4U30A

Human mesotrypsin complexed with bikunin kunitz domain 2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
b'IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-3
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Sequence and Conformational Specificity in Substrate Recognition: SEVERAL HUMAN KUNITZ PROTEASE INHIBITOR DOMAINS ARE SPECIFIC SUBSTRATES OF MESOTRYPSIN.
pubmed doi rcsb
total genus 57
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u30A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u30A02
1C2KA 1YM0A 4UFEH 4FU7A 1MTVA 1GBAA 4IN1A 2ZWLH 1QIXB 4NIVA 3VGCC 3TIUA 3AASA 2PFEA 5E8EH 2A31A 1EPTC 3M5OA 1ANBA 1ELFA 3BIUH 1C1VH 1VCWA 4U32A 2ZHFH 3SJ9A 2TGPZ 1TLDA 3RXCA 1GWAA 1J15A 1EAIA 3LC3A 3M5MA 3RXHA 1TOMH 4FUIA 4NFFA 3SNBA 2VVCA 3ZVFA 6GCHG 4K1EA 1GBDA 2JH6D 1MKWH 2VIOA 1D4PB 4WVPE 1ZSKA 2Z3CA 1YPJH 1ELAA 3GYMA 1GHVH 3BTHE 2NU0E 3GY6A 2ZF0H 1T31A 3RXTA 1UTJA 1WQVH 1GBBA 5GWZA 2FYQA 1ANCA 1W0YH 1BQYA 4NCYA 2ZGCA 4LK4A 3SUGA 1G3EA 3F9GA 1UTLM 3U8RH 3OU0A 1T8NA 1TRNA 3LGUA 2GCTB 1O3KA 3UWJH 1JXPA 2XC4A 2J34A 2GV6A 4X6NA 1GJ4H 3RXJA 1GJBB 5FPSA 1Y5BT 5JBCS 2Z9JA 2GX4A 1BTZA 4FUBA 3S7HB 4XFQA 2ZKSA 2BY5X 3LJJA 3NCLA 1A3BH 1AN1E 1CQQA 4Q7YA 4E7RG 4X8SH 2W3KA 3NXPA 2ZFFH 1QJ1B 2G4TA 3MU5A 1L1NA 1GCTC 2ZDAH 2FIRH 3FAOA 3GY7A 1BTXA 4DG4A 2BLQA 1JIRA 1UTQA 1HAHH 4B2BA 3PWCA 3SV7A 3M7QA 1C2JA 2A1DB 4Y0ZE 1HLTH 4K1TA 2PGBB 5J4QA 2OBQA 3AW0A 3FZZA 2XW9A 1LDTT 5LH8A 4UFDH 1IHTH 4B2CA 2QAAA 1G37A 1C9PA 6LPRA 1K22H 2FOBA 3RP2A 1K1LA 1MZAA 3LGYA 4NA7A 1ZTLA 1GGDB 1KXDA 1QJ6B 2SGPE 3VB3A 4Y6DA 4X8VH 1TNIA 3RMMH 1GJAB 5PTPA 3H7OA 1UHBB 4X1QU 2WPJS 1C2IA 2OC7A 1ARBA 4WF8A 1NESE 1DY8A 1UCYK 2HGTH 5ABWA 3UIRA 3SOSA 4YOJA 3MHWU 3KN2A 1WV7H 1HAVA 4UE7H 1L1GA 3AW1A 3D65E 5C1XA 4F4OC 4A1VA 1EB1H 1C1NA 1EOLA 1TFXA 1Y3VA 1O2MA 1QHRB 3A7WA 2PKSB 1B0EA 4Y79A 1L0ZA 1CE5A 1KXAA 1LVYA 3SJKA 5C5NA 2H9TH 2ZQ2A 2FX6A 1FONA 2FOCA 1A5GH 3SV6A 1O5AB 3A7TA 2D8WA 1MQ5A 2VB0A 4ABBA 1AE8H 2ZU2A 5L2ZH 1P2MA 4TPYA 4DURA 4Y0YE 1V3XA 3RXGA 2PKAB 1A61H 1E35B 1ELDE 4X2YA 1GHYH 2Y7XA 2SNVA 3OTJE 2CMYA 2IOTA 4JYTA 1HPGA 2A4GA 1UTMA 2V6NA 3SNEA 4K3JA 2G51A 4BAKB 1B7XB 1FJSA 1FLEE 2V3OH 4TYDA 3MH5A 1CU1A 4AORA 2ZU1A 1A0LA 3LU9B 1HJ8A 1F0UA 2SGQE 1JWTA 1HUTH 2OC8A 2BX4A 3VGCB 4O9VA 1VGCC 3D49H 4XBDA 2ANMH 3PLPA 3KQBA 3OY5U 2BX3A 4MPWA 4FUHA 1ABIH 3FP7E 3SU6A 5EPYA 2RA0A 3ZVEA 2GMTC 1F0SA 1F7ZA 2QN5T 4FU9A 1ETSH 4BTUB 5EGMA 1YKTA 3F1SB 3ELAH 1P3EA 4DIHH 1CA0C 2FX4A 1HYLA 1ZSJA 3MWIU 4MG3A 1S0QA 1G2LA 3RLWH 1V2JT 1THRH 3B23B 3FP8E 1PYTD 1LTOA 5LPEA 2GCTC 1MH0A 3DFJA 2VWLA 3DD2H 3QK1A 2OTVA 2WPKS 1LKBA 2ZFQH 1GL1A 3OX7U 3PLBA 3RXAA 4RSPA 1CBWB 5E0JA 4DGJA 1AZ8A 1F5KU 2GP9B 4BXSA 3UNRA 2BDHA 1ETRH 1QJ7B 3MNCA 1MAXA 1O3BA 2A5IA 5JBAS 1O2RA 1Q31A 2BTCE 1EAUA 1SFIA 1FY8E 1QTFA 1DPOA 1FN6A 3LIWA 3LKWA 1HCGA 1CO7E 2Y5HA 2ZFTA 5K0HA 1QRXA 4ISIH 5FX6A 1WSSH 2F9BH 3SORA 1F92A 1LPZB 2LNCA 1O3IA 3VXFH 2JETC 3RMOH 4O03A 3ZV9A 3O8CA 4ASHA 4CBNA 3N7OA 1Y5AT 5CMXH 1ZLRA 3PMJA 1GGDC 4R0IA 3MO6A 4ABJA 2PR3A 1Z8JB 3A7ZA 1UCYH 1QBVH 2FS9A 5DP3A 