3ODFA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. second step of radiation damage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 66
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3odfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3odfA01
1K1IA 2RA0A 1TGBA 1UVUH 3LGIA 2A4QA 1QBOA 4O3UA 1O2UA 6LPRA 1WAYB 3QWCH 3A8BA 1TNIA 4CR9A 3SJ8A 1KY9A 1G30B 2VIDA 2XCFA 2ZF0H 1LPGB 3MWIU 4XDEA 2B5TB 1VITH 1EASA 1TB6H 1TE0A 1LQDB 5C1UA 3H5CB 1WTGH 2BTCE 1O5BB 5EPYA 2JH0D 3DFLA 2C4FH 3QK1A 4HTCH 1F0TA 1B0FA 1GDNA 3M36A 1IQNA 2PWXA 4ZH8A 5SGAE 1FN8A 1RTKA 4NG9H 2GMTB 4FUEA 3H7TA 3KQBA 4GVUA 1Z6JH 2P59A 1TOCB 1S83A 4JCNA 1CA0C 3SBKA 3ZZDA 1KLIH 2TGAA 4CH8B 1UJ1A 1AD8H 3SU4A 1KIGH 3KGPA 1L4ZA 3MTYA 1O3EA 1SOTA 4CH2B 1MD7A 2QGRA 4E05H 3G01A 3DFJA 3RXPA 3BTHE 1VJ9U 1C5YB 3QGJA 4X1NU 1O2NA 2VGCC 3KQEA 2OBOA 2ZPRA 3ENSB 1V2LT 1NM6A 4DW2U 1KTSB 1Z71A 2CXVA 1VR1H 3GY4A 2ZGXH 2VWLA 1K1OA 1SGDE 1H9IE 3A82A 3HK6B 1FPCH 2CF8H 1UHBB 2F9PA 5GIBA 4RKOB 3N7OA 2VVUA 1PQ8A 3SV6A 1EZUC 4AZ2B 4AG1A 3K65B 3RXAA 1P9SA 2CN0H 1EZQA 1T8OA 4WXIA 3UWIA 1Y8TA 2OCVB 3ESTA 1OSSA 1GL0E 4O03A 2FTMA 3ZVFA 1O30A 5CHAC 2ZA5A 2BVXH 4I8JA 1HAGE 2WYJA 5E0JA 5C1XA 4Y7AA 3UNSA 1EZXC 1DXPA 2FTLE 4FU8A 2GV6A 1ELGA 4I8LA 1SFQB 1THSH 1V6DA 2C8XB 1ETSH 1WU1A 1Y3YA 4THNH 1C2GA 1MZDA 5DGJA 1P2MA 2FO9A 2BY5X 1WCZA 2TPIZ 4FU7A 1DWCH 2VINA 5A8YA 1ANEA 1EAIA 1OWIA 2PR3A 1T32A 5FX5A 3GDUA 2UWOA 3S7KB 2A5AA 1V2OT 1C1VH 1SGPE 1P06A 1BJUA 3OY6U 3MH7A 4B76A 2W3IA 3F6UH 4KGAA 1IQKA 2GT8A 1GI1A 2FWWA 4NZLA 5E0HA 5B6OA 1WYKA 5ESTE 1KXCA 1CQQA 2ZHQH 1MD8A 2QXJA 3FZDA 3T27A 1NS3A 1KDQB 5IDKA 2BX4A 2F9NA 3LJOA 3F9GA 1F0RA 3RMMH 4UDWH 4GCHF 4ABAA 3QTVH 2NU2E 2FOBA 3M7UA 1RGQA 3A81A 1PFXC 1WSSH 1WTHD 2F9UA 1J15A 4ZROA 3RLYH 2A7CA 2D8WA 5T3HA 1GCTC 4IC6A 1KXDA 3PV4A 3PB1E 1BT7A 1BTHH 4PROA 5HM9A 2EA3A 3TGIE 3MNXA 3EA8A 3P8NA 2BD4A 1EAWA 3LJJA 1GG6C 1FXYA 4X6NA 2PKSC 4ZXXH 2F3CE 1H9LB 4SGBE 4ABGA 1IOEA 3SW2B 3RLWH 4A5TS 3P8FA 1YPGH 1C2DA 2BX3A 4K69A 4GHQA 2BQ7B 3PLKA 1TNJA 2EI6A 4OGXA 1BBRH 1TBZH 1QNJA 2ZCHP 2JETC 4WY3A 4J1YA 4AB8A 1KSNA 1W12U 3MOCA 4FUIA 1ELBA 1YLDA 1DWDH 2XRCA 1Q31A 3TJNA 1O3KA 4K1TA 5A8XA 3TNSA 2SNVA 5JPMH 4AB9A 1CGJE 1C9PA 3TH2H 4ABDA 2ZGBH 4YOJA 1DPOA 1BCUH 1XUFA 1OWKA 4ZHMU 4A1XA 4Y11E 2P3UB 1PJPA 3SQHE 2ZHFH 1SFIA 1ZYOA 3SJKA 3T25A 2FOEA 5GXPA 3BEIB 1GDUA 3RXRA 1P10A 1QB9A 2FOFA 4MPUA 3SUFA 2HRVA 1S6HA 1FIZA 2DE9A 1VCPA 1EKBB 3MH6A 1W14U 2UWPA 3DA9B 3ELAH 2H6MA 3Q3XA 1CHOG 3GY3A 3AAUA 2Z6BD 1DSTA 1L0ZA 1V2JT 1UTLM 1HAVB 1WQSA 5C67A 1C5PA 1CGIE 1BRCE 1O39A 1SGTA 1TIOA 2A7JA 3S7HB 4AX9H 9LPRA 3BG8A 1LHEH 4Q80A 3GYMA 2ODYB 1TPAE 2HVXA 3M3TA 5EQRA 3A8AA 4YLUA 1LHCH 1HJAC 1QL7A 2FLBH 1RTLA 3LT3A 4ZKNU 2BD2A 1KLTA 1EB2A 1SGYE 2ZHWH 4FUFA 3AAVA 1ZRBA 2RDLA 5F8ZA 1P11E 2CF9H 4WJG2 2ZTZA 1O2KA 1F0UA 2P3TB 2ASUB 4K8YA 3BG4B 4NSYA 1J8AA 1ETRH 5DP7A 4JMYA 1O35A 2HLCA 1A0HB 2FYQA 5HXFA 4MQAA 2GZ7A 1UCYH 1C1SA 3H7OA 5EQSA 1PPCE 4D8NA 1GMDG 1LO6A 1C4V2 1NRQH 1IAUA 3DUXH 3VB7A 1GMCF 1GBLA 4YOGA 2ZCLP 1HB0B 1HXEH 5PTPA 4CBNA 1FN6A 1LPKB 1E38B 4X8SH 3ZVCA 4KTSA 2CGAA 3K2UA 1ESBA 1FJSA 1HNEE 2CV3A 1AB9B 4ISLA 5DK1A 3VGCC 2W26A 2BD8A 3KQCA 1P05A 2O8MA 2WPIS 4WMEA 1LKAA 1SBWA 3QO6A 5E8EH 3TK9A 2WUBA 2Y81A 1O2XA 3R3GB 5FXLA 2J94A 1ZGVA 1XVOA 3U8RH 2AERH 2Z3CA 1EZSC 2ZTXA 4BTIB 1MUEB 2BLWA 2VIOA 2QXIA 2BB4A 4CRDA 5LPRA 1EJAA 4GUXA 1DWEH 1YCPH 2BLQA 3URCA 2P8OB 1UTOA 1BDAA 1A3BH 1QTFA 3TU7H 2GDEH 3M5OA 4OS7A 3TGKE 1BTPA 4LK4A 5G4BA 3PMHB 2OQUA 1MBQA 1SHYA 3QZQA 3QZRA 2SGFE 1Y5UT 1M9UA 2ALVA 1N8OB 3EDXB 1O3OA 3SU0A 2WV4A 1HJ8A 1GMHF 3BTTE 1AGJA 4Y0ZE 1G32B 3RDZA 6GCHG 4SGAE 1XXDA 3TIUA 2PW8H 1NRNH 2A45B 5C2ZA 2C3SA 1GL1A 4UD9H 1K1LA 2BY8X 1BMLA 1GI2A 1ID5H 4JZIA 3SGQE 2XBVA 5A0BA 1EP5A 2G8TA 1GGDB 4NCYA 4UFGH 1AWHB 1MMJN 2BZAA 4WF8A 1QL9A 2Z3EA 1AMHA 1BTUA 2ZGJA 2AGEX 2G51A 2R2WU 4K8BA 2ZG0H 1P09A 3GY5A 3MH5A 1Z7KA 1A5HA 1SQAA 3GCHB 2XBYA 1YP9A 3RXFA 3P70B 4Y71A 1A0LA 1C4U2 1F5LA 1ORFA 3SORA 5AFYH 1O3MA 1DX5M 1P57B 5EODA 1P8VC 3KHVA 1IQHA 3CP7A 2FX6A 4MTBA 1G3EA 1G37A 1WV7H 3GDSA 4JYUH 1LVBA 1P01A 2J34A 3VEQB 5DP4A 3GISB 4BAOB 4CHAB 4Y8XA 1EX3A 1O5CB 4DG4A 2VIVA 7GCHG 1LTOA 4K60A 5K7RA 1IQLA 2NU0E 2DUCA 4UONA 5HYOA 1C2MA 1ZPZA 5IYTA 2TGPZ 1QY6A 1FQ3A 1CT2E 1MU8B 2P3FH 3ATWA 3JZ2B 2BLOA 5EPNA 1ESTA 1ZSJA 2VU8E 1MTNC 2FDAA 4I31A 1NRRH 4Y8ZA 4VGCB 1U6QA 5FCKA 2QXGA 2BDAA 3RC6A 1TNLA 3U9AH 2OQ5A 1O2PA 1O2JA 3BEUA 1EXFA 1GI0A 3SU6A 4GAWA 4X8TH 3ZZCA 1MU6B 1C5SA 1LCYA 1NN6A 3TVJB 6CHAB 1C2FA 1T8MA 2VIWA 3CS7A 1MAXA 1SB1H 2AFQB 3ZZ9A 5FCRA 2A2XH 2G00A 2ANKH 2WV5A 1UO6A 2AIQA 3HKIB 1SLVB 1GBBA 5JBAS 1TALA 1GCDA 2VIQA 4A1TA 3V12A 2FOAA 1FNIA 3PWBA 4FUJA 4Y79A 3I78A 3MU5A 4YESB 5EXNA 2ZTYA 1XKAC 1MZAA 1RIWB 2PTCE 4ISHH 3K6YA 2GP9B 2BD9A 1P02A 2SFAA 1P3CA 4K1EA 3L6PA 2F9OA 3GY8A 4X2VA 4ABBA 4X1RU 4H4FA 1GHBF 3KL6A 1EAUA 2AH4X 1HRTH 2B7DH 4NFEA 4F4OC 3E3TA 3B8JA 2CHAB 1F0SA 2JKHA 2ODPA 2GV7A 2QIQA 3VB3A 5J4QA 1PQ5A 4LXBH 1TBRH 4Y10E 1O0DH 1SGRE 2ZFPH 2BDHA 1ABJH 1NU7B 