3ODFA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. second step of radiation damage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 66
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3odfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3odfA01
2IN2A 1HAZB 1C5WB 1W11U 5EXNA 3M7UA 1MKWH 4IBLH 2F9VA 3STJA 1C1VH 2FI3E 2V3OH 1OP8A 3QTVH 1C1QA 2NU2E 3MU4A 3IG6B 1GMCG 3QUMP 2FIRH 2BVXH 1QQ4A 2R3YA 1LHCH 4B2CA 5F8XA 2RG3A 1AB9C 2VVCA 3ZZ7A 5DK1A 3RC6A 1OX1A 4NG9H 4X6PA 1O36A 2ZPQA 3RMMH 5EOKA 3ZVDA 3A7ZA 3S9CA 4MNXA 2VWOA 1TNJA 1EB1H 1O2MA 3KL6A 2OC7A 1A1RA 4X8VH 1AN1E 4LZ4B 4GSOA 3SORA 1YYY1 2FI5E 2Y7XA 1ZSKA 5DPAA 2AH4X 3BTEE 4UFGH 2PSYA 1AGJA 4MNVA 3DUXH 2FLRH 1C5RA 4Y8ZA 4FU8A 4B1TA 3SV8A 5F6MA 1IQHA 1VCQA 1TPAE 2R2MB 3U98H 2WUBA 2VJ1A 4O3UA 4YESB 1AKSA 2YNAA 1LKBA 3LONA 1EASA 1WCZA 5J4SA 4ZHAA 2BDIA 1QL7A 1BDAA 1SGRE 2TGTA 4AOQA 2GCHF 1O2UA 3U8RH 1LCYA 2Z3EA 3SI4H 3OYPA 4FUDA 3S69A 1VITF 1EZQA 1S81A 1QIXB 2ZFQH 1GBLA 1SFQB 2W5EA 2F9UA 2ZDMA 3IWMA 3A89A 1XX9A 1C2EA 2DE9A 3T2NA 1GJ6A 5E2OA 4GVUA 3PV4A 6CHAB 2ZQ1A 2SGEE 1Z7KA 2SNVA 3SJ9A 3MWIU 1V2VT 1BHXB 1QRZA 1Z6JH 3T29A 3RXRA 2XC4A 1H9HE 2FLBH 2ZO3H 4FUIA 1ZRBA 3UY9A 3URCA 2BVRH 4I8GA 1GG6B 2ZGHA 1F0RA 2XC5A 3MNCA 4IN1A 1XUHA 1GBHA 1PQAA 4WWYA 3VXFH 1W12U 4CH8B 1C9PA 2HGTH 3TK5A 1S83A 1SGTA 3VFEA 3DFJA 2BZ6H 3TJNA 1L4ZA 3B9FH 2XXLA 3SV2H 2ALVA 1LHDH 2W26A 2QXIA 1A0HB 1PPFE 4UDWH 2FM2A 6ESTA 2A1DB 1D3TB 3K2UA 3A8CA 1FMGA 1GBAA 1HAPH 1P3EA 1OKXA 1QB9A 1OYQA 1GBEA 1TOMH 2VIWA 2GD4B 3Q00A 3PLBA 3D62A 3M3VA 4X6NA 2XW9A 3RXPA 1AU8A 1NY22 4MPWA 3MH6A 1P9UA 2AGGX 1O3IA 3P8NA 3EYDA 1TAWA 1MCTA 1QBOA 2OCVB 3O8DA 3VXEH 4D9RA 5CMXH 3ATLA 2GT8A 5LGOA 1H4WA 1AO5A 2HNTF 1Y8TA 1NRSH 2GGVB 1Y3XA 3NZIA 1TMUH 2LPRA 1GHYH 2OC8A 2CMYA 2FZZA 1B5GH 1NT1A 2G5NA 2ZDNA 4E05H 2QAAA 2FX4A 2NU1E 2Z9KA 3MU5A 2O8LA 1AHTH 3PROA 1INCA 3TK6A 2ZPRA 1ZPBA 3P17H 4WXVA 3LKWA 2CXVA 4MPXA 8GCHF 3GY3A 1PPGE 1KYNA 1UJ1A 2PWXA 4OS2A 4WMDA 1TX7A 1TFXA 3V0XA 2R3UA 5DP9A 1CSOE 4X1QU 4X6MA 1YPMH 3T26A 2TGPZ 1L1NA 1D3DB 1MTNB 1O5AB 1SPJA 2Y5HA 2TGAA 2TIOA 1AFQB 5EPNA 3TITA 1GBTA 3TLOA 1QBVH 1D4PB 4WVPE 5EODA 3EAJA 2CN0H 3A7TA 1OWHA 1AVGH 4YOGA 2DE8A 3A8DA 1ZPCA 5FX6A 3O8RA 2G00A 1GMDF 2ILNA 2BMGB 5EG4A 1AZ8A 1K1LA 3UREA 1GHBF 4AFUA 5EQRA 1TGCA 3ZVGA 4HGCA 2FOGA 5F8ZA 1GBIA 1F0TA 4GCHF 2ZDKA 3LH1A 1RJXB 1Y3VA 1MU6B 1IQFA 3CENA 1HUTH 4HFPB 1SGQE 5FBEA 2Q6DA 3MI4A 1MD8A 3QO6A 1DOJA 1BUIA 1T31A 3VB5A 4FVBA 3RXLA 1DWCH 2VIVA 1AQ7A 1AZZA 3AAUA 3O8BA 2CHAB 4X8SH 1IQGA 1HAHH 3ZVBA 3ZZ9A 1DVAH 1YPJH 2SGDE 1FIZA 2J38A 1TX8A 3SU2A 2XC0A 1EP5A 4A7IB 1O3LA 2ZFRH 2WV4A 1F92A 2BDHA 3A84A 2ZGXH 4HTCH 4DY7B 4IMZA 1T4VH 5A8XA 1KXCA 3VB3A 4UONA 5H4IB 1FY4A 1C2IA 2NU0E 1OYTH 2JH5D 3SQEE 4XSKU 4D9QA 3SU3A 1ABJH 3A82A 3QK1A 2BY8X 1NESE 1BTHH 2ZDLA 2ZEBA 2XWBI 4IW4E 2ZGBH 2UUFB 3LGTA 4U32A 3UIRA 2D1JA 1V2QT 1KLJH 1MKWK 2EA3A 5DP4A 5F03A 2PSXA 1HAYB 3TJOA 1ZSLA 2BLVA 2ZU4A 3KHVA 5DKMA 2PFEA 4K3JA 1HFDA 4GHTA 2PKAB 3PTBA 2H9HA 1Y5AT 2SNWA 5DGJA 1JOUB 3RXAA 2Z7FE 1A7SA 3NKKA 4AN7A 1UTPA 4MDSA 2GVFA 4CRDA 2ZFSA 1CGIE 1HB0B 1FAXA 1GPZA 1TA6A 1DICA 1O2XA 8KME2 1MAXA 4NWKA 1YC0A 2FOHA 1VZQH 2FEQH 2A45B 4FXGH 1J16A 1XKBC 2D2DA 2HNTE 3A88A 2HALA 1TNGA 1O2WA 3ATWA 3BG8A 4MG3A 1Z8JB 1NN6A 3ZZCA 5JB8S 1SSXA 1V2TT 1BBRH 4GAWA 4DG4A 1YLDA 1THSH 3UR6A 1ZRKA 1BB0B 2UUKB 2Z94A 5EPYA 1ZGVA 1S0RA 1LQDB 2J9NA 1ELGA 1AMHA 1TNIA 1ZOMA 2JETC 1GHAG 1C4V2 1UTOA 1ELVA 2TPIZ 4ZUHA 1C1WH 4I31A 1A0JA 4JK5A 4ESTE 1O3EA 1QJ7B 1O3MA 3ELAH 3BTHE 1KLTA 1BMNH 1S85A 2BVSH 1QY6A 1EPTA 3N7OA 1OWDA 1CGJE 2VH6A 3SN8A 2A31A 3L6PA 3BG4C 1AI8H 1UHBB 1EB2A 2FOBA 1HRTH 3ZYEA 1MD7A 1KSNA 4Y79A 4JYTA 2AS9A 2BD4A 2K1QA 1O2VA 3MH7A 2Y7ZA 1C5MD 3GCTF 4JCNA 4O03A 2KAIB 4D7GA 4B76A 5BRRE 4YO9A 1QR3E 1K9OE 2A32A 2LNCA 1TQ0B 1O3KA 5HMAA 3RU4T 2Z9IA 2AGEX 2AIPA 1L1JA 1DLKB 1GJBB 7GCHF 1JRSA 4B74A 4CBOA 2BD9A 1VR1H 1C2FA 1JRTA 1JIMA 2BDAA 1RTKA 1NU7B 3LJOA 1H8DH 1ELFA 2ZCLP 1LQEA 1MMJN 1O3PB 3ZV8A 1Y3WA 2VVUA 3NWUA 1GDNA 4NIVA 4AX9H 1WUNH 2FWWA 2PTCE 1P8VC 1P12E 4NA8A 1P2QA 1MTWA 2OTVA 2VIOA 1GI3A 4ABAA 3IITA 1WTGH 1YPGH 1AFEH 3F9GA 3ZZ3A 4YT6H 1P2MA 3TH2H 3DT0H 1EJMA 1XVMA 3Q77A 5GWZA 2BLQA 3AASA 3CS7A 2ZU5A 3ZVFA 1A3BH 1F5RA 1GI5A 2B9LA 1GL1A 2PGBB 4D8NA 5JYIA 2ZF0H 5AVDA 3TIUA 3ATMA 4BAHB 3GY4A 3RXHA 1OS8A 4KTSA 1C5SA 5JBCS 2XNIA 1C1RA 1TRYA 1KIGH 1TGSZ 1Z8RA 3TGIE 4FUJA 2XBVA 3NCLA 4X0WU 3RXTA 2FS8A 3FP8E 4AFZA 3UNRA 1AVXA 4B2AA 1V2PT 3RMLH 2YNBA 3SU0A 3SU6A 1P09A 2JETB 4WF8A 1ZZZA 4X1PU 2QXHA 1VITG 1T32A 2OQUA 3RXSA 3FVFB 4A1XA 2A7JA 4UFFH 1PQ7A 1RFNA 1OSSA 2W3IA 2FYQA 3MNBA 3RM0H 1NC6A 1UVSH 3UWJH 1O2JA 3ZV9A 3DA9B 4MTBA 1MU8B 2B0FA 3BG4B 2ANMH 1W7GH 4ZAEA 1UK3A 1FIWA 1C1TA 1O2YA 3TH3H 1DY9A 1C5OH 3SUGA 4TYDA 1C1NA 2AMDA 2GV7A 3ATIA 3MU1A 2AIQA 1DWBH 1RRKA 2H2ZA 1ESAA 2O8WA 4H4FA 3QLPH 5HGGA 1V6DA 1HNEE 1FAKH 2AFQB 1KXBA 2ZU3A 1MTSA 3S9AA 1SGPE 5L30H 5C5NA 4WH6A 1GI6A 3QTOH 3D49H 4RN6A 1HJ8A 2XCNA 2QYIA 1E37B 1GMHF 3RP2A 1MZDA 1JWTA 1NFYA 2QV1A 3MOCA 