4U30A

Human mesotrypsin complexed with bikunin kunitz domain 2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin-3
publication title Sequence and Conformational Specificity in Substrate Recognition: SEVERAL HUMAN KUNITZ PROTEASE INHIBITOR DOMAINS ARE SPECIFIC SUBSTRATES OF MESOTRYPSIN.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u30A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u30A02
1WUNH 1RFNA 4MNWA 1LKBA 2ASUB 2R3YA 1UTKA 3K9XB 1BMLA 1TLDA 1YLCA 2SNWA 5E0GA 4JZIA 2UUJB 1EXFA 1O2RA 1F0RA 2BY5X 1G37A 5K7RA 1P8VC 4K1SA 1W8BH 3PMHB 4NZLA 3ODFA 2IPHA 1C1RA 2VIPA 1EZXC 3ZVFA 3QZRA 4A6LA 2GMTB 2F91A 4JZFH 3GOVB 2C8XB 5A0BA 3UOPA 4ZMAH 1A1RA 3A7VA 1KTTB 4X1QU 1SGCA 1OWIA 4I8KA 3RC4A 3EQ0H 1PYTD 1TALA 1E37B 2BDCA 3M61U 1V2PT 1QBOA 4DOQA 4K60A 2FZZA 2I6SA 3KNXA 3P8NA 3Q00A 2PTCE 1MKXK 3ZVGA 2ODQA 1GVZA 1GMDF 4YOJA 1GBTA 4CR5A 1GGDB 1HYLA 6GCHF 1ZLRA 1AUTC 2STBE 1BMAA 1G36A 1MD8A 3E0NB 3F9HA 3BTEE 2GP9B 2JH0D 2PTNA 2HRVA 1QJ7B 2ILNA 1GBEA 1C5WB 1DLKB 2EI6A 1DSUA 5E0JA 4XDEA 1HRTH 3HKIB 1W13U 1GHXH 2R3UA 4Y8XA 1DY8A 1GBBA 2ZDMA 1BRUP 2B5TB 2FLBH 1TABE 2VVVA 4O3UA 3BTWE 1NROH 4YLUA 3U98H 2F83A 3VFEA 3IITA 3SV6A 2XRCA 2KAIB 1A5GH 1LHDH 4DT7B 1S6FA 1TNHA 2FI5E 5CMXH 1TQ0B 4X6MA 1O3IA 3BSQA 1FV9A 4NIVA 1ZSKA 2SGDE 4JYUH 1IQFA 5LPRA 3ITIA 1OOKB 1ZYOA 2FYQA 1E34B 1GBDA 3FZDA 4X6PA 3ATMA 1V2WT 1EQ9A 2BLOA 3T62A 4ZROA 4M7GA 1MAYA 1ELVA 1V2LT 1GHVH 4Q7XA 1OP8A 3LJJA 1QNJA 4CREA 3RM0H 1GG6C 1KXDA 2Z9LA 4HTCH 4BOHA 1FY5A 3RXQA 1V2UT 2VWOA 4YESB 1TRMA 2ZGXH 1OYQA 2AIPA 3ZZBA 4Y7AA 3UR9A 1V2RT 3UY9A 1C9PA 1O5AB 1SGRE 2ZKSA 4UD9H 3U8OH 2WYJA 4YT7H 3SV9A 1AZZA 1OWDA 1THSH 4ESTE 3SI4H 1GBIA 2ALPA 2IN2A 2BLWA 1FPCH 2UWOA 1F7ZA 1L1JA 2FXRA 1IQEA 3BTME 3RC6A 1QBVH 1Z6EA 3S7KB 4AGJA 2A45B 2SNVA 1GBKA 2ZPRA 2Q1JA 3PM3A 2VNTA 3HGPA 1QHRB 3SHCH 1D6WA 3T28A 1T8LA 1TOMH 2BLVA 3RXHA 2XBYA 1LVMA 1AB9B 5JDUB 1F0UA 2AEIH 2BDHA 4TY7A 1GHAG 2Z9IA 2P8OB 4GPGA 1WAYB 2B0FA 4XBDA 4ABAA 1HCGA 2AGIX 3SV2H 2OXSA 1ELAA 1C4V2 4ISLA 2ZQ2A 3ZZ5A 3QK1A 1FY4A 5A0AE 1V2TT 5L2ZH 1PJPA 5TCCA 2Y5HA 4BNRA 1O30A 5DJ7A 4B76A 3GY3A 2AMDA 1HAIH 4MPVA 2F9VA 4D7FA 5GWZA 3C1KA 2THFB 3SV8A 3FP6E 5ABWA 1TYNA 4UEHH 4XOJA 1X7AC 1C2DA 1DWBH 1XUJA 3MU1A 2ZWLH 1DWEH 2KAIA 2W7UA 1RGQA 4Y10E 1FY3A 4X6NA 3MMGA 1IQLA 3TLOA 2ZECA 3OYPA 3M7TA 1BRCE 2FP7B 1HJ9A 5F8TA 3UUZA 4B2AA 3T26A 3MH6A 4PROA 2ANMH 2ZTYA 2QGRA 1O0DH 3MNXA 1GDUA 1FDPA 1ID5H 3RMMH 1NZQH 5GJ4B 3FZZA 1HAYB 2VJ1A 2Z6BD 4AX9H 1Z6JH 4X6OA 4WH8A 2XW9A 3BV9B 3VB6A 4Q7ZA 2ZFFH 1P9UA 2QXGA 5LH8A 3KL6A 3LGYA 1AU8A 1FNIA 1MTNB 2BD3A 1KLTA 1MZDA 1YPLH 1CU1A 3LC5A 3RMOH 2H9EH 3NZIA 5DKMA 2JETB 3RLWH 1QL7A 3FP8E 3CP7A 4U32A 1ESBA 4F49A 1IQGA 1W0ZU 1OS8A 3A83A 4J2YB 3TIUA 1SL3A 2GTBA 3LH1A 5GXPA 2V3OH 1K1OA 1V2JT 2ZU5A 1TQ7B 4HFPB 2V6NA 1G9IE 3R0FA 5C20A 1HJAB 2FMJA 3SNEA 2FOAA 4MVNA 4NA9H 1Z8RA 1CBWB 1KLIH 2ZZUH 1TFXA 1PPCE 1CGIE 1O2HA 1PFXC 2OBQA 3P8FA 3GY7A 2BM2A 1ANDA 2G81E 1HAHH 1ZHPA 3FANA 3M36A 1ELEE 3V12A 4I8GA 1OSSA 2HNTE 2WUCA 4TYDA 2BLQA 1F0TA 1Z7KA 1NRSH 1BRAA 5LPFA 1S6HA 1MBQA 1SGEE 3SNCA 1S82A 2PV9B 4B2BA 5AF9H 3GY8A 2BVSH 4OS5A 1GJ4H 2A0QB 4INHA 1NFXA 5EG4A 2FPZA 1YCPM 4BTUB 1C2GA 3RP2A 4DGJA 1GI6A 1TGBA 1O2OA 1TA2A 3TPIZ 3TGIE 3JZ2B 1W7XH 1MTVA 3FAOA 1OP0A 3UNQA 1AVXA 3MO3A 1LHGH 1NU9A 4U01A 4BAKB 1ANBA 1EKBB 2BY7X 5AHGH 3SHAH 1EJAA 1E0FD 1IAUA 2AYWA 3GDUA 3QTOH 2LPRA 1SGNE 1Y5BT 4KTCA 1CT4E 4LK4A 1DXWA 2UUFB 1WBGB 3UREA 4I8HA 4BAHB 3GISB 1QB1A 5FPTA 2F9UA 1BJUA 5DO4H 1G30B 1GCDA 1DVAH 1C2IA 1NU7B 1BITA 2K1QA 5C1XA 3T5FH 1LVBA 3CS0A 4XFQA 1GHAF 1O36A 2R2MB 1V2ST 3PO1C 2FS9A 1O35A 3SI3H 4O3TA 3ZVAA 2VIOA 2G5VA 3QX5H 4Q7YA 1ACBE 1V2MT 1VGCC 2Y6TA 1RIWC 1GJ5H 3Q76A 2XCNA 1C2HA 3MH7A 1MZAA 2ZDVH 2PWXA 3GY4A 3AASA 2H9HA 3FFGA 1ELFA 1K1IA 3G01A 1SGFG 3F9EA 1UK4A 1B0EA 4MPXA 2YNBA 2QV1A 4Y79A 7LPRA 1QY6A 3RMNH 1TGSZ 3UOUA 3KIDU 2G4TA 1O3AA 5T6GA 1TGTA 3QLPH 3KCGH 2H1UA 2H5DA 1LTOA 3SNAA 1NFYA 1V2NT 4X1NU 2QYIA 3A84A 1V2QT 1SQAA 1TBZH 3SNBA 2VVUA 5GDSH 2O8UA 1SGIB 2H5CA 5BRRE 1K28D 1QA0A 2TPIZ 1MAXA 1RRKA 1QL9A 3E1XB 1ZGIA 3SGQE 1YPHC 4AFSA 3RU4E 1LDTT 2C93B 1ZGVA 3LGWA 1KXBA 1O2UA 4MLFB 4RKOB 1FI8A 3EE0B 3U1JB 2QA9E 2GDDA 2ZHWH 1T8MA 5A2MH 1ZHRA 1FQ3A 3LGVA 1WU1A 1IQJA 1P03A 1P04A 1DX5M 1AE8H 3QO6A 2VINA 1P09A 4UFEH 3RC5A 2ZU4A 4AZ2B 5FCRA 3SGAE 3T29A 3KQBA 4RKJB 5PTPA 2RCEA 3E90B 2OLGA 2WV4A 3RMLH 3DD2H 1NRQH 1AWHB 5E2OA 3VGCC 4X2XA 1NFUA 1GI5A 2A7HA 2GT8A 1O3DA 1TONA 2SGQE 2QY0B 2PSYA 2BHGA 1ZZZA 1J16A 2VGCC 2FOFA 1Y3WA 2C90B 4DW2U 5EU8A 3ZV8A 3WY8A 1ZTLA 4GCHG 4NWLA 2ZDAH 1H8IH 1JWTA 1XUFA 2FOGA 1P57B 2FI3E 2OCVB 1TPPA 1J14A 1HIAB 3ZZ3A 1QGFA 1GPZA 1RS0A 3P70B 3NK8A 2FWWA 1BHXB 5L6NH 2ZCLP 4QT8C 2VU8E 1UVTH 1BT7A 2AMQA 2F9NA 3CS7A 3SU4A 5DP5A 1LHFH 1UVOA 1C5PA 1W10U 2R0KA 3TJOA 5HM9A 2FOHA 4A92A 1F2SE 3TJUA 5JBAS 2TGAA 1HB0B 1W12U 3LONA 4AG2A 4B2CA 1QRXA 5GCHG 1C5VA 1CT0E 1C5NH 1RTLA 1C5UA 3ZZ9A 3TK5A 1BRBE 3T27A 4NIWA 4YOGA 1ZPZA 1WTHD 2ZDNA 4X2WA 2XC0A 1C2LA 3A89A 2O8WA 1YLDA 2FS8A 4NZQA 3D49H 2ZHDA 