 1KIGH 1YPEH 2GV7A 1BMAA 3Q3YA 2WHXA 4HGCA 2WPIS 3SI4H 2F9UA 1AUTC 2BDHA 3LOXA 2KFWA 8LPRA 1PFXC 2B7DH 2PGBB 1WUNH 3F6UH 3QZRA 2ZG0H 1GI3A 3LIWA 1QBNA 3ZVDA 5DP7A 1PPGE 3MNBA 1ZHRA 2XW9A 2RCEA 1V2MT 4BTTB 5EW2H 3VGCC 2R2WU 1P3CA 3ZZ4A 1F0RA 2HLCA 1G3CA 3BTFE 4FXGH 4MNVA 4WJG2 3H5CB 2PKSB 1ELAA 1YPGH 2ZDMA 4O3UA 1O3CA 2IOTA 2QCYA 4PROA 5F03A 2FYRA 1BTHH 1XVMA 2Y5FA 4E7NA 3H09A 1SHYA 3G01A 1BZXE 2TRMA 8GCHF 1C1SA 3GY7A 3QTOH 5JB8S 1J15A 3LGTA 3R0FA 1NTPA 1MU6B 4UEHH 2BDYA 4ABJA 4DW2U 4FETA 1BIOA 4AGKA 1YC0A 1V2QT 3LONA 1A3BH 2OP9A 3KQEA 1HCGA 1O2XA 2JKHA 2J9NA 3VXEH 4VGCC 2D1JA 1NRSH 1N1LA 1RS0A 1EPTA 2FI4E 1W0KD 9LPRA 4BAHB 3SGBE 3A89A 2QE7D 3GYMA 1YBWA 2J98A 1QJ1B 2WPDD 1E79D 2WYJA 4K3JA 1TGSZ 1COWD 3DD2H 2BLOA 1D9IA 3UOPA 3MU8A 2GT8A 3ATIA 3VB7A 1YKTA 3RC4A 4NA8A 1ZOMA 2FP7B 1U6QA 4YLQH 1UVUH 3HKIB 1XUIA 1D6WA 5CHAC 4D7GA 1NESE 1CGHA 4X2VA 1FXYA 1HAOH 4Y71A 3RXPA 4F48B 1LKBA 1GJ8B 2VVUA 2VIDA 5KECA 5J4QA 1V2VT 2WV4A 2PUXB 1H1BA 1AKSB 1F0UA 1O2MA 1QA7A 2BY8X 2XBWA 1TNGA 4KKDA 1MKXH 3A88A 5EPNA 4GHTA 3B9FH 3SJKA 3M5NA 4FU8A 2CF9H 4X1NU 1C9PA 1SGYE 4CH2B 1WQSA 3A8CA 2ZFFH 2SGEE 1FX0B 1BA8B 2H5CA 3ZZ3A 3UQVA 2RA0A 1UCYH 1FPHH 1C1VH 3RXEA 1OX1A 2HNTE 4RN6A 2FODA 4YZUA 3NUMA 3SU4A 3QK1A 4F55A 3GOVB 2ZFSA 4JZIA 1N6YA 2ANKH 4YTAA 1TBRH 2A31A 1KLIH 2SFAA 2YNAA 2ZTXA 1W0ZU 1FNIA 2QYIA 4RKJB 1PQ7A 1QIXB 3A80A 4UE7H 3WWFA 4TWYA 2BVSH 4CHAB 1HYLA 3Q3XA 3MO6A 1WYKA 4Z0KA 3RU4T 1AZZA 5AFYH 3BF6H 2M2AA 1MBMA 1UMAH 3BTQE 2EY4C 1AVGH 1F92A 1O3GA 4TSFD 3ATKA 3ATWA 1NRRH 2BOKA 2BTCE 1TGBA 5GCHG 4CBOA 5JBAS 1S81A 2ZF0H 1DPOA 2UUKB 1DY9A 1UHBA 1O2SA 2FLRH 2THFB 2WUCA 1P57B 1CA0B 5FBEA 1WDIA 4KP0A 2QXGA 2GV6A 4MNWA 1FJSA 2TGAA 2XNIA 5C0TA 3QUMP 1FLEE 2BZAA 1GDUA 4ISHH 2VU8E 1H8DH 2V6NA 1T8NA 1RTLA 