3ZZ8A 3QN7A 1YGCH 3ZZDA 1O3BA 1TGNA 1L2EA 1Z6EA 3MH5A 3SNBA 1O2PA 4INLA 1EXFA 2BQWB 2GZ9A 5JBTA 1GHZA 4BAMB 2AEIH 2ZTXA 5FPSA 3UUZA 1P2JA 2O8MA 1J15A 3OX7U 1C2GA 1SQOA 2BQ7B 4X1RU 4LK4A 1BRUP 4ZHMU 1C5ZB 3E8LA 2AMQA 4BANB 1LVBA 1NFXA 2Q6GA 1FY5A 4YZUA 1TYNA 1LDTT 1YLCA 2GMTB 3TU7H 1LPZB 4XDEA 4H6TA 4ABFA 1OWJA 2FYRA 7KMEH 2WPLS 1O3GA 3M7TA 1TBQH 2ZKSA 1GL0E 2A2XH 1Z71A 2SGQE 3SGAE 4JYVH 3OY5U 1A2CH 2GZ8A 1IHTH 3BV9B 1JBUH 2FTLE 3UOPA 1XUKA 4NGAH 2HLCA 1YF4A 2WPMS 2WPHS 3C27B 1VJAU 3V13A 4Y7AA 2EC9H 4NIYA 8GCHG 3S0NA 3BTWE 2RCEA 5T6DA 5ABWA 3E90B 2HWLB 4XFQA 4AG2A 5JBAS 2ODQA 2NU4E 2ZZUH 2SGAA 1P57B 2ZHQH 1ANEA 1BMLA 3E91A 1QB1A 2OBQA 3M3TA 1SL3A 3TPIZ 1ELCA 3K65B 3FANA 1S6FA 3ESTA 3SU4A 1ORFA 4O9VA 1O33A 3SNEA 1GMDG 2QIQA 4ISOA 1O2TA 1H8IH 4I8HA 3F68H 4CBNA 1GHBG 1H1BA 3E0PB 1P0SH 1ZHMA 2QXJA 1C5PA 2Y6TA 3TGKE 1W3CA 1BBRK 1WU1A 2H6MA 1FXYA 4GCHG 4Y76A 3GY2A 4INHA 3PMAB 2BD2A 3SUEA 4A6LA 5C5OA 5TCAA 4TPIZ 7ESTE 3Q3YA 1TONA 4AFSA 3KGPA 2BYAX 1ZMJA 3URDA 2GX4A 4NZLA 1BZXE 1W0YH 5L6NH 2GP9B 4CRCA 1MTNC 4YM9A 2TBSA 1AFQC 4E7RG 2IPHA 1KTTB 4Q80A 1Y5BT 3I29A 1HV7A 3P6ZB 2Z3DA 5FXLA 1IQMA 1IQNA 1ELEE 5CHAC 5K0HA 4H6SB 3BSQA 2QCYA 1UO6A 1GI9B 3A87A 4XBBA 2UWPA 2A7HA 2PTNA 1V3XA 1CO7E 1QJ1B 1XXFA 3BTTE 3BTME 1EP6A 3BF6H 3HGPA 1JIRA 1HAGE 2OLGA 1HAOH 1HIAA 3R3GB 2WYJA 1GJ8B 2XWAA 3HATH 1X7AC 4BAQB 3S9BA 3G01A 5LH8A 4FU7A 1UCYH 1FDPA 1O2NA 1CQQA 4KKDA 3M36A 1GJ9B 1ETSH 1V2WT 1IQEA 2ZC9H 4B71A 2C90B 1CT0E 4BTTB 4NA7A 1UCYE 3M7QA 2RA3A 4Z0KA 3ZVAA 2BD3A 2CHAC 4UFDH 1F5LA 2OD3B 1E36B 2FODA 1C1PA 3LT3A 1YPHE 3ZVEA 4ABGA 3GY5A 4WXIA 1LHFH 1XUFA 3RXKA 5C1UA 1OXGA 3UQOA 2H5DA 5C3NA 4X1NU 3RLWH 1FY1A 4RSPA 4XBDA 5G4BA 3UNSA 1N6YA 1T7CA 1V2NT 1WBGB 4Y7BA 5E8EH 1EOLA 1BRCE 3GY8A 1FZZA 1K1JA 1K22H 4Q2KA 1LVOA 1JMOH 3A8BA 5E0GA 5C20A 3SJIA 3GDVA 3PYHA 5EW1H 4FUBA 1AUJA 1ELAA 5DP8A 1T8NA 1O32A 2C8ZB 1O5CB 1PPCE 4ZROA 2OINA 2R9PA 4JZFH 3A80A 4H42U 2D26C 4I33A 2PUQH 5FBIA 1BOQA 1BJVA 2B7DH 1XKAC 2Y80A 1IQLA 4JYUH 1NFUA 2Y81A 3F9EA 3LGIA 4AYVB 4IC5A 3UQVA 2PKAA 1BJUA 1HIAB 2UUJB 5CHAB 1W13U 5DO4H 3LU9B 1P2NA 1ACBE 1GJ5H 3PO1C 2ZHDA 1O39A 4ABJA 3OU0A 1XVOA 1ETRH 3MYWA 5JB9S 2BOKA 1ZTKA 3K6YA 1K1MA 1HLTH 1TA2A 2G81E 1BTXA 4Y11E 2BY9X 3P92A 2P8OC 3SU1A 1NTPA 1UK4A 2G8TA 5ESBA 5C1YA 1HDTH 4TY6A 3GCTG 2W7SA 1VITH 3BEUA 3SBKA 3MH4A 2B8OH 2ANWA 1ARCA 1BMAA 4A1VA 2BLWA 1O3HA 1C1OA 4F49A 1ZYOA 3M5MA 1RXPA 1MTVA 2ZFFH 7GCHG 1NM6A 2WPJS 3LDXH 3MU8A 4J2YB 3H7TA 2H5CA 4GLYA 4OS1A 1P2IA 1C5TA 2FXRA 1DPOA 1O37A 4AYYB 2BD5A 3VB6A 1IOEA 3CP7A 4DT7B 2HNTC 3UTUH 1YPEH 2V35A 1T8LA 1TOCB 3RC4A 2ZHEH 4OS7A 1F0UA 2HOBA 3M5LA 2CF8H 5IDKA 1FONA 1O35A 4M7GA 1P9SA 1TX6A 2FMJA 1A61H 3VGCC 1TRNA 3LOXA 3M3SA 4CRFA 1UTQA 1BRAA 2FTMA 2ESTE 1ZTJA 3TK9A 3SHCH 4K1SA 1UHBA 1O3CA 1NROH 1HAVB 5DP6A 1FLEE 2F9OA 1ZPZA 3P8OA 4A1TA 2XBYA 4K60A 4UE7H 2A5IA 5K7RA 2KAIA 3RDZA 4B75A 2C8XB 3QGJA 1C2JA 1QRWA 1SGNE 3VB7A 4Z6AH 2HVXA 1Z8IB 3E0NB 3QZQA 1GCDA 3TNSA 2WINI 1THRH 3SNDA 1SI5H 3BN9A 5FCKA 1UTJA 4I8LA 1EJNA 4I7YH 2XRCA 3C1KA 4ZMAH 2P93A 3U9AH 4CHAC 4TY7A 1YBWA 3SUFA 2VIDA 1S5SA 2VB0A 4KELA 1G3DA 3PO1B 4J1YA 1S82A 4ABDA 1WAYB 1OP0A 2C4FH 3O8CA 1SLXB 9LPRA 1AD8H 1GVZA 1SR5C 2FPZA 2P3TB 4KP0A 2ZTZA 3LGUA 1Q2WA 1V2UT 4I32A 1SVPA 1PPEE 2A4QA 2QXGA 2G5VA 3A83A 3PWCA 1NRQH 2P8OB 2VIPA 1VCWA 3V3MA 1WQSA 1G2MA 2C93B 2RA0A 2HPQH 2CV3A 3QDZB 1SFIA 3NPSA 1EX3A 4FUGA 2R0KA 4JZ1A 3FP7E 5PTPA 2JKHA 2BXUH 2HPPH 2A4RA 2D8WA 1DY8A 4B73A 1GCTC 2BDYA 4ZXYH 3ZZBA 1FN8A 4Q7XA 1C1UH 1SLUB 3LC5A 1C5QA 1EZUC 2BLOA 3P8FA 3FP6E 4D7FA 1IQJA 5EQQA 1GMHG 3PB1E 4Y6DA 2IOTA 2H9EH 2GCTC 5GCHF 1C9TA 1KXEA 1DANH 2ZPSA 2NU3E 6LPRA 2H9TH 1O2GH 1GI8B 1QGFA 1TGBA 1GBKA 1ELBA 1Q31A 4MNYA 1UVOA 2BHGA 1A5HA 3VGCB 1AE8H 1DFPA 1Q3XA 3PMHB 3E1XB 2BX3A 4XBCA 1P03A 2J94A 1C5NH 3RXEA 4IS5A 1QB6A 3TGJE 2ZP0H 1DUAA 5LPEA 4KTCA 1S0QA 1XXDA 1UCYK 4NSVA 3MFJA 1Y5UT 5EW2H 4BTIB 1FV9A 3RXQA 1HXFH 1W10U 1K2I1 1C2HA 1FY3A 1EJAA 1QCPA 2G4UA 3FFGA 1KLIH 2TRMA 4ZHLU 1A0LA 4BXWA 5TJXA 4HZHA 2W7UA 2YOLA 1N8OB 3KQDA 4CHAB 5FAHA 1AIXH 3OY6U 3SNCA 3ZZ6A 1EAWA 4WJG2 1HPGA 3A7WA 1FPHH 1NU9A 3GCHB 3AAVA 2NWNA 2O9QA 5F8TA 2XBWA 1UVUH 3BEIB 1DUEA 1O3FA 3QWCH 2RDLA 1WQVH 3ZYDA 1SQAA 3RXBA 3ZZAA 1THPB 2A0QB 3P95A 4NIWA 5T3HA 2GZ7A 1SC8U 6GCHF 3RM2H 1C5VA 1BHXF 1O5FH 4Y71A 1ZJKA 1CU1A 1UTKA 1BTYA 5FCRA 4CRBA 1FQ3A 4BOHA 2WV5A 5A09A 2GMTC 3T27A 1GHXH 4MVNA 2FOFA 2ANKH 5I25A 4U01A 1VGCB 3M35A 2PV9B 1XMNB 1O38A 2I6SA 2ASUB 2GT7A 1UTLM 1D3QB 1O0DH 5EXMA 1SB1H 3F1SB 1GCTB 2GCHG 4DURA 1WTHD 1LMWB 4ZKRU 4ZXXH 1O30A 5DG6A 5T6GA 1P05A 1G2LA 2ZG0H 1MBQA 4ZH8A 1C4Y2 5C2ZA 3T25A 1NPMA 3GOVB 1LPKB 2GCTB 3Q3XA 4WMEA 3U1IB 1P01A 1BITA 1GVKB 2BD8A 2VIQA 3EA9A 1EAUA 1KDQA 1GI2A 4GPGA 1BTPA 1TIOA 5A0AE 1E35B 4AG1A 1E34B 2SGFE 1EAIA 1T4UH 4K69A 4GHQA 5EQSA 1DM4B 1J9CH 1VCPA 1K21H 1O2SA 1OWIA 3RXDA 2OQ5A 3QX5H 4XOJA 3GY7A 1TALA 1Z1IA 1DDJA 2A2QH 2G4TA 2H1UA 5JDUB 1PYTC 2BDCA 3LGVA 5EXLA 1HGTH 5A0CA 2BY7X 2FOCA 2Q6FA 4JZDH 3RXCA 3BTQE 1G3EA 3RXMA 3MO3A 2F9BH 