3SOSA 1ANEA 1MKXH 1A61H 2G00A 1UTOA 2LNCA 1O31A 5LGOA 1O5GH 2PFEA 4SGAE 1TRNA 5CE1A 5AFYH 8GCHG 3V13A 4NIYA 3RXKA 1SLXB 1RXPA 1P2QA 1XM1A 3RXBA 4B73A 3TGJE 5E2PA 4B74A 3NPSA 3MU5A 1L4DA 1GI2A 4X1PU 3SQEE 2EC9H 1IQNA 1B0FA 4YZUA 4K8YA 1O5DH 1A5HA 1C5OH 1YF4A 1GMCG 1SQTA 5H4IB 1GVLA 1IHSH 1OX1A 1C4Y2 2NU0E 3S0NA 1GL1A 1CGHA 3BTKE 1XMNB 2G55A 3O8CA 2ZI2H 4WJG2 3OY5U 4BTTB 1EATA 3KN2A 2OP9A 5L2YH 4NSYA 4TWWA 3LJOA 4DY7B 2PW8H 4H6TA 1QIXB 4J1YA 1GCTC 4ISOA 4LZ4B 4DIHH 3ZYDA 1EP6A 2ZNKH 3I29A 5DP3A 2FODA 4NGAH 2OC7A 2AS9A 2W3IA 4OS6A 4MQAA 2DE9A 3BTQE 1K22H 1T7CA 1EB2A 1E35B 4IBLH 2ZG0H 4ZHMU 2B9LA 1PQ5A 1KXAA 1HIAA 2Y80A 1SQOA 3E3TA 1EPTB 3MO9A 1XUGA 1ELGA 1UCYK 2NU4E 3LGUA 4NG9H 1AE5A 2EA3A 4XBBA 5C67A 1P0SH 2BX4A 1K1PA 1O3PB 1UVPA 3SV7A 3TK9A 1NRRH 2H6MA 1UVUH 1HAOH 4ISIH 3O8BA 1NTPA 2CMYA 2ZFPH 1AFQB 4X1SU 1CA0C 1NT1A 1JXPA 5JB9S 3DFLA 4OS1A 3U1IB 3GICB 1SHHB 2IJOB 5DK1A 1DICA 2GCHG 1TA6A 2PKSB 1C2KA 2GKVE 1TWXB 2FM2A 1M9UA 2BDIA 2XTTB 1OWEA 4FVDA 1O3BA 2OQ5A 2Y7ZA 1ZPCA 2B7DH 1DXPA 4ASHA 2ZFSA 4AOQA 1W2KH 2W7SA 2VIVA 1FY1A 1H9LB 3BTDE 4GCHF 4NIXA 3BN9A 1HLTH 4Y0YE 1ANCA 2XWAA 3SGBE 4XSKU 1O3HA 4IW4E 4AYVB 3A80A 1GI9B 2P3TB 4UE7H 1WSSH 1O2LA 3NKKA 1GWAA 2FEQH 1GBCA 1BMMH 1O34A 1EZSC 5C2ZA 1H1BA 1QA7A 1V6DA 4FUCA 2Z7FE 2UWPA 1HAVB 1TIOA 1P3EA 2STAE 5GCHF 3A7WA 5T6FA 4FUHA 1CE5A 4MDSA 3ZVBA 3RXFA 2ZCHP 4JZDH 2J34A 2GX4A 3EAJA 2C4FH 1C1NA 3PLBA 4Y76A 2SGFE 1HNEE 3E0PB 1J15A 2ZHEH 2O9QA 4ABBA 2XNIA 5B6OA 1K1JA 3VEQB 1GL0E 2OBOA 2C8WB 4FUBA 1IHTH 2FOBA 3AAVA 3N7OA 1AY6H 1CA8B 8GCHF 4B1TA 1EPTA 2Z3CA 1Y8TA 3UIRA 1THRH 4I32A 5EPNA 3KQEA 3H7OA 4KP0A 1SPJA 3LIWA 1KSNA 1N6YA 2CF8H 1AZ8A 1W14U 2HNTC 3EYDA 1QRZA 1A3EH 1J17T 4OGXA 1BIOA 3RM2H 1FZZA 3M5MA 1GMCF 4K1TA 3UQVA 1CHOG 2A5IA 2A5AA 1C5QA 1MQ6A 3KGPA 4GAWA 3M35A 1T31A 1LHCH 1DFPA 4CHAC 1S0RA 2PKAB 2BVXH 2SGAA 5EODA 3VPKA 1LO6A 4WWYA 3RXDA 1AGJA 1QTFA 2FOCA 1FJSA 1O3GA 6ESTA 1BQYA 1VITF 4A1VA 1O2ZA 1A2CH 1GMHG 4ZKNU 1BHXF 1Z1IA 2J92A 1O2WA 2EI8A 4FU9A 3SU6A 3URCA 1NPMA 4INKA 2RA3A 2UUKB 5IDKA 2ANWA 3RXPA 3SUEA 1HAPH 1F5KU 1P2JA 2AERH 3V7TA 1FN8A 3MNBA 3ELAH 3M3VA 2VH0A 4WMEA 3RXAA 3SU1A 2ZEBA 5DP9A 2QF3A 4DCDA 1O2KA 4BANB 2C8YB 4KGAA 1O2XA 1O2IA 2XCFA 1MTNC 4ZKSU 1OXGA 2ZQ1A 2UWLA 1OWJA 1XKAC 3F9GA 3S9BA 3PV4A 1Z71A 5GIBA 3A7ZA 1UMAH 1VR1H 4X8TH 1JRTA 1G2MA 2A7JA 1T8OA 5G4BA 7KMEH 5DP7A 3RXGA 1ZOMA 2OUAA 1O3NA 2VH6A 3PMBB 1EASA 3EA8A 2BD2A 1TNKA 3AVZA 3MHWU 2FI4E 3BG4B 1CQQA 1F5RA 1TX6A 3Q3YA 1ELBA 1HJAC 1ETTH 1LHEH 2FLRH 1NFWA 2GCHF 3PTBA 2WYGA 3F1SB 2Q6DA 1VITH 6CHAB 1Z8IB 1OPHB 5FPYA 1DSTA 1KDQB 1L1GA 3FVFB 2G51A 1UCYE 1V2OT 2R0LA 4JZ1A 1QJ1B 1C1OA 5EXNA 1GJ9B 1ETRH 4LOYH 4DVAU 4JCNA 3TJVA 4ZXXH 3ZVDA 2ZA5A 1CO7E 4E06H 3SN8A 4CRFA 4BAOB 1O3EA 4ABDA 4YTAA 4CRCA 5C5OA 2ZIQH 3Q3XA 3HATH 3GYMA 2QAAA 3RXJA 4CBOA 4U2WA 1MCTA 4ABEA 4AORA 1C5LH 1JOUB 3RU4T 1L2EA 3L6PA 2CGAA 3TNTA 3STIA 3NCLA 3MU8A 3ZZAA 1MMJN 1O3MA 1ZHMA 2QC2A 3IG6B 4B75A 1MQ5A 2PKAA 2P59A 1O5FH 3RXVA 4Y8YA 2VWNA 2H2ZA 2V35A 8LPRA 3SUFA 3PTNA 2AIQA 1KXFA 4IGDA 2P3FH 2DUCA 1GVKB 1O33A 2WPHS 3GY2A 1L0ZA 3ATKA 1SOTA 1RD3B 1UTNA 1H9IE 2YOLA 2A4GA 3MNCA 1K1LA 1EOJA 4Z6AH 3P17H 5C3NA 3PLKA 3AW1A 2FOMB 3QTVH 4GVUA 1TNLA 3UTUH 1YYY1 1A46H 2BY9X 2W5EA 5CHAC 1GJ6A 4X1RU 1AIXH 3URDA 4ZHLU 2BQWB 1SHYA 1HGTH 1P2KA 1PPZA 2D2DA 3HGNA 2HVXA 3K65B 1C5TA 4GUXA 1EJNA 3M7UA 2CF9H 2PUQH 2J94A 4GHTA 1VCQA 1IQIA 5DP8A 2FDAA 1GJDB 2G52A 4FUDA 1EZUC 1SB1H 4WH6A 1NESE 3I77A 2VWMA 1YP9A 1CHOF 4UFGH 3SJIA 3P6ZB 1NY22 2NWNA 4WY3A 1G3CA 4WXVA 4I7YH 2XYAA 3EA9A 2TGDA 3E8LA 1DOJA 2ZFQH 3NUMA 4CH8B 5FBEA 3OTJE 3A8CA 3GCHB 1JIMA 3H5CB 3MOCA 1DWDH 3ESTA 4Q80A 3U8RH 2ALVA 3A85A 5TJXA 1KDQA 1P05A 2BXTH 3JZ1B 1FXYA 2Z9JA 1TX8A 5DGJA 3SJ8A 1WV7H 1O37A 2FTMA 3VB4A 4TPIZ 3GCTG 1DITH 1PPBH 3RLYH 4AGKA 1BTXA 2ZCKP 3OX7U 1S84A 2ZP0H 1FAKH 1QURH 2OQUA 4AB8A 3D23A 2RA0A 1ZRKA 1YBWA 1K9OE 2R9PA 3UR6A 2VVCA 3M5LA 1YGCH 1GJCB 3HK6B 1AVGH 3E6PH 1YCPH 4Y71A 3GDVA 1SGFA 4R0IA 1Z8GA 1IQKA 2ZDKA 1P06A 3T25A 1QL8A 4WMDA 1DY9A 1GDNA 3BEUA 4ABGA 3UFAA 2J95A 4ISHH 3ZZDA 1PPGE 2FO9A 2ODYB 4FXGH 2Y82A 4IMZA 4LXBH 1V3XA 4DIIH 4UFFH 1XUIA 3UNRA 3NWUA 3PO1B 2Z3EA 2QXIA 1P12E 4CR9A 2CHAC 2OC1A 4MNXA 1A5IA 2GV6A 2ZO3H 3AAUA 1CVWH 3B23B 1VGCB 2B8OH 2BOKA 1S5SA 1PPHE 3A8DA 2XXLA 4CH2B 3HK3B 3DA9B 1GBFA 1BA8B 1C1VH 2QCYA 4Q2KA 4IC5A 1CT2E 2GZ8A 4Y11E 3SW2B 3MH4A 4OS7A 5EQRA 2FOEA 1WCZA 4OS2A 4H6SB 4TPYA 1VZQH 1ESTA 1TNJA 1W0YH 2SGPE 5JBBS 1D3QB 1GMDG 1HAXB 3MFJA 2ZTXA 1GHBG 2JKHA 2GVFA 5ETXA 5HM2A 2A4OA 4BAQB 1GHWH 2XBVA 5A0CA 1ZMNA 2BVRH 8ESTE 4FU7A 1O2SA 5BPEA 3TGKE 1FAXA 1UTMA 1YPMH 4YOIA 3PB1E 3RXIA 2EI7A 2GZ9A 4BAMB 4ZUHA 5EGMA 1A0HB 3RXTA 1QB6A 3RXRA 3KEEA 1AQ7A 1UCYH 4D7GA 3QDZB 1UO6A 2WPJS 4K1EA 3HKJB 3PROA 1SR5C 1T8NA 2TBSA 4Z0KA 2VB0A 3BTTE 1NS3A 3M5NA 3RXMA 2A5KA 1O2YA 3LKWA 1NN6A 1G2LA 1XVMA 4IMQA 1RTKA 4K8BA 1YCPK 1LPGB 2AGEX 4CBNA 3H7TA 3F68H 2ZFRH 4WMFA 1ZRBA 1A0LA 4ABHA 3VB5A 2GCTC 1SGDE 3VGCB 3ZZ6A 1ZPBA 2V0BA 2ZU2A 3S9CA 4BXSA 3BF6H 2VGCB 4ZKOU 5HMAA 2BD9A 5HGGA 