1XUGA 1S81A 3F68H 5A8XA 1XUHA 5F6MA 3AVZA 3KGPA 1GHXH 3SJOA 4AOQA 1O3MA 4CRAA 1BT7A 2BD9A 1GJ5H 2EEKA 1TX8A 2QF3A 4INKA 4ZKNU 3RU4E 1TGNA 2QF0A 1D9IA 4ZKSU 4UDWH 5TCAA 2ZDNA 1TPAE 2CGAA 2R0LA 1ZTKA 3NK8A 3EA9A 1WQSA 3Q3XA 4B76A 3GCNA 1GVLA 1GMCG 2TGDA 3EAJA 3VB6A 1GBEA 3QDZB 4X2VA 4AG1A 4BTTB 1O2WA 2J9NA 2XRCA 1TX6A 2H2ZA 1T8OA 3SBKA 1L2EA 1TQ0B 5T6FA 4OS7A 3RC5A 3TNSA 3RXFA 1OP2A 1ELVA 1IQKA 1DDJA 4BTIB 1BCUH 1SGQE 5DPAA 3FP6E 3TH2H 2D26C 1TNJA 1O5FH 3M5LA 1YCPH 1UVUH 2ASUB 1ELGA 1SQOA 4HGCA 2BD4A 2G4UA 1YYY1 4MDSA 5I25A 2IPHA 3NZIA 1DITH 4D8NA 1OS8A 4DOQA 1FQ3A 1CT0E 1H8DH 2F83A 2R0KA 1C5TA 3A8AA 5E0GA 4B2AA 2FLRH 5EG4A 1WU1A 2HNTE 1HJAB 2STBE 1G36A 3QZRA 4F49A 3TH3H 1P02A 2VIQA 4INHA 1BZXE 1EP5A 2GV7A 1AY6H 4CR5A 4E7NA 2H1UA 3RXMA 2P59A 2VVVA 4HTCH 1VCPA 1GHAG 2Z6BD 4KP0A 1SLVB 5FBIA 4OGXA 4X6MA 2GZ9A 1C2FA 1CA0B 5DO4H 2HNTF 2FI5E 3STJA 1ZHPA 4BAHB 1LVMA 3RLYH 2GDDA 2OD3B 4GHQA 2GKVE 1UK4A 1HDTH 6ESTA 1D3QB 1P12E 1FNIA 3EA7A 2DUCA 1GI3A 4Y10E 1AO5A 1P2NA 1ZSLA 1G3BA 1DY9A 1T8MA 1C5UA 1V2NT 2I6QA 4XOJA 4Z0KA 4Q7XA 5HXFA 4ABGA 1P0SH 3F9FA 2W7UA 4WXVA 1C5ZB 2FOAA 3VEQB 1P03A 4IC5A 1Y59T 2CHAB 1GBKA 2ZTZA 4GUXA 5JYIA 1P57B 4GPGA 3PV4A 1BTWA 1ELCA 1H1BA 4I7YH 3W94A 2BQ7B 2FDAA 4HFPB 1OSSA 2VU8E 1IQLA 1J16A 8ESTE 4K60A 5IYTA 4ISOA 2BOKA 3M37A 1QL7A 4NWLA 1RTFB 1GI8B 1TABE 4JZ1A 4Y11E 1O2HA 4K1SA 2BDCA 3NPSA 1TGTA 1W3CA 3MU1A 1GI2A 2AGIX 2XBVA 1HV7A 2HOBA 3MO9A 4E06H 5LPRA 2BY7X 2GVFA 4JK5A 4H6TA 3OYPA 1BMMH 4MQAA 1O39A 5A0BA 4I8JA 3UFAA 3FANA 3RMNH 1W0ZU 1T4VH 3BTQE 1WAYB 1ZPCA 2AGGX 1UVPA 2PSXA 3HGPA 2A5AA 3NKKA 2GZ8A 1QQ4A 4LOYH 3K6YA 3RU4D 4ABIA 1IQHA 4Y76A 2ZFSA 1CGJE 2H5CA 4BNRA 2ODPA 1TNLA 2J94A 2AIQA 1GBLA 2ZQ1A 1TYNA 2FTLE 1B5GH 1GBIA 1MZDA 1E36B 1RS0A 3ODDA 1CT2E 5ETXA 4OS4A 2G5VA 1VITF 4NIYA 4OS2A 1K1OA 3SW2B 8GCHG 1GBJA 3A80A 1DLEA 2A7HA 4TWWA 3ZZ4A 2K1QA 2VGCC 1UJ1A 4ZH8A 3DHKH 3U69H 1DWDH 5DP8A 4JZFH 5GCHG 1W2KH 3MH4A 3NUMA 5A8ZA 2BB4A 3GYLB 4NA8A 1J9CH 1H9HE 3A85A 5EW2H 1Z7KA 3SNAA 1DE7H 2GMTB 1O38A 1OPHB 2H6MA 5BPEA 4X6PA 1CGHA 1Y3UA 1M9UA 3VB5A 4CREA 3ZYDA 2R3UA 1DOJA 5C20A 1VITH 1GJCB 1N8OC 1SGFG 4ABEA 1SBWA 1GJ6A 1C5WB 2JKHA 1YGCH 4YT7H 2W26A 2GD4B 1KLJH 1GI0A 3PB1E 4A7IB 1DICA 4Y8YA 1GMDG 1EZQA 4OS1A 1UHBA 2ILNA 1C5PA 1F5LA 1NN6A 2KAIA 4E05H 1SLUB 3E0NB 1WOFA 1S83A 2QXGA 3A7VA 2AS9A 4K5ZA 3BTEE 1NRQH 1EZUC 1KDQA 1T7CA 3HGNA 1C2MA 1G32B 1MD8A 1XKAC 3RXRA 2XWBI 1NS3A 1O3HA 3T28A 1PFXC 2HALA 4H6SB 1XM1A 2ZG0H 5T6GA 2G52A 2G81E 4WMDA 3UREA 1Y3YA 1PQ8A 2FESH 3SU3A 1T4UH 1C5XB 5C3NA 4X6OA 2VVUA 3V7TA 1BBRE 1QRWA 2ZHEH 3GY5A 1KLTA 4JYVH 2W5EA 2ZU5A 4A92A 2TIOA 1ANEA 5DP6A 2Z9GA 4ZROA 3BTME 3SGBE 1EASA 4JZEH 3TPIZ 1GL0E 1GVZA 2ZCHP 3CENA 3CS0A 1P06A 4ZKOU 4X1PU 1G9IE 4WY3A 1C2HA 5ESBA 1N6XA 1HB0B 4I33A 1TWXB 1O2UA 3RU4T 1QFKH 2FEQH 2Y5FA 1GBMA 3L6PA 1QURH 5EXLA 4MTBA 3M61U 5JPMH 1NROH 1KTTB 1MD7A 1N8OB 4H42U 1ESBA 1GDNA 2Q6FA 1ZJKA 3F9EA 2RA3A 1AZZA 2V35A 2P93A 2QXHA 3UY9A 1Q3XA 1DANH 2F91A 1K1MA 1C1WH 1O2TA 1LCYA 2BDAA 2EA3A 1SGTA 1BIOA 2M5TA 3M7UA 1GI4A 1D3PB 3URCA 3ATMA 3DFLA 1O5DH 4FXGH 