1SGNE 5ABWA 1BA8B 3IWMA 1LHGH 1GBHA 3SJOA 1O3PB 4AN7A 3E8LA 1AZZA 2QYIA 2OTVA 2Y5GA 1THRH 3K9XB 1NY22 1Z8IB 1TABE 2G4UA 1GHXH 4H42U 3A7WA 5FX6A 1EPTA 1DT2A 1UVSH 3FANA 3MU1A 3A7YA 4MDSA 5EW2H 1XM1A 2R2MB 2P94A 2ZI2H 3Q76A 3QGNB 3BIVH 1BRUP 5K0HA 2H5DA 3RXKA 2PFEA 3V7TA 2FXRA 1KXBA 3E16B 2CJIA 5I46H 1HYLA 1T4VH 1TX6A 3HKJB 4O3TA 5E2OA 4E7NA 3M37A 3KF2A 1HAIH 2OP9A 4X2XA 2ZHDA 1LHDH 3RXHA 1QJ1B 1GHWH 3CENA 5T6GA 1GBAA 1O3GA 1P03A 3SV8A 5T6DA 1K1NA 3VXEH 2BZ6H 3EA9A 1K22H 2WPHS 3E90B 1ZSKA 4AFQA 2HALA 2ZPSA 1IQJA 5JB8S 3SV2H 2V6NA 3ATKA 1LPZB 3HK3B 3GCTG 1A1RA 3MMGA 4ZKSU 4IN2A 1AU8A 1G3DA 1SGCA 4TPIZ 4BAHB 1V2QT 4X2WA 4XBBA 1O2MA 2Q6DA 1D4PB 4CRCA 1GJAB 2Q1JA 1PPBH 3SUEA 2TRMA 2ZC9H 2HWLB 4OS1A 3HGPA 5CE1A 2BYAX 1FAKH 1SVPA 1HAXB 2ANMH 3BIUH 2XBWA 3SU2A 1NT1A 2G81E 3Q3KA 2A5IA 3K6ZA 1L1JA 3PLPA 3VB6A 1YPKH 2H5CA 1TA6A 2GX4A 3B23B 1IHTH 3FAOA 2BQ6B 4DOQA 4YZUA 2AYWA 1ZMJA 1DY8A 2XC5A 3LGWA 3GYLB 1IQIA 1SPJA 1TRYA 4BTUB 1QRXA 3ZYEA 1ZHPA 3M5MA 1XKBC 9ESTA 2BDGA 2M5TA 1L1NA 5F8XA 2QF0A 5EGMA 1A2CH 2BY6X 1C5RA 4BXSA 3PTNA 3V0XA 4JK6A 1TA2A 4Y6DA 4FUCA 3M35A 2BHGA 2VB0A 4ZXYH 5GWZA 4HFPB 1DXWA 2WPLS 4ZHAA 3BTFE 1NFXA 2ZU1A 1SQTA 1VITF 2O8LA 1OP0A 4BNRA 1CBWB 2Z7FE 1EP6A 2QXHA 5AF9H 2BVSH 4D7FA 1DICA 2SNWA 2YNAA 4A1VA 2FOMB 1CVWH 1ZSLA 1VGCB 1O2HA 1GBMA 4WMFA 1K28D 1DSUA 2I6SA 3T5FH 5TJXA 1NESE 4YOIA 1V3XA 3LU9B 3ZV9A 4A6LA 3RXLA 1QGFA 4LOYH 3SGBE 1G36A 3ZZ5A 4ABFA 2GKVE 5C20A 1EUFA 3PO1B 3NKKA 2ANWA 1AO5A 4IN1A 1XVMA 3T26A 3MU8A 3T62A 4B73A 3GCNA 4BAQB 4FUGA 1GHAG 1C1MA 4B2AA 5L6NH 1G3BA 2GCTC 2V3HH 3BV9B 3TH4H 2A31A 1UVTH 1O3FA 4YM9A 2TBSA 2HGTH 1FONA 1VJAU 2GZ8A 3SNAA 4GHTA 4TY6A 1IQFA 1EB1H 1CA0B 4BANB 2ZZUH 1XX9A 4RN6A 4JZEH 1V2TT 1SG8B 2OC8A 1L4DA 1HUTH 1NTPA 4I8KA 1XUIA 3LOXA 1SSXA 3NUMA 4Q7YA 4Z0KA 3SOSA 4CR5A 2BDCA 4ISIH 1K1MA 2VGCB 3WY8A 1HLTH 3TLOA 1AQ7A 1SLUB 1SGEE 4KELA 3RP2A 1CT4E 1TRMA 3TJUA 3UNQA 3EQ0H 3UR9A 1MTVA 3UOPA 3IITA 1A61H 5LPEA 2RCEA 3O8DA 1BMNH 3V3MA 5AVDA 4K3JA 1W7GH 3E0NB 3VPKA 1W11U 1N6YA 1AVWA 1TGSZ 3LGYA 4RKJB 5EXLA 3A85A 1O2IA 2WINI 5F03A 3A7XA 4WVPE 3OYPA 4FUDA 2AMDA 3Q3YA 1VZQH 1S84A 4B1TA 3U1JB 5CHAB 1GVKB 1SGFG 4KP0A 1QFKH 1JOUB 1J9CH 3FZZA 2FODA 4MNWA 1UMAH 1KXAA 2TGDA 2ZDNA 2BDBA 1C5OH 4CRBA 4UFFH 1W0ZU 1YC0A 1D6WA 2HOBA 2A2QH 3T2NA 1YPMH 1L2EA 1O2VA 1VCWA 2IN2A 3HPTB 5J4SA 1XUKA 4ZUHA 3LGUA 4GLYA 5GCHF 1J16A 2PGBB 1FI8A 1GDQA 1ZLRA 5JDUB 1FMGA 1TX8A 4AFSA 1P2QA 1GBTA 1HAPH 1NRPH 2VWNA 3BEFB 1TGNA 3MU4A 2BQWB 4X1SU 3U69H 1OXGA 3R0FA 1TNKA 1JMOH 1O2YA 1S85A 4XE4A 1QR3E 3UR6A 1ARCA 1QBNA 3HGNA 1NPMA 2XXLA 3PYHA 1ANBA 1Z6EA 1EPTB 1O2ZA 1AUTC 3A88A 3F68H 3MYWA 1TGCA 4MPXA 5LH8A 2PSYA 1HGTH 3BTQE 1GJ8B 1GJ7B 1K9OE 1SLWB 1GMHG 4Y7BA 1EATA 2UUYA 1AE5A 2C90B 2Z9IA 1N8OC 3SU5A 4FUHA 1GJ9B 3E6PH 1UVPA 2ZDAH 4NZQA 1ESAA 1NU9A 3F9EA 2FMJA 3O8BA 1RS0A 4AYYB 1S0RA 1GCTB 2ZU2A 1BOQA 1GBDA 2EEKA 2ZIQH 2PSXA 3SI3H 4XFQA 4JZDH 1C2EA 3E91A 1BHXB 1GG6B 1HPGA 1ELVA 2FX4A 2PKSB 3OX7U 4U32A 1F5RA 4D9RA 5AFZH 1A46H 1ZOMA 3Q00A 3LKWA 2FYRA 1ELTA 1LKBA 3KN2A 5ESBA 2SGPE 5A0CA 2FM2A 2ZGCA 4U2WA 3ZZ4A 5A09A 1SGQE 1TFXA 1AFQC 3GCHC 2F9VA 2ILNA 1AKSA 1CHGA 1OS8A 2JETB 2B8OH 1NC6A 1DUAA 5GDSH 2J38A 3SO3A 3SZNA 3S9CA 1V2MT 3TNTA 1P2KA 1F92A 1RTFB 2SGAA 1K21H 4M7GA 1LQEA 1KLJH 1JXPA 5DO4H 2J4IA 2ZQ2A 3U98H 8GCHF 1C5XB 3KEEA 1N1LA 4B2BA 1K2I1 2H9HA 1UTMA 2IPHA 3KQDA 1ZGIA 3RXVA 4B74A 1OWEA 1D6RA 2J2UA 1C1PA 2QF3A 3I29A 4IS5A 1O3BA 3C27B 2BY9X 1S82A 1Z1IA 2PKAA 3D62A 1ETTH 1L1GA 3MU0A 1O5DH 3UQVA 2Y80A 5T6FA 1GI8B 5JBBS 4HGCA 1A5GH 1Y5BT 2BM2A 5DP5A 4ASHA 1V2NT 1E35B 3RXGA 1GBIA 1OWDA 1W7XH 4AYVB 4D7GA 2XWBI 2OD3B 3MNCA 1GI4A 2STBE 4XBDA 3MI4A 1YPEH 3ITIA 3SUDA 1ANDA 2FOGA 3S9BA 1QURH 4X2YA 2ZNKH 1LDTT 1GBEA 6CHAC 5EG4A 1BHXF 4IC5A 3U8OH 4HZHA 1O32A 2TIOA 1V2PT 1CHOF 1C1RA 1PPZA 2ZU3A 5C3NA 1GHZA 2R3YA 3ZVEA 2GCHG 1BRBE 3QUMP 4Q7XA 1JRSA 2HPQH 3SN8A 7KMEH 3SNBA 3SU1A 1Y5AT 1HJAB 2XW9A 2AEIH 3B9FH 3M7QA 1GHBG 1MKXK 2ZFQH 2JH5D 3UREA 2P16A 3VB4A 4YTAA 3SI4H 1SMFE 2FOHA 3MNSA 6ESTA 3BF6H 1ZZZA 3KNXA 1BUIA 1YLCA 4UFDH 2H9EH 3EYDA 1GJCB 1T8NA 1TWXB 1DUEA 1P9UA 2Q6FA 4CRAA 1FUJA 1B7XB 1Z8RA 8ESTE 2W7SA 2ZHEH 1FY1A 1J14A 1UTKA 3V13A 3SGAE 2O8TA 1TQ0B 3ZZ8A 1Z8GA 2FIRH 3MO9A 1SC8U 5JBTA 4IMZA 1NROH 2D26C 2EC9H 2B0FA 2ULLA 3SNEA 1GI7B 1MTSA 5F8TA 1O3AA 5LPFA 1T4UH 1WQVH 2V35A 2D2DA 1C5ZB 4CRFA 3VGCB 2OUAA 1HFDA 4NWLA 4TWWA 5HGGA 1O2QA 1K1JA 2ZWLH 4X8VH 1MQ5A 5A2MH 1JIRA 3RU4D 3HATH 1TPOA 1THPB 1YKTA 3UWJH 2Z9LA 3MHWU 1GVLA 1PYTC 1O5AB 3RXJA 3MNBA 3A7TA 5EOKA 2SGEE 1GPZA 4FUBA 2XTTB 4I8HA 2SGDE 1LHFH 2J95A 3BTME 2FI3E 3L3TA 5TCCA 2ZECA 1V2ST 1XXFA 5GPIB 2GMTC 5C5OA 2GVFA 3SUGA 4D9QA 3LPRA 1YGCH 5C1YA 3AW0A 3BN9A 1XUGA 1H8IH 1MKWK 1LVYA 1GWAA 4INHA 4NFFA 1HAHH 1C5QA 3UUZA 1OWJA 2RG3A 1C5WB 1LVMA 2Y6TA 3RC5A 2Y7ZA 3I77A 3A7ZA 5EW1H 2WPMS 2ZFFH 7LPRA 1H4WA 2F83A 4Q2KA 1C5NH 1B0EA 3S69A 2IJOB 3PLBA 1YM0A 5DPAA 1ACBE 2ZU5A 4KTCA 1QJ6B 1O5FH 1AFEH 1QJ7B 1FY4A 3P6ZB 3QX5H 1FZZA 1O31A 1YPJH 2OINA 2WPJS 3RXSA 1SLXB 1NO9H 