3T5FH 1TMBH 3P70B 2ALPA 1EUFA 2BDGA 2C8WB 3LPRA 1EZSC 4X2XA 2ZNKH 2ODYB 1PPBH 1ESTA 2STAE 4ZKOU 1K1IA 1BA8B 2SFAA 4A92A 3NUMA 1DSUA 3KN2A 2P94A 1AY6H 1GI4A 3F9FA 3SJ8A 1AE5A 2ZECA 3RXUA 1JXPA 1KXDA 1SLVB 5DP3A 2WUCA 4MPUA 1C2DA 4SGAE 4INKA 1O5EH 1UK2A 2VWMA 1OOKB 3EGKH 3Q76A 4SGBE 5ESTE 3SGBE 1GBMA 2UUYA 5A0BA 1J17T 2UWOA 3SQHE 3T62A 2BDBA 2PKSB 3FZDA 1F5KU 4DJZB 3NXPA 2VWNA 1TPOA 3TJVA 1TMTH 1UVTH 1SG8B 1RIWC 3UPEA 1P11E 2B5TB 4FUEA 2XBXA 1MQ6A 2EEKA 2WYGA 1CBWC 2TGDA 2FS9A 1CT2E 1K1PA 3KQEA 4BNRA 3A7YA 2VINA 2GKVE 3A81A 5GIBA 1KDQB 2BD7A 2HRVA 1SGIB 1P2KA 1TPPA 1B7XB 1MKXH 3TNTA 3UWIA 1GBJA 1H9IE 3E6PH 1QJ6B 4RKOB 2ZQ2A 3V7TA 3KQCA 4LXBH 1ZHPA 4WMFA 3SV7A 4DW2U 2J34A 3GCOA 1NFWA 5FHTA 3SOSA 3RXGA 1Z8GA 2OC1A 2ZU1A 1C2MA 1SGEE 4ABEA 4NFFA 4ASHA 3PLKA 2BB4A 1OP2A 2F83A 3B8JA 1O3OA 4OS5A 5B6OA 5AHGH 4BAOB 1ZMLA 3EA7A 3SNAA 1WOFA 1P2OA 2XYAA 2FO9A 1GJDB 1AWFH 1QURH 2PUXB 1PQ5A 1ELDE 3A7XA 1NS3A 2ZHFH 4I8JA 3DD2H 2EI6A 1FUJA 1YP9A 2F9NA 1O5GH 4Y8XA 3U69H 1GI0A 4UD9H 1D6RA 1TABE 3HKIB 3D65E 1MTUA 4LZ1H 1NZQH 1DXPA 2R0LA 2Z9JA 3PM3A 1EQ9A 1KXAA 1XUIA 1ZGIA 1KXFA 4IC6A 1P10A 3KEEA 1O2IA 1YPHC 3RXVA 1CE5A 1YCPM 3RXFA 4DVAU 2ZHWH 1LO6A 2AERH 2UWLA 2QGRA 1V2RT 1TPSA 1HXEH 1G3CA 3GYMA 4K1EA 1P04A 2F9PA 4DCDA 1VJ9U 1EAXA 1ESBA 1ABIH 1EKBB 4UFEH 2O8UA 1SLWB 4BXSA 1BT7A 3BTGE 1SHYA 9ESTA 2VH0A 2G52A 5JPMH 3TH4H 2THFB 1V2KT 1RIWB 2VU8E 2ZA5A 1CHOF 2P3UB 1SBWA 1QTFA 4JZIA 4YTAA 1V2ST 2CGAA 1K28D 4VGCC 1CBWB 4I8KA 4NIXA 1A5IA 1GGDB 1O2RA 2CJIA 2OXSA 2A5KA 1M9UA 1ETTH 3GDSA 4X6OA 3MTYA 1KY9A 3RXOA 2ZGJA 1DWEH 1BMMH 1DT2A 1O5DH 4THNH 3U8TH 4AFQA 3MNXA 3E3TA 3SUDA 3CS0A 1A5GH 4AZ2B 3E16B 2GTBA 2J2UA 1PPHE 1AB9B 4RKJB 1D3PB 1C1SA 3EDXB 4JK6A 5A8ZA 2ZDAH 1C4U2 4ISNA 1LKAA 3LGYA 3V12A 2PHBA 2EI7A 3HPTB 4CRGA 2Q1JA 2FOEA 4NFEA 7LPRA 2ZFTA 5FX5A 5A2MH 2BOHB 1K1OA 1TLDA 2G55A 1SGFG 1CA0C 4CRAA 4YT7H 4X1SU 1HYLA 1AKSB 5JBBS 2JH0D 2Z3CA 1QHRB 3SHAH 4AB8A 2ZGCA 3BTFE 1NRNH 1UMAH 1SGCA 1MAYA 4AGKA 1SMFE 1CVWH 5DP7A 2A4GA 3SV6A 1N6XA 1GMCF 1MBMA 1O3AA 1QA7A 1TNKA 2BY5X 3LH3A 1PPZA 5E0JA 3RMNH 3RU4D 1ANBA 1MQ5A 2A5AA 1F0SA 3NK8A 2ZCHP 2QN5T 4TPYA 1HAVA 1IAUA 3RC5A 1AUTC 1SGDE 2Y82A 1GHVH 4K8YA 4CH2B 3EQ0H 2JH6D 3B23B 5GJ4B 1QRXA 1P02A 1N1LA 3P8GA 1W14U 1TWXB 3PMJA 1FY8E 2VVVA 2WPIS 4OGXA 1PYTD 4O3TA 4YLUA 5GCHG 3I77A 1G3BA 1HAXB 1ANCA 2SGPE 1HJAC 3BIVH 2OP9A 2BXTH 2BX4A 3MU0A 1ZHRA 1OWEA 1RTLA 2Z9LA 2I6QA 1GDQA 2P16A 3PWBA 3GDUA 4A5TS 1P06A 4K8BA 4VGCB 5BPEA 2QF3A 2C3SA 1ANDA 1RS0A 1J8AA 1MCVA 3EA8A 1Z1JA 4E06H 3HKJB 1Y3UA 4BAKB 2FP7B 2PGQB 1E0FD 4KTUA 5E2PA 5HM2A 2VGCC 1HAIH 2A7CA 3JZ2B 1O2OA 1GJ7B 1GI7B 3KF2A 4ISLA 1O2HA 1BCUH 1A46H 1OPHB 3KCGH 3MMGA 2BZAA 3LJJA 1L1GA 4FUCA 3F6UH 1GJ4H 1DLEA 1QL8A 1GHWH 4UEHH 3DHKH 1ZSJA 1GWAA 1ARBA 1G9IE 3H7OA 1B0FA 1O3NA 2A4OA 4YOIA 2AYWA 2ODPA 3STIA 1CA8B 5GXPA 4BTUB 5E0HA 1BTWA 1CA0B 1Y3YA 1V2MT 4CR9A 5J4QA 4K1TA 4R8TB 2GDEH 2FDAA 3SO3A 4AB9A 5A8YA 1G32B 2G51A 1L4DA 1YCPH 3KIDU 2P95A 4K5ZA 6GCHG 5HXFA 1GI1A 4O97A 4ZKSU 1O2ZA 3M61U 3H5CB 4YLQH 3ITIA 1P3CA 1LVMA 3HK3B 5T6FA 2ZI2H 1GDUA 5L2ZH 1PFXC 4Y0ZE 2FX6A 4YOJA 1UTNA 1UVPA 1MKXK 5TCCA 4NA9H 1N8OC 2Y5FA 4ABBA 3QGNB 3RLYH 1WV7H 2WPKS 2J92A 4FVDA 1PQ8A 3MO9A 1FJSA 3S7KB 3GCHC 1QL9A 2QC2A 1HJ9A 1D9IA 4U2WA 1GVLA 3A7VA 3SU5A 1HJAB 1AWHB 1EOJA 4DIHH 3FZZA 4NCYA 4JZEH 1F2SE 3K6ZA 2GV6A 4NSYA 1BTZA 1DITH 4B2BA 4X8UH 4X8TH 3A85A 5ETXA 5GPIB 1NRRH 3ENSB 4ZKNU 8ESTE 4IMQA 2PW8H 1TNLA 1YKTA 1O2QA 2BY6X 3LC3A 1C5YB 3MO6A 1VGCC 3DFLA 3ODDA 1ZTLA 3L33A 3A8AA 1TBRH 2VGCB 3MNSA 3VB4A 1C5LH 1GBCA 3GCNA 1GJAB 2GDDA 1OWKA 4ABHA 3GICB 1CT4E 3RUOA 1CHGA 4K2YA 1FI8A 4FU9A 2STBE 3HGNA 3SGQE 1BBRE 1XM1A 2AGIX 2Z9GA 1L0ZA 2FI4E 3BIUH 3OTJE 1S6HA 1DS2E 1TBZH 1EPTC 1YM0A 2CF9H 4MPVA 3RMOH 1DE7H 4Y8YA 3SI3H 5DP5A 1DSTA 1C5UA 2ZFPH 4X2YA 4ISIH 1TRMA 1B0EA 2ZTYA 3M5OA 2DUCA 2ULLA 2ZU2A 1O5BB 1QBNA 1F7ZA 3KNXA 2W3KA 3M5NA 4XE4A 2F91A 1TGTA 3HK6B 1TNHA 2QF0A 1A4WH 1MUEB 4FUHA 1C2KA 3U1JB 5AFYH 2Z6BD 5SGAE 2OC0A 2O8TA 2BQ6B 1BRBE 2OBOA 2R2WU 4WY3A 3LIWA 4U30A 2IJOB 4ISHH 5L2YH 4OS4A 1FNIA 1ZR0A 5CE1A 1E38B 4OS6A 2V3HH 1GBBA 4CR5A 3SZNA 4X2VA 3MHWU 2XCFA 4DGJA 2FESH 2F3CE 3M37A 4TWWA 1GJCB 3SJOA 4MQAA 1V2LT 1WSSH 1GBDA 1RGQA 4F4OC 2FOMB 2QA9E 1DX5M 1H9LB 4E7NA 1LHGH 5GDSH 2P59A 1LVYA 1O31A 5I46H 3I78A 3L3TA 4NZQA 3A86A 3UNQA 1BTUA 1PJPA 4MNWA 1C5XB 1BIOA 5C67A 4LOYH 2PKSC 3RXIA 1SGFA 4FUFA 4CREA 3AW0A 4Y10E 4Q7ZA 2C8YB 3AVZA 1EZXC 3S7HB 3W95A 2QY0B 3ODFA 5LPRA 4ABIA 1A3EH 1LHEH 4IN2A 3UOUA 4AGJA 1XUGA 4AORA 1D6WA 1EATA 3Q3KA 1LPGB 2FOAA 3LGWA 2P3FH 2VWLA 3SJKA 1QQUA 2BTCE 1C2LA 1C1MA 1YPKH 3GY6A 1IQIA 1ZLRA 2VNTA 1O34A 3K9XB 2BM2A 1NRPH 2PLXA 5FPTA 3BTKE 4X2WA 3SV9A 1G30B 3ZZ5A 1G37A 3OSYA 1QFKH 2J4IA 4OGYA 1EPTB 2M5TA 1ID5H 1TQ7B 1FN6A 3D23A 1BQYA 1NO9H 3PTNA 4KGAA 2OUAA 3ZVCA 5HM9A 1WYKA 2XTTB 4D76A 1LTOA 1DXWA 1ELTA 1SHHB 1MZAA 2AMPA 5EGMA 5LPFA 3VPKA 1T8OA 1MH0A 3GISB 4IGDA 1QNJA 1W8BH 1HCGA 1O2KA 3PMBB 1S84A 4MLFB 1O2LA 2V6NA 1W7XH 1G36A 4DIIH 1O3JA 1Y59T 3ATKA 8LPRA 1W0ZU 3AW1A 3R0FA 2Y5GA 1CHOG 4PROA 1W2KH 1V2JT 1GBFA 3TVJB 1SQTA 1TB6H 2PR3A 2EI8A 3EE0B 5IYTA 1SOTA 2ZDVH 3JZ1B 3TJUA 1GHAF 3PLPA 1J14A 2ZCKP 4NWLA 5FPYA 1YPLH 3BEFB 1ZJDA 3ZZ4A 1RD3B 1QA0A 2J95A 3SW2B 1FPCH 3KQBA 1HBTH 4R0IA 3WY8A 1V2OT 4QT8C 4HI3A 4Q7YA 3FAOA 5DJ7A 3UR9A 4GUXA 2ZWLH 1RTFB 1SOZA 4WH8A 5EU8A 1TE0A 2ANYA 1U6QA 3VEQB 6CHAC 3T28A 1T8MA 3BTDE 1SGYE 5HYOA 1KTSB 1IQKA 4JMYA 1CGHA 5AF9H 1AVWA 3UFAA 4TWYA 3F9HA 1XUJA 1O3DA 5AFZH 1K1NA 2V0BA 3QZRA 2ZIQH 3RXJA 4Y0YE 3RU4E 3U8OH 3W94A 3GYLB 1GG6C 1IHSH 1YCPK 1UTMA 1ZMNA 1GGDC 4DOQA 5C1XA 1DWDH
