3ODFA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. second step of radiation damage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
total genus 66
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3odfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3odfA01
1NRNH 2BVSH 3I77A 4Y10E 2TRMA 2XXLA 3S0NA 1MAYA 4AG2A 1IQNA 2BZ6H 1DS2E 1IQHA 3SO3A 3E90B 5FXLA 3RC6A 1CBWB 2ZA5A 1G30B 1HJ8A 1AFQC 4BANB 1BITA 2R3UA 2A4RA 3M3SA 3V13A 3OTJE 1PJPA 3A7ZA 1BUIA 2JH6D 4XE4A 1ZHPA 1K1JA 1UHBA 2AMQA 2BY6X 5SGAE 3D62A 3MNXA 2VVCA 2Z7FE 2PGQB 3BG4B 1GMDF 3O8DA 4TYDA 4AFQA 2IOTA 3A82A 2FOMB 1O3PB 2BYAX 3KHVA 5DP3A 1EKBB 3S9CA 2IJOB 1O2GH 1WU1A 4GHQA 3SW2B 4CRCA 3AASA 2VINA 1XKAC 3TH3H 1P3EA 2G5VA 4XBCA 2A5KA 1LHCH 4A1TA 4WXIA 2UUJB 3CS0A 1GI4A 3DFLA 1KXDA 1S6HA 1FY1A 1O2SA 1EAWA 2VIOA 3BEIB 1AKSA 2VH6A 3NUMA 1S6FA 4K3JA 1FXYA 5GDSH 1CQQA 1TQ0B 4Y7AA 1O3CA 2GGVB 5T6DA 1AVWA 1W0ZU 3RU4T 3E0NB 5FX6A 2W3IA 3PO1B 2C8ZB 3A8BA 1P12E 1LCYA 1P2MA 1V2WT 4GCHF 4DGJA 1ANBA 5LH8A 1GMCF 1TBRH 4FUFA 2P3TB 1C5NH 3RXBA 3TNSA 1DLEA 2ALVA 4ZUHA 1FMGA 1H9IE 2FTMA 4AZ2B 1JRSA 1MD7A 1XVMA 6GCHF 4WH8A 3P70B 1DUEA 3RXVA 1OXGA 1Z1IA 3UTUH 1BTXA 4U2WA 1G37A 3M5NA 1QRZA 1SHHB 3V7TA 1C2HA 1O30A 2SFAA 1BMAA 2YOLA 1DY9A 1DXPA 4K8YA 3SJKA 1HB0B 1A46H 1N6YA 1PPBH 4KTUA 5G4BA 4B2AA 1O3AA 4NA7A 4ESTE 1ELBA 3PWCA 1CGJE 1DT2A 2G81E 3VXFH 1GPZA 2ZHQH 4Y71A 3UWIA 1MMJN 1ANDA 3QLPH 2PHBA 2FLBH 4WVPE 4ZKOU 1C5RA 2XCFA 3Q3YA 1LQDB 3W94A 3KIDU 4BAHB 1V2JT 3GY5A 4IS5A 1O0DH 1AVGH 3Q77A 5E8EH 3OU0A 3UQVA 1GI2A 1TAWA 1YGCH 3AVZA 3UUZA 1EJAA 1QB9A 1GL0E 1Z8IB 2FOEA 2GP9B 1HJAC 2YNAA 4WMEA 2YNBA 1QJ6B 2FZZA 1ELCA 4BNRA 2BDGA 2BDAA 4D7FA 4JZEH 3T28A 4MNVA 4SGBE 3GCTF 1SGIB 2XC4A 1ZSKA 1ESBA 3BF6H 1FV9A 2G00A 3RDZA 4FUHA 4CRGA 2WYGA 5EW1H 1TFXA 2A1DB 1TPAE 1BB0B 1G9IE 2FOFA 1CGHA 1MTNC 4KGAA 1ZLRA 1C5OH 2ILNA 2EI6A 4IGDA 2BXUH 3BEUA 5JBBS 4FVBA 5ETXA 2BLWA 1WTHD 5C20A 3KN2A 1GJDB 1D6WA 1DM4B 1BTHH 2OINA 1YCPM 1ZRBA 2ODQA 3KQCA 3SUFA 1O2LA 3IWMA 1K2I1 5I25A 2HNTC 1GVKB 3GY7A 2JETB 1KIGH 1AHTH 1MQ5A 3SN8A 2DE9A 2I6SA 2PKAB 1C1SA 1Z6JH 2I6QA 1HYLA 4AOQA 3Q76A 4CRBA 1MBQA 3ZVAA 1O38A 1NRRH 2A0QB 2J95A 3A7VA 3S7HB 1GDQA 4GUXA 3RC4A 4HFPB 3STJA 5C5OA 2F9VA 1LVBA 3QGJA 2OBQA 5E0JA 1P9SA 2AS9A 3TGKE 1UHBB 3UQOA 2GCTB 1ZJDA 2WPLS 1NZQH 4X1QU 4GLYA 3FVFB 4IN2A 3RXSA 5GXPA 3PYHA 2ZZUH 1E34B 3SGAE 3TVJB 4AFZA 3ZZ5A 4CBOA 1C2JA 1MTWA 3OY5U 2PGBB 1PQ8A 3MH6A 1F92A 2A7CA 1P57B 1EATA 1LVOA 5L30H 4XFQA 2VIQA 5A09A 1DWBH 4OGXA 3RXCA 1GBTA 1HAXB 4DG4A 2P3FH 4NWLA 3RXFA 1IQMA 3A7WA 2ZU5A 2P59A 3IG6B 1UVUH 1CBWC 1GI9B 4UFGH 2BD2A 1Q31A 2ASUB 2QV1A 4D9RA 3RXDA 4BOHA 2Y7XA 4WH6A 4BAMB 1C1UH 2HPPH 4Y0YE 1YKTA 2JH0D 1O2HA 3HK3B 3OX7U 1ELEE 1W0YH 2VWOA 4YOIA 1CVWH 2VIVA 2ZTZA 2BDCA 1XUHA 3OSYA 1RFNA 1M9UA 3A86A 2F83A 3HK6B 1GVLA 2FTLE 3QK1A 1G36A 2FYRA 2VH0A 4A6LA 1O3BA 3RXAA 1H1BA 2FIRH 1K1PA 1KSNA 3VB5A 2VIWA 4ZXYH 1P01A 1PPCE 1S0RA 1C1MA 2P8OC 3VGCB 2WPMS 1V2LT 2C93B 5T6GA 3A81A 1C4U2 1VGCC 4MDSA 4X6OA 2ZFTA 2FPZA 3M5LA 3ZZ9A 2SGDE 1O37A 1MCVA 4CH2B 1VITH 5DP6A 2CXVA 1SGQE 1B7XB 1HNEE 1OKXA 3H7TA 4OS7A 1WQVH 3BTFE 4IBLH 2GDEH 2H9EH 1PQ7A 3KEEA 1FN6A 2ZEBA 4Z0KA 3R3GB 4O03A 3U8TH 1BHXF 3QTVH 1UTKA 4K2YA 1AE5A 1FY8E 1THSH 1O5GH 1Y5AT 3T2NA 1AB9C 4OS2A 2CF9H 1P11E 4NIYA 1QL9A 2B5TB 2GX4A 4UFEH 1KTTB 1T8LA 4ISNA 2BQ6B 2Y7ZA 2BOKA 5TJXA 2PUQH 3MNSA 3SV8A 4E7RG 1ZTKA 1C1WH 1ZHRA 2GDDA 3RXOA 1G32B 1DLKB 3SU5A 3P95A 3FANA 3K6ZA 1O35A 3LGVA 3MU4A 1IQLA 1GJCB 1D3PB 2BX4A 2BDBA 1TQ7B 4X8UH 5EQSA 1GBMA 3LPRA 3TJUA 2C8YB 1YPHE 2H1UA 1C2LA 1F0TA 4ABDA 4ZKSU 1O2ZA 2ZGHA 3ZYDA 2F9NA 1L1GA 4MNYA 1NROH 5HM2A 2GMTB 5C1UA 2G8TA 2BDYA 1ETSH 1TGCA 3U98H 2SGEE 2TGDA 1Z8RA 2BLQA 3VFEA 2PWXA 3ATKA 1T32A 1BQYA 3RU4D 1Z8JB 4NZLA 2J94A 1YLCA 1FY4A 2Y6TA 3LGUA 3QX5H 1H8IH 4YO9A 1DFPA 2BY9X 3SNEA 4TPIZ 1CT2E 1ZR0A 1G2LA 5DP8A 2FOAA 1P09A 1O32A 1OOKB 3A85A 1TRMA 2SGAA 5F6MA 5L2YH 1XKBC 1NO9H 4X8VH 4YOGA 2NU0E 4AGKA 2FYQA 1TB6H 3S69A 5EU8A 1BRCE 5DP7A 5LPRA 1ZPCA 4Q7YA 1HAHH 3BIVH 3PMAB 1FIWA 1O2NA 1TBQH 5TCCA 3GCTG 2PR3A 1YF4A 3LH1A 4NWKA 5AF9H 3CP7A 1GBHA 3UPEA 4H6SB 1DOJA 2O8MA 3A7XA 1CHOG 4WMDA 1GBCA 2QF0A 1NRQH 2BXTH 2ZHFH 4UDWH 2BMGB 3MYWA 1K9OE 3ELAH 1YPEH 5GPIB 4NFFA 1V2ST 2TPIZ 1DWDH 2F9PA 2OXSA 1O3NA 3RM2H 1J9CH 4X1NU 3TK9A 5E0GA 1VGCB 1YPLH 1Z7KA 4ISHH 3VGCC 1UMAH 4FXGH 3PMJA 3FP7E 3F9HA 2VIDA 1QGFA 1G3CA 3F9FA 3M37A 2A2XH 2PKSB 1A5IA 2G5NA 3GDSA 1MD8A 1QFKH 1JIRA 1HGTH 3RXGA 1D4PB 1MZDA 1NT1A 3E16B 1EB2A 4FUDA 1H4WA 2FI3E 5GCHF 4ABHA 2BVRH 1QB1A 1EOJA 1TABE 1O3KA 4U01A 1VR1H 5EODA 2ZTYA 1C2FA 3WY8A 1GJ5H 3PM3A 2WPIS 4E06H 2FI5E 1K1NA 1SPJA 1EPTC 4XBDA 4A7IB 2XC5A 3LC3A 5JYIA 1GHBG 1EJMA 1UVOA 1G2MA 1NFXA 1CO7E 2A4GA 3ZVDA 1J16A 2OC0A 3PMHB 3RC5A 1C4V2 3RXKA 2HRVA 3FFGA 1EOLA 1AFEH 1C1QA 1BJUA 1HCGA 2GZ8A 5GCHG 1RJXB 2ZPRA 3RXJA 3BV9B 3UFAA 3TGJE 1C1VH 2SGQE 2CN0H 1P02A 1C2EA 1RD3B 4BTIB 4CR9A 1BTUA 1ESTA 4JK5A 9LPRA 2FMJA 3E1XB 8ESTE 3BTWE 1KXAA 4YT6H 2Z3EA 5ESBA 4F49A 4X1RU 1TRYA 5BPEA 1ZOMA 