3P17H 3P8OA 1O37A 3KHVA 3U98H 5JDUB 1CHOG 2UWOA 1K1NA 3SHCH 4NA9H 1DLKB 3TNTA 3UWIA 1MKXK 3L3TA 1SR5C 1O3EA 1EZSC 3E6PH 3GY2A 3RUOA 3STIA 1G3CA 5C2ZA 3ZZ6A 2GZ7A 1F0RA 1NFYA 5LPFA 1MMJN 3IG6B 3T2NA 2XXLA 1THPB 2UUJB 2ZECA 1AE5A 2BMGB 2V3HH 4CH2B 1QA7A 1A46H 1EUFA 4MPXA 1GI5A 1PJPA 3SU1A 6CHAC 2BDYA 1GHBF 1IQGA 2ZA5A 1WUNH 2SGEE 1P8VC 3AAVA 2A7JA 1O2KA 3RC6A 4RN6A 1IQIA 5CE1A 1SMFE 2BVRH 2A0QB 3H5CB 1FV9A 1UMAH 4KGAA 4THNH 3SU4A 3ATWA 1C1OA 2A32A 3TJNA 2FTMA 2ZFRH 3VPKA 4B71A 3ITIA 1K1JA 1BRUP 3GISB 4D7GA 1INCA 2TBSA 2PSYA 1XXDA 1MU6B 2PTCE 3SGQE 1PPHE 1SQAA 2BXUH 3K65B 3MNXA 4YTAA 1Y8TA 1UVTH 4NSYA 1UTPA 1SGDE 3SQEE 3BTTE 3JZ2B 3EA8A 1SSXA 1LQDB 1O2QA 1HAVB 4CRBA 7GCHF 2ZGJA 1NPMA 1KXBA 4GCHG 2HRVA 7ESTE 2QGRA 3Q3KA 8KME2 2VWNA 4FU8A 1TNKA 3SZNA 2FMJA 4BAOB 3MU0A 1V2KT 4M7GA 4AG2A 1TGSZ 3ZYEA 3ZVDA 1LVOA 1ZOMA 1RRKA 2BZAA 2ZI2H 5EPNA 3VXEH 3T62A 1EX3A 4O3TA 3TGKE 1OXGA 4GAWA 3ZVBA 4NWKA 1P2JA 3LDXH 2CJIA 5EQSA 4INLA 2QYIA 2ANWA 2QXJA 3RXUA 3UNQA 1MTNB 7KMEH 1GI6A 3T5FH 1JOUB 1SHYA 3FFGA 1SOTA 1DS2E 5B6OA 1OWIA 4I8HA 4ESTE 3CS7A 2R2WU 1N1LA 3UTUH 5GIBA 3Q00A 1L4DA 3MFJA 1V2OT 1TNHA 5HM2A 1GJ9B 2OP9A 1DUEA 2VH6A 3EDXB 3GOVB 2OCVB 2RCEA 3HK6B 3SGAE 2OQ5A 3SUDA 1O30A 5EXNA 1FMGA 4OS6A 2P94A 1YCPM 1PPGE 2XBYA 1A5HA 1S0RA 2GT8A 2XWAA 3SHAH 1TBZH 1P2KA 1O3LA 1GG6B 4KTUA 2Y6TA 1IQMA 1GJDB 1KTSB 2BVXH 1RIWB 1AIXH 1F2SE 2BD5A 3SU0A 1OOKB 3HATH 1SHHB 2EI7A 1EOJA 4TY7A 1GHBG 1SLXB 2QXIA 4MPVA 1S82A 3U8TH 2PUQH 2A7CA 5AFZH 6GCHF 3ZZ3A 3FVFB 5HM9A 3V13A 1FN8A 2FOEA 5TJXA 4QT8C 3PMBB 3U9AH 1KYNA 1PQ5A 3TGIE 4YOIA 3UR6A 5DG6A 3TITA 8LPRA 2SGFE 4MNVA 5C5OA 1GHAF 3EQ0H 2CHAC 3SU2A 5I46H 1TMUH 2FI3E 2GDEH 5FCKA 4MNWA 1FY4A 4HZHA 1O2PA 1ZMLA 1GMDF 1ZJDA 2VGCB 1GVKB 1CT4E 4U01A 1C2DA 2Q6GA 2ALPA 1D6RA 4X0WU 1TRYA 1OWKA 1W10U 3QZQA 1TMBH 2OXSA 1MUEB 1Z1IA 4AN7A 3PO1B 2C8WB 1BRBE 1QBNA 1AVXA 5GXPA 2GT7A 3A83A 1ELTA 2A4QA 1BOQA 1Y5UT 1C1UH 3S7KB 4CBOA 4IMQA 1TALA 3MYWA 2Z3DA 4CHAB 1BA8B 4DCDA 1DXWA 3SU5A 1IAUA 2H9HA 1C5OH 2GCHG 1O0DH 5AVDA 2BVSH 2ZHWH 1C2GA 5DKMA 3TGJE 2VJ1A 1OYTH 1V2UT 4H4FA 1SVPA 1AFQB 5AHGH 1C1MA 1V2WT 5A0CA 3U1IB 1NRRH 3QX5H 1FDPA 1IHSH 3P95A 5FXLA 1A0HB 1Z6EA 5T6DA 3T25A 2WUBA 1AU8A 5JBTA 4JYUH 1T8LA 3A89A 1Z6JH 5F8XA 1VR1H 2QCYA 1GMHF 1ZYOA 1MTSA 2VINA 4IC6A 4GLYA 3A8DA 4NG9H 1QA0A 2B9LA 1HBTH 4XDEA 2BXTH 2ZDVH 1AQ7A 3RXSA 3MNSA 5FHTA 2FODA 1DUAA 2FOHA 5EU8A 1C5LH 1VJAU 1YLCA 1ABJH 3BTFE 2Q6DA 1PQAA 3P8NA 5GJ4B 1O34A 1AKSA 1KDQB 1MBMA 3PWBA 1OKXA 1SGEE 3R3GB 1LHFH 3A7XA 4NZQA 3ZZ8A 1CHOF 3ATLA 3UUZA 1SGPE 1FIWA 3MU8A 2IJOB 1LHEH 2B7DH 1EPTB 2O8WA 1BUIA 1YPHC 5L6NH 1HIAB 2GCHF 2FOGA 1EAXA 1ELEE 2BM2A 1C4Y2 1GG6C 2HLCA 1HXFH 1W12U 1CA8B 1K28D 2Z94A 3MTYA 4XSKU 4X1SU 4ABAA 3KCGH 1BB0B 3IITA 4Q80A 4AGKA 1ZGVA 4Y8ZA 1SGNE 1AKSB 1HFDA 3HKIB 3F6UH 3TJVA 3GCTF 2AH4X 3NWUA 2HPPH 1LMWB 1MBQA 2LPRA 3M3TA 1Y3XA 1C1RA 3ATKA 1VZQH 1C1QA 3Q3YA 5BRRE 3M7TA 3PM3A 1SC8U 2TRMA 4I31A 1A2CH 3ZZ7A 1OX1A 3M5NA 3R0FA 1CSOE 1BMNH 1QQUA 1XUFA 1Z1JA 1MTWA 5DP4A 1E0FD 5EQQA 2P8OC 2IN2A 1TGBA 2F9NA 3G01A 1ELBA 1UO6A 1P2IA 4DJZB 