1AWFH 3PMJA 1BMMH 4MPVA 4FXGH 4MNYA 3E1XB 4FVDA 4ESTE 4BTTB 1P12E 3GDVA 3A8DA 1O2OA 1O2SA 1MQ6A 1W8BH 1BQYA 2FI5E 1YF4A 3QN7A 1PYTD 1TNGA 3RU4T 2W7UA 4KTUA 3RXQA 3PMBB 1OPHB 1ZR0A 1VITG 3LDXH 3TITA 2BVRH 2ZQ1A 1EAXA 1EOJA 1C5VA 1O36A 1ZTKA 3PROA 4DIIH 4AFZA 2P95A 2V0BA 3F1SB 3SJ9A 3F9HA 1TNHA 2H2ZA 4Y76A 1CU1A 1DS2E 3DHKH 2STAE 1XUJA 1NZQH 1SGFA 4IBLH 4XSKU 4LZ1H 1DOJA 4B71A 1V2WT 1JIMA 4XBCA 1AY6H 3RM2H 1S0QA 1VGCC 4AOQA 4OGYA 2R9PA 1AKSB 1AUJA 1TMTH 1C1QA 4I32A 5L2YH 2GTBA 2PGQB 3ODDA 2ZP0H 1Q3XA 7GCHF 1GI3A 1MTNB 2Y5FA 3QDZB 1V2RT 2ZCKP 1HCGA 2PTNA 1O33A 4MNVA 4GCHG 1RFNA 4TWYA 1OX1A 3M61U 1TPPA 5FBIA 3PO1C 2AMPA 4U30A 1GHYH 3BTWE 1RD3B 2VVCA 3NXPA 3TK5A 2B9LA 1F5KU 1G2LA 1O3LA 3UY9A 5DG6A 3NCLA 2P93A 3LIWA 2PKAB 3LGVA 1P3EA 3BSQA 1BB0B 1FLEE 1QQ4A 3STIA 2VH0A 5I25A 3OSYA 2HNTF 1T8LA 1ZMLA 1P2OA 1P04A 1C5TA 1FY8E 2NU3E 2CMYA 4KKDA 2H1UA 1ZTLA 4BAMB 5HMAA 1CGHA 2Z9GA 1Y3XA 4AFUA 2VIPA 4NWKA 1BITA 1HV7A 1H9HE 1TMUH 1D3DB 1GI5A 3UQOA 1IHSH 2ZGHA 4GPGA 1XMNB 1TX7A 3D65E 5DP9A 4Z6AH 3OU0A 1G2MA 1GBJA 3QTOH 1GHVH 1Y3WA 1ZJKA 1GJDB 1E37B 2SGQE 1UK3A 2Y5HA 1GI9B 4BOHA 3ZVGA 1BBRE 3TK6A 5E0GA 1WUNH 1IQGA 1P0SH 3SNCA 2AGGX 2Z3DA 1GJ5H 2TGTA 1TAWA 1OOKB 2BXUH 1YBWA 2G4TA 2QN5T 4NIYA 2ODQA 1O3DA 3FVFB 4DCDA 3P8OA 2FLRH 1TOMH 4WMDA 3RXIA 1TRNA 4K1SA 4X6OA 1MTUA 4RSPA 1PQ7A 4JZFH 4WWYA 2BD7A 1SGIB 1JWTA 1O38A 1W2KH 2THFB 3QLPH 4U01A 1TGTA 5GCHG 1YPLH 1K1PA 3RMOH 4AORA 3S0NA 3SJIA 1HAYB 1YCPM 2PUXB 3P95A 4OS6A 1Z1JA 2BDYA 1ARBA 1QIXB 1BMAA 4ABHA 2OC7A 8LPRA 2K1QA 1YYY1 1JBUH 4TPYA 1WBGB 1UK2A 2UUJB 3EE0B 3EA7A 1SL3A 3ZZ7A 2AIPA 1Y3UA 1BTXA 3O8CA 1BTYA 1ZPCA 1FPHH 4CREA 3MFJA 1BBRK 4CBOA 3A89A 1W0YH 1ZHRA 3VFEA 4AGKA 1A5IA 1B5GH 1VCQA 1O3CA 1RRKA 2BXTH 1BIOA 2FEQH 2XBXA 1EPTC 4X1PU 1W3CA 4DT7B 1WOFA 1UVOA 1GBCA 2FOCA 3ZVBA 1O5EH 2QV1A 3GY2A 2AS9A 2BLVA 1ELEE 2A1DB 2O8WA 1DDJA 1ABIH 1QRWA 4BXWA 1ELFA 4R8TB 1FDPA 2C8WB 1DFPA 3UOUA 2ZU4A 3UIRA 1PQAA 5JB9S 3ATMA 1RXPA 1X7AC 1JRTA 1CE5A 4X0WU 2ZDLA 2QC2A 3GCTF 4MNXA 1P2JA 3KIDU 1CA8B 3BG4C 2ZO3H 1O2RA 1PPFE 3F9FA 1GMCG 3ODFA 1CO7E 3FP6E 3RUOA 1KXEA 3PWCA 5F6MA 2QCYA 1HIAA 1P2IA 1BTZA 1E36B 1TPSA 1UCYE 2PHBA 2OBQA 4MPWA 2W3KA 3ZZ3A 3GICB 4BAKB 4WH8A 1AVXA 3ZZBA 1PPEE 2C8ZB 8GCHG 2WPKS 4DGJA 2XYAA 2ZKSA 1KYNA 5L30H 3PMAB 1LMWB 3AASA 1AB9C 3M7TA 2D1JA 1BZXE 3RXEA 5L2ZH 1MCVA 3ZVAA 3D23A 1Y59T 2KAIA 3EAJA 3KCGH 3RXBA 3T29A 2NWNA 1ZTJA 2ZFRH 1PPHE 5FPTA 4HI3A 1RJXB 3NK8A 2A4OA 2ZDMA 4ISNA 3A83A 3ZZ6A 2QA9E 2A32A 4R0IA 4LZ4B 2PUQH 2ZDVH 3PM3A 4Y8YA 1FY3A 2FP7B 4A7IB 5ETXA 2F91A 1V2VT 3CS0A 2O8UA 4I8GA 5TCAA 1TLDA 2BD5A 1NFWA 1S5SA 2IOTA 2GGVB 2W5EA 4WXVA 2UUFB 1QHRB 4UEHH 1FIWA 2P8OC 1UCYK 3VXFH 4JK5A 3NZIA 3RMNH 4DY7B 3A8CA 2BMGB 1YPHE 4NIVA 4YLQH 4H6SB 1CT0E 1QB6A 5HM2A 3BTKE 1DLEA 1YPHC 1LVOA 5FAHA 2GZ9A 1AN1E 2FZZA 1C2HA 2GCTB 1C2LA 5E2PA 1V2KT 3ZV8A 4AGJA 3URDA 1AE8H 2G52A 3SQEE 4K2YA 1GHAF 3UPEA 1ELCA 1C1OA 3UFAA 4ABIA 2G55A 1O5GH 1FY5A 1IQMA 1SHHB 3ATLA 3RXOA 1NFYA 4QT8C 4O9VA 4DJZB 1QRZA 1GGDC 1EJMA 3BTGE 1TQ7B 3NPSA 4ZKOU 5BPEA 1G9IE 5CMXH 2DE8A 2FPZA 1O3IA 2ZPQA 1INCA 2FS9A 1O2WA 2EI7A 4ABEA 3GY7A 3W94A 2VWOA 2R3UA 2R0LA 1AVGH 3T28A 2Z94A 3SHCH 3O8RA 4UE7H 3SU3A 5A8ZA 1YCPK 5DJ7A 4X8UH 3MO3A 4NA8A 1C1WH 3M5NA 1W13U 2I6QA 4I7YH 5FBEA 4OS5A 5C5NA 1GBFA 2WYGA 1KXFA 2YNBA 4OS4A 3TH3H 4Y0YE 2OXSA 2A4RA 4NA9H 4YO9A 3DT0H 1DVAH 4CHAC 3PTBA 3FP8E 1C1NA 1EOLA 1MAYA 4JYTA 3RXTA 5DP6A 4MVNA 2VWMA 2GT7A 1DWBH 1V2UT 1QL8A 5FPSA 2VJ1A 2PLXA 3LC3A 1O3JA 2ZFTA 2XNIA 2J9NA 2PV9B 1BRAA 1C5MD 5EQQA 1GJ4H 1O37A 1HJ9A 2GDDA 4VGCC 1UK4A 2XC4A 2G5NA 1A0JA 3LH1A 4ZHLU 8KME2 4TYDA 2BDIA 4OS2A 4E7RG 1BJVA 1HBTH 4I33A 1FAXA 1OWHA 4K5ZA 4MG3A 3LH3A 4A92A 4NGAH 2Z9JA 3FP7E 3GCOA 1D3TB 1D3PB 3P17H 2EI8A 3E0PB 1Y3VA 4IMQA 4X1QU 2XWAA 1AZ8A 1A7SA 1QA7A 4IW4E 2BOKA 4D76A 3MH4A 4Q7ZA 1O3NA 1UHBA 3ZZAA 1PPGE 1DANH 1S81A 2V3OH 3RU4E 4AG2A 2F9BH 3EGKH 1D9IA 5BRRE 1QQUA 2JH6D 3BTDE 3TJVA 2BD3A 2HPPH 1N6XA 4INLA 1FV9A 4B2CA 2AGIX 1ZMNA 4ISOA 1QCPA 2Q6GA 1ELAA 3STJA 4E06H 1A4WH 4NSVA 1HAOH 1RIWC 2OC1A 2A4GA 5FHTA 2Y82A 4X6PA 2OC0A 3BTEE 1OP8A 2ZDKA 1SOZA 2R0KA 2FESH 4DURA 3M5LA 3P92A 1DLKB 3Q77A 1HXFH 4INKA 3TJOA 1C1TA 1GVZA 2CHAC 1C9TA 2HNTE 3A80A 3RXDA 3RXCA 4FU9A 1O3HA 4UFEH 1F2SE 1H1BA 2XCNA 2VNTA 2HNTC 4CRGA 1S6FA 3SNDA 4X6MA 2H9TH 1MBMA 2LPRA 4O97A 1T31A 1GI6A 5DKMA 1AFQB 1UTJA 3DD2H 1MCTA 1GJBB 1NFUA 3OY5U 4ABJA 2Z9KA 4ZAEA 1F7ZA 1GMDF 1ZPBA 5EU8A 3RC4A 2ALPA 1SR5C 1GBKA 2QY0B 3L33A 3UNRA 1HAZB 4DIHH 3RM0H 1DM4B 1KDQA 3UTUH 3S9AA 1HIAB 5GJ4B 1C5LH 2LNCA 4H6TA 2O9QA 1C2IA 3SV9A 3M3SA 2G5VA 4FVBA 1QBVH 3FFGA 7ESTE 3A7VA 1MKXH 4ZKRU 1OYTH 1Z8JB 3SV7A 3U1IB 1W10U 1ZJDA 2A7HA 1HDTH 1TMBH 1DE7H 2FI4E 2NU1E 4ZMAH 3P8GA 1Q2WA 4WH6A 1CSOE 5DP8A 2ESTE 3A87A 2BOHB 3ZVDA 4F49A 1C2JA 1TBQH 2J92A 1OKXA 1UTNA 5JYIA 2KAIB 1TYNA 2OLGA 1E0FD 2Y7XA 1KTTB 1T7CA 1TONA 3SHAH 1C1UH 1C2KA 1D3QB 4MLFB 4DVAU 1ZHMA 2A5KA 2ZFSA 4GSOA 2ANYA 2VH6A 3TGJE 3LONA 3LGTA 1SQOA 2YOLA 1EQ9A 1QB1A 5H4IB 1ANCA 4YT6H 1DITH 1C4Y2 1A3EH 2C93B 3IG6B 2ZEBA 5DP3A 3GY6A 1GJ6A 3U8TH 5LGOA 5AHGH 2XC0A 3D49H 1OP2A 3GOVB 4B75A 4YT7H 2RA3A 2NU4E 4JYVH 3W95A 1E34B 6GCHF 1UTPA 1ELDE 3ATIA 1EJNA 3MO6A 3LC5A 1AI8H 5EXMA 2GCHF 5A0AE 5JBCS 3RXMA 2BY7X 1H8DH 1BTWA 3RXUA 3VB5A 1AIXH 4NA7A 3M3VA 4XOJA 3AW1A 1UTQA 2WUCA 1O34A 1SI5H 2VVVA 1O2GH 2GD4B 1DY9A 3C1KA 1MTWA 2UUKB 2FS8A 3NWUA 3JZ1B 2A0QB 3A84A 4NIWA 2QAAA 4J2YB 3RMLH 1P2NA 3OTJE 4NIXA 3ZYDA 2UWLA 1IQEA 1MKWH 1C5UA 4IGDA 1CBWC 1G3CA 2C8YB 1XUHA 3A86A 3AVZA 1ZRKA 3TPIZ 1J17T 1NRSH 4JZ1A 5FPYA 1O2LA 1QA0A 1O2TA 1OYQA 1MH0A 1AHTH 1HAVA 4TY7A 2AMQA
