1HAZB

Snapshots of serine protease catalysis: (c) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 9 for 1 minute
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine proteinase/hydrolase substrate
molecule keywords BETA-CASOMORPHIN-7
publication title X-Ray Snapshots of Serine Protease Catalysis Reveal a Tetrahedral Intermediate
pubmed doi rcsb
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hazB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hazB01
1EAUA 4YLQH 1SGTA 2WPMS 4F49A 4KGAA 3SJIA 3UWJH 4I31A 1Q31A 4BTUB 3K65B 4CRDA 1HBTH 4JYVH 2THFB 5ETXA 5DPAA 4WWYA 2TIOA 3RXLA 4YT6H 1NFXA 2GVFA 2BLOA 1CA0B 1KY9A 3W94A 1AB9C 3GCOA 3SNEA 7LPRA 2Y5FA 4MG3A 1W14U 3TLOA 4UE7H 3LDXH 6ESTA 1T31A 1VJAU 1O3AA 1C1MA 1MD7A 3NK8A 5F03A 1ELVA 1P57B 1QBOA 2A7CA 5K7RA 4X1SU 3LGVA 1NU7B 5E8EH 3AVZA 2YNBA 5E2OA 1UK4A 3D49H 1C2FA 1OSSA 3FZZA 2NWNA 3EAJA 3ATMA 3WY8A 2FPZA 4SGBE 4Z6AH 2JKHA 3DFJA 3FFGA 5T3HA 1V2PT 2JH0D 3HPTB 2GCTB 1KXCA 5EU8A 4AFZA 1WBGB 2GCHG 1V2UT 2TGAA 2KAIB 3DD2H 1ANEA 1GDNA 3MH4A 3SV6A 3OTJE 2H1UA 2GZ9A 1MTUA 2FS9A 1K28D 1GHVH 3TJOA 2PUQH 1QJ1B 5C1XA 3U98H 1GWAA 5C5OA 2BDAA 2FOAA 2XBWA 4MPWA 5AHGH 1IQHA 1TFXA 1A1RA 1ZMNA 1HRTH 1EB1H 4MTBA 4XDEA 3UNQA 2ZU3A 1O2RA 2Z9JA 2FOGA 1DE7H 3A81A 1O2IA 3BG8A 5DKMA 2AIQA 4K5ZA 1NC6A 5TCCA 2Y5GA 1DT2A 1H8DH 3SNDA 1T32A 1S84A 1V2VT 3BIVH 1A5IA 1UCYE 1ELFA 1LDTT 4R0IA 5DP6A 5GDSH 1TONA 4X0WU 2VGCC 1TWXB 5F8XA 5EXNA 2ZTXA 3FZDA 1UHBA 1RTFB 2EEKA 1T8MA 3ZYEA 1HIAA 4DG4A 3A83A 3RC4A 2ZCKP 3SHCH 2VINA 2ZKSA 1Q3XA 1EATA 1N8OC 8GCHG 2Q6GA 2QN5T 1W3CA 4A6LA 4IC6A 1V6DA 1HAYB 3KQDA 2J34A 1LHEH 2Q1JA 1QCPA 2P3FH 2PSXA 1BBRK 3BTHE 1NESE 3HGPA 3LJJA 3P8OA 1TOCB 2WPHS 4ABGA 4OS2A 3UREA 1XXFA 1DLEA 1RGQA 1ZGVA 4D8NA 4K1TA 3BTGE 1GJDB 1MTWA 2ANWA 2ZWLH 3T62A 1KIGH 1ZJDA 3P8NA 4ISIH 2XWBI 1PPCE 1TIOA 2SGAA 3MH7A 1V2ST 1ZPCA 3A7VA 1MAYA 1THPB 3PYHA 4Y0ZE 4Y7BA 5JBBS 3I78A 1GBDA 1DSTA 1W11U 4Y11E 1GJ6A 1PPFE 2G81E 2OQUA 1EASA 5E2PA 2UUJB 3SGQE 2XW9A 4JYTA 1ARCA 1F0TA 2QYIA 1VCWA 5ESBA 1A2CH 1J17T 3TITA 4A7IB 3SI3H 4ABEA 2AIPA 4NA7A 2GV6A 1F5RA 1O3JA 2Y6TA 4ABDA 3EQ0H 1SI5H 1C4U2 4JZDH 3GDUA 2ZC9H 1W8BH 1FY4A 1QHRB 3TK9A 5A8XA 3MO6A 3A87A 4MNWA 1IOEA 3T26A 1TBQH 4Q7ZA 3SGBE 1XUHA 4FUFA 4JZEH 1P2MA 1P02A 2R9PA 5A2MH 1QQUA 5TJXA 4FUBA 1RFNA 2A5AA 4RN6A 3FP8E 1FXYA 2CN0H 4R8TB 1Z7KA 2AH4X 3BEUA 2WYGA 5HYOA 1YPGH 1Z6EA 1OWJA 3VB4A 4MLFB 3DA9B 1QR3E 1PFXC 4M7GA 1C5UA 1NO9H 2PGBB 1E38B 1O32A 2JETB 1MKWK 4X6NA 3GOVB 1DWDH 2FOHA 3RXVA 3PLKA 2CXVA 4AOQA 1QTFA 1P9UA 3Q3XA 1C5PA 2WYJA 5CE1A 2SGEE 2FWWA 5DP3A 3BF6H 2ZA5A 4ISNA 1L2EA 1NY22 2K1QA 3VFEA 1EAXA 2HGTH 2OD3B 5DP9A 3CS0A 4YOGA 1FPCH 3SU5A 4WY3A 3RXHA 3MOCA 1W12U 3ITIA 2EI8A 4IGDA 1ANCA 1GGDB 1V2WT 4IN2A 1UTNA 2DE8A 1MTSA 3M36A 1T4VH 4ESTE 2VVVA 3QGJA 1J14A 1LHGH 2WPIS 3U1IB 1IQLA 1GPZA 1VJ9U 1P2NA 1TQ0B 1GJBB 9ESTA 1AE5A 3L33A 3DT0H 1TLDA 4CBOA 2BDBA 1K1PA 1YPEH 4TWYA 1GG6B 4Y79A 3LC5A 4MPXA 1OXGA 5DG6A 2D8WA 1GHAF 1F5KU 3QX5H 2QXIA 2ZPRA 1YGCH 2XXLA 5LPEA 2VIQA 1O2ZA 4OS1A 3D62A 4XSKU 1BTHH 1X7AC 1ZTKA 4X8SH 2F91A 1T4UH 3S9AA 3A7XA 1NFWA 1UTOA 2XYAA 1TA2A 1UVUH 4A1VA 2VB0A 3TK6A 1QL7A 3UNRA 1G3DA 1K1LA 3MNXA 4WJG2 1GBCA 1EXFA 1TGCA 1O2JA 2ZU5A 5JBCS 3UY9A 4DOQA 1C1TA 5CMXH 4AG2A 1KSNA 2HNTC 2GDEH 1SB1H 1ABJH 2FMJA 2P94A 1TGBA 5DGJA 1PQ7A 1SGNE 3MH6A 4IMZA 1P01A 8KME2 1T7CA 2Z6BD 3LJOA 1C1NA 3M37A 2OC8A 4NZLA 1HAHH 1W7XH 4HTCH 1C2MA 1ANBA 4DW2U 3RXQA 2ZU1A 3LIWA 2OXSA 1GJ5H 3GY6A 1MBMA 1AFQB 2XBVA 3S7HB 3VEQB 1K9OE 3GCHB 4D7FA 1NFYA 1O3LA 1UVOA 1IQNA 2R2MB 5HM9A 3S7KB 5FBIA 3EDXB 1S82A 1HJAB 3SO3A 1NU9A 4DURA 5GWZA 1WCZA 1LVYA 2V3HH 2BDCA 1BJUA 2WINI 4AYYB 1HAGE 1SL3A 1GG6C 2AYWA 4YTAA 2WV4A 1EAIA 1A3BH 1LPKB 2HPQH 3A8CA 2CGAA 4BTTB 1EOJA 1A0LA 1GBHA 3UOPA 5LH8A 1PPZA 2TRMA 1VITG 1YPHC 1ZR0A 1C1VH 4H42U 5T6GA 1PYTD 2OC7A 2CV3A 3PO1C 3W95A 1C2HA 1VCPA 3MU8A 5JDUB 1C4Y2 3RMLH 3OSYA 2D1JA 1QQ4A 1KXEA 2PTCE 3VB7A 4FVBA 2HWLB 1RD3B 2FOCA 3GCNA 1Y8TA 2G51A 2ZGCA 4K3JA 4NZQA 1FAKH 1N1LA 1NRSH 1GBAA 1ACBE 5HMAA 2Y80A 1OKXA 1FAXA 1EZUC 1DX5M 2A5IA 2NU4E 2ZGHA 1OP8A 3E1XB 3UIRA 1A7SA 1YKTA 2BD9A 3TH3H 1QL9A 4GUXA 4OS5A 2GCHF 3MU5A 1SGRE 3MNCA 4THNH 1ZSLA 5E0JA 2QF0A 3K9XB 1G3EA 5JPMH 1OX1A 1BB0B 1IHTH 1C5XB 2LPRA 1ELTA 1SGCA 5LGOA 1BRBE 1VGCB 2IJOB 2J38A 5DP5A 4DCDA 4RSPA 2YNAA 4XFQA 4AGKA 1GCTC 4TPYA 1O2KA 1O3CA 3LGWA 1KYNA 2QXHA 4U2WA 5EQSA 5B6OA 1OS8A 3SW2B 1O3FA 1Y3VA 4NIXA 5T6DA 3L3TA 4AFUA 4AG1A 3BEIB 1S6FA 5GCHG 6GCHG 1EUFA 1Z8RA 1SQAA 2Z9IA 4NFFA 1VR1H 1ZYOA 4FU9A 3D65E 2CF9H 5DP8A 2ZPQA 1BTWA 1C5RA 1DS2E 5L6NH 2A31A 3AW1A 3CENA 2FOMB 4I8JA 4HI3A 1GMDG 2A4GA 2ASUB 4I32A 2ESTE 3I77A 1MD8A 1TX6A 2BVSH 1DSUA 1JWTA 2Z3CA 4FUJA 4B2CA 2ZDKA 1GMCG 3GYMA 3KQEA 1GHBF 1T8LA 2FZZA 3BTEE 1GVZA 1ZPBA 4ISOA 5DP7A 1P3EA 1TMUH 1WQVH 3O8BA 1PPEE 2C4FH 1BA8B 1SQOA 3RXKA 1HLTH 8GCHF 2VH0A 1O0DH 1THSH 4CH2B 2BXTH 1QFKH 2FOBA 4QT8C 3RXGA 3RM0H 1W0YH 3TGJE 5I25A 5EW2H 3RXEA 1MU8B 1HGTH 2O8LA 2V6NA 2PKSC 2ZDNA 1W7GH 1Y3UA 1HDTH 3AAVA 4ZROA 1MTNB 5FCKA 1F2SE 1GI2A 