1SI5H 2VIVA 3MH6A 4UFFH 1LVOA 2XRCA 1EB1H 1HAZB 1UJ1A 3QLPH 2BQ7B 1CO7E 1TRNA 2P3FH 1NO9H 1C2EA 1O2TA 2VIQA 1GHXH 1A0JA 3K65B 1QHRB 5AF9H 1GWAA 4HI3A 1TONA 2GCHG 1TNHA 4Q7XA 3F2FA 2J2UA 4Q7ZA 1DT2A 2XBYA 1F7ZA 1GHBF 3PM3A 1P12E 2HWLB 2Z9LA 1QA0A 1OS8A 1IQFA 4ESTE 3TK9A 1T8LA 1ZRKA 1C5SA 1HXEH 2W6ID 3ATMA 1AUJA 1GBCA 2W6JD 1L4ZA 1V2JT 1MTNC 1S84A 1LCYA 4K2YA 5C1XA 2W7UA 2XWAA 1PPBH 3PWCA 1GJCB 4Z1MD 1BHXF 2ULLA 2G5NA 1EATA 2FOCA 1A61H 3LGUA 1V2PT 4R8TB 1PQ8A 4MNXA 1ELDE 4H6SB 1W14U 4ZROA 5EXMA 1SGQE 4IS5A 1HAVA 1UVSH 3SU1A 5GWZA 1FAKH 1TNLA 2XC4A 4AORA 3GICB 1FIWA 2D26C 1HGTH 1O35A 2ZHFH 4TWWA 1C2GA 4ACBA 4AFSA 2BHGA 1GG6C 5DKMA 3U69H 1OHHD 1K1OA 2P3UB 1P2JA 2KCAA 2RDEA 2YMSB 3KQBA 1RGQA 3ITIA 4X2YA 1AB9B 3OAAD 4AN7A 1D3TB 2AIPA 1OWDA 1O3DA 3O8CA 2CGAA 2Z9JA 1XX9A 1TNKA 5FL7D 5HM2A 1ID5H 4ZXYH 1QQUA 5C5OA 1E34B 2F9OA 5L6NH 3MHWU 4SGBE 1ZZZA 4HZHA 1ANBA 1MBQA 3SV2H 2EEKA 3M7TA 2Q6GA 1TX7A 1S6HA 3FAOA 3RXAA 2O9QA 1C2HA 1QFKH 2FS9A 4IGDA 1TA2A 1YCPH 2A1DB 1NU7B
chains in the Genus database with same CATH topology
2XWBI 3BTDE 1GBIA 3KHVA 4X6PA 1A3EH 1BT7A 2A2XH 2PSXA 2FLBH 4GHQA 3VB5A 2Q1JA 4ISLA 1RIWB 5F8XA 3ZZCA 3E8LA 1SGFA 1ZGVA 1QR3E 2F83A 1OWHA 2ZDAH 1WCZA 4BNRA 1EJMA 1YP9A 1GHWH 1O5EH 3GY2A 1TNIA 1FY1A 2W3IA 1XUFA 1AU8A 2AS9A 2ZPQA 2VNTA 3MO3A 2AGGX 4NSYA 2HPPH 1D3DB 4ABFA 1GG6B 3ZZ9A 3SUGA 1C5YB 1V2NT 3GY8A 3HATH 4K1TA 2OBOA 5DP4A 1CGJE 1Z8JB 1EASA 9ESTA 3TJVA 1FY8E 2ZU2A 2GVFA 5C67A 1PYTC 5ESBA 1UTJA 2VWMA 5E0GA 3MO9A 4RSPA 1JRTA 3BN9A 1BMNH 2KAIA 2QIQA 2P16A 1KYNA 2Y7ZA 2F9VA 5FAHA 1NC6A 1ZLRA 5JBCS 3RXJA 1DUEA 5GPIB 1T8OA 2P8OB 5FCRA 1GBDA 1A0HB 2FXRA 3SORA 4K8YA 3I29A 2EI6A 3A86A 1GMHG 2HGTH 1D3QB 1MTVA 3GY3A 3SUFA 1IQKA 2DE9A 5E0HA 4XBCA 5E2OA 7GCHF 2BLVA 1JIRA 1TX6A 2AERH 