chains in the Genus database with same CATH superfamily
1K1IA 2RA0A 1TGBA 1UVUH 3LGIA 2A4QA 1QBOA 4O3UA 1O2UA 6LPRA 1WAYB 3QWCH 3A8BA 1TNIA 4CR9A 3SJ8A 1KY9A 1G30B 2VIDA 2XCFA 2ZF0H 1LPGB 3MWIU 4XDEA 2B5TB 1VITH 1EASA 1TB6H 1TE0A 1LQDB 5C1UA 3H5CB 1WTGH 2BTCE 1O5BB 5EPYA 2JH0D 3DFLA 2C4FH 3QK1A 4HTCH 1F0TA 1B0FA 1GDNA 3M36A 1IQNA 2PWXA 3WWBA 4ZH8A 4TT3D 5SGAE 1FN8A 1RTKA 4NG9H 2GMTB 4FUEA 3H7TA 3KQBA 4GVUA 1Z6JH 2P59A 1TOCB 1S83A 4JCNA 1CA0C 3SBKA 3ZZDA 1KLIH 2TGAA 4CH8B 1UJ1A 1AD8H 3SU4A 1KIGH 3KGPA 1L4ZA 3MTYA 1O3EA 1SOTA 4CH2B 1MD7A 2QGRA 4E05H 3G01A 3DFJA 4ACBA 3RXPA 3BTHE 1VJ9U 1C5YB 3QGJA 4X1NU 1O2NA 2VGCC 3KQEA 2OBOA 2KCOA 2ZPRA 3ENSB 1V2LT 3N7DA 1NM6A 4DW2U 1KTSB 1Z71A 2CXVA 1VR1H 4ACAA 3GY4A 2ZGXH 5C94A 2VWLA 1K1OA 1SGDE 1H9IE 3A82A 3HK6B 1FPCH 2CF8H 1UHBB 2F9PA 3CNRA 5GIBA 4RKOB 3N7OA 2VVUA 1PQ8A 3SV6A 1EZUC 4AZ2B 4AG1A 3K65B 3RXAA 1P9SA 2CN0H 2CK3D 1EZQA 1T8OA 4WXIA 3UWIA 1Y8TA 2OCVB 3ESTA 1OSSA 1GL0E 4O03A 2FTMA 3ZVFA 1O30A 5CHAC 2ZA5A 2BVXH 4I8JA 1HAGE 2WYJA 5E0JA 5C1XA 4Y7AA 3UNSA 1EZXC 3F2FA 1DXPA 2FTLE 4FU8A 2GV6A 1ELGA 4I8LA 1SFQB 1THSH 1V6DA 2C8XB 1ETSH 1WU1A 1Y3YA 4THNH 1C2GA 1MZDA 5DGJA 1P2MA 2FO9A 2BY5X 1WCZA 2TPIZ 4FU7A 1DWCH 2VINA 5A8YA 1ANEA 1EAIA 1OWIA 2PR3A 1T32A 5FX5A 3GDUA 2UWOA 3S7KB 2A5AA 1V2OT 1C1VH 1SGPE 1P06A 1BJUA 3OY6U 3MH7A 4B76A 2W3IA 3F6UH 4KGAA 1IQKA 2GT8A 1GI1A 2FWWA 4NZLA 5E0HA 5B6OA 1WYKA 5ESTE 1KXCA 1CQQA 2ZHQH 1MD8A 2QXJA 3FZDA 3T27A 1NS3A 1KDQB 5IDKA 2BX4A 2F9NA 3LJOA 5IK2D 3F9GA 1F0RA 3RMMH 4UDWH 3UB0A 4GCHF 4ABAA 3QTVH 2NU2E 2FOBA 3M7UA 1RGQA 3A81A 1PFXC 1WSSH 1WTHD 2F9UA 1J15A 4ZROA 3RLYH 2A7CA 2D8WA 5T3HA 1GCTC 4IC6A 1KXDA 3PV4A 3PB1E 1BT7A 1BTHH 4PROA 5HM9A 2EA3A 3TGIE 3MNXA 3EA8A 3P8NA 2BD4A 1EAWA 3LJJA 1GG6C 1FXYA 4X6NA 2PKSC 4ZXXH 2F3CE 1H9LB 4SGBE 4ABGA 1IOEA 3SW2B 3RLWH 4A5TS 3P8FA 1YPGH 1C2DA 4RT1A 2BX3A 2K0QA 4K69A 4GHQA 2BQ7B 3PLKA 1TNJA 2EI6A 4OGXA 1BBRH 1TBZH 1QNJA 2ZCHP 2JETC 4WY3A 4J1YA 4AB8A 1KSNA 1W12U 3MOCA 4FUIA 1ELBA 1YLDA 1DWDH 2XRCA 1Q31A 2YMSB 3TJNA 1O3KA 4K1TA 5A8XA 3TNSA 2SNVA 5JPMH 4AB9A 1CGJE 1C9PA 5EJ1A 3TH2H 4ABDA 2ZGBH 4YOJA 1DPOA 1BCUH 1XUFA 1E79D 1OWKA 4ZHMU 4A1XA 4Y11E 2P3UB 1PJPA 3SQHE 2ZHFH 1SFIA 1ZYOA 3SJKA 3T25A 2FOEA 4F48B 5GXPA 3BEIB 1GDUA 3RXRA 1P10A 1QB9A 2FOFA 4MPUA 3SUFA 2HRVA 1S6HA 1FIZA 4Q4LA 2DE9A 1VCPA 1EKBB 3MH6A 1W14U 2UWPA 3DA9B 3ELAH 2H6MA 3Q3XA 1CHOG 3GY3A 3AAUA 2Z6BD 1DSTA 1L0ZA 2QF5A 1V2JT 1UTLM 1HAVB 1WQSA 5C67A 1C5PA 1CGIE 1BRCE 1O39A 1SGTA 1E1QD 1TIOA 2A7JA 3S7HB 4AX9H 9LPRA 3BG8A 1LHEH 4Q80A 3GYMA 2ODYB 1TPAE 2HVXA 3M3TA 5EQRA 3A8AA 4YLUA 1LHCH 1HJAC 1QL7A 2FLBH 1RTLA 3LT3A 4ZKNU 2BD2A 1KLTA 2KCAA 1EB2A 1SGYE 2F43B 2ZHWH 4FUFA 3AAVA 1ZRBA 2RDLA 3PV5A 5F8ZA 1P11E 2CF9H 4WJG2 2ZTZA 1O2KA 1F0UA 2P3TB 2ASUB 5GNDA 4K8YA 3BG4B 3SZEA 4NSYA 1J8AA 1ETRH 5DP7A 4JMYA 1O35A 2HLCA 1A0HB 2FYQA 5HXFA 4MQAA 2GZ7A 1UCYH 1C1SA 3H7OA 5EQSA 1PPCE 4D8NA 1GMDG 1LO6A 1C4V2 1NRQH 1IAUA 3DUXH 3VB7A 1GMCF 1GBLA 4YOGA 2ZCLP 1HB0B 1HXEH 5PTPA 4CBNA 1FN6A 1LPKB 1E38B 4X8SH 2J5UA 3ZVCA 4KTSA 2CGAA 3K2UA 2KZ4A 1ESBA 1FJSA 1HNEE 2CV3A 1AB9B 4ISLA 5DK1A 3VGCC 2W26A 2BD8A 3KQCA 1P05A 2O8MA 2WPIS 4WMEA 1LKAA 1SBWA 3QO6A 5E8EH 3TK9A 2WUBA 2Y81A 1O2XA 3R3GB 5FXLA 2J94A 1ZGVA 1XVOA 3F2HA 3U8RH 2AERH 2Z3CA 1EZSC 3NRLA 2ZTXA 4BTIB 1MUEB 2BLWA 2VIOA 2QXIA 2BB4A 4CRDA 5LPRA 1EJAA 4GUXA 1DWEH 1YCPH 2BLQA 3URCA 2P8OB 1UTOA 1BDAA 1A3BH 1QTFA 3TU7H 2GDEH 3M5OA 4OS7A 3TGKE 1BTPA 4LK4A 5G4BA 3PMHB 2OQUA 1MBQA 1SHYA 2WV9A 3QZQA 3QZRA 2SGFE 1Y5UT 1M9UA 2ALVA 1N8OB 3EDXB 1O3OA 3SU0A 2WV4A 1HJ8A 1GMHF 3BTTE 1AGJA 4Y0ZE 1G32B 3RDZA 6GCHG 2PP6A 4SGAE 1XXDA 3TIUA 2PW8H 1NRNH 2A45B 5C2ZA 2C3SA 1GL1A 4UD9H 1K1LA 2BY8X 1BMLA 1GI2A 1ID5H 4B6EA 4JZIA 3SGQE 2XBVA 5A0BA 1EP5A 2G8TA 1GGDB 4NCYA 4UFGH 1AWHB 1MMJN 2BZAA 3OEHD 4WF8A 1QL9A 2Z3EA 1AMHA 1BTUA 2ZGJA 2AGEX 2G51A 2R2WU 4K8BA 2ZG0H 1P09A 3GY5A 3MH5A 1Z7KA 1A5HA 1SQAA 3GCHB 2XBYA 1YP9A 3RXFA 3P70B 4Y71A 1A0LA 1C4U2 1F5LA 1ORFA 3SORA 5AFYH 1O3MA 1DX5M 5HIZA 1P57B 5EODA 4Z1MD 1P8VC 3KHVA 1IQHA 3CP7A 2FX6A 4MTBA 1G3EA 1G37A 1SQRA 1WV7H 3GDSA 4JYUH 1LVBA 1P01A 2J34A 3VEQB 5DP4A 3GISB 4BAOB 4CHAB 4Y8XA 1EX3A 1O5CB 4DG4A 2VIVA 7GCHG 1LTOA 4K60A 1S6LA 5K7RA 1IQLA 2NU0E 2DUCA 4UONA 4YXWD 5HYOA 1C2MA 1ZPZA 5IYTA 2TGPZ 1QY6A 1FQ3A 1CT2E 1MU8B 2P3FH 3ATWA 2QE7D 3JZ2B 2BLOA 5EPNA 1ESTA 1ZSJA 2VU8E 1MTNC 2FDAA 4I31A 1NRRH 4Y8ZA 4VGCB 1U6QA 5FCKA 2QXGA 2BDAA 3RC6A 