2AMPA 3C1KA 3SJ8A 4YZUA 1TX7A 1P9UA 3SNDA 1ZRBA 1A0JA 1C5RA 4WMEA 2ODYB 1A7SA 4Y8XA 3O8BA 4JZIA 2STAE 1DM4B 1PPBH 1AWFH 4ABDA 1D3DB 2PKAA 1XUIA 2BD2A 3RM0H 2W3IA 4I8KA 1SPJA 5ESTE 2SFAA 2OC0A 1C1SA 1OP8A 2B5TB 2UWLA 9ESTA 2ALVA 4LZ1H 3TK5A 1ZMJA 3RC4A 4ZKRU 4YM9A 3SO3A 3SV9A 1PPCE 1O32A 1YPLH 3QWCH 2GTBA 4LXBH 2ANKH 1S84A 4SGAE 3E0PB 5EODA 1V2RT 2PUXB 1SB1H 2F9OA 1O3JA 5H4IB 4AYYB 3RXLA 1SFQB 1SGRE 3U1JB 1ANDA 1GBHA 1AGJA 1O2YA 2CXVA 2F3CE 2BOHB 1NT1A 4FUEA 2J92A 1SQTA 2O8LA 2NU1E 1TB6H 4GSOA 4FUDA 2UWPA 2CV3A 1HAYB 1PQ7A 1GPZA 5F8TA 2ZHQH 1ETTH 1O2LA 2ODQA 1EJAA 4I8GA 3ZZBA 3MNBA 3S9BA 2DE8A 2WV4A 3BF6H 4JK6A 4WH8A 3T27A 1CHGA 4YO9A 2BHGA 1SOZA 4AX9H 1X7AC 1EKBB 1RJXB 3WY8A 5EOKA 5JB9S 1TA6A 2QV1A 1DVAH 1HIAA 1EATA 1QB9A 1QL8A 1W7XH 4XBBA 4B74A 3TLOA 2UUFB 1UK3A 1SI5H 2BYAX 3GDUA 3K9XB 2SGDE 3K6ZA 1GBFA 1TIOA 1GHZA 4IW4E 3A8BA 1G2MA 1XVMA 2G5NA 4X1NU 4Y71A 4CHAC 1O2OA 1BHXB 1P11E 4LZ4B 1ZPBA 1O2IA 3TK6A 2XNIA 3RXKA 2AMQA 5HYOA 1OWDA 2R9PA 1BJUA 1EPTA 1FI8A 1C1TA 4O97A 3ENSB 2ZGXH 2XBXA 1MKXH 1O3DA 1P04A 2I6SA 3KQCA 3VB7A 1Z8IB 1GDUA 1O2JA 2ZGBH 4RKOB 1MTUA 1SGYE 3QN7A 3TH4H 1C5MD 1WYKA 1O3FA 2A5KA 4TPIZ 3GICB 1FAXA 1QB6A 1ZR0A 2FXRA 5A2MH 1F5RA 2NU4E 1D6WA 3SUEA 1PPZA 4RKJB 1H9IE 3ESTA 1O2NA 1YPKH 1DWEH 3LT3A 1UK2A 2BD8A 1NRSH 2H5DA 1UTOA 3LGTA 3QUMP 1LPGB 3S9AA 1GJ8B 3LH3A 5FAHA 1EJMA 4FUGA 2FLBH 2ZIQH 1QR3E 2SNWA 3RXIA 9LPRA 3E91A 4AFQA 5A09A 2ANYA 1MCTA 1ZTJA 1NM6A 2AEIH 3A87A 3L33A 1H4WA 2R2MB 4D9QA 1IQNA 1C4V2 2B8OH 2ZO3H 1FXYA 1L1JA 1FPCH 3AAUA 4I8LA 4NFEA 1HAOH 1Y3WA 4U30A 3S9CA 1P10A 1SL3A 3BG8A 3QGJA 3A8CA 1TONA 4X1RU 2ESTE 1P9SA 1ZZZA 1O36A 1HGTH 1RIWC 1AFEH 2OINA 2TGTA 2ZCLP 2F9VA 4ABHA 1KLIH 1TPSA 1XUJA 1TMTH 1A4WH 1S85A 1HAXB 3ZZDA 2BD3A 1KSNA 5SGAE 1TQ7B 3B9FH 4ISNA 2P16A 2Z3EA 1HAGE 3C27B 2ZPSA 3KNXA 1UVSH 1L4ZA 2QIQA 4I32A 4YOGA 2Z9LA 1B0FA 4AB8A 3F9HA 1C2EA 3A82A 2OBOA 1AHTH 4MNYA 1IQFA 5FCRA 1BRAA 1EXFA 2CF9H 1YPGH 1GCTB 1OWHA 2F9UA 1LHGH 1GJ7B 2UUKB 3BEFB 4CH8B 2ZHDA 5G4BA 3P8GA 3GY4A 1IQJA 1OWJA 3V12A 1C5QA 1V2ST 3MH7A 1FY3A 4ISHH 5E2PA 4DW2U 2FOMB 3BEIB 3O8RA 2AFQB 2FYRA 2WPMS 2Y5GA 1RTKA 2P3TB 4Q7ZA 3PTBA 2FM2A 3ZZ9A 1TGCA 1ESAA 2OC1A 4NIXA 1O31A 2XTTB 3SI4H 2C90B 6CHAB 1WCZA 4IS5A 2YNAA 3V3MA 1EP6A 3TU7H 3A81A 1FY1A 1W8BH 4YESB 4X2XA 3BSQA 1V2QT 4DY7B 1HAIH 1SLWB 3QO6A 1NO9H 5HGGA 4WXIA 2ZTXA 1RD3B 4VGCB 2OUAA 1SG8B 3SUFA 1QL9A 5J4SA 3ZVAA 2TGAA 1W14U 3BTDE 3MO3A 1GI9B 3DA9B 1P2QA 4B1TA 1LHDH 1E38B 2O9QA 2A45B 3BTGE 4BANB 1P09A 1V6DA 4YLUA 4JCNA 1OP0A 3LPRA 5L30H 1VITG 3UPEA 2J95A 2Y81A 1E37B 1MCVA 3H7TA 4MPUA 1SGIB 4D76A 2FI4E 4Q2KA 1ARCA 3BEUA 3TVJB 5FPTA 3EYDA 5FX5A 5GCHF 4MLFB 3I29A 2XCNA 1XVOA 4IN2A 1C5VA 1P2OA 3Q77A 3UQVA 3BTKE 4X8UH 1HJ9A 4WWYA 1C2LA 4IMZA 4UFFH 1TE0A 1C1PA 1GMCF 1BITA 1O3PB 1S6HA 2ZU3A 1Z8RA 1XUKA 2FWWA 2PV9B 2EC9H 3B8JA 5TCCA 1ID5H 3RXQA 1LQEA 1TNGA 1YPMH 1YLDA 1BTUA 2VIPA 2ZZUH 3GDSA 5EXMA 2ZDKA 1DSTA 1LPKB 3ZZCA 1JBUH 1J14A 1UTNA 5A0AE 2AYWA 5C1YA 3T26A 2ZCKP 4IGDA 1PPEE 2ZDMA 3DT0H 4FVDA 4U2WA 1DFPA 5CHAC 1O3OA 4GHTA 1NFUA 1JRTA 2F9PA 4OS5A 1XX9A 5DGJA 