4H4FA 4X0WU 2R9PA 3DFLA 3FANA 2G4TA 1P01A 2GCTB 1UVOA 7ESTE 4XSKU 3EAJA 1TABE 1K9OE 1QJ6B 4AOQA 2QXHA 1IHSH 3RUOA 1QURH 2NU2E 3A87A 1F0SA 4JMYA 2BLWA 3A7TA 3SU3A 2AMPA 2W7SA 3MH7A 3U8OH 4ZUHA 4WXIA 1O31A 1IQNA 1E38B 1BBRE 2PWXA 4LXBH 2ZDNA 4NFFA 2P59A 3RM2H 3RXUA 2WINI 1GI1A 1TNJA 2VVCA 4I33A 5IDKA 3KL6A 1P03A 1FN8A 1XKAC 1SSXA 1EZXC 5HYOA 2A7CA 4IMZA 4UFDH 1TGNA 5DGJA 4YT6H 1OWKA 2DE8A 1O3LA 1V2LT 1SPJA 2STBE 4CRBA 2AGEX 1EAXA 1C4Y2 3SV9A 1ARCA 2TPIZ 1PPZA 4BXWA 1QB1A 3NPSA 5LPFA 1UK2A 3NZIA 2GMTB 4INKA 1W13U 2VIPA 2BY5X 3S7KB 2YOLA 1AFEH 1Z8RA 1CE5A 2GTBA 3URDA 1C2JA 3PO1B 3QZQA 3RXRA 1UVPA 4KTUA 1GI0A 1O32A 1OP2A 4LOYH 1J17T 1ELVA 3MOCA 3GCOA 2FO9A 1GMCG 1BITA 1CBWB 3PMBB 2B5TB 2FI3E 2PGQB 2FOMB 3C27B 3MNSA 1Y5UT 2ZFTA 3RP2A 5EODA 3I78A 5GJ4B 2GCTC 1BCUH 3EA9A 4GPGA 2BXTH 3RXKA 2UUYA 1GHZA 1M9UA 1ABIH 3EYDA 2FOBA 2OTVA 3FP7E 2H9HA 2G00A 4LZ1H 2C8YB 5TJXA 5FPSA 4BANB 4TPIZ 8GCHG 1SQTA 1TGCA 4GCHG 4H6TA 5EU8A 1GJDB 3OU0A 3SJ8A 1EX3A 3UQOA 3D65E 3C1KA 4D76A 2PKSC 1TFXA 3GY6A 2J92A 2P8OC 3FP6E 1SMFE 2J38A 3TH2H 5DP5A 3TGIE 1HAPH 2CHAC 4AG1A 5DO4H 1AO5A 3A8BA 2PTNA 2A5IA 1Y5BT 2WPKS 1A2CH 2A45B 3F9EA 3R3GB 1N6XA 4H42U 1P10A 3ZZ7A 4FVDA 2QXJA 2ZGXH 3BSQA 3E3TA 1P8VC 2ODQA 1SGDE 4GVUA 2VIOA 4QT8C 1G36A 2Z3DA 1AB9C 2W3KA 1O2NA 2VB0A 2ZDLA 3MH5A 1WSSH 4I8KA 1UO6A 3URCA 1GCTB 2HPQH 4OS5A 5GXPA 1EOJA 1TE0A 2TGPZ 1P02A 3PROA 4K1SA 3LPRA 3V12A 1QJ7B 4M7GA 1Y3XA 3PMAB 1UTLM 1ZPBA 4I8GA 2I6SA 2GZ7A 3LH3A 1G3EA 1NU9A 5B6OA 4THNH 3TJNA 1KXDA 3RLWH 1DICA 5EG4A 4ABGA 1Y3YA 2JETC 2ZWLH 4OGYA 4D7FA 1PPHE 1PPFE 3A8AA 3SN8A 3ZZ5A 4A92A 2Q6FA 1GJ5H 1DANH 3EE0B 3A85A 1P2IA 3UR9A 4INLA 2P3TB 1EAUA 2CHAB 1SGIB 1C5NH 2ZQ1A 1ZSKA 1CHOF 3GCTG 3KIDU 3SHCH 1BTUA 4FUEA 3ZVBA 2Z9GA 1BRCE 1JBUH 1J9CH 1L1NA 