1TNLA 3U9AH 2OQ5A 2J98A 1O2PA 2RDEA 1O2JA 3BEUA 1EXFA 1GI0A 3SU6A 4GAWA 4X8TH 3ZZCA 1MU6B 1C5SA 1LCYA 1NN6A 3TVJB 6CHAB 1C2FA 4RI0A 1T8MA 2VIWA 3CS7A 1MAXA 1SB1H 2AFQB 3ZZ9A 5FCRA 2A2XH 2G00A 2ANKH 2WV5A 1UO6A 2AIQA 3HKIB 1SLVB 1GBBA 3OAAD 5JBAS 1TALA 1GCDA 3UAIC 2VIQA 4A1TA 3V12A 2FOAA 3KYFA 1FNIA 3PWBA 4FUJA 4Y79A 3I78A 3MU5A 4YESB 5EXNA 2ZTYA 1XKAC 4P02A 1MZAA 1RIWB 2PTCE 4ISHH 3K6YA 2GP9B 2BD9A 1P02A 2SFAA 1P3CA 4K1EA 3L6PA 2F9OA 3GY8A 4X2VA 4ABBA 4X1RU 4H4FA 1GHBF 3KL6A 1EAUA 2AH4X 1HRTH 2B7DH 4NFEA 4F4OC 3E3TA 4B6FA 3B8JA 2CHAB 1F0SA 2JKHA 2ODPA 2GV7A 2QIQA 3VB3A 5J4QA 1PQ5A 4LXBH 1TBRH 4Y10E 1O0DH 1SGRE 2ZFPH 2BDHA 1ABJH 1NU7B 1SGNE 5ABWA 1BA8B 3IWMA 1LHGH 1GBHA 3SJOA 2JIZD 1O3PB 4AN7A 3GS9A 3E8LA 1AZZA 2QYIA 2OTVA 2Y5GA 1THRH 3K9XB 1NY22 1Z8IB 1TABE 2G4UA 2JJ1D 1GHXH 4H42U 3A7WA 5FX6A 1EPTA 1DT2A 1UVSH 3FANA 3MU1A 3A7YA 4MDSA 5EW2H 1XM1A 2R2MB 2P94A 2ZI2H 3Q76A 3QGNB 3BIVH 1BRUP 5K0HA 2H5DA 3RXKA 2PFEA 3V7TA 2FXRA 1KXBA 3E16B 2CJIA 5I46H 1HYLA 1T4VH 1TX6A 3HKJB 4I86A 4O3TA 5E2OA 4E7NA 3M37A 3FOAA 3KF2A 1HAIH 2OP9A 4X2XA 2ZHDA 1LHDH 4XD7D 3RXHA 1QJ1B 1GHWH 3CENA 5T6GA 1GBAA 1O3GA 1P03A 3SV8A 5T6DA 1K1NA 3VXEH 2BZ6H 3EA9A 1K22H 2WPHS 3E90B 1ZSKA 2WSSD 4AFQA 2HALA 2ZPSA 3F2GA 1IQJA 5JB8S 3SV2H 2V6NA 5DN6D 3ATKA 1LPZB 3HK3B 3GCTG 1A1RA 3MMGA 4ZKSU 4IN2A 4RT0A 1AU8A 1G3DA 1SGCA 4TPIZ 4BAHB 1V2QT 4X2WA 4XBBA 1O2MA 2Q6DA 1D4PB 3ZIAD 4CRCA 1GJAB 2Q1JA 1PPBH 3SUEA 2TRMA 2ZC9H 2HWLB 4OS1A 3HGPA 5CE1A 4AC9A 2BYAX 1FAKH 1SVPA 1HAXB 2ANMH 3BIUH 2XBWA 3SU2A 1NT1A 2G81E 3Q3KA 2A5IA 3K6ZA 1L1JA 3PLPA 3VB6A 1YPKH 2H5CA 1TA6A 2GX4A 3B23B 1IHTH 3FAOA 2BQ6B 4DOQA 4YZUA 2AYWA 1ZMJA 3PV2A 1DY8A 2XC5A 3LGWA 3N7EA 3GYLB 1IQIA 1SPJA 1TRYA 4BTUB 1QRXA 3ZYEA 1ZHPA 3M5MA 1XKBC 9ESTA 2XNDD 2BDGA 2M5TA 1L1NA 5F8XA 2QF0A 5EGMA 1A2CH 2YMSC 2BY6X 1C5RA 4BXSA 3PTNA 3V0XA 4JK6A 1TA2A 4Y6DA 4FUCA 3M35A 2BHGA 2VB0A 4ZXYH 5GWZA 4HFPB 1DXWA 1W0KD 2WPLS 4ZHAA 3FO8D 3BTFE 1NFXA 2ZU1A 1SQTA 1VITF 2O8LA 1OP0A 4BNRA 1CBWB 2Z7FE 1EP6A 2QXHA 5AF9H 2BVSH 4D7FA 1DICA 5KGOA 2SNWA 2YNAA 4A1VA 2FOMB 1CVWH 1ZSLA 1VGCB 1O2HA 1GBMA 4WMFA 1K28D 1DSUA 2I6SA 3T5FH 5TJXA 1NESE 4YOIA 1V3XA 3LU9B 3ZV9A 4A6LA 3RXLA 1QGFA 4LOYH 3SGBE 1G36A 3ZZ5A 4ABFA 2GKVE 5C20A 1EUFA 3PO1B 3NKKA 2ANWA 1AO5A 4IN1A 1XVMA 3T26A 3MU8A 3T62A 4B73A 3GCNA 4BAQB 4FUGA 1GHAG 1C1MA 5EJLA 4B2AA 5L6NH 4M9FA 1G3BA 2GCTC 2V3HH 3BV9B 3TH4H 2A31A 1UVTH 1O3FA 4YM9A 2TBSA 2HGTH 1FONA 1VJAU 2GZ8A 3SNAA 4GHTA 2L74A 4TY6A 1IQFA 1EB1H 1CA0B 5CHBA 4BANB 2ZZUH 1XX9A 4RN6A 4JZEH 1V2TT 2KCYA 2J98B 1SG8B 1K0HA 2QF4A 2OC8A 1L4DA 1HUTH 1NTPA 4I8KA 1XUIA 3LOXA 1SSXA 3NUMA 4Q7YA 4Z0KA 3SOSA 4CR5A 2BDCA 4ISIH 1K1MA 2VGCB 3WY8A 1HLTH 3TLOA 1AQ7A 1SLUB 1SGEE 4KELA 3RP2A 1CT4E 1TRMA 3TJUA 3UNQA 3EQ0H 3UR9A 1MTVA 3UOPA 3IITA 1A61H 5LPEA 2RCEA 3O8DA 1BMNH 3V3MA 5AVDA 4K3JA 1W7GH 3E0NB 3VPKA 1W11U 1N6YA 1AVWA 1TGSZ 3LGYA 4RKJB 5EXLA 3A85A 1O2IA 2WINI 5F03A 3A7XA 4WVPE 3OYPA 4FUDA 2AMDA 3Q3YA 1VZQH 1S84A 4B1TA 3U1JB 2GJGA 5CHAB 1GVKB 1SGFG 4KP0A 1QFKH 1JOUB 1J9CH 3FZZA 2FODA 4MNWA 1UMAH 1KXAA 1H8HD 2TGDA 2ZDNA 2BDBA 1C5OH 4CRBA 4UFFH 1W0ZU 1YC0A 2AHME 2HVYB 1D6WA 2HOBA 2A2QH 3T2NA 1YPMH 1L2EA 1O2VA 1VCWA 2IN2A 3HPTB 3FN8A 5J4SA 1XUKA 4ZUHA 3LGUA 4GLYA 5GCHF 1J16A 2PGBB 1FI8A 1GDQA 1ZLRA 5JDUB 1FMGA 1TX8A 4AFSA 1P2QA 1GBTA 1HAPH 1NRPH 2VWNA 3BEFB 1TGNA 3MU4A 2BQWB 4X1SU 3U69H 1OXGA 3R0FA 1TNKA 3F3BA 1JMOH 1O2YA 1S85A 2V3MA 3F0PA 4XE4A 2XOKD 1QR3E 3UR6A 1ARCA 1QBNA 3HGNA 1NPMA 2XXLA 3PYHA 1ANBA 2EY4C 1Z6EA 1EPTB 1O2ZA 1AUTC 3A88A 3F68H 3MYWA 1TGCA 4MPXA 5LH8A 2PSYA 1HGTH 3BTQE 1GJ8B 1GJ7B 1K9OE 1SLWB 1GMHG 4Y7BA 1EATA 2UUYA 1AE5A 2C90B 2Z9IA 1N8OC 3SU5A 4FUHA 1GJ9B 3E6PH 1UVPA 2ZDAH 1COWD 4NZQA 1ESAA 1NU9A 3F9EA 2FMJA 3O8BA 1RS0A 4AYYB 1S0RA 1GCTB 2ZU2A 1BOQA 1GBDA 2EEKA 2ZIQH 2PSXA 3SI3H 4XFQA 4JZDH 1C2EA 1KMHB 1BHXB 3E91A 1GG6B 1HPGA 1ELVA 2FX4A 2PKSB 3OX7U 4U32A 1F5RA 4D9RA 5AFZH 1A46H 1ZOMA 3Q00A 3LKWA 2FYRA 1ELTA 1LKBA 3KN2A 5ESBA 2SGPE 5A0CA 2FM2A 2ZGCA 4U2WA 3ZZ4A 5A09A 1SGQE 1TFXA 1AFQC 3GCHC 2F9VA 2ILNA 1AKSA 1CHGA 1OS8A 2JETB 2B8OH 1NC6A 1DUAA 5GDSH 2J38A 3SO3A 3SZNA 3S9CA 1V2MT 3TNTA 3W1EA 1P2KA 1F92A 1RTFB 2SGAA 1K21H 4M7GA 1LQEA 1KLJH 1JXPA 5DO4H 3VG8A 2J4IA 2ZQ2A 3U98H 8GCHF 1C5XB 3KEEA 1N1LA 4B2BA 1K2I1 2H9HA 1UTMA 2IPHA 3KQDA 1ZGIA 3RXVA 4B74A 1OWEA 1D6RA 2J2UA 1C1PA 2QF3A 3I29A 4IS5A 1O3BA 3C27B 2BY9X 1S82A 1Z1IA 2PKAA 3D62A 1ETTH 1L1GA 3MU0A 2KR7A 2WZQA 1O5DH 3UQVA 2Y80A 5T6FA 1GI8B 5JBBS 4HGCA 1A5GH 1Y5BT 2BM2A 5DP5A 4ASHA 1V2NT 1E35B 3RXGA 1GBIA 1OWDA 1W7XH 4AYVB 4D7GA 2XWBI 2OD3B 3MNCA 1GI4A 2STBE 4XBDA 3MI4A 1YPEH 3ITIA 3SUDA 1ANDA 2FOGA 3S9BA 1QURH 3DCLA 4X2YA 3DSPA 2ZNKH 1LDTT 2HLDD 1GBEA 6CHAC 5EG4A 1BHXF 4IC5A 3U8OH 4HZHA 1O32A 2TIOA 1V2PT 1YWUA 1CHOF 1C1RA 1PPZA 2ZU3A 5C3NA 1GHZA 2R3YA 3ZVEA 2GCHG 1BRBE 5HIYA 3QUMP 4Q7XA 1JRSA 2HPQH 3SN8A 7KMEH 3SNBA 3SU1A 1Y5AT 1HJAB 2XW9A 2AEIH 3B9FH 3M7QA 1GHBG 1MKXK 2ZFQH 2JH5D 3UREA 3N99A 2P16A 3VB4A 4YTAA 3SI4H 1SMFE 2FOHA 3MNSA 6ESTA 3BF6H 1ZZZA 