2QXJA 5JBCS 3ATWA 2UWLA 2GCTC 3P6ZB 1T7CA 3DT0H 4Q80A 1N1LA 1TX7A 1ZMLA 3SGBE 3F68H 3GY2A 4UFFH 1XUIA 5A0CA 5T6FA 3EAJA 3UR6A 1Y3WA 1FIZA 1NU7B 2XBXA 1IQKA 1SLVB 1OWJA 1LTOA 4NIVA 2ZFRH 5EQRA 3OYPA 1SGPE 5TCAA 1LKAA 4AG1A 3CENA 1AU8A 2Q6GA 4OGYA 1YPGH 3O8BA 3F9EA 3L3TA 3RXMA 2V35A 1DWCH 3SV7A 1SSXA 1E35B 3PV4A 1O2YA 2QA9E 4JYVH 3MO6A 3RXLA 3SUDA 4FUCA 1O2KA 2ZGCA 1LVYA 1P3CA 5DP4A 1H9LB 1ESAA 5GIBA 1NRSH 5K0HA 1NY22 1OWKA 1A5HA 2AERH 5CE1A 1AO5A 5DK1A 3MH7A 1UCYH 3ZVGA 3M5OA 3TITA 3FAOA 2DE8A 4BXSA 1ZZZA 5T3HA 2FS9A 1C4Y2 2IPHA 1F5KU 3MNBA 2PTNA 1K21H 3O8RA 1HAPH 1VCQA 1FY5A 2D2DA 2GV7A 1BTZA 1QB6A 5CHAC 1BMNH 1ZJKA 4MQAA 5J4QA 1MCTA 1HRTH 3BTEE 5EGMA 4MVNA 3EYDA 1NU9A 2VGCB 2GVFA 2W3KA 3TLOA 3GOVB 1GGDB 1PPHE 2OQUA 2ZU2A 3A84A 1Y3XA 1PYTC 5EPNA 3Q3KA 1KXEA 1SMFE 3HPTB 4FU8A 1TMTH 2FO9A 4LK4A 1VCPA 1ZRKA 1BBRH 6LPRA 1W11U 1F0RA 2ZQ1A 4Y11E 2BD3A 2ZO3H 4HI3A 2DUCA 1W2KH 3SV9A 1SLXB 3KCGH 2V0BA 3LGTA 1VJAU 4Y76A 3QGNB 3ZZAA 1SGFA 1AZZA 3MO9A 2TGPZ 1S84A 2ZU3A 4DURA 5LGOA 1E38B 1O3IA 1HUTH 2FOGA 3UOUA 2GT8A 2BQ7B 3U1IB 3M3VA 1QY6A 1XUGA 4AYVB 4TY6A 2NU2E 3V3MA 3M3TA 5C5NA 2ZDMA 1WV7H 1J8AA 1PPGE 1FPCH 3GYMA 4GPGA 4RN6A 4B2BA 2GKVE 3TJVA 4YZUA 3M35A 2B0FA 3BG4C 3LH3A 3Q3XA 3DA9B 2PW8H 3GCOA 2ZP0H 3SHAH 1U6QA 3ENSB 4I8KA 1TPSA 1CT4E 2ZWLH 1ACBE 2AIQA 1F5RA 2UUYA 1QBOA 4X0WU 4MG3A 4Y6DA 3R0FA 1C5ZB 2ZFQH 1O34A 1NTPA 5C2ZA 1NRPH 2PSYA 2VU8E 1RRKA 3ZZDA 3L6PA 3E0PB 9ESTA 2J9NA 1AFQB 1EPTB 2F91A 2XYAA 5EQQA 4LZ1H 4K69A 2JH5D 1P2KA 1BBRE 1DANH 2TIOA 4KKDA 3MOCA 4UEHH 1OSSA 3VB7A 2UWOA 2ZGBH 1K1MA 3GISB 3UREA 1O3EA 1GCTB 1D3TB 3P8OA 4MPXA 8LPRA 1TE0A 1N8OB 3MU5A 1LMWB 1RIWB 1SQAA 1C9TA 1V2NT 1QTFA 1W7XH 3B9FH 5J4SA 1W7GH 2V3HH 1UVTH 1GMHG 3SU1A 1KLIH 1IOEA 3B8JA 3DD2H 2BVXH 2NWNA 2ZHEH 4AYYB 4YLUA 1Y8TA 1NN6A 5HYOA 5EG4A 1EQ9A 2BDIA 4JCNA 2C8WB 4E05H 2OTVA 1ZMJA 4I8GA 3M5MA 2AFQB 2ANKH 4X2WA 1IQGA 5PTPA 1EZUC 1CA0C 1O2VA 1AKSB 1QRXA 1TNKA 1SOZA 2ZG0H 3ZZ6A 1Q3XA 1EJNA 1GJAB 1GMCG 4NIWA 4O3UA 1O5EH 3AAUA 1EUFA 3ZV8A 5K7RA 3HKIB 1CGIE 1MAXA 4TWYA 2LPRA 1E0FD 1BDAA 4GHTA 3LGYA 1NFUA 1MUEB 2QAAA 1DE7H 1GBAA 3RU4E 1XXFA 1C5YB 1C5UA 1TPOA 1Z71A 2H5DA 2H9TH 4FU9A 1KY9A 1O2PA 1C5SA 3K2UA 3MHWU 3LONA 2OLGA 3S7KB 3QUMP 1A7SA 6ESTA 3RLWH 1ETTH 2FESH 3SV2H 2C8XB 2PV9B 4I31A 5JB8S 1C5QA 1C5LH 2SNWA 4CHAB 4YT7H 1UVPA 1L1JA 2O9QA 2ZGXH 1BZXE 1TNLA 1S5SA 3E6PH 1OPHB 3RXIA 3VEQB 3UNRA 1IQEA 4YOJA 2P94A 4SGAE 4X8SH 1PPZA 1AB9B 1HAYB 1BTYA 4TY7A 1QHRB 2PLXA 3HGNA 1DUAA 1O3OA 4RKJB 5LPFA 3QO6A 4X6MA 1GWAA 3P8GA 3D49H 2QN5T 1NFWA 4IMQA 3MNCA 1BTPA 1RTFB 1ARCA 1L2EA 4OS6A 4R8TB 4ZAEA 2ZCHP 1JIMA 1TGTA 5JB9S 1WTGH 3ZZBA 3S9BA 1GBJA 2STAE 1GI8B 5C67A 1OS8A 3T29A 3LU9B 2G55A 1JMOH 4ZKNU 3MTYA 4AB9A 3PLKA 1HBTH 2P8OB 1UCYK 1ORFA 2QY0B 4KTSA 4Y8YA 4K60A 5ABWA 1O3HA 1P9UA 1J15A 3EGKH 1O33A 1TOMH 4A5TS 2VJ1A 1GG6B 2Z9KA 4B73A 4I7YH 1ZMNA 2G4UA 1PYTD 4WF8A 4K5ZA 3QN7A 1A0HB 3P8NA 2Z3DA 1Y5BT 1GJ4H 4GCHG 2ZCKP 1UJ1A 1OWEA 3C1KA 1C1OA 1AWHB 1SB1H 5C1XA 3RP2A 3RLYH 1TYNA 1WSSH 1EXFA 2Q6DA 1CSOE 2A4QA 2AGIX 4I8JA 7GCHG 1X7AC 2ZU4A 2UUKB 2B8OH 6GCHG 1B0FA 1TNGA 1HAOH 3F6UH 4WY3A 2AGEX 3PMBB 3RUOA 6CHAB 1C2GA 1HJ9A 1O5BB 2FP7B 5A8XA 1GI0A 3MI4A 1LDTT 2AIPA 3C27B 1HAIH 1D6RA 4X8TH 3UWJH 4DW2U 1XX9A 1C1RA 1SGYE 2P3UB 1GCTC 2HWLB 3TNTA 2XC0A 1GJ6A 1GMDG 1SQOA 1F5LA 2ZECA 1V2KT 3GDVA 2NU1E 1H9HE 2WUCA 1KXCA 4K8BA 4AFUA 1O2WA 1GBKA 3NXPA 2WPHS 1GBFA 1V6DA 1FNIA 3SZNA 4Y8ZA 5A2MH 3RMMH 1RTLA 1BA8B 1YCPK 3SI3H 2B9LA 3KF2A 1AGJA 5A8YA 1XUJA 3BTTE 7LPRA 1NPMA 1IQIA 1UTQA 4U30A 1GHXH 1GHWH 5EPYA 2R2WU 2NU3E 2K1QA 1P05A 1HLTH 1DDJA 2C90B 2AGGX 1XUFA 2AMPA 2AH4X 1GL1A 1Z8GA 1VITF 4F4OC 4DIIH 1L4ZA 4QT8C 1WYKA 3SU6A 1K1LA 4GSOA 3VB6A 3LKWA 1MH0A 1Z6EA 5F8ZA 4LZ4B 1Y5UT 2PUXB 1KLJH 2BD4A 4ZHLU 4ZH8A 1SR5C 1O2OA 1GGDC 4LOYH 2TGTA 1NFYA 1WUNH 2SGFE 3ODDA 2Y82A 3HKJB 3TIUA 1A0JA 4O9VA 1TALA 1ABJH 1TPPA 1UCYE 1YP9A 1C5MD 2STBE 1SFQB 1L4DA 3DHKH 5CHAB 2BOHB 5L2ZH 3SOSA 1BIOA 1C2KA 5IDKA 1TX6A 1UTLM 4ABFA 1MBMA 1GHVH 4FVDA 1P2NA 1C1PA 1GMHF 2HLCA 2OP9A 4ABIA 2O8UA 2XBYA 3BTDE 3ZVCA 5I46H 1E37B 2HALA 1CT0E 1HJAB 1ZSLA 1O3FA 2Q6FA 1A3EH 4NA9H 1K1IA 3A7YA 1ABIH 2FXRA 3PLPA 4XSKU 3SU2A 2VIPA 1FAXA 4JK6A 1DXWA 1QL7A 2QCYA 4NCYA 2J92A 1FY3A 1ZPBA 2VGCC 4ISLA 2QYIA 2Y5FA 4UD9H 1W14U 2ANWA 4B74A 1MTNB 3M36A 1P06A 4Q2KA 3BTHE 1K1OA 3LGWA 1O5FH 4XBBA 3ZZ7A 1C5WB 2UWPA 2VB0A 3I29A 2QGRA 1C1TA 1DY8A 2R3YA 5B6OA 1V2MT 1GI1A 1O3JA 1QCPA 2H6MA 4B2CA 1ID5H 3JZ1B 4CH8B 2FDAA 3K65B 3NCLA 2PKAA 2J38A 2ZDNA 1Y59T 2VWMA 3UOPA 1EX3A 2LNCA 1O5AB 1CA8B 1EASA 1P2OA 1O2IA 2J34A 1ZYOA 2CV3A 5A0AE 4FUBA 1OP0A 5FPYA 1SG8B 2BD8A 2HPQH 2BY8X 5C3NA 4MPVA 2PFEA 1QQUA 4WXVA 2V3OH 1Y3UA 4Y8XA 4A1XA 3QZRA 2CGAA 1K22H 2FOHA 2XRCA 2GTBA 3P92A 4IC6A 3TK6A 1KYNA 1GI7B 2W5EA 3TJNA 1UK2A 2ZF0H 3SBKA 2P93A 3FP8E 1CE5A 1QA7A 1HDTH 1VJ9U 4D9QA 1XVOA 2BLVA 4MNXA 1MTUA 3E91A 1VITG 3NWUA 4FUEA 1EB1H 2OD3B 1SGDE 1OWIA 5FCKA 1VZQH 2FOCA 4FUGA 5FAHA 7ESTE 1THRH 1D3DB 1QNJA 5DO4H 2BD5A 3NPSA 1HIAB 4OS5A 1YPJH 1GHZA 