1HAZB

Snapshots of serine protease catalysis: (c) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 9 for 1 minute
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Snapshots of Serine Protease Catalysis Reveal a Tetrahedral Intermediate
pubmed doi rcsb
molecule tags Serine proteinase/hydrolase substrate
molecule keywords BETA-CASOMORPHIN-7
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hazB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hazB01
1O5GH 4KP0A 1VZQH 1MKWK 4JZ1A 1DVAH 1MTVA 1Y59T 3ZVBA 2ZQ1A 1QTFA 1SBWA 2F9VA 3HK6B 4CH8B 3LONA 3GYMA 4OS1A 1C5UA 2ZTYA 3M5OA 3W94A 1Y5BT 2PHBA 1LVOA 1IQHA 3VB5A 1RIWB 1SLXB 2ILNA 1K9OE 1O5FH 3Q00A 1TYNA 2O9QA 2ZDAH 2FYQA 3A7WA 3ESTA 4ZKRU 3QTOH 1SLUB 2FTLE 4A1VA 1KLIH 1XUFA 5E2PA 1V6DA 2BM2A 4X1SU 1AKSA 2W7SA 2M5TA 3RXUA 5F03A 4VGCB 4ZMAH 1GBLA 2BLWA 3FP6E 1A61H 1K1NA 2Q1JA 2VVCA 1BIOA 3RXQA 1K1JA 3QZQA 1EJMA 4ISHH 4KTSA 4E05H 4Q7YA 3TH4H 3FFGA 4NIWA 2G51A 2VWOA 1VGCC 4A92A 1BJVA 1ABJH 3HKJB 4IMZA 1EB1H 2A1DB 1BTWA 2BDAA 1LQDB 3M3VA 1FPHH 2G4TA 3ZVAA 1EATA 5ABWA 4MTBA 2P3TB 4O03A 1O2NA 5GPIB 4K1SA 1O0DH 4WF8A 4BAMB 3Q3YA 3EA9A 1FAKH 2HNTF 2VU8E 1J17T 2AMDA 4CH2B 1FY3A 4I8KA 1ZTLA 4ZKOU 1T8OA 2W3IA 4DCDA 3SV7A 1EPTA 4Y0YE 1ZR0A 2CHAC 3EAJA 3JZ2B 4LOYH 3GICB 3M5NA 3GCNA 2EEKA 2IN2A 1PPBH 1OX1A 3H7TA 1OYQA 3RXBA 5A8XA 1AB9B 1AZ8A 4CRFA 5FPSA 1C5RA 1ZHRA 1O3CA 2OQ5A 3BTME 1P2OA 3I29A 3SNEA 5L30H 3RXTA 2BDYA 1BJUA 1NROH 4U30A 1L4DA 1S5SA 1MD7A 3Q76A 3QN7A 4JK5A 1NRRH 4NA8A 3GCHB 3FP7E 4Q7XA 1TX8A 2UUKB 1QL8A 2W5EA 3AW1A 1P2MA 1K21H 1GMCG 1LKBA 2FMJA 4FXGH 3PYHA 3PM3A 2GT8A 1CA0C 1P04A 2XRCA 3MFJA 3TGKE 2B0FA 2PSYA 1EZUC 3GY7A 3DUXH 2O8UA 3H7OA 1O39A 2IOTA 1MKXH 5A0AE 1A0LA 1V2LT 1C9TA 1P2JA 1O2GH 5HM9A 1SFQB 1A2CH 1TPSA 5A0CA 1MAXA 1RIWC 3RMOH 3HPTB 3UY9A 2Z3CA 4OGYA 4JYUH 4AGKA 1UHBB 1YPGH 1ZPCA 2DE8A 4H6SB 3LH1A 1F7ZA 3N7OA 3BG4C 3SJ8A 2PKSB 1FUJA 3STIA 2ZDLA 2CJIA 3QZRA 4IN2A 3UNRA 1XXFA 4VGCC 1EASA 1PQ8A 2F9UA 1W3CA 5HYOA 1G2MA 1C2KA 4U2WA 3SU4A 1EP5A 3FP8E 1GHBF 4AFQA 5DP9A 3RXHA 2VIDA 3ZZCA 3F9HA 1O3IA 1H9IE 3A7XA 3VGCC 1BTXA 1PFXC 4AB9A 2FOHA 2VGCC 3A7VA 3HGPA 4CREA 4BTUB 6ESTA 4O9VA 2GMTC 1UCYK 1TOCB 1CVWH 1HJAC 1HJ8A 1YYY1 4INLA 1HAOH 2O8LA 4X1RU 1M9UA 3OYPA 4IW4E 5DJ7A 4B2AA 4WMFA 3RXSA 1O2OA 1WSSH 1C5OH 2OC7A 2VWLA 1GGDB 4NG9H 2FZZA 5F8TA 2FI3E 5DP7A 4HI3A 1G3BA 1AE5A 3M35A 3SNDA 1FV9A 1A5GH 1ESBA 1V2ST 2BD9A 2FWWA 5AF9H 3SUEA 4FU8A 2JETB 4H4FA 1UTQA 4RN6A 4D7FA 1KYNA 1RGQA 4YT6H 5E0GA 3S9BA 4WWYA 1DY9A 2GDDA 2VH6A 3BIVH 2QY0B 2PUXB 2VVUA 1C4U2 2BDCA 2SFAA 1K1OA 4WMEA 2P3FH 1EUFA 2BD2A 1QB6A 1GJ9B 3Q3XA 1ZLRA 4CR9A 2NU3E 1ZHPA 1O5EH 1J14A 1HUTH 4U32A 2FXRA 1N8OB 4UE7H 1O5DH 4IMQA 1HLTH 2EC9H 3A85A 1EB2A 1LO6A 1FNIA 4NA9H 1ABIH 2UUJB 4WH6A 1W7GH 1V2NT 2BOKA 2BX3A 1ZPZA 3M36A 1UK2A 4OS2A 2ULLA 1W11U 1E0FD 1KXBA 4QT8C 3RM2H 2XXLA 1L4ZA 2KAIA 2CV3A 1S83A 1INCA 5EU8A 4Y79A 1Z7KA 1SQTA 4AZ2B 2PGQB 1HJ9A 2PKSC 1TRMA 1PPCE 4I8HA 2BZ6H 2ZO3H 2XBYA 4X0WU 3M7TA 1D3TB 1F0SA 1GWAA 5B6OA 2C8XB 2OCVB 1SVPA 2ESTE 3T26A 1DFPA 1YC0A 1A5HA 2PLXA 2BDHA 1N1LA 4D9QA 2GDEH 2OD3B 2W7UA 1RXPA 1QBOA 5EPYA 4ABBA 1G32B 3TJOA 4B71A 3K6YA 1E38B 1MTWA 3SU1A 1UVUH 3NCLA 3BTGE 3BTEE 3LC5A 4I8GA 1SPJA 1FY8E 2FESH 1W7XH 2A7HA 2ZWLH 3QGNB 1TE0A 1ZGIA 5TJXA 3MI4A 5DK1A 2FO9A 3MYWA 1DWDH 5BPEA 2H5CA 1EAIA 1C1PA 2VNTA 1LMWB 3MOCA 1GI6A 1KLTA 4I33A 4UD9H 3ZVGA 4Y0ZE 1Q31A 2HGTH 3TGJE 4Y6DA 3VXEH 1EP6A 1JOUB 2ZHQH 2A2QH 1BRAA 2ANYA 1TQ7B 3ATWA 1SQAA 1L1NA 1J15A 1K1PA 3TVJB 4AGJA 4X2WA 1CBWC 1O2RA 3GY4A 1DICA 3BTTE 2V6NA 3SJOA 1LHGH 1O3PB 2OLGA 4MPWA 1QB9A 4JZIA 3FZZA 1SGNE 1MZAA 1XVOA 2C3SA 3GDSA 4ZROA 3IITA 1P09A 1OWKA 5FX5A 3RMLH 1GBEA 2UWLA 1GHXH 1ZRKA 1NU9A 5JPMH 1A0HB 2AMQA 2FOAA 3F1SB 1V2OT 3UPEA 3P92A 2FEQH 3W95A 3PTNA 1HAYB 4ABIA 2JH0D 2ZIQH 3RXEA 4ZUHA 3VGCB 3KHVA 1BTYA 3E1XB 3MO9A 2AFQB 1S81A 1DT2A 1ORFA 1QCPA 2G8TA 5JBAS 2C8YB 2TGTA 3SU0A 1O2WA 3A80A 1DUEA 3GY6A 1UHBA 5FBEA 2XBXA 1D6RA 1MBMA 2SNVA 2TRMA 1DWBH 2QC2A 1A3BH 2QAAA 1O33A 3UR6A 1V2UT 3SHAH 2ZHFH 3FANA 1GBJA 3DD2H 1OYTH 5HMAA 1PYTC 6CHAC 1F2SE 3BV9B 1YPKH 3E0NB 4DT7B 1XUJA 2VWNA 4K8YA 5C1XA 3GY2A 1DLKB 1DY8A 1MTNC 3GISB 1NFUA 1IQKA 1AE8H 4NIVA 2GZ8A 1DSTA 5DO4H 1SC8U 2ALVA 3A8CA 1F0TA 3P8NA 1O2HA 1GMHG 1O3HA 2AGEX 2JETC 3P70B 4YM9A 1QJ1B 1C2FA 1F5KU 2SGQE 2HOBA 3A7YA 1KTTB 4FUIA 5F8ZA 1EX3A 2G4UA 3PMBB 4U01A 3RXIA 1HPGA 1V2WT 5CE1A 2Y81A 2XCNA 1AUTC 1BRUP 1O2PA 3NXPA 1XUKA 3M5MA 3A8DA 1ELVA 1V2KT 4JZDH 1NS3A 3MU0A 2VJ1A 2WV4A 1S82A 1P3EA 1BBRH 1T4UH 3MO3A 2Z9GA 3SQEE 3ZZ7A 2Y82A 1H9LB 4ISNA 1WBGB 4A7IB 7KMEH 3TK9A 1S84A 1G36A 1TNLA 4CBNA 1LVMA 4CRGA 2SNWA 4O97A 2AIQA 4ZHLU 3NUMA 1KDQA 3SORA 1AWFH 1NFXA 2A5IA 2HVXA 1C5MD 2F3CE 3M37A 4PROA 4ZXYH 1T8NA 4UDWH 3V3MA 4X6PA 3LGVA 4MNWA 4AYYB 3WY8A 3M5LA 4AB8A 2ZCHP 3P8GA 2GD4B 1QL9A 1D3PB 3ATKA 2BMGB 5EXMA 3F9EA 1THSH 5GCHG 1YKTA 1IQFA 1P9UA 1ZMNA 3GOVB 1ZSKA 5CMXH 5FXLA 1C1WH 1GBBA 3LGIA 4ZKNU 3SU6A 1ZTKA 1BDAA 1O5BB 1P2KA 3GY3A 1H8DH 3SI3H 2PTCE 1FQ3A 1EJAA 2C90B 1LHFH 2ZFRH 4MDSA 1T4VH 