3UR9A 2G00A 1NC6A 1E34B 3P70B 2WV5A 2Z9IA 1KY9A 2XCFA 1AVGH 2C8YB 1Q2WA 3LGIA 5JBBS 2C8ZB 1ZRKA 1OYQA 3GCOA 3Q76A 1NFWA 2EI6A 4Y7AA 2BDGA 4NZLA 5L2YH 1DT2A 1GHWH 4GVUA 3RXVA 4R8TB 2A2QH 2SGAA 4ZXXH 2A4RA 1BMAA 3HK3B 1V2VT 5DP9A 2FS8A 1GBTA 5DJ7A 1H8IH 3DUXH 3GCHB 2BY8X 3RDZA 4AYVB 3URDA 3U8OH 3PTNA 1IOEA 4XBCA 1EZXC 3ZVCA 2BDBA 1NRNH 2JH0D 1SGFA 1DXPA 1QCPA 1HJAC 2BLVA 1MQ6A 7LPRA 3SN8A 1HNEE 4K2YA 5AF9H 3UQOA 4FUJA 1EB2A 1TBRH 3SNCA 4Y7BA 1K21H 1QBOA 3E16B 3GY3A 4DIIH 1FIZA 4UEHH 8GCHF 3SJIA 1AUJA 2BZ6H 1S5SA 1A5IA 4OGYA 3E3TA 2W7SA 4FUFA 4BAQB 4O3UA 1O3CA 2CF8H 4HI3A 2FP7B 1BBRH 1O3AA 2KAIB 4JZDH 2XC0A 1AMHA 4YT6H 1AI8H 1AD8H 1RFNA 1O5GH 2D1JA 2JETB 3T29A 2BLOA 4AZ2B 5JB8S 2AERH 1VJ9U 2QA9E 2C8XB 3JZ1B 3ZVGA 4CRDA 1S6FA 3RXPA 2A2XH 1C4U2 2WYGA 1WTGH 2Z7FE 3M36A 1BDAA 2PHBA 3BN9A 3P8FA 4DT7B 1HXEH 3K2UA 2AMDA 1EQ9A 2HPQH 1BTHH 2FPZA 2WYJA 5FBEA 1LVBA 1YPHE 3SV2H 3SQHE 3QGNB 1LHCH 1QGFA 2XBWA 1NFXA 1QNJA 1BBRK 4A6LA 1UCYE 5C67A 1JIMA 1FZZA 4WH6A 1W11U 2QC2A 3KIDU 5DK1A 3ODFA 2D2DA 2O8MA 2ZU4A 1O33A 2P3UB 2H9EH 1V2TT 2BY6X 4WJG2 1W13U 1BJVA 1K9OE 4ZXYH 1EJNA 3D62A 3MOCA 1JRSA 3LGWA 2QY0B 1TPOA 3QLPH 1K2I1 2ZC9H 4BXWA 4UONA 5AFYH 4ZUHA 3QTVH 2XC5A 4PROA 1NTPA 2RG3A 1GBCA 2ZDLA 3ZV8A 4GCHF 2C93B 2G8TA 4ISLA 4TY6A 3TJUA 2V0BA 1YF4A 2HWLB 4K8BA 1DWBH 3KQEA 1GCDA 4CRFA 4ZHAA 1TPPA 1HAZB 3BIVH 3MMGA 3BG4C 1F0TA 1P01A 1K1PA 4BAMB 1RXPA 3BG4B 1YCPK 4JMYA 1KXCA 2BLWA 2JH5D 1KXEA 3TJOA 1A1RA 4YLQH 3LJOA 3RMLH 1A3EH 5A8YA 2YNBA 4ZHLU 1QRZA 2HVXA 2BQWB 1NZQH 1EAWA 4B75A 3OSYA 2R3YA 2TPIZ 3A86A 5CHAB 1C5SA 1AFQC 4IBLH 4SGBE 2ULLA 2ZPQA 1BTPA 1XXFA 2CN0H 1PYTC 3MU4A 3RXEA 1KIGH 1P3CA 1NRPH 1VGCB 2WUCA 2GGVB 4UFGH 1LO6A 2P95A 3ZZ5A 4A1XA 3KF2A 3E1XB 2VH0A 1TAWA 1TOCB 2VWOA 1O2SA 2PWXA 4MNXA 3GCTG 1C9TA 4AFSA 1RTLA 2PGQB 1V2MT 2ZPRA 1C5YB 1YP9A 5EQRA 5LGOA 4AFZA 1OWEA 2BD7A 1O2GH 2NU3E 1YPEH 1T32A 1WBGB 2PLXA 1AB9B 3UOPA 2B0FA 3CP7A 2VIDA 4K8YA 3ATIA 3GDVA 3LH1A 1J8AA 1GMHG 2UUYA 3PYHA 4ABFA 3KEEA 1J17T 1D3TB 1Z71A 2ZTYA 4KELA 4B73A 4AFUA 3PO1C 4D7FA 4AGJA 2A4OA 3EGKH 3A88A 2VWMA 1BMLA 1FY5A 5DP7A 3FZDA 1JMOH 1G3DA 1O5CB 1Z8GA 2P3FH 2RDLA 1TA2A 4ZAEA 3OY6U 2NU2E 2OQUA 3PLKA 3BTWE 1O5BB 1YBWA 3P6ZB 2VIVA 1O2XA 2YOLA 3M3VA 2Y7ZA 3GY8A 3GCHC 1G30B 2O8TA 1LKAA 1UVOA 5F03A 2WPHS 3P92A 1CVWH 1O3GA 5HMAA 1UTKA 1AB9C 2C4FH 3PMAB 1CBWC 2J4IA 2Z9KA 2Y80A 3E8LA 1ZGIA 3RXBA 1TRMA 4NIWA 1TBQH 3KQDA 4J2YB 1PPFE 3LGVA 1BHXF 2O8UA 4DVAU 2PW8H 2BQ6B 1ZHRA 3HKJB 3LONA 3RXDA 2P8OB 3A84A 4ZMAH 4CR9A 1FUJA 1V2PT 1KXFA 1DSUA 2NWNA 1WTHD 4CRCA 5F8ZA 4NGAH 1AUTC 4UD9H 1O3NA 4ZHMU 3BV9B 2C3SA 3PROA 1FAKH 1FPHH 2FOFA 5DP5A 3EE0B 2Q1JA 1QB1A 1ZMNA 3M35A 4J1YA 1HAPH 1ORFA 2WINI 1IQEA 4Z6AH 1O35A 1QY6A 2ZEBA 5E2OA 2G55A 2ZFPH 4MVNA 5FPYA 4WMFA 4CRGA 1BRCE 2WPLS 2BY9X 4A5TS 1O2VA 1N6YA 2J38A 4NSVA 1NY22 1MAYA 1V2LT 2EI8A 1C5NH 2ZGHA 3I78A 3LC5A 3E90B 3W95A 3RM2H 2THFB 3A7YA 4TWYA 2AIPA 2HNTC 2J2UA 1NU7B 5GDSH 1SGCA 4FVBA 1XMNB 4FUCA 1HRTH 2VIWA 1DWCH 3ZZAA 1AVWA 1BTYA 1MTNC 1CGIE 1NU9A 1YC0A 3QTOH 2XYAA 3VFEA 1AWHB 2DE9A 2WPIS 3MH6A 1ESTA 2FZZA 4XE4A 1O5EH 1H9LB 4KTCA 4X2WA 2OLGA 1O2ZA 4KKDA 2PTNA 5T3HA 3D23A 1MU8B 3MI4A 4D9RA 1P05A 3S69A 3I77A 1ACBE 3SI3H 4VGCC 1XKBC 3UNSA 2FO9A 2Y82A 1VCQA 4AB9A 5GPIB 3S0NA 5IDKA 2BDIA 3KL6A 4KTSA 3VB4A 2PKSC 1ZPZA 3M3SA 5C1UA 1THSH 1GI7B 2VNTA 3IWMA 3TK9A 5EW1H 4K69A 5E0HA 3V0XA 1W7GH 2ZP0H 1MKWK 3RXOA 4X8TH 4A1TA 4BOHA 3HPTB 3UOUA 1ZHMA 2AGEX 1K1IA 1GDQA 7GCHG 1GI1A 3SV8A 5K7RA 1RGQA 3LOXA 2ZNKH 3O8DA 1DX5M 3PMHB 1U6QA