3H7OA 3TPIZ 1OYQA 3O8CA 2G4TA 2OCVB 4UE7H 1W3CA 4NSVA 3ZVBA 3NKKA 4H42U 2HOBA 2R0KA 1W10U 1DSTA 4IC5A 2A7HA 4UFDH 4THNH 3PWBA 4X1SU 5L6NH 1AUTC 1PPEE 1IQJA 1EAUA 1O3LA 4OS4A 4Y79A 4Y7BA 1GJ7B 4A1VA 2F9BH 4BAQB 3EA7A 2ZPSA 4RKOB 1FAKH 2ZFFH 3KQEA 2HVXA 2A31A 1YPKH 4H6TA 1LHGH 1TGSZ 1L1NA 2VWNA 1A0LA 3SU3A 1XM1A 2OC8A 1LPKB 3JZ2B 4BTUB 1K28D 4D76A 1G3BA 3SU0A 1UO6A 3MO3A 4JYUH 1C5XB 2GCHF 3KQBA 4FUJA 2F3CE 3U8RH 2RG3A 1HXFH 1ZGVA 1BT7A 1WQSA 2QC2A 5A0BA 8GCHG 1Z1JA 2A5IA 1DSUA 4MLFB 1TGNA 1O5CB 4WMFA 1WBGB 4KTCA 3SORA 1UK4A 3NK8A 4AORA 5AHGH 1ETRH 3W95A 7KMEH 1ELTA 2WV5A 4I32A 1P03A 1YPMH 2CMYA 1THPB 1T4UH 1RS0A 2A2QH 1P04A 1O5DH 3A80A 4NSYA 5HM9A 5JBAS 1S82A 4ASHA 1T31A 3S9AA 3V12A 1GBBA 3SUGA 3HATH 1J17T 1P2IA 4MTBA 3ZV9A 1DX5M 3UY9A 3ESTA 2A7JA 2TGAA 1SBWA 1V2RT 4H4FA 1YC0A 1OP2A 2Z94A 1O3DA 1ZTJA 1EZQA 1SQTA 3VB4A 2FWWA 1AZ8A 2ZIQH 3EA8A 1GI5A 3A8DA 3QDZB 4YESB 5DP5A 1MZAA 1BBRK 2ZFPH 1O2UA 4I8HA 1GI6A 1NM6A 3A83A 1ANCA 3LC5A 5DKMA 4BXWA 1SLUB 1AMHA 3KNXA 1SGEE 1UTOA 3T26A 3G01A 2ZHWH 1AD8H 2B7DH 3SHCH 2AMDA 1VCWA 5EXMA 3F9GA 2GMTC 5EOKA 1G3DA 1UTMA 4DY7B 2AEIH 3ZZ8A 1ELFA 3SU4A 5DP9A 1AVXA 2WUBA 2OC1A 2F9UA 5H4IB 2BD9A 3A8CA 3MH4A 4IMZA 4Q7XA 3PB1E 2Y80A 3GDUA 1IHSH 1OP8A 1EP5A 2GZ9A 2FS8A 1SOTA 2G51A 4XOJA 1O36A 5EW2H 3GYLB 1CA0B 1GHAG 1H8DH 2XNIA 2BLOA 1HAGE 1TNHA 3MU1A 1GCDA 1KLTA 4ZROA 1V3XA 1XXDA 3ZVFA 1WCZA 1FJSA 1S81A 1YPHC 3H5CB 1HAZB 2OUAA 3CS7A 5F03A 4AFSA 4CRAA 2EA3A 2PSXA 4Z6AH 3SQEE 1UTNA 2GT7A 1W8BH 3FZDA 3MU8A 1E36B 2HNTF 5F8XA 1MKXH 1SVPA 2VVUA 1QA0A 3E8LA 2A5AA 3UNSA 1AIXH 1EPTA 5EXNA 4IN1A 3LOXA 3DFJA 3EA9A 1MTVA 3ATIA 1RIWC 3OY6U 1TONA 2QF3A 4CREA 3ODFA 3ZZCA 2Z9GA 3PLBA 1AUJA 2BY5X 1V2PT 1FDPA 1V2OT 4NA8A 3SV6A 5E2OA 3A8AA 1SI5H 1F0SA 3SNCA 2OQ5A 4X2YA 1NS3A 1W13U 1AWFH 1HIAA 1T8NA 3D23A 4IW4E 3BSQA 4JZFH 4CRFA 1OX1A 3EQ0H 5LPEA 4D8NA 4ZKRU 1BRBE 1P2QA 3GY3A 5DGJA 2VWLA 1KDQA 1UTJA 1LPZB 3HGPA 1PQAA 3DUXH 2TBSA 2VNTA 2Y5HA 4FUIA 2P95A 3P8FA 1D9IA 4AX9H 2CJIA 1G3EA 2BM2A 2R9PA 5AFYH 1NESE 1CHOF 1QJ1B 4B75A 2PTCE 4DJZB 1O2JA 1TGBA 1V2VT 3ZYEA 1FI8A 1J14A 2CHAC 2V6NA 1BJVA 1SL3A 2XWBI 1S85A 2WPKS 2Y5GA 5ESTE 1MU6B 1N8OC 3GICB 1XMNB 2QXIA 3ZZ3A 1Y3YA 2ZI2H 4ISOA 4CR5A 3F1SB 4MNWA 4UONA 5FHTA 1WOFA 1QBVH 1V2QT 1TNIA 2SGPE 3BTGE 1MKWK 4DIHH 3GCHB 1S83A 3AW0A 1KDQB 3FP6E 2C3SA 4NFEA 3BG8A 2ZCLP 1T8OA 1GJ9B 1GI3A 4J1YA 3V0XA 1GJBB 3KGPA 2F9OA 3RMNH 3TJOA 3U69H 5DJ7A 1EAXA 3P17H 4JMYA 5IYTA 4X1PU 1SC8U 2ANYA 4WJG2 3BTKE 3A87A 4KELA 5JPMH 5FPSA 3PTNA 2ZC9H 1IHTH 2JETC 2ZU1A 2XWAA 3PROA 2GZ7A 1QQ4A 4MPWA 3VPKA 1C5PA 3SQHE 1ZGIA 1P8VC 2P16A 5A8ZA 2KAIA 3A88A 1DWEH 3TK5A 2GCHG 1OYTH 5DG6A 8KME2 2A45B 2GV6A 1CHGA 1W12U 3IITA 4TPYA 1QURH 1FUJA 2VVVA 3EE0B 2EC9H 3RXEA 3LDXH 1O2XA 1O3MA 2THFB 2BTCE 1TLDA 2XCNA 2ZNKH 4X2VA 3A7TA 4NG9H 4DOQA 1SGTA 1BRUP 1C2DA 3QWCH 1IAUA 1P2JA 3LJJA 2ZQ2A 3UR9A 2FLRH 4FU7A 4K1SA 3LJOA 2FX6A 2J2UA 3BEFB 1B0EA 4ZHMU 2FEQH 1RXPA 4E7NA 3QZQA 5GJ4B 2ODYB 4DVAU 1O31A 1GHBF 1ANEA 2Z9JA 4BTTB 4U32A 4XDEA 1SGNE 1T4VH 1C9PA 2OBOA 3TH4H 3EDXB 2Z3CA 1FZZA 2ZGJA 1WAYB 3M7QA 2ZPQA 1TX8A 4NGAH 3SJ8A 3ATLA 5FBIA 2W26A 3N7OA 2RA3A 3BTME 3M7UA 2ZKSA 1HV7A 2ZDAH 1BMMH 2O8TA 2R2MB 2D8WA 4DT7B 1SGFG 4ABAA 3PTBA 3RMOH 4BAKB 2QIQA 4ABJA 3RXRA 4I33A 4NIXA 1HAVB 1V2TT 1BCUH 5FPTA 1LHDH 3A89A 4J2YB 4X6NA 1SGCA 1JWTA 1V2UT 2RDLA 5F8TA 1F7ZA 2BDHA 4HTCH 1O2MA 2J4IA 1C2IA 1O3GA 3FZZA 3SNAA 5GWZA 1GJ8B 1AN1E 3VXEH 1DPOA 2BD7A 3KL6A 2AYWA 4I8LA 3UIRA 3SGQE 4JYTA 4ZHAA 3URDA 2HGTH 1Y3VA 2CF8H 2ZFSA 3UNQA 4JZ1A 2BQWB 2EEKA 3K9XB 3MFJA 3D65E 7GCHF 2BHGA 1O2TA 1MKWH 4K1TA 4GAWA 1GBIA 1ZHMA 3MMGA 1ZTLA 2ZDKA 4LXBH 1RGQA 2ULLA 1JOUB 3GCHC 1BHXB 3ZZ4A 3L33A 8GCHF 1QIXB 3RXPA 1GVZA 1PPFE 5FBEA 3AW1A 4ZXXH 3RMLH 4O3TA 2O8WA 2D1JA 1JXPA 2BY7X 4B71A 1QL8A 4YTAA 3RXTA 4ABGA 3B23B 1DICA 1S0QA 3T5FH 2ESTE 1IQFA 2O8LA 3MWIU 1LQEA 4Q7ZA 1OWDA 1GBEA 3GY6A 2ZTXA 3PO1C 1PFXC 3RXUA 2PKSC 2WV4A 3RXHA 4K1EA 1TA6A 1TRNA 2BX3A 5DPAA 5E2PA 3BIUH 4YM9A 1BMLA 2FOBA 4ABEA 1QJ7B 3TU7H 3U8OH 1HPGA 3E3TA 1C5TA 2G52A 1UVSH 2ZHDA 3URCA 5EXLA 1SLWB 1YCPH 1QBNA 1A3BH 4B76A 2H2ZA 2EI8A 1D3QB 1BTWA 4INLA 4YLQH 1FN8A 1ELVA 1XUKA 1DVAH 1KXBA 1ELDE 1ZSJA 3ZVEA 3LIWA 2CHAB 1GG6C 4A92A 4OS1A 2KAIB 1BOQA 1TIOA 2XTTB 5HMAA 6CHAC 4VGCC 3I78A 1C1NA 2BB4A 1ZPZA 3T25A 4X2XA 1EP6A 1BRAA 3LT3A 1HFDA 3RXQA 2Y81A 2W7UA 4B1TA 2JKHA 1A5GH 1TOCB 4INKA 2XBVA 4X6PA 5BRRE 1QRWA 5AVDA 3TH2H 2ZDLA 4HZHA 4ABBA 5HGGA 2M5TA 1LKBA 2H5CA 2QXHA 4KP0A 3Q00A 1L0ZA 3BTQE 2OC7A 2XBWA 4M7GA 3NZIA 1FONA 2FX4A 1YLDA 1UK3A 1GHYH 1QR3E 4DCDA 3GY8A 1LVMA 5HXFA 5JBTA 1AQ7A 4ISIH 4CRDA 5E0HA 3AAVA 1JBUH 1DITH 4GVUA 3K6YA 1CU1A 1YYY1 2SNVA 4AN7A 4D7GA 1TWXB 4TWWA 4AB8A 1HXEH 1B5GH 3U1JB 3M7TA 1C5VA 1MKXK 2RA0A 4CBNA 1FQ3A 1GDNA 2FODA 1AI8H 1PQ5A 1YBWA 2NU4E 3RM0H 3MH5A 1T8MA 3VB3A 1KXFA 1SFIA 1F0UA 1EZSC 2QXGA 2GD4B 2Z9LA 2ANMH 2D26C 1GBDA 1YM0A 3M61U 4ZMAH 2WPJS 1A4WH 1INCA 1P0SH 1GBLA 1O2RA 2ODPA 2Z6BD 1SHYA 1TMUH 4JZIA 2Z9IA 1HAVA 2WINI 3TGIE 1ARBA 1A61H 1LHFH 4WWYA 3SNDA 3T27A 1FPHH 2A4OA 2ZDVH 3LGIA 2BZAA 1OWHA 1LHEH 3SI4H 4INHA 2IN2A 1EZXC 1UTPA 1LO6A 3MU0A 3SJOA 2XW9A 1A1RA 1SGRE 2UUFB 4MPUA 1A2CH 1TNJA 4CHAC 4JZDH 3SUEA 2A32A 1GHAF 1ELGA 3ITIA 3QTOH 5FCRA 3STIA 3U9AH 2R0LA 2W7SA 2ALPA 1LPGB 5C1YA 3GCNA 3SJIA 2FI4E 5FX5A 1C2MA 1FLEE 5CMXH 1TMBH 4R0IA 4HGCA 1F2SE 1MU8B 4O97A 2RCEA 1ELAA 1MQ6A 1NC6A 1JRTA 2HNTE 3ATMA 3SJ9A 1TA2A 1MTSA 2FM2A 1N6XA 2EI7A 1RTKA 2Q1JA 1Q2WA 2WYJA 3KQDA 3GY4A 1KTSB 4BAOB 5JDUB 4RSPA 4VGCB 1AE8H 1TBZH 2C4FH 4Y0ZE 4NZQA 3BN9A 1O39A 3T62A 5AFZH 1GDUA 1EAIA 4AGJA 4PROA 1AY6H 1P10A 2H9HA 3SNBA 1O2QA