1O3GA 1PYTC 1QIXB 1MKXK 3M5NA 1TNLA 2DE9A 3SHAH 4A5TS 2P8OB 1S85A 4Q7YA 1LQDB 4OS6A 1NT1A 1OWHA 5AVDA 1GVLA 2BX3A 3A85A 5C3NA 2P59A 3P17H 1JMOH 1GI7B 4I8LA 2P16A 1AZ8A 4DY7B 2CHAB 3NUMA 3SUEA 2FEQH 5JYIA 3GY8A 3V3MA 3MNSA 2F9VA 4WXIA 2BDIA 2XCNA 5FPYA 3TNTA 2BY8X 3D23A 1GI4A 2STAE 7GCHG 4VGCC 1O3NA 1O5EH 2ZFSA 3HKJB 2FM2A 1NPMA 3NWUA 2KAIA 1GI3A 4UEHH 4Y8ZA 2QAAA 1AI8H 4WH8A 1NRNH 4K2YA 5JB8S 1NRQH 2ZFTA 1V2RT 2FTLE 2BOKA 3BTKE 2Z94A 1Z8GA 2BYAX 1BMAA 4LOYH 4JK6A 2Y7XA 3F9HA 2FXRA 2GP9B 4B1TA 5F8ZA 1C5QA 1DFPA 2XC4A 4CBNA 1T8NA 1BQYA 1H1BA 3RXMA 3TGIE 1IQGA 1ELGA 2C8XB 1MZDA 1LCYA 4FUEA 4FUCA 1A5GH 4XBCA 2PTNA 1GI9B 3T27A 4D9QA 1K1MA 4KTUA 2FYQA 1QY6A 3IITA 3ZV9A 4HFPB 5AFZH 1TMBH 1XVMA 1E36B 2A45B 2ZO3H 4D9RA 1WQSA 3O8CA 1ZHPA 1EJAA 2FS8A 2ZHEH 1DM4B 4YESB 1P0SH 1KXDA 3SJKA 3KEEA 4ZHLU 3A8BA 1IAUA 2CJIA 4H4FA 1LHCH 1HFDA 1GMHG 2TBSA 2O8MA 1O3PB 3A80A 2GKVE 5JBAS 3SV2H 3QTOH 1EZXC 3S0NA 1C2DA 3TH4H 4Y71A 4U32A 4GHTA 3URCA 1WYKA 2ANMH 1HCGA 3PMBB 3R3GB 2FYRA 2CF8H 2Z7FE 1RRKA 2GV7A 1Z8IB 1YP9A 1O2TA 1WTGH 3M5OA 3S9BA 1DUEA 1NROH 2XBXA 1CT4E 1DWEH 3UOUA 4NIYA 4O3TA 1GL1A 1PQ8A 2AS9A 2I6SA 1AKSB 1QURH 1O2VA 1IQJA 4MNXA 1P2JA 2ZDVH 3A86A 4DVAU 1RTLA 1V3XA 3TJUA 1CHOG 4GVUA 3M61U 1V2MT 4AX9H 1O2GH 2ZCHP 3SU2A 1O2HA 1IQIA 1GI1A 1O2OA 1TRMA 2XTTB 1C2GA 2FX6A 2VJ1A 6CHAB 2B7DH 4CR5A 5A0BA 5I46H 1QBVH 3RU4E 2F9BH 3QGNB 3NZIA 4X1NU 4Q7XA 5G4BA 1EPTB 1MU6B 5FX6A 3ZVAA 5FBEA 3T28A 2GDDA 1CA0C 3HKIB 1YPMH 3EA8A 3RXRA 2J95A 1F92A 3RMOH 3EE0B 1P3CA 2FESH 4CRCA 1AN1E 3MI4A 2A4RA 3RLWH 1NZQH 3NXPA 4ZKNU 2GZ8A 2ZI2H 5JBTA 2BD8A 1Y59T 3RMNH 4ZXXH 1C5LH 2QXJA 1S0RA 3LKWA 5LPFA 1H9IE 2G55A 2VVCA 3MO9A 1O3IA 2OCVB 3LT3A 1AMHA 3PB1E 3V7TA 2Z3DA 2VIOA 2BZ6H 1O2PA 4I7YH 5HM2A 4X8VH 1FJSA 1BRUP 2BD7A 2WV5A 3C27B 4TY7A 2J94A 4YOJA 1THRH 2GCTC 2VVUA 2VWNA 1OYQA 2A2QH 1XMNB 1C5VA 2GD4B 1QB6A 3PTNA 3E90B 4LZ4B 3SGAE 1Y3YA 1C2IA 2BM2A 2BQ7B 3ZZ4A 4FXGH 1O33A 4NA8A 3PWCA 2BDGA 4KTSA 4YT7H 1FUJA 1Z8JB 2OLGA 1GHXH 1SLVB 3SU3A 2FI4E 3S9CA 1WV7H 3ZZDA 3SOSA 1G9IE 1QL8A 1W13U 3MFJA 4AZ2B 3AASA 1LMWB 4ABBA 3M5MA 1WOFA 1SVPA 4FVDA 2H2ZA 2Z3EA 3L6PA 1HAZB 2ZCLP 2FOFA 1RIWB 2TGPZ 1EZQA 1NRRH 4XOJA 1CBWB 3MH5A 5GCHF 1FZZA 1Z6JH 2B5TB 6GCHF 1QJ6B 1BDAA 2J2UA 2ZU4A 4I8HA 2UWPA 1RS0A 1YCPH 5E0HA 1UO6A 2W7SA 1EZSC 1EJMA 2O8TA 3N7OA 1Y3XA 2FODA 5HGGA 1GMDF 1IHSH 2P95A 2ZDMA 2SGDE 1FDPA 3K6YA 1F0SA 1S6HA 1D4PB 1L4ZA 2A4OA 1C2EA 1C5ZB 1GMCF 3KCGH 3VGCB 2AMPA 2Y81A 1MBQA 2BVRH 3RC6A 2G4UA 2GMTB 1LPGB 1JRSA 3SUGA 1UTKA 1KXAA 3Q76A 1C1OA 1ELEE 1UMAH 3HATH 2W3KA 4DT7B 4KELA 1TPPA 3T2NA 1FN6A 4ISLA 1AQ7A 2B8OH 2A4QA 3M3TA 2WUBA 1ELBA 2VIWA 1OP2A 1VITH 4ZMAH 3ZVGA 2PUXB 4RKJB 3STJA 1FONA 2C3SA 2PHBA 1GBBA 1P04A 2VIPA 3MHWU 1QRXA 3P70B 3RXDA 3SNCA 3GISB 1YM0A 2ODPA 1CA8B 2XWAA 2ZFPH 3KIDU 4Y0YE 4BXSA 5IDKA 1GI5A 3ZZ8A 1P2OA 2GT8A 1XKBC 2R2WU 7ESTE 3VB6A 1NN6A 1PPHE 1S81A 1AO5A 3SBKA 2BQ6B 1L4DA 1YCPM 3M7TA 1V2NT 7GCHF 2G00A 2R3YA 3RP2A 1DITH 3LGUA 4ABHA 4TWWA 2AERH 2M5TA 3I29A 1AVGH 1GHYH 5SGAE 3ZZ3A 2GGVB 1ZLRA 1JOUB 1SGQE 3JZ2B 3LU9B 1DY8A 1XUKA 2R3UA 1SGIB 4Q2KA 5LPRA 1ZOMA 4I8GA 2JETC 2ZHDA 4X2XA 5BPEA 2QXGA 2VNTA 5EQQA 3QN7A 3FP7E 3GDVA 1G36A 3P8GA 4PROA 1C9TA 4MPUA 2F3CE 1T8OA 1TALA 2A2XH 1AY6H 2C93B 2A7HA 3GYLB 3LONA 4E06H 1L1GA 1MZAA 3T5FH 1GDUA 2Y5HA 3U8RH 5DO4H 3BIUH 3OY5U 2STBE 4Y8YA 5A8ZA 1SGPE 3SJOA 3Q3KA 2SGPE 1GGDC 1QJ7B 3SORA 4Y10E 4IMQA 2IPHA 2XC0A 4GCHG 2HRVA 4CREA 3A88A 3ZZAA 2BOHB 1S0QA 4OGYA 1P2IA 3LPRA 5L2YH 4Q80A 1GMHF 3TIUA 3KGPA 2H9TH 2FX4A 1BBRH 3VXEH 5EPYA 1LHDH 1BTYA 2W3IA 5A0CA 3ZVCA 3RUOA 2W7UA 4Y6DA 4ABAA 1GJ7B 1C2LA 1L1JA 5J4QA 2ZNKH 4UFEH 4MNYA 1W10U 1MCTA 1TGNA 1KDQA 4NGAH 6LPRA 4BTIB 4CH8B 2FI5E 4CR9A 3NKKA 2W5EA 4NIVA 3ZZ5A 2PKAA 5F6MA 2F9PA 2BX4A 1F7ZA 3BG4B 2ZU2A 3OY6U 1C5NH 1S5SA 1AIXH 1GJCB 1HAIH 3V12A 2UUYA 1DPOA 1DLKB 1NFUA 2NU0E 2SGFE 2ZFQH 1YLDA 1EB2A 3RXUA 3A8DA 1GI0A 1EOLA 3GY5A 2GX4A 5AFYH 2EA3A 1XXDA 5FPTA 1E35B 3ZZBA 3UTUH 1A3EH 2VIVA 1ZRKA 2BD2A 3UWIA 2ZFFH 3BTWE 1CT0E 4FUHA 4Y8XA 8ESTE 4UONA 4O9VA 4MQAA 2PR3A 1DANH 1W0ZU 3ZYDA 1CO7E 1O2SA 2H5DA 1AFQC 1GVKB 3GCHC 3BEFB 1CSOE 3NCLA 5GJ4B 2EI7A 4AYVB 1C5WB 1DICA 2ZTYA 2C90B 1AFEH 4X2YA 3ODFA 4AFQA 1HJAC 1C1UH 2W26A 3AAUA 2ZFRH 2VU8E 4WMDA 4YOIA 4NSVA 4AB9A 1C4V2 1TRNA 3UFAA 1ESAA 2BDYA 3M7UA 1IQEA 1SBWA 1F0RA 1GBJA 3HK6B 2BY6X 1FY5A 1GBTA 4IC5A 3F6UH 1MKWH 5ABWA 1O2XA 2ZDLA 1KXBA 1TPSA 1AE8H 1TNKA 1HB0B 1F5LA 2QC2A 5C1UA 1A0JA 1BUIA 4ZKRU 2F83A 1BOQA 1V2KT 2ZHFH 4ISHH 1TABE 1P05A 1BMLA 4K60A 3LH1A 3ZVEA 1O35A 1WU1A 2VH6A 4FU8A 1HJ8A 3ATKA 1TPOA 4J2YB 1C5MD 1O2YA 4D7GA 1PPGE 2D2DA 1TNJA 1SOTA 2BY7X 3GY2A 2BHGA 3M3VA 1SLWB 2LNCA 3UR6A 5AF9H 4CRBA 5FXLA 1P06A 1HNEE 2AMQA 4X1QU 4MNVA 2V0BA 4X8UH 5A09A 5FX5A 1HV7A 4JK5A 2RDLA 1UK3A 3ZZ6A 1OOKB 1VGCC 2JH5D 2QIQA 2EI6A 2C8WB 4X8TH 2HOBA 3U69H 5DJ7A 4FUDA 1C5TA 2AFQB 4GAWA 1O2MA 1GCDA 5C1YA 1UVPA 2R0LA 2SNWA 5FCRA 1BTPA 3KF2A 1GBEA 2FIRH 2HNTE 1FQ3A 1BRCE 1IQKA 4JZFH 1WTHD 1FPHH 4JYUH 4LZ1H 1V2JT 2OINA 4X6PA 1QA7A 1C5YB 1AKSA 1WUNH 2Q6FA 3ATWA 