chains in the Genus database with same CATH superfamily
1C2KA 1YM0A 4UFEH 4FU7A 1MTVA 1GBAA 4IN1A 2ZWLH 1QIXB 4NIVA 3VGCC 3TIUA 3AASA 2PFEA 5E8EH 2A31A 1EPTC 3M5OA 1ANBA 1ELFA 3BIUH 1C1VH 1VCWA 4U32A 2ZHFH 3SJ9A 2TGPZ 1TLDA 3RXCA 1GWAA 1J15A 1BMFD 1EAIA 3LC3A 3M5MA 3RXHA 1TOMH 4FUIA 4NFFA 3SNBA 2VVCA 3ZVFA 6GCHG 4K1EA 1GBDA 5C94A 2JH6D 1MKWH 2VIOA 1D4PB 2WHXA 4WVPE 1ZSKA 2Z3CA 1YPJH 2V7QD 1ELAA 3GYMA 1GHVH 3BTHE 2NU0E 1YY3A 3GY6A 2ZF0H 1T31A 3RXTA 1UTJA 4OM9A 1WQVH 1GBBA 5GWZA 2FYQA 1ANCA 1W0YH 1BQYA 4NCYA 2ZGCA 4LK4A 3SUGA 1G3EA 3F9GA 1UTLM 4I86A 3U8RH 3OU0A 1T8NA 1TRNA 3LGUA 2GCTB 1O3KA 3UWJH 1JXPA 2XC4A 2J34A 2GV6A 4X6NA 1GJ4H 3RXJA 1GJBB 5FPSA 1Y5BT 5JBCS 2Z9JA 2GX4A 1BTZA 4FUBA 3S7HB 2KR7A 4XFQA 2ZKSA 2BY5X 3LJJA 3NCLA 1A3BH 1AN1E 1CQQA 4Q7YA 4E7RG 4X8SH 2W3KA 3NXPA 2ZFFH 1QJ1B 2G4TA 3MU5A 1L1NA 1GCTC 2ZDAH 2FIRH 3FAOA 3GY7A 1BTXA 4DG4A 2BLQA 1JIRA 1UTQA 1HAHH 4B2BA 3PWCA 3SV7A 3M7QA 1C2JA 2A1DB 4Y0ZE 1HLTH 4K1TA 2PGBB 3OEED 5J4QA 2OBQA 3AW0A 3FZZA 2XW9A 1LDTT 5LH8A 3WW7A 4UFDH 1IHTH 4B2CA 4DT4A 2QAAA 1G37A 1C9PA 6LPRA 1K22H 2FOBA 3RP2A 3PV5A 1K1LA 1MZAA 3LGYA 4NA7A 1ZTLA 1GGDB 1KXDA 1QJ6B 2SGPE 3VB3A 4Y6DA 4X8VH 1TNIA 3RMMH 1GJAB 5PTPA 3H7OA 1UHBB 4X1QU 2WPJS 1C2IA 2OC7A 1ARBA 1WXRA 4WF8A 1NESE 1DY8A 1UCYK 2HGTH 5ABWA 3UIRA 3SOSA 4YOJA 3MHWU 3KN2A 1WV7H 1HAVA 4UE7H 1L1GA 3AW1A 3D65E 5C1XA 2QF4A 4F4OC 4A1VA 1EB1H 1C1NA 1EOLA 1TFXA 1Y3VA 1O2MA 1QHRB 3A7WA 2PKSB 1B0EA 4Y79A 1L0ZA 1CE5A 1KXAA 1LVYA 3SJKA 5C5NA 2H9TH 2ZQ2A 2FX6A 1FONA 2FOCA 1A5GH 3SV6A 1O5AB 3A7TA 2D8WA 1MQ5A 2VB0A 4ABBA 1AE8H 2ZU2A 5L2ZH 1P2MA 2LP6A 3KQ5A 1VKYA 4TPYA 4DURA 4Y0YE 3VG8A 1V3XA 3RXGA 2PKAB 3KYFA 1A61H 1E35B 1ELDE 4X2YA 2QE7D 1GHYH 2Y7XA 2SNVA 3OTJE 2CMYA 2IOTA 4JYTA 1HPGA 4XD7D 2A4GA 1UTMA 2V6NA 3SNEA 4K3JA 2G51A 4BAKB 1B7XB 1FJSA 1FLEE 2V3OH 4TYDA 3MH5A 1CU1A 4AORA 2ZU1A 1A0LA 2KCAA 3LU9B 1HJ8A 1F0UA 2SGQE 1JWTA 1HUTH 2OC8A 2BX4A 3VGCB 4O9VA 1VGCC 3D49H 4XBDA 2ANMH 3PLPA 3KQBA 3OY5U 2BX3A 4MPWA 4FUHA 1ABIH 3FP7E 3SU6A 5EPYA 2RA0A 3ZVEA 2GMTC 1F0SA 1F7ZA 2QN5T 4FU9A 1ETSH 4BTUB 5EGMA 1YKTA 3F1SB 3ELAH 1P3EA 4DIHH 1CA0C 2FX4A 1HYLA 1ZSJA 3MWIU 4MG3A 1YWUA 1S0QA 1G2LA 3RLWH 1V2JT 1THRH 3B23B 3FP8E 1PYTD 1LTOA 5LPEA 3N7DA 2GCTC 1MH0A 3DFJA 2VWLA 3DD2H 4P02A 3QK1A 2OTVA 2WPKS 1KMHB 1LKBA 2ZFQH 1GL1A 3OX7U 3PLBA 3RXAA 4RSPA 1CBWB 5E0JA 4DGJA 1AZ8A 1F5KU 2GP9B 4BXSA 3UNRA 2BDHA 1ETRH 1QJ7B 3MNCA 1MAXA 1O3BA 2A5IA 5JBAS 1O2RA 4P00A 1Q31A 2BTCE 1EAUA 1SFIA 1FY8E 1QTFA 1DPOA 1FN6A 3LIWA 3LKWA 1HCGA 1CO7E 2Y5HA 2ZFTA 5K0HA 1QRXA 4ISIH 5FX6A 1WSSH 2F9BH 3SORA 1F92A 1LPZB 2LNCA 1O3IA 3VXFH 2JETC 3RMOH 4O03A 3ZV9A 3O8CA 