chains in the Genus database with same CATH superfamily
1NRNH 2BVSH 3I77A 4Y10E 2TRMA 2XXLA 3S0NA 1MAYA 4AG2A 1IQNA 2BZ6H 1DS2E 1IQHA 1NBME 3SO3A 3E90B 5FXLA 3RC6A 1CBWB 2ZA5A 1G30B 1HJ8A 1AFQC 4BANB 1BITA 2R3UA 2A4RA 3M3SA 3V13A 3OTJE 1PJPA 3U28C 3A7ZA 1BUIA 2JH6D 4XE4A 1ZHPA 1K1JA 1UHBA 5GNDA 2AMQA 2BY6X 5SGAE 3D62A 3MNXA 2VVCA 2Z7FE 2PGQB 3BG4B 1GMDF 3O8DA 4TYDA 4AFQA 2IOTA 3A82A 2FOMB 1O3PB 2BYAX 3KHVA 3N7EA 1EKBB 5DP3A 3S9CA 2IJOB 1O2GH 1WU1A 4GHQA 3SW2B 4CRCA 3AASA 2VINA 1XKAC 3TH3H 1P3EA 2G5VA 4XBCA 2A5KA 1LHCH 4A1TA 4WXIA 4RI0A 2UUJB 3CS0A 1GI4A 3DFLA 1KXDA 1S6HA 1FY1A 1O2SA 3UAIC 1EAWA 2VIOA 3BEIB 1AKSA 2VH6A 3NUMA 1S6FA 4K3JA 1FXYA 5GDSH 1CQQA 1TQ0B 4Y7AA 1O3CA 2GGVB 5T6DA 1AVWA 1W0ZU 3RU4T 3E0NB 5FX6A 2W3IA 3PO1B 2C8ZB 3A8BA 1P12E 1LCYA 1P2MA 1V2WT 4GCHF 3SYJA 4DGJA 1ANBA 5LH8A 1GMCF 1TBRH 4FUFA 2P3TB 1C5NH 3RXBA 3TNSA 1DLEA 2ALVA 4ZUHA 1FMGA 1H9IE 2FTMA 4AZ2B 5C0TA 1JRSA 3DSPA 1MD7A 1XVMA 6GCHF 4WH8A 3P70B 1DUEA 3RXVA 1OXGA 1Z1IA 3UTUH 1BTXA 4U2WA 1G37A 3M5NA 1QRZA 1SHHB 3V7TA 1C2HA 1O30A 2SFAA 1BMAA 2YOLA 1DY9A 1DXPA 4K8YA 3SJKA 1HB0B 1A46H 1N6YA 1PPBH 4KTUA 5G4BA 4B2AA 1O3AA 4NA7A 4ESTE 1ELBA 3PWCA 1CGJE 1DT2A 2G81E 3VXFH 1GPZA 2ZHQH 4Y71A 3UWIA 1MMJN 1ANDA 3QLPH 2PHBA 2FLBH 4WVPE 4ZKOU 1C5RA 2XCFA 3Q3YA 1LQDB 3W94A 3KIDU 4BAHB 1V2JT 3GY5A 4IS5A 1O0DH 1AVGH 3Q77A 5E8EH 3UB0A 3OU0A 3UQVA 1K0HA 1GI2A 1TAWA 1YGCH 3AVZA 3UUZA 1EJAA 1QB9A 1GL0E 1Z8IB 2FOEA 2GP9B 1HJAC 2YNAA 4WMEA 2YNBA 1QJ6B 2FZZA 1ELCA 4BNRA 3F2HA 2BDGA 2BDAA 4D7FA 4JZEH 3T28A 4MNVA 4SGBE 3GCTF 1SGIB 2XC4A 1ZSKA 1ESBA 3BF6H 1FV9A 2G00A 3RDZA 4FUHA 4CRGA 2WYGA 5EW1H 1TFXA 2A1DB 1TPAE 1BB0B 1G9IE 2FOFA 1CGHA 1MTNC 4KGAA 1ZLRA 1C5OH 2ILNA 2EI6A 4IGDA 2BXUH 3BEUA 5JBBS 4FVBA 5ETXA 4ACAA 2BLWA 1WTHD 5C20A 3KN2A 1GJDB 1D6WA 1DM4B 1BTHH 2OINA 1YCPM 1ZRBA 2ODQA 3KQCA 3SUFA 1O2LA 3IWMA 1K2I1 5I25A 2HNTC 1GVKB 3GY7A 2JETB 1KIGH 1AHTH 1SKYE 1MQ5A 3SN8A 2DE9A 2I6SA 2PKAB 1C1SA 1Z6JH 2I6QA 1HYLA 4AOQA 3Q76A 4CRBA 1MBQA 1VKYA 3ZVAA 1O38A 1NRRH 2A0QB 2J95A 3A7VA 3S7HB 1GDQA 4GUXA 3RC4A 4HFPB 3F3BA 3STJA 5C5OA 2F9VA 2J98A 1LVBA 3QGJA 2OBQA 5CDFE 5E0JA 1P9SA 2AS9A 3TGKE 1UHBB 3UQOA 2GCTB 1ZJDA 2WPLS 3PRDA 1NZQH 2KFWA 4X1QU 4GLYA 3FVFB 4IN2A 3RXSA 5GXPA 4F48B 3PYHA 2ZZUH 1E34B 3SGAE 3TVJB 4AFZA 3ZZ5A 4CBOA 1C2JA 1MTWA 2M2AA 3OY5U 2PGBB 1S6LA 1PQ8A 3MH6A 1F92A 2A7CA 1P57B 1EATA 1LVOA 5L30H 4XFQA 2VIQA 5A09A 1DWBH 4OGXA 3RXCA 1GBTA 1HAXB 3KYGA 4DG4A 2P3FH 4NWLA 3RXFA 1IQMA 3A7WA 2ZU5A 2P59A 1EFRD 3IG6B 1UVUH 1CBWC 1GI9B 4UFGH 2BD2A 1Q31A 2ASUB 2QV1A 4D9RA 3RXDA 1WXRA 4BOHA 2Y7XA 4P02A 4WH6A 4BAMB 1C1UH 2L74A 2RFKC 2HPPH 4Y0YE 1YKTA 2JH0D 1O2HA 3HK3B 3OX7U 1ELEE 1W0YH 2VWOA 4YOIA 1CVWH 2VIVA 2ZTZA 1W0JD 2BDCA 1XUHA 3OSYA 1RFNA 1M9UA 3A86A 2F83A 3HK6B 1GVLA 2FTLE 3QK1A 1G36A 2FYRA 2VH0A 4A6LA 1O3BA 3RXAA 1H1BA 2FIRH 1K1PA 1KSNA 1COWD 3VB5A 2VIWA 4ZXYH 1P01A 1PPCE 1S0RA 1C1MA 2P8OC 3VGCB 2WPMS 5C94A 1V2LT 2C93B 5T6GA 3A81A 1C4U2 1VGCC 4MDSA 4X6OA 2ZFTA 2FPZA 3M5LA 3ZZ9A 2SGDE 1O37A 1MCVA 4CH2B 1VITH 5DP6A 2CXVA 1SGQE 5KEDA 1B7XB 1HNEE 1OKXA 3H7TA 4OS7A 1WQVH 2CK3D 3BTFE 4IBLH 2GDEH 2H9EH 1PQ7A 3KEEA 1FN6A 2ZEBA 4Z0KA 3R3GB 4O03A 3U8TH 1BHXF 3QTVH 1UTKA 4K2YA 1AE5A 1FY8E 1THSH 1O5GH 1Y5AT 3T2NA 1AB9C 4OS2A 2CF9H 1P11E 4NIYA 1QL9A 2B5TB 2GX4A 4UFEH 4ASUD 1KTTB 1T8LA 4ISNA 2BQ6B 2Y7ZA 2BOKA 5TJXA 2PUQH 3MNSA 3SV8A 4E7RG 1ZTKA 1C1WH 1ZHRA 2GDDA 3RXOA 1G32B 1DLKB 3SU5A 3P95A 1YLNA 3FANA 3K6ZA 1O35A 3LGVA 3MU4A 1IQLA 1GJCB 1D3PB 2BX4A 2BDBA 1TQ7B 4X8UH 5EQSA 1GBMA 3LPRA 3TJUA 2C8YB 1YPHE 2H1UA 1C2LA 1F0TA 2KZ4A 4ZKSU 4ABDA 3WWFA 1O2ZA 2ZGHA 3ZYDA 2F9NA 1L1GA 2KM0A 4MNYA 1NROH 2J97A 5HM2A 2QF5A 2GMTB 5C1UA 2G8TA 2BDYA 1ETSH 1TGCA 3U98H 2SGEE 2TGDA 1NBMD 1Z8RA 2BLQA 3VFEA 2PWXA 3ATKA 1T32A 1BQYA 3RU4D 1Z8JB 4NZLA 2J94A 2YMSB 1YLCA 1FY4A 2Y6TA 3LGUA 3QX5H 1H8IH 4YO9A 1DFPA 2BY9X 3SNEA 4TPIZ 1CT2E 1ZR0A 1G2LA 5DP8A 2FOAA 1P09A 1O32A 1OOKB 3A85A 1TRMA 2SGAA 5F6MA 5L2YH 1XKBC 1NO9H 4X8VH 4YOGA 2NU0E 4AGKA 2FYQA 1TB6H 3S69A 5EU8A 1BRCE 5DP7A 5LPRA 1ZPCA 4Q7YA 1HAHH 3BIVH 3PMAB 1FIWA 1O2NA 1TBQH 5TCCA 3GCTG 2PR3A 1UW7A 1YF4A 3LH1A 4NWKA 5AF9H 3CP7A 1GBHA 3UPEA 4H6SB 1DOJA 2O8MA 3A7XA 1CHOG 4WMDA 1GBCA 2QF0A 1NRQH 2BXTH 2ZHFH 4UDWH 2BMGB 3MYWA 4Q63A 1K9OE 3ELAH 1YPEH 5GPIB 4NFFA 1V2ST 2TPIZ 1DWDH 2F9PA 2OXSA 1O3NA 3RM2H 1J9CH 4X1NU 3TK9A 5E0GA 1VGCB 1YPLH 1Z7KA 4ISHH 3VGCC 1UMAH 4FXGH 3PMJA 3FP7E 3F9HA 