3ATIA 4YM9A 1ZZZA 2ALPA 2BY9X 3STIA 3U8OH 1TE0A 1GJ4H 1P9SA 1ELDE 2VWMA 1XKAC 3SN8A 4IN1A 1XM1A 4JZ1A 1KXFA 2A32A 4KP0A 1GJ9B 3HGNA 4AFSA 2ZGBH 1HJ9A 1UTLM 1J9CH 1NS3A 4WH6A 1FMGA 3GDSA 1AB9B 4D76A 1G2MA 3UNSA 1MUEB 3QDZB 1EPTA 5DK1A 1EKBB 1TNHA 4JZIA 2J9NA 4Y7AA 1O3KA 1WSSH 1GHAG 3BTME 2RCEA 1MMJN 1MTNC 1B7XB 1D3QB 3O8RA 1HYLA 1RXPA 1O3HA 4WF8A 5E0GA 3SNBA 1B0FA 3GY3A 2A1DB 2P8OC 3KNXA 2H6MA 1UTJA 1HAXB 4UD9H 1TB6H 4TY6A 4XE4A 1XVOA 3F68H 1ORFA 3Q77A 2ILNA 3PMHB 1AWHB 3OYPA 1MAXA 3ATLA 4Y76A 1INCA 2CHAC 1JBUH 2GT7A 2HNTF 3MU4A 3TPIZ 1EJNA 1CU1A 2ZP0H 1MQ5A 2ZHQH 2AGGX 4MVNA 2P3UB 1QNJA 4ABFA 4OS7A 2JH6D 3A82A 3E0PB 3KQCA 4B74A 3GCTG 1LPZB 3A7YA 1QBNA 5K0HA 4SGAE 1Z1JA 2O8WA 3R0FA 3SNAA 4B75A 4INLA 4E05H 7KMEH 1ZTLA 2ZECA 3BTDE 2ZZUH 3DFLA 3M3SA 2F9NA 3PLPA 5A0AE 2ZDAH 2BMGB 2OC0A 4X6MA 1ZSJA 3F9GA 3TNSA 1HAVB 1DY9A 1O3EA 1D6RA 1ZMJA 2BLQA 3QUMP 3QWCH 2A5KA 3P92A 3NPSA 4A92A 1V2QT 3BTQE 3F9FA 3Q3YA 4U30A 5J4SA 3B8JA 1YPJH 3ZZCA 1W2KH 1VCQA 2C8ZB 1LQEA 4ZKOU 1ELCA 5L30H 4K8YA 2VGCB 3MO3A 3CS7A 3PMAB 5EODA 3RXFA 3KQBA 1BHXF 1V2OT 1O3DA 1O37A 3E3TA 5GPIB 5EQRA 1P11E 1KLJH 1SHYA 3UUZA 4BAOB 2GZ7A 3SU0A 4B2BA 2BY5X 2BQWB 1SMFE 1YF4A 4H6TA 8LPRA 5FHTA 2BD4A 1N8OB 3RXPA 2OUAA 1N6YA 3U8TH 1BTXA 1HUTH 2ZQ1A 1HAPH 1A46H 1G32B 4OGXA 1P03A 3RLYH 1UVSH 1C9PA 2A7JA 5DP4A 1LVBA 4GCHF 1AZZA 2I6QA 1H4WA 3V13A 2PFEA 1MCVA 1ETRH 3TVJB 1K1IA 3SUDA 4ZXYH 2QA9E 3RXSA 3B23B 1YPLH 2BLWA 2ODQA 1CE5A 1DXPA 1SC8U 2G5VA 1SR5C 3VPKA 3H7OA 2FP7B 4UDWH 1ARBA 1UCYK 2F9OA 2ULLA 2VWLA 3TJNA 1MKXH 2XRCA 4NFEA 4UFFH 1YBWA 4XBBA 1QRZA 1TMTH 1VITF 3E91A 4NCYA 2Z9GA 3LGIA 3MTYA 3TK5A 1UJ1A 2Y7ZA 2EC9H 1HAOH 1A0HB 1RTKA 4O3UA 4UFGH 1GJ8B 2D26C 1DDJA 2B9LA 4K1EA 2NU3E 4XBDA 1DUAA 2OC1A 2OTVA 1DVAH 3PLBA 2AEIH 1ZHMA 3Q00A 5CHAB 1ZHRA 3ZV8A 2QGRA 4BNRA 4TYDA 6CHAC 1GHBG 2TPIZ 3MMGA 1TX8A 1OPHB 1O5GH 1FIZA 1TAWA 1GI6A 2F9UA 1BBRE 1A4WH 1EPTC 1J16A 4X6OA 3FANA 3QTVH 5FPSA 3RXOA 1RJXB 1Q2WA 2O8UA 4ZUHA 1Z1IA 1C1PA 1PQ5A 1M9UA 4NA9H 3S69A 2PLXA 3A7ZA 4UFDH 1TNGA 1OP0A 1SPJA 3SV9A 1WAYB 2AGEX 4BANB 3BV9B 1YC0A 2ALVA 2FDAA 3ZVDA 1DWCH 1TPAE 1XX9A 1G3CA 3E16B 2O9QA 2SNVA 1KTTB 1CQQA 1FNIA 2UUKB 2OQ5A 2OBQA 3QZQA 5FAHA 4H6SB 1V2TT 4YZUA 1LTOA 2NU1E 4AB8A 4RKOB 2BVXH 3SZNA 2B0FA 2ZHWH 2CMYA 1O5CB 1D3TB 4GPGA 1ZRBA 1TGTA 2P3TB 3OU0A 4CRGA 4DJZB 5H4IB 1QRWA 3ELAH 3P95A 1ZMLA 1E0FD 1G2LA 5A8YA 1H9LB 1TQ7B 4X1PU 2TGDA 2BD5A 1B0EA 2FLBH 1C5OH 5GXPA 5CHAC 4WMFA 2SFAA 4AGJA 1GBLA 3VXFH 3ESTA 1SG8B 1K21H 2NU2E 1B5GH 2G52A 4BAMB 2XC5A 1TYNA 5BRRE 1AU8A 3M7QA 1PJPA 1FY8E 3KN2A 4BAQB 1KLIH 3MNBA 2ZGJA 2ZG0H 1H9HE 1D9IA 1CT2E 2BZAA 2BXUH 3EA7A 4OS4A 3ENSB 1K22H 5EXLA 1V2LT 1O38A 1TNIA 4F4OC 4NIWA 3RC5A 1C1QA 4GLYA 1EX3A 2ANKH 2ZPSA 1RIWC 1ELAA 2FLRH 1C5SA 1FY3A 1UTQA 1SGEE 3SU1A 3F9EA 4E7NA 1UHBB 1L0ZA 1OWDA 1CBWC 3DHKH 1HIAB 1XUJA 1P09A 1Y5AT 4DIHH 3QO6A 1P2KA 1PQAA 1GBMA 4ZHMU 1SGFA 1SGDE 3QK1A 3UQOA 3PROA 1AUJA 3IG6B 4HGCA 1HXFH 3TH2H 3RXIA 1FI8A 1P2QA 4K1SA 3RM2H 3F1SB 1O3BA 1AWFH 5HXFA 1ESBA 1JXPA 3DUXH 3VGCC 1SFQB 1S83A 1TOMH 4LXBH 1JRTA 2GMTC 4NSYA 2A0QB 1ZGIA 4J1YA 5JB9S 1UTPA 2TGTA 5TCAA 3P8FA 1FLEE 4K8BA 5L2ZH 3RXCA 4JMYA 1LKAA 3K6ZA 3M35A 1O5BB 2AGIX 1O3MA 1C1RA 2J92A 3RMMH 3SI4H 4IBLH 5IYTA 2ANYA 3JZ1B 1OYTH 1GDQA 1AUTC 1OWKA 1A5HA 2BDHA 3K2UA 1O2QA 1OWIA 2UUFB 2XNIA 1BITA 3PO1B 2BD3A 4FU7A 1YLCA 5EOKA 1LVMA 1YPKH 3ODDA 4GHQA 1GL0E 2XCFA 1UCYH 1BHXB 1TBZH 1FIWA 2PGQB 1FY1A 1MTVA 1O2NA 3H7TA 1GBIA 3SQEE 1Y5BT 4INKA 4ABJA 3E0NB 2HPPH 4K69A 1O2WA 4AN7A 1KTSB 4IW4E 5PTPA 3EYDA 3SQHE 1O31A 2RA3A 3A7WA 3SV7A 1G3BA 4ZHAA 4ZKSU 3OX7U 1SFIA 4U01A 3SV8A 2ZGXH 1HXEH 1C1WH 1K1JA 3URDA 4IS5A 3GCTF 3G01A 3TGKE 4WMEA 1QA0A 2AMDA 3BTFE 3O8DA 2BB4A 3FP6E 1ESTA 2RG3A 3GY4A 1GCTB 2V3OH 5EW1H 1SSXA 3E6PH 4I8KA 1IQMA 1DXWA 1GBFA 3BTTE 2OP9A 5EG4A 3QZRA 2RA0A 4A1XA 3KHVA 3PTBA 1P10A 3RU4D 2QY0B 1CGIE 1BTZA 1J8AA 1C1SA 1N6XA 3HK3B 1O3OA 1O5FH 5F8TA 1DWBH 2R0KA 5C2ZA 1P8VC 4X2WA 2WUCA 3UPEA 1SGYE 5C20A 1CHOF 1SGFG 3MU1A 1ETSH 1LVOA 2ODYB 1KLTA 4HZHA 4ABIA 4NG9H 1IQFA 1BZXE 3RXAA 1XUIA 1QGFA 4ASHA 1VZQH 4BAHB 4JCNA 2HVXA 2OBOA 3RDZA 3PM3A 1BMMH 3PMJA 1NM6A 1A61H 4X1RU 3SJ8A 1E34B 2H9EH 3A7TA 3MYWA 4ZAEA 3BSQA 1SQTA 2ZEBA 4E7RG 2Q6DA 5EPNA 3UQVA 3PWBA 4Z0KA 1K1OA 2QCYA 1QB9A 1TGSZ 3VB3A 2PKSB 2VIDA 4CRFA 3LC3A 3T25A 1O5DH 1TX7A 1O2UA 3E8LA 4X2VA 1ZTJA 3VB5A 1BTUA 1LO6A 4WVPE 2VWOA 3GY7A 5GIBA 1NRPH 1E37B 1ABIH 4I33A 3RXBA 3MWIU 2PSYA 1GI8B 2ZQ2A 1XUGA 3FVFB 4LK4A 3U1JB 2QF3A 1ID5H 5C5NA 2G4TA 2ZTZA 1CGJE 2P93A 3BG4C 4KTCA 5ESTE 4DIIH 1J15A 3TU7H 1MH0A 2G5NA 3ZVFA 1H8IH 4FUIA 3C1KA 2H5CA 3QLPH 4B71A 3LH3A 4BOHA 1F0UA 1SOZA 1K2I1 5C67A 4WXVA 5T6FA 1EP6A 2IN2A 1UTMA 3A8AA 1C2KA 3EGKH 1ANDA 4VGCB 3T29A 2GTBA 1SLUB 2UWLA 1BIOA 1AD8H 2G8TA 3SU6A 3LGTA 2SGQE 1AVXA 1BCUH 2J4IA 1GBKA 2WPJS 3ZVBA 1BJVA 1ZSKA 1Z71A 4INHA 1O5AB 1TRYA 1O30A 5EXMA 1D6WA 1C2JA 1AGJA 2FOEA 1G37A 1SLXB 1ZPZA 3ZZ9A 4B73A 1O34A 3BN9A 4YLUA 2FTMA 1SHHB 3U9AH 4YO9A 1QB1A 3FAOA 4A1TA 1EP5A 1BMNH 3A89A 1CGHA 1TBRH 3KL6A 1O36A 2HLCA 2BTCE 1HAVA 2V35A 3P6ZB 1KDQB 4B2AA 1G30B 4MPVA 2PKAB 4AORA 1OWEA 2Z9LA 2DUCA 1HPGA 1DOJA 2FO9A 1U6QA 3AW0A 4CHAB 1EQ9A 2Y82A 2H9HA 1JIRA 1AVWA 1TA6A 1O2LA 1P12E 3LGYA 1ETTH 2WPKS 5EGMA 3M5LA 1LHFH 1L1NA 3IWMA 1NTPA 3SU4A 1JIMA 1XUFA 4TPIZ 1GHZA 4BXWA 2QV1A 3LOXA 4ZH8A 1D3PB 1K1NA 1UVTH 1PPBH 1YYY1 1UK2A 1MQ6A 2WPLS 1GHWH 2PV9B 4DGJA 1GJAB 4MDSA 4O03A 2PWXA 4NWKA 1EAWA 2ZF0H 2Z9KA 1YPHE 2XBYA 1BT7A 1FV9A 2C8YB 4KKDA 3PV4A 3H5CB 3EA9A 3RXTA 3A84A 3ZZ7A 2IOTA 1FN8A 4O97A 3RXJA 3SJ9A 3B9FH 1Y3WA 1BRAA 1CHGA 3TJVA 2UWOA 3GICB 2PW8H 9LPRA 3UR9A 3SUFA 1AHTH 4CRAA 1LKBA 2YOLA 3RU4T 4B76A 2ZIQH 1O39A 4NWLA 1CVWH 4GSOA 4BAKB 1Y5UT 1D3DB 2HALA 3MU0A 1YCPK 2FI3E 1ZJKA 3CP7A 4FUGA 4CHAC 3V0XA 2BLVA