3O8RA 5FHTA 1TBRH 2TGTA 1HDTH 1OP2A 1JRSA 1OYTH 1LPZB 1AWFH 4D76A 1AI8H 2SGEE 2P16A 4UONA 1OWHA 1TPAE 5T6DA 5T3HA 4K69A 3KQCA 2BZ6H 1BTPA 4Y7BA 7ESTE 4E7NA 4ABIA 1C5XB 1LCYA 1KTSB 1EPTC 2Y5GA 1C4U2 1FIZA 2PGQB 1C2JA 1MKWK 1KXCA 2ZU3A 4NA7A 2BD8A 2GMTC 1ETSH 3S7HB 3GYLB 1C5SA 3LT3A 5J4SA 3SZNA 1AKSB 1HJ8A 1A4WH 1GBJA 5E0HA 1SFIA 3P8GA 1N8OB 3A87A 1ARCA 4ABJA 3GCTF 3LGIA 2UUYA 5A09A 2CN0H 1G3BA 4NA8A 5I25A 1LVOA 1PYTC 2NU2E 1F5LA 2BD5A 3MNSA 4FUJA 3VB3A 3SNDA 1K1MA 3W95A 2W26A 2Y5FA 1SGTA 1B7XB 1GGDC 1O3LA 1DANH 2WPMS 1Q2WA 1SLUB 4AB9A 1YPHE 1FMGA 2XC5A 4I33A 1ELDE 1QQ4A 1XXDA 3BIUH 3V0XA 4JYTA 1DM4B 3A88A 1GJAB 1YPKH 3PMJA 3Q77A 3VB7A 4NWKA 1C1WH 5FCKA 2CXVA 1BTZA 5FX6A 3DHKH 3SBKA 3TU7H 1C1PA 3RDZA 1U6QA 3RXSA 3BIVH 1DS2E 1O3KA 3MWIU 3U69H 2ZPSA 1P10A 3BTFE 4VGCB 2F9OA 3T2NA 3QUMP 4BXWA 1FPHH 5F03A 1LPKB 3ZV9A 1BCUH 3SJKA 1TB6H 5ESTE 2GT7A 3E91A 1HXFH 1TMBH 1C2FA 2TGPZ 2VWLA 3DUXH 4H4FA 3UQOA 1P9SA 1GCTB 1K2I1 1WYKA 3OSYA 3R3GB 3AW0A 3A8AA 1AVWA 4SGBE 5JBCS 3FP7E 1AN1E 1GI0A 1ZR0A 1LMWB 1XXFA 4XBCA 1AUJA 3BG8A 2ESTE 2TIOA 3SORA 4DG4A 1UTQA 1VJ9U 2Q6FA 2ZFTA 1SGYE 2QN5T 3STJA 5JYIA 1O32A 3W94A 1MTUA 3TVJB 1GHBF 1HUTH 3PWBA 1DUEA 5C1UA 1BTWA 1BBRK 1C5MD 2Y81A 3ZYEA 1W11U 1D4PB 4AFQA 4X2YA 1GBLA 2PGBB 1ZJKA 3GY5A 1GI8B 2A2QH 2BOHB 4D9QA 1P02A 1QQUA 1HFDA 2GGVB 3ATWA 3LC3A 3UWJH 1C1MA 3UPEA 1P2IA 1Y3UA 2D26C 5EQQA 4FU8A 5SGAE 1GJBB 1BMNH 1AKSA 1O5CB 1XKBC 3PYHA 1V2KT 2Y7XA 2Z9KA 4X8UH 1MU8B 1W3CA 1KY9A 1THPB 3MYWA 3PWCA 1CA0B 2OTVA 1P2MA 2AGGX 2PSXA 4E05H 4O97A 7GCHG 1T32A 1PPEE 5FAHA 1JIRA 3A7YA 1K21H 3P95A 1AB9C 2Z9GA 1EUFA 2F3CE 1A3BH 2JH5D 2ANKH 1HAZB 4MTBA 3EGKH 4MNYA 1XVOA 2EEKA 2JH6D 2P8OC 1Y5AT 4GSOA 1BTUA 1YC0A 2W3KA 4OS4A 3A81A 1C9TA 2ZF0H 1P3CA 3D62A 4IS5A 4IN1A 1P2NA 1FLEE 1O2GH 3DT0H 1EZQA 4MNVA 5DG6A 3A7TA 5A8XA 4JZEH 4UFDH 3QN7A 1O3CA 1IQMA 1HAGE 1ABIH 3GCNA 3SO3A 1AHTH 3B8JA 2D1JA 1J8AA 5TCAA 2ZTZA 2A7CA 4FUEA 4FUIA 3SU5A 2HPPH 1T4VH 1MTSA 3M5OA 3OY6U 1DUAA 1IQHA 1BZXE 3LU9B 4ISNA 2XBXA 4JK6A 4UDWH 5EQSA 4D8NA 1BDAA 4ZH8A 2FESH 3MI4A 3M3TA 2J2UA 1SOZA 1TX7A 4MPUA 1KXEA 2D8WA 3BG4C 1GBHA 1GG6B 1TMTH 2G8TA 1QB9A 1ZSLA 4GHQA 3TH3H 3LH3A 4NCYA 2ZGBH 3QZQA 1UHBB 1MTWA 3L3TA 1NRNH 2PR3A 4XE4A 4BTIB 6CHAC 2BY6X 1O2TA 1EOLA 2G4UA 1AMHA 2VIQA 3RXOA 2CJIA 1GI1A 1ELCA 2QXJA 3QGNB 5HYOA 1Q31A 4WVPE 1HV7A 1JBUH 2J38A 1TE0A 2JETC 4X8SH 2HWLB 2A4RA 1NM6A 5DP6A 1HAVA 4FUFA 1S83A 3D65E 5LPEA 5J4QA 2ZHQH 4HGCA 2VIWA 3UWIA 3E16B 5F8ZA 5JB8S 1OWKA 5A8YA 4NSVA 1TGCA 3ATLA 4CHAB 3ZZ8A 1TRYA 4RSPA 1WTGH 2NU1E 1ZMLA 2M5TA 1SG8B 6LPRA 1TGNA 2HLCA 1CBWC 4MPWA 3RXUA 1SLWB 1UK2A 2DE8A 1L4ZA 1LQEA 2QXHA 4MG3A 1ZSJA 4ABFA 2BQ6B 4U30A 1QR3E 1S85A 1B5GH 2Z94A 1S81A 1O2JA 2IOTA 1O2NA 3ZZ7A 4H42U 4R8TB 1S0QA 1C5YB 2WV5A 3VXEH 1ESAA 4FUGA 2GD4B 1EAWA 3RXLA 3RXEA 2P95A 2BD4A 1TOCB 4KTSA 1KIGH 2XC4A 1N6XA 5FPSA 5K0HA 1UJ1A 1YPGH 4D9RA 1C5RA 1VCWA 1T4UH 2FYRA 2WINI 3K6YA 1ABJH 1QFKH 4OGYA 2FTLE 5EW1H 1ZMJA 3S69A 1CSOE 1Q3XA 4JK5A 1C2EA 2BDAA 2BYAX 4THNH 5FBIA 4Y8ZA 1VCPA 4DJZB 2HGTH 1P2OA 2XWBI 3GY6A 1O3FA 3IWMA 1SBWA 5JBTA 1DDJA 4CRGA 2R2WU 2H9TH 4AYYB 7GCHF 3LPRA 3GCHC 1NC6A 2A2XH 3KF2A 4X2VA 4WF8A 1O5BB 1BBRE 3ODDA 3KQDA 3A82A 1AD8H 3NXPA 3S9AA 3SJOA 1UHBA 3K2UA 1SVPA 1PQ8A 1MD7A 1D9IA 2J4IA 1TNIA 2BMGB 1AFEH 3BEFB 1FUJA 5C5NA 1JMOH 1UTLM 2BXUH 1EAUA 4X8VH 3LGTA 3BEIB 1CGJE 1WOFA 2BDGA 1MH0A 1GBAA 3A7XA 3TITA 2AH4X 1Z8JB 2BZAA 1AO5A 2WPLS 3RUOA 3RU4D 1TBQH 1C1QA 1F0SA 1O3JA 5A8ZA 4K2YA 2Z3DA 4NFFA 1DPOA 1N1LA 1Y3YA 4JYVH 2RG3A 1HXEH 1SGPE 2BY8X 3MTYA 1H9HE 2CV3A 3PLPA 4IN2A 1O3OA 1BUIA 5HXFA 3U8TH 4YM9A 4WXIA 2ZGCA 3SU3A 2AMPA 5DP4A 1J9CH 2YNAA 4Y6DA 4RN6A 5ESBA 1GMHF 1UTJA 3RXCA 1RJXB 1SSXA 1C1SA 3KHVA 1EB1H 1FN6A 1RTFB 2NU3E 1QBNA 4E7RG 9ESTA 2OC8A 2TRMA 2WPKS 4HI3A 3GCOA 1L1NA 5CHAB 1Y3XA 1GJ7B 1NRPH 1D3DB 1XUHA 1E38B 4JMYA 1FIWA 4KTUA 1NO9H 1LVYA 1GJ8B 5F8XA 1GHYH 4A7IB 4ZAEA 2P94A 1Y59T 2OINA 1EAIA 2V3HH 1O2MA 4CRBA 4ZXYH 2C3SA 2OC0A 1PPFE 4LZ1H 3TK6A 5L30H 2G5NA 2O8TA 1D6RA 1BOQA 1PQAA 4INLA 3SU2A 2F9PA 1INCA 1FONA 2Q6GA 1UK3A 1TAWA 2ZU1A 9LPRA 1C1UH 2BX3A 2P3UB 2QF0A 1K1NA 3A86A 1O5EH 4YT6H 3SQHE 3SUDA 1MCVA 5I46H 2ANYA 4F4OC 3QGJA 3M3SA 1VJAU 4ZHAA 1QCPA 2PLXA 4A5TS 1DWCH 3SJ9A 2HOBA 2VIDA 1WQVH 1XUKA 2XBWA 1F92A 1RIWB 3TH4H 2BTCE 1TPSA 1MBMA 3ATIA 2ULLA 1BTYA 1MKWH 2QIQA 2A32A 1MUEB 5EPYA 3F6UH 4HZHA 1EX3A 5EXLA 1ELTA 1GBMA 1W7GH 1KLJH 5FXLA 1SMFE 1DLEA 2A1DB 3TH2H 2FX4A 2O8LA 4O9VA 1QRWA 4KELA 1SC8U 1PQ7A 4ZKRU 3L33A 1DE7H 1D3TB 5AVDA 3I78A 1GDQA 1ORFA 4K3JA 5EXMA 6GCHG 1EJMA 1WQSA 1UTPA 3ZVEA 4O03A 3U9AH 1Y3VA 4NFEA 4A1TA 1C1TA 2ZPQA 3Q3KA 2FIRH 3ENSB 5JPMH 1SI5H 1GI3A 3SU0A 1C2MA 1FY8E 1SFQB 1EP5A 2HPQH 3MO6A 3A8BA 3MU4A 4FVBA 2F9BH 1ZJDA 5E8EH 3LOXA 1CHGA 3MH5A 5EW2H 3C27B 2BDYA 3BTGE 3TJNA 1Z1JA 2BDBA 2HNTF 4Y0ZE 3K6ZA 2GV7A 1HPGA 3QWCH 4KKDA 3BTHE 3SUGA 1UVSH 2ZDLA 8KME2 2CHAB 1ZTJA 1GI7B 2A4QA 3HPTB 3VXFH 1P11E 4AN7A 1HBTH 2BB4A 4CRDA 2J9NA 1TNGA 2AFQB 3P8OA 1KYNA 1YM0A 1O2QA 4I31A 4A1XA 3UNSA 1C5ZB 1LQDB 1OKXA 1N8OC 1GHZA 1O38A 1V2VT 1A0JA 2PUXB 5FX5A 4K5ZA 1D3PB 1MU6B 2OD3B 3B9FH 1G32B 3EDXB 3GDSA 4AG1A 3PMAB 2O8MA 3ZZCA 5C1YA 3V3MA 4I8LA 3TNSA 4X0WU 4B71A 2ZC9H 1O39A 2I6QA 4TY6A 1Y5UT 3OU0A 1BB0B 1ZTKA 1EAXA 2SFAA 1XX9A 1H4WA 1G3DA 1BBRH 4TWYA 2ODPA 4I8JA 2GDEH 1YKTA 3ZZ4A 2ZGHA 3M37A 2GZ7A 2BQ7B 4GLYA 1SLVB 1BTHH 1P01A 1H8DH 2A31A 5DPAA 1GI4A 4AFZA 3ZVCA 2ZHFH 3P92A 3M7QA 2HALA 4AFUA 1ARBA 4YLQH 1TMUH 1E36B 5AFZH 5GPIB 4CRAA 1TPOA 2C8ZB 2ZGJA 2RDLA 1BJVA 5F6MA 2WUBA 2WPIS 4VGCC 4YO9A 1YPJH 1LKAA 1AFQC 5IYTA 3CENA 1A7SA 1IOEA 5EOKA 2FX6A 1SGQE 1O2PA 3LDXH 2PHBA 2BD7A 2PKSC 3DFJA 1G3EA 1DT2A 4DURA 2GCTB 3EA7A 4IC6A 3MU0A 1VITG 3F9FA 2P93A 1O2VA 1YPEH 3O8DA 1QJ6B