3KNXA 1BUIA 1YLCA 4UFDH 4ZCNA 2H9EH 3EYDA 1GJCB 1T8NA 1TWXB 5CDFE 1DUEA 1P9UA 2Q6FA 4CRAA 1FUJA 1B7XB 3KYGA 1Z8RA 8ESTE 2W7SA 2ZHEH 1FY1A 1J14A 1UTKA 3V13A 3SGAE 2O8TA 1TQ0B 3ZZ8A 1Z8GA 2FIRH 3MO9A 1SC8U 5JBTA 4IMZA 1NROH 2D26C 2EC9H 2B0FA 2ULLA 1WXRA 3SNEA 1GI7B 1MTSA 5F8TA 1O3AA 5LPFA 1T4UH 1WQVH 2V35A 3U28C 2D2DA 1C5ZB 4CRFA 3VGCB 2OUAA 1HFDA 4NWLA 4TWWA 5HGGA 1O2QA 1K1JA 2ZWLH 4X8VH 1MQ5A 5A2MH 1JIRA 3RU4D 3HATH 1TPOA 1THPB 1YKTA 3UWJH 2Z9LA 3MQKC 3MHWU 1GVLA 1PYTC 1O5AB 3RXJA 3MNBA 3A7TA 5EOKA 2SGEE 1GPZA 4FUBA 2XTTB 4I8HA 2SGDE 3WWFA 1LHFH 2J95A 3BTME 2FI3E 3L3TA 5TCCA 2ZECA 1V2ST 1XXFA 5GPIB 2GMTC 5C5OA 2GVFA 3SUGA 4D9QA 3LPRA 1YGCH 5C1YA 3AW0A 3BN9A 1XUGA 1H8IH 3OTPA 1MKWK 1LVYA 1GWAA 4INHA 4NFFA 1HAHH 1C5QA 3UUZA 1OWJA 2RG3A 1C5WB 1LVMA 2Y6TA 3RC5A 2Y7ZA 3I77A 3A7ZA 5EW1H 2IJD1 2WPMS 2ZFFH 7LPRA 1H4WA 2F83A 5HKKD 4Q2KA 1C5NH 1B0EA 3S69A 2IJOB 3PLBA 1YM0A 5DPAA 1ACBE 2K8IA 2JDID 2ZU5A 2LP6A 4KTCA 1QJ6B 1O5FH 1AFEH 1QJ7B 1FY4A 3P6ZB 3QX5H 1FZZA 1O31A 1YPJH 2OINA 2WPJS 3RXSA 1SLXB 1NO9H 4XRNA 1AWFH 3PMJA 1BMMH 4MPVA 4FXGH 3AK5A 4MNYA 3E1XB 4FVDA 4ESTE 4BTTB 1P12E 3GDVA 3A8DA 1O2OA 5FL7D 1O2SA 1MQ6A 1W8BH 1BQYA 2FI5E 1YF4A 2RFKC 3QN7A 1PYTD 1TNGA 3RU4T 2W7UA 4KTUA 3RXQA 3PMBB 1OPHB 1ZR0A 5EJZA 1VITG 3LDXH 3TITA 2BVRH 2ZQ1A 1EAXA 1EOJA 1C5VA 5KEDA 1O36A 1ZTKA 3PROA 4DIIH 4AFZA 3H09A 2P95A 1WDIA 2V0BA 3F1SB 3SJ9A 3OEED 3F9HA 1TNHA 2H2ZA 4Y76A 3OFND 1CU1A 1DS2E 3DHKH 2STAE 1XUJA 1NZQH 1SGFA 4IBLH 4XSKU 2L6OA 4LZ1H 1DOJA 4B71A 1V2WT 1JIMA 4XBCA 1AY6H 3RM2H 1S0QA 2M2AA 1VGCC 4AOQA 4OGYA 2R9PA 1AKSB 1AUJA 1TMTH 1C1QA 4I32A 5L2YH 2GTBA 2PGQB 3ODDA 2ZP0H 1Q3XA 7GCHF 1GI3A 4OM9A 1MTNB 2Y5FA 3QDZB 1V2RT 5EIYA 2ZCKP 1HCGA 2PTNA 1O33A 4MNVA 4GCHG 1RFNA 4TWYA 1OX1A 3M61U 1TPPA 5FBIA 3PO1C 2AMPA 4U30A 1GHYH 3BTWE 1RD3B 2VVCA 3NXPA 3TK5A 2B9LA 1F5KU 1G2LA 1O3LA 3UY9A 5DG6A 3NCLA 2P93A 3LIWA 2PKAB 3LGVA 1P3EA 3BSQA 1BB0B 1FLEE 1QQ4A 3STIA 2VH0A 5I25A 3OSYA 2HNTF 1T8LA 1ZMLA 1P2OA 1P04A 1C5TA 1FY8E 2NU3E 2CMYA 4KKDA 2H1UA 1ZTLA 4BAMB 5HMAA 1CGHA 2Z9GA 1Y3XA 4AFUA 2VIPA 4NWKA 1BITA 1HV7A 1H9HE 1TMUH 1D3DB 1GI5A 3UQOA 1IHSH 4DT4A 2ZGHA 4GPGA 1XMNB 1TX7A 4TSFD 3D65E 1H8ED 5DP9A 4Z6AH 3OU0A 1G2MA 1GBJA 3QTOH 1GHVH 1Y3WA 1ZJKA 1GJDB 1E37B 2SGQE 1UK3A 2Y5HA 1GI9B 4BOHA 3ZVGA 1BBRE 3TK6A 5E0GA 1WUNH 1IQGA 1P0SH 3SNCA 2AGGX 2Z3DA 1GJ5H 2TGTA 1TAWA 1OOKB 2BXUH 1YBWA 2G4TA 2QN5T 2VBCA 4NIYA 2ODQA 1O3DA 3FVFB 4DCDA 3P8OA 2FLRH 1TOMH 4WMDA 3RXIA 1TRNA 4K1SA 4X6OA 5T1VA 1MTUA 4RSPA 1PQ7A 4JZFH 4WWYA 2BD7A 1SGIB 1JWTA 1O38A 1W2KH 2THFB 3QLPH 4U01A 1TGTA 5GCHG 1YPLH 1K1PA 3RMOH 4AORA 3S0NA 3SJIA 1HAYB 1YCPM 2PUXB 3P95A 4OS6A 1Z1JA 2BDYA 1ARBA 1QIXB 1BMAA 4ABHA 2OC7A 8LPRA 2K1QA 1YYY1 1JBUH 4TPYA 1WBGB 1UK2A 2UUJB 3EE0B 3EA7A 1SL3A 3ZZ7A 2AIPA 1Y3UA 1BTXA 3O8CA 1BTYA 1ZPCA 1FPHH 2WHXA 4CREA 3MFJA 1BBRK 4CBOA 3A89A 1W0YH 1ZHRA 3VFEA 4AGKA 1A5IA 1B5GH 1VCQA 1O3CA 1RRKA 2BXTH 1BIOA 2FEQH 2XBXA 1EPTC 4X1PU 1W3CA 4DT7B 1WOFA 1UVOA 1GBCA 2FOCA 3ZVBA 1O5EH 2QV1A 1FX0B 2AS9A 3GY2A 3WW7A 2BLVA 2YMSD 1ELEE 2A1DB 2O8WA 1DDJA 1ABIH 1QRWA 4BXWA 1ELFA 4R8TB 1FDPA 2C8WB 1DFPA 3F0OA 3UOUA 2ZU4A 3UIRA 1PQAA 5JB9S 3ATMA 1RXPA 1X7AC 1JRTA 1CE5A 1BMFD 4X0WU 2ZDLA 2QC2A 3GCTF 4MNXA 1P2JA 5KECA 3KIDU 1CA8B 3BG4C 2ZO3H 1O2RA 1PPFE 3F9FA 1GMCG 3ODFA 1CO7E 3FP6E 3RUOA 1KXEA 4ASUD 3PWCA 5F6MA 2QCYA 1HIAA 1P2IA 1BTZA 1E36B 1TPSA 1UCYE 2PHBA 2OBQA 4MPWA 2W3KA 3ZZ3A 3GICB 4BAKB 4WH8A 1YY3A 1AVXA 3ZZBA 1PPEE 2C8ZB 8GCHG 2WPKS 4DGJA 2XYAA 2ZKSA 1KYNA 5L30H 3PMAB 1LMWB 5C17A 3AASA 1AB9C 3M7TA 2D1JA 1BZXE 3RXEA 5L2ZH 1MCVA 3ZVAA 3D23A 1Y59T 2KAIA 3EAJA 3KCGH 3RXBA 3T29A 2NWNA 1ZTJA 2ZFRH 1PPHE 5FPTA 4HI3A 1RJXB 3NK8A 4F55A 2A4OA 2ZDMA 4ISNA 3A83A 3ZZ6A 2QA9E 2A32A 4R0IA 4LZ4B 2PUQH 2ZDVH 3PM3A 4Y8YA 1FY3A 2FP7B 4A7IB 5ETXA 2F91A 1V2VT 2F4LA 3CS0A 2O8UA 4I8GA 5TCAA 1TLDA 2BD5A 1NFWA 1S5SA 2IOTA 2GGVB 2W5EA 4WXVA 2UUFB 1QHRB 4UEHH 1FIWA 2P8OC 1UCYK 3VXFH 4JK5A 2J97A 3NZIA 3RMNH 4DY7B 3A8CA 2BMGB 1YPHE 4NIVA 4YLQH 4H6SB 1CT0E 1QB6A 5HM2A 3BTKE 2KM0A 1DLEA 1YPHC 1LVOA 4Q63A 5FAHA 2GZ9A 1AN1E 2FZZA 1C2HA 2GCTB 1C2LA 5E2PA 1V2KT 3ZV8A 4AGJA 3URDA 1AE8H 2G52A 2W6JD 3SQEE 4K2YA 1GHAF 3UPEA 1ELCA 3DSGA 1C1OA 3UFAA 4ABIA 2G55A 1O5GH 1FY5A 1IQMA 1SHHB 3ATLA 3RXOA 3PRBA 1NFYA 4QT8C 4O9VA 4DJZB 1QRZA 1GGDC 1EJMA 3BTGE 1TQ7B 3NPSA 4ZKOU 1UW7A 5BPEA 1G9IE 5CMXH 2DE8A 2FPZA 1O3IA 2ZPQA 1INCA 2FS9A 1O2WA 2EI7A 4ABEA 3GY7A 2JJ2D 3W94A 2VWOA 2R3UA 2R0LA 1AVGH 2OK5A 2Z94A 3T28A 1W0JD 3SHCH 3O8RA 3KQ5A 4UE7H 3SU3A 5A8ZA 1YCPK 5DJ7A 2W6ID 4X8UH 4FETA 3MO3A 4NA8A 1C1WH 3M5NA 5F53A 1W13U 5C0UA 2I6QA 2EQNA 4I7YH 5FBEA 4OS5A 5C5NA 1GBFA 2WYGA 1KXFA 2YNBA 4OS4A 3TH3H 4Y0YE 2OXSA 2A4RA 4NA9H 4YO9A 3DT0H 1DVAH 4CHAC 3PTBA 3FP8E 1C1NA 1EOLA 1MABB 1MAYA 4JYTA 3RXTA 5DP6A 4MVNA 2VWMA 2GT7A 1DWBH 1V2UT 1QL8A 5FPSA 2VJ1A 2PLXA 3LC3A 1O3JA 2ZFTA 2XNIA 2J9NA 2PV9B 1BRAA 1C5MD 5EQQA 1GJ4H 1O37A 1HJ9A 2GDDA 4VGCC 1UK4A 2IPQX 2XC4A 2G5NA 1A0JA 3LH1A 4ZHLU 8KME2 4HG6A 4TYDA 1NBME 2BDIA 4OS2A 4E7RG 