2ZQ2A 1Z6EA 5EPNA 1WUNH 2GZ9A 1W0YH 2ZCKP 1HB0B 1HIAB 2ZNKH 3TNSA 2BZAA 1LPKB 2AMPA 4F4OC 2Y80A 3P8OA 3RXOA 6GCHG 5EXNA 3LKWA 2VWMA 4Q7ZA 4BAKB 5EOKA 3S7HB 2H1UA 2PWXA 1QL7A 5H4IB 1ANDA 2TGAA 1GJCB 1UCYH 1GI8B 4WXVA 1TRNA 1GHAG 1O2ZA 4JYVH 5FAHA 4ISOA 2ZU2A 3RC4A 1YLDA 3D23A 2BTCE 3SGBE 2BQWB 1OXGA 3SZNA 2UUFB 3UUZA 1C5LH 2NU4E 3PTBA 5A8YA 1AN1E 3BTWE 3L3TA 3VB7A 5C20A 3BIUH 1O2YA 4JK6A 4LZ4B 6LPRA 1G2LA 3QK1A 2AEIH 2AYWA 4HTCH 1HDTH 4NCYA 5T3HA 5HXFA 1GVLA 5A2MH 1TNKA 1ELFA 1LVBA 1PQ5A 2HLCA 1HGTH 1IOEA 2V3HH 1O2SA 2GCHF 3EQ0H 5TCAA 1CQQA 1O3EA 5K0HA 2FPZA 1GBHA 8ESTE 1CBWB 1GDUA 1D3QB 1X7AC 2PR3A 5JBCS 1C5TA 1NESE 2WPIS 2P94A 1XKAC 2R3YA 2P95A 4AN7A 3GDUA 2QXGA 4FU9A 2HNTC 5JBTA 1B0FA 1GVZA 2PSXA 1WOFA 4FUHA 4ASHA 1IQMA 4Y71A 1PPGE 3ZZ9A 1A0JA 1G3EA 1Q2WA 6GCHF 4BAQB 3KQCA 1W13U 2BQ7B 1ETSH 3E90B 1TNGA 5DP4A 3SI4H 1CO7E 3ZV8A 3TGIE 1A7SA 1DANH 1Z1IA 2XC4A 3E0PB 4TWYA 3BTDE 1NRSH 1V2MT 2A7JA 1O5CB 4OGXA 4BANB 1UTMA 2D2DA 4FUEA 1SOZA 1D9IA 1GHWH 1UTNA 3RDZA 4NWKA 1FLEE 1F0RA 2ZA5A 3GCTG 1HAVB 2TBSA 4X1NU 2ANMH 2OQUA 2I6QA 1AWHB 1GBIA 1MQ6A 1V2JT 1A5IA 2OBQA 3UIRA 1THRH 3GY5A 4AG1A 5FCKA 1UVSH 4Y8YA 1GI1A 1O3LA 1DXWA 5C3NA 1O2MA 2LPRA 2BOHB 4I32A 1EZSC 4JZFH 3ITIA 3GCTF 2F9OA 2RG3A 4D9RA 1WAYB 4MPVA 3OY5U 3VEQB 3M7QA 2D26C 3ZZDA 2ANWA 2P8OC 3H5CB 2Z9IA 2ZGBH 1XX9A 4ESTE 2R9PA 2O8MA 1LPZB 2WUBA 2ANKH 4GHQA 4NFEA 3MU1A 3ZZBA 5LPFA 1G9IE 2GV7A 3C27B 2TGDA 3S7KB 3SBKA 3TIUA 1F92A 3EDXB 3RU4T 1D3DB 1YF4A 4KTUA 1L2EA 2WPJS 4TY7A 4WMDA 3SJ9A 4K1EA 1ZOMA 1TMUH 2VIPA 2ASUB 1EQ9A 2B5TB 1QJ7B 1TB6H 4FUJA 4B75A 1GJ5H 5FPTA 1P01A 2B7DH 1A46H 4DG4A 5GWZA 4FUGA 1NRNH 1BZXE 3TNTA 1GJ6A 1O2UA 2OC1A 1FI8A 2VIOA 1LTOA 3RUOA 2BY9X 1ZSLA 2BY5X 1C5VA 1RD3B 3KN2A 1BTUA 2A4RA 1A1RA 1GMHF 1UK3A 2PGBB 3BG4B 3VB6A 4FUBA 5PTPA 1BCUH 4GVUA 4X2XA 2H9HA 1GBAA 1MCVA 1YCPM 1C5ZB 1CSOE 2XBVA 2ZDKA 1CE5A 1Y3XA 1UTLM 4X8SH 5LGOA 1ELEE 1WTGH 2BD5A 4XBDA 5A0BA 1C2MA 3R3GB 1O38A 1YGCH 2BQ6B 4DIHH 3LGTA 4K3JA 4JMYA 4X2YA 3UTUH 3PMJA 1V2QT 2Y6TA 1NC6A 1V2VT 2A31A 2BB4A 1HAZB 2BVSH 3LPRA 4R0IA 3NKKA 3ZZ8A 1P02A 2QN5T 2SGDE 4CBOA 4IS5A 3DFJA 1TMTH 4NA7A 1EAUA 1WYKA 1AMHA 4WVPE 4Y76A 1C5QA 3TJNA 3ATMA 3MH5A 1EXFA 1DE7H 1DDJA 5A09A 3T29A 1Y5UT 2WV5A 1QB1A 3O8BA 4AX9H 1GBFA 1C1QA 3Q77A 1HFDA 4XBBA 2ZDNA 3BSQA 5HM2A 2B9LA 1FJSA 2Z6BD 2FOEA 3ZYDA 1FDPA 2F9NA 4E7NA 2FIRH 1LPGB 3MNCA 2PV9B 2V35A 4BOHA 3A84A 1XUIA 3V7TA 1Z8RA 1UO6A 3SJKA 1XUHA 2ZC9H 2H9TH 1E35B 1FONA 1NU7B 1ZMJA 4X6OA 2Y5HA 4WXIA 2OTVA 1O2VA 3SU5A 3B8JA 4BXSA 1N8OC 3RU4D 1Y3WA 1CHOF 5ETXA 2JH5D 3NK8A 4DURA 1P06A 3RXPA 2A0QB 1LHCH 1VR1H 2BDGA 4D8NA 1HAPH 2AGIX 1C1UH 4IN1A 2XWBI 5L2YH 4ZHAA 1QRXA 3K65B 3QTVH 4IGDA 1IQLA 4ZHMU 2ZG0H 3HKIB 3BN9A 3ZVDA 4K1TA 2H2ZA 1RTFB 4Y7BA 1BBRK 3KL6A 4I31A 1MTUA 3RU4E 1EZXC 1XVMA 1Z1JA 1L1GA 2RA3A 2FX6A 2OUAA 4BAOB 4AFUA 1O2JA 2V0BA 3P17H 3SU2A 1C2IA 4ABGA 1PQAA 2ZGHA 5L2ZH 4MPUA 2GP9B 1TPPA 1S85A 2XBWA 2Q6DA 2EA3A 4IBLH 3JZ1B 1F5RA 1TNHA 5J4QA 3KQBA 1S6FA 4INHA 2OINA 2BY8X 4MNXA 1SOTA 5TCCA 1ZZZA 2XTTB 3KNXA 5I25A 3KIDU 3KF2A 3PMAB 3RXGA 3BG8A 1TBQH 2I6SA 1T32A 3EA7A 2QCYA 2FOMB 2EI8A 1IAUA 1P05A 3SO3A 4DVAU 2ZFQH 1KTSB 1Z8GA 1H1BA 1Z8JB 1W12U 3BF6H 1DUAA 2BYAX 1SGEE 3I77A 4FVDA 1GI3A 1QBVH 4HFPB 1C9PA 4Y11E 2R0KA 1WQVH 1YP9A 2FI5E 3D49H 2BXTH 1MD8A 4OS7A 1TGTA 1O37A 1RJXB 1TIOA 3KEEA 4NGAH 1VITG 1LDTT 4H42U 5IYTA 1UTJA 3K2UA 1V2PT 3RXLA 3FZDA 2ALPA 1VCWA 3TJUA 1GHBG 3ZVEA 4X8UH 1J16A 3MU5A 4O3TA 2QF0A 1Z71A 4X1QU 4Y10E 2BD4A 1W0ZU 2LNCA 3GCOA 2PUQH 1C4V2 1ELTA 5FHTA 3SU3A 1GHZA 3BEIB 1BHXF 2OC8A 1T7CA 4XDEA 3PV4A 3R0FA 3PROA 1BRBE 3IWMA 4GAWA 8LPRA 4IC6A 2PFEA 3V0XA 5FBIA 2BY6X 3DA9B 3ZZ5A 3STJA 1AFQC 3A82A 3LDXH 2ZCLP 4XE4A 2GT7A 4NZQA 4YLQH 1Y3VA 1CA8B 1JBUH 3AAVA 1MAYA 4YO9A 3OTJE 5AFYH 4ZXXH 1NPMA 2CXVA 1Z8IB 3A83A 1C2EA 4KGAA 1LKAA 4NWLA 3RXCA 2QV1A 5ESTE 1JMOH 1ETTH 3RC5A 3RXKA 4ABDA 3ZZ6A 1P10A 2ZTZA 1DX5M 1BTHH 2BVXH 1GI9B 6CHAB 3LGUA 1KXAA 4CRDA 1UJ1A 2PW8H 1O35A 2GCHG 3QGJA 4OS5A 2FDAA 1G3DA 1GHYH 1MTNB 1SGYE 1KY9A 1O3JA 2WYJA 4KKDA 3U8RH 3C1KA 1O3OA 1TFXA 1SHHB 1YCPH 3VB3A 1XXDA 4Y8ZA 2ZDVH 3OY6U 3K9XB 4DW2U 3ATLA 2XC5A 1F5LA 2ZGJA 1QURH 3A89A 3EE0B 3TK5A 2P59A 3B9FH 2BVRH 3A87A 1GI5A 2FLBH 2HPQH 1K1MA 5T6DA 2PKAB 4UFDH 1B5GH 4NIYA 3KCGH 2ZFPH 3P8FA 1GI7B 2DE9A 2R0LA 1CU1A 4MG3A 1C5XB 3ENSB 4XFQA 2J95A 1Y3YA 3VXFH 9LPRA 1GI2A 2FTMA 2R2WU 1GHVH 2G00A 3S9AA 1FMGA 1P11E 1GMCF 4FUDA 3U69H 2Q6GA 3O8DA 4MLFB 2GTBA 3PO1B 1P03A 2BHGA 1AKSB 4Z0KA 3E8LA 3RM0H 5EQSA 5LPEA 1JXPA 1SGFG 5EGMA 3UQOA 1SB1H 1KSNA 3MTYA 4Y8XA 1AIXH 2G55A 3SV8A 4CHAC 3RP2A 4ZKSU 1K28D 2ZDMA 5K7RA 1QQ4A 2AIPA 4NSYA 1NO9H 4J1YA 5LH8A 2G52A 2Y5GA 2ZKSA 3SJIA 3LOXA 3KQEA 1FIZA 4TWWA 3TH3H 1ARBA 1PJPA 1TGCA 2Y5FA 1GCDA 3K6ZA 1AVGH 1AHTH 1BT7A 4MNYA 2ODYB 1VJ9U 5E0JA 1WQSA 3S69A 2ZGXH 2GKVE 2FLRH 1C5NH 1QY6A 3U8OH 1VJAU 1T8MA 4B2BA 3UREA 3RXMA 3A88A 3UR9A 2ZU1A 3A81A 1CT0E 3RXVA 1TALA 4I8LA 2Z94A 4CRAA 3KQDA 1MUEB 4X8VH 1AGJA 4X8TH 3T5FH 3Q3KA 1E36B 5T6GA 1T8LA 3F6UH 2CMYA 2WUCA 2GMTB 3GDVA 2ZGCA 2ZU3A 