chains in the Genus database with same CATH superfamily
1WUNH 1RFNA 4Q63A 4MNWA 1LKBA 2ASUB 3SZEA 2R3YA 3VG8A 1UTKA 3K9XB 1BMLA 1TLDA 1YLCA 2SNWA 5E0GA 4JZIA 2UUJB 1EXFA 1O2RA 1F0RA 2BY5X 1G37A 5K7RA 1P8VC 4K1SA 1W8BH 3PMHB 4NZLA 3ODFA 2IPHA 1C1RA 3NRLA 2VIPA 2WV9A 1EZXC 3OE7D 3ZVFA 3QZRA 4A6LA 2GMTB 2F91A 4JZFH 3GOVB 2C8XB 5A0BA 3UOPA 4ZMAH 1A1RA 3A7VA 1KTTB 4X1QU 1SGCA 1OWIA 4I8KA 3RC4A 3EQ0H 1PYTD 1TALA 1E37B 2BDCA 3M61U 1V2PT 1QBOA 4DOQA 2J5UA 4K60A 2FZZA 2I6SA 3KNXA 3P8NA 3Q00A 2PTCE 1MKXK 3ZVGA 5EJ1A 2ODQA 1GVZA 1GMDF 4YOJA 1GBTA 2KZ4A 4CR5A 1GGDB 1HYLA 6GCHF 1ZLRA 1AUTC 2STBE 1BMAA 1SKYE 1G36A 1MD8A 3E0NB 3F9HA 3BTEE 2GP9B 2JH0D 2PTNA 2HRVA 1QJ7B 2ILNA 1GBEA 1C5WB 1DLKB 2EI6A 1DSUA 5E0JA 4XDEA 1HRTH 3HKIB 1W13U 1GHXH 2R3UA 4Y8XA 1DY8A 1GBBA 2ZDMA 1BRUP 2B5TB 2FLBH 1TABE 2VVVA 4O3UA 3BTWE 1NROH 4YLUA 3U98H 2F83A 3VFEA 3IITA 3SV6A 2XRCA 2KAIB 1A5GH 1LHDH 4DT7B 3GS9A 1S6FA 1TNHA 2FI5E 5CMXH 1TQ0B 4X6MA 1O3IA 3BSQA 1FV9A 4NIVA 2XNDD 1ZSKA 2SGDE 4JYUH 1IQFA 5LPRA 3ITIA 1OOKB 1ZYOA 2FYQA 1E34B 1GBDA 3FZDA 4X6PA 3ATMA 5F53A 1SQRA 1V2WT 1EQ9A 2BLOA 3T62A 4ZROA 4M7GA 1MAYA 1ELVA 3OEHD 1H8ED 1V2LT 1GHVH 4TT3D 4Q7XA 1OP8A 3LJJA 1QNJA 4CREA 3RM0H 1GG6C 1KXDA 2Z9LA 4HTCH 4BOHA 1FY5A 3RXQA 1V2UT 2VWOA 4YESB 1TRMA 2ZGXH 1OYQA 2AIPA 3ZZBA 4Y7AA 3UR9A 1V2RT 2IJD1 3UY9A 1C9PA 1O5AB 1SGRE 2ZKSA 4UD9H 3U8OH 2WYJA 4YT7H 3SV9A 1AZZA 1OWDA 1THSH 4ESTE 3SI4H 1GBIA 2ALPA 2IN2A 2BLWA 1FPCH 2UWOA 1F7ZA 1L1JA 2FXRA 1IQEA 3PRDA 3BTME 3RC6A 1QBVH 1Z6EA 2J97A 3S7KB 4AGJA 2A45B 2SNVA 1GBKA 5DSFA 2ZPRA 2Q1JA 3PM3A 2VNTA 3HGPA 1QHRB 3SHCH 1D6WA 3T28A 1T8LA 1TOMH 2BLVA 3RXHA 2XBYA 1LVMA 1E1QD 1AB9B 5JDUB 1F0UA 2AEIH 2BDHA 4TY7A 1GHAG 2Z9IA 2P8OB 5C0UA 4GPGA 1WAYB 2B0FA 4XBDA 4ABAA 1HCGA 2AGIX 3SV2H 2OXSA 1ELAA 1C4V2 4ISLA 2ZQ2A 3ZZ5A 3QK1A 1FY4A 5A0AE 1V2TT 5L2ZH 1PJPA 5TCCA 2Y5HA 4BNRA 1O30A 5DJ7A 4B76A 3GY3A 2AMDA 1HAIH 4MPVA 2F9VA 4D7FA 5CDFE 5GWZA 3C1KA 2THFB 3SV8A 3FP6E 5ABWA 1TYNA 4UEHH 4XOJA 1X7AC 1C2DA 1DWBH 1XUJA 3MU1A 2ZWLH 1DWEH 5B6LA 2KAIA 2W7UA 1RGQA 3KQ5A 4Y10E 1FY3A 4X6NA 3MMGA 1IQLA 3TLOA 2ZECA 3OYPA 3M7TA 1BRCE 2FP7B 1HJ9A 5F8TA 3UUZA 4B2AA 3T26A 3MH6A 4PROA 2ANMH 2ZTYA 2QGRA 1O0DH 3MNXA 1GDUA 1FDPA 1ID5H 3RMMH 1NZQH 5GJ4B 3FZZA 1HAYB 2VJ1A 2Z6BD 4AX9H 1Z6JH 4X6OA 4WH8A 2XW9A 3BV9B 3VB6A 4Q7ZA 2ZFFH 1P9UA 2QXGA 5LH8A 3KL6A 3LGYA 1AU8A 1FNIA 1MTNB 2BD3A 1KLTA 1MZDA 3F2GA 1YPLH 1CU1A 3LC5A 3RMOH 2H9EH 3NZIA 2YMSC 5DKMA 2JETB 3RLWH 1QL7A 3FP8E 3CP7A 4U32A 1ESBA 4F49A 1IQGA 1W0ZU 1OS8A 3A83A 4J2YB 3TIUA 1SL3A 2GTBA 3LH1A 5GXPA 2V3OH 1K1OA 1V2JT 2ZU5A 1TQ7B 4HFPB 2V6NA 1G9IE 1WDIA 3R0FA 5C20A 1HJAB 2FMJA 3SNEA 2FOAA 4MVNA 4NA9H 1Z8RA 1CBWB 1KLIH 2ZZUH 1TFXA 1PPCE 1CGIE 1O2HA 1PFXC 2OBQA 3P8FA 3GY7A 2BM2A 1ANDA 2G81E 1HAHH 1ZHPA 3FANA 3M36A 1ELEE 3V12A 4I8GA 1OSSA 2HNTE 2WUCA 4TYDA 2BLQA 1F0TA 3CNRA 1Z7KA 1NRSH 1BRAA 2EQNA 5LPFA 1S6HA 1MBQA 4RI0A 1SGEE 3SNCA 1S82A 2PV9B 4B2BA 5AF9H 3GY8A 2BVSH 4OS5A 1GJ4H 2A0QB 4INHA 1NFXA 2YMSD 2FPZA 1YCPM 5EG4A 4BTUB 1C2GA 3RP2A 4DGJA 1GI6A 1TGBA 1O2OA 1TA2A 3TPIZ 3TGIE 3JZ2B 1W7XH 1MTVA 3FAOA 1OP0A 3UNQA 1AVXA 3MO3A 1LHGH 1NU9A 4U01A 4BAKB 5KEDA 1ANBA 1EKBB 2BY7X 5AHGH 3SHAH 1EJAA 1E0FD 1IAUA 2AYWA 3GDUA 3QTOH 2LPRA 1SGNE 1Y5BT 4KTCA 1CT4E 4LK4A 1DXWA 2UUFB 1WBGB 3UREA 4I8HA 4BAHB 4B6FA 3GISB 1QB1A 5FPTA 2F9UA 4I86A 1BJUA 5DO4H 1G30B 1GCDA 1DVAH 1C2IA 1NU7B 1BITA 2K1QA 5C1XA 3T5FH 1LVBA 3CS0A 4XFQA 1GHAF 1O36A 2F43B 2R2MB 1V2ST 3PO1C 2FS9A 1O35A 3SI3H 4O3TA 3ZVAA 2VIOA 2G5VA 3QX5H 4Q7YA 1ACBE 1V2MT 1VGCC 2Y6TA 3FN8A 1RIWC 1GJ5H 3Q76A 2XCNA 1C2HA 3MH7A 1MZAA 2ZDVH 2PWXA 3GY4A 3AASA 3OEED 2H9HA 3FFGA 1W0KD 1ELFA 1K1IA 3G01A 1SGFG 3F9EA 1UK4A 1B0EA 4MPXA 2KX4A 2YNBA 2QV1A 4Y79A 7LPRA 1QY6A 3RMNH 1TGSZ 3UOUA 3KIDU 1EFRD 2G4TA 1O3AA 5T6GA 2QF5A 1TGTA 3QLPH 3KCGH 2H1UA 2H5DA 5IK2D 1LTOA 3SNAA 1NFYA 1V2NT 4X1NU 2QYIA 3A84A 1V2QT 1SQAA 4P02A 1TBZH 3SNBA 2VVUA 5GDSH 2O8UA 1SGIB 2H5CA 5BRRE 1K28D 1QA0A 2TPIZ 1MAXA 1RRKA 1QL9A 3E1XB 1ZGIA 3SGQE 1YPHC 4AFSA 3RU4E 1LDTT 2C93B 1ZGVA 3LGWA 2JJ2D 5GNDA 1KXBA 1O2UA 4MLFB 4RKOB 1FI8A 3EE0B 3U1JB 2QA9E 2GDDA 2ZHWH 1T8MA 5A2MH 1ZHRA 2HVYB 1FQ3A 3LGVA 1WU1A 1IQJA 1P03A 1P04A 1DX5M 1AE8H 3QO6A 2VINA 1P09A 4UFEH 3RC5A 2ZU4A 4AZ2B 5FCRA 3SGAE 3T29A 1UW7A 3KQBA 4RKJB 5PTPA 2RCEA 3E90B 2OLGA 2WV4A 3RMLH 3DD2H 1NRQH 1AWHB 