chains in the Genus database with same CATH superfamily
2IN2A 1HAZB 1C5WB 1W11U 5EXNA 3M7UA 1MKWH 5EIYA 4IBLH 2F9VA 3STJA 1C1VH 2FI3E 2V3OH 1OP8A 3QTVH 1C1QA 2NU2E 3MU4A 3IG6B 1GMCG 3QUMP 2FIRH 2BVXH 1QQ4A 2R3YA 1LHCH 4B2CA 5F8XA 2RG3A 1AB9C 2VVCA 3ZZ7A 5DK1A 3RC6A 1OX1A 4NG9H 4X6PA 1O36A 2ZPQA 3RMMH 5EOKA 3ZVDA 3A7ZA 3S9CA 4MNXA 2VWOA 1TNJA 1EB1H 1K0HA 1O2MA 3KL6A 2OC7A 1A1RA 4X8VH 1AN1E 4LZ4B 4GSOA 3SORA 1YYY1 2FI5E 2Y7XA 1ZSKA 5DPAA 2AH4X 3BTEE 4UFGH 2PSYA 1AGJA 4MNVA 3DUXH 3DSOA 2FLRH 1C5RA 4Y8ZA 4FU8A 4B1TA 3SV8A 5F6MA 1IQHA 1VCQA 1TPAE 2R2MB 3U98H 2WUBA 2VJ1A 4O3UA 4YESB 1AKSA 2YNAA 1LKBA 3LONA 1EASA 1WCZA 5J4SA 3VG8A 4ZHAA 2BDIA 1QL7A 1BDAA 1SGRE 2TGTA 4AOQA 2GCHF 1O2UA 3U8RH 1LCYA 2Z3EA 3SI4H 3OYPA 2KCPA 4FUDA 3S69A 1VITF 1EZQA 1S81A 1QIXB 2ZFQH 1GBLA 1SFQB 2W5EA 2F9UA 2ZDMA 3IWMA 3A89A 2KCYA 1XX9A 1C2EA 2DE9A 3T2NA 1GJ6A 5E2OA 4GVUA 3PV4A 6CHAB 2ZQ1A 2SGEE 1Z7KA 2SNVA 3SJ9A 3MWIU 1V2VT 1BHXB 1QRZA 1Z6JH 3T29A 3RXRA 2XC4A 1H9HE 2FLBH 2ZO3H 4FUIA 1ZRBA 1E1RD 3URCA 2BVRH 3UY9A 4I8GA 1GG6B 2ZGHA 1F0RA 2XC5A 3MNCA 4IN1A 1XUHA 1GBHA 1PQAA 4WWYA 3VXFH 1W12U 4CH8B 1C9PA 2HGTH 3TK5A 1S83A 1SGTA 3VFEA 3DFJA 2BZ6H 3TJNA 1L4ZA 3B9FH 3PRDA 2XXLA 3SV2H 4FETA 1SKYE 2ALVA 1LHDH 2W26A 2QXIA 3F2GA 1A0HB 1PPFE 4UDWH 2FM2A 4RI0A 6ESTA 2A1DB 1D3TB 3K2UA 3A8CA 3FOAA 1FMGA 1GBAA 2GJGA 2HVYB 1HAPH 1P3EA 1OKXA 1QB9A 1OYQA 1GBEA 1TOMH 2VIWA 2GD4B 3Q00A 3PLBA 2F4LA 3D62A 3M3VA 4X6NA 2XW9A 3RXPA 1AU8A 1NY22 4MPWA 3MH6A 1P9UA 2AGGX 1O3IA 3P8NA 3EYDA 1TAWA 1MCTA 1QBOA 2OCVB 3O8DA 3VXEH 4D9RA 5CMXH 3ATLA 2GT8A 5LGOA 1H4WA 1AO5A 2HNTF 1Y8TA 1NRSH 2GGVB 1Y3XA 3NZIA 1TMUH 4ACAA 2LPRA 1GHYH 2OC8A 2CMYA 2FZZA 1B5GH 1NT1A 2G5NA 2ZDNA 4E05H 2QAAA 2FX4A 2NU1E 2Z9KA 3MU5A 2O8LA 1AHTH 3PROA 1INCA 3TK6A 3UB0A 2EQNA 2ZPRA 1ZPBA 2V3MA 3P17H 4XD7D 4WXVA 3LKWA 2CXVA 4MPXA 8GCHF 3GY3A 1PPGE 1KYNA 1UJ1A 2PWXA 4OS2A 4WMDA 1TX7A 1TFXA 3V0XA 2R3UA 5DP9A 1CSOE 4X1QU 4X6MA 1YPMH 3T26A 2TGPZ 1L1NA 1D3DB 1MTNB 1O5AB 1SPJA 2Y5HA 2TGAA 2TIOA 1AFQB 5EPNA 3TITA 1GBTA 3TLOA 1QBVH 1D4PB 4WVPE 5EODA 3EAJA 2CN0H 3OTPA 3A7TA 5EJLA 1OWHA 3F2HA 1AVGH 4YOGA 2DE8A 3A8DA 1ZPCA 5FX6A 4ASUD 3O8RA 2G00A 1GMDF 2ILNA 2BMGB 5EG4A 1AZ8A 1K1LA 3UREA 1GHBF 4AFUA 5EQRA 1TGCA 3ZVGA 4HGCA 2FOGA 5F8ZA 1GBIA 1F0TA 4GCHF 2ZDKA 3LH1A 1RJXB 1Y3VA 1MU6B 2LP6A 1IQFA 3CENA 2WZQA 1HUTH 4HFPB 1SGQE 5FBEA 2Q6DA 3MI4A 1MD8A 3QO6A 1DOJA 1BUIA 1T31A 3VB5A 4FVBA 3KQ5A 3RXLA 1DWCH 2VIVA 1AQ7A 1AZZA 2KX4A 3AAUA 3O8BA 2CHAB 4X8SH 1IQGA 1HAHH 3ZVBA 1COWD 3CNRA 3ZZ9A 1DVAH 1YPJH 2SGDE 1FIZA 3OAAD 2J38A 1TX8A 3SU2A 2XC0A 1EP5A 4A7IB 1O3LA 2ZFRH 2WV4A 1F92A 2BDHA 3A84A 2ZGXH 4HTCH 4DY7B 4IMZA 1T4VH 5A8XA 1KXCA 3VB3A 4UONA 5H4IB 1FY4A 1C2IA 2NU0E 1OYTH 2JH5D 3SQEE 4XSKU 4D9QA 3SU3A 1ABJH 3A82A 3QK1A 2BY8X 1NESE 1BTHH 2ZDLA 2ZEBA 2XWBI 3KYFA 4IW4E 2ZGBH 2XOKD 2UUFB 3LGTA 4U32A 3UIRA 2D1JA 1V2QT 1KLJH 1MKWK 2EA3A 5DP4A 5F03A 2PSXA 1HAYB 3TJOA 1ZSLA 2BLVA 2ZU4A 3KHVA 5DKMA 2PFEA 4K3JA 1HFDA 4GHTA 2PKAB 3PTBA 2H9HA 1Y5AT 2SNWA 5DGJA 1JOUB 3RXAA 2Z7FE 1A7SA 3NKKA 4AN7A 1UTPA 4MDSA 2GVFA 4CRDA 2ZFSA 1CGIE 1HB0B 1FAXA 1GPZA 1TA6A 1DICA 1O2XA 8KME2 1QZ8A 1MAXA 4NWKA 1YC0A 2FOHA 1VZQH 2FEQH 2A45B 3PRBA 1WXRA 4FXGH 1J16A 1XKBC 2D2DA 2HNTE 3A88A 4ACBA 1NBME 2HALA 1TNGA 1O2WA 3ATWA 3BG8A 4MG3A 1Z8JB 1NN6A 3ZZCA 5JB8S 4OM9A 1SSXA 1V2TT 1BBRH 4GAWA 4DG4A 1YLDA 1THSH 3UR6A 1ZRKA 4XRNA 1BB0B 2UUKB 2Z94A 5EPYA 1ZGVA 1S0RA 1LQDB 2J9NA 1ELGA 5CDFE 1AMHA 1TNIA 1ZOMA 2JETC 1GHAG 1C4V2 1UTOA 1ELVA 2TPIZ 4ZUHA 1C1WH 4I31A 1A0JA 1W0KD 4JK5A 4ESTE 5C17A 5HIZA 1O3EA 1QJ7B 1O3MA 3ELAH 3BTHE 1KLTA 1BMNH 1S85A 2BVSH 1QY6A 1EPTA 3N7EA 3N7OA 1OWDA 1CGJE 2KR7A 2VH6A 3SN8A 2A31A 3L6PA 3BG4C 1AI8H 1UHBB 1EB2A 2FOBA 1HRTH 3ZYEA 1MD7A 5IK2D 1KSNA 4Y79A 4JYTA 2AS9A 2BD4A 2K1QA 1O2VA 3MH7A 2Y7ZA 1C5MD 3GCTF 4JCNA 4O03A 2KAIB 4D7GA 4B76A 5BRRE 4YO9A 1QR3E 1K9OE 2A32A 2LNCA 1TQ0B 1O3KA 5HMAA 3RU4T 2Z9IA 2AGEX 2AIPA 1L1JA 1DLKB 1GJBB 7GCHF 1JRSA 4B74A 4CBOA 2BD9A 1VR1H 1C2FA 1JRTA 1JIMA 2BDAA 1RTKA 1NU7B 3LJOA 1H8DH 4P02A 2K8IA 1ELFA 2ZCLP 1LQEA 1MMJN 1O3PB 4RT0A 3ZV8A 1Y3WA 2VVUA 3NWUA 1GDNA 4NIVA 4AX9H 1WUNH 2FWWA 2PTCE 1P8VC 1P12E 4NA8A 1P2QA 1MTWA 2OTVA 2VIOA 1GI3A 4ABAA 3IITA 1WTGH 1YPGH 1AFEH 3F9GA 3ZZ3A 2J5UA 4YT6H 1P2MA 3TH2H 3DT0H 1EJMA 1XVMA 3Q77A 5GWZA 5DSFA 2BLQA 3AASA 3CS7A 2ZU5A 3ZVFA 3N7DA 1A3BH 1F5RA 1GI5A 2B9LA 1GL1A 3DSGA 2PGBB 4D8NA 5JYIA 2ZF0H 5AVDA 3TIUA 3ATMA 