1HJAB 2R3UA 3RXRA 4GPGA 4HZHA 3B23B 4RKOB 1MCTA 1GCTC 4KELA 1QBNA 2R2MB 3T28A 4UONA 1MMJN 2A5KA 1O30A 3DHKH 3MNXA 1KXCA 3ATIA 4UEHH 2UWPA 1GPZA 1O2LA 1JWTA 3G01A 2ZTXA 3RXFA 3O8CA 1UTOA 4F49A 1C1MA 3BTFE 3PWCA 4XBCA 4O3UA 1ANCA 1LHEH 5DGJA 1P3CA 1O32A 1SLWB 1PPFE 1W14U 2WPHS 4E7RG 5A8ZA 1FAXA 1O2KA 3AAUA 3M3SA 1YPHC 3M61U 1AFEH 4NZLA 4B1TA 1SQOA 2FOCA 2Z7FE 3UNSA 1Z6JH 1G37A 2A5AA 2EI6A 2O8WA 2OP9A 7GCHF 5T6FA 2XCFA 3TK6A 4I8JA 4I7YH 3FVFB 1QGFA 1TGBA 1SGQE 5JB9S 1YM0A 1QNJA 3RXJA 1IHTH 2SGEE 1W2KH 3PO1C 5E8EH 4JCNA 1FZZA 3RMMH 2VIWA 4K2YA 2ZI2H 3HGNA 1C1RA 3RXAA 3RXDA 2FS9A 2QGRA 2BD8A 2CF9H 3F9GA 5DPAA 1FIWA 5DP6A 3RLYH 1C1OA 1HIAA 1O3BA 2A32A 2FX4A 3KGPA 3EA8A 4BNRA 2A45B 4X6NA 1O3GA 5JDUB 3PLBA 5EG4A 2NU0E 2GGVB 1TOMH 3SV2H 1KDQB 1B7XB 2FM2A 2GCTB 3TITA 3UQVA 2BXUH 2Q6FA 4XOJA 1AY6H 2BY7X 1ZHMA 5CHAC 5GDSH 1HAHH 5FPYA 4AYVB 1XMNB 2STAE 1O36A 1S6HA 4B73A 4YZUA 2RA0A 3U8TH 4JZEH 3ZVFA 4CRCA 4NFFA 1ZTJA 2ZPQA 1C2DA 2GZ7A 3S0NA 1HAVA 1MQ5A 1WU1A 1ZJDA 2J34A 2ZHDA 2CGAA 4A1TA 1ZGVA 1GL0E 2RCEA 2P16A 3QLPH 3SGQE 1ELDE 4AORA 1VCPA 3MWIU 1OOKB 1J8AA 4IC5A 1EOJA 1NN6A 1V3XA 4MNVA 5G4BA 5SGAE 1BHXB 4R8TB 1TGNA 1NRPH 2A4OA 1GI4A 1BQYA 1XM1A 1GBDA 3PLPA 1KLJH 1TBZH 2BX4A 1JRSA 1FY1A 4AG2A 1DXPA 1C1SA 3MU8A 4MQAA 2XYAA 1FPCH 2H9EH 1GG6C 2W26A 4AFSA 1ID5H 2XNIA 4BTIB 1C5YB 1IQJA 1OS8A 3I78A 5EXLA 2IPHA 3S9CA 1G30B 1NT1A 3A8BA 1O2QA 2A2XH 2ZEBA 5EW2H 4LZ1H 1H8IH 4ABEA 3BTHE 2D8WA 3D65E 4BTTB 1HYLA 1UVOA 4UFGH 2HWLB 1GVKB 2G81E 4GUXA 4Q2KA 2CF8H 2J38A 4CHAB 1GJBB 4ABHA 1NTPA 1HV7A 4SGBE 4ABAA 1XKBC 1OP2A 1ZSJA 5C67A 1ZJKA 1TMBH 5L6NH 2ZFSA 1YPMH 1GDNA 1SI5H 2BD7A 4DJZB 3MHWU 4TY6A 3LGWA 4CR5A 1JIMA 1QQUA 1EKBB 1UK4A 3VPKA 3M7UA 3PB1E 4INKA 2ZP0H 4D76A 3LJOA 1AUJA 1BTPA 1LQEA 1O3AA 1C5PA 1OSSA 1TQ0B 3QX5H 3CP7A 4J2YB 3PWBA 4YTAA 2ZF0H 1WCZA 1RTKA 1OKXA 1A3EH 4K8BA 1YPJH 5C1YA 5JBBS 3ZZ3A 1ESTA 4K60A 3SN8A 4K69A 3BTKE 5J4SA 1QFKH 1SHYA 1UTPA 1HBTH 3O8RA 1O3MA 1VITH 1O2TA 1EPTB 3MNSA 1TPAE 2CN0H 1GJAB 1VGCB 2ZFTA 2EI7A 1W8BH 5AVDA 5E2OA 2AH4X 1GBMA 1MKXK 1NY22 3F68H 1G3CA 2C8ZB 1GJ4H 1NZQH 1MH0A 1UVTH 3A7ZA 5CHAB 1JIRA 2ZU5A 1OWEA 1SGFA 2A4GA 2YOLA 2QIQA 1WV7H 1TLDA 1O34A 2RDLA 2YNBA 3A8AA 2P3UB 1CHGA 3RLWH 1VITF 2UWOA 1THPB 1TABE 1L1JA 1Q3XA 4NSVA 2YNAA 1ESAA 1O3DA 4Q80A 4GHTA 1EAXA 1GBTA 2QXIA 2ZU4A 3U98H 5DG6A 2HALA 1TRYA 1OP0A 3OSYA 2NU2E 1ARCA 2VINA 1TAWA 1FN8A 3MH4A 3SNCA 2PTNA 1YBWA 5AHGH 1P57B 1ANEA 1LVYA 1CHOG 2IJOB 2VVVA 2JH6D 2ZPSA 1SG8B 1LHDH 1SR5C 1BMMH 1GMDF 3CENA 3NZIA 1MZDA 1TWXB 2NU1E 1W10U 2Y7ZA 1IQEA 1OPHB 1V2TT 5C1UA 2AGGX 4D7GA 3U1JB 2AS9A 1ZPBA 3LH3A 3CS7A 2ZZUH 4DGJA 1RRKA 3D62A 1H9HE 1F0UA 1QRWA 1O3NA 4E06H 1ANBA 2DUCA 2JKHA 1NM6A 2VIVA 2Z9KA 1NRQH 2F91A 1DWCH 4YT7H 5EQQA 1TBRH 1BTZA 3NPSA 1AU8A 4Z6AH 1SGIB 1RFNA 2SGPE 3DT0H 1QA0A 1AZZA 3BEFB 1D6WA 2B8OH 1UCYE 1FXYA 2OBOA 2ODQA 1QRZA 4FVBA 5JB8S 5F8XA 2GCTC 3T25A 3LT3A 4MPXA 5GCHF 4YESB 5EODA 3UWJH 2A4QA 3TH2H 3BEUA 1E34B 2QXHA 2ZFFH 1SFIA 1Y3UA 2C8WB 1Y8TA 1OWDA 1D4PB 2KAIB 2Y7XA 3OX7U 5LPRA 3SUFA 1O31A 1L0ZA 1YPEH 8KME2 3E6PH 1TX6A 1AVXA 1K1LA 1P12E 1J9CH 1KXFA 2QXJA 4X2VA 1DLEA 3ZV9A 3CS0A 1TGSZ 1KXDA 1O5AB 1SGRE 2HRVA 2Z3DA 2XC0A 1O3KA 3QO6A 3UOPA 1ELCA 4TYDA 2QYIA 3URDA 4ABJA 1TX7A 1SGDE 3TJVA 1OWHA 2WPLS 2D1JA 3GY8A 1P8VC 1GGDC 1OP8A 3HATH 3SUGA 3TPIZ 1K22H 4B2CA 1B0EA 3ZYEA 1HXEH 2OC0A 1SGCA 2FOGA 4NIXA 5JYIA 3A7TA 3HK3B 4H6TA 3EYDA 2J9NA 4DY7B 4XSKU 1BBRE 2FI4E 1BA8B 1AFQB 3GYLB 5E0HA 3PMHB 3RMNH 2ODPA 5HGGA 5GIBA 3ELAH 3QDZB 1UVPA 4MVNA 2Z3EA 2QA9E 1CGJE 4TPIZ 3SW2B 1ELAA 3UFAA 1PPHE 3MH6A 3ZZ4A 4DOQA 1GHAF 5C2ZA 1DOJA 2GV6A 4FUCA 4THNH 3TU7H 1OWIA 1HXFH 2J94A 1P2IA 1H4WA 2H6MA 1SGTA 1C2GA 1EPTC 2BLOA 2GX4A 1AVWA 2J2UA 1QA7A 4JYTA 7ESTE 3M3TA 7GCHG 4YOJA 1XUGA 2F9PA 4LK4A 4SGAE 1FN6A 4ISLA 4B74A 1GL1A 2GVFA 1WTHD 2ZHEH 1DS2E 2O8TA 2WPKS 1NFWA 1DM4B 2P8OB 1CGIE 2FOFA 3U9AH 1MTSA 3F9FA 4ABFA 2BDIA 4ZAEA 1C1NA 2BDBA 3AASA 3SGAE 2VH0A 1BOQA 1C1VH 1GBCA 1Y5AT 4UFFH 3E3TA 1TA2A 3T27A 4RSPA 1AI8H 1RTLA 3SHCH 4TPYA 1N6XA 1QIXB 3EGKH 2C93B 1S0QA 3OU0A 1KXEA 1DITH 4LXBH 4ZH8A 4OS4A 3SOSA 3VFEA 3SNBA 1UMAH 2TPIZ 4ISIH 1BMAA 1BITA 5FCRA 1C4Y2 2WINI 2ZECA 3UNQA 2W3KA 1CT4E 1SSXA 1SLVB 4FUFA 1PYTD 1UTKA 1GI0A 1HAGE 2NWNA 4X6MA 2XWAA 3QUMP 4GLYA 4A1XA 1HAXB 3ODFA 1NFYA 3AVZA 2VIQA 2HPPH 1FY5A 1EJNA 5C5OA 1LCYA 3MNBA 3MH7A 3UOUA 2FYRA 3L6PA 1AD8H 3T2NA 1MU8B 1O2XA 1QR3E 3P6ZB 2UUYA 2FODA 1GMDG 4Y7AA 1MU6B 1IQNA 9ESTA 1V2RT 2FS8A 2HNTE 2WYGA 1TA6A 3LU9B 5EQRA 2QF3A 3SV9A 3SNAA 7LPRA 2BLQA 5I46H 1SGPE 1GDQA 3SV6A 1YPLH 3V13A 4GSOA 5IDKA 1SMFE 1TPOA 1DSUA 5DKMA 4BAHB 2J92A 3URCA 3ODDA 1A4WH 2FOBA 1AQ7A 3E16B 3LIWA 1C5SA 3PLKA 1AO5A 1O2IA 3FAOA 1JRTA 1TNIA 1BMNH 4HGCA 2ZPRA 1K2I1 1GCTB 1IQGA 1E37B 4UFEH 2Z9JA 4AFZA 5EW1H 3AW0A 4WJG2 1P2NA 2CHAB 3SUDA 5ESBA 3ZZAA 2XW9A 2K1QA 4BXWA 2SGAA 1QHRB 5DP3A 1AB9C 2G5VA 3P95A 5F6MA 1TNJA 4A5TS 3BTQE 1TONA 4WH8A 5C5NA 1SL3A 5DP5A 8GCHG 4AOQA 1P9SA 4OS6A 5BRRE 2BD3A 1GBKA 2V3OH 4X1PU 1MKWH 2F9BH 1ELBA 1N6YA 4M7GA 2OXSA 1ZMLA 3E91A 2SGFE 1CA0B 1DWEH 2J4IA 1BMLA 3QWCH 3ZVCA 1HAIH 1CGHA 1CT2E 1YLCA 4B76A 2FP7B 1C5WB 1EAWA 4YOIA 1DPOA 4DIIH 1EZQA 3V12A 2Z9LA 4FU7A 1P2QA 3MMGA 5GJ4B 2STBE 2TGPZ 3IG6B 1FY4A 2P93A 1HRTH 3A86A 1QJ6B 3UWIA 1BUIA 4A6LA 1GJDB 5DP8A 3LC3A 2TIOA 1P0SH 5FX6A 1RS0A 1ACBE 1C1TA 1GJ7B 4YLUA 1S0RA 2A7CA 1C2HA 1KIGH 1T31A 3U1IB 1C2JA 1GJ8B 1PPZA 5AFZH 3DFLA 1YPHE 3VB4A 1HCGA 1U6QA 1IQIA 3SQHE 2ZHWH 1YCPK 1HNEE 4GCHG 1EOLA 4K5ZA 4YOGA 2AERH 1PPEE 2H5DA 4CRBA 1IHSH 2BLVA 1OWJA 2VGCB 3T62A 3L33A 2VB0A 2G5NA 4KTCA 1ELGA 4RKJB 3NWUA 2THFB 1K1IA 2C4FH 1ZRBA 1MBQA 4WY3A 1VCQA 3GCHC 5GXPA 2F83A 1GG6B 8GCHF 1ETRH 4GCHF 1O3FA 1PQ7A 3MO6A 1BRCE 3MU4A 3LJJA 1ZYOA 2PKAA 2WPMS 3RC6A 3TLOA 3LGYA 1C2LA 1BB0B