5E2OA 3VGCC 4X2XA 1NFUA 1GI5A 2A7HA 2GT8A 1O3DA 1TONA 2SGQE 2QY0B 2PSYA 2BHGA 1ZZZA 1J16A 2VGCC 2FOFA 1Y3WA 2C90B 4DW2U 5EU8A 3ZV8A 3WY8A 1ZTLA 4GCHG 4NWLA 2ZDAH 1H8IH 1JWTA 1XUFA 2FOGA 1P57B 2FI3E 2OCVB 1TPPA 1J14A 1HIAB 3ZZ3A 1QGFA 1GPZA 1RS0A 3P70B 3NK8A 2FWWA 1BHXB 5L6NH 2ZCLP 3SYJA 4QT8C 2VU8E 1UVTH 1BT7A 2AMQA 2F9NA 3CS7A 3SU4A 5DP5A 1LHFH 1UVOA 1C5PA 1W10U 2R0KA 3TJOA 5HM9A 2FOHA 4A92A 1F2SE 3TJUA 5JBAS 2TGAA 1HB0B 1W12U 3LONA 4AG2A 4B2CA 1QRXA 5GCHG 1C5VA 1CT0E 1C5NH 1RTLA 1C5UA 3ZZ9A 3TK5A 1BRBE 3T27A 4NIWA 4YOGA 1ZPZA 1WTHD 2ZDNA 4X2WA 2XC0A 1C2LA 3A89A 2O8WA 1YLDA 2FS8A 4NZQA 3D49H 4AC9A 2ZHDA 3SOSA 1ANEA 1MKXH 1A61H 2G00A 1UTOA 2LNCA 1O31A 5LGOA 1O5GH 2PFEA 4SGAE 4M9FA 1TRNA 5CE1A 5AFYH 8GCHG 3V13A 4NIYA 3RXKA 1SLXB 1RXPA 1P2QA 1XM1A 3RXBA 4B73A 3TGJE 5E2PA 4B74A 3NPSA 3MU5A 1L4DA 1GI2A 4X1PU 3SQEE 2EC9H 1IQNA 1B0FA 4YZUA 4K8YA 1O5DH 1A5HA 1C5OH 1YF4A 1GMCG 4FETA 1SQTA 5H4IB 1GVLA 4DT4A 1IHSH 1OX1A 1C4Y2 2NU0E 3S0NA 1GL1A 1CGHA 3BTKE 1XMNB 2G55A 3O8CA 2ZI2H 4WJG2 3OY5U 4BTTB 1EATA 3KN2A 2WHXA 1YY3A 2OP9A 5L2YH 4NSYA 4TWWA 2KCAA 3LJOA 4DY7B 2PW8H 4H6TA 1QIXB 4J1YA 1GCTC 4ISOA 4FOUC 4ACBA 4DIHH 4LZ4B 3ZYDA 1EP6A 2ZNKH 3I29A 5DP3A 2FODA 4NGAH 2OC7A 2AS9A 2W3IA 4OS6A 4MQAA 2DE9A 3BTQE 1K22H 1T7CA 1EB2A 1E35B 4IBLH 2ZG0H 4ZHMU 2B9LA 1PQ5A 1KXAA 1HIAA 2Y80A 1SQOA 2J98A 3E3TA 1EPTB 3MO9A 1XUGA 1ELGA 1UCYK 2NU4E 3LGUA 4NG9H 1AE5A 2EA3A 4XBBA 5C67A 1P0SH 2BX4A 1K1PA 1O3PB 1UVPA 3SV7A 3TK9A 1NRRH 2H6MA 1UVUH 1HAOH 4ISIH 3O8BA 1NTPA 2CMYA 2WZQA 2ZFPH 1AFQB 4X1SU 1CA0C 3PV2A 1NT1A 1JXPA 5JB9S 3DFLA 4OS1A 3U1IB 3GICB 1SHHB 2IJOB 5DK1A 1DICA 2GCHG 1TA6A 2PKSB 1C2KA 2GKVE 1TWXB 2FM2A 1M9UA 3F0PA 2BDIA 2XTTB 1OWEA 4FVDA 1O3BA 2OQ5A 2Y7ZA 1ZPCA 2B7DH 1DXPA 4ASHA 2ZFSA 4AOQA 1W2KH 2W7SA 2VIVA 1FY1A 1H9LB 3BTDE 4GCHF 4NIXA 3BN9A 1HLTH 4Y0YE 1ANCA 2XWAA 3SGBE 4XSKU 1O3HA 4IW4E 4AYVB 3A80A 1K0HA 1GI9B 2P3TB 4UE7H 1WSSH 1O2LA 3NKKA 1GWAA 2FEQH 1GBCA 1BMMH 1O34A 1OHHD 1EZSC 5C2ZA 1H1BA 1QA7A 1V6DA 4FUCA 5HKKD 1W0JD 2Z7FE 2UWPA 1HAVB 1TIOA 5HIYA 1P3EA 2STAE 5GCHF 3A7WA 5T6FA 4FUHA 1CE5A 4MDSA 3ZVBA 3RXFA 2ZCHP 4JZDH 2J34A 2GX4A 3EAJA 2C4FH 1C1NA 3PLBA 4Y76A 2SGFE 1HNEE 3E0PB 1J15A 2ZHEH 2O9QA 4ABBA 2XNIA 5B6OA 1K1JA 3VEQB 1GL0E 2OBOA 2C8WB 1BMFD 4FUBA 1IHTH 5FL7D 2FOBA 3AAVA 3N7OA 1AY6H 1CA8B 8GCHF 4B1TA 1EPTA 2Z3CA 1Y8TA 3UIRA 1THRH 4I32A 5EPNA 3KQEA 3H7OA 4KP0A 1SPJA 3LIWA 1KSNA 1N6YA 2CF8H 1AZ8A 1W14U 2HNTC 3EYDA 1QRZA 1A3EH 1J17T 4OGXA 1BIOA 3RM2H 4ACAA 1FZZA 3M5MA 1GMCF 4K1TA 3UQVA 1CHOG 2A5IA 2A5AA 1C5QA 1MQ6A 3KGPA 3WWBA 4GAWA 2RFKC 3M35A 1T31A 1LHCH 1DFPA 4CHAC 1S0RA 2PKAB 2BVXH 2SGAA 5EODA 2K0QA 3VPKA 1LO6A 4WWYA 3RXDA 1AGJA 1QTFA 2FOCA 1FJSA 1O3GA 6ESTA 1BQYA 1VITF 4A1VA 1O2ZA 1A2CH 1GMHG 4ZKNU 1BHXF 1Z1IA 2J92A 1O2WA 2EI8A 4FU9A 3SU6A 3URCA 1NPMA 4INKA 2RA3A 2UUKB 5IDKA 2ANWA 3RXPA 3SUEA 1HAPH 1F5KU 1P2JA 2AERH 3V7TA 1FN8A 3MNBA 3ELAH 3M3VA 2VH0A 4WMEA 3RXAA 3SU1A 2ZEBA 5DP9A 2QF3A 4DCDA 1O2KA 4BANB 2XOKD 2C8YB 4KGAA 1O2XA 1O2IA 2OK5A 2XCFA 1MTNC 4ZKSU 1OXGA 2ZQ1A 2UWLA 2V3MA 1OWJA 1XKAC 3F9GA 3S9BA 3PV4A 1Z71A 5GIBA 2L6OA 3A7ZA 1UMAH 1VR1H 4X8TH 1JRTA 1G2MA 2A7JA 1T8OA 5G4BA 7KMEH 5DP7A 3RXGA 1ZOMA 2OUAA 1O3NA 2VH6A 3PMBB 1EASA 3EA8A 2BD2A 1TNKA 3AVZA 3MHWU 2FI4E 3BG4B 1CQQA 1F5RA 1TX6A 3Q3YA 1ELBA 1HJAC 1ETTH 1LHEH 2FLRH 1NFWA 2GCHF 3PTBA 3H09A 2WYGA 3F1SB 2Q6DA 2JJ1D 1S6LA 1VITH 4Z1MD 6CHAB 1Z8IB 1OPHB 5FPYA 1DSTA 1KDQB 1L1GA 3FVFB 2G51A 1UCYE 1V2OT 2R0LA 4JZ1A 1QJ1B 1C1OA 5EXNA 1GJ9B 1ETRH 4LOYH 4DVAU 4JCNA 2LP6A 3TJVA 4ZXXH 1FX0B 3ZVDA 2ZA5A 1CO7E 1NBMD 4E06H 3SN8A 4CRFA 4BAOB 1O3EA 4ABDA 4YTAA 4CRCA 5C5OA 2ZIQH 3Q3XA 3HATH 3GYMA 2QAAA 3RXJA 4CBOA 4U2WA 1MCTA 4ABEA 2HLDD 4AORA 1C5LH 1JOUB 1MABB 1L2EA 3RU4T 3L6PA 2CGAA 3TNTA 3STIA 3NCLA 3MU8A 3ZZAA 1MMJN 1O3MA 1ZHMA 2QC2A 2K8IA 3IG6B 4B75A 1MQ5A 2PKAA 2P59A 1O5FH 3RXVA 4Y8YA 2VWNA 3UAIC 2H2ZA 2JIZD 2V35A 8LPRA 3SUFA 3PTNA 2AIQA 1KXFA 4IGDA 2P3FH 2DUCA 5EJLA 1GVKB 1O33A 2WPHS 3GY2A 1L0ZA 3ATKA 1SOTA 1RD3B 1E1RD 1UTNA 1H9IE 2KM0A 2YOLA 2A4GA 3MNCA 1K1LA 1EOJA 4Z6AH 1H8HD 3P17H 5C3NA 3PLKA 3AW1A 2FOMB 3QTVH 4GVUA 1TNLA 3UTUH 1YYY1 1A46H 2BY9X 2W5EA 5CHAC 1GJ6A 4X1RU 3SU0A 1AIXH 3URDA 4ZHLU 2BQWB 1SHYA 1HGTH 1P2KA 1PPZA 2D2DA 3HGNA 2YMSB 2HVXA 3K65B 5KECA 1C5TA 4GUXA 1EJNA 3M7UA 2CF9H 2PUQH 2J94A 4GHTA 1VCQA 1IQIA 3N7EA 4ASUD 5DP8A 2FDAA 1GJDB 2G52A 4FUDA 1EZUC 1SB1H 4WH6A 1NESE 3I77A 2VWMA 1YP9A 1CHOF 4UFGH 3SJIA 3P6ZB 1NY22 2NWNA 4WY3A 1G3CA 4WXVA 4I7YH 2XYAA 3EA9A 2TGDA 4Q4LA 3E8LA 1DOJA 2ZFQH 3NUMA 4CH8B 5FBEA 3OTJE 3A8CA 3GCHB 1JIMA 3H5CB 3MOCA 1DWDH 3ESTA 4Q80A 3U8RH 2ALVA 3A85A 5TJXA 1KDQA 1P05A 2BXTH 3JZ1B 1FXYA 2Z9JA 2KFWA 1TX8A 5DGJA 3SJ8A 1WV7H 1O37A 2FTMA 3VB4A 4TPIZ 3GCTG 1DITH 1PPBH 3RLYH 4RT0A 4AGKA 1BTXA 2ZCKP 3OX7U 1S84A 2ZP0H 1FAKH 1QURH 2OQUA 4AB8A 3D23A 2RA0A 3WW7A 1ZRKA 1YBWA 1K9OE 2R9PA 3UR6A 2VVCA 3M5LA 1YGCH 1GJCB 3HK6B 1AVGH 3E6PH 1YCPH 4Y71A 3GDVA 1SGFA 4R0IA 1Z8GA 1IQKA 1COWD 2ZDKA 1P06A 3T25A 1QL8A 4WMDA 1DY9A 1GDNA 3BEUA 4ABGA 3UFAA 