4BAHB 3GY4A 3RXHA 3NRLA 1OS8A 4FOUC 4KTSA 1C5SA 5JBCS 2XNIA 1C1RA 4P00A 1TRYA 1KIGH 1TGSZ 1Z8RA 3TGIE 4FUJA 2XBVA 3NCLA 4X0WU 3RXTA 2FS8A 3FP8E 4AFZA 3UNRA 1AVXA 4B2AA 1V2PT 3RMLH 2YNBA 3SU0A 3SU6A 1P09A 2JETB 4WF8A 1ZZZA 4X1PU 2QXHA 1VITG 1T32A 2OQUA 3RXSA 3FVFB 4A1XA 2A7JA 4UFFH 1PQ7A 1RFNA 1OSSA 2W3IA 2FYQA 3MNBA 3RM0H 1NC6A 1UVSH 3UWJH 1O2JA 3ZV9A 3DA9B 4MTBA 1MU8B 2B0FA 3BG4B 2ANMH 1W7GH 4ZAEA 1UK3A 1FIWA 1C1TA 1O2YA 3TH3H 1DY9A 1C5OH 3F3BA 3SUGA 4TYDA 1C1NA 3OEED 2AMDA 2GV7A 3ATIA 3MU1A 2AIQA 1DWBH 1RRKA 2H2ZA 1ESAA 2O8WA 2W6ID 4H4FA 3QLPH 5HGGA 1V6DA 1HNEE 1FAKH 2AFQB 1KXBA 2ZU3A 1MTSA 3S9AA 1SGPE 5L30H 5C5NA 4WH6A 5FL7D 1GI6A 3QTOH 3D49H 4RN6A 1HJ8A 2XCNA 2QYIA 1E37B 1GMHF 3RP2A 1MZDA 1JWTA 1NFYA 2QV1A 3MOCA 3ZZ8A 3QN7A 1YGCH 3ZZDA 1O3BA 3F2FA 1TGNA 1L2EA 1Z6EA 3MH5A 3SNBA 1O2PA 4INLA 1EXFA 2BQWB 2GZ9A 5JBTA 1GHZA 4BAMB 2AEIH 2ZTXA 5FPSA 3UUZA 1P2JA 2O8MA 1J15A 3OX7U 1C2GA 1SQOA 2BQ7B 4X1RU 4LK4A 1BRUP 4ZHMU 1C5ZB 3E8LA 2AMQA 4BANB 1LVBA 1NFXA 2L6OA 2Q6GA 1FY5A 4YZUA 1TYNA 1LDTT 1UW7A 1YLCA 2GMTB 3TU7H 1LPZB 5C0UA 4XDEA 4H6TA 4ABFA 1OWJA 2FYRA 7KMEH 2WPLS 1O3GA 3M7TA 1TBQH 2ZKSA 1GL0E 2A2XH 1Z71A 2SGQE 3SGAE 4JYVH 3OY5U 1A2CH 2GZ8A 1IHTH 3BV9B 1JBUH 2FTLE 3UOPA 1XUKA 4NGAH 2HLCA 1WDIA 1YF4A 2WPMS 2WPHS 3C27B 1VJAU 3V13A 4Y7AA 2EC9H 4NIYA 8GCHG 3S0NA 3BTWE 2RCEA 5T6DA 5ABWA 3F0OA 3E90B 2HWLB 4XFQA 4AG2A 5JBAS 2ODQA 2NU4E 2ZZUH 2SGAA 1P57B 2ZHQH 1ANEA 1BMLA 3E91A 1QB1A 2OBQA 3M3TA 1SL3A 3TPIZ 1ELCA 3K65B 3FANA 1S6FA 3ESTA 3SU4A 1ORFA 4O9VA 1O33A 3SNEA 1GMDG 2QIQA 4ISOA 1O2TA 1H8IH 4YXWD 4I8HA 3F68H 4CBNA 1GHBG 1H1BA 3E0PB 1P0SH 1ZHMA 2QXJA 1C5PA 2Y6TA 3TGKE 1W3CA 1BBRK 1WU1A 2H6MA 1FXYA 4GCHG 4Y76A 3GY2A 4INHA 3PMAB 2BD2A 3SUEA 4A6LA 5C5OA 5TCAA 4TPIZ 7ESTE 2RDEA 3Q3YA 1TONA 5F53A 4AFSA 3KGPA 2BYAX 1ZMJA 3URDA 2GX4A 1S6LA 4NZLA 1BZXE 1W0YH 5L6NH 2GP9B 3PV2A 4CRCA 1MTNC 5KEDA 4YM9A 2TBSA 1AFQC 4E7RG 2IPHA 1KTTB 3SYJA 4Q80A 1Y5BT 3I29A 1HV7A 3P6ZB 2WPDD 2Z3DA 5FXLA 1IQMA 1IQNA 1ELEE 5CHAC 5K0HA 4H6SB 3BSQA 2QCYA 1UO6A 2QF5A 1GI9B 3A87A 4XBBA 2UWPA 2A7HA 2PTNA 1V3XA 1CO7E 1QJ1B 1XXFA 3BTTE 3BTME 1EP6A 3BF6H 3OFND 3HGPA 1JIRA 1HAGE 2OLGA 1HAOH 1HIAA 3R3GB 2WYJA 1GJ8B 2XWAA 3HATH 1X7AC 1YLNA 4BAQB 3G01A 4F48B 5LH8A 3S9BA 4FU7A 1UCYH 1FDPA 1O2NA 1CQQA 4KKDA 3M36A 1GJ9B 1ETSH 1V2WT 1IQEA 2ZC9H 4B71A 2C90B 1CT0E 4BTTB 4NA7A 1UCYE 3DSPA 3M7QA 2V7QD 2RA3A 4Z0KA 3ZVAA 2BD3A 2CHAC 4UFDH 1F5LA 2OD3B 1E36B 2FODA 1C1PA 3LT3A 1YPHE 3ZVEA 4ABGA 3GY5A 4WXIA 1LHFH 1XUFA 3RXKA 5C1UA 1OXGA 3UQOA 2H5DA 5C3NA 4X1NU 3RLWH 1FY1A 4RSPA 4XBDA 5G4BA 3UNSA 1N6YA 1T7CA 1V2NT 1WBGB 4Y7BA 5E8EH 1EOLA 1BRCE 2WV9A 3UAIC 3GY8A 1FZZA 1K1JA 1K22H 4Q2KA 1LVOA 1JMOH 3A8BA 5E0GA 5C20A 3SJIA 2KCOA 3GDVA 3PYHA 5EW1H 4FUBA 1AUJA 1ELAA 5DP8A 1T8NA 1O32A 2C8ZB 1O5CB 1PPCE 4ZROA 2OINA 2R9PA 4JZFH 3A80A 4H42U 2D26C 4I33A 2PUQH 5FBIA 1BOQA 1BJVA 2B7DH 1XKAC 2Y80A 1IQLA 4JYUH 3ZIAD 1NFUA 2Y81A 3F9EA 3LGIA 4AYVB 4IC5A 3UQVA 2PKAA 1BJUA 1HIAB 2UUJB 5CHAB 1W13U 5DO4H 3LU9B 1P2NA 1ACBE 1GJ5H 3PO1C 2ZHDA 1O39A 4ABJA 3OU0A 1XVOA 1ETRH 3MYWA 1YY3A 5JB9S 2BOKA 1ZTKA 3K6YA 1K1MA 5C94A 1HLTH 1TA2A 2AHME 2G81E 1BTXA 4Y11E 2BY9X 3P92A 2P8OC 3SU1A 1NTPA 1UK4A 2G8TA 5ESBA 5C1YA 1HDTH 4TY6A 3GCTG 2W7SA 1VITH 3BEUA 3SBKA 3MH4A 3WWBA 2B8OH 2ANWA 1FX0B 2J97A 1ARCA 1BMAA 4A1VA 2BLWA 1O3HA 5EJ1A 1C1OA 4F49A 1ZYOA 3M5MA 1RXPA 1MTVA 2ZFFH 5T1VA 7GCHG 1NM6A 2WPJS 3LDXH 3MU8A 4J2YB 3H7TA 2H5CA 4GLYA 4OS1A 1P2IA 1C5TA 2FXRA 3AK5A 1DPOA 1O37A 4AYYB 2BD5A 3VB6A 1IOEA 3CP7A 4DT7B 2HNTC 3UTUH 1YPEH 2V35A 1T8LA 1TOCB 3RC4A 2ZHEH 4OS7A 1F0UA 2HOBA 3M5LA 2CF8H 5IDKA 5DN6D 2L74A 1FONA 1O35A 4M7GA 1P9SA 1TX6A 2YMSB 2FMJA 1A61H 3VGCC 1TRNA 3LOXA 2CK3D 3M3SA 4CRFA 1UTQA 1BRAA 2FTMA 2ESTE 1ZTJA 3TK9A 3SHCH 4K1SA 1UHBA 1O3CA 1NROH 1HAVB 5DP6A 1FLEE 2F9OA 1ZPZA 3P8OA 4A1TA 2XBYA 4K60A 4UE7H 2A5IA 5K7RA 2KAIA 3RDZA 4B75A 2C8XB 3QGJA 1C2JA 1QRWA 1SGNE 3VB7A 4Z6AH 2HVXA 1Z8IB 3E0NB 3QZQA 1GCDA 3TNSA 2WINI 4M9FA 1THRH 3SNDA 1SI5H 3BN9A 5FCKA 1UTJA 4I8LA 1EJNA 4I7YH 2XRCA 3C1KA 4ZMAH 2P93A 3U9AH 4CHAC 4TY7A 1YBWA 3SUFA 2VIDA 1S5SA 2VB0A 4KELA 1G3DA 2KM0A 3PO1B 4J1YA 1S82A 4ABDA 1WAYB 1OP0A 2C4FH 3O8CA 1SLXB 9LPRA 1AD8H 1GVZA 1SR5C 2FPZA 2P3TB 4KP0A 2ZTZA 3LGUA 1Q2WA 1V2UT 4I32A 4DT4A 3U28C 1SVPA 1PPEE 2A4QA 2QXGA 2G5VA 3A83A 3PWCA 1NRQH 3GS9A 2P8OB 2VIPA 1VCWA 3V3MA 1WQSA 2IJD1 5CHBA 1G2MA 2C93B 2RA0A 2HPQH 2CV3A 3QDZB 1SFIA 3NPSA 1EX3A 4FUGA 2R0KA 4JZ1A 3FP7E 5PTPA 2JKHA 2BXUH 2HPPH 2A4RA 2D8WA 1DY8A 4B73A 1GCTC 2BDYA 4ZXYH 3ZZBA 1FN8A 4Q7XA 1C1UH 1SLUB 3LC5A 1C5QA 1EZUC 2BLOA 3P8FA 3FP6E 4D7FA 1IQJA 5EQQA 1GMHG 3PB1E 4Y6DA 2IOTA 2H9EH 2GCTC 5GCHF 1C9TA 1KXEA 1DANH 2ZPSA 2NU3E 6LPRA 2H9TH 1O2GH 1GI8B 1QGFA 1TGBA 1GBKA 1ELBA 1Q31A 4MNYA 1UVOA 2BHGA 1A5HA 3VGCB 1AE8H 1DFPA 1Q3XA 3PMHB 3E1XB 2BX3A 4XBCA 1P03A 2J94A 1C5NH 3RXEA 4IS5A 1QB6A 3TGJE 2ZP0H 1DUAA 5LPEA 4KTCA 1S0QA 1XXDA 1UCYK 4NSVA 3FKSD 3MFJA 1Y5UT 5EW2H 5GNDA 4AC9A 4BTIB 1FV9A 3RXQA 1HXFH 1W10U 1K2I1 1C2HA 1FY3A 1EJAA 1QCPA 2G4UA 