chains in the Genus database with same CATH superfamily
1EAUA 4YLQH 1SGTA 2WPMS 4F49A 4KGAA 3SJIA 3UWJH 4I31A 1Q31A 4BTUB 3K65B 5DSFA 4CRDA 1HBTH 4JYVH 2THFB 5ETXA 5DPAA 4WWYA 2TIOA 3RXLA 4YT6H 1NFXA 2GVFA 2BLOA 1CA0B 1KY9A 3W94A 1AB9C 3GCOA 3SNEA 7LPRA 2Y5FA 4MG3A 1W14U 3TLOA 4UE7H 3LDXH 6ESTA 1T31A 1VJAU 1O3AA 1C1MA 1MD7A 3NK8A 5F03A 1ELVA 3PRDA 1P57B 1QBOA 2A7CA 5K7RA 4X1SU 3LGVA 1NU7B 5E8EH 3AVZA 2YNBA 5E2OA 1UK4A 3D49H 1C2FA 1OSSA 3FZZA 2NWNA 3EAJA 3ATMA 3WY8A 2FPZA 4SGBE 4Z6AH 2JKHA 3DFJA 3FFGA 5T3HA 1V2PT 2JH0D 3HPTB 2GCTB 1KXCA 5EU8A 4AFZA 1WBGB 2GCHG 1V2UT 3EE7A 2TGAA 2KAIB 3OE7D 3DD2H 1ANEA 1GDNA 3MH4A 3SV6A 3OTJE 2H1UA 2GZ9A 1MTUA 2FS9A 1K28D 1GHVH 3TJOA 2PUQH 1QJ1B 5C1XA 3U98H 1GWAA 5C5OA 1SKYE 2BDAA 2FOAA 2XBWA 4MPWA 5AHGH 1IQHA 1TFXA 1A1RA 1ZMNA 1HRTH 1NBME 1EB1H 4MTBA 4XDEA 3UNQA 2ZU3A 1O2RA 2IJD1 2Z9JA 2FOGA 1DE7H 3A81A 1O2IA 3BG8A 2QE7D 5DKMA 2AIQA 4K5ZA 1NC6A 5TCCA 2Y5GA 1DT2A 1H8DH 3SNDA 1T32A 1S84A 1V2VT 3BIVH 1A5IA 1UCYE 1KMHB 1ELFA 2OK5A 1LDTT 4R0IA 5DP6A 5GDSH 1TONA 4X0WU 2VGCC 1TWXB 5F8XA 3KYGA 5EXNA 2ZTXA 1VKYA 3FZDA 1UHBA 1RTFB 2EEKA 1T8MA 3ZYEA 1HIAA 4DG4A 3A83A 3RC4A 2ZCKP 3SHCH 2VINA 2ZKSA 5HKKD 1Q3XA 1EATA 1N8OC 8GCHG 2Q6GA 2QN5T 3F2GA 1W3CA 4A6LA 4IC6A 1V6DA 1HAYB 3KQDA 2J34A 1LHEH 2Q1JA 1QCPA 2P3FH 2PSXA 1BBRK 3BTHE 1NESE 3HGPA 3LJJA 3P8OA 1TOCB 2WPHS 4ABGA 4OS2A 3UREA 1XXFA 1DLEA 1RGQA 1ZGVA 4D8NA 4K1TA 3BTGE 1GJDB 1MTWA 2ANWA 2ZWLH 3T62A 1KIGH 1ZJDA 3P8NA 4ISIH 2XWBI 1PPCE 1TIOA 2SGAA 3MH7A 1V2ST 1ZPCA 3A7VA 1MAYA 1THPB 3PYHA 4Y0ZE 4Y7BA 5JBBS 3I78A 1GBDA 3VG8A 1DSTA 1W11U 4Y11E 1GJ6A 1PPFE 2G81E 2OQUA 1EASA 5E2PA 2UUJB 2YMSB 3SGQE 2XW9A 4JYTA 1ARCA 1F0TA 2QYIA 1VCWA 5ESBA 1A2CH 1J17T 3TITA 4A7IB 3SI3H 4ABEA 2AIPA 4NA7A 2GV6A 2KCPA 1F5RA 1O3JA 2Y6TA 4ABDA 3EQ0H 1SI5H 1C4U2 4JZDH 3GDUA 2ZC9H 1W8BH 1FY4A 1QHRB 3TK9A 5A8XA 3MO6A 3A87A 4MNWA 1IOEA 3T26A 1TBQH 4Q7ZA 3SGBE 1XUHA 4FUFA 3DCLA 4JZEH 1P2MA 1P02A 2R9PA 4F55A 5A2MH 1QQUA 5TJXA 4FUBA 1RFNA 2A5AA 4RN6A 3FP8E 1FXYA 2CN0H 4R8TB 1Z7KA 2AH4X 3BEUA 2WYGA 5HYOA 1YPGH 1Z6EA 1OWJA 3VB4A 4MLFB 3DA9B 1QR3E 1PFXC 4M7GA 1C5UA 1NO9H 2PGBB 1E38B 3F2HA 1O32A 2JETB 1MKWK 4X6NA 3GOVB 1DWDH 2FOHA 3RXVA 3PLKA 2CXVA 4AOQA 1QTFA 1P9UA 3Q3XA 2KX4A 1C5PA 2WYJA 5CE1A 2SGEE 2FWWA 5DP3A 3BF6H 2ZA5A 4ISNA 1L2EA 1NY22 2K1QA 3VFEA 1EAXA 2HGTH 2OD3B 5DP9A 4ZCNA 3CS0A 4YOGA 1FPCH 3SU5A 4WY3A 3RXHA 3MOCA 1W12U 3ITIA 2EI8A 4IGDA 1ANCA 4P02A 1GGDB 1V2WT 4IN2A 1UTNA 2DE8A 1MTSA 2RFKC 3M36A 1T4VH 4ESTE 2VVVA 2LELA 3QGJA 1J14A 1LHGH 2WPIS 3U1IB 1IQLA 1GPZA 1VJ9U 1P2NA 1TQ0B 1GJBB 9ESTA 1AE5A 3L33A 3DT0H 1TLDA 4CBOA 2BDBA 1K1PA 1YPEH 4TWYA 1GG6B 3OTPA 4Y79A 3LC5A 2JJ2D 4MPXA 1OXGA 5DG6A 2D8WA 1GHAF 1F5KU 3QX5H 2QXIA 2ZPRA 1YGCH 2XXLA 5LPEA 2VIQA 1O2ZA 4OS1A 3D62A 4XSKU 1BTHH 1X7AC 1ZTKA 4X8SH 2F91A 1T4UH 3S9AA 3A7XA 1NFWA 1UTOA 2XYAA 1TA2A 1UVUH 4A1VA 2VB0A 3TK6A 1QL7A 2W6JD 3UNRA 1G3DA 1K1LA 3MNXA 3PV2A 4WJG2 1GBCA 1EXFA 1TGCA 1O2JA 2ZU5A 5JBCS 3UY9A 4DOQA 1BMFD 1C1TA 5CMXH 4AG2A 1KSNA 2HNTC 2GDEH 1SB1H 1ABJH 2FMJA 2P94A 4TSFD 1TGBA 5DGJA 1PQ7A 1SGNE 3MH6A 4IMZA 1P01A 8KME2 1T7CA 2Z6BD 3LJOA 1C1NA 3M37A 2OC8A 4NZLA 1HAHH 1W7XH 4HTCH 1C2MA 1ANBA 4DW2U 3RXQA 2ZU1A 3LIWA 2QF4A 2OXSA 1GJ5H 3GY6A 1MBMA 1AFQB 2XBVA 3S7HB 3VEQB 1K9OE 3GCHB 4D7FA 1NFYA 1O3LA 1UVOA 1IQNA 2R2MB 5HM9A 3S7KB 3CNRA 5FBIA 3EDXB 1S82A 1HJAB 3SO3A 1NU9A 4DURA 5GWZA 1WCZA 1LVYA 2V3HH 2BDCA 1BJUA 2WINI 4AYYB 1HAGE 1SL3A 1GG6C 2AYWA 4YTAA 2WV4A 1EAIA 1A3BH 1LPKB 2HPQH 3A8CA 2CGAA 4Q4LA 4BTTB 1EOJA 1A0LA 1GBHA 3UOPA 5LH8A 1PPZA 2TRMA 1VITG 1YPHC 1ZR0A 1C1VH 4H42U 5T6GA 1PYTD 2OC7A 2CV3A 3PO1C 3W95A 1C2HA 1VCPA 3MU8A 5CHBA 1C4Y2 5JDUB 3RMLH 3OSYA 2D1JA 1QQ4A 1KXEA 2PTCE 3VB7A 4FVBA 5KEDA 2HWLB 1RD3B 2FOCA 3GCNA 1Y8TA 2G51A 2ZGCA 4K3JA 4NZQA 1FAKH 1N1LA 1NRSH 1GBAA 1ACBE 5HMAA 2Y80A 1OKXA 1FAXA 1EZUC 1DX5M 2A5IA 2NU4E 2ZGHA 1OP8A 3E1XB 3UIRA 1A7SA 1YKTA 2BD9A 3TH3H 1QL9A 4GUXA 4OS5A 2GCHF 3MU5A 1SGRE 3MNCA 4THNH 1ZSLA 5E0JA 2QF0A 3K9XB 1G3EA 5JPMH 1W0JD 3PV5A 1OX1A 1BB0B 1IHTH 1C5XB 2LPRA 1ELTA 1SGCA 5LGOA 1BRBE 1VGCB 2IJOB 2J38A 5DP5A 4DCDA 2KCAA 4RSPA 3FOAA 2YNAA 4XFQA 4AGKA 1GCTC 4TPYA 1O2KA 1O3CA 3LGWA 1KYNA 2QXHA 4U2WA 5EQSA 5B6OA 1OS8A 3SW2B 1O3FA 1Y3VA 4NIXA 5T6DA 2XNDD 3L3TA 4AFUA 4AG1A 3BEIB 1S6FA 5GCHG 6GCHG 1EUFA 1Z8RA 1SQAA 