4F4OC 3DHKH 1W11U 2FDAA 2TGTA 1Z6JH 3SNAA 4A6LA 1DLKB 1NZQH 2SGQE 1ZSJA 3MTYA 4MTBA 4O03A 2J95A 3RMLH 3GY4A 2BVRH 4YOIA 2PW8H 4ZKOU 7LPRA 1HAXB 2QGRA 3E16B 4AFQA 2TGDA 1ZHMA 1P04A 2Y5GA 2D8WA 3HGNA 1ZR0A 3GDSA 4MPXA 4NWLA 2BLQA 8KME2 5DP3A 2V35A 4TYDA 1YLCA 2C3SA 1FY5A 2ZHWH 1LPZB 4BTUB 1K21H 2QY0B 1SFIA 3LJJA 3SUEA 1L4DA 1MAXA 1JOUB 1O33A 3SBKA 3KNXA 4KTCA 4IN2A 4NGAH 1DS2E 1UTPA 2EA3A 3SZNA 1S85A 1J14A 4IW4E 1VCQA 3H7OA 3A83A 1H8IH 1EOLA 3MWIU 1MTSA 1QRXA 3P8FA 1O3PB 1SGNE 4TY6A 3F9FA 2FIRH 2ZC9H 4X8SH 3SUDA 4TY7A 3MH4A 2ZEBA 3QX5H 3QDZB 1O2WA 4DURA 1Y59T 4DCDA 3LGWA 1HJ9A 2FOEA 1WBGB 4FUCA 1O2HA 1P9SA 1SBWA 2GKVE 3M37A 1ETSH 1QY6A 4AFZA 2HVXA 2J4IA 1VITH 4ZHAA 1C9TA 2QF3A 5C3NA 4CBNA 1UK3A 1A46H 1W7XH 1ELEE 1MKWK 3FZZA 4A5TS 1O3FA 1RFNA 1HB0B 2ZIQH 4DY7B 3ODDA 1OYTH 2PKAA 1F2SE 2HALA 2XC5A 3D62A 5FPYA 3DFJA 3QWCH 4E06H 5TCAA 1CU1A 2AH4X 1L2EA 3BEIB 1EJNA 4MPVA 1DWCH 4UDWH 1SQOA 1V2KT 3V3MA 3M3VA 1ZYOA 1TQ7B 5EXNA 3KF2A 1KDQB 1C5PA 3RC5A 1SLUB 4I32A 4XDEA 1AMHA 1SC8U 4CR9A 2AMQA 5FX5A 1C2LA 1NFYA 2WUBA 3K6YA 4Y0ZE 1SVPA 1C5VA 3BTME 3TGKE 5G4BA 4FU7A 3T5FH 1GBLA 1TOCB 1DWBH 2QAAA 1JIMA 2H5DA 1IQEA 1O3IA 1YPLH 1BJVA 3P8GA 1DXWA 3RXMA 1OWIA 2F9PA 1FDPA 1TBZH 3S0NA 3SOSA 2GT7A 1C2KA 4DG4A 1O36A 1QRWA 3E90B 2FEQH 2HNTF 1BRBE 3BG8A 3A7ZA 4IN1A 1O5CB 4LZ4B 1TX8A 3M61U 1TRMA 1DVAH 1UK4A 3Q00A 1AFQB 5E2PA 1IQJA 1GCTC 4NCYA 3RMOH 1S83A 3ZZ6A 4GAWA 5C1YA 4B1TA 1P2MA 1AY6H 2A4QA 1ANDA 6GCHF 1GI9B 1BBRH 2XCNA 1AN1E 3RXVA 4CRCA 1A0LA 5L2YH 1SOTA 1KTSB 1K1MA 1CBWC 1N8OC 2K1QA 5C5NA 2AFQB 1W2KH 5A8XA 2B9LA 4ZKSU 3GDVA 1YYY1 3O8RA 1QBVH 2QA9E 2ZGJA 3PTNA 1P2OA 1WOFA 1O2OA 3P92A 3RXSA 1UTOA 3TLOA 2ZI2H 1SGTA 1AE5A 1AIXH 1IHTH 3M5MA 3M3TA 1BOQA 3S69A 1XM1A 3PMHB 2UWLA 1NS3A 1VGCC 3HK6B 5LPEA 2BQWB 