4ASHA 4CBNA 3N7OA 1Y5AT 5CMXH 1ZLRA 3PMJA 1GGDC 4R0IA 3MO6A 4ABJA 2PR3A 1Z8JB 3A7ZA 1UCYH 1QBVH 2FS9A 5DP3A 1XUGA 1S81A 3F68H 5A8XA 1XUHA 5F6MA 3AVZA 3KGPA 1GHXH 3SJOA 4AOQA 1O3MA 4CRAA 1BT7A 2BD9A 1GJ5H 2EEKA 1TX8A 2QF3A 4INKA 4ZKNU 3RU4E 1TGNA 2QF0A 1D9IA 4ZKSU 3DSPA 4UDWH 5TCAA 2ZDNA 1TPAE 2CGAA 2R0LA 1ZTKA 3NK8A 3EA9A 1WQSA 3Q3XA 4B76A 3GCNA 1GVLA 1GMCG 2TGDA 3EAJA 3VB6A 1GBEA 3QDZB 4X2VA 4AG1A 4BTTB 1O2WA 2J9NA 2XRCA 1TX6A 2H2ZA 1T8OA 3SBKA 1L2EA 1TQ0B 5T6FA 4OS7A 3RC5A 3TNSA 3RXFA 1OP2A 1ELVA 1IQKA 1DDJA 1SQRA 4BTIB 1BCUH 1SGQE 5DPAA 3FP6E 3TH2H 2D26C 1TNJA 1O5FH 3M5LA 2L6OA 1YCPH 1UVUH 2ASUB 1ELGA 1SQOA 4HGCA 2BD4A 2G4UA 1YYY1 4MDSA 5I25A 2IPHA 3NZIA 1DITH 4D8NA 1OS8A 4DOQA 1FQ3A 1CT0E 1H8DH 2F83A 2R0KA 1C5TA 3A8AA 5E0GA 1EFRD 4B2AA 2FLRH 5EG4A 1WU1A 2HNTE 1HJAB 2STBE 1G36A 3QZRA 2K8IA 4F49A 3TH3H 1P02A 2VIQA 4INHA 1BZXE 1EP5A 2GV7A 1AY6H 4CR5A 4E7NA 1OHHD 2H1UA 3RXMA 2P59A 2VVVA 4HTCH 1VCPA 1GHAG 2Z6BD 4KP0A 1SLVB 5FBIA 4OGXA 4X6MA 2GZ9A 1C2FA 1CA0B 5DO4H 2HNTF 2FI5E 3STJA 2LELA 1ZHPA 4BAHB 1LVMA 3RLYH 5KGOA 2GDDA 2OD3B 4GHQA 2GKVE 1UK4A 1HDTH 6ESTA 1D3QB 1P12E 1FNIA 3EA7A 2DUCA 1GI3A 4Y10E 1AO5A 1P2NA 1ZSLA 1G3BA 1DY9A 1T8MA 1C5UA 1V2NT 2I6QA 4XOJA 4Z0KA 4Q7XA 5HXFA 4ABGA 1P0SH 3F9FA 2W7UA 4WXVA 1C5ZB 2FOAA 3VEQB 1P03A 4IC5A 1Y59T 2CHAB 1GBKA 2ZTZA 4GUXA 5JYIA 1P57B 4GPGA 3PV4A 1BTWA 1ELCA 1H1BA 4I7YH 3W94A 2BQ7B 2FDAA 3EE7A 1OSSA 2VU8E 1IQLA 4HFPB 1J16A 8ESTE 4K60A 5IYTA 4ISOA 2BOKA 3M37A 1QL7A 2JJ1D 4NWLA 1RTFB 1GI8B 1TABE 4JZ1A 4Y11E 1O2HA 3OE7D 4K1SA 2BDCA 2J97A 3NPSA 1TGTA 1W3CA 3MU1A 1GI2A 5CHBA 2AGIX 5T1VA 2XBVA 1HV7A 4F48B 2HOBA 3MO9A 4E06H 5LPRA 2BY7X 2GVFA 4JK5A 4H6TA 3OYPA 1BMMH 4MQAA 1O39A 5A0BA 4I8JA 3PV2A 3UFAA 3FANA 3RMNH 1W0ZU 1T4VH 3BTQE 1WAYB 1ZPCA 2AGGX 1UVPA 2PSXA 3HGPA 3OEHD 2A5AA 3NKKA 2KCPA 2GZ8A 1QQ4A 4LOYH 3K6YA 3RU4D 4ABIA 1IQHA 4Y76A 2ZFSA 1CGJE 2H5CA 4BNRA 2ODPA 1TNLA 2J94A 2AIQA 1GBLA 2ZQ1A 1TYNA 2FTLE 1B5GH 1GBIA 1MZDA 1E36B 1RS0A 3ODDA 1CT2E 5ETXA 4OS4A 2G5VA 1VITF 4NIYA 4OS2A 1K1OA 3SW2B 8GCHG 1GBJA 3A80A 1DLEA 2A7HA 4TWWA 3ZZ4A 2K1QA 2VGCC 1UJ1A 2PP6A 4ZH8A 3DHKH 3U69H 1DWDH 4RT1A 5DP8A 4JZFH 5GCHG 1W2KH 3MH4A 3NUMA 5A8ZA 2BB4A 3GYLB 4NA8A 1J9CH 1H9HE 3A85A 5EW2H 1Z7KA 3SNAA 1DE7H 2GMTB 1O38A 1OPHB 3UB0A 5EIYA 2H6MA 5BPEA 4X6PA 1CGHA 1Y3UA 1M9UA 2L74A 3VB5A 4CREA 3ZYDA 2R3UA 1DOJA 5C20A 3FOAA 1VITH 1GJCB 1N8OC 1SGFG 4ABEA 1SBWA 5HIZA 1GJ6A 1C5WB 2JKHA 1YGCH 3SYJA 4YT7H 2W26A 2GD4B 1KLJH 1GI0A 3PB1E 4A7IB 1DICA 1SKYE 4Y8YA 1GMDG 1EZQA 4OS1A 1UHBA 2ILNA 1C5PA 1F5LA 1NN6A 2KAIA 4E05H 1SLUB 3E0NB 1WOFA 1S83A 5EJZA 2QXGA 3A7VA 2AS9A 4K5ZA 3BTEE 1NRQH 1EZUC 1KDQA 1T7CA 3HGNA 1C2MA 1G32B 1MD8A 1XKAC 2W6JD 3RXRA 2XWBI 1NS3A 1O3HA 5IK2D 3T28A 1PFXC 2HALA 4H6SB 4YXWD 1XM1A 2ZG0H 5T6GA 2G52A 2G81E 4WMDA 5KECA 3UREA 1Y3YA 1PQ8A 2FESH 3SU3A 1T4UH 1C5XB 2V3MA 5C3NA 4X6OA 2VVUA 3V7TA 1BBRE 1QRWA 2ZHEH 3GY5A 1KLTA 4JYVH 2W5EA 2ZU5A 4A92A 2TIOA 1ANEA 5DP6A 2Z9GA 4ZROA 3BTME 3SGBE 1EASA 4JZEH 3TPIZ 1GL0E 1GVZA 2ZCHP 3CENA 3CS0A 1P06A 4ZKOU 4X1PU 1G9IE 2RDEA 4WY3A 1C2HA 5ESBA 