1BJVA 1HBTH 4I33A 1FAXA 1OWHA 4K5ZA 4MG3A 3LH3A 4A92A 4NGAH 2Z9JA 3FP7E 3GCOA 1D3TB 1D3PB 3P17H 2EI8A 3E0PB 1Y3VA 4IMQA 4X1QU 2XWAA 1AZ8A 1A7SA 1QA7A 4IW4E 2BOKA 4D76A 3MH4A 4Q7ZA 1O3NA 1UHBA 3ZZAA 1PPGE 1DANH 1S81A 2V3OH 3RU4E 1VKYA 4AG2A 2F9BH 3EGKH 1D9IA 5BRRE 1QQUA 2JH6D 5C0TA 3BTDE 3TJVA 2BD3A 2HPPH 1N6XA 4INLA 1FV9A 4B2CA 2AGIX 1ZMNA 4ISOA 1QCPA 2Q6GA 1ELAA 3STJA 4E06H 1A4WH 4NSVA 1HAOH 1RIWC 2OC1A 2A4GA 5FHTA 1YLNA 2Y82A 4X6PA 3DSOA 2OC0A 3BTEE 1OP8A 2ZDKA 1SOZA 2R0KA 2FESH 4DURA 3M5LA 3P92A 3EE7A 1DLKB 3Q77A 1HXFH 4INKA 3TJOA 1C1TA 1GVZA 2CHAC 1C9TA 2HNTE 3A80A 3RXDA 3RXCA 4FU9A 1O3HA 4UFEH 1F2SE 1H1BA 2XCNA 2VNTA 2HNTC 4CRGA 1S6FA 3PRDA 3SNDA 4X6MA 2H9TH 1MBMA 3FKSD 2LPRA 4O97A 1T31A 1GI6A 5DKMA 1AFQB 1UTJA 3DD2H 1MCTA 1GJBB 1NBMD 1NFUA 3OY5U 4ABJA 2Z9KA 4ZAEA 1F7ZA 1GMDF 1ZPBA 5EU8A 3RC4A 1QZ8A 2ALPA 1SR5C 1GBKA 2KFWA 2QY0B 3L33A 3UNRA 1HAZB 4DIHH 3RM0H 1DM4B 1KDQA 3UTUH 2LELA 5B6LA 1E1RD 3S9AA 1HIAB 5GJ4B 1C5LH 2LNCA 4H6TA 2O9QA 1C2IA 3SV9A 3M3SA 2G5VA 4FVBA 1QBVH 3FFGA 7ESTE 3A7VA 1MKXH 4ZKRU 1OYTH 1Z8JB 3SV7A 3U1IB 1SKYE 1W10U 1ZJDA 2A7HA 1HDTH 1TMBH 1DE7H 2FI4E 2NU1E 4ZMAH 3P8GA 1Q2WA 4WH6A 1CSOE 5DP8A 2ESTE 3A87A 2BOHB 3ZVDA 4F49A 1C2JA 1TBQH 2J92A 1OKXA 1UTNA 5JYIA 2KAIB 4FOUC 1TYNA 2OLGA 1E0FD 3OE7D 2Y7XA 1KTTB 1T7CA 1TONA 4P00A 3SHAH 1C1UH 1C2KA 1D3QB 4MLFB 4DVAU 1ZHMA 2A5KA 2ZFSA 4GSOA 2ANYA 2VH6A 3TGJE 3LONA 3LGTA 1SQOA 2YOLA 1EQ9A 1QB1A 5H4IB 1ANCA 4YT6H 1DITH 1C4Y2 1A3EH 5DSFA 2C93B 3IG6B 2ZEBA 2KX4A 5DP3A 3GY6A 1GJ6A 3SYJA 3U8TH 5LGOA 5AHGH 2XC0A 3D49H 1OP2A 3GOVB 4B75A 4YT7H 2RA3A 2NU4E 4JYVH 3W95A 1E34B 6GCHF 1UTPA 1ELDE 3ATIA 1EJNA 3MO6A 3LC5A 1AI8H 5EXMA 2GCHF 5A0AE 5JBCS 3RXMA 2BY7X 1H8DH 1BTWA 3RXUA 3VB5A 1AIXH 4NA7A 3M3VA 4XOJA 1OHHD 3AW1A 1UTQA 2WUCA 1O34A 1SI5H 2VVVA 1O2GH 2GD4B 1DY9A 1EFRD 3C1KA 1MTWA 2UUKB 2FS8A 3NWUA 3JZ1B 2A0QB 3A84A 4NIWA 2QAAA 2WPDD 4J2YB 2KCPA 3RMLH 1P2NA 3OTJE 4NIXA 3ZYDA 2UWLA 1IQEA 2V7QD 1MKWH 1C5UA 4IGDA 1CBWC 1G3CA 2C8YB 1XUHA 3A86A 3AVZA 1ZRKA 3TPIZ 1J17T 1NRSH 4JZ1A 5FPYA 1O2LA 1QA0A 1O2TA 1OYQA 1MH0A 1AHTH 1HAVA 4TY7A 2AMQA
chains in the Genus database with same CATH topology
1K1IA 2RA0A 1TGBA 1UVUH 3LGIA 2A4QA 1QBOA 4O3UA 1O2UA 6LPRA 1WAYB 3QWCH 3A8BA 1TNIA 4CR9A 3SJ8A 1KY9A 1G30B 2VIDA 2XCFA 2ZF0H 1LPGB 3MWIU 4XDEA 2B5TB 1VITH 1EASA 1TB6H 1TE0A 1LQDB 5C1UA 3H5CB 1WTGH 2BTCE 1O5BB 5EPYA 2JH0D 3DFLA 2C4FH 3QK1A 4HTCH 1F0TA 1B0FA 1GDNA 3M36A 1IQNA 2PWXA 4ZH8A 5SGAE 1FN8A 1RTKA 4NG9H 2GMTB 4FUEA 3H7TA 3KQBA 4GVUA 1Z6JH 2P59A 1TOCB 1S83A 4JCNA 1CA0C 3SBKA 3ZZDA 1KLIH 2TGAA 4CH8B 1UJ1A 1AD8H 3SU4A 1KIGH 3KGPA 1L4ZA 3MTYA 1O3EA 1SOTA 4CH2B 1MD7A 2QGRA 4E05H 3G01A 3DFJA 3RXPA 3BTHE 1VJ9U 1C5YB 3QGJA 4X1NU 1O2NA 2VGCC 3KQEA 2OBOA 2ZPRA 3ENSB 1V2LT 1NM6A 4DW2U 1KTSB 1Z71A 2CXVA 1VR1H 3GY4A 2ZGXH 2VWLA 1K1OA 1SGDE 1H9IE 3A82A 3HK6B 1FPCH 2CF8H 1UHBB 2F9PA 5GIBA 4RKOB 3N7OA 2VVUA 1PQ8A 3SV6A 1EZUC 4AZ2B 4AG1A 3K65B 3RXAA 1P9SA 2CN0H 1EZQA 1T8OA 4WXIA 3UWIA 1Y8TA 2OCVB 3ESTA 1OSSA 1GL0E 4O03A 2FTMA 3ZVFA 1O30A 5CHAC 2ZA5A 2BVXH 4I8JA 1HAGE 2WYJA 5E0JA 5C1XA 4Y7AA 3UNSA 1EZXC 1DXPA 2FTLE 4FU8A 2GV6A 1ELGA 4I8LA 1SFQB 1THSH 1V6DA 2C8XB 1ETSH 1WU1A 1Y3YA 4THNH 1C2GA 1MZDA 5DGJA 1P2MA 2FO9A 2BY5X 1WCZA 2TPIZ 4FU7A 1DWCH 2VINA 5A8YA 1ANEA 1EAIA 1OWIA 2PR3A 1T32A 5FX5A 3GDUA 2UWOA 3S7KB 2A5AA 1V2OT 1C1VH 1SGPE 1P06A 1BJUA 3OY6U 3MH7A 4B76A 2W3IA 3F6UH 4KGAA 1IQKA 2GT8A 1GI1A 2FWWA 4NZLA 5E0HA 5B6OA 1WYKA 5ESTE 1KXCA 1CQQA 2ZHQH 1MD8A 2QXJA 3FZDA 3T27A 1NS3A 1KDQB 5IDKA 2BX4A 2F9NA 3LJOA 3F9GA 1F0RA 3RMMH 4UDWH 4GCHF 4ABAA 3QTVH 2NU2E 2FOBA 3M7UA 1RGQA 3A81A 1PFXC 1WSSH 1WTHD 2F9UA 1J15A 4ZROA 3RLYH 2A7CA 2D8WA 5T3HA 1GCTC 4IC6A 1KXDA 3PV4A 3PB1E 1BT7A 1BTHH 4PROA 5HM9A 2EA3A 3TGIE 3MNXA 3EA8A 3P8NA 2BD4A 1EAWA 3LJJA 1GG6C 1FXYA 4X6NA 2PKSC 4ZXXH 2F3CE 1H9LB 4SGBE 4ABGA 1IOEA 3SW2B 3RLWH 4A5TS 3P8FA 1YPGH 1C2DA 2BX3A 4K69A 4GHQA 2BQ7B 3PLKA 1TNJA 2EI6A 4OGXA 1BBRH 1TBZH 1QNJA 2ZCHP 2JETC 4WY3A 4J1YA 4AB8A 1KSNA 1W12U 3MOCA 4FUIA 1ELBA 1YLDA 1DWDH 2XRCA 1Q31A 3TJNA 1O3KA 4K1TA 5A8XA 3TNSA 2SNVA 5JPMH 4AB9A 1CGJE 1C9PA 3TH2H 4ABDA 2ZGBH 4YOJA 1DPOA 1BCUH 1XUFA 1OWKA 4ZHMU 4A1XA 4Y11E 2P3UB 1PJPA 3SQHE 2ZHFH 1SFIA 1ZYOA 3SJKA 3T25A 2FOEA 5GXPA 3BEIB 1GDUA 3RXRA 1P10A 1QB9A 2FOFA 4MPUA 3SUFA 2HRVA 1S6HA 1FIZA 2DE9A 1VCPA 1EKBB 3MH6A 1W14U 2UWPA 3DA9B 3ELAH 2H6MA 3Q3XA 1CHOG 3GY3A 3AAUA 2Z6BD 1DSTA 1L0ZA 1V2JT 1UTLM 1HAVB 1WQSA 5C67A 1C5PA 1CGIE 1BRCE 1O39A 1SGTA 1TIOA 2A7JA 3S7HB 4AX9H 9LPRA 3BG8A 1LHEH 4Q80A 3GYMA 2ODYB 1TPAE 2HVXA 3M3TA 5EQRA 3A8AA 4YLUA 1LHCH 1HJAC 1QL7A 2FLBH 1RTLA 3LT3A 4ZKNU 2BD2A 1KLTA 1EB2A 1SGYE 2ZHWH 4FUFA 3AAVA 1ZRBA 2RDLA 5F8ZA 1P11E 2CF9H 4WJG2 2ZTZA 1O2KA 1F0UA 2P3TB 2ASUB 4K8YA 3BG4B 4NSYA 1J8AA 1ETRH 5DP7A 4JMYA 1O35A 2HLCA 1A0HB 2FYQA 5HXFA 4MQAA 2GZ7A 1UCYH 1C1SA 3H7OA 5EQSA 1PPCE 4D8NA 1GMDG 1LO6A 1C4V2 1NRQH 1IAUA 3DUXH 3VB7A 1GMCF 1GBLA 4YOGA 2ZCLP 1HB0B 1HXEH 5PTPA 4CBNA 1FN6A 1LPKB 1E38B 4X8SH 3ZVCA 4KTSA 2CGAA 3K2UA 