2Z9IA 4NFFA 1VR1H 1ZYOA 4FU9A 3D65E 2CF9H 5DP8A 2ZPQA 1BTWA 1C5RA 1DS2E 1W0KD 5L6NH 2A31A 3AW1A 3CENA 2FOMB 4I8JA 4HI3A 1GMDG 2A4GA 2ASUB 4I32A 2ESTE 3I77A 1MD8A 1TX6A 2BVSH 1DSUA 2XOKD 3OAAD 1JWTA 2Z3CA 4FUJA 4B2CA 2ZDKA 1GMCG 3GYMA 3KQEA 1GHBF 1T8LA 2FZZA 3BTEE 1GVZA 1ZPBA 4ISOA 5DP7A 1P3EA 1TMUH 1WQVH 3O8BA 1PPEE 2C4FH 1BA8B 1SQOA 3RXKA 1HLTH 8GCHF 2VH0A 1YWUA 1O0DH 1THSH 4CH2B 2BXTH 1QFKH 2FOBA 4QT8C 3RXGA 3RM0H 1W0YH 3TGJE 5I25A 5EW2H 3RXEA 1MU8B 1HGTH 2O8LA 2V6NA 2PKSC 2ZDNA 1W7GH 1Y3UA 1HDTH 3AAVA 4ZROA 1MTNB 5FCKA 1F2SE 1GI2A 1O3GA 1PYTC 1QIXB 1MKXK 3M5NA 1TNLA 2DE9A 3SHAH 4A5TS 2P8OB 1S85A 4Q7YA 1LQDB 4OS6A 1NT1A 1OWHA 5AVDA 1GVLA 2BX3A 3A85A 5C3NA 2P59A 2WV9A 3P17H 1JMOH 1GI7B 4I8LA 2P16A 1AZ8A 4DY7B 2CHAB 3NUMA 3SUEA 2FEQH 5JYIA 3GY8A 3V3MA 2IPQX 3MNSA 2F9VA 4WXIA 2BDIA 2XCNA 5FPYA 3TNTA 2BY8X 3D23A 1GI4A 2STAE 7GCHG 4VGCC 1O3NA 1O5EH 2ZFSA 3HKJB 2FM2A 1NPMA 3NWUA 4DT4A 2KAIA 1GI3A 4UEHH 4Y8ZA 2QAAA 1AI8H 4WH8A 1NRNH 4K2YA 5JB8S 1NRQH 2ZFTA 1V2RT 2FTLE 2BOKA 3BTKE 2Z94A 1Z8GA 2BYAX 1BMAA 4LOYH 4JK6A 2Y7XA 3F9HA 2FXRA 2GP9B 4B1TA 1FX0B 3KQ5A 5F8ZA 1C5QA 1DFPA 2XC4A 4CBNA 1T8NA 1BQYA 1H1BA 3RXMA 3TGIE 1IQGA 1ELGA 2C8XB 1MZDA 1LCYA 4FUEA 4FUCA 1A5GH 4XBCA 2PTNA 1GI9B 3T27A 4D9QA 1K1MA 4KTUA 2JIZD 2FYQA 1QY6A 3IITA 3ZV9A 4I86A 4HFPB 5AFZH 1TMBH 1XVMA 3F2FA 1E36B 2A45B 2ZO3H 4D9RA 1WQSA 3O8CA 1ZHPA 1EJAA 2FS8A 2ZHEH 1DM4B 4YESB 1P0SH 1KXDA 3SJKA 3UAIC 5IK2D 3KEEA 4ZHLU 3UB0A 3A8BA 4Z1MD 1IAUA 2CJIA 2LP6A 1LHCH 1HFDA 1GMHG 4H4FA 2TBSA 2O8MA 1O3PB 3A80A 2J98B 2GKVE 5JBAS 3SV2H 3QTOH 1EZXC 3S0NA 1C2DA 3TH4H 4Y71A 4U32A 4GHTA 3URCA 1WYKA 2ANMH 1HCGA 3PMBB 2L74A 3R3GB 2FYRA 2CF8H 2Z7FE 1RRKA 2GV7A 1Z8IB 1YP9A 1O2TA 1WTGH 3M5OA 3S9BA 1DUEA 1NROH 2XBXA 1CT4E 1DWEH 3UOUA 5B6LA 4NIYA 4O3TA 1GL1A 1PQ8A 2AS9A 2I6SA 1AKSB 1QURH 1O2VA 1IQJA 4MNXA 1P2JA 2ZDVH 3A86A 4DVAU 1RTLA 1V3XA 3KYFA 3TJUA 1CHOG 4GVUA 3M61U 1V2MT 4Q63A 4AX9H 1O2GH 2ZCHP 3SU2A 1O2HA 3F0PA 1IQIA 1GI1A 1O2OA 1TRMA 2XTTB 1C2GA 2FX6A 2VJ1A 6CHAB 2B7DH 4CR5A 5A0BA 5I46H 1QBVH 3RU4E 2F9BH 3QGNB 5EJZA 3NZIA 4X1NU 3FN8A 4Q7XA 5G4BA 1EPTB 1MU6B 5FX6A 3ZVAA 5FBEA 3T28A 2GDDA 1CA0C 3HKIB 1YPMH 3EA8A 3RXRA 2J95A 1F92A 3RMOH 3EE0B 1P3CA 3FO8D 2FESH 1E1QD 4CRCA 1AN1E 3MI4A 2A4RA 3RLWH 1NZQH 3NXPA 4ZKNU 2GZ8A 2ZI2H 5JBTA 2BD8A 1Y59T 3RMNH 4ZXXH 1C5LH 2QXJA 1S0RA 2KR7A 3LKWA 5LPFA 1H9IE 2G55A 2VVCA 3MO9A 2HVYB 1O3IA 2OCVB 3LT3A 1AMHA 3PB1E 3V7TA 2Z3DA 2VIOA 2BZ6H 1O2PA 4I7YH 2YMSD 5HM2A 4X8VH 1FJSA 1BRUP 2BD7A 2WV5A 3C27B 4TY7A 2J94A 4YOJA 3N7EA 1THRH 2GCTC 2VVUA 2VWNA 1OYQA 2A2QH 1S6LA 1XMNB 1C5VA 2GD4B 1QB6A 3PTNA 3E90B 4LZ4B 3SGAE 1Y3YA 1C2IA 2BM2A 2BQ7B 3ZZ4A 4FXGH 1O33A 4NA8A 2F43B 3PWCA 2BDGA 4F48B 4KTSA 4YT7H 1FUJA 1Z8JB 2OLGA 1GHXH 1SLVB 3SU3A 2FI4E 3S9CA 1WV7H 3ZZDA 3SOSA 1G9IE 1QL8A 1W13U 3MFJA 3WW7A 4AZ2B 5CDFE 3AASA 1LMWB 4ABBA 3GS9A 3M5MA 1WOFA 1SVPA 4FVDA 2H2ZA 2Z3EA 3L6PA 2JJ1D 1HAZB 2ZCLP 2FOFA 1RIWB 2TGPZ 1EZQA 1NRRH 4XOJA 1CBWB 3MH5A 5GCHF 1FZZA 1Z6JH 2B5TB 6GCHF 1QJ6B 1BDAA 2J2UA 2ZU4A 4I8HA 2UWPA 1RS0A 1YCPH 5E0HA 5EJLA 1UO6A 2W7SA 1EZSC 1EJMA 2O8TA 3N7OA 1Y3XA 2FODA 5HGGA 1GMDF 1IHSH 2P95A 2ZDMA 2SGDE 1FDPA 3K6YA 1F0SA 1S6HA 5HIYA 1D4PB 1L4ZA 2A4OA 1C2EA 1C5ZB 1GMCF 3KCGH 3VGCB 2AMPA 2Y81A 1MBQA 2BVRH 3RC6A 2G4UA 2GMTB 1LPGB 1JRSA 3SUGA 1UTKA 1KXAA 3Q76A 1C1OA 1ELEE 1UMAH 3HATH 2W3KA 4DT7B 1QZ8A 4KELA 1TPPA 3T2NA 1FN6A 3DSOA 4ISLA 1AQ7A 2B8OH 2A4QA 3M3TA 2WUBA 1ELBA 2VIWA 1OP2A 1VITH 4ZMAH 3ZVGA 2YMSC 2PUXB 4RKJB 3STJA 1FONA 2C3SA 2PHBA 1GBBA 1P04A 2VIPA 3MHWU 1QRXA 3P70B 3RXDA 3SNCA 3GISB 1YM0A 2ODPA 4RI0A 1CA8B 2XWAA 2ZFPH 3KIDU 4Y0YE 4BXSA 5IDKA 1GI5A 3ZZ8A 4TT3D 1P2OA 2GT8A 1XKBC 2R2WU 7ESTE 3VB6A 1NN6A 1PPHE 1S81A 1AO5A 3SBKA 2BQ6B 1L4DA 1YCPM 3M7TA 1V2NT 7GCHF 2G00A 3F0OA 2R3YA 3RP2A 1DITH 3LGUA 4ABHA 4TWWA 2AERH 2M5TA 3I29A 1AVGH 1GHYH 3WWBA 5SGAE 3ZZ3A 1SQRA 2GGVB 1ZLRA 1JOUB 1SGQE 3JZ2B 2WPDD 3LU9B 3SYJA 1DY8A 1XUKA 2R3UA 1SGIB 4Q2KA 5LPRA 1ZOMA 4I8GA 2JETC 2ZHDA 4RT0A 4X2XA 5BPEA 2QXGA 2VNTA 5EQQA 3QN7A 3FP7E 3GDVA 1G36A 3P8GA 4PROA 1C9TA 4MPUA 2F3CE 1T8OA 1TALA 2A2XH 1AY6H 3MQKC 2C93B 2A7HA 3GYLB 3LONA 4E06H 1L1GA 1MZAA 3T5FH 1GDUA 2Y5HA 3U8RH 5DO4H 3BIUH 3OY5U 2STBE 4Y8YA 5A8ZA 1SGPE 3SJOA 3Q3KA 2F4LA 2SGPE 1GGDC 1QJ7B 3SORA 4Y10E 4IMQA 2IPHA 2XC0A 4GCHG 2HRVA 4CREA 3A88A 3ZZAA 2BOHB 1S0QA 4OGYA 1P2IA 3LPRA 4B6FA 5L2YH 4Q80A 1GMHF 3TIUA 3KGPA 2L6OA 2H9TH 2FX4A 2WSSD 1BBRH 3VXEH 5EPYA 1LHDH 1BTYA 2W3IA 5A0CA 3ZVCA 3RUOA 2W7UA 4Y6DA 4ABAA 1GJ7B 1C2LA 1L1JA 5J4QA 2ZNKH 4UFEH 4MNYA 1W10U 1MCTA 1TGNA 2EQNA 1KDQA 4NGAH 6LPRA 4BTIB 4CH8B 2FI5E 4CR9A 3NKKA 2W5EA 4NIVA 3ZZ5A 2PKAA 5F6MA 2F9PA 2BX4A 1F7ZA 3BG4B 2ZU2A 3OY6U 1C5NH 1S5SA 1AIXH 1GJCB 1HAIH 3V12A 2UUYA 1DPOA 1DLKB 2GJGA 1NFUA 2NU0E 2SGFE 2ZFQH 1YLDA 1EB2A 1NBMD 3RXUA 3A8DA 1GI0A 1EOLA 3GY5A 2GX4A 5AFYH 2EA3A 1XXDA 5FPTA 1E35B 3ZZBA 3UTUH 1A3EH 2VIVA 1ZRKA 2BD2A 3UWIA 2ZFFH 3BTWE 1CT0E 4FUHA 3N99A 4Y8XA 8ESTE 4UONA 4O9VA 2V7QD 2PR3A 1DANH 1W0ZU 4MQAA 1CO7E 1O2SA 3ZYDA 2H5DA 1AFQC 1GVKB 3GCHC 3BEFB 