2VIDA 1QGFA 1G3CA 3F9FA 3M37A 2A2XH 2PKSB 1A5IA 2G5NA 3GDSA 1MD8A 1QFKH 1JIRA 1HGTH 3RXGA 1D4PB 2W6JD 1MZDA 1NT1A 3E16B 1EB2A 4FUDA 1H4WA 2FI3E 5GCHF 4ABHA 2BVRH 1QB1A 1EOJA 1TABE 1O3KA 4U01A 1VR1H 5EODA 2ZTYA 1C2FA 3WY8A 1GJ5H 3PM3A 2WPIS 4E06H 2FI5E 1K1NA 1SPJA 1EPTC 2LP6A 4XBDA 4A7IB 2XC5A 3LC3A 5JYIA 1GHBG 1EJMA 1UVOA 1G2MA 1NFXA 1CO7E 2A4GA 3ZVDA 1J16A 2OC0A 3PMHB 3RC5A 1C4V2 3RXKA 2HRVA 3FFGA 1EOLA 1AFEH 1C1QA 1BJUA 1HCGA 2GZ8A 5GCHG 1RJXB 1OHHD 2ZPRA 3RXJA 3BV9B 3UFAA 3TGJE 5HIYA 1C1VH 2SGQE 2CN0H 1P02A 1C2EA 1RD3B 3FKSD 4BTIB 4CR9A 1BTUA 1ESTA 4JK5A 9LPRA 2FMJA 3E1XB 8ESTE 1E79D 3BTWE 1KXAA 4YT6H 2Z3EA 5ESBA 4F49A 4X1RU 2K0QA 1TRYA 5BPEA 1ZOMA 2QXJA 5JBCS 3ATWA 2UWLA 2GCTC 3P6ZB 1T7CA 3DT0H 3VG8A 4Q80A 5F53A 1N1LA 1TX7A 1ZMLA 3SGBE 3F68H 3GY2A 4UFFH 1XUIA 5A0CA 5T6FA 3EAJA 3UR6A 1Y3WA 1FIZA 1NU7B 2XBXA 1IQKA 1SLVB 1OWJA 1LTOA 4NIVA 2ZFRH 5EQRA 3OYPA 1SGPE 5TCAA 1LKAA 4AG1A 3CENA 1AU8A 4HG6A 2Q6GA 3N99A 4OGYA 1YPGH 3O8BA 3F9EA 3L3TA 3RXMA 1DWCH 2V35A 3SV7A 1SSXA 1E35B 3PV4A 1O2YA 2QA9E 3F2FA 4JYVH 3MO6A 3RXLA 3SUDA 4FUCA 1O2KA 2ZGCA 1LVYA 2JJ1D 1P3CA 5DP4A 1H9LB 1ESAA 5GIBA 1NRSH 5K0HA 1NY22 1OWKA 1A5HA 2AERH 5EIYA 5CE1A 1AO5A 5DK1A 5EJ1A 3MH7A 1UCYH 3ZVGA 2HVYB 3M5OA 3TITA 3FAOA 2DE8A 4BXSA 1ZZZA 5T3HA 2FS9A 1C4Y2 2IPHA 1F5KU 3MNBA 2PTNA 1K21H 3O8RA 4M9FA 1HAPH 1VCQA 1FY5A 2D2DA 2GV7A 1BTZA 1QB6A 3OEHD 5CHAC 1BMNH 1ZJKA 4MQAA 5J4QA 4ACBA 1MCTA 1HRTH 3BTEE 5EGMA 4MVNA 3EYDA 1NU9A 2VGCB 2GVFA 2W3KA 3TLOA 3GOVB 1GGDB 1PPHE 2OQUA 2ZU2A 3A84A 4AC9A 1Y3XA 1PYTC 5EPNA 3Q3KA 1KXEA 2LELA 1SMFE 3HPTB 4FU8A 2QF4A 1TMTH 2FO9A 4LK4A 1VCPA 1ZRKA 1BBRH 6LPRA 1W11U 1F0RA 2ZQ1A 4Y11E 2BD3A 2ZO3H 4HI3A 2DUCA 1W2KH 3SV9A 1SLXB 3KCGH 2V0BA 3LGTA 1VJAU 4Y76A 3QGNB 3ZZAA 1SGFA 1AZZA 3MO9A 2TGPZ 1S84A 2ZU3A 4DURA 5LGOA 1E38B 1O3IA 1HUTH 2FOGA 3UOUA 2GT8A 2BQ7B 3U1IB 3M3VA 1QY6A 1XUGA 4AYVB 4TY6A 2NU2E 3V3MA 3M3TA 5C5NA 2ZDMA 1WV7H 1J8AA 1PPGE 1FPCH 3GYMA 4GPGA 3DCLA 4RN6A 4B2BA 2GKVE 3TJVA 4YZUA 3M35A 2B0FA 3BG4C 3LH3A 3Q3XA 3DA9B 2PW8H 3GCOA 2VBCA 2ZP0H 3SHAH 1U6QA 3ENSB 4I8KA 1TPSA 1CT4E 4FETA 2ZWLH 1ACBE 2AIQA 1F5RA 2UUYA 1QBOA 4X0WU 4MG3A 4Y6DA 3R0FA 1C5ZB 2ZFQH 1O34A 2J5UA 4Q4LA 1NTPA 5C2ZA 1NRPH 1BMFD 2PSYA 2VU8E 1RRKA 3ZZDA 3L6PA 3E0PB 9ESTA 2J9NA 1AFQB 1EPTB 2F91A 2XYAA 5EQQA 4LZ1H 4K69A 2JH5D 1P2KA 1BBRE 1DANH 2TIOA 4KKDA 2V7QD 3MOCA 4UEHH 1OSSA 3VB7A 2UWOA 2ZGBH 1K1MA 1QZ8A 3GISB 3UREA 1O3EA 1GCTB 1D3TB 2KCAA 3P8OA 4MPXA 8LPRA 1TE0A 1N8OB 3CNRA 3MU5A 1LMWB 1RIWB 3OE7D 1SQAA 1C9TA 1V2NT 1QTFA 1W7XH 3B9FH 5J4SA 1W7GH 2PP6A 2V3HH 1UVTH 1GMHG 3SU1A 1KLIH 3KQ5A 1E1RD 1IOEA 3B8JA 3DD2H 2BVXH 2NWNA 2ZHEH 4AYYB 4YLUA 1Y8TA 1NN6A 5HYOA 5EG4A 1EQ9A 2BDIA 4JCNA 2C8WB 4E05H 2OTVA 1ZMJA 4I8GA 3M5MA 2AFQB 2ANKH 4X2WA 2YMSC 2XOKD 2QE7D 1IQGA 5PTPA 1EZUC 1CA0C 1O2VA 1AKSB 1QRXA 1TNKA 1SOZA 2ZG0H 3ZZ6A 1Q3XA 1EJNA 1GJAB 1GMCG 4NIWA 4O3UA 1O5EH 3AAUA 1EUFA 3ZV8A 5K7RA 3HKIB 1CGIE 1MAXA 4TWYA 2LPRA 1E0FD 3MQKC 1BDAA 4GHTA 3LGYA 1NFUA 1MUEB 2QAAA 1DE7H 1GBAA 3RU4E 1XXFA 1C5YB 1C5UA 1TPOA 1Z71A 2H5DA 2H9TH 4FU9A 1KY9A 1O2PA 1C5SA 3K2UA 3MHWU 3LONA 2OLGA 3S7KB 3QUMP 1A7SA 6ESTA 3RLWH 1ETTH 2FESH 2L6OA 3SV2H 2C8XB 2PV9B 4I31A 5JB8S 1C5QA 2SNWA 1C5LH 4CHAB 4YT7H 1UVPA 4B6FA 1L1JA 2O9QA 2ZGXH 1BZXE 1TNLA 1S5SA 3E6PH 1OPHB 3RXIA 3VEQB 3UNRA 1IQEA 3DSGA 4YOJA 2P94A 4SGAE 4X8SH 1PPZA 1AB9B 1HAYB 1BTYA 4TY7A 1QHRB 2PLXA 3HGNA 1DUAA 1O3OA 4RKJB 5LPFA 3QO6A 4X6MA 1GWAA 3GS9A 3P8GA 3D49H 2QN5T 1NFWA 4IMQA 3MNCA 1BTPA 1RTFB 1ARCA 1L2EA 4OS6A 4R8TB 4ZAEA 2ZCHP 1JIMA 1TGTA 5JB9S 1WTGH 4I86A 3ZZBA 3S9BA 1GBJA 2STAE 1GI8B 5C67A 1OS8A 3H09A 3T29A 3LU9B 2G55A 1JMOH 4ZKNU 3MTYA 4AB9A 3PLKA 1HBTH 2P8OB 1UCYK 2AHME 1ORFA 2QY0B 4KTSA 4Y8YA 4K60A 5ABWA 1O3HA 1P9UA 1J15A 3EGKH 1O33A 1TOMH 4A5TS 2VJ1A 1GG6B 2Z9KA 4B73A 4I7YH 1ZMNA 2G4UA 1PYTD 4WF8A 4K5ZA 3QN7A 1A0HB 3P8NA 2Z3DA 1Y5BT 1GJ4H 4GCHG 2ZCKP 1UJ1A 1OWEA 2XNDD 3C1KA 1C1OA 3F2GA 1AWHB 1SB1H 5C1XA 3RP2A 3ZIAD 3RLYH 1TYNA 1WSSH 1EXFA 2Q6DA 1CSOE 2A4QA 2AGIX 4I8JA 7GCHG 1X7AC 2ZU4A 2UUKB 2B8OH 6GCHG 5EJZA 1B0FA 1TNGA 3WW7A 1HAOH 3F6UH 4WY3A 2AGEX 3PMBB 3RUOA 6CHAB 1C2GA 1HJ9A 1O5BB 2FP7B 5A8XA 1GI0A 3MI4A 1LDTT 2AIPA 3C27B 1HAIH 1D6RA 4X8TH 3UWJH 4DW2U 1XX9A 1C1RA 1SGYE 2P3UB 1GCTC 2HWLB 3TNTA 2XC0A 1GJ6A 1GMDG 1SQOA 3F0OA 1F5LA 2ZECA 1V2KT 3GDVA 1E1QD 2NU1E 1H9HE 2WUCA 1KXCA 4K8BA 4AFUA 1O2WA 1GBKA 3NXPA 2WPHS 1GBFA 1V6DA 1FNIA 3SZNA 4Y8ZA 5A2MH 3RMMH 1RTLA 1BA8B 1YCPK 3SI3H 2B9LA 3KF2A 1AGJA 4P00A 5T1VA 5A8YA 1XUJA 3BTTE 7LPRA 1NPMA 1IQIA 1UTQA 4U30A 1GHXH 1GHWH 5EJLA 5EPYA 2R2WU 2NU3E 2K1QA 1P05A 1HLTH 1DDJA 2C90B 2AGGX 1XUFA 2AMPA 3SZEA 2AH4X 1GL1A 1Z8GA 1VITF 4F4OC 4DIIH 1L4ZA 4QT8C 1WYKA 3SU6A 1K1LA 4GSOA 3VB6A 3LKWA 1MH0A 3OAAD 1Z6EA 5F8ZA 4LZ4B 1Y5UT 2PUXB 1KLJH 2BD4A 4ZHLU 4ZH8A 1SR5C 1O2OA 1GGDC 4LOYH 2TGTA 1NFYA 1WUNH 2SGFE 3ODDA 2Y82A 3HKJB 3TIUA 1A0JA 4O9VA 1TALA 1ABJH 1TPPA 1UCYE 1YP9A 1C5MD 2STBE 1SFQB 1L4DA 3DHKH 5CHAB 2BOHB 5L2ZH 3SOSA 3OTPA 1BIOA 1C2KA 5IDKA 1TX6A 1UTLM 4ABFA 1MBMA 