3FFGA 1KLIH 2TRMA 4ZHLU 1A0LA 4Q63A 4BXWA 5TJXA 4HZHA 2W7UA 2YOLA 1N8OB 3KQDA 4CHAB 1H8ED 5FAHA 1AIXH 3OY6U 3SNCA 3ZZ6A 1EAWA 4WJG2 1HPGA 3A7WA 1FPHH 1NU9A 3GCHB 3AAVA 2NWNA 2O9QA 5F8TA 2XBWA 1UVUH 3BEIB 1DUEA 1O3FA 2RFKC 3QWCH 2RDLA 1WQVH 3ZYDA 1SQAA 3RXBA 3ZZAA 1THPB 2J98B 2A0QB 3P95A 4NIWA 5T3HA 2GZ7A 1SC8U 6GCHF 3RM2H 2KCAA 1C5VA 1BHXF 1O5FH 4Y71A 1ZJKA 1CU1A 1UTKA 1BTYA 5FCRA 4CRBA 1FQ3A 4BOHA 2HLDD 2WV5A 5A09A 2GMTC 3T27A 1GHXH 3FO8D 4MVNA 2FOFA 2ANKH 5I25A 4U01A 1VGCB 3M35A 2PV9B 1XMNB 1O38A 2I6SA 2ASUB 2GT7A 1UTLM 1D3QB 1O0DH 2K0QA 5EXMA 1SB1H 3F1SB 1GCTB 2GCHG 3OEHD 4DURA 1WTHD 1LMWB 2VBCA 4ZKRU 4ZXXH 1O30A 5DG6A 5T6GA 1P05A 1G2LA 2ZG0H 1MBQA 4ZH8A 1C4Y2 5C2ZA 3T25A 1NPMA 3GOVB 1LPKB 2GCTB 3Q3XA 3OE7D 4WMEA 3U1IB 1P01A 1BITA 1GVKB 2BD8A 2VIQA 3EA9A 1EAUA 1KDQA 1GI2A 4GPGA 1BTPA 1TIOA 5A0AE 1E35B 4AG1A 1E1QD 1E34B 2SGFE 1EAIA 1T4UH 4K69A 4GHQA 5EQSA 1DM4B 1J9CH 1VCPA 1K21H 1O2SA 1OWIA 3RXDA 2OQ5A 3QX5H 4XOJA 3GY7A 1TALA 1Z1IA 1DDJA 2A2QH 2G4TA 2H1UA 5JDUB 1PYTC 2BDCA 3LGVA 5EXLA 1HGTH 5A0CA 2BY7X 2FOCA 2Q6FA 4JZDH 3RXCA 3BTQE 1G3EA 3RXMA 3MO3A 2F9BH 3T5FH 1TMBH 3P70B 2ALPA 1EUFA 2BDGA 2C8WB 3LPRA 1EZSC 4X2XA 3EE7A 2ZNKH 2ODYB 1PPBH 1ESTA 2STAE 4ZKOU 1K1IA 1BA8B 2SFAA 4A92A 3NUMA 1DSUA 3KN2A 2P94A 1AY6H 1NBMD 1GI4A 3F9FA 1OHHD 3SJ8A 1AE5A 2ZECA 3RXUA 1JXPA 1KXDA 1SLVB 5DP3A 2WUCA 4MPUA 1C2DA 4SGAE 4INKA 5HIYA 4ZCNA 1O5EH 1UK2A 2VWMA 1OOKB 3EGKH 3Q76A 4SGBE 5ESTE 3SGBE 1GBMA 2UUYA 5A0BA 1J17T 2UWOA 2XNDD 3SQHE 3T62A 2BDBA 2PKSB 3FZDA 1F5KU 4DJZB 3NXPA 2VWNA 1TPOA 3TJVA 1TMTH 3W1EA 1UVTH 1SG8B 1RIWC 3UPEA 1P11E 2B5TB 4FUEA 2XBXA 1MQ6A 2EEKA 2WYGA 1CBWC 2TGDA 2FS9A 5EJZA 1CT2E 1K1PA 3KQEA 4BNRA 3A7YA 2VINA 2GKVE 3A81A 5GIBA 1KDQB 2BD7A 2HRVA 1SGIB 1P2KA 1TPPA 1B7XB 1MKXH 3TNTA 3UWIA 1GBJA 1H9IE 1W0JD 1QJ6B 3E6PH 4RKOB 2ZQ2A 3V7TA 3KQCA 4LXBH 1ZHPA 4WMFA 3SV7A 4DW2U 2J34A 3GCOA 1NFWA 5FHTA 3SOSA 3RXGA 1Z8GA 2OC1A 2ZU1A 1C2MA 1SGEE 4ABEA 4NFFA 4ASHA 3PLKA 2JDID 2BB4A 1OP2A 2F83A 3B8JA 1O3OA 4OS5A 5B6OA 5AHGH 4BAOB 1ZMLA 3EA7A 3SNAA 1WOFA 1P2OA 2XYAA 3SZEA 2FO9A 1GJDB 1AWFH 1QURH 2PUXB 1PQ5A 1ELDE 3A7XA 1NS3A 2ZHFH 4I8JA 3DD2H 2EI6A 1FUJA 1YP9A 2F9NA 1O5GH 4Y8XA 3U69H 1GI0A 4UD9H 1D6RA 1TABE 3HKIB 3D65E 1MTUA 4LZ1H 1NZQH 1DXPA 2R0LA 2Z9JA 3PM3A 1EQ9A 1KXAA 1XUIA 1ZGIA 1KXFA 4IC6A 1P10A 3KEEA 1O2IA 1H8HD 1YPHC 3RXVA 1CE5A 1YCPM 3PV5A 4TT3D 3RXFA 4DVAU 2ZHWH 1LO6A 2AERH 2UWLA 2QGRA 1V2RT 1TPSA 2W6JD 1HXEH 1G3CA 3GYMA 4K1EA 1P04A 2F9PA 4DCDA 1VJ9U 1EAXA 1ESBA 1ABIH 1EKBB 4UFEH 2O8UA 1E79D 1SLWB 4BXSA 1BT7A 3BTGE 1SHYA 9ESTA 2VH0A 2G52A 5JPMH 5KECA 3TH4H 2JIZD 2THFB 1V2KT 1RIWB 2VU8E 2ZA5A 1CHOF 2P3UB 1SBWA 1QTFA 4JZIA 4YTAA 1V2ST 2CGAA 1K28D 4VGCC 1CBWB 4I8KA 4NIXA 1A5IA 1GGDB 1O2RA 2CJIA 2A5KA 2OXSA 1M9UA 1ETTH 3GDSA 4X6OA 3MTYA 1KY9A 3RXOA 2ZGJA 1DWEH 1BMMH 1DT2A 1O5DH 4THNH 3U8TH 4AFQA 3MNXA 3E3TA 3SUDA 3CS0A 1A5GH 4AZ2B 3E16B 2GTBA 2J2UA 1PPHE 1AB9B 4RKJB 1D3PB 1C1SA 3EDXB 4JK6A 2OK5A 1BMFD 5A8ZA 2ZDAH 1C4U2 3H09A 4ISNA 1LKAA 3LGYA 3V12A 2PHBA 2EI7A 3HPTB 4CRGA 2Q1JA 2FOEA 4NFEA 7LPRA 2ZFTA 5FX5A 5A2MH 2BOHB 2YMSC 1K1OA 1TLDA 2G55A 1SGFG 1CA0C 4CRAA 4YT7H 4X1SU 1HYLA 1AKSB 5JBBS 2JH0D 2Z3CA 1QHRB 3SHAH 4AB8A 2ZGCA 3BTFE 1NRNH 1UMAH 1SGCA 1MAYA 4AGKA 1SMFE 1CVWH 5DP7A 2A4GA 3SV6A 1N6XA 1GMCF 1MBMA 1O3AA 1QA7A 1TNKA 2BY5X 3LH3A 1PPZA 5E0JA 3RMNH 3RU4D 1ANBA 1MQ5A 2A5AA 1F0SA 3NK8A 2F43B 2ZCHP 2QN5T 4TPYA 1HAVA 1IAUA 3RC5A 1AUTC 1SGDE 2Y82A 1GHVH 4K8YA 4CH2B 3EQ0H 2JH6D 3B23B 5GJ4B 1QRXA 1P02A 1N1LA 3P8GA 1W14U 1TWXB 3PMJA 1FY8E 2VVVA 2WPIS 4OGXA 1PYTD 4O3TA 4YLUA 5GCHG 3I77A 1G3BA 1HAXB 1ANCA 2SGPE 1HJAC 3BIVH 2OP9A 2BXTH 2BX4A 3MU0A 1ZHRA 1OWEA 1RTLA 2Z9LA 2I6QA 1GDQA 2P16A 3PWBA 3GDUA 4A5TS 1P06A 4K8BA 4VGCB 2WHXA 2QF3A 5BPEA 2C3SA 1ANDA 1RS0A 1J8AA 1MCVA 3EA8A 1Z1JA 4E06H 3HKJB 1Y3UA 4BAKB 2FP7B 2JJ2D 2PGQB 1E0FD 4KTUA 5E2PA 5HM2A 2VGCC 1HAIH 2A7CA 3JZ2B 1O2OA 1GJ7B 1GI7B 3KF2A 4ISLA 1O2HA 1BCUH 1A46H 1EFRD 1OPHB 3KCGH 2EY4C 2LELA 3MMGA 2BZAA 3LJJA 1L1GA 4FUCA 3F6UH 1GJ4H 2M2AA 1DLEA 1QL8A 1GHWH 4UEHH 3DHKH 1ZSJA 1GWAA 1ARBA 1G9IE 3H7OA 1B0FA 1O3NA 2A4OA 2IPQX 2AYWA 4YOIA 2ODPA 3STIA 1CA8B 5GXPA 4BTUB 2KFWA 1BTWA 5E0HA 1CA0B 1Y3YA 1V2MT 4TSFD 4CR9A 5J4QA 4K1TA 4R8TB 2GDEH 2FDAA 3SO3A 4AB9A 5A8YA 1G32B 2G51A 1L4DA 1YCPH 3KIDU 2P95A 4K5ZA 6GCHG 5HXFA 1GI1A 4O97A 4ZKSU 1O2ZA 3M61U 3H5CB 4YLQH 3ITIA 1P3CA 1LVMA 3HK3B 5T6FA 2ZI2H 1GDUA 5L2ZH 1PFXC 4B6FA 4Y0ZE 2FX6A 4YOJA 1UTNA 1UVPA 1MKXK 5TCCA 4NA9H 4F55A 1N8OC 2Y5FA 4ABBA 3QGNB 3RLYH 1WV7H 2QF4A 2WPKS 2J92A 4FVDA 1PQ8A 3MO9A 1FJSA 3S7KB 3GCHC 1QL9A 2QC2A 1HJ9A 1D9IA 4U2WA 1GVLA 3A7VA 3SU5A 1HJAB 1AWHB 1EOJA 4DIHH 3FZZA 4NCYA 4JZEH 5KGOA 1F2SE 3K6ZA 2GV6A 3F0PA 4NSYA 1BTZA 1DITH 4B2BA 4X8UH 4X8TH 3A85A 5ETXA 5GPIB 1NRRH 3ENSB 4ZKNU 8ESTE 4IMQA 2PW8H 1TNLA 1YKTA 1O2QA 2BY6X 3LC3A 1C5YB 3MO6A 2J98A 1VGCC 3DFLA 3ODDA 1ZTLA 3L33A 3A8AA 1KMHB 1TBRH 2VGCB 3MNSA 3VB4A 1C5LH 1GBCA 3GCNA 1GJAB 2GDDA 1OWKA 4ABHA 3GICB 1CT4E 3RUOA 1CHGA 4K2YA 1FI8A 4FU9A 2STBE 