1CSOE 3NCLA 5GJ4B 2EI7A 4AYVB 1C5WB 1DICA 2ZTYA 4FOUC 2C90B 1AFEH 4X2YA 3ODFA 4AFQA 1HJAC 4XRNA 1C1UH 2W26A 3AAUA 2ZFRH 2VU8E 4WMDA 4YOIA 4NSVA 4AB9A 1C4V2 1TRNA 3UFAA 1ESAA 2BDYA 3M7UA 1IQEA 1SBWA 2M2AA 1F0RA 1GBJA 3HK6B 2BY6X 1FY5A 1GBTA 4IC5A 3F6UH 1MKWH 5ABWA 1O2XA 2ZDLA 1KXBA 1TPSA 1AE8H 1TNKA 1HB0B 1F5LA 2QC2A 5C1UA 2HLDD 1A0JA 1BUIA 4ZKRU 2F83A 1BOQA 1V2KT 2ZHFH 4ISHH 1TABE 1P05A 1BMLA 4K60A 3LH1A 3ZVEA 1O35A 1WU1A 2VH6A 4FU8A 1HJ8A 3ATKA 1TPOA 4J2YB 1C5MD 1O2YA 4D7GA 1PPGE 2D2DA 1TNJA 1SOTA 3SZEA 2BY7X 3GY2A 2BHGA 3M3VA 5C94A 1SLWB 2LNCA 3UR6A 5AF9H 4CRBA 5FXLA 1P06A 1HNEE 2AMQA 4X1QU 2J98A 4MNVA 2V0BA 4X8UH 5A09A 5FX5A 3AK5A 1HV7A 4JK5A 2RDLA 1UK3A 3ZZ6A 1OOKB 4ACAA 1VGCC 2JH5D 2QIQA 2WZQA 2EI6A 2C8WB 4X8TH 2J5UA 2HOBA 3U69H 5DJ7A 4FUDA 3OFND 1C5TA 2AFQB 2QF5A 4GAWA 1O2MA 1GCDA 5C1YA 1UVPA 2R0LA 2SNWA 5FCRA 1BTPA 3KF2A 1GBEA 2FIRH 2HNTE 1FQ3A 1BRCE 1IQKA 4JZFH 1WTHD 1FPHH 4JYUH 4LZ1H 1V2JT 2OINA 4X6PA 4B6EA 1QA7A 1C5YB 1AKSA 1WUNH 2Q6FA 3ATWA 3ATIA 4YM9A 1ZZZA 2ALPA 2BY9X 3STIA 3U8OH 1TE0A 1GJ4H 1P9SA 1ELDE 2VWMA 1XKAC 3SN8A 4IN1A 1XM1A 4JZ1A 1KXFA 1YY3A 2A32A 4KP0A 2KCOA 1GJ9B 3HGNA 4AFSA 2ZGBH 1HJ9A 1UTLM 1J9CH 1NS3A 4WH6A 1FMGA 2AHME 1COWD 3GDSA 1AB9B 4D76A 1G2MA 3UNSA 1MUEB 3QDZB 1EPTA 2WHXA 5DK1A 1EKBB 1TNHA 4JZIA 2J9NA 4Y7AA 1O3KA 1WSSH 1GHAG 3BTME 2RCEA 4XD7D 1MMJN 1MTNC 1B7XB 1D3QB 3O8RA 1HYLA 1RXPA 1O3HA 4WF8A 5E0GA 3SNBA 1B0FA 3GY3A 2A1DB 2P8OC 3KNXA 2H6MA 1UTJA 1HAXB 4UD9H 1TB6H 4TY6A 4XE4A 5C17A 1XVOA 3F68H 1ORFA 3Q77A 2ILNA 1MABB 3PMHB 1AWHB 3OYPA 1MAXA 3ATLA 4Y76A 1INCA 2CHAC 1JBUH 2GT7A 2HNTF 3MU4A 3TPIZ 1EJNA 1CU1A 2ZP0H 1MQ5A 2ZHQH 2AGGX 3DSPA 4MVNA 2P3UB 1QNJA 4ABFA 4OS7A 2JH6D 3A82A 3E0PB 3KQCA 4B74A 3GCTG 1LPZB 3A7YA 1QBNA 5K0HA 4SGAE 5FL7D 1Z1JA 2O8WA 3R0FA 3SNAA 4B75A 4INLA 3F3BA 4E05H 1ZTLA 7KMEH 2ZECA 3BTDE 2ZZUH 3DFLA 3M3SA 2F9NA 3PLPA 5A0AE 2ZDAH 2BMGB 2OC0A 4X6MA 5DN6D 1ZSJA 3F9GA 3TNSA 1HAVB 1DY9A 5GNDA 2PP6A 3N7DA 1O3EA 1D6RA 1ZMJA 2BLQA 3QUMP 3QWCH 2A5KA 3P92A 3NPSA 4A92A 1V2QT 3BTQE 3F9FA 3Q3YA 4U30A 5J4SA 3B8JA 1YPJH 3ZZCA 1W2KH 1VCQA 2C8ZB 1LQEA 4ZKOU 1ELCA 5L30H 4K8YA 2VGCB 3MO3A 3CS7A 3PMAB 5EODA 3RXFA 3KQBA 1BHXF 1V2OT 1O3DA 1O37A 3E3TA 5GPIB 5EQRA 1P11E 1KLJH 1SHYA 3UUZA 4BAOB 2GZ7A 3SU0A 4B2BA 2BY5X 2BQWB 1SMFE 1YF4A 4H6TA 8LPRA 2CK3D 5FHTA 2BD4A 1N8OB 3RXPA 2OUAA 1N6YA 3U8TH 1BTXA 1HUTH 2ZQ1A 1HAPH 1A46H 1G32B 4OGXA 1P03A 3RLYH 1UVSH 1C9PA 2A7JA 5DP4A 1LVBA 3OEED 4GCHF 1AZZA 2I6QA 1H4WA 3V13A 1YLNA 1MCVA 1ETRH 2PFEA 4YXWD 4HG6A 3TVJB 1K1IA 3SUDA 4ZXYH 2QA9E 3RXSA 3B23B 1YPLH 2BLWA 2ODQA 1CE5A 1DXPA 1SC8U 2G5VA 1SR5C 3VPKA 3H7OA 2FP7B 4UDWH 1ARBA 1UCYK 2F9OA 2ULLA 2VWLA 4OM9A 3TJNA 1MKXH 2XRCA 4NFEA 4UFFH 1YBWA 4XBBA 5HIZA 1QRZA 2KFWA 1TMTH 1H8ED 1VITF 3E91A 4NCYA 2Z9GA 3LGIA 3MTYA 3TK5A 1UJ1A 2Y7ZA 2EC9H 1HAOH 1A0HB 1RTKA 4O3UA 4UFGH 3FKSD 1GJ8B 2D26C 1DDJA 5EJ1A 2B9LA 4K1EA 2NU3E 4XBDA 1DUAA 2OC1A 2OTVA 1DVAH 3PLBA 2AEIH 1ZHMA 3Q00A 5CHAB 1ZHRA 3ZV8A 2QGRA 4BNRA 4TYDA 6CHAC 1GHBG 2TPIZ 2J97A 3MMGA 1TX8A 1OPHB 1O5GH 1FIZA 3ZIAD 1TAWA 1GI6A 2F9UA 2RDEA 1BBRE 1A4WH 1EPTC 1J16A 4X6OA 3FANA 3QTVH 5FPSA 3RXOA 1RJXB 1Q2WA 2O8UA 4ZUHA 1Z1IA 1C1PA 1PQ5A 1M9UA 4NA9H 3S69A 2PLXA 3A7ZA 4UFDH 1TNGA 1OP0A 1SPJA 3SV9A 1WAYB 2AGEX 4BANB 3BV9B 1YC0A 2ALVA 2FDAA 3ZVDA 1DWCH 1TPAE 1XX9A 1G3CA 3E16B 2O9QA 2SNVA 1KTTB 1CQQA 1FNIA 2UUKB 2OQ5A 2OBQA 3QZQA 5FAHA 4H6SB 1V2TT 4YZUA 1LTOA 2NU1E 4AB8A 4RKOB 2BVXH 3SZNA 2B0FA 2ZHWH 2CMYA 1O5CB 1D3TB 4GPGA 1ZRBA 1TGTA 2P3TB 3OU0A 4CRGA 4DJZB 5H4IB 1QRWA 3ELAH 3P95A 1ZMLA 1E0FD 1G2LA 5A8YA 1H9LB 1TQ7B 4X1PU 2TGDA 2BD5A 1B0EA 2FLBH 1C5OH 2KZ4A 5GXPA 5CHAC 4WMFA 2SFAA 4AGJA 1GBLA 3VXFH 3ESTA 1SG8B 1K21H 2NU2E 1B5GH 2G52A 4BAMB 2XC5A 1TYNA 5BRRE 1AU8A 3M7QA 1PJPA 1FY8E 3KN2A 4BAQB 1KLIH 3MNBA 2ZGJA 2ZG0H 1H9HE 1D9IA 1CT2E 2BZAA 2BXUH 3EA7A 4OS4A 3ENSB 1K22H 5EXLA 1V2LT 1O38A 1TNIA 4F4OC 3OEHD 4NIWA 3RC5A 1C1QA 4GLYA 1EX3A 2ANKH 2ZPSA 1RIWC 1ELAA 2FLRH 1C5SA 1FY3A 1UTQA 1SGEE 3SU1A 3F9EA 4E7NA 1UHBB 1L0ZA 1OHHD 1OWDA 1CBWC 3DHKH 1HIAB 1XUJA 1P09A 1Y5AT 4DIHH 3QO6A 1P2KA 1PQAA 1GBMA 4ZHMU 1SGFA 1SGDE 3QK1A 3UQOA 3PROA 1AUJA 3IG6B 4HGCA 1HXFH 3TH2H 3RXIA 3U28C 1FI8A 1P2QA 4K1SA 3RM2H 2K0QA 3F1SB 1O3BA 1AWFH 5HXFA 5C0TA 1UW7A 1ESBA 1JXPA 3DUXH 3VGCC 1SFQB 1S83A 1TOMH 4LXBH 3PRBA 1JRTA 2GMTC 4NSYA 2A0QB 1ZGIA 4J1YA 5JB9S 1UTPA 2TGTA 5TCAA 3P8FA 1FLEE 4K8BA 5L2ZH 3RXCA 4JMYA 1LKAA 3K6ZA 3M35A 1O5BB 2AGIX 1O3MA 1C1RA 2J92A 3RMMH 3SI4H 4IBLH 5IYTA 2ANYA 3JZ1B 1OYTH 1GDQA 1AUTC 1OWKA 1A5HA 2BDHA 3K2UA 1O2QA 1OWIA 2UUFB 2XNIA 1BITA 3PO1B 2BD3A 4FU7A 1YLCA 5EOKA 1LVMA 1YPKH 3ODDA 4GHQA 1GL0E 2XCFA 1UCYH 1BHXB 4ASUD 1TBZH 1FIWA 2PGQB 1FY1A 1MTVA 1O2NA 3H7TA 1GBIA 3SQEE 1Y5BT 4INKA 4ABJA 3E0NB 2HPPH 4K69A 1O2WA 4AN7A 1KTSB 4IW4E 5PTPA 3EYDA 3SQHE 1O31A 2RA3A 3A7WA 3SV7A 1G3BA 4ZHAA 4ZKSU 2KCYA 3OX7U 1SFIA 4U01A 3SV8A 2ZGXH 3NRLA 1HXEH 1C1WH 1K1JA 3URDA 4IS5A 3GCTF 3G01A 3TGKE 4WMEA 1QA0A 2AMDA 3BTFE 3O8DA 2BB4A 3FP6E 1ESTA 2RG3A 3GY4A 1GCTB 2V3OH 5EW1H 1SSXA 3E6PH 4I8KA 