1GHVH 4FVDA 1P2NA 1C1PA 1GMHF 2HLCA 2OP9A 2YMSD 4ABIA 2O8UA 2XBYA 3BTDE 3ZVCA 5DN6D 5I46H 1E37B 2HALA 1CT0E 1HJAB 1ZSLA 3FN8A 1O3FA 2Q6FA 1A3EH 4NA9H 1K1IA 3A7YA 1ABIH 2FXRA 3PLPA 4XSKU 3SU2A 2VIPA 1FAXA 4JK6A 1DXWA 1QL7A 2QCYA 4NCYA 2J92A 1FY3A 1ZPBA 2VGCC 4ISLA 2QYIA 2Y5FA 4TSFD 1W14U 4UD9H 2ANWA 4B74A 1MTNB 3M36A 1P06A 4Q2KA 3BTHE 1K1OA 3LGWA 1O5FH 5CHBA 4XBBA 3ZZ7A 1C5WB 2UWPA 2VB0A 3I29A 2QGRA 1C1TA 1DY8A 2R3YA 5B6OA 1V2MT 1GI1A 1O3JA 1QCPA 2H6MA 4B2CA 1ID5H 3JZ1B 4CH8B 2FDAA 4FOUC 3K65B 3NCLA 2PKAA 3PRBA 2J38A 2ZDNA 1Y59T 2VWMA 3UOPA 1EX3A 2LNCA 1O5AB 1CA8B 1EASA 1P2OA 1O2IA 5C17A 2J34A 1ZYOA 2CV3A 5A0AE 4FUBA 1OP0A 2WZQA 5FPYA 1SG8B 2BD8A 2HPQH 2BY8X 5C3NA 4MPVA 2PFEA 1QQUA 4WXVA 2V3OH 1Y3UA 4Y8XA 4A1XA 3QZRA 2CGAA 1K22H 2FOHA 2XRCA 2GTBA 3P92A 4IC6A 3TK6A 1KYNA 1GI7B 1YWUA 2W5EA 3TJNA 1UK2A 2EY4C 2ZF0H 3SBKA 2P93A 3FP8E 1CE5A 1QA7A 1HDTH 2KCYA 1VJ9U 4D9QA 1XVOA 2BLVA 4MNXA 1MTUA 3E91A 1VITG 3NWUA 4FUEA 1EB1H 2OD3B 1SGDE 1OWIA 4XRNA 5FCKA 2JDID 1VZQH 2FOCA 4FUGA 5FAHA 7ESTE 1THRH 1D3DB 3N7DA 4Z1MD 1QNJA 5DO4H 2BD5A 3NPSA 1HIAB 4OS5A 1YPJH 1GHZA 3H7OA 3TPIZ 1OYQA 2WV9A 3OEED 3O8CA 2G4TA 2OCVB 4UE7H 1W3CA 4NSVA 3ZVBA 3NKKA 4H42U 2HOBA 2R0KA 1MABB 1DSTA 1W10U 2A7HA 3PV2A 4IC5A 4UFDH 4THNH 3PWBA 4X1SU 5L6NH 1AUTC 1PPEE 1IQJA 1EAUA 1O3LA 4OS4A 4Y79A 4Y7BA 1GJ7B 4A1VA 2F9BH 4BAQB 3EA7A 2ZPSA 4RKOB 1FAKH 2ZFFH 3KQEA 2HVXA 2A31A 5HIZA 1YPKH 4H6TA 1LHGH 1TGSZ 1L1NA 2VWNA 1A0LA 3SU3A 1XM1A 2OC8A 1LPKB 3JZ2B 4BTUB 1K28D 4D76A 1G3BA 3SU0A 1UO6A 3MO3A 4JYUH 1C5XB 5KGOA 2GCHF 3KQBA 4FUJA 2F3CE 3U8RH 2RG3A 1HXFH 1ZGVA 1BT7A 1WQSA 2QC2A 5A0BA 8GCHG 1Z1JA 3FO8D 2A5IA 4RT0A 1DSUA 4MLFB 1TGNA 1O5CB 2WPDD 4WMFA 2F43B 1WBGB 4KTCA 3SORA 1UK4A 3NK8A 4AORA 5AHGH 1ETRH 1H8ED 3W95A 7KMEH 1ELTA 2WV5A 4I32A 1P03A 1YPMH 2CMYA 1THPB 1T4UH 1RS0A 2A2QH 1P04A 1O5DH 3A80A 3DSOA 4NSYA 5HM9A 5JBAS 1S82A 4ASHA 1T31A 3S9AA 3V12A 1GBBA 3SUGA 3HATH 1J17T 1P2IA 4MTBA 3ZV9A 1DX5M 3UY9A 1SQRA 3ESTA 2A7JA 2TGAA 1SBWA 1V2RT 4H4FA 1YC0A 1OP2A 2Z94A 1O3DA 1ZTJA 1EZQA 1SQTA 3VB4A 2FWWA 1AZ8A 2ZIQH 3EA8A 1GI5A 3FOAA 3A8DA 3QDZB 4YESB 5DP5A 1MZAA 1BBRK 2ZFPH 1O2UA 4I8HA 1W0KD 1GI6A 1NM6A 3A83A 1ANCA 3LC5A 5DKMA 4BXWA 1SLUB 1AMHA 3KNXA 1SGEE 1UTOA 3T26A 3G01A 2ZHWH 1AD8H 2B7DH 3SHCH 2AMDA 1VCWA 5EXMA 3F9GA 2GMTC 5EOKA 1G3DA 1UTMA 4DY7B 2AEIH 4OM9A 3ZZ8A 1ELFA 3SU4A 5DP9A 1AVXA 2WUBA 2OC1A 2F9UA 5H4IB 2BD9A 3A8CA 3MH4A 4IMZA 4Q7XA 3PB1E 2Y80A 3GDUA 1IHSH 1OP8A 1EP5A 2GZ9A 2FS8A 1SOTA 2G51A 4XOJA 1O36A 5EW2H 3GYLB 1CA0B 1GHAG 1H8DH 2BLOA 2XNIA 1HAGE 1TNHA 3MU1A 1GCDA 1KLTA 4ZROA 1V3XA 1XXDA 3ZVFA 1WCZA 2KCOA 1FJSA 1S81A 1YPHC 3H5CB 1HAZB 2OUAA 3CS7A 5F03A 4AFSA 2IJD1 2EA3A 4CRAA 2PSXA 4Z6AH 3SQEE 1UTNA 2GT7A 1W8BH 3FZDA 3MU8A 1E36B 2HNTF 5F8XA 1MKXH 1SVPA 2VVUA 1QA0A 3E8LA 2A5AA 3UNSA 1AIXH 1EPTA 5EXNA 4IN1A 3LOXA 3DFJA 3EA9A 1MTVA 3ATIA 1RIWC 3OY6U 1TONA 2QF3A 4CREA 3ODFA 3ZZCA 2Z9GA 3PLBA 1AUJA 2BY5X 1V2PT 1FDPA 3F0PA 1V2OT 4NA8A 3SV6A 1YY3A 5E2OA 3A8AA 1SI5H 1F0SA 3SNCA 2OQ5A 4X2YA 1NS3A 1W13U 1AWFH 1HIAA 1T8NA 3D23A 4IW4E 3BSQA 4JZFH 4CRFA 1OX1A 3EQ0H 5LPEA 4D8NA 4ZKRU 1BRBE 1P2QA 5B6LA 3GY3A 5DGJA 2VWLA 1KDQA 1UTJA 1LPZB 3EE7A 3HGPA 1PQAA 3DUXH 2TBSA 1FX0B 2VNTA 2Y5HA 2K8IA 4FUIA 2P95A 3P8FA 1D9IA 4AX9H 2CJIA 1G3EA 2BM2A 2R9PA 5AFYH 1NESE 1CHOF 1QJ1B 4B75A 5FL7D 2PTCE 4DJZB 1O2JA 1TGBA 1V2VT 3ZYEA 1FI8A 1J14A 2CHAC 2V6NA 1BJVA 1SL3A 2WPKS 1S85A 2XWBI 2Y5GA 5ESTE 1MU6B 3KYFA 1N8OC 3GICB 1XMNB 2QXIA 3ZZ3A 1Y3YA 2ZI2H 4ISOA 4CR5A 3F1SB 4MNWA 4UONA 5FHTA 1WOFA 4F55A 4DT4A 1QBVH 1V2QT 1TNIA 2SGPE 3BTGE 1MKWK 4DIHH 3GCHB 1S83A 3AW0A 1KDQB 3FP6E 2C3SA 4NFEA 2RDEA 3BG8A 2ZCLP 1T8OA 1GJ9B 1GI3A 4J1YA 3V0XA 1GJBB 3KGPA 2F9OA 3RMNH 3TJOA 1KMHB 3U69H 5DJ7A 1EAXA 3P17H 4JMYA 3WWBA 5IYTA 4X1PU 1SC8U 2ANYA 4WJG2 3BTKE 3A87A 4KELA 5JPMH 5FPSA 3PTNA 2ZC9H 1IHTH 2JETC 2ZU1A 2XWAA 3PROA 2GZ7A 1QQ4A 4MPWA 3VPKA 1C5PA 3SQHE 1ZGIA 1P8VC 2P16A 5A8ZA 2KAIA 3A88A 1DWEH 3TK5A 2GCHG 1OYTH 5DG6A 8KME2 2A45B 2GV6A 1CHGA 1W12U 3IITA 4TPYA 3OFND 1QURH 1FUJA 2VVVA 3EE0B 2EC9H 3RXEA 3LDXH 1O2XA 1O3MA 2THFB 2BTCE 1TLDA 2XCNA 2ZNKH 4X2VA 3A7TA 4NG9H 4DOQA 1SGTA 2W6ID 1BRUP 1C2DA 3QWCH 1IAUA 1P2JA 3LJJA 2ZQ2A 3UR9A 2FLRH 4FU7A 2KR7A 4K1SA 3LJOA 2FX6A 2J2UA 3BEFB 2HLDD 1B0EA 4ZHMU 2FEQH 1RXPA 4E7NA 3QZQA 5GJ4B 2ODYB 4DVAU 1O31A 1GHBF 1ANEA 2Z9JA 4BTTB 4U32A 4XDEA 1SGNE 1T4VH 1C9PA 2OBOA 3TH4H 3EDXB 2Z3CA 5IK2D 1FZZA 2ZGJA 1WAYB 5HKKD 2JIZD 4XD7D 3M7QA 2ZPQA 1TX8A 4NGAH 3SJ8A 3ATLA 5FBIA 2W26A 3N7OA 2RA3A 3BTME 3M7UA 2ZKSA 1HV7A 1WDIA 2ZDAH 2WSSD 1BMMH 2O8TA 2R2MB 2D8WA 4DT7B 1SGFG 4ABAA 3PTBA 3RMOH 4BAKB 2QIQA 4ABJA 3RXRA 4I33A 4NIXA 1HAVB 1V2TT 1BCUH 5FPTA 1LHDH 3A89A 4J2YB 4X6NA 1SGCA 1JWTA 1V2UT 2RDLA 5F8TA 1F7ZA 2BDHA 4HTCH 1O2MA 2J4IA 1C2IA 1O3GA 3FZZA 3AK5A 3SNAA 5GWZA 1GJ8B 1AN1E 3VXEH 1DPOA 2BD7A 3KL6A 2AYWA 4I8LA 2GJGA 3UIRA 3SGQE 4JYTA 4ZHAA 3URDA 2HGTH 1Y3VA 2CF8H 2ZFSA 3UNQA 4JZ1A 2BQWB 2EEKA 3K9XB 3MFJA 3D65E 7GCHF 2BHGA 1O2TA 1MKWH 4K1TA 4GAWA 1GBIA 1ZHMA 3MMGA 