chains in the Genus database with same CATH superfamily
1O5GH 4KP0A 1VZQH 1MKWK 4JZ1A 1H8HD 1DVAH 1MTVA 1Y59T 3ZVBA 2ZQ1A 1QTFA 1SBWA 2F9VA 3HK6B 4CH8B 3LONA 3GYMA 4OS1A 1C5UA 2ZTYA 3M5OA 3W94A 4Z1MD 1Y5BT 2PHBA 4ASUD 1LVOA 1IQHA 3VB5A 1RIWB 1SLXB 2ILNA 1K9OE 3NRLA 1O5FH 3Q00A 1TYNA 2O9QA 2ZDAH 2J98B 2FYQA 3A7WA 3ESTA 4ZKRU 3QTOH 1SLUB 2FTLE 4A1VA 1KLIH 1XUFA 5E2PA 1V6DA 2BM2A 4X1SU 4I86A 1AKSA 2W7SA 2M5TA 3RXUA 5F03A 4VGCB 4ZMAH 1GBLA 2BLWA 3F0OA 3FP6E 1A61H 1K1NA 2Q1JA 2VVCA 1BIOA 1OHHD 3RXQA 1K1JA 3QZQA 1EJMA 4ISHH 4KTSA 4E05H 2KZ4A 4Q7YA 3TH4H 3FFGA 4NIWA 2HVYB 2G51A 2VWOA 1VGCC 4A92A 1BJVA 1ABJH 3HKJB 4IMZA 1EB1H 2A1DB 1BTWA 2BDAA 1LQDB 3M3VA 1FPHH 2G4TA 3ZVAA 1EATA 5ABWA 4MTBA 2P3TB 4O03A 1O2NA 5GPIB 4K1SA 1O0DH 4WF8A 4BAMB 3Q3YA 3EA9A 1FAKH 2HNTF 2VU8E 1J17T 1E79D 2AMDA 2K8IA 4CH2B 1FY3A 4I8KA 1ZTLA 4ZKOU 1T8OA 2W3IA 4DCDA 3SV7A 1EPTA 4Y0YE 1ZR0A 2CHAC 3EAJA 3JZ2B 4LOYH 3GICB 3M5NA 3GCNA 2EEKA 2IN2A 1PPBH 1OX1A 3H7TA 1OYQA 5T1VA 3RXBA 5A8XA 1AB9B 1AZ8A 4CRFA 5FPSA 1C5RA 1ZHRA 1O3CA 2OQ5A 3BTME 1P2OA 3I29A 3SNEA 5L30H 3RXTA 2BDYA 1BJUA 1NROH 4U30A 1L4DA 1S5SA 1MD7A 3Q76A 3QN7A 4JK5A 1NRRH 4NA8A 3GCHB 3FP7E 4Q7XA 1TX8A 2UUKB 1QL8A 2W5EA 3AW1A 1P2MA 1K21H 1GMCG 5EJZA 1LKBA 2FMJA 4FXGH 3PYHA 3PM3A 2GT8A 1CA0C 1COWD 1P04A 2XRCA 3MFJA 3TGKE 2B0FA 2PSYA 1EZUC 3GY7A 3DUXH 2KCPA 2O8UA 3H7OA 1O39A 2IOTA 1MKXH 5A0AE 1A0LA 1V2LT 1C9TA 1P2JA 1O2GH 5C17A 5HM9A 1SFQB 1A2CH 1TPSA 5A0CA 1MAXA 1RIWC 2LP6A 3RMOH 3HPTB 4Q63A 3UY9A 2Z3CA 4OGYA 4JYUH 4AGKA 1UHBB 1YPGH 1ZPCA 2DE8A 4H6SB 3LH1A 1F7ZA 3N7OA 3BG4C 3SJ8A 2PKSB 1FUJA 3STIA 2ZDLA 2CJIA 3QZRA 4IN2A 3UNRA 1XXFA 4VGCC 1EASA 1PQ8A 4M9FA 2F9UA 1W3CA 5HYOA 1G2MA 1C2KA 4U2WA 3SU4A 1EP5A 3FP8E 1GHBF 4AFQA 5DP9A 3RXHA 2VIDA 3ZZCA 3F9HA 4B6EA 1O3IA 1H9IE 3A7XA 3VGCC 1BTXA 1PFXC 4AB9A 2FOHA 2VGCC 3A7VA 3HGPA 4CREA 4BTUB 6ESTA 4O9VA 2GMTC 2XOKD 1UCYK 1TOCB 5FL7D 1CVWH 1HJAC 1HJ8A 1YYY1 4INLA 1HAOH 2O8LA 4X1RU 1M9UA 3OYPA 4IW4E 5DJ7A 4B2AA 4WMFA 3RXSA 1O2OA 1WSSH 1C5OH 2OC7A 2VWLA 1GGDB 4NG9H 2FZZA 5F8TA 2FI3E 5DP7A 4HI3A 1G3BA 1AE5A 5EJLA 3M35A 3SNDA 1FV9A 1A5GH 1ESBA 1V2ST 2BD9A 2FWWA 5AF9H 3SUEA 4FU8A 2JETB 4H4FA 1UTQA 4RN6A 4D7FA 1KYNA 1RGQA 4YT6H 5E0GA 3S9BA 4WWYA 1DY9A 2GDDA 2VH6A 3BIVH 2QY0B 2PUXB 1C4U2 1K1OA 2BDCA 2SFAA 2VVUA 4WMEA 2P3FH 1EUFA 2BD2A 1QB6A 1GJ9B 3Q3XA 1ZLRA 4CR9A 2NU3E 1ZHPA 1O5EH 1J14A 1HUTH 4U32A 2FXRA 1N8OB 4UE7H 1O5DH 4IMQA 1HLTH 2EC9H 3A85A 1EB2A 1LO6A 1FNIA 4NA9H 1ABIH 2UUJB 2KM0A 4WH6A 1W7GH 1V2NT 2BOKA 2BX3A 1ZPZA 3M36A 1UK2A 4OS2A 2ULLA 1W11U 1E0FD 1KXBA 4QT8C 3RM2H 4F55A 1L4ZA 2XXLA 3F2FA 2KAIA 2CV3A 1S83A 1INCA 5EU8A 4Y79A 1Z7KA 1SQTA 4AZ2B 2PGQB 1HJ9A 2PKSC 1TRMA 1PPCE 1WXRA 4I8HA 2BZ6H 2ZO3H 2XBYA 4X0WU 3M7TA 1D3TB 1F0SA 1GWAA 5B6OA 2C8XB 2OCVB 1SVPA 2ESTE 3T26A 1DFPA 1YC0A 1A5HA 2PLXA 2BDHA 1N1LA 4D9QA 2GDEH 2OD3B 2W7UA 2JDID 1RXPA 1QBOA 5EPYA 4ABBA 1G32B 3TJOA 3KYFA 3OAAD 4B71A 3K6YA 1E38B 1MTWA 3SU1A 1UVUH 3NCLA 3BTGE 3BTEE 3LC5A 4I8GA 1SPJA 1FY8E 2FESH 1W7XH 2A7HA 3F2GA 2ZWLH 3QGNB 1TE0A 1ZGIA 5TJXA 3MI4A 1NBME 5DK1A 2FO9A 3MYWA 1DWDH 5BPEA 2H5CA 1EAIA 1C1PA 1LMWB 2VNTA 3MOCA 1GI6A 1KLTA 4I33A 4UD9H 3ZVGA 4Y0ZE 1Q31A 2HGTH 3TGJE 4Y6DA 3VXEH 1EP6A 1JOUB 2ZHQH 2A2QH 1BRAA 2ANYA 1TQ7B 3ATWA 1SQAA 1L1NA 1J15A 1K1PA 3TVJB 4AGJA 4X2WA 1CBWC 1O2RA 3GY4A 1DICA 3BTTE 2V6NA 3SJOA 1LHGH 1O3PB 2OLGA 4MPWA 1QB9A 4JZIA 3FZZA 1SGNE 1MZAA 1XVOA 2C3SA 3GDSA 4ZROA 5B6LA 3IITA 1P09A 1OWKA 5FX5A 3RMLH 1GBEA 2UWLA 1GHXH 1ZRKA 1NU9A 5JPMH 1A0HB 2AMQA 2FOAA 3F1SB 1V2OT 3UPEA 3P92A 2FEQH 3W95A 3PTNA 1HAYB 4ABIA 2JH0D 2ZIQH 3RXEA 4ZUHA 5DN6D 3VGCB 3KHVA 1BTYA 3E1XB 3MO9A 2AFQB 1S81A 1DT2A 1ORFA 1QCPA 2G8TA 5JBAS 2C8YB 2TGTA 3SU0A 1O2WA 3A80A 1DUEA 3GY6A 1UHBA 5FBEA 2XBXA 1NBMD 1D6RA 1MBMA 2SNVA 2TRMA 1DWBH 2QC2A 1A3BH 2QAAA 1O33A 3UR6A 1V2UT 3SHAH 2ZHFH 3FANA 1GBJA 3DD2H 1OYTH 5HMAA 1PYTC 6CHAC 2WPDD 1F2SE 3H09A 3BV9B 1YPKH 3E0NB 4DT7B 1XUJA 2VWNA 4K8YA 5C1XA 3GY2A 1DLKB 1DY8A 1MTNC 3GISB 1NFUA 2IJD1 5DSFA 1IQKA 1AE8H 4NIVA 2GZ8A 1DSTA 5DO4H 1SC8U 2ALVA 3A8CA 1F0TA 3P8NA 1O2HA 1GMHG 1O3HA 2AGEX 2EQNA 2JETC 3P70B 1QJ1B 4YM9A 1C2FA 1F5KU 2SGQE 2HOBA 3A7YA 1KTTB 4FUIA 5F8ZA 1EX3A 2G4UA 3PMBB 4U01A 3RXIA 1HPGA 1V2WT 5CE1A 2Y81A 1AUTC 2XCNA 1BRUP 1O2PA 3NXPA 1XUKA 3M5MA 3A8DA 1ELVA 1V2KT 4JZDH 1NS3A 3MU0A 2VJ1A 