1IQMA 1DXWA 1GBFA 3BTTE 2OP9A 5EG4A 3QZRA 2RA0A 4A1XA 3KHVA 3PTBA 1P10A 4AC9A 3RU4D 2QY0B 1CGIE 1BTZA 1J8AA 1C1SA 1N6XA 1H8HD 3HK3B 1O3OA 1O5FH 5F8TA 1DWBH 2R0KA 5C2ZA 1P8VC 4X2WA 2WUCA 3UPEA 1SGYE 5C20A 1CHOF 1SGFG 3MU1A 1ETSH 1LVOA 2ODYB 1KLTA 4HZHA 4ABIA 4NG9H 1IQFA 1BZXE 3RXAA 1XUIA 1QGFA 4ASHA 1VZQH 4BAHB 4JCNA 2HVXA 2OBOA 3RDZA 3PM3A 1BMMH 3PMJA 1NM6A 1A61H 4X1RU 3SJ8A 1E34B 2H9EH 3A7TA 3MYWA 4ZAEA 3BSQA 1SQTA 2ZEBA 4E7RG 2Q6DA 5EPNA 3UQVA 3PWBA 3W1EA 4Z0KA 1K1OA 2QCYA 1QB9A 1TGSZ 3VB3A 2PKSB 2VIDA 3H09A 4CRFA 3LC3A 3T25A 1O5DH 1TX7A 5EIYA 1O2UA 3E8LA 4X2VA 1ZTJA 3VB5A 1BTUA 1LO6A 4WVPE 2VWOA 3GY7A 5GIBA 1NRPH 1E37B 1ABIH 4I33A 3RXBA 3MWIU 2PSYA 1GI8B 2ZQ2A 1XUGA 3FVFB 4LK4A 1E79D 3U1JB 2QF3A 1ID5H 5C5NA 2G4TA 2ZTZA 1CGJE 2P93A 2W6ID 3BG4C 4KTCA 5ESTE 2K8IA 4DIIH 1J15A 5KGOA 5T1VA 3TU7H 1MH0A 2JDID 2G5NA 3ZVFA 1H8IH 4FUIA 3C1KA 4M9FA 2KM0A 2H5CA 3QLPH 4B71A 4RT1A 3LH3A 4BOHA 1F0UA 1SOZA 1K2I1 5C67A 4WXVA 5T6FA 1EP6A 2IN2A 1UTMA 3A8AA 1C2KA 3EGKH 1ANDA 4VGCB 3T29A 2GTBA 1SLUB 2UWLA 1BIOA 1AD8H 2G8TA 3SU6A 3DSGA 3LGTA 2SGQE 1AVXA 1BCUH 2J4IA 1GBKA 2WPJS 1EFRD 3ZVBA 1BJVA 1ZSKA 1Z71A 4INHA 1O5AB 5KECA 1TRYA 1O30A 5EXMA 1D6WA 1C2JA 1AGJA 2FOEA 1G37A 1SLXB 1ZPZA 3ZZ9A 4B73A 1O34A 4P00A 3BN9A 4YLUA 2FTMA 1SHHB 3U9AH 4YO9A 1QB1A 3FAOA 4A1TA 1EP5A 1BMNH 3A89A 1CGHA 1TBRH 3KL6A 1O36A 2HLCA 2BTCE 1HAVA 2V35A 3P6ZB 1KDQB 4B2AA 1G30B 4MPVA 2PKAB 4AORA 1OWEA 2VBCA 2DUCA 2Z9LA 1HPGA 1DOJA 2FO9A 1U6QA 3AW0A 4CHAB 1EQ9A 2Y82A 2H9HA 1JIRA 1AVWA 1TA6A 1O2LA 1P12E 3LGYA 1WDIA 1ETTH 4ACBA 2WPKS 5EGMA 3M5LA 1LHFH 1L1NA 3IWMA 1NTPA 3SU4A 1JIMA 1XUFA 4TPIZ 1GHZA 4BXWA 2QV1A 3LOXA 4ZH8A 1D3PB 1K1NA 1UVTH 1PPBH 1YYY1 2V3MA 1UK2A 1MQ6A 2WPLS 1GHWH 2PV9B 4FETA 4DGJA 1GJAB 4MDSA 4O03A 2PWXA 4NWKA 1EAWA 2ZF0H 2Z9KA 1YPHE 2XBYA 5F53A 1BT7A 1FV9A 2C8YB 4KKDA 3PV4A 1E1RD 3H5CB 3EA9A 3RXTA 3A84A 3ZZ7A 2IOTA 1FN8A 4O97A 3RXJA 3SJ9A 3WWFA 3B9FH 1Y3WA 1BRAA 1CHGA 3TJVA 2UWOA 3GICB 2PW8H 9LPRA 3UR9A 3SUFA 1AHTH 4CRAA 2EY4C 1LKBA 2YOLA 3RU4T 4B76A 1WXRA 1K0HA 2ZIQH 1O39A 4NWLA 1CVWH 4GSOA 4BAKB 1Y5UT 1D3DB 2HALA 3MU0A 1YCPK 2FI3E 1ZJKA 3CP7A 4FUGA 5C0UA 4CHAC 3V0XA 2BLVA
chains in the Genus database with same CATH topology
1EAUA 4YLQH 1SGTA 2WPMS 4F49A 4KGAA 3SJIA 3UWJH 4I31A 1Q31A 4BTUB 3K65B 4CRDA 1HBTH 4JYVH 2THFB 5ETXA 5DPAA 4WWYA 2TIOA 3RXLA 4YT6H 1NFXA 2GVFA 2BLOA 1CA0B 1KY9A 3W94A 1AB9C 3GCOA 3SNEA 7LPRA 2Y5FA 4MG3A 1W14U 3TLOA 4UE7H 3LDXH 6ESTA 1T31A 1VJAU 1O3AA 1C1MA 1MD7A 3NK8A 5F03A 1ELVA 1P57B 1QBOA 2A7CA 5K7RA 4X1SU 3LGVA 1NU7B 5E8EH 3AVZA 2YNBA 5E2OA 1UK4A 3D49H 1C2FA 1OSSA 3FZZA 2NWNA 3EAJA 3ATMA 3WY8A 2FPZA 4SGBE 4Z6AH 2JKHA 3DFJA 3FFGA 5T3HA 1V2PT 2JH0D 3HPTB 2GCTB 1KXCA 5EU8A 4AFZA 1WBGB 2GCHG 1V2UT 2TGAA 2KAIB 3DD2H 1ANEA 1GDNA 3MH4A 3SV6A 3OTJE 2H1UA 2GZ9A 1MTUA 2FS9A 1K28D 1GHVH 3TJOA 2PUQH 1QJ1B 5C1XA 3U98H 1GWAA 5C5OA 2BDAA 2FOAA 2XBWA 4MPWA 5AHGH 1IQHA 1TFXA 1A1RA 1ZMNA 1HRTH 1EB1H 4MTBA 4XDEA 3UNQA 2ZU3A 1O2RA 2Z9JA 2FOGA 1DE7H 3A81A 1O2IA 3BG8A 5DKMA 2AIQA 4K5ZA 1NC6A 5TCCA 2Y5GA 1DT2A 1H8DH 3SNDA 1T32A 1S84A 1V2VT 3BIVH 1A5IA 1UCYE 1ELFA 1LDTT 4R0IA 5DP6A 5GDSH 1TONA 4X0WU 2VGCC 1TWXB 5F8XA 5EXNA 2ZTXA 3FZDA 1UHBA 1RTFB 2EEKA 1T8MA 3ZYEA 1HIAA 4DG4A 3A83A 3RC4A 2ZCKP 3SHCH 2VINA 2ZKSA 1Q3XA 1EATA 1N8OC 8GCHG 2Q6GA 2QN5T 1W3CA 4A6LA 4IC6A 1V6DA 1HAYB 3KQDA 2J34A 1LHEH 2Q1JA 1QCPA 2P3FH 2PSXA 1BBRK 3BTHE 1NESE 3HGPA 3LJJA 3P8OA 1TOCB 2WPHS 4ABGA 4OS2A 3UREA 1XXFA 1DLEA 1RGQA 1ZGVA 4D8NA 4K1TA 3BTGE 1GJDB 1MTWA 2ANWA 2ZWLH 3T62A 1KIGH 1ZJDA 3P8NA 4ISIH 2XWBI 1PPCE 1TIOA 2SGAA 3MH7A 1V2ST 1ZPCA 3A7VA 1MAYA 1THPB 3PYHA 4Y0ZE 4Y7BA 5JBBS 3I78A 1GBDA 1DSTA 1W11U 4Y11E 1GJ6A 1PPFE 2G81E 2OQUA 1EASA 5E2PA 2UUJB 3SGQE 2XW9A 4JYTA 1ARCA 1F0TA 2QYIA 1VCWA 5ESBA 1A2CH 1J17T 3TITA 4A7IB 3SI3H 4ABEA 2AIPA 4NA7A 2GV6A 1F5RA 1O3JA 2Y6TA 4ABDA 3EQ0H 1SI5H 1C4U2 4JZDH 3GDUA 2ZC9H 1W8BH 1FY4A 1QHRB 3TK9A 5A8XA 3MO6A 3A87A 4MNWA 1IOEA 3T26A 1TBQH 4Q7ZA 3SGBE 1XUHA 4FUFA 4JZEH 1P2MA 1P02A 2R9PA 5A2MH 1QQUA 5TJXA 4FUBA 1RFNA 2A5AA 4RN6A 3FP8E 1FXYA 2CN0H 4R8TB 1Z7KA 2AH4X 3BEUA 2WYGA 5HYOA 1YPGH 1Z6EA 1OWJA 3VB4A 4MLFB 3DA9B 1QR3E 1PFXC 4M7GA 1C5UA 1NO9H 2PGBB 1E38B 1O32A 2JETB 1MKWK 4X6NA 3GOVB 1DWDH 2FOHA 3RXVA 3PLKA 2CXVA 4AOQA 1QTFA 1P9UA 3Q3XA 1C5PA 2WYJA 5CE1A 2SGEE 2FWWA 5DP3A 3BF6H 2ZA5A 4ISNA 1L2EA 1NY22 2K1QA 3VFEA 1EAXA 2HGTH 2OD3B 5DP9A 3CS0A 4YOGA 1FPCH 3SU5A 4WY3A 3RXHA 3MOCA 1W12U 3ITIA 2EI8A 4IGDA 1ANCA 1GGDB 1V2WT 4IN2A 1UTNA 2DE8A 1MTSA 3M36A 1T4VH 4ESTE 2VVVA 3QGJA 1J14A 1LHGH 2WPIS 3U1IB 1IQLA 1GPZA 1VJ9U 1P2NA 1TQ0B 1GJBB 9ESTA 1AE5A 3L33A 3DT0H 1TLDA 4CBOA 2BDBA 1K1PA 1YPEH 4TWYA 1GG6B 4Y79A 3LC5A 4MPXA 1OXGA 5DG6A 2D8WA 1GHAF 1F5KU 3QX5H 2QXIA 2ZPRA 1YGCH 2XXLA 5LPEA 2VIQA 1O2ZA 4OS1A 3D62A 4XSKU 1BTHH 1X7AC 1ZTKA 4X8SH 2F91A 1T4UH 3S9AA 3A7XA 1NFWA 1UTOA 2XYAA 1TA2A 1UVUH 4A1VA 2VB0A 3TK6A 1QL7A 3UNRA 1G3DA 1K1LA 3MNXA 4WJG2 1GBCA 1EXFA 1TGCA 1O2JA 2ZU5A 5JBCS 3UY9A 4DOQA 1C1TA 5CMXH 4AG2A 1KSNA 2HNTC 2GDEH 1SB1H 1ABJH 2FMJA 