3HGNA 3SGQE 1BBRE 1XM1A 2AGIX 2Z9GA 1L0ZA 2FI4E 3BIUH 3OTJE 1S6HA 1DS2E 1TBZH 1EPTC 1YM0A 2JJ1D 2CF9H 4MPVA 3RMOH 1DE7H 4Y8YA 3SI3H 5DP5A 1DSTA 1C5UA 2ZFPH 4X2YA 4ISIH 1TRMA 1B0EA 2ZTYA 3M5OA 2DUCA 3KYGA 2ULLA 2ZU2A 1O5BB 1QBNA 1F7ZA 3KNXA 2W3KA 3M5NA 4XE4A 2F91A 1TGTA 3HK6B 1TNHA 2QF0A 1A4WH 1MUEB 4FUHA 1C2KA 3U1JB 5AFYH 2Z6BD 5SGAE 2OC0A 2O8TA 2BQ6B 1BRBE 2OBOA 2R2WU 1VKYA 4WY3A 3LIWA 4U30A 2IJOB 4ISHH 5L2YH 4OS4A 1MABB 1FNIA 1ZR0A 5CE1A 1E38B 4OS6A 2V3HH 1GBBA 4CR5A 3SZNA 4X2VA 3MHWU 2XCFA 4DGJA 2FESH 2F3CE 3M37A 4TWWA 1GJCB 3MQKC 3SJOA 4MQAA 1V2LT 1WSSH 1GBDA 1RGQA 4F4OC 2FOMB 2QA9E 1DX5M 1H9LB 2YMSD 4E7NA 1LHGH 5GDSH 2P59A 1LVYA 1O31A 5I46H 4HG6A 3I78A 3L3TA 4NZQA 3A86A 3UNQA 1BTUA 1PJPA 4MNWA 1C5XB 1BIOA 5C67A 4LOYH 2PKSC 3RXIA 1SGFA 3N99A 4FUFA 4CREA 3AW0A 5B6LA 4Y10E 5C0TA 4Q7ZA 2C8YB 3AVZA 1EZXC 3S7HB 3W95A 2QY0B 3ODFA 5LPRA 4ABIA 1A3EH 1LHEH 4IN2A 3UOUA 4AGJA 1XUGA 4AORA 1D6WA 1EATA 3Q3KA 4RT1A 1LPGB 2FOAA 3LGWA 2P3FH 2VWLA 3SJKA 1QQUA 2BTCE 1C2LA 1C1MA 1YPKH 3GY6A 1IQIA 1ZLRA 3WW7A 2VNTA 1O34A 3K9XB 2BM2A 1NRPH 2PLXA 5FPTA 3BTKE 4X2WA 3SV9A 1G30B 3ZZ5A 1G37A 3OSYA 1QFKH 2J4IA 4OGYA 1EPTB 5HKKD 2M5TA 1ID5H 1TQ7B 1FN6A 3D23A 1BQYA 1NO9H 3PTNA 4KGAA 2OUAA 3FN8A 3ZVCA 5HM9A 1WYKA 2XTTB 4D76A 1LTOA 1DXWA 1ELTA 1SHHB 1MZAA 2AMPA 5EGMA 5LPFA 3VPKA 1T8OA 1MH0A 3GISB 4IGDA 1QNJA 1W8BH 1HCGA 1O2KA 3PMBB 1S84A 1SQRA 4MLFB 1O2LA 2V6NA 4B6EA 1W7XH 2QE7D 1G36A 4DIIH 1O3JA 4I86A 1Y59T 3ATKA 8LPRA 2WSSD 1W0ZU 3AW1A 3R0FA 2Y5GA 1CHOG 4PROA 1W2KH 1V2JT 1GBFA 3TVJB 1SQTA 1TB6H 2PR3A 2EI8A 3EE0B 5IYTA 1SOTA 2ZDVH 3JZ1B 3TJUA 1GHAF 3PLPA 1J14A 2ZCKP 1YWUA 4NWLA 5FPYA 1YPLH 3BEFB 1ZJDA 3ZZ4A 1RD3B 1QA0A 2J95A 3SW2B 1FPCH 3KQBA 1HBTH 4R0IA 3WY8A 4Z1MD 1V2OT 4QT8C 4HI3A 4Q7YA 3FAOA 5DJ7A 3UR9A 2KZ4A 4GUXA 2ZWLH 1RTFB 1SOZA 4WH8A 5EU8A 1TE0A 2ANYA 1U6QA 3VEQB 6CHAC 3T28A 3WWFA 1T8MA 3BTDE 1SGYE 5HYOA 1KTSB 1IQKA 4JMYA 1CGHA 4Q4LA 5AF9H 1AVWA 3UFAA 4TWYA 3F9HA 1XUJA 1O3DA 2PP6A 5AFZH 1K1NA 2V0BA 3QZRA 2ZIQH 3RXJA 4Y0YE 3RU4E 3U8OH 3W94A 3GYLB 1GG6C 3DCLA 1IHSH 1YCPK 1UTMA 1ZMNA 1GGDC 4DOQA 5C1XA 1DWDH
chains in the Genus database with same CATH topology
2IN2A 1HAZB 1C5WB 1W11U 5EXNA 3M7UA 1MKWH 4IBLH 2F9VA 3STJA 1C1VH 2FI3E 2V3OH 1OP8A 3QTVH 1C1QA 2NU2E 3MU4A 3IG6B 1GMCG 3QUMP 2FIRH 2BVXH 1QQ4A 2R3YA 1LHCH 4B2CA 5F8XA 2RG3A 1AB9C 2VVCA 3ZZ7A 5DK1A 3RC6A 1OX1A 4NG9H 4X6PA 1O36A 2ZPQA 3RMMH 5EOKA 3ZVDA 3A7ZA 3S9CA 4MNXA 2VWOA 1TNJA 1EB1H 1O2MA 3KL6A 2OC7A 1A1RA 4X8VH 1AN1E 4LZ4B 4GSOA 3SORA 1YYY1 2FI5E 2Y7XA 1ZSKA 5DPAA 2AH4X 3BTEE 4UFGH 2PSYA 1AGJA 4MNVA 3DUXH 2FLRH 1C5RA 4Y8ZA 4FU8A 4B1TA 3SV8A 5F6MA 1IQHA 1VCQA 1TPAE 2R2MB 3U98H 2WUBA 2VJ1A 4O3UA 4YESB 1AKSA 2YNAA 1LKBA 3LONA 1EASA 1WCZA 5J4SA 4ZHAA 2BDIA 1QL7A 1BDAA 1SGRE 2TGTA 4AOQA 2GCHF 1O2UA 3U8RH 1LCYA 2Z3EA 3SI4H 3OYPA 4FUDA 3S69A 1VITF 1EZQA 1S81A 1QIXB 2ZFQH 1GBLA 1SFQB 2W5EA 2F9UA 2ZDMA 3IWMA 3A89A 1XX9A 1C2EA 2DE9A 3T2NA 1GJ6A 5E2OA 4GVUA 3PV4A 6CHAB 2ZQ1A 2SGEE 1Z7KA 2SNVA 3SJ9A 3MWIU 1V2VT 1BHXB 1QRZA 1Z6JH 3T29A 3RXRA 2XC4A 1H9HE 2FLBH 2ZO3H 4FUIA 1ZRBA 3UY9A 3URCA 2BVRH 4I8GA 1GG6B 2ZGHA 1F0RA 2XC5A 3MNCA 4IN1A 1XUHA 1GBHA 1PQAA 4WWYA 3VXFH 1W12U 4CH8B 1C9PA 2HGTH 3TK5A 1S83A 1SGTA 3VFEA 3DFJA 2BZ6H 3TJNA 1L4ZA 3B9FH 2XXLA 3SV2H 2ALVA 1LHDH 2W26A 2QXIA 1A0HB 1PPFE 4UDWH 2FM2A 6ESTA 2A1DB 1D3TB 3K2UA 3A8CA 1FMGA 1GBAA 1HAPH 1P3EA 1OKXA 1QB9A 1OYQA 1GBEA 1TOMH 2VIWA 2GD4B 3Q00A 3PLBA 3D62A 3M3VA 4X6NA 2XW9A 3RXPA 1AU8A 1NY22 4MPWA 3MH6A 1P9UA 2AGGX 1O3IA 3P8NA 3EYDA 1TAWA 1MCTA 1QBOA 2OCVB 3O8DA 3VXEH 4D9RA 5CMXH 3ATLA 2GT8A 5LGOA 1H4WA 1AO5A 2HNTF 1Y8TA 1NRSH 2GGVB 1Y3XA 3NZIA 1TMUH 2LPRA 1GHYH 2OC8A 2CMYA 2FZZA 1B5GH 1NT1A 2G5NA 2ZDNA 4E05H 2QAAA 2FX4A 2NU1E 2Z9KA 3MU5A 2O8LA 1AHTH 3PROA 1INCA 3TK6A 2ZPRA 1ZPBA 3P17H 4WXVA 3LKWA 2CXVA 4MPXA 8GCHF 3GY3A 1PPGE 1KYNA 1UJ1A 2PWXA 4OS2A 4WMDA 1TX7A 1TFXA 3V0XA 2R3UA 5DP9A 1CSOE 4X1QU 4X6MA 1YPMH 3T26A 2TGPZ 1L1NA 1D3DB 1MTNB 1O5AB 1SPJA 2Y5HA 2TGAA 2TIOA 1AFQB 5EPNA 3TITA 1GBTA 3TLOA 1QBVH 1D4PB 4WVPE 5EODA 3EAJA 2CN0H 3A7TA 1OWHA 1AVGH 4YOGA 2DE8A 3A8DA 1ZPCA 5FX6A 3O8RA 2G00A 1GMDF 2ILNA 2BMGB 5EG4A 1AZ8A 1K1LA 3UREA 1GHBF 4AFUA 5EQRA 1TGCA 3ZVGA 4HGCA 2FOGA 5F8ZA 1GBIA 1F0TA 4GCHF 2ZDKA 3LH1A 1RJXB 1Y3VA 1MU6B 1IQFA 3CENA 1HUTH 4HFPB 1SGQE 5FBEA 2Q6DA 3MI4A 1MD8A 3QO6A 1DOJA 1BUIA 1T31A 3VB5A 4FVBA 3RXLA 1DWCH 2VIVA 1AQ7A 1AZZA 3AAUA 3O8BA 2CHAB 4X8SH 1IQGA 1HAHH 3ZVBA 3ZZ9A 1DVAH 1YPJH 2SGDE 1FIZA 2J38A 1TX8A 3SU2A 2XC0A 1EP5A 4A7IB 1O3LA 2ZFRH 2WV4A 1F92A 2BDHA 3A84A 2ZGXH 4HTCH 4DY7B 4IMZA 1T4VH 5A8XA 1KXCA 3VB3A 4UONA 5H4IB 1FY4A 1C2IA 2NU0E 1OYTH 2JH5D 3SQEE 4XSKU 4D9QA 3SU3A 1ABJH 3A82A 3QK1A 2BY8X 1NESE 1BTHH 2ZDLA 2ZEBA 2XWBI 4IW4E 2ZGBH 2UUFB 3LGTA 4U32A 3UIRA 2D1JA 1V2QT 1KLJH 1MKWK 2EA3A 5DP4A 5F03A 2PSXA 1HAYB 3TJOA 1ZSLA 2BLVA 2ZU4A 3KHVA 5DKMA 2PFEA 4K3JA 1HFDA 4GHTA 2PKAB 3PTBA 2H9HA 1Y5AT 2SNWA 5DGJA 1JOUB 3RXAA 2Z7FE 1A7SA 3NKKA 4AN7A 1UTPA 4MDSA 2GVFA 4CRDA 2ZFSA 1CGIE 1HB0B 1FAXA 