2J95A 4ISHH 3ZZDA 1PPGE 2FO9A 2ODYB 4FXGH 2Y82A 4IMZA 4LXBH 1V3XA 4DIIH 4UFFH 1XUIA 3F2HA 3UNRA 3NWUA 3PO1B 2Z3EA 2QXIA 1P12E 4CR9A 2CHAC 2OC1A 3OTPA 1A5IA 4MNXA 2GV6A 2ZO3H 3AAUA 1CVWH 3B23B 1VGCB 2B8OH 2BOKA 1S5SA 1PPHE 3A8DA 2XXLA 4CH2B 3HK3B 3DA9B 1GBFA 1BA8B 1C1VH 2QCYA 4Q2KA 3PRBA 4IC5A 1CT2E 2GZ8A 4Y11E 3SW2B 3MH4A 4OS7A 5EQRA 2FOEA 1WCZA 4OS2A 4H6SB 4TPYA 1VZQH 2EY4C 1ESTA 1TNJA 1W0YH 2SGPE 5JBBS 1D3QB 1GMDG 1HAXB 3MFJA 2ZTXA 1GHBG 2JKHA 2GVFA 5ETXA 5HM2A 2A4OA 4BAQB 1GHWH 2XBVA 5A0CA 1ZMNA 2BVRH 8ESTE 4FU7A 1O2SA 5BPEA 3TGKE 1FAXA 1UTMA 1YPMH 4YOIA 3PB1E 3RXIA 2EI7A 2GZ9A 4BAMB 4ZUHA 5EGMA 1A0HB 3RXTA 1QB6A 3RXRA 3KEEA 1AQ7A 1UCYH 4D7GA 3QDZB 1UO6A 2WPJS 4K1EA 1KMHB 3HKJB 3PROA 1WXRA 1SR5C 3WWFA 1T8NA 2TBSA 4Z0KA 2VB0A 3BTTE 1NS3A 3M5NA 3RXMA 2A5KA 1O2YA 3LKWA 1NN6A 1G2LA 1XVMA 4IMQA 1RTKA 4K8BA 1YCPK 1LPGB 2AGEX 4CBNA 3H7TA 3F68H 2ZFRH 4WMFA 1ZRBA 1A0LA 4ABHA 3VB5A 2GCTC 1SGDE 3VGCB 3ZZ6A 1ZPBA 2V0BA 2ZU2A 3S9CA 4BXSA 3BF6H 2VGCB 4ZKOU 5HMAA 2BD9A 5HGGA 3O8RA 5FHTA 1TBRH 2TGTA 1HDTH 1OP2A 1JRSA 1OYTH 1LPZB 5C0TA 1AWFH 4D76A 1AI8H 2SGEE 2P16A 4UONA 1OWHA 1TPAE 5T6DA 2W6JD 5T3HA 4K69A 3KQCA 2BZ6H 4XRNA 1BTPA 4Y7BA 7ESTE 5T1VA 4E7NA 4ABIA 1C5XB 1LCYA 1KTSB 1EPTC 2Y5GA 1C4U2 1FIZA 2PGQB 1C2JA 1MKWK 1KXCA 2CK3D 2ZU3A 4NA7A 2BD8A 2GMTC 1ETSH 3S7HB 3GYLB 1C5SA 3LT3A 5J4SA 3SZNA 1AKSB 1HJ8A 3N7DA 1A4WH 1GBJA 5E0HA 1SFIA 3P8GA 4HG6A 1N8OB 3A87A 1ARCA 4ABJA 3GCTF 3LGIA 2UUYA 5A09A 2CN0H 1G3BA 2W6ID 4NA8A 5I25A 1LVOA 1PYTC 2IPQX 2NU2E 1F5LA 2BD5A 3KYFA 3MNSA 4FUJA 3VB3A 3SNDA 1K1MA 3W95A 2W26A 2Y5FA 1SGTA 1B7XB 1GGDC 3FOAA 1O3LA 1DANH 2WPMS 1Q2WA 1SLUB 3AK5A 4AB9A 1YPHE 1FMGA 2XC5A 4I33A 1ELDE 1QQ4A 1XXDA 2VBCA 3BIUH 3W1EA 3V0XA 4JYTA 1DM4B 3A88A 1GJAB 1YPKH 3PMJA 3Q77A 3VB7A 4NWKA 1C1WH 5FCKA 2CXVA 1BTZA 5FX6A 3DHKH 3SBKA 3TU7H 1C1PA 3KYGA 3OAAD 1U6QA 3RDZA 3RXSA 3BIVH 1DS2E 1O3KA 3MWIU 3U69H 2ZPSA 2KCPA 1P10A 3BTFE 4VGCB 2F9OA 3T2NA 3QUMP 3DCLA 4BXWA 1FPHH 5F03A 1LPKB 1YWUA 3ZV9A 1BCUH 3SJKA 1TB6H 5ESTE 2GT7A 3E91A 1HXFH 1TMBH 1C2FA 2TGPZ 2VWLA 2KR7A 3DUXH 4H4FA 3UQOA 1P9SA 1GCTB 1K2I1 1WYKA 2GJGA 3OSYA 3R3GB 3AW0A 3A8AA 1AVWA 4SGBE 5JBCS 3FP7E 1AN1E 1GI0A 1ZR0A 1LMWB 1XXFA 4XBCA 1AUJA 3BG8A 2ESTE 2TIOA 3SORA 4DG4A 1UTQA 1VJ9U 2Q6FA 2ZFTA 1SGYE 2QN5T 3STJA 5JYIA 1O32A 3W94A 1MTUA 3TVJB 1GHBF 1HUTH 3PWBA 1DUEA 5C1UA 1BTWA 1BBRK 1C5MD 2Y81A 3ZYEA 1W11U 1D4PB 4AFQA 4X2YA 1GBLA 2PGBB 1ZJKA 3GY5A 1GI8B 2A2QH 2BOHB 4D9QA 1P02A 1QQUA 1HFDA 2GGVB 3ATWA 3LC3A 3UWJH 1C1MA 3UPEA 1P2IA 1Y3UA 3F3BA 2D26C 5EQQA 4FU8A 5SGAE 1GJBB 1BMNH 1AKSA 1O5CB 1XKBC 4XD7D 3PYHA 1V2KT 2Y7XA 2Z9KA 4X8UH 1MU8B 1W3CA 1KY9A 1THPB 3MYWA 3PWCA 1CA0B 2OTVA 3F2FA 1P2MA 2AGGX 2PSXA 4E05H 4O97A 7GCHG 1T32A 1PPEE 5FAHA 1JIRA 3A7YA 1K21H 3P95A 1AB9C 1VKYA 2Z9GA 1EUFA 2F3CE 1A3BH 2JH5D 2ANKH 1HAZB 4MTBA 3EGKH 4MNYA 1XVOA 2EEKA 2JH6D 2P8OC 1Y5AT 4GSOA 1BTUA 1YC0A 2W3KA 4OS4A 3A81A 1C9TA 2ZF0H 1P3CA 3D62A 4IS5A 5C17A 4IN1A 3U28C 1P2NA 1FLEE 1O2GH 3DT0H 1EZQA 4MNVA 5DG6A 3A7TA 5A8XA 4JZEH 4UFDH 3QN7A 1O3CA 1IQMA 1HAGE 1ABIH 3GCNA 3SO3A 1AHTH 3B8JA 2D1JA 1J8AA 5TCAA 2ZTZA 2A7CA 4FUEA 4FUIA 3SU5A 2HPPH 1T4VH 1MTSA 3M5OA 3OY6U 1DUAA 1IQHA 1BZXE 3LU9B 4ISNA 2XBXA 4JK6A 4UDWH 5EQSA 4D8NA 2LELA 1BDAA 4ZH8A 2FESH 2WSSD 4TSFD 3MI4A 3M3TA 2J2UA 1SOZA 1TX7A 4MPUA 1KXEA 2D8WA 3BG4C 1GBHA 1GG6B 1TMTH 2G8TA 1QB9A 1ZSLA 4GHQA 3TH3H 3LH3A 4NCYA 2ZGBH 3QZQA 1UHBB 1MTWA 3L3TA 1NRNH 2PR3A 4XE4A 4BTIB 6CHAC 2BY6X 1O2TA 1EOLA 2G4UA 1AMHA 2VIQA 3RXOA 2CJIA 1GI1A 1ELCA 2QXJA 3QGNB 5HYOA 1Q31A 4WVPE 1HV7A 3DSPA 1JBUH 2J38A 2JDID 1TE0A 2JETC 5DN6D 4X8SH 2HWLB 5EIYA 2A4RA 1NM6A 5DP6A 1HAVA 4FUFA 1S83A 3D65E 5LPEA 5J4QA 2ZHQH 4HGCA 2VIWA 3UWIA 3E16B 5F8ZA 5JB8S 1OWKA 5A8YA 4NSVA 1TGCA 3ATLA 4CHAB 3ZZ8A 1TRYA 4RSPA 1WTGH 2NU1E 1ZMLA 2M5TA 1SG8B 6LPRA 1TGNA 2HLCA 1CBWC 4MPWA 2L74A 3RXUA 1SLWB 1UK2A 2DE8A 1L4ZA 1LQEA 2QXHA 4MG3A 1ZSJA 4ABFA 2M2AA 2BQ6B 2F4LA 4U30A 1QR3E 1S85A 1B5GH 2Z94A 1S81A 4RT1A 1O2JA 2IOTA 1O2NA 3ZZ7A 2V7QD 4H42U 4R8TB 1S0QA 1C5YB 2WV5A 3VXEH 1ESAA 4FUGA 2GD4B 5EJZA 1EAWA 3RXLA 3RXEA 2P95A 2BD4A 1TOCB 4KTSA 1KIGH 2XC4A 1N6XA 5FPSA 5K0HA 1UJ1A 1YPGH 4D9RA 1C5RA 1VCWA 1T4UH 2FYRA 2WINI 3K6YA 1ABJH 1QFKH 4OGYA 2FTLE 5EW1H 1ZMJA 3S69A 1CSOE 1Q3XA 1QZ8A 4JK5A 1C2EA 2BDAA 2BYAX 4THNH 5FBIA 4Y8ZA 3UB0A 1VCPA 4DJZB 2HGTH 1P2OA 2XWBI 3GY6A 1O3FA 3IWMA 1SBWA 5JBTA 1DDJA 4CRGA 2R2WU 2H9TH 4AYYB 7GCHF 3LPRA 3GCHC 1NC6A 2A2XH 2RDEA 3KF2A 4X2VA 4WF8A 1O5BB 1BBRE 3ODDA 3KQDA 3A82A 1AD8H 3NXPA 3S9AA 3SJOA 1UHBA 3K2UA 1SVPA 1PQ8A 1MD7A 1D9IA 2J4IA 1TNIA 2BMGB 1AFEH 3FO8D 3BEFB 1FUJA 5C5NA 1JMOH 1UTLM 2BXUH 1EAUA 4X8VH 3LGTA 3BEIB 1CGJE 1WOFA 2BDGA 1MH0A 1GBAA 3A7XA 3TITA 2AH4X 1Z8JB 2BZAA 1AO5A 3MQKC 2WPLS 3RUOA 3RU4D 1TBQH 1C1QA 1F0SA 1O3JA 5A8ZA 4K2YA 2Z3DA 4NFFA 1DPOA 1N1LA 1Y3YA 4JYVH 2RG3A 1HXEH 1SGPE 2BY8X 3MTYA 1H9HE 2CV3A 3PLPA 4IN2A 1O3OA 1BUIA 5HXFA 3U8TH 4YM9A 4WXIA 2ZGCA 3SU3A 2AMPA 5DP4A 1J9CH 5KGOA 2YNAA 4Y6DA 4RN6A 5ESBA 1GMHF 1UTJA 3RXCA 1RJXB 1SSXA 1C1SA 1NBME 3KHVA 