2P94A 1TGBA 5DGJA 1PQ7A 1SGNE 3MH6A 4IMZA 1P01A 8KME2 1T7CA 2Z6BD 3LJOA 1C1NA 3M37A 2OC8A 4NZLA 1HAHH 1W7XH 4HTCH 1C2MA 1ANBA 4DW2U 3RXQA 2ZU1A 3LIWA 2OXSA 1GJ5H 3GY6A 1MBMA 1AFQB 2XBVA 3S7HB 3VEQB 1K9OE 3GCHB 4D7FA 1NFYA 1O3LA 1UVOA 1IQNA 2R2MB 5HM9A 3S7KB 5FBIA 3EDXB 1S82A 1HJAB 3SO3A 1NU9A 4DURA 5GWZA 1WCZA 1LVYA 2V3HH 2BDCA 1BJUA 2WINI 4AYYB 1HAGE 1SL3A 1GG6C 2AYWA 4YTAA 2WV4A 1EAIA 1A3BH 1LPKB 2HPQH 3A8CA 2CGAA 4BTTB 1EOJA 1A0LA 1GBHA 3UOPA 5LH8A 1PPZA 2TRMA 1VITG 1YPHC 1ZR0A 1C1VH 4H42U 5T6GA 1PYTD 2OC7A 2CV3A 3PO1C 3W95A 1C2HA 1VCPA 3MU8A 5JDUB 1C4Y2 3RMLH 3OSYA 2D1JA 1QQ4A 1KXEA 2PTCE 3VB7A 4FVBA 2HWLB 1RD3B 2FOCA 3GCNA 1Y8TA 2G51A 2ZGCA 4K3JA 4NZQA 1FAKH 1N1LA 1NRSH 1GBAA 1ACBE 5HMAA 2Y80A 1OKXA 1FAXA 1EZUC 1DX5M 2A5IA 2NU4E 2ZGHA 1OP8A 3E1XB 3UIRA 1A7SA 1YKTA 2BD9A 3TH3H 1QL9A 4GUXA 4OS5A 2GCHF 3MU5A 1SGRE 3MNCA 4THNH 1ZSLA 5E0JA 2QF0A 3K9XB 1G3EA 5JPMH 1OX1A 1BB0B 1IHTH 1C5XB 2LPRA 1ELTA 1SGCA 5LGOA 1BRBE 1VGCB 2IJOB 2J38A 5DP5A 4DCDA 4RSPA 2YNAA 4XFQA 4AGKA 1GCTC 4TPYA 1O2KA 1O3CA 3LGWA 1KYNA 2QXHA 4U2WA 5EQSA 5B6OA 1OS8A 3SW2B 1O3FA 1Y3VA 4NIXA 5T6DA 3L3TA 4AFUA 4AG1A 3BEIB 1S6FA 5GCHG 6GCHG 1EUFA 1Z8RA 1SQAA 2Z9IA 4NFFA 1VR1H 1ZYOA 4FU9A 3D65E 2CF9H 5DP8A 2ZPQA 1BTWA 1C5RA 1DS2E 5L6NH 2A31A 3AW1A 3CENA 2FOMB 4I8JA 4HI3A 1GMDG 2A4GA 2ASUB 4I32A 2ESTE 3I77A 1MD8A 1TX6A 2BVSH 1DSUA 1JWTA 2Z3CA 4FUJA 4B2CA 2ZDKA 1GMCG 3GYMA 3KQEA 1GHBF 1T8LA 2FZZA 3BTEE 1GVZA 1ZPBA 4ISOA 5DP7A 1P3EA 1TMUH 1WQVH 3O8BA 1PPEE 2C4FH 1BA8B 1SQOA 3RXKA 1HLTH 8GCHF 2VH0A 1O0DH 1THSH 4CH2B 2BXTH 1QFKH 2FOBA 4QT8C 3RXGA 3RM0H 1W0YH 3TGJE 5I25A 5EW2H 3RXEA 1MU8B 1HGTH 2O8LA 2V6NA 2PKSC 2ZDNA 1W7GH 1Y3UA 1HDTH 3AAVA 4ZROA 1MTNB 5FCKA 1F2SE 1GI2A 1O3GA 1PYTC 1QIXB 1MKXK 3M5NA 1TNLA 2DE9A 3SHAH 4A5TS 2P8OB 1S85A 4Q7YA 1LQDB 4OS6A 1NT1A 1OWHA 5AVDA 1GVLA 2BX3A 3A85A 5C3NA 2P59A 3P17H 1JMOH 1GI7B 4I8LA 2P16A 1AZ8A 4DY7B 2CHAB 3NUMA 3SUEA 2FEQH 5JYIA 3GY8A 3V3MA 3MNSA 2F9VA 4WXIA 2BDIA 2XCNA 5FPYA 3TNTA 2BY8X 3D23A 1GI4A 2STAE 7GCHG 4VGCC 1O3NA 1O5EH 2ZFSA 3HKJB 2FM2A 1NPMA 3NWUA 2KAIA 1GI3A 4UEHH 4Y8ZA 2QAAA 1AI8H 4WH8A 1NRNH 4K2YA 5JB8S 1NRQH 2ZFTA 1V2RT 2FTLE 2BOKA 3BTKE 2Z94A 1Z8GA 2BYAX 1BMAA 4LOYH 4JK6A 2Y7XA 3F9HA 2FXRA 2GP9B 4B1TA 5F8ZA 1C5QA 1DFPA 2XC4A 4CBNA 1T8NA 1BQYA 1H1BA 3RXMA 3TGIE 1IQGA 1ELGA 2C8XB 1MZDA 1LCYA 4FUEA 4FUCA 1A5GH 4XBCA 2PTNA 1GI9B 3T27A 4D9QA 1K1MA 4KTUA 2FYQA 1QY6A 3IITA 3ZV9A 4HFPB 5AFZH 1TMBH 1XVMA 1E36B 2A45B 2ZO3H 4D9RA 1WQSA 3O8CA 1ZHPA 1EJAA 2FS8A 2ZHEH 1DM4B 4YESB 1P0SH 1KXDA 3SJKA 3KEEA 4ZHLU 3A8BA 1IAUA 2CJIA 4H4FA 1LHCH 1HFDA 1GMHG 2TBSA 2O8MA 1O3PB 3A80A 2GKVE 5JBAS 3SV2H 3QTOH 1EZXC 3S0NA 1C2DA 3TH4H 4Y71A 4U32A 4GHTA 3URCA 1WYKA 2ANMH 1HCGA 3PMBB 3R3GB 2FYRA 2CF8H 2Z7FE 1RRKA 2GV7A 1Z8IB 1YP9A 1O2TA 1WTGH 3M5OA 3S9BA 1DUEA 1NROH 2XBXA 1CT4E 1DWEH 3UOUA 4NIYA 4O3TA 1GL1A 1PQ8A 2AS9A 2I6SA 1AKSB 1QURH 1O2VA 1IQJA 4MNXA 1P2JA 2ZDVH 3A86A 4DVAU 1RTLA 1V3XA 3TJUA 1CHOG 4GVUA 3M61U 1V2MT 4AX9H 1O2GH 2ZCHP 3SU2A 1O2HA 1IQIA 1GI1A 1O2OA 1TRMA 2XTTB 1C2GA 2FX6A 2VJ1A 6CHAB 2B7DH 4CR5A 5A0BA 5I46H 1QBVH 3RU4E 2F9BH 3QGNB 3NZIA 4X1NU 4Q7XA 5G4BA 1EPTB 1MU6B 5FX6A 3ZVAA 5FBEA 3T28A 2GDDA 1CA0C 3HKIB 1YPMH 3EA8A 3RXRA 2J95A 1F92A 3RMOH 3EE0B 1P3CA 2FESH 4CRCA 1AN1E 3MI4A 2A4RA 3RLWH 1NZQH 3NXPA 4ZKNU 2GZ8A 2ZI2H 5JBTA 2BD8A 1Y59T 3RMNH 4ZXXH 1C5LH 2QXJA 1S0RA 3LKWA 5LPFA 1H9IE 2G55A 2VVCA 3MO9A 1O3IA 2OCVB 3LT3A 1AMHA 3PB1E 3V7TA 2Z3DA 2VIOA 2BZ6H 1O2PA 4I7YH 5HM2A 4X8VH 1FJSA 1BRUP 2BD7A 2WV5A 3C27B 4TY7A 2J94A 4YOJA 1THRH 2GCTC 2VVUA 2VWNA 1OYQA 2A2QH 1XMNB 1C5VA 2GD4B 1QB6A 3PTNA 3E90B 4LZ4B 3SGAE 1Y3YA 1C2IA 2BM2A 2BQ7B 3ZZ4A 4FXGH 1O33A 4NA8A 3PWCA 2BDGA 4KTSA 4YT7H 1FUJA 1Z8JB 2OLGA 1GHXH 1SLVB 3SU3A 2FI4E 3S9CA 1WV7H 3ZZDA 3SOSA 1G9IE 1QL8A 1W13U 3MFJA 4AZ2B 3AASA 1LMWB 4ABBA 3M5MA 1WOFA 1SVPA 4FVDA 2H2ZA 2Z3EA 3L6PA 1HAZB 2ZCLP 2FOFA 1RIWB 2TGPZ 1EZQA 1NRRH 4XOJA 1CBWB 3MH5A 5GCHF 1FZZA 1Z6JH 2B5TB 6GCHF 1QJ6B 1BDAA 2J2UA 2ZU4A 4I8HA 2UWPA 1RS0A 1YCPH 5E0HA 1UO6A 2W7SA 1EZSC 1EJMA 2O8TA 3N7OA 1Y3XA 2FODA 5HGGA 1GMDF 1IHSH 2P95A 2ZDMA 2SGDE 1FDPA 3K6YA 1F0SA 1S6HA 1D4PB 1L4ZA 2A4OA 1C2EA 1C5ZB 1GMCF 3KCGH 3VGCB 2AMPA 2Y81A 1MBQA 2BVRH 3RC6A 2G4UA 2GMTB 1LPGB 1JRSA 3SUGA 1UTKA 1KXAA 3Q76A 1C1OA 1ELEE 1UMAH 3HATH 2W3KA 4DT7B 4KELA 1TPPA 3T2NA 1FN6A 4ISLA 1AQ7A 2B8OH 2A4QA 3M3TA 2WUBA 1ELBA 2VIWA 1OP2A 1VITH 4ZMAH 3ZVGA 2PUXB 4RKJB 3STJA 1FONA 2C3SA 2PHBA 1GBBA 1P04A 2VIPA 3MHWU 1QRXA 3P70B 3RXDA 3SNCA 3GISB 1YM0A 2ODPA 1CA8B 2XWAA 2ZFPH 3KIDU 4Y0YE 4BXSA 5IDKA 1GI5A 3ZZ8A 1P2OA 2GT8A 1XKBC 2R2WU 7ESTE 3VB6A 1NN6A 1PPHE 1S81A 1AO5A 3SBKA 2BQ6B 1L4DA 1YCPM 3M7TA 1V2NT 7GCHF 2G00A 2R3YA 3RP2A 1DITH 3LGUA 4ABHA 4TWWA 2AERH 2M5TA 3I29A 1AVGH 1GHYH 5SGAE 3ZZ3A 2GGVB 1ZLRA 1JOUB 1SGQE 3JZ2B 3LU9B 1DY8A 1XUKA 2R3UA 1SGIB 4Q2KA 5LPRA 1ZOMA 4I8GA 2JETC 2ZHDA 4X2XA 5BPEA 2QXGA 2VNTA 5EQQA 3QN7A 3FP7E 3GDVA 1G36A 3P8GA 4PROA 1C9TA 4MPUA 2F3CE 1T8OA 1TALA 2A2XH 1AY6H 2C93B 2A7HA 3GYLB 3LONA 4E06H 1L1GA 1MZAA 3T5FH 1GDUA 2Y5HA