1ZTLA 2ZDKA 4LXBH 1RGQA 2ULLA 1JOUB 3GCHC 5KECA 1BHXB 3ZZ4A 3L33A 8GCHF 1QIXB 3RXPA 1GVZA 1PPFE 3NRLA 3AW1A 5FBEA 4ZXXH 3RMLH 4O3TA 2O8WA 2D1JA 1JXPA 2BY7X 4B71A 1QL8A 4YTAA 3RXTA 4ABGA 3B23B 3W1EA 1DICA 1S0QA 3T5FH 2ESTE 1IQFA 1H8HD 2O8LA 3MWIU 1LQEA 4ZCNA 4Q7ZA 1OWDA 1GBEA 3GY6A 2ZTXA 3PO1C 1PFXC 3RXUA 2PKSC 2WV4A 3RXHA 4K1EA 1TA6A 1TRNA 2BX3A 2WHXA 5DPAA 5E2PA 3BIUH 3PV5A 4YM9A 1BMLA 2KCPA 2FOBA 4ABEA 1QJ7B 3TU7H 3U8OH 1HPGA 3E3TA 2EQNA 1C5TA 2G52A 1UVSH 2ZHDA 3URCA 5EXLA 1SLWB 1YCPH 1QBNA 1A3BH 4B76A 2H2ZA 2EI8A 1D3QB 1BTWA 4INLA 4YLQH 1FN8A 1ELVA 2F4LA 1XUKA 1DVAH 1KXBA 1ELDE 1ZSJA 3ZVEA 3LIWA 2CHAB 5DSFA 1GG6C 4A92A 4OS1A 2KAIB 1BOQA 1TIOA 2XTTB 5HMAA 6CHAC 4VGCC 3I78A 1C1NA 2BB4A 1ZPZA 3T25A 4X2XA 2J98B 1EP6A 1BRAA 3LT3A 1HFDA 3RXQA 2Y81A 2W7UA 4B1TA 2JKHA 1A5GH 1TOCB 4INKA 2XBVA 4X6PA 5BRRE 1QRWA 5AVDA 3TH2H 2ZDLA 4HZHA 4ABBA 5HGGA 2M5TA 1LKBA 2H5CA 2QXHA 4KP0A 3Q00A 1L0ZA 3BTQE 2OC7A 2XBWA 4M7GA 3NZIA 1FONA 2FX4A 1YLDA 1UK3A 1GHYH 1QR3E 4DCDA 3GY8A 1LVMA 5HXFA 5JBTA 1AQ7A 4ISIH 4CRDA 5E0HA 3AAVA 1JBUH 1DITH 4GVUA 3K6YA 1CU1A 1YYY1 2SNVA 4AN7A 2IPQX 4D7GA 1TWXB 4TWWA 4AB8A 1HXEH 1B5GH 3U1JB 3M7TA 1C5VA 1MKXK 2RA0A 4CBNA 1FQ3A 1GDNA 2FODA 1AI8H 1PQ5A 1YBWA 2NU4E 3RM0H 3MH5A 1T8MA 3VB3A 1KXFA 1SFIA 1F0UA 1EZSC 2QXGA 2GD4B 4RT1A 4B6EA 2Z9LA 2ANMH 2OK5A 2D26C 1GBDA 1YM0A 3M61U 4ZMAH 1A4WH 1INCA 1P0SH 2WPJS 1GBLA 1O2RA 2ODPA 2Z6BD 1SHYA 1TMUH 4JZIA 2Z9IA 1HAVA 2WINI 3TGIE 1ARBA 1A61H 1LHFH 4WWYA 3SNDA 3T27A 1FPHH 2A4OA 2ZDVH 3LGIA 2BZAA 1OWHA 1LHEH 3SI4H 4INHA 2IN2A 1EZXC 1UTPA 1LO6A 3MU0A 3SJOA 2XW9A 1A1RA 1SGRE 2UUFB 4MPUA 1A2CH 1TNJA 4CHAC 4JZDH 3SUEA 2A32A 5C0UA 1GHAF 1ELGA 3ITIA 3QTOH 5FCRA 3STIA 3U9AH 2JJ2D 2R0LA 2W7SA 2ALPA 1LPGB 5C1YA 3GCNA 3SJIA 2FI4E 5FX5A 1C2MA 1FLEE 5CMXH 1TMBH 4R0IA 4HGCA 1F2SE 1MU8B 4O97A 2RCEA 1ELAA 1MQ6A 1NC6A 1JRTA 4TT3D 2HNTE 3ATMA 2V3MA 3SJ9A 1TA2A 1MTSA 2FM2A 1N6XA 2EI7A 1RTKA 2Q1JA 1Q2WA 2WYJA 3KQDA 3GY4A 1KTSB 4BAOB 5JDUB 4RSPA 4VGCB 1AE8H 4YXWD 1TBZH 2C4FH 4Y0ZE 4NZQA 3BN9A 1O39A 3T62A 5AFZH 1GDUA 2KX4A 1EAIA 4AGJA 4PROA 1AY6H 1P10A 2H9HA 3SNBA 1O2QA
chains in the Genus database with same CATH topology
1NRNH 2BVSH 3I77A 4Y10E 2TRMA 2XXLA 3S0NA 1MAYA 4AG2A 1IQNA 2BZ6H 1DS2E 1IQHA 3SO3A 3E90B 5FXLA 3RC6A 1CBWB 2ZA5A 1G30B 1HJ8A 1AFQC 4BANB 1BITA 2R3UA 2A4RA 3M3SA 3V13A 3OTJE 1PJPA 3A7ZA 1BUIA 2JH6D 4XE4A 1ZHPA 1K1JA 1UHBA 2AMQA 2BY6X 5SGAE 3D62A 3MNXA 2VVCA 2Z7FE 2PGQB 3BG4B 1GMDF 3O8DA 4TYDA 4AFQA 2IOTA 3A82A 2FOMB 1O3PB 2BYAX 3KHVA 5DP3A 1EKBB 3S9CA 2IJOB 1O2GH 1WU1A 4GHQA 3SW2B 4CRCA 3AASA 2VINA 1XKAC 3TH3H 1P3EA 2G5VA 4XBCA 2A5KA 1LHCH 4A1TA 4WXIA 2UUJB 3CS0A 1GI4A 3DFLA 1KXDA 1S6HA 1FY1A 1O2SA 1EAWA 2VIOA 3BEIB 1AKSA 2VH6A 3NUMA 1S6FA 4K3JA 1FXYA 5GDSH 1CQQA 1TQ0B 4Y7AA 1O3CA 2GGVB 5T6DA 1AVWA 1W0ZU 3RU4T 3E0NB 5FX6A 2W3IA 3PO1B 2C8ZB 3A8BA 1P12E 1LCYA 1P2MA 1V2WT 4GCHF 4DGJA 1ANBA 5LH8A 1GMCF 1TBRH 4FUFA 2P3TB 1C5NH 3RXBA 3TNSA 1DLEA 2ALVA 4ZUHA 1FMGA 1H9IE 2FTMA 4AZ2B 1JRSA 1MD7A 1XVMA 6GCHF 4WH8A 3P70B 1DUEA 3RXVA 1OXGA 1Z1IA 3UTUH 1BTXA 4U2WA 1G37A 3M5NA 1QRZA 1SHHB 3V7TA 1C2HA 1O30A 2SFAA 1BMAA 2YOLA 1DY9A 1DXPA 4K8YA 3SJKA 1HB0B 1A46H 1N6YA 1PPBH 4KTUA 5G4BA 4B2AA 1O3AA 4NA7A 4ESTE 1ELBA 3PWCA 1CGJE 1DT2A 2G81E 3VXFH 1GPZA 2ZHQH 4Y71A 3UWIA 1MMJN 1ANDA 3QLPH 2PHBA 2FLBH 4WVPE 4ZKOU 1C5RA 2XCFA 3Q3YA 1LQDB 3W94A 3KIDU 4BAHB 1V2JT 3GY5A 4IS5A 1O0DH 1AVGH 3Q77A 5E8EH 3OU0A 3UQVA 1GI2A 1TAWA 1YGCH 3AVZA 3UUZA 1EJAA 1QB9A 1GL0E 1Z8IB 2FOEA 2GP9B 1HJAC 2YNAA 4WMEA 2YNBA 1QJ6B 2FZZA 1ELCA 4BNRA 2BDGA 2BDAA 4D7FA 4JZEH 3T28A 4MNVA 4SGBE 3GCTF 1SGIB 2XC4A 1ZSKA 1ESBA 3BF6H 1FV9A 2G00A 3RDZA 4FUHA 4CRGA 2WYGA 5EW1H 1TFXA 2A1DB 1TPAE 1BB0B 1G9IE 2FOFA 1CGHA 1MTNC 4KGAA 1ZLRA 1C5OH 2ILNA 2EI6A 4IGDA 2BXUH 3BEUA 5JBBS 4FVBA 5ETXA 2BLWA 1WTHD 5C20A 3KN2A 1GJDB 1D6WA 1DM4B 1BTHH 2OINA 1YCPM 1ZRBA 2ODQA 3KQCA 3SUFA 1O2LA 3IWMA 1K2I1 5I25A 2HNTC 1GVKB 3GY7A 2JETB 1KIGH 1AHTH 1MQ5A 3SN8A 2DE9A 2I6SA 2PKAB 1C1SA 1Z6JH 2I6QA 1HYLA 4AOQA 3Q76A 4CRBA 1MBQA 3ZVAA 1O38A 1NRRH 2A0QB 2J95A 3A7VA 3S7HB 1GDQA 4GUXA 3RC4A 4HFPB 3STJA 5C5OA 2F9VA 1LVBA 3QGJA 2OBQA 5E0JA 1P9SA 2AS9A 3TGKE 1UHBB 3UQOA 2GCTB 1ZJDA 2WPLS 1NZQH 4X1QU 4GLYA 3FVFB 4IN2A 3RXSA 5GXPA 3PYHA 2ZZUH 1E34B 3SGAE 3TVJB 4AFZA 3ZZ5A 4CBOA 1C2JA 1MTWA 3OY5U 2PGBB 1PQ8A 3MH6A 1F92A 2A7CA 1P57B 1EATA 1LVOA 5L30H 4XFQA 2VIQA 5A09A 1DWBH 4OGXA 3RXCA 1GBTA 1HAXB 4DG4A 2P3FH 4NWLA 3RXFA 1IQMA 3A7WA 2ZU5A 2P59A 3IG6B 1UVUH 1CBWC 1GI9B 4UFGH 2BD2A 1Q31A 2ASUB 2QV1A 4D9RA 3RXDA 4BOHA 2Y7XA 4WH6A 4BAMB 1C1UH 2HPPH 4Y0YE 1YKTA 2JH0D 1O2HA 3HK3B 3OX7U 1ELEE 1W0YH 2VWOA 4YOIA 1CVWH 2VIVA 2ZTZA 2BDCA 1XUHA 3OSYA 1RFNA 1M9UA 3A86A 2F83A 3HK6B 1GVLA 2FTLE 3QK1A 1G36A 2FYRA 2VH0A 4A6LA 1O3BA 3RXAA 1H1BA 2FIRH 1K1PA 1KSNA 3VB5A 2VIWA 4ZXYH 1P01A 1PPCE 1S0RA 1C1MA 2P8OC 3VGCB 2WPMS 1V2LT 2C93B 5T6GA 3A81A 1C4U2 1VGCC 4MDSA 4X6OA 2ZFTA 2FPZA 3M5LA 3ZZ9A 2SGDE 1O37A 1MCVA 4CH2B 1VITH 5DP6A 2CXVA 1SGQE 1B7XB 1HNEE 1OKXA 3H7TA 4OS7A 1WQVH 