2WV4A 1S82A 1P3EA 1BBRH 1T4UH 3MO3A 2Z9GA 3SQEE 3ZZ7A 2Y82A 1H9LB 4ISNA 1WBGB 4A7IB 7KMEH 3TK9A 1S84A 1G36A 1TNLA 4CBNA 1LVMA 4CRGA 2SNWA 4O97A 2AIQA 4ZHLU 3NUMA 1KDQA 3SORA 1AWFH 1NFXA 2A5IA 2HVXA 1C5MD 2F3CE 3M37A 4PROA 4ZXYH 1T8NA 4UDWH 3V3MA 4X6PA 3LGVA 4MNWA 4AYYB 3WY8A 3M5LA 4AB8A 2ZCHP 3P8GA 2GD4B 3UB0A 1QL9A 1D3PB 3ATKA 4B6FA 2BMGB 2HLDD 5EXMA 3F9EA 1THSH 5GCHG 1YKTA 1IQFA 1P9UA 1ZMNA 3OEHD 3GOVB 1ZSKA 5CMXH 5FXLA 1C1WH 1GBBA 3LGIA 4ZKNU 3SU6A 2KCOA 1ZTKA 1BDAA 1O5BB 1P2KA 3GY3A 1H8DH 3SI3H 2PTCE 1FQ3A 1EJAA 4TSFD 2C90B 1LHFH 2ZFRH 4MDSA 1T4VH 2ZQ2A 1Z6EA 5EPNA 1WUNH 2GZ9A 1W0YH 2ZCKP 1HB0B 2WV9A 1HIAB 2ZNKH 3TNSA 2BZAA 1LPKB 2AMPA 4F4OC 2Y80A 3P8OA 3RXOA 2VBCA 6GCHG 1EFRD 5EXNA 3LKWA 2VWMA 4Q7ZA 4BAKB 5EOKA 3OEED 3S7HB 2EY4C 2H1UA 1S6LA 3FO8D 2PWXA 2W6ID 1QL7A 5H4IB 1ANDA 2TGAA 1GJCB 1UCYH 1GI8B 4WXVA 1TRNA 1GHAG 1O2ZA 4JYVH 5FAHA 4ISOA 2ZU2A 3RC4A 1YLDA 3D23A 2BTCE 3SGBE 2BQWB 1OXGA 4ZCNA 2QF4A 2UUFB 2GJGA 3SZNA 3UUZA 1C5LH 2NU4E 3PTBA 5A8YA 1AN1E 3BTWE 3L3TA 3VB7A 5C20A 3BIUH 1O2YA 4JK6A 4LZ4B 6LPRA 1G2LA 3QK1A 2AEIH 2AYWA 5GNDA 3SZEA 4HTCH 1HDTH 4NCYA 5T3HA 4F48B 5HXFA 4P02A 1GVLA 5A2MH 1TNKA 1ELFA 1LVBA 4XD7D 1PQ5A 2HLCA 1HGTH 1IOEA 2V3HH 1O2SA 2GCHF 3EQ0H 5TCAA 1CQQA 1O3EA 5K0HA 2FPZA 1GBHA 8ESTE 1CBWB 1E1RD 1GDUA 1D3QB 1X7AC 2PR3A 2W6JD 1C5TA 1NESE 2WPIS 2P94A 5JBCS 1XKAC 2R3YA 2P95A 3PV5A 4AN7A 3WWFA 3GDUA 2QXGA 4FU9A 2HNTC 5JBTA 1B0FA 1GVZA 2PSXA 1WOFA 4FUHA 4ASHA 1IQMA 4Y71A 1PPGE 3ZZ9A 1A0JA 2YMSD 1G3EA 1Q2WA 6GCHF 4BAQB 3KQCA 1W13U 2BQ7B 1ETSH 3E90B 1TNGA 5DP4A 1BMFD 1CO7E 3SI4H 3ZV8A 3TGIE 1A7SA 1DANH 1Z1IA 2XC4A 3E0PB 4TWYA 3BTDE 1NRSH 1V2MT 2A7JA 1O5CB 4OGXA 4BANB 1UTMA 2D2DA 4FUEA 1SOZA 1D9IA 1GHWH 1UTNA 3RDZA 4NWKA 1FLEE 5C94A 1F0RA 2ZA5A 3GCTG 1HAVB 2TBSA 1UW7A 4X1NU 2ANMH 2OQUA 2I6QA 1AWHB 1GBIA 1MQ6A 1V2JT 1A5IA 2OBQA 3UIRA 1THRH 4Q4LA 2L74A 3GY5A 4AG1A 5FCKA 1UVSH 4Y8YA 1GI1A 1O3LA 1DXWA 5C3NA 1O2MA 2LPRA 2BOHB 4I32A 1EZSC 4JZFH 3ITIA 3GCTF 2F9OA 2RG3A 4D9RA 1WAYB 4MPVA 3OY5U 3VEQB 3M7QA 2D26C 3ZZDA 2ANWA 2P8OC 3H5CB 2Z9IA 2ZGBH 1XX9A 4ESTE 2R9PA 2O8MA 1LPZB 2WUBA 2ANKH 4GHQA 4NFEA 3MU1A 3ZZBA 5LPFA 1G9IE 2GV7A 3C27B 2TGDA 3S7KB 3GS9A 3SBKA 3TIUA 1F92A 3EDXB 3RU4T 2J97A 1D3DB 1YF4A 4KTUA 1L2EA 2WPJS 4TY7A 4WMDA 3SJ9A 4K1EA 1ZOMA 1TMUH 2VIPA 2ASUB 1EQ9A 2B5TB 1QJ7B 1TB6H 4FUJA 4B75A 1GJ5H 5FPTA 1P01A 2B7DH 1A46H 4DG4A 5GWZA 4FUGA 1NRNH 3F2HA 1BZXE 3TNTA 2IPQX 1GJ6A 1O2UA 2OC1A 1FI8A 2VIOA 1LTOA 3EE7A 3RUOA 2BY9X 1ZSLA 2BY5X 1C5VA 1RD3B 3KN2A 1BTUA 2A4RA 1A1RA 1GMHF 1UK3A 2PGBB 3BG4B 3VB6A 4FUBA 5PTPA 1BCUH 4GVUA 4X2XA 2H9HA 1GBAA 1MCVA 1YCPM 1C5ZB 1CSOE 2XBVA 2ZDKA 3N7EA 1CE5A 1Y3XA 1UTLM 4X8SH 5LGOA 1WDIA 1ELEE 1WTGH 2BD5A 4XBDA 5A0BA 1C2MA 3R3GB 1O38A 1YGCH 2BQ6B 4DIHH 3LGTA 4K3JA 4JMYA 4X2YA 3UTUH 3PMJA 1V2QT 2Y6TA 1NC6A 2KX4A 1V2VT 2A31A 2BB4A 1HAZB 2BVSH 3LPRA 4R0IA 3NKKA 3ZZ8A 1P02A 2QN5T 2SGDE 5CDFE 4CBOA 4IS5A 3DFJA 2LELA 1TMTH 4NA7A 1EAUA 1WYKA 1AMHA 4WVPE 4Y76A 1C5QA 3TJNA 3ATMA 3MH5A 1EXFA 3PRDA 1DE7H 1DDJA 5A09A 3T29A 1Y5UT 2WV5A 1QB1A 3O8BA 4AX9H 1GBFA 1C1QA 3Q77A 2WZQA 1HFDA 4XBBA 2ZDNA 3BSQA 5HM2A 2B9LA 1FJSA 2Z6BD 2FOEA 3ZYDA 2V7QD 1FDPA 2F9NA 4E7NA 4ACAA 2FIRH 1LPGB 3MNCA 2PV9B 2V35A 4HG6A 5HIYA 4BOHA 3A84A 1XUIA 3V7TA 1Z8RA 1UO6A 3SJKA 1XUHA 2ZC9H 2H9TH 1E35B 1FONA 1NU7B 1ZMJA 4X6OA 2Y5HA 4WXIA 5IK2D 2OTVA 1O2VA 3SU5A 3B8JA 4BXSA 1N8OC 4YXWD 3RU4D 1Y3WA 1CHOF 5ETXA 2JH5D 3NK8A 4DURA 1P06A 3RXPA 2A0QB 3FKSD 1LHCH 1VR1H 2BDGA 4D8NA 1HAPH 2AGIX 2AHME 1C1UH 4IN1A 2XWBI 5L2YH 4ZHAA 1QRXA 3K65B 3QTVH 4IGDA 1IQLA 4ZHMU 2ZG0H 3HKIB 3BN9A 3ZVDA 4K1TA 2H2ZA 1RTFB 4Y7BA 1BBRK 3KL6A 4I31A 1MTUA 3RU4E 1EZXC 1XVMA 1Z1JA 1L1GA 2RA3A 2FX6A 2OUAA 4BAOB 4AFUA 1O2JA 5C0TA 2V0BA 3P17H 3SU2A 1C2IA 4OM9A 4ABGA 1PQAA 2ZGHA 5L2ZH 4MPUA 2GP9B 1TPPA 1S85A 2XBWA 2Q6DA 2EA3A 4IBLH 3JZ1B 1F5RA 1TNHA 5J4QA 3KQBA 1S6FA 4INHA 2OINA 2BY8X 4MNXA 1SOTA 5TCCA 1ZZZA 3ZIAD 2XTTB 3KNXA 5I25A 3KIDU 3KF2A 3PMAB 3RXGA 3BG8A 1TBQH 2I6SA 1T32A 3DSGA 2QCYA 3EA7A 2JJ2D 2FOMB 2EI8A 1IAUA 4P00A 1P05A 3SO3A 4DVAU 2ZFQH 1KTSB 1Z8GA 1H1BA 1Z8JB 1W12U 3BF6H 1DUAA 2BYAX 1SGEE 3I77A 2YMSB 4FVDA 1GI3A 1QBVH 4HFPB 1C9PA 4Y11E 2R0KA 1WQVH 1YP9A 2FI5E 3D49H 2BXTH 1MD8A 4OS7A 1TGTA 5HKKD 1O37A 1RJXB 1TIOA 3KEEA 4NGAH 1VITG 1LDTT 4H42U 5IYTA 1UTJA 3K2UA 1V2PT 3RXLA 3FZDA 2ALPA 1VCWA 3TJUA 1GHBG 3ZVEA 4X8UH 1J16A 3MU5A 4O3TA 2QF0A 1Z71A 4X1QU 4Y10E 2BD4A 1W0ZU 2LNCA 3GCOA 2CK3D 2PUQH 1C4V2 1ELTA 5FHTA 3SU3A 1GHZA 3BEIB 1BHXF 2OC8A 1T7CA 4XDEA 3F0PA 3PV4A 3R0FA 3PROA 1BRBE 3IWMA 4GAWA 8LPRA 4IC6A 2PFEA 3V0XA 5FBIA 2BY6X 3DA9B 3ZZ5A 3STJA 1AFQC 3A82A 2OK5A 3LDXH 2ZCLP 4XE4A 2GT7A 4NZQA 4YLQH 1Y3VA 1CA8B 1JBUH 3AAVA 1MAYA 4YO9A 3OTJE 5AFYH 4ZXXH 1NPMA 2CXVA 1Z8IB 3A83A 1C2EA 1KMHB 4KGAA 3FN8A 1LKAA 4NWLA 3RXCA 2QV1A 5ESTE 1JMOH 1ETTH 3RC5A 3RXKA 4ABDA 3ZZ6A 1P10A 2ZTZA 1DX5M 1BTHH 2BVXH 1GI9B 6CHAB 3LGUA 1KXAA 4CRDA 1UJ1A 2PW8H 1O35A 2GCHG 3QGJA 4OS5A 2FDAA 1GHYH 1G3DA 1MTNB 1SGYE 1KY9A 1O3JA 2WYJA 4KKDA 3U8RH 3C1KA 1O3OA 1TFXA 1SHHB 1YCPH 3VB3A 