1EB1H 1FN6A 1RTFB 2NU3E 1QBNA 4E7RG 9ESTA 2OC8A 4P00A 2TRMA 4B6EA 2WPKS 4HI3A 3GCOA 1L1NA 5CHAB 1Y3XA 1GJ7B 1NRPH 1D3DB 1XUHA 1E38B 4JMYA 1FIWA 4KTUA 1NO9H 1LVYA 1GJ8B 3F0OA 5F8XA 1GHYH 4A7IB 4ZAEA 2P94A 1Y59T 2OINA 3PV5A 1EAIA 2V3HH 1O2MA 4CRBA 4ZXYH 2C3SA 2OC0A 1PPFE 4LZ1H 3TK6A 5L30H 2G5NA 2O8TA 1D6RA 1BOQA 1PQAA 4INLA 3SU2A 2F9PA 1INCA 1FONA 2WPDD 2Q6GA 1UK3A 1TAWA 2ZU1A 9LPRA 1C1UH 2BX3A 2P3UB 2QF0A 1K1NA 3A86A 1O5EH 4YT6H 3SQHE 3SUDA 1MCVA 5I46H 2ANYA 4F4OC 4F48B 3QGJA 3M3SA 1VJAU 4ZHAA 1QCPA 2PLXA 4A5TS 1DWCH 3SJ9A 2AHME 2HOBA 2VIDA 1WQVH 1XUKA 4F55A 2XBWA 1F92A 1RIWB 3TH4H 4ZCNA 2BTCE 1TPSA 1MBMA 2KCYA 3ATIA 2ULLA 1BTYA 1MKWH 2QIQA 2A32A 1MUEB 5EPYA 3F6UH 4HZHA 1EX3A 5EXLA 1ELTA 1GBMA 1W7GH 1KLJH 5FXLA 1SMFE 1DLEA 2A1DB 3TH2H 2FX4A 2O8LA 4O9VA 1QRWA 4KELA 1SC8U 1PQ7A 4ZKRU 3L33A 1DE7H 1D3TB 5AVDA 3I78A 1GDQA 1ORFA 4K3JA 5EXMA 6GCHG 1EJMA 1WQSA 1UTPA 3ZVEA 4O03A 3U9AH 1Y3VA 4NFEA 4A1TA 1C1TA 2ZPQA 3Q3KA 2FIRH 3ENSB 5JPMH 1E79D 1GI3A 1SI5H 1C2MA 1FY8E 1SFQB 1EP5A 2HPQH 3MO6A 3A8BA 3MU4A 4FVBA 2F9BH 1ZJDA 5E8EH 3LOXA 1CHGA 3MH5A 3OFND 3C27B 5EW2H 2BDYA 3BTGE 3TJNA 1Z1JA 2BDBA 2HNTF 4Y0ZE 3K6ZA 2GV7A 1HPGA 3QWCH 4KKDA 2J98B 3BTHE 3SUGA 1UVSH 2ZDLA 8KME2 2CHAB 1ZTJA 1GI7B 2A4QA 3HPTB 3VXFH 1P11E 4AN7A 1HBTH 2BB4A 4CRDA 5HIZA 2J9NA 1TNGA 2AFQB 3P8OA 1KYNA 1YM0A 1O2QA 4I31A 4A1XA 2PP6A 1C5ZB 1LQDB 1OKXA 1N8OC 3UNSA 1GHZA 1O38A 1V2VT 1A0JA 2PUXB 5FX5A 4K5ZA 1D3PB 1MU6B 2OD3B 3B9FH 1G32B 3EDXB 3GDSA 4AG1A 3PMAB 2O8MA 3ZZCA 5C1YA 3V3MA 4I8LA 3DSOA 3TNSA 3ZIAD 4X0WU 4B71A 2KCOA 2ZC9H 1O39A 5CHBA 2I6QA 3FKSD 4TY6A 1Y5UT 3OU0A 1YLNA 1BB0B 1ZTKA 1EAXA 2SFAA 1XX9A 1H4WA 1G3DA 1BBRH 2QE7D 4TWYA 2ODPA 3DSGA 4I8JA 5C94A 2GDEH 1YKTA 3ZZ4A 2ZGHA 3M37A 2GZ7A 2BQ7B 4GLYA 1SLVB 1BTHH 1P01A 1H8DH 2A31A 5DPAA 1GI4A 4AFZA 3ZVCA 2ZHFH 3P92A 3M7QA 2HALA 4AFUA 1ARBA 4YLQH 1TMUH 1E36B 5AFZH 5GPIB 4YXWD 4CRAA 1TPOA 2C8ZB 2ZGJA 2RDLA 1BJVA 5F6MA 2WUBA 2WPIS 4VGCC 4OM9A 4YO9A 1YPJH 1LKAA 1AFQC 5IYTA 3CENA 1A7SA 1IOEA 2QF4A 5EOKA 2FX6A 1SGQE 1O2PA 3LDXH 2PHBA 2BD7A 2PKSC 3DFJA 3N99A 1G3EA 1DT2A 4DURA 2GCTB 3EA7A 4IC6A 3MU0A 1VITG 3F9FA 2P93A 3EE7A 1O2VA 1YPEH 3O8DA 1QJ6B
chains in the Genus database with same CATH topology
1WUNH 1RFNA 4MNWA 1LKBA 2ASUB 2R3YA 1UTKA 3K9XB 1BMLA 1TLDA 1YLCA 2SNWA 5E0GA 4JZIA 2UUJB 1EXFA 1O2RA 1F0RA 2BY5X 1G37A 5K7RA 1P8VC 4K1SA 1W8BH 3PMHB 4NZLA 3ODFA 2IPHA 1C1RA 2VIPA 1EZXC 3ZVFA 3QZRA 4A6LA 2GMTB 2F91A 4JZFH 3GOVB 2C8XB 5A0BA 3UOPA 4ZMAH 1A1RA 3A7VA 1KTTB 4X1QU 1SGCA 1OWIA 4I8KA 3RC4A 3EQ0H 1PYTD 1TALA 1E37B 2BDCA 3M61U 1V2PT 1QBOA 4DOQA 4K60A 2FZZA 2I6SA 3KNXA 3P8NA 3Q00A 2PTCE 1MKXK 3ZVGA 2ODQA 1GVZA 1GMDF 4YOJA 1GBTA 4CR5A 1GGDB 1HYLA 6GCHF 1ZLRA 1AUTC 2STBE 1BMAA 1G36A 1MD8A 3E0NB 3F9HA 3BTEE 2GP9B 2JH0D 2PTNA 2HRVA 1QJ7B 2ILNA 1GBEA 1C5WB 1DLKB 2EI6A 1DSUA 5E0JA 4XDEA 1HRTH 3HKIB 1W13U 1GHXH 2R3UA 4Y8XA 1DY8A 1GBBA 2ZDMA 1BRUP 2B5TB 2FLBH 1TABE 2VVVA 4O3UA 3BTWE 1NROH 4YLUA 3U98H 2F83A 3VFEA 3IITA 3SV6A 2XRCA 2KAIB 1A5GH 1LHDH 4DT7B 1S6FA 1TNHA 2FI5E 5CMXH 1TQ0B 4X6MA 1O3IA 3BSQA 1FV9A 4NIVA 1ZSKA 2SGDE 4JYUH 1IQFA 5LPRA 3ITIA 1OOKB 1ZYOA 2FYQA 1E34B 1GBDA 3FZDA 4X6PA 3ATMA 1V2WT 1EQ9A 2BLOA 3T62A 4ZROA 4M7GA 1MAYA 1ELVA 1V2LT 1GHVH 4Q7XA 1OP8A 3LJJA 1QNJA 4CREA 3RM0H 1GG6C 1KXDA 2Z9LA 4HTCH 4BOHA 1FY5A 3RXQA 1V2UT 2VWOA 4YESB 1TRMA 2ZGXH 1OYQA 2AIPA 3ZZBA 4Y7AA 3UR9A 1V2RT 3UY9A 1C9PA 1O5AB 1SGRE 2ZKSA 4UD9H 3U8OH 2WYJA 4YT7H 3SV9A 1AZZA 1OWDA 1THSH 4ESTE 3SI4H 1GBIA 2ALPA 2IN2A 2BLWA 1FPCH 2UWOA 1F7ZA 1L1JA 2FXRA 1IQEA 3BTME 3RC6A 1QBVH 1Z6EA 3S7KB 4AGJA 2A45B 2SNVA 1GBKA 2ZPRA 2Q1JA 3PM3A 2VNTA 3HGPA 1QHRB 3SHCH 1D6WA 3T28A 1T8LA 1TOMH 2BLVA 3RXHA 2XBYA 1LVMA 1AB9B 5JDUB 1F0UA 2AEIH 2BDHA 4TY7A 1GHAG 2Z9IA 2P8OB 4GPGA 1WAYB 2B0FA 4XBDA 4ABAA 1HCGA 2AGIX 3SV2H 2OXSA 1ELAA 1C4V2 4ISLA 2ZQ2A 3ZZ5A 3QK1A 1FY4A 5A0AE 1V2TT 5L2ZH 1PJPA 5TCCA 2Y5HA 4BNRA 1O30A 5DJ7A 4B76A 3GY3A 2AMDA 1HAIH 4MPVA 2F9VA 4D7FA 5GWZA 3C1KA 2THFB 3SV8A 3FP6E 5ABWA 1TYNA 4UEHH 4XOJA 1X7AC 1C2DA 1DWBH 1XUJA 3MU1A 2ZWLH 1DWEH 2KAIA 2W7UA 1RGQA 4Y10E 1FY3A 4X6NA 3MMGA 1IQLA 3TLOA 2ZECA 3OYPA 3M7TA 1BRCE 2FP7B 1HJ9A 5F8TA 3UUZA 4B2AA 3T26A 3MH6A 4PROA 2ANMH 2ZTYA 2QGRA 1O0DH 3MNXA 1GDUA 1FDPA 1ID5H 3RMMH 1NZQH 5GJ4B 3FZZA 1HAYB 2VJ1A 2Z6BD 4AX9H 1Z6JH 4X6OA 4WH8A 2XW9A 3BV9B 3VB6A 4Q7ZA 2ZFFH 1P9UA 2QXGA 5LH8A 3KL6A 3LGYA 1AU8A 1FNIA 1MTNB 2BD3A 1KLTA 1MZDA 1YPLH 1CU1A 3LC5A 3RMOH 2H9EH 3NZIA 5DKMA 2JETB 3RLWH 1QL7A 3FP8E 3CP7A 4U32A 1ESBA 4F49A 1IQGA 1W0ZU 1OS8A 3A83A 4J2YB 3TIUA 1SL3A 2GTBA 3LH1A 5GXPA 2V3OH 1K1OA 1V2JT 2ZU5A 1TQ7B 4HFPB 2V6NA 1G9IE 3R0FA 5C20A 1HJAB 2FMJA 3SNEA 2FOAA 4MVNA 4NA9H 1Z8RA 1CBWB 1KLIH 2ZZUH 1TFXA 1PPCE 1CGIE 1O2HA 1PFXC 2OBQA 3P8FA 3GY7A 2BM2A 1ANDA 2G81E 1HAHH 1ZHPA 3FANA 3M36A 1ELEE 3V12A 4I8GA 1OSSA 2HNTE 2WUCA 4TYDA 2BLQA 1F0TA 1Z7KA 1NRSH 1BRAA 5LPFA 1S6HA 1MBQA 1SGEE 3SNCA 1S82A 2PV9B 4B2BA 5AF9H 3GY8A 2BVSH 4OS5A 1GJ4H 2A0QB 4INHA 1NFXA 5EG4A 2FPZA 1YCPM 4BTUB 1C2GA 3RP2A 4DGJA 1GI6A 1TGBA 