3BTFE 4IBLH 2GDEH 2H9EH 1PQ7A 3KEEA 1FN6A 2ZEBA 4Z0KA 3R3GB 4O03A 3U8TH 1BHXF 3QTVH 1UTKA 4K2YA 1AE5A 1FY8E 1THSH 1O5GH 1Y5AT 3T2NA 1AB9C 4OS2A 2CF9H 1P11E 4NIYA 1QL9A 2B5TB 2GX4A 4UFEH 1KTTB 1T8LA 4ISNA 2BQ6B 2Y7ZA 2BOKA 5TJXA 2PUQH 3MNSA 3SV8A 4E7RG 1ZTKA 1C1WH 1ZHRA 2GDDA 3RXOA 1G32B 1DLKB 3SU5A 3P95A 3FANA 3K6ZA 1O35A 3LGVA 3MU4A 1IQLA 1GJCB 1D3PB 2BX4A 2BDBA 1TQ7B 4X8UH 5EQSA 1GBMA 3LPRA 3TJUA 2C8YB 1YPHE 2H1UA 1C2LA 1F0TA 4ABDA 4ZKSU 1O2ZA 2ZGHA 3ZYDA 2F9NA 1L1GA 4MNYA 1NROH 5HM2A 2GMTB 5C1UA 2G8TA 2BDYA 1ETSH 1TGCA 3U98H 2SGEE 2TGDA 1Z8RA 2BLQA 3VFEA 2PWXA 3ATKA 1T32A 1BQYA 3RU4D 1Z8JB 4NZLA 2J94A 1YLCA 1FY4A 2Y6TA 3LGUA 3QX5H 1H8IH 4YO9A 1DFPA 2BY9X 3SNEA 4TPIZ 1CT2E 1ZR0A 1G2LA 5DP8A 2FOAA 1P09A 1O32A 1OOKB 3A85A 1TRMA 2SGAA 5F6MA 5L2YH 1XKBC 1NO9H 4X8VH 4YOGA 2NU0E 4AGKA 2FYQA 1TB6H 3S69A 5EU8A 1BRCE 5DP7A 5LPRA 1ZPCA 4Q7YA 1HAHH 3BIVH 3PMAB 1FIWA 1O2NA 1TBQH 5TCCA 3GCTG 2PR3A 1YF4A 3LH1A 4NWKA 5AF9H 3CP7A 1GBHA 3UPEA 4H6SB 1DOJA 2O8MA 3A7XA 1CHOG 4WMDA 1GBCA 2QF0A 1NRQH 2BXTH 2ZHFH 4UDWH 2BMGB 3MYWA 1K9OE 3ELAH 1YPEH 5GPIB 4NFFA 1V2ST 2TPIZ 1DWDH 2F9PA 2OXSA 1O3NA 3RM2H 1J9CH 4X1NU 3TK9A 5E0GA 1VGCB 1YPLH 1Z7KA 4ISHH 3VGCC 1UMAH 4FXGH 3PMJA 3FP7E 3F9HA 2VIDA 1QGFA 1G3CA 3F9FA 3M37A 2A2XH 2PKSB 1A5IA 2G5NA 3GDSA 1MD8A 1QFKH 1JIRA 1HGTH 3RXGA 1D4PB 1MZDA 1NT1A 3E16B 1EB2A 4FUDA 1H4WA 2FI3E 5GCHF 4ABHA 2BVRH 1QB1A 1EOJA 1TABE 1O3KA 4U01A 1VR1H 5EODA 2ZTYA 1C2FA 3WY8A 1GJ5H 3PM3A 2WPIS 4E06H 2FI5E 1K1NA 1SPJA 1EPTC 4XBDA 4A7IB 2XC5A 3LC3A 5JYIA 1GHBG 1EJMA 1UVOA 1G2MA 1NFXA 1CO7E 2A4GA 3ZVDA 1J16A 2OC0A 3PMHB 3RC5A 1C4V2 3RXKA 2HRVA 3FFGA 1EOLA 1AFEH 1C1QA 1BJUA 1HCGA 2GZ8A 5GCHG 1RJXB 2ZPRA 3RXJA 3BV9B 3UFAA 3TGJE 1C1VH 2SGQE 2CN0H 1P02A 1C2EA 1RD3B 4BTIB 4CR9A 1BTUA 1ESTA 4JK5A 9LPRA 2FMJA 3E1XB 8ESTE 3BTWE 1KXAA 4YT6H 2Z3EA 5ESBA 4F49A 4X1RU 1TRYA 5BPEA 1ZOMA 2QXJA 5JBCS 3ATWA 2UWLA 2GCTC 3P6ZB 1T7CA 3DT0H 4Q80A 1N1LA 1TX7A 1ZMLA 3SGBE 3F68H 3GY2A 4UFFH 1XUIA 5A0CA 5T6FA 3EAJA 3UR6A 1Y3WA 1FIZA 1NU7B 2XBXA 1IQKA 1SLVB 1OWJA 1LTOA 4NIVA 2ZFRH 5EQRA 3OYPA 1SGPE 5TCAA 1LKAA 4AG1A 3CENA 1AU8A 2Q6GA 4OGYA 1YPGH 3O8BA 3F9EA 3L3TA 3RXMA 2V35A 1DWCH 3SV7A 1SSXA 1E35B 3PV4A 1O2YA 2QA9E 4JYVH 3MO6A 3RXLA 3SUDA 4FUCA 1O2KA 2ZGCA 1LVYA 1P3CA 5DP4A 1H9LB 1ESAA 5GIBA 1NRSH 5K0HA 1NY22 1OWKA 1A5HA 2AERH 5CE1A 1AO5A 5DK1A 3MH7A 1UCYH 3ZVGA 3M5OA 3TITA 3FAOA 2DE8A 4BXSA 1ZZZA 5T3HA 2FS9A 1C4Y2 2IPHA 1F5KU 3MNBA 2PTNA 1K21H 3O8RA 1HAPH 1VCQA 1FY5A 2D2DA 2GV7A 1BTZA 1QB6A 5CHAC 1BMNH 1ZJKA 4MQAA 5J4QA 1MCTA 1HRTH 3BTEE 5EGMA 4MVNA 3EYDA 1NU9A 2VGCB 2GVFA 2W3KA 3TLOA 3GOVB 1GGDB 1PPHE 2OQUA 2ZU2A 3A84A 1Y3XA 1PYTC 5EPNA 3Q3KA 1KXEA 1SMFE 3HPTB 4FU8A 1TMTH 2FO9A 4LK4A 1VCPA 1ZRKA 1BBRH 6LPRA 1W11U 1F0RA 2ZQ1A 4Y11E 2BD3A 2ZO3H 4HI3A 2DUCA 1W2KH 3SV9A 1SLXB 3KCGH 2V0BA 3LGTA 1VJAU 4Y76A 3QGNB 3ZZAA 1SGFA 1AZZA 3MO9A 2TGPZ 1S84A 2ZU3A 4DURA 5LGOA 1E38B 1O3IA 1HUTH 2FOGA 3UOUA 2GT8A 2BQ7B 3U1IB 3M3VA 1QY6A 1XUGA 4AYVB 4TY6A 2NU2E 3V3MA 3M3TA 5C5NA 2ZDMA 1WV7H 1J8AA 1PPGE 1FPCH 3GYMA 4GPGA 4RN6A 4B2BA 2GKVE 3TJVA 4YZUA 3M35A 2B0FA 3BG4C 3LH3A 3Q3XA 3DA9B 2PW8H 3GCOA 2ZP0H 3SHAH 1U6QA 3ENSB 4I8KA 1TPSA 1CT4E 2ZWLH 1ACBE 2AIQA 1F5RA 2UUYA 1QBOA 4X0WU 4MG3A 4Y6DA 3R0FA 1C5ZB 2ZFQH 1O34A 1NTPA 5C2ZA 1NRPH 2PSYA 2VU8E 1RRKA 3ZZDA 3L6PA 3E0PB 9ESTA 2J9NA 1AFQB 1EPTB 2F91A 2XYAA 5EQQA 4LZ1H 4K69A 2JH5D 1P2KA 1BBRE 1DANH 2TIOA 4KKDA 3MOCA 4UEHH 1OSSA 3VB7A 2UWOA 2ZGBH 1K1MA 3GISB 3UREA 1O3EA 1GCTB 1D3TB 3P8OA 4MPXA 8LPRA 1TE0A 1N8OB 3MU5A 1LMWB 1RIWB 1SQAA 1C9TA 1V2NT 1QTFA 1W7XH 3B9FH 5J4SA 1W7GH 2V3HH 1UVTH 1GMHG 3SU1A 1KLIH 1IOEA 3B8JA 3DD2H 2BVXH 2NWNA 2ZHEH 4AYYB 4YLUA 1Y8TA 1NN6A 5HYOA 5EG4A 1EQ9A 2BDIA 4JCNA 2C8WB 4E05H 2OTVA 1ZMJA 4I8GA 3M5MA 2AFQB 2ANKH 4X2WA 1IQGA 5PTPA 1EZUC 1CA0C 1O2VA 1AKSB 1QRXA 1TNKA 1SOZA 2ZG0H 3ZZ6A 1Q3XA 1EJNA 1GJAB 1GMCG 4NIWA 4O3UA 1O5EH 3AAUA 1EUFA 3ZV8A 5K7RA 3HKIB 1CGIE 1MAXA 4TWYA 2LPRA 1E0FD 1BDAA 4GHTA 3LGYA 1NFUA 1MUEB 2QAAA 1DE7H 1GBAA 3RU4E 1XXFA 1C5YB 1C5UA 1TPOA 1Z71A 2H5DA 2H9TH 4FU9A 1KY9A 1O2PA 1C5SA 3K2UA 3MHWU 3LONA 2OLGA 3S7KB 3QUMP 1A7SA 6ESTA 3RLWH 1ETTH 2FESH 3SV2H 2C8XB 2PV9B 4I31A 5JB8S 1C5QA 1C5LH 2SNWA 4CHAB 4YT7H 1UVPA 1L1JA 2O9QA 2ZGXH 1BZXE 1TNLA 1S5SA 3E6PH 1OPHB 3RXIA 3VEQB 3UNRA 1IQEA 4YOJA 2P94A 4SGAE 4X8SH 1PPZA 1AB9B 1HAYB 1BTYA 4TY7A 1QHRB 2PLXA 3HGNA 1DUAA 1O3OA 4RKJB 5LPFA 3QO6A 4X6MA 1GWAA 3P8GA 3D49H 2QN5T 1NFWA 4IMQA 3MNCA 1BTPA 1RTFB 1ARCA 1L2EA 4OS6A 4R8TB 4ZAEA 2ZCHP 1JIMA 1TGTA 5JB9S 1WTGH 3ZZBA 3S9BA 1GBJA 2STAE 1GI8B 5C67A 1OS8A 3T29A 3LU9B 2G55A 1JMOH 4ZKNU 3MTYA 4AB9A 3PLKA 1HBTH 2P8OB 1UCYK 1ORFA 2QY0B 4KTSA 4Y8YA 4K60A 5ABWA 1O3HA 1P9UA 1J15A 3EGKH 1O33A 1TOMH 4A5TS 2VJ1A 1GG6B 2Z9KA 4B73A 4I7YH 1ZMNA 2G4UA 1PYTD 4WF8A 4K5ZA 3QN7A 1A0HB 3P8NA 2Z3DA 1Y5BT 1GJ4H 4GCHG 2ZCKP 1UJ1A 1OWEA 3C1KA 1C1OA 1AWHB 1SB1H 5C1XA 3RP2A 3RLYH 1TYNA 1WSSH 1EXFA 2Q6DA 1CSOE 2A4QA 2AGIX 4I8JA 7GCHG 1X7AC 2ZU4A 2UUKB 2B8OH 6GCHG 1B0FA 1TNGA 1HAOH 3F6UH 4WY3A