1ZMLA 3RXGA 3RXQA 2ZFQH 1C2IA 3SNCA 3PLPA 4JZ1A 1O0DH 4B71A 5GDSH 3ENSB 4BAQB 4K69A 2GGVB 2BVXH 3SHAH 2VWNA 4X6OA 3DT0H 1P09A 4OS2A 3A81A 2NWNA 4CRGA 1YPKH 1B5GH 3JZ1B 1AI8H 2R0KA 2GD4B 1C5QA 1IAUA 4Y0YE 2G52A 2G4UA 1QB6A 2XYAA 1P06A 1G30B 1Z1IA 5AFZH 4WH8A 5DP6A 3UWIA 3Q76A 4JCNA 1YM0A 2ILNA 2I6QA 4JK6A 1CGIE 4WMFA 3LDXH 1HLTH 1V2RT 2NU0E 4DIHH 3EQ0H 2ZU1A 5F6MA 2BD4A 4B73A 3F9GA 2BM2A 3T2NA 2FX4A 2BOHB 1SHHB 5FX6A 1G3BA 4WMDA 1LHDH 1C5ZB 1P11E 1C4V2 2BD9A 2ZFPH 3GYLB 1GBHA 2FPZA 5EGMA 1DE7H 1BTXA 1E36B 1Q2WA 3BTTE 1AVWA 4Y8XA 1QB9A 2W26A 3PWBA 5CMXH 5T6FA 3BEUA 1XMNB 2GX4A 2BB4A 1C1RA 1UTKA 1QCPA 1UVTH 3RXIA 3RLYH 2PKAB 4DJZB 4CRAA 1EZSC 3SGQE 1GBAA 3BTGE 1XVOA 2FESH 2A0QB 1AGJA 3RM0H 1YPMH 3E6PH 1MQ5A 1SLXB 2XBVA 4ISIH 1GBEA 3SNEA 4AYYB 1HAYB 4GUXA 1WU1A 1KXEA 1VGCB 2ODYB 1O37A 1O5DH 3P8NA 1B7XB 2OCVB 1MTNB 1MZDA 1TMTH 3E91A 4Y8ZA 4DVAU 2PSYA 4U2WA 1A5HA 1GPZA 2GDDA 4KTSA 4FUIA 2EC9H 1P2QA 1F5KU 1DM4B 1UHBB 1H4WA 3SQHE 5EQQA 1ZMNA 3Q3KA 1C2FA 1YF4A 4Y8YA 2AYWA 1CHGA 1O3HA 3LGYA 2Y82A 2A7JA 2NU1E 3QN7A 5DG6A 2FOAA 1YGCH 2QXIA 3IITA 1GJ6A 5T6GA 3SGAE 1C2DA 5C1UA 1GJ9B 3B8JA 1L1JA 3MU4A 1HV7A 3T28A 4X2XA 3RU4E 1CA8B 1AZ8A 2QC2A 1TALA 1DFPA 3ODFA 2FOHA 1YPHC 2O8WA 3MU0A 2W5EA 1IQIA 1FQ3A 3VB3A 2LNCA 4OGXA 2V3HH 3UPEA 5J4SA 1GMCF 4ZKRU 2A2QH 4I8LA 2VIWA 4OS6A 1O30A 3EA7A 2A4RA 5FXLA 4NZLA 2CN0H 4ZAEA 1YPHE 2BX3A 2C8WB 1KXBA 3GDUA 5IYTA 1ARBA 2ZPSA 4VGCB 1HFDA 1TGTA 4IBLH 1C1WH 1PQAA 1K1LA 4Y10E 3TVJB 5A0CA 3TNSA 3SU0A 1MD8A 1O39A 4MPUA 5K0HA 2EI7A 2GZ9A 1KXFA 2O8UA 3PYHA 1LHEH 3F1SB 4OS7A 4U30A 1ZMJA 1ZTJA 3RU4D 2O8LA 3PB1E 1LO6A 1ZPZA 2Z3CA 1BTZA 1CQQA 7KMEH 2J94A 1P2KA 1LPGB 1IQMA 1TB6H 4FVBA 1VITG 5DPAA 1NFWA 3PTBA 4O97A 2A5AA 2R3UA 3EGKH 5BRRE 3RXCA 1XXDA 1KLTA 2OXSA 2V3OH 