1XXDA 4Y8ZA 2ZDVH 3OY6U 3K9XB 4DW2U 3ATLA 2XC5A 1F5LA 2ZGJA 1QURH 3A89A 3EE0B 3TK5A 4FETA 2P59A 5HIZA 3B9FH 2BVRH 3A87A 1GI5A 2FLBH 2YMSC 2HPQH 1K1MA 5T6DA 2PKAB 4UFDH 3W1EA 1B5GH 4NIYA 3KCGH 2ZFPH 3P8FA 1GI7B 2DE9A 2R0LA 1CU1A 4MG3A 1C5XB 3ENSB 4XFQA 2J95A 1Y3YA 3VXFH 9LPRA 1GI2A 2FTMA 2R2WU 1GHVH 2G00A 2RDEA 3S9AA 1FMGA 1P11E 1GMCF 4FUDA 3U69H 2Q6GA 3O8DA 4MLFB 2GTBA 3PO1B 1P03A 2BHGA 1AKSB 1W0JD 4Z0KA 3E8LA 3RM0H 5EQSA 5LPEA 1JXPA 1SGFG 5EGMA 3UQOA 1SB1H 1KSNA 3MTYA 4Y8XA 1AIXH 2G55A 3SV8A 4CHAC 3RP2A 4ZKSU 1K28D 2ZDMA 5K7RA 1QQ4A 2AIPA 4NSYA 1NO9H 4J1YA 5LH8A 3AK5A 2G52A 2Y5GA 2ZKSA 3SJIA 3LOXA 3KQEA 1FIZA 4TWWA 3TH3H 1ARBA 1PJPA 1TGCA 2Y5FA 1SQRA 1GCDA 3K6ZA 1AVGH 1W0KD 1AHTH 1BT7A 4MNYA 2ODYB 1VJ9U 5E0JA 1WQSA 3S69A 2ZGXH 2GKVE 2FLRH 1C5NH 5CHBA 1QY6A 3U8OH 1VJAU 1T8MA 4B2BA 3UREA 3RXMA 3A88A 3UR9A 2ZU1A 3A81A 1CT0E 3RXVA 1TALA 4I8LA 2Z94A 4CRAA 3KQDA 1MUEB 4X8VH 1AGJA 4X8TH 3T5FH 3Q3KA 1E36B 5T6GA 1T8LA 3PV2A 3F6UH 2CMYA 2WUCA 2GMTB 3GDVA 1SKYE 2ZGCA 2ZU3A 1HJAB 2F4LA 2R3UA 4GPGA 4HZHA 3RXRA 3N7DA 3B23B 4RKOB 1MCTA 2WHXA 1GCTC 4KELA 1QBNA 2R2MB 3T28A 4UONA 1MMJN 2A5KA 1O30A 3DHKH 4XRNA 3MNXA 1KXCA 3ATIA 4UEHH 3DSOA 2UWPA 1GPZA 1O2LA 1JWTA 3G01A 2ZTXA 3RXFA 3O8CA 1UTOA 4F49A 1C1MA 3BTFE 3PWCA 4XBCA 4O3UA 1ANCA 1LHEH 5DGJA 1P3CA 1O32A 1SLWB 1PPFE 1W14U 2WPHS 4E7RG 5A8ZA 1FAXA 2WSSD 1O2KA 3AAUA 3M3SA 1YPHC 3M61U 1AFEH 4NZLA 4B1TA 1SQOA 2FOCA 2Z7FE 3UNSA 1Z6JH 1G37A 2V3MA 2A5AA 2EI6A 2O8WA 2OP9A 7GCHF 5T6FA 2XCFA 3TK6A 4I8JA 4I7YH 3FVFB 1QGFA 1TGBA 1SGQE 5JB9S 1YM0A 1QNJA 3RXJA 4AC9A 1IHTH 2SGEE 1W2KH 3PO1C 5E8EH 4JCNA 1FZZA 3RMMH 2VIWA 4K2YA 2ZI2H 3HGNA 1C1RA 3RXAA 3RXDA 2FS9A 2QGRA 2BD8A 2CF9H 3F9GA 5DPAA 1FIWA 5DP6A 3RLYH 1C1OA 1HIAA 1O3BA 2A32A 2FX4A 3KGPA 3EA8A 4BNRA 2A45B 4X6NA 1O3GA 5JDUB 3PLBA 5EG4A 2NU0E 2GGVB 1QZ8A 1TOMH 3SV2H 1KDQB 1B7XB 2FM2A 2GCTB 3TITA 3UQVA 2BXUH 2Q6FA 4XOJA 1AY6H 2BY7X 1ZHMA 5CHAC 5GDSH 3UAIC 1HAHH 5FPYA 4AYVB 1XMNB 2STAE 1O36A 1S6HA 4B73A 4YZUA 2RA0A 3U8TH 4JZEH 3ZVFA 4CRCA 4NFFA 1ZTJA 2ZPQA 1C2DA 2GZ7A 3S0NA 1HAVA 1MQ5A 1WU1A 1ZJDA 2J34A 2ZHDA 2CGAA 4A1TA 1ZGVA 1GL0E 2RCEA 2P16A 3QLPH 3SGQE 1ELDE 4AORA 1VCPA 3MWIU 1OOKB 1J8AA 4IC5A 1EOJA 1NN6A 1V3XA 4MNVA 5G4BA 5SGAE 1BHXB 4R8TB 1TGNA 1NRPH 2A4OA 1GI4A 1BQYA 1XM1A 1GBDA 3PLPA 1KLJH 1TBZH 2BX4A 1JRSA 1FY1A 4AG2A 1DXPA 1C1SA 3MU8A 4MQAA 2XYAA 1FPCH 2H9EH 2KFWA 1GG6C 2W26A 4AFSA 1ID5H 2XNIA 4BTIB 1C5YB 1IQJA 1OS8A 3I78A 5EXLA 2XNDD 2IPHA 3S9CA 1G30B 1NT1A 3A8BA 1O2QA 2A2XH 2ZEBA 5EW2H 4LZ1H 1H8IH 4ABEA 3BTHE 2D8WA 3D65E 2QE7D 4BTTB 1HYLA 1UVOA 4UFGH 2HWLB 1GVKB 2G81E 4GUXA 4Q2KA 2CF8H 2J38A 4CHAB 1GJBB 4ABHA 1NTPA 1HV7A 4SGBE 4ABAA 2RFKC 1XKBC 1OP2A 1ZSJA 5C67A 1ZJKA 1TMBH 5L6NH 2ZFSA 1YPMH 1GDNA 1SI5H 2BD7A 4DJZB 3MHWU 4TY6A 3LGWA 4CR5A 1JIMA 1QQUA 1EKBB 1UK4A 3VPKA 3M7UA 3PB1E 4INKA 2ZP0H 4D76A 3LJOA 1AUJA 1BTPA 1LQEA 1O3AA 1TQ0B 1C5PA 1OSSA 3QX5H 3CP7A 4J2YB 1FX0B 3PWBA 4YTAA 2ZF0H 1WCZA 1RTKA 1OKXA 1A3EH 4K8BA 1YPJH 5C1YA 3KQ5A 5JBBS 3ZZ3A 1ESTA 4K60A 3SN8A 4K69A 3BTKE 5J4SA 1QFKH 1SHYA 1E1QD 1UTPA 1HBTH 3O8RA 1O3MA 1VITH 1O2TA 1EPTB 3MNSA 1TPAE 2CN0H 1GJAB 1VGCB 2ZFTA 2EI7A 1W8BH 5AVDA 5E2OA 2AH4X 1GBMA 1MKXK 1NY22 3F68H 1G3CA 2C8ZB 1GJ4H 1NZQH 1MH0A 1UVTH 3A7ZA 5CHAB 1JIRA 2ZU5A 1OWEA 1SGFA 2A4GA 2YOLA 2QIQA 1WV7H 1TLDA 1O34A 2RDLA 2YNBA 3A8AA 2P3UB 1CHGA 3RLWH 1VITF 2UWOA 1THPB 1TABE 1L1JA 1Q3XA 4NSVA 2YNAA 1ESAA 1O3DA 4Q80A 4GHTA 1EAXA 1GBTA 2QXIA 2ZU4A 3U98H 5DG6A 2HALA 1TRYA 1OP0A 3OSYA 2NU2E 1ARCA 2VINA 1TAWA 1FN8A 3MH4A 3SNCA 2PTNA 1YBWA 5AHGH 1P57B 2JIZD 1ANEA 1LVYA 1CHOG 2IJOB 2VVVA 2JH6D 2ZPSA 1SG8B 1LHDH 1SR5C 1BMMH 1GMDF 3CENA 3NZIA 1MZDA 1TWXB 2NU1E 1W10U 2Y7ZA 1IQEA 1OPHB 1V2TT 5C1UA 2AGGX 4D7GA 3U1JB 2AS9A 1ZPBA 3LH3A 3CS7A 3DSPA 2ZZUH 4DGJA 1RRKA 3D62A 1H9HE 1F0UA 1QRWA 1O3NA 4E06H 1ANBA 2DUCA 2JKHA 1NM6A 1VKYA 2VIVA 2Z9KA 2JJ1D 1NRQH 2F91A 1DWCH 4YT7H 5EQQA 1TBRH 1BTZA 3NPSA 1AU8A 4Z6AH 1SGIB 1RFNA 2SGPE 3DT0H 2QF5A 1QA0A 1AZZA 3BEFB 1D6WA 2B8OH 1UCYE 1FXYA 2OBOA 2ODQA 1QRZA 4FVBA 5JB8S 5F8XA 2GCTC 3T25A 3LT3A 4MPXA 5GCHF 4YESB 5EODA 3UWJH 2A4QA 3TH2H 3BEUA 1E34B 2QXHA 2ZFFH 1SFIA 1Y3UA 2C8WB 1Y8TA 1OWDA 1D4PB 2M2AA 2KAIB 2Y7XA 3OX7U 5LPRA 3SUFA 1O31A 1L0ZA 1YPEH 8KME2 3E6PH 1TX6A 1AVXA 1K1LA 1P12E 1J9CH 1KXFA 2QXJA 4X2VA 1DLEA 3ZV9A 5KGOA 3CS0A 1TGSZ 1KXDA 1O5AB 1SGRE 2HRVA 2Z3DA 2XC0A 1O3KA 3QO6A 3UOPA 3U28C 1ELCA 4TYDA 2QYIA 3URDA 4ABJA 5F53A 1TX7A 1SGDE 3TJVA 1OWHA 2WPLS 1H8ED 2D1JA 3GY8A 1P8VC 1GGDC 1OP8A 3HATH 3SUGA 3TPIZ 3WWBA 1K22H 4B2CA 1B0EA 3ZYEA 1HXEH 2OC0A 1SGCA 2FOGA 4NIXA 5JYIA 3A7TA 3HK3B 4H6TA 3EYDA 2J9NA 4DY7B 4XSKU 1BBRE 2FI4E 1BA8B 1YWUA 1AFQB 3GYLB 5E0HA 3PMHB 3SYJA 3RMNH 2ODPA 5HGGA 5GIBA 3ELAH 3QDZB 1UVPA 4MVNA 2Z3EA 2QA9E 1CGJE 4TPIZ 3SW2B 1ELAA 3UFAA 3N99A 5C0UA 1PPHE 3MH6A 3ZZ4A 4DOQA 1GHAF 5C2ZA 1DOJA 2GV6A 4FUCA 4THNH 3TU7H 1OWIA 1HXFH 2J94A 1P2IA 1H4WA 2H6MA 1SGTA 1C2GA 1EPTC 2BLOA 2GX4A 1AVWA 2J2UA 1K0HA 1QA7A 4JYTA 7ESTE 3M3TA 7GCHG 4YOJA 1XUGA 2F9PA 4LK4A 4SGAE 1FN6A 4ISLA 4B74A 1GL1A 