1ESBA 1FJSA 1HNEE 2CV3A 1AB9B 4ISLA 5DK1A 3VGCC 2W26A 2BD8A 3KQCA 1P05A 2O8MA 2WPIS 4WMEA 1LKAA 1SBWA 3QO6A 5E8EH 3TK9A 2WUBA 2Y81A 1O2XA 3R3GB 5FXLA 2J94A 1ZGVA 1XVOA 3U8RH 2AERH 2Z3CA 1EZSC 2ZTXA 4BTIB 1MUEB 2BLWA 2VIOA 2QXIA 2BB4A 4CRDA 5LPRA 1EJAA 4GUXA 1DWEH 1YCPH 2BLQA 3URCA 2P8OB 1UTOA 1BDAA 1A3BH 1QTFA 3TU7H 2GDEH 3M5OA 4OS7A 3TGKE 1BTPA 4LK4A 5G4BA 3PMHB 2OQUA 1MBQA 1SHYA 3QZQA 3QZRA 2SGFE 1Y5UT 1M9UA 2ALVA 1N8OB 3EDXB 1O3OA 3SU0A 2WV4A 1HJ8A 1GMHF 3BTTE 1AGJA 4Y0ZE 1G32B 3RDZA 6GCHG 4SGAE 1XXDA 3TIUA 2PW8H 1NRNH 2A45B 5C2ZA 2C3SA 1GL1A 4UD9H 1K1LA 2BY8X 1BMLA 1GI2A 1ID5H 4JZIA 3SGQE 2XBVA 5A0BA 1EP5A 2G8TA 1GGDB 4NCYA 4UFGH 1AWHB 1MMJN 2BZAA 4WF8A 1QL9A 2Z3EA 1AMHA 1BTUA 2ZGJA 2AGEX 2G51A 2R2WU 4K8BA 2ZG0H 1P09A 3GY5A 3MH5A 1Z7KA 1A5HA 1SQAA 3GCHB 2XBYA 1YP9A 3RXFA 3P70B 4Y71A 1A0LA 1C4U2 1F5LA 1ORFA 3SORA 5AFYH 1O3MA 1DX5M 1P57B 5EODA 1P8VC 3KHVA 1IQHA 3CP7A 2FX6A 4MTBA 1G3EA 1G37A 1WV7H 3GDSA 4JYUH 1LVBA 1P01A 2J34A 3VEQB 5DP4A 3GISB 4BAOB 4CHAB 4Y8XA 1EX3A 1O5CB 4DG4A 2VIVA 7GCHG 1LTOA 4K60A 5K7RA 1IQLA 2NU0E 2DUCA 4UONA 5HYOA 1C2MA 1ZPZA 5IYTA 2TGPZ 1QY6A 1FQ3A 1CT2E 1MU8B 2P3FH 3ATWA 3JZ2B 2BLOA 5EPNA 1ESTA 1ZSJA 2VU8E 1MTNC 2FDAA 4I31A 1NRRH 4Y8ZA 4VGCB 1U6QA 5FCKA 2QXGA 2BDAA 3RC6A 1TNLA 3U9AH 2OQ5A 1O2PA 1O2JA 3BEUA 1EXFA 1GI0A 3SU6A 4GAWA 4X8TH 3ZZCA 1MU6B 1C5SA 1LCYA 1NN6A 3TVJB 6CHAB 1C2FA 1T8MA 2VIWA 3CS7A 1MAXA 1SB1H 2AFQB 3ZZ9A 5FCRA 2A2XH 2G00A 2ANKH 2WV5A 1UO6A 2AIQA 3HKIB 1SLVB 1GBBA 5JBAS 1TALA 1GCDA 2VIQA 4A1TA 3V12A 2FOAA 1FNIA 3PWBA 4FUJA 4Y79A 3I78A 3MU5A 4YESB 5EXNA 2ZTYA 1XKAC 1MZAA 1RIWB 2PTCE 4ISHH 3K6YA 2GP9B 2BD9A 1P02A 2SFAA 1P3CA 4K1EA 3L6PA 2F9OA 3GY8A 4X2VA 4ABBA 4X1RU 4H4FA 1GHBF 3KL6A 1EAUA 2AH4X 1HRTH 2B7DH 4NFEA 4F4OC 3E3TA 3B8JA 2CHAB 1F0SA 2JKHA 2ODPA 2GV7A 2QIQA 3VB3A 5J4QA 1PQ5A 4LXBH 1TBRH 4Y10E 1O0DH 1SGRE 2ZFPH 2BDHA 1ABJH 1NU7B 1SGNE 5ABWA 1BA8B 3IWMA 1LHGH 1GBHA 3SJOA 1O3PB 4AN7A 3E8LA 1AZZA 2QYIA 2OTVA 2Y5GA 1THRH 3K9XB 1NY22 1Z8IB 1TABE 2G4UA 1GHXH 4H42U 3A7WA 5FX6A 1EPTA 1DT2A 1UVSH 3FANA 3MU1A 3A7YA 4MDSA 5EW2H 1XM1A 2R2MB 2P94A 2ZI2H 3Q76A 3QGNB 3BIVH 1BRUP 5K0HA 2H5DA 3RXKA 2PFEA 3V7TA 2FXRA 1KXBA 3E16B 2CJIA 5I46H 1HYLA 1T4VH 1TX6A 3HKJB 4O3TA 5E2OA 4E7NA 3M37A 3KF2A 1HAIH 2OP9A 4X2XA 2ZHDA 1LHDH 3RXHA 1QJ1B 1GHWH 3CENA 5T6GA 1GBAA 1O3GA 1P03A 3SV8A 5T6DA 1K1NA 3VXEH 2BZ6H 3EA9A 1K22H 2WPHS 3E90B 1ZSKA 4AFQA 2HALA 2ZPSA 1IQJA 5JB8S 3SV2H 2V6NA 3ATKA 1LPZB 3HK3B 3GCTG 1A1RA 3MMGA 4ZKSU 4IN2A 1AU8A 1G3DA 1SGCA 4TPIZ 4BAHB 1V2QT 4X2WA 4XBBA 1O2MA 2Q6DA 1D4PB 4CRCA 1GJAB 2Q1JA 1PPBH 3SUEA 2TRMA 2ZC9H 2HWLB 4OS1A 3HGPA 5CE1A 2BYAX 1FAKH 1SVPA 1HAXB 2ANMH 3BIUH 2XBWA 3SU2A 1NT1A 2G81E 3Q3KA 2A5IA 3K6ZA 1L1JA 3PLPA 3VB6A 1YPKH 2H5CA 1TA6A 2GX4A 3B23B 1IHTH 3FAOA 2BQ6B 4DOQA 4YZUA 2AYWA 1ZMJA 1DY8A 2XC5A 3LGWA 3GYLB 1IQIA 1SPJA 1TRYA 4BTUB 1QRXA 3ZYEA 1ZHPA 3M5MA 1XKBC 9ESTA 2BDGA 2M5TA 1L1NA 5F8XA 2QF0A 5EGMA 1A2CH 2BY6X 1C5RA 4BXSA 3PTNA 3V0XA 4JK6A 1TA2A 4Y6DA 4FUCA 3M35A 2BHGA 2VB0A 4ZXYH 5GWZA 4HFPB 1DXWA 2WPLS 4ZHAA 3BTFE 1NFXA 2ZU1A 1SQTA 1VITF 2O8LA 1OP0A 4BNRA 1CBWB 2Z7FE 1EP6A 2QXHA 5AF9H 2BVSH 4D7FA 1DICA 2SNWA 2YNAA 4A1VA 2FOMB 1CVWH 1ZSLA 1VGCB 1O2HA 1GBMA 4WMFA 1K28D 1DSUA 2I6SA 3T5FH 5TJXA 1NESE 4YOIA 1V3XA 3LU9B 3ZV9A 4A6LA 3RXLA 1QGFA 4LOYH 3SGBE 1G36A 3ZZ5A 4ABFA 2GKVE 5C20A 1EUFA 3PO1B 3NKKA 2ANWA 1AO5A 4IN1A 1XVMA 3T26A 3MU8A 3T62A 4B73A 3GCNA 4BAQB 4FUGA 1GHAG 1C1MA 4B2AA 5L6NH 1G3BA 2GCTC 2V3HH 3BV9B 3TH4H 2A31A 1UVTH 1O3FA 4YM9A 2TBSA 2HGTH 1FONA 1VJAU 2GZ8A 3SNAA 4GHTA 4TY6A 1IQFA 1EB1H 1CA0B 4BANB 2ZZUH 1XX9A 4RN6A 4JZEH 1V2TT 1SG8B 2OC8A 1L4DA 1HUTH 1NTPA 4I8KA 1XUIA 3LOXA 1SSXA 3NUMA 4Q7YA 4Z0KA 3SOSA 4CR5A 2BDCA 4ISIH 1K1MA 2VGCB 3WY8A 1HLTH 3TLOA 1AQ7A 1SLUB 1SGEE 4KELA 3RP2A 1CT4E 1TRMA 3TJUA 3UNQA 3EQ0H 3UR9A 1MTVA 3UOPA 3IITA 1A61H 5LPEA 2RCEA 3O8DA 1BMNH 3V3MA 5AVDA 4K3JA 1W7GH 3E0NB 3VPKA 1W11U 1N6YA 1AVWA 1TGSZ 3LGYA 4RKJB 5EXLA 3A85A 1O2IA 2WINI 5F03A 3A7XA 4WVPE 3OYPA 4FUDA 2AMDA 3Q3YA 1VZQH 1S84A 4B1TA 3U1JB 5CHAB 1GVKB 1SGFG 4KP0A 1QFKH 1JOUB 1J9CH 3FZZA 2FODA 4MNWA 1UMAH 1KXAA 2TGDA 2ZDNA 2BDBA 1C5OH 4CRBA 4UFFH 1W0ZU 1YC0A 1D6WA 2HOBA 2A2QH 3T2NA 1YPMH 1L2EA 1O2VA 1VCWA 2IN2A 3HPTB 5J4SA 1XUKA 4ZUHA 3LGUA 4GLYA 5GCHF 1J16A 2PGBB 1FI8A 1GDQA 1ZLRA 5JDUB 1FMGA 1TX8A 4AFSA 1P2QA 1GBTA 1HAPH 1NRPH 2VWNA 3BEFB 1TGNA 3MU4A 2BQWB 4X1SU 3U69H 1OXGA 3R0FA 1TNKA 1JMOH 1O2YA 1S85A 4XE4A 1QR3E 3UR6A 1ARCA 1QBNA 3HGNA 1NPMA 2XXLA 3PYHA 1ANBA 1Z6EA 1EPTB 1O2ZA 1AUTC 3A88A 3F68H 3MYWA 1TGCA 4MPXA 5LH8A 2PSYA 1HGTH 3BTQE 1GJ8B 1GJ7B 1K9OE 1SLWB 1GMHG 4Y7BA 1EATA 2UUYA 1AE5A 2C90B 2Z9IA 1N8OC 3SU5A 4FUHA 1GJ9B 3E6PH 1UVPA 2ZDAH 4NZQA 1ESAA 1NU9A 3F9EA 2FMJA 3O8BA 1RS0A 4AYYB 1S0RA 1GCTB 2ZU2A 1BOQA 1GBDA 2EEKA 2ZIQH 2PSXA 3SI3H 4XFQA 4JZDH 1C2EA 3E91A 1BHXB 1GG6B 1HPGA 1ELVA 2FX4A 2PKSB 3OX7U 4U32A 1F5RA 4D9RA 5AFZH 1A46H 1ZOMA 3Q00A 3LKWA 2FYRA 1ELTA 1LKBA 3KN2A 5ESBA 2SGPE 5A0CA 2FM2A 2ZGCA 4U2WA 3ZZ4A 5A09A 1SGQE 1TFXA