2OC8A 5F8ZA 1PYTD 3M35A 3TNTA 2SNWA 4NG9H 1BHXB 2ZGCA 3O8BA 1NM6A 1E35B 1XUJA 4NIVA 1O2RA 4BAKB 1QBOA 1O34A 4JYUH 4Q80A 3ATLA 1GVZA 2XTTB 2BD5A 2ANMH 2PV9B 3EDXB 1KY9A 1LHGH 1KXAA 2PTCE 3TK5A 1P9UA 3HK3B 2OINA 4NZQA 3TJOA 1EPTB 1K1JA 3BG4B 4XBBA 1FN6A 2TIOA 3MU5A 1C5RA 2ZDVH 1ZJDA 1GGDB 3ZVEA 1HIAB 1GL1A 3UREA 1Y3VA 3UR6A 3D23A 2BDGA 4X8VH 1HNEE 1RIWC 3P17H 1KSNA 4AFUA 5FCKA 1EP5A 4I31A 3MYWA 1C5WB 1F5RA 4WH6A 5F8TA 3WY8A 3RXBA 3ZVFA 2ZU4A 1AFQC 4BAOB 1ETTH 3RC6A 4ASHA 5A8ZA 1AHTH 1OSSA 3IG6B 3SNDA 3E0PB 4INHA 1DUAA 1TPAE 3P70B 4B2AA 1CVWH 1JWTA 2D2DA 1SQAA 2AGIX 2BY7X 1BMLA 1K2I1 3KQDA 3A8DA 3DUXH 5FHTA 2A4OA 1DDJA 1TPOA 4ABDA 3TGJE 2YNBA 4X1SU 4XFQA 4CH8B 2F91A 4X6MA 1VJ9U 1C4U2 1O2VA 3NWUA 3P6ZB 3QGJA 1Z8IB 3Q77A 4GSOA 3M5OA 5JYIA 3I77A 2Z9IA 4Y79A 1S0RA 1THPB 1C5MD 3NCLA 5DP9A 2G51A 1EZQA 4HTCH 2RDLA 3SV8A 7GCHG 1MQ6A 4E7RG 4UFEH 1OKXA 4U01A 1LTOA 3MFJA 4XOJA 1Y5AT 4ZHMU 4ZKNU 4MVNA 1MZAA 3LGIA 3LGVA 1O2UA 1QL8A 1WQVH 1LDTT 1ESAA 2ODPA 1X7AC 2CF8H 1A5GH 4DGJA 5E0JA 2DUCA 2JETB 3SJ9A 1T31A 1FPCH 3BIUH 1XUKA 1EP6A 2VJ1A 3PV4A 1RD3B 1PJPA 3SV6A 3A7XA 3MMGA 1SL3A 2BQ6B 3VFEA 1LMWB 1A1RA 4AYVB 1HPGA 1SOZA 1UCYE 5JB9S 1FY4A 1K1NA 3A7VA 5AHGH 1GBTA 1GJAB 1XUHA 2A32A 3M3SA 4AG2A 5T6DA 2ZU3A 1Z6EA 2PFEA 4FU9A 4CRFA 1BBRK 1JRSA 1GL0E 1VZQH 1NRNH 3OY5U 4BAMB 1INCA 1HIAA 1BUIA 1KXCA 3ELAH 1O3MA 2F9BH 4MPWA 4B75A 2Q6DA 2G55A 3ZVAA 3NKKA 3TK6A 1GMHF 3AVZA 2VH6A 2ANWA 5FPTA 3ZV9A 4FUBA 2OUAA 1DLEA 1GI4A 3M5LA 3PMJA 3GCNA 2ZPRA 4AB9A 5JBBS 1DY8A 1Z71A 3TH4H 1GBMA 1HAVB 2XXLA 1ESTA 4YO9A 1TMUH 1IQHA 1HJ8A 1ZGIA 2VGCB 2Y80A 3K2UA 1P0SH 1HXFH 3VXFH 1FY3A 5PTPA 4R0IA 1MH0A 1AWHB 1YPJH 5ESTE 1HAIH 1GHAG 1TMBH 2FOGA 4Y7AA 1DWDH 2C93B 1NFXA 1ZTKA 1GDQA 1G2LA 5DP8A 2JH0D 3ZV8A 4X8TH 1JXPA 1EB2A 3MNCA