2GVFA 1WTHD 2ZHEH 1DS2E 2O8TA 2WPKS 1NFWA 1DM4B 2P8OB 1CGIE 2FOFA 3F3BA 3U9AH 1MTSA 3F9FA 3OTPA 4ABFA 2BDIA 4ZAEA 1C1NA 2BDBA 3AASA 3SGAE 2VH0A 4TT3D 1BOQA 1C1VH 1GBCA 1Y5AT 4UFFH 2J5UA 3E3TA 1TA2A 3T27A 4RSPA 1AI8H 2KCAA 4DT4A 1RTLA 3CNRA 3SHCH 4TPYA 1N6XA 3PRBA 1QIXB 3EGKH 2C93B 1S0QA 3OU0A 1KXEA 1DITH 4LXBH 4ZH8A 4OS4A 3SOSA 3VFEA 3SNBA 1UMAH 2TPIZ 4ISIH 1BMAA 1BITA 5FCRA 1C4Y2 2WINI 2ZECA 3UNQA 2W3KA 1CT4E 1SSXA 1SLVB 1MABB 4FUFA 1PYTD 1UTKA 1GI0A 1HAGE 2NWNA 4X6MA 2XWAA 3QUMP 4GLYA 4A1XA 1HAXB 3FOAA 3ODFA 1NFYA 3AVZA 2VIQA 3KYGA 2HPPH 1FY5A 1EJNA 5C5OA 1LCYA 3MNBA 3MH7A 3UOUA 2FYRA 3L6PA 1AD8H 3T2NA 1MU8B 1O2XA 1QR3E 3P6ZB 2UUYA 2FODA 1GMDG 4Y7AA 1MU6B 1IQNA 9ESTA 1V2RT 2FS8A 2HNTE 2WYGA 1TA6A 3LU9B 5EQRA 2QF3A 3SV9A 3SNAA 7LPRA 2BLQA 5I46H 1SGPE 1GDQA 3SV6A 1YPLH 3V13A 4GSOA 5IDKA 3MQKC 1YLNA 4RI0A 1SMFE 1TPOA 1DSUA 5DKMA 4BAHB 2J92A 3URCA 3ODDA 1A4WH 3OFND 2FOBA 2J98A 1AQ7A 3E16B 3LIWA 1C5SA 3PLKA 1AO5A 1O2IA 3FAOA 1JRTA 1TNIA 1BMNH 4HGCA 2ZPRA 1K2I1 1GCTB 1IQGA 1E37B 4UFEH 2Z9JA 4AFZA 5EW1H 3AW0A 4WJG2 5KEDA 1P2NA 2CHAB 3SUDA 5ESBA 3ZZAA 2XW9A 2K1QA 4BXWA 2SGAA 1QHRB 5DP3A 1AB9C 2G5VA 3P95A 5F6MA 1TNJA 4A5TS 3BTQE 1TONA 4WH8A 5C5NA 1SL3A 5DP5A 8GCHG 4AOQA 1P9SA 4OS6A 5BRRE 2BD3A 1GBKA 2V3OH 5EIYA 4X1PU 1MKWH 2F9BH 1ELBA 1N6YA 4M7GA 2OXSA 1ZMLA 3E91A 2SGFE 1CA0B 1DWEH 2J4IA 1BMLA 2PP6A 3QWCH 3ZVCA 1HAIH 1CGHA 1CT2E 1YLCA 4B76A 2FP7B 1C5WB 1EAWA 4YOIA 1DPOA 4DIIH 1EZQA 2K0QA 3V12A 4FOUC 2Z9LA 4FU7A 1P2QA 3MMGA 5GJ4B 2STBE 2TGPZ 3IG6B 1FY4A 2P93A 1HRTH 3A86A 3VG8A 1QJ6B 3UWIA 1BUIA 4A6LA 1GJDB 5DP8A 3DCLA 2TIOA 3LC3A 1P0SH 5FX6A 1RS0A 1ACBE 1C1TA 1GJ7B 4YLUA 1S0RA 2A7CA 1C2HA 1KIGH 2L6OA 1T31A 4RT0A 4ACBA 3U1IB 1C2JA 1GJ8B 1PPZA 2KCYA 5AFZH 3DFLA 1YPHE 3VB4A 1HCGA 1U6QA 1IQIA 3SQHE 2ZHWH 1YCPK 5KECA 1HNEE 4GCHG 1EOLA 4K5ZA 4YOGA 2AERH 1PPEE 2H5DA 3OE7D 4CRBA 1IHSH 2BLVA 1OWJA 5EJ1A 3WW7A 2VGCB 3T62A 3L33A 2VB0A 2G5NA 4KTCA 1ELGA 4RKJB 3NWUA 2THFB 1K1IA 2C4FH 1YY3A 4RT1A 1ZRBA 1MBQA 4WY3A 1VCQA 3GCHC 5GXPA 2F83A 1GG6B 8GCHF 1ETRH 4GCHF 1O3FA 1PQ7A 3MO6A 1BRCE 2KR7A 3MU4A 3LJJA 1ZYOA 2PKAA 2WPMS 3RC6A 3TLOA 2F43B 3LGYA 1C2LA 1BB0B
chains in the Genus database with same CATH topology
1O5GH 4KP0A 1VZQH 1MKWK 4JZ1A 1DVAH 1MTVA 1Y59T 3ZVBA 2ZQ1A 1QTFA 1SBWA 2F9VA 3HK6B 4CH8B 3LONA 3GYMA 4OS1A 1C5UA 2ZTYA 3M5OA 3W94A 1Y5BT 2PHBA 1LVOA 1IQHA 3VB5A 1RIWB 1SLXB 2ILNA 1K9OE 1O5FH 3Q00A 1TYNA 2O9QA 2ZDAH 2FYQA 3A7WA 3ESTA 4ZKRU 3QTOH 1SLUB 2FTLE 4A1VA 1KLIH 1XUFA 5E2PA 1V6DA 2BM2A 4X1SU 1AKSA 2W7SA 2M5TA 3RXUA 5F03A 4VGCB 4ZMAH 1GBLA 2BLWA 3FP6E 1A61H 1K1NA 2Q1JA 2VVCA 1BIOA 3RXQA 1K1JA 3QZQA 1EJMA 4ISHH 4KTSA 4E05H 4Q7YA 3TH4H 3FFGA 4NIWA 2G51A 2VWOA 1VGCC 4A92A 1BJVA 1ABJH 3HKJB 4IMZA 1EB1H 2A1DB 1BTWA 2BDAA 1LQDB 3M3VA 1FPHH 2G4TA 3ZVAA 1EATA 5ABWA 4MTBA 2P3TB 4O03A 1O2NA 5GPIB 4K1SA 1O0DH 4WF8A 4BAMB 3Q3YA 3EA9A 1FAKH 2HNTF 2VU8E 1J17T 2AMDA 4CH2B 1FY3A 4I8KA 1ZTLA 4ZKOU 1T8OA 2W3IA 4DCDA 3SV7A 1EPTA 4Y0YE 1ZR0A 2CHAC 3EAJA 3JZ2B 4LOYH 3GICB 3M5NA 3GCNA 2EEKA 2IN2A 1PPBH 1OX1A 3H7TA 1OYQA 3RXBA 5A8XA 1AB9B 1AZ8A 4CRFA 5FPSA 1C5RA 1ZHRA 1O3CA 2OQ5A 3BTME 1P2OA 3I29A 3SNEA 5L30H 3RXTA 2BDYA 1BJUA 1NROH 4U30A 1L4DA 1S5SA 1MD7A 3Q76A 3QN7A 4JK5A 1NRRH 4NA8A 3GCHB 3FP7E 4Q7XA 1TX8A 2UUKB 1QL8A 2W5EA 3AW1A 1P2MA 1K21H 1GMCG 1LKBA 2FMJA 4FXGH 3PYHA 3PM3A 2GT8A 1CA0C 1P04A 2XRCA 3MFJA 3TGKE 2B0FA 2PSYA 1EZUC 3GY7A 3DUXH 2O8UA 3H7OA 1O39A 2IOTA 1MKXH 5A0AE 1A0LA 1V2LT 1C9TA 1P2JA 1O2GH 5HM9A 1SFQB 1A2CH 1TPSA 5A0CA 1MAXA 1RIWC 3RMOH 3HPTB 3UY9A 2Z3CA 4OGYA 4JYUH 4AGKA 1UHBB 1YPGH 1ZPCA 2DE8A 4H6SB 3LH1A 1F7ZA 3N7OA 3BG4C 3SJ8A 2PKSB 1FUJA 3STIA 2ZDLA 2CJIA 3QZRA 4IN2A 3UNRA 1XXFA 4VGCC 1EASA 1PQ8A 2F9UA 1W3CA 5HYOA 1G2MA 1C2KA 4U2WA 3SU4A 1EP5A 3FP8E 1GHBF 4AFQA 5DP9A 3RXHA 2VIDA 3ZZCA 3F9HA 1O3IA 1H9IE 3A7XA 3VGCC 1BTXA 1PFXC 4AB9A 2FOHA 2VGCC 3A7VA 3HGPA 4CREA 4BTUB 6ESTA 4O9VA 2GMTC 1UCYK 1TOCB 1CVWH 1HJAC 1HJ8A 1YYY1 4INLA 1HAOH 2O8LA 4X1RU 1M9UA 3OYPA 4IW4E 5DJ7A 4B2AA 4WMFA 3RXSA 1O2OA 1WSSH 1C5OH 2OC7A 2VWLA 1GGDB 4NG9H 2FZZA 5F8TA 2FI3E 5DP7A 4HI3A 1G3BA 1AE5A 3M35A 3SNDA 1FV9A 1A5GH 1ESBA 1V2ST 2BD9A 2FWWA 5AF9H 3SUEA 4FU8A 2JETB 4H4FA 1UTQA 4RN6A 4D7FA 1KYNA 1RGQA 4YT6H 5E0GA 3S9BA 4WWYA 1DY9A 2GDDA 2VH6A 3BIVH 2QY0B 2PUXB 2VVUA 1C4U2 2BDCA 2SFAA 1K1OA 4WMEA 2P3FH 1EUFA 2BD2A 1QB6A 1GJ9B 3Q3XA 1ZLRA 4CR9A 2NU3E 1ZHPA 1O5EH 1J14A 1HUTH 4U32A 2FXRA 1N8OB 4UE7H 1O5DH 4IMQA 1HLTH 2EC9H 3A85A 1EB2A 1LO6A 1FNIA 4NA9H 1ABIH 2UUJB 4WH6A 1W7GH 1V2NT 2BOKA 2BX3A 1ZPZA 3M36A 1UK2A 4OS2A 2ULLA 1W11U 1E0FD 1KXBA 4QT8C 3RM2H 2XXLA 1L4ZA 2KAIA 2CV3A 1S83A 1INCA 5EU8A 4Y79A 1Z7KA 1SQTA 4AZ2B 2PGQB 1HJ9A 2PKSC 1TRMA 1PPCE 4I8HA 2BZ6H 2ZO3H 2XBYA 4X0WU 3M7TA 1D3TB 1F0SA 1GWAA 5B6OA 2C8XB 2OCVB 1SVPA 2ESTE 3T26A 1DFPA 1YC0A 1A5HA 2PLXA 2BDHA 1N1LA 4D9QA 2GDEH 2OD3B 2W7UA 1RXPA 1QBOA 5EPYA 4ABBA 1G32B 3TJOA 4B71A 3K6YA 1E38B 1MTWA 3SU1A 1UVUH 3NCLA 3BTGE 3BTEE 3LC5A 4I8GA 1SPJA 1FY8E 2FESH 1W7XH 2A7HA 2ZWLH 3QGNB 1TE0A 1ZGIA 5TJXA 3MI4A 5DK1A 2FO9A 