1GPZA 1TA6A 1DICA 1O2XA 8KME2 1MAXA 4NWKA 1YC0A 2FOHA 1VZQH 2FEQH 2A45B 4FXGH 1J16A 1XKBC 2D2DA 2HNTE 3A88A 2HALA 1TNGA 1O2WA 3ATWA 3BG8A 4MG3A 1Z8JB 1NN6A 3ZZCA 5JB8S 1SSXA 1V2TT 1BBRH 4GAWA 4DG4A 1YLDA 1THSH 3UR6A 1ZRKA 1BB0B 2UUKB 2Z94A 5EPYA 1ZGVA 1S0RA 1LQDB 2J9NA 1ELGA 1AMHA 1TNIA 1ZOMA 2JETC 1GHAG 1C4V2 1UTOA 1ELVA 2TPIZ 4ZUHA 1C1WH 4I31A 1A0JA 4JK5A 4ESTE 1O3EA 1QJ7B 1O3MA 3ELAH 3BTHE 1KLTA 1BMNH 1S85A 2BVSH 1QY6A 1EPTA 3N7OA 1OWDA 1CGJE 2VH6A 3SN8A 2A31A 3L6PA 3BG4C 1AI8H 1UHBB 1EB2A 2FOBA 1HRTH 3ZYEA 1MD7A 1KSNA 4Y79A 4JYTA 2AS9A 2BD4A 2K1QA 1O2VA 3MH7A 2Y7ZA 1C5MD 3GCTF 4JCNA 4O03A 2KAIB 4D7GA 4B76A 5BRRE 4YO9A 1QR3E 1K9OE 2A32A 2LNCA 1TQ0B 1O3KA 5HMAA 3RU4T 2Z9IA 2AGEX 2AIPA 1L1JA 1DLKB 1GJBB 7GCHF 1JRSA 4B74A 4CBOA 2BD9A 1VR1H 1C2FA 1JRTA 1JIMA 2BDAA 1RTKA 1NU7B 3LJOA 1H8DH 1ELFA 2ZCLP 1LQEA 1MMJN 1O3PB 3ZV8A 1Y3WA 2VVUA 3NWUA 1GDNA 4NIVA 4AX9H 1WUNH 2FWWA 2PTCE 1P8VC 1P12E 4NA8A 1P2QA 1MTWA 2OTVA 2VIOA 1GI3A 4ABAA 3IITA 1WTGH 1YPGH 1AFEH 3F9GA 3ZZ3A 4YT6H 1P2MA 3TH2H 3DT0H 1EJMA 1XVMA 3Q77A 5GWZA 2BLQA 3AASA 3CS7A 2ZU5A 3ZVFA 1A3BH 1F5RA 1GI5A 2B9LA 1GL1A 2PGBB 4D8NA 5JYIA 2ZF0H 5AVDA 3TIUA 3ATMA 4BAHB 3GY4A 3RXHA 1OS8A 4KTSA 1C5SA 5JBCS 2XNIA 1C1RA 1TRYA 1KIGH 1TGSZ 1Z8RA 3TGIE 4FUJA 2XBVA 3NCLA 4X0WU 3RXTA 2FS8A 3FP8E 4AFZA 3UNRA 1AVXA 4B2AA 1V2PT 3RMLH 2YNBA 3SU0A 3SU6A 1P09A 2JETB 4WF8A 1ZZZA 4X1PU 2QXHA 1VITG 1T32A 2OQUA 3RXSA 3FVFB 4A1XA 2A7JA 4UFFH 1PQ7A 1RFNA 1OSSA 2W3IA 2FYQA 3MNBA 3RM0H 1NC6A 1UVSH 3UWJH 1O2JA 3ZV9A 3DA9B 4MTBA 1MU8B 2B0FA 3BG4B 2ANMH 1W7GH 4ZAEA 1UK3A 1FIWA 1C1TA 1O2YA 3TH3H 1DY9A 1C5OH 3SUGA 4TYDA 1C1NA 2AMDA 2GV7A 3ATIA 3MU1A 2AIQA 1DWBH 1RRKA 2H2ZA 1ESAA 2O8WA 4H4FA 3QLPH 5HGGA 1V6DA 1HNEE 1FAKH 2AFQB 1KXBA 2ZU3A 1MTSA 3S9AA 1SGPE 5L30H 5C5NA 4WH6A 1GI6A 3QTOH 3D49H 4RN6A 1HJ8A 2XCNA 2QYIA 1E37B 1GMHF 3RP2A 1MZDA 1JWTA 1NFYA 2QV1A 3MOCA 3ZZ8A 3QN7A 1YGCH 3ZZDA 1O3BA 1TGNA 1L2EA 1Z6EA 3MH5A 3SNBA 1O2PA 4INLA 1EXFA 2BQWB 2GZ9A 5JBTA 1GHZA 4BAMB 2AEIH 2ZTXA 5FPSA 3UUZA 1P2JA 2O8MA 1J15A 3OX7U 1C2GA 1SQOA 2BQ7B 4X1RU 4LK4A 1BRUP 4ZHMU 1C5ZB 3E8LA 2AMQA 4BANB 1LVBA 1NFXA 2Q6GA 1FY5A 4YZUA 1TYNA 1LDTT 1YLCA 2GMTB 3TU7H 1LPZB 4XDEA 4H6TA 4ABFA 1OWJA 2FYRA 7KMEH 2WPLS 1O3GA 3M7TA 1TBQH 2ZKSA 1GL0E 2A2XH 1Z71A 2SGQE 3SGAE 4JYVH 3OY5U 1A2CH 2GZ8A 1IHTH 3BV9B 1JBUH 2FTLE 3UOPA 1XUKA 4NGAH 2HLCA 1YF4A 2WPMS 2WPHS 3C27B 1VJAU 3V13A 4Y7AA 2EC9H 4NIYA 8GCHG 3S0NA 3BTWE 2RCEA 5T6DA 5ABWA 3E90B 2HWLB 4XFQA 4AG2A 5JBAS 2ODQA 2NU4E 2ZZUH 2SGAA 1P57B 2ZHQH 1ANEA 1BMLA 3E91A 1QB1A 2OBQA 3M3TA 1SL3A 3TPIZ 1ELCA 3K65B 3FANA 1S6FA 3ESTA 3SU4A 1ORFA 4O9VA 1O33A 3SNEA 1GMDG 2QIQA 4ISOA 1O2TA 1H8IH 4I8HA 3F68H 4CBNA 1GHBG 1H1BA 3E0PB 1P0SH 1ZHMA 2QXJA 1C5PA 2Y6TA 3TGKE 1W3CA 1BBRK 1WU1A 2H6MA 1FXYA 4GCHG 4Y76A 3GY2A 4INHA 3PMAB 2BD2A 3SUEA 4A6LA 5C5OA 5TCAA 4TPIZ 7ESTE 3Q3YA 1TONA 4AFSA 3KGPA 2BYAX 1ZMJA 3URDA 2GX4A 4NZLA 1BZXE 1W0YH 5L6NH 2GP9B 4CRCA 1MTNC 4YM9A 2TBSA 1AFQC 4E7RG 2IPHA 1KTTB 4Q80A 1Y5BT 3I29A 1HV7A 3P6ZB 2Z3DA 5FXLA 1IQMA 1IQNA 1ELEE 5CHAC 5K0HA 4H6SB 3BSQA 2QCYA 1UO6A 1GI9B 3A87A 4XBBA 2UWPA 2A7HA 2PTNA 1V3XA 1CO7E 1QJ1B 1XXFA 3BTTE 3BTME 1EP6A 3BF6H 3HGPA 1JIRA 1HAGE 2OLGA 1HAOH 1HIAA 3R3GB 2WYJA 1GJ8B 2XWAA 3HATH 1X7AC 4BAQB 3S9BA 3G01A 5LH8A 4FU7A 1UCYH 1FDPA 1O2NA 1CQQA 4KKDA 3M36A 1GJ9B 1ETSH 1V2WT 1IQEA 2ZC9H 4B71A 2C90B 1CT0E 4BTTB 4NA7A 1UCYE 3M7QA 2RA3A 4Z0KA 3ZVAA 2BD3A 2CHAC 4UFDH 1F5LA 2OD3B 1E36B 2FODA 1C1PA 3LT3A 1YPHE 3ZVEA 4ABGA 3GY5A 4WXIA 1LHFH 1XUFA 3RXKA 5C1UA 1OXGA 3UQOA 2H5DA 5C3NA 4X1NU 3RLWH 1FY1A 4RSPA 4XBDA 5G4BA 3UNSA 1N6YA 1T7CA 1V2NT 1WBGB 4Y7BA 5E8EH 1EOLA 1BRCE 3GY8A 1FZZA 1K1JA 1K22H 4Q2KA 1LVOA 1JMOH 3A8BA 5E0GA 5C20A 3SJIA 3GDVA 3PYHA 5EW1H 4FUBA 1AUJA 1ELAA 5DP8A 1T8NA 1O32A 2C8ZB 1O5CB 1PPCE 4ZROA 2OINA 2R9PA 4JZFH 3A80A 4H42U 2D26C 4I33A 2PUQH 5FBIA 1BOQA 1BJVA 2B7DH 1XKAC 2Y80A 1IQLA 4JYUH 1NFUA 2Y81A 3F9EA 3LGIA 4AYVB 4IC5A 3UQVA 2PKAA 1BJUA 1HIAB 2UUJB 5CHAB 1W13U 5DO4H 3LU9B 1P2NA 1ACBE 1GJ5H 3PO1C 2ZHDA 1O39A 4ABJA 3OU0A 1XVOA 1ETRH 3MYWA 5JB9S 2BOKA 1ZTKA 3K6YA 1K1MA 1HLTH 1TA2A 2G81E 1BTXA 4Y11E 2BY9X 3P92A 2P8OC 3SU1A 1NTPA 1UK4A 2G8TA 5ESBA 5C1YA 1HDTH 4TY6A 3GCTG 2W7SA 1VITH 3BEUA 3SBKA 3MH4A 2B8OH 2ANWA 1ARCA 1BMAA 4A1VA 2BLWA 1O3HA 1C1OA 4F49A 1ZYOA 3M5MA 1RXPA 1MTVA 2ZFFH 7GCHG 1NM6A 2WPJS 3LDXH 3MU8A 4J2YB 3H7TA 2H5CA 4GLYA 4OS1A 1P2IA 1C5TA 2FXRA 1DPOA 1O37A 4AYYB 2BD5A 3VB6A 1IOEA 3CP7A 4DT7B 2HNTC 3UTUH 1YPEH 2V35A 1T8LA 1TOCB 3RC4A 2ZHEH 4OS7A 1F0UA 2HOBA 3M5LA 2CF8H 5IDKA 1FONA 1O35A 4M7GA 1P9SA 1TX6A 2FMJA 1A61H 3VGCC 1TRNA 3LOXA 3M3SA 4CRFA 1UTQA 1BRAA 2FTMA 2ESTE 1ZTJA 3TK9A 3SHCH 4K1SA 1UHBA 1O3CA 1NROH 1HAVB 5DP6A 1FLEE 2F9OA 1ZPZA 3P8OA 4A1TA 2XBYA 4K60A 4UE7H 2A5IA 5K7RA 2KAIA 3RDZA 4B75A 2C8XB 3QGJA 1C2JA 1QRWA 1SGNE 3VB7A 4Z6AH 2HVXA 1Z8IB 3E0NB 3QZQA 1GCDA 3TNSA 2WINI 1THRH 3SNDA 1SI5H 3BN9A 5FCKA 1UTJA 4I8LA 1EJNA 4I7YH 2XRCA 3C1KA 4ZMAH 2P93A 3U9AH 4CHAC 4TY7A 1YBWA 3SUFA 2VIDA 1S5SA 2VB0A 4KELA