1O2OA 1TA2A 3TPIZ 3TGIE 3JZ2B 1W7XH 1MTVA 3FAOA 1OP0A 3UNQA 1AVXA 3MO3A 1LHGH 1NU9A 4U01A 4BAKB 1ANBA 1EKBB 2BY7X 5AHGH 3SHAH 1EJAA 1E0FD 1IAUA 2AYWA 3GDUA 3QTOH 2LPRA 1SGNE 1Y5BT 4KTCA 1CT4E 4LK4A 1DXWA 2UUFB 1WBGB 3UREA 4I8HA 4BAHB 3GISB 1QB1A 5FPTA 2F9UA 1BJUA 5DO4H 1G30B 1GCDA 1DVAH 1C2IA 1NU7B 1BITA 2K1QA 5C1XA 3T5FH 1LVBA 3CS0A 4XFQA 1GHAF 1O36A 2R2MB 1V2ST 3PO1C 2FS9A 1O35A 3SI3H 4O3TA 3ZVAA 2VIOA 2G5VA 3QX5H 4Q7YA 1ACBE 1V2MT 1VGCC 2Y6TA 1RIWC 1GJ5H 3Q76A 2XCNA 1C2HA 3MH7A 1MZAA 2ZDVH 2PWXA 3GY4A 3AASA 2H9HA 3FFGA 1ELFA 1K1IA 3G01A 1SGFG 3F9EA 1UK4A 1B0EA 4MPXA 2YNBA 2QV1A 4Y79A 7LPRA 1QY6A 3RMNH 1TGSZ 3UOUA 3KIDU 2G4TA 1O3AA 5T6GA 1TGTA 3QLPH 3KCGH 2H1UA 2H5DA 1LTOA 3SNAA 1NFYA 1V2NT 4X1NU 2QYIA 3A84A 1V2QT 1SQAA 1TBZH 3SNBA 2VVUA 5GDSH 2O8UA 1SGIB 2H5CA 5BRRE 1K28D 1QA0A 2TPIZ 1MAXA 1RRKA 1QL9A 3E1XB 1ZGIA 3SGQE 1YPHC 4AFSA 3RU4E 1LDTT 2C93B 1ZGVA 3LGWA 1KXBA 1O2UA 4MLFB 4RKOB 1FI8A 3EE0B 3U1JB 2QA9E 2GDDA 2ZHWH 1T8MA 5A2MH 1ZHRA 1FQ3A 3LGVA 1WU1A 1IQJA 1P03A 1P04A 1DX5M 1AE8H 3QO6A 2VINA 1P09A 4UFEH 3RC5A 2ZU4A 4AZ2B 5FCRA 3SGAE 3T29A 3KQBA 4RKJB 5PTPA 2RCEA 3E90B 2OLGA 2WV4A 3RMLH 3DD2H 1NRQH 1AWHB 5E2OA 3VGCC 4X2XA 1NFUA 1GI5A 2A7HA 2GT8A 1O3DA 1TONA 2SGQE 2QY0B 2PSYA 2BHGA 1ZZZA 1J16A 2VGCC 2FOFA 1Y3WA 2C90B 4DW2U 5EU8A 3ZV8A 3WY8A 1ZTLA 4GCHG 4NWLA 2ZDAH 1H8IH 1JWTA 1XUFA 2FOGA 1P57B 2FI3E 2OCVB 1TPPA 1J14A 1HIAB 3ZZ3A 1QGFA 1GPZA 1RS0A 3P70B 3NK8A 2FWWA 1BHXB 5L6NH 2ZCLP 4QT8C 2VU8E 1UVTH 1BT7A 2AMQA 2F9NA 3CS7A 3SU4A 5DP5A 1LHFH 1UVOA 1C5PA 1W10U 2R0KA 3TJOA 5HM9A 2FOHA 4A92A 1F2SE 3TJUA 5JBAS 2TGAA 1HB0B 1W12U 3LONA 4AG2A 4B2CA 1QRXA 5GCHG 1C5VA 1CT0E 1C5NH 1RTLA 1C5UA 3ZZ9A 3TK5A 1BRBE 3T27A 4NIWA 4YOGA 1ZPZA 1WTHD 2ZDNA 4X2WA 2XC0A 1C2LA 3A89A 2O8WA 1YLDA 2FS8A 4NZQA 3D49H 2ZHDA 3SOSA 1ANEA 1MKXH 1A61H 2G00A 1UTOA 2LNCA 1O31A 5LGOA 1O5GH 2PFEA 4SGAE 1TRNA 5CE1A 5AFYH 8GCHG 3V13A 4NIYA 3RXKA 1SLXB 1RXPA 1P2QA 1XM1A 3RXBA 4B73A 3TGJE 5E2PA 4B74A 3NPSA 3MU5A 1L4DA 1GI2A 4X1PU 3SQEE 2EC9H 1IQNA 1B0FA 4YZUA 4K8YA 1O5DH 1A5HA 1C5OH 1YF4A 1GMCG 1SQTA 5H4IB 1GVLA 1IHSH 1OX1A 1C4Y2 2NU0E 3S0NA 1GL1A 1CGHA 3BTKE 1XMNB 2G55A 3O8CA 2ZI2H 4WJG2 3OY5U 4BTTB 1EATA 3KN2A 2OP9A 5L2YH 4NSYA 4TWWA 3LJOA 4DY7B 2PW8H 4H6TA 1QIXB 4J1YA 1GCTC 4ISOA 4LZ4B 4DIHH 3ZYDA 1EP6A 2ZNKH 3I29A 5DP3A 2FODA 4NGAH 2OC7A 2AS9A 2W3IA 4OS6A 4MQAA 2DE9A 3BTQE 1K22H 1T7CA 1EB2A 1E35B 4IBLH 2ZG0H 4ZHMU 2B9LA 1PQ5A 1KXAA 1HIAA 2Y80A 1SQOA 3E3TA 1EPTB 3MO9A 1XUGA 1ELGA 1UCYK 2NU4E 3LGUA 4NG9H 1AE5A 2EA3A 4XBBA 5C67A 1P0SH 2BX4A 1K1PA 1O3PB 1UVPA 3SV7A 3TK9A 1NRRH 2H6MA 1UVUH 1HAOH 4ISIH 3O8BA 1NTPA 2CMYA 2ZFPH 1AFQB 4X1SU 1CA0C 1NT1A 1JXPA 5JB9S 3DFLA 4OS1A 3U1IB 3GICB 1SHHB 2IJOB 5DK1A 1DICA 2GCHG 1TA6A 2PKSB 1C2KA 2GKVE 1TWXB 2FM2A 1M9UA 2BDIA 2XTTB 1OWEA 4FVDA 1O3BA 2OQ5A 2Y7ZA 1ZPCA 2B7DH 1DXPA 4ASHA 2ZFSA 4AOQA 1W2KH 2W7SA 2VIVA 1FY1A 1H9LB 3BTDE 4GCHF 4NIXA 3BN9A 1HLTH 4Y0YE 1ANCA 2XWAA 3SGBE 4XSKU 1O3HA 4IW4E 4AYVB 3A80A 1GI9B 2P3TB 4UE7H 1WSSH 1O2LA 3NKKA 1GWAA 2FEQH 1GBCA 1BMMH 1O34A 1EZSC 5C2ZA 1H1BA 1QA7A 1V6DA 4FUCA 2Z7FE 2UWPA 1HAVB 1TIOA 1P3EA 2STAE 5GCHF 3A7WA 5T6FA 4FUHA 1CE5A 4MDSA 3ZVBA 3RXFA 2ZCHP 4JZDH 2J34A 2GX4A 3EAJA 2C4FH 1C1NA 3PLBA 4Y76A 2SGFE 1HNEE 3E0PB 1J15A 2ZHEH 2O9QA 4ABBA 2XNIA 5B6OA 1K1JA 3VEQB 1GL0E 2OBOA 2C8WB 4FUBA 1IHTH 2FOBA 3AAVA 3N7OA 1AY6H 1CA8B 8GCHF 4B1TA 1EPTA 2Z3CA 1Y8TA 3UIRA 1THRH 4I32A 5EPNA 3KQEA 3H7OA 4KP0A 1SPJA 3LIWA 1KSNA 1N6YA 2CF8H 1AZ8A 1W14U 2HNTC 3EYDA 1QRZA 1A3EH 1J17T 4OGXA 1BIOA 3RM2H 1FZZA 3M5MA 1GMCF 4K1TA 3UQVA 1CHOG 2A5IA 2A5AA 1C5QA 1MQ6A 3KGPA 4GAWA 3M35A 1T31A 1LHCH 1DFPA 4CHAC 1S0RA 2PKAB 2BVXH 2SGAA 5EODA 3VPKA 1LO6A 4WWYA 3RXDA 1AGJA 1QTFA 2FOCA 1FJSA 1O3GA 6ESTA 1BQYA 1VITF 4A1VA 1O2ZA 1A2CH 1GMHG 4ZKNU 1BHXF 1Z1IA 2J92A 1O2WA 2EI8A 4FU9A 3SU6A 3URCA 1NPMA 4INKA 2RA3A 2UUKB 5IDKA 2ANWA 3RXPA 3SUEA 1HAPH 1F5KU 1P2JA 2AERH 3V7TA 1FN8A 3MNBA 3ELAH 3M3VA 2VH0A 4WMEA 3RXAA 3SU1A 2ZEBA 5DP9A 2QF3A 4DCDA 1O2KA 4BANB 2C8YB 4KGAA 1O2XA 1O2IA 2XCFA 1MTNC 4ZKSU 1OXGA 2ZQ1A 2UWLA 1OWJA 1XKAC 3F9GA 3S9BA 3PV4A 1Z71A 5GIBA 3A7ZA 1UMAH 1VR1H 4X8TH 1JRTA 1G2MA 2A7JA 1T8OA 5G4BA 7KMEH 5DP7A 3RXGA 1ZOMA 2OUAA 1O3NA 2VH6A 3PMBB 1EASA 3EA8A 2BD2A 1TNKA 3AVZA 3MHWU 2FI4E 3BG4B 1CQQA 1F5RA 1TX6A 3Q3YA 1ELBA 1HJAC 1ETTH 1LHEH 2FLRH 1NFWA 2GCHF 3PTBA 2WYGA 3F1SB 2Q6DA 1VITH 6CHAB 1Z8IB 1OPHB 5FPYA 1DSTA 1KDQB 1L1GA 3FVFB 2G51A 1UCYE 1V2OT 2R0LA 4JZ1A 1QJ1B 1C1OA 5EXNA 1GJ9B 1ETRH 4LOYH 4DVAU 4JCNA 3TJVA 4ZXXH 3ZVDA 2ZA5A 1CO7E 4E06H 3SN8A 4CRFA 4BAOB 1O3EA 4ABDA 4YTAA 4CRCA 5C5OA 2ZIQH 3Q3XA 3HATH 3GYMA 2QAAA 3RXJA 4CBOA 4U2WA 1MCTA 4ABEA 4AORA 1C5LH 1JOUB 3RU4T 1L2EA 3L6PA 2CGAA 3TNTA 3STIA 3NCLA 3MU8A 3ZZAA 1MMJN 1O3MA 1ZHMA 2QC2A 3IG6B 4B75A 1MQ5A 2PKAA 2P59A 1O5FH 3RXVA 4Y8YA 2VWNA 2H2ZA 2V35A 8LPRA 3SUFA 3PTNA 2AIQA 1KXFA 4IGDA 2P3FH 2DUCA 1GVKB 1O33A 2WPHS 3GY2A 1L0ZA 3ATKA 1SOTA 1RD3B 1UTNA 1H9IE 2YOLA 2A4GA 3MNCA 1K1LA 1EOJA 4Z6AH 3P17H 5C3NA 3PLKA 3AW1A 2FOMB 3QTVH 4GVUA 1TNLA 3UTUH