3MYWA 1DWDH 5BPEA 2H5CA 1EAIA 1C1PA 2VNTA 1LMWB 3MOCA 1GI6A 1KLTA 4I33A 4UD9H 3ZVGA 4Y0ZE 1Q31A 2HGTH 3TGJE 4Y6DA 3VXEH 1EP6A 1JOUB 2ZHQH 2A2QH 1BRAA 2ANYA 1TQ7B 3ATWA 1SQAA 1L1NA 1J15A 1K1PA 3TVJB 4AGJA 4X2WA 1CBWC 1O2RA 3GY4A 1DICA 3BTTE 2V6NA 3SJOA 1LHGH 1O3PB 2OLGA 4MPWA 1QB9A 4JZIA 3FZZA 1SGNE 1MZAA 1XVOA 2C3SA 3GDSA 4ZROA 3IITA 1P09A 1OWKA 5FX5A 3RMLH 1GBEA 2UWLA 1GHXH 1ZRKA 1NU9A 5JPMH 1A0HB 2AMQA 2FOAA 3F1SB 1V2OT 3UPEA 3P92A 2FEQH 3W95A 3PTNA 1HAYB 4ABIA 2JH0D 2ZIQH 3RXEA 4ZUHA 3VGCB 3KHVA 1BTYA 3E1XB 3MO9A 2AFQB 1S81A 1DT2A 1ORFA 1QCPA 2G8TA 5JBAS 2C8YB 2TGTA 3SU0A 1O2WA 3A80A 1DUEA 3GY6A 1UHBA 5FBEA 2XBXA 1D6RA 1MBMA 2SNVA 2TRMA 1DWBH 2QC2A 1A3BH 2QAAA 1O33A 3UR6A 1V2UT 3SHAH 2ZHFH 3FANA 1GBJA 3DD2H 1OYTH 5HMAA 1PYTC 6CHAC 1F2SE 3BV9B 1YPKH 3E0NB 4DT7B 1XUJA 2VWNA 4K8YA 5C1XA 3GY2A 1DLKB 1DY8A 1MTNC 3GISB 1NFUA 1IQKA 1AE8H 4NIVA 2GZ8A 1DSTA 5DO4H 1SC8U 2ALVA 3A8CA 1F0TA 3P8NA 1O2HA 1GMHG 1O3HA 2AGEX 2JETC 3P70B 4YM9A 1QJ1B 1C2FA 1F5KU 2SGQE 2HOBA 3A7YA 1KTTB 4FUIA 5F8ZA 1EX3A 2G4UA 3PMBB 4U01A 3RXIA 1HPGA 1V2WT 5CE1A 2Y81A 2XCNA 1AUTC 1BRUP 1O2PA 3NXPA 1XUKA 3M5MA 3A8DA 1ELVA 1V2KT 4JZDH 1NS3A 3MU0A 2VJ1A 2WV4A 1S82A 1P3EA 1BBRH 1T4UH 3MO3A 2Z9GA 3SQEE 3ZZ7A 2Y82A 1H9LB 4ISNA 1WBGB 4A7IB 7KMEH 3TK9A 1S84A 1G36A 1TNLA 4CBNA 1LVMA 4CRGA 2SNWA 4O97A 2AIQA 4ZHLU 3NUMA 1KDQA 3SORA 1AWFH 1NFXA 2A5IA 2HVXA 1C5MD 2F3CE 3M37A 4PROA 4ZXYH 1T8NA 4UDWH 3V3MA 4X6PA 3LGVA 4MNWA 4AYYB 3WY8A 3M5LA 4AB8A 2ZCHP 3P8GA 2GD4B 1QL9A 1D3PB 3ATKA 2BMGB 5EXMA 3F9EA 1THSH 5GCHG 1YKTA 1IQFA 1P9UA 1ZMNA 3GOVB 1ZSKA 5CMXH 5FXLA 1C1WH 1GBBA 3LGIA 4ZKNU 3SU6A 1ZTKA 1BDAA 1O5BB 1P2KA 3GY3A 1H8DH 3SI3H 2PTCE 1FQ3A 1EJAA 2C90B 1LHFH 2ZFRH 4MDSA 1T4VH 2ZQ2A 1Z6EA 5EPNA 1WUNH 2GZ9A 1W0YH 2ZCKP 1HB0B 1HIAB 2ZNKH 3TNSA 2BZAA 1LPKB 2AMPA 4F4OC 2Y80A 3P8OA 3RXOA 6GCHG 5EXNA 3LKWA 2VWMA 4Q7ZA 4BAKB 5EOKA 3S7HB 2H1UA 2PWXA 1QL7A 5H4IB 1ANDA 2TGAA 1GJCB 1UCYH 1GI8B 4WXVA 1TRNA 1GHAG 1O2ZA 4JYVH 5FAHA 4ISOA 2ZU2A 3RC4A 1YLDA 3D23A 2BTCE 3SGBE 2BQWB 1OXGA 3SZNA 2UUFB 3UUZA 1C5LH 2NU4E 3PTBA 5A8YA 1AN1E 3BTWE 3L3TA 3VB7A 5C20A 3BIUH 1O2YA 4JK6A 4LZ4B 6LPRA 1G2LA 3QK1A 2AEIH 2AYWA 4HTCH 1HDTH 4NCYA 5T3HA 5HXFA 1GVLA 5A2MH 1TNKA 1ELFA 1LVBA 1PQ5A 2HLCA 1HGTH 1IOEA 2V3HH 1O2SA 2GCHF 3EQ0H 5TCAA 1CQQA 1O3EA 5K0HA 2FPZA 1GBHA 8ESTE 1CBWB 1GDUA 1D3QB 1X7AC 2PR3A 5JBCS 1C5TA 1NESE 2WPIS 2P94A 1XKAC 2R3YA 2P95A 4AN7A 3GDUA 2QXGA 4FU9A 2HNTC 5JBTA 1B0FA 1GVZA 2PSXA 1WOFA 4FUHA 4ASHA 1IQMA 4Y71A 1PPGE 3ZZ9A 1A0JA 1G3EA 1Q2WA 6GCHF 4BAQB 3KQCA 1W13U 2BQ7B 1ETSH 3E90B 1TNGA 5DP4A 3SI4H 1CO7E 3ZV8A 3TGIE 1A7SA 1DANH 1Z1IA 2XC4A 3E0PB 4TWYA 3BTDE 1NRSH 1V2MT 2A7JA 1O5CB 4OGXA 4BANB 1UTMA 2D2DA 4FUEA 1SOZA 1D9IA 1GHWH 1UTNA 3RDZA 4NWKA 1FLEE 1F0RA 2ZA5A 3GCTG 1HAVB 2TBSA 4X1NU 2ANMH 2OQUA 2I6QA 1AWHB 1GBIA 1MQ6A 1V2JT 1A5IA 2OBQA 3UIRA 1THRH 3GY5A 4AG1A 5FCKA 1UVSH 4Y8YA 1GI1A 1O3LA 1DXWA 5C3NA 1O2MA 2LPRA 2BOHB 4I32A 1EZSC 4JZFH 3ITIA 3GCTF 2F9OA 2RG3A 4D9RA 1WAYB 4MPVA 3OY5U 3VEQB 3M7QA 2D26C 3ZZDA 2ANWA 2P8OC 3H5CB 2Z9IA 2ZGBH 1XX9A 4ESTE 2R9PA 2O8MA 1LPZB 2WUBA 2ANKH 4GHQA 4NFEA 3MU1A 3ZZBA 5LPFA 1G9IE 2GV7A 3C27B 2TGDA 3S7KB 3SBKA 3TIUA 1F92A 3EDXB 3RU4T 1D3DB 1YF4A 4KTUA 1L2EA 2WPJS 4TY7A 4WMDA 3SJ9A 4K1EA 1ZOMA 1TMUH 2VIPA 2ASUB 1EQ9A 2B5TB 1QJ7B 1TB6H 4FUJA 4B75A 1GJ5H 5FPTA 1P01A 2B7DH 1A46H 4DG4A 5GWZA 4FUGA 1NRNH 1BZXE 3TNTA 1GJ6A 1O2UA 2OC1A 1FI8A 2VIOA 1LTOA 3RUOA 2BY9X 1ZSLA 2BY5X 1C5VA 1RD3B 3KN2A 1BTUA 2A4RA 1A1RA 1GMHF 1UK3A 2PGBB 3BG4B 3VB6A 4FUBA 5PTPA 1BCUH 4GVUA 4X2XA 2H9HA 1GBAA 1MCVA 1YCPM 1C5ZB 1CSOE 2XBVA 2ZDKA 1CE5A 1Y3XA 1UTLM 4X8SH 5LGOA 1ELEE 1WTGH 2BD5A 4XBDA 5A0BA 1C2MA 3R3GB 1O38A 1YGCH 2BQ6B 4DIHH 3LGTA 4K3JA 4JMYA 4X2YA 3UTUH 3PMJA 1V2QT 2Y6TA 1NC6A 1V2VT 2A31A 2BB4A 1HAZB 2BVSH 3LPRA 4R0IA 3NKKA 3ZZ8A 1P02A 2QN5T 2SGDE 4CBOA 4IS5A 3DFJA 1TMTH 4NA7A 1EAUA 1WYKA 1AMHA 4WVPE 4Y76A 1C5QA 3TJNA 3ATMA 3MH5A 1EXFA 1DE7H 1DDJA 5A09A 3T29A 1Y5UT 2WV5A 1QB1A 3O8BA 4AX9H 1GBFA 1C1QA 3Q77A 1HFDA 4XBBA 2ZDNA 3BSQA 5HM2A 2B9LA 1FJSA 2Z6BD 2FOEA 3ZYDA 1FDPA 2F9NA 4E7NA 2FIRH 1LPGB 3MNCA 2PV9B 2V35A 4BOHA 3A84A 1XUIA 3V7TA 1Z8RA 1UO6A 3SJKA 1XUHA 2ZC9H 2H9TH 1E35B 1FONA 1NU7B 1ZMJA 4X6OA 2Y5HA 4WXIA 2OTVA 1O2VA 3SU5A 3B8JA 4BXSA 1N8OC 3RU4D 1Y3WA 1CHOF 5ETXA 2JH5D 3NK8A 4DURA 1P06A 3RXPA 2A0QB 1LHCH 1VR1H 2BDGA 4D8NA 1HAPH 2AGIX 1C1UH 4IN1A 2XWBI 5L2YH 4ZHAA 1QRXA 3K65B 3QTVH 4IGDA 1IQLA 4ZHMU 2ZG0H 3HKIB 3BN9A 3ZVDA 4K1TA 2H2ZA 1RTFB 4Y7BA 1BBRK 3KL6A 4I31A 1MTUA 3RU4E 1EZXC 1XVMA 1Z1JA 1L1GA 2RA3A 2FX6A 2OUAA 4BAOB 4AFUA 1O2JA 2V0BA 3P17H 3SU2A 1C2IA 4ABGA 1PQAA 2ZGHA 5L2ZH 4MPUA 2GP9B 1TPPA 1S85A 2XBWA 2Q6DA 2EA3A 4IBLH 3JZ1B 1F5RA 1TNHA 5J4QA 3KQBA 1S6FA 4INHA 2OINA 2BY8X 4MNXA 1SOTA 5TCCA 1ZZZA 2XTTB 3KNXA 5I25A 3KIDU 3KF2A 3PMAB 3RXGA 3BG8A 1TBQH 2I6SA 1T32A 3EA7A 2QCYA 2FOMB 2EI8A 1IAUA 1P05A 3SO3A 4DVAU 2ZFQH 1KTSB 1Z8GA 1H1BA 1Z8JB 1W12U 3BF6H 1DUAA 2BYAX 1SGEE 3I77A 4FVDA 1GI3A 1QBVH 4HFPB 1C9PA 4Y11E 2R0KA 1WQVH 1YP9A 2FI5E 3D49H 2BXTH 1MD8A</