1N6XA 1HB0B 4I33A 4ACBA 5DN6D 1TWXB 1O2UA 3RU4T 1QFKH 2FEQH 2JIZD 4FOUC 2Y5FA 1GBMA 5KEDA 1E1QD 5EJ1A 3L6PA 1QURH 3KYGA 4MTBA 5EXLA 3M61U 5JPMH 1NROH 1KTTB 1MD7A 1N8OB 4H42U 1ESBA 1GDNA 2Q6FA 1ZJKA 3F9EA 4XRNA 3CNRA 2RA3A 1AZZA 2V35A 2P93A 2QXHA 3UY9A 1Q3XA 5GNDA 1DANH 2AHME 2F91A 2VBCA 1K1MA 1C1WH 1O2TA 1LCYA 2BDAA 2EA3A 1SGTA 1BIOA 2M5TA 3M7UA 1GI4A 1D3PB 3URCA 4RI0A 3ATMA 3DFLA 1O5DH 4FXGH 3P17H 3P8OA 1O37A 3KHVA 3U98H 5JDUB 1CHOG 2UWOA 1K1NA 3SHCH 2XOKD 4NA9H 1DLKB 3TNTA 3UWIA 1MKXK 3L3TA 1SR5C 1O3EA 1EZSC 3E6PH 3GY2A 3RUOA 3STIA 1G3CA 5C2ZA 3ZZ6A 2GZ7A 1F0RA 1NFYA 5LPFA 1MMJN 3IG6B 3T2NA 2XXLA 1THPB 2UUJB 2ZECA 1AE5A 2BMGB 2V3HH 4CH2B 1QA7A 1A46H 3W1EA 1EUFA 1UW7A 4MPXA 1GI5A 1PJPA 3SU1A 6CHAC 2BDYA 1GHBF 1IQGA 2ZA5A 1WUNH 2SGEE 1P8VC 3AAVA 2A7JA 1FX0B 1O2KA 3RC6A 4RN6A 1IQIA 5CE1A 1SMFE 2BVRH 2A0QB 3H5CB 1FV9A 1UMAH 4KGAA 4THNH 3SU4A 3ATWA 1C1OA 2A32A 3TJNA 2FTMA 2IJD1 2YMSB 2ZFRH 3VPKA 4B71A 3F0OA 3ITIA 1K1JA 1BRUP 3GISB 4D7GA 1INCA 2TBSA 2PSYA 1XXDA 1MU6B 2PTCE 3SGQE 1PPHE 1SQAA 2BXUH 3K65B 3MNXA 4YTAA 1Y8TA 1UVTH 4NSYA 1UTPA 1SGDE 3SQEE 3BTTE 3JZ2B 3EA8A 1SSXA 1LQDB 1O2QA 1HAVB 4CRBA 7GCHF 2ZGJA 1NPMA 1KXBA 4GCHG 2HRVA 7ESTE 2QGRA 3Q3KA 8KME2 2VWNA 4FU8A 1TNKA 3SZNA 2FMJA 4BAOB 1S6LA 3MU0A 1V2KT 4M7GA 4AG2A 1TGSZ 3ZYEA 3ZVDA 1LVOA 1ZOMA 1RRKA 2BZAA 2ZI2H 5EPNA 3VXEH 3T62A 1EX3A 4O3TA 3TGKE 1OXGA 4GAWA 3ZVBA 4NWKA 1P2JA 3LDXH 1QZ8A 2CJIA 5EQSA 4INLA 2QYIA 2ANWA 2QXJA 3RXUA 3UNQA 1MTNB 2KZ4A 7KMEH 1GI6A 3T5FH 1JOUB 1SHYA 3FFGA 1SOTA 1DS2E 5B6OA 1OWIA 4I8HA 4ESTE 3CS7A 2R2WU 1N1LA 3UTUH 5GIBA 3Q00A 1L4DA 3MFJA 3MQKC 1V2OT 1TNHA 5HM2A 1GJ9B 2OP9A 1DUEA 2VH6A 3EDXB 2EY4C 3GOVB 2OCVB 2RCEA 3HK6B 3SGAE 2OQ5A 3SUDA 1O30A 5EXNA 1FMGA 3F2GA 4OS6A 2P94A 1YCPM 1PPGE 2XBYA 1A5HA 1S0RA 2GT8A 2XWAA 3SHAH 5FL7D 1TBZH 1P2KA 4RT0A 1O3LA 1GG6B 4KTUA 2Y6TA 1IQMA 1GJDB 1KTSB 2BVXH 1RIWB 1AIXH 1F2SE 2BD5A 3SU0A 1OOKB 4Z1MD 3HATH 1NBME 1SHHB 4ASUD 2EI7A 1COWD 1EOJA 4TY7A 1GHBG 1SLXB 2QXIA 4MPVA 1S82A 3U8TH 2PUQH 2A7CA 5AFZH 6GCHF 3ZZ3A 3FVFB 5HM9A 3V13A 1FN8A 2FOEA 2JDID 5TJXA 2CK3D 4QT8C 3PMBB 3U9AH 1KYNA 1PQ5A 2QF5A 3TGIE 4YOIA 3UR6A 5DG6A 3TITA 1NBMD 8LPRA 2SGFE 4MNVA 5C5OA 1GHAF 3EQ0H 2CHAC 3SU2A 4AC9A 5I46H 1TMUH 2FI3E 2GDEH 5FCKA 4MNWA 1FY4A 4HZHA 1O2PA 1ZMLA 1GMDF 4Q63A 1ZJDA 2VGCB 1GVKB 1CT4E 4U01A 1C2DA 2Q6GA 2ALPA 1D6RA 4X0WU 1TRYA 1OWKA 1W10U 3QZQA 1TMBH 4HG6A 2OXSA 1MUEB 1Z1IA 4AN7A 3PO1B 2C8WB 1BRBE 5B6LA 1QBNA 1AVXA 5GXPA 2GT7A 3A83A 1ELTA 2A4QA 1BOQA 1Y5UT 1C1UH 3N99A 3S7KB 4CBOA 4IMQA 1TALA 3MYWA 2Z3DA 4CHAB 1BA8B 4DCDA 1DXWA 3SU5A 1IAUA 2H9HA 4FETA 1C5OH 2GCHG 1O0DH 5AVDA 2BVSH 2ZHWH 1C2GA 5DKMA 3TGJE 2VJ1A 1OYTH 1V2UT 4H4FA 1SVPA 1AFQB 5AHGH 1C1MA 1V2WT 5A0CA 3U1IB 1NRRH 3QX5H 1FDPA 1IHSH 3P95A 5FXLA 1A0HB 1Z6EA 5T6DA 3T25A 2WUBA 5CDFE 1AU8A 5JBTA 4JYUH 1T8LA 3A89A 1Z6JH 5F8XA 1VR1H 2QCYA 1GMHF 3OAAD 1ZYOA 3N7EA 1MTSA 2VINA 3PRBA 4IC6A 4GLYA 3A8DA 4NG9H 1QA0A 2B9LA 1HBTH 4XDEA 2BXTH 2ZDVH 1AQ7A 3RXSA 3MNSA 5FHTA 2FODA 1DUAA 2FOHA 5EU8A 1C5LH 1VJAU 1YLCA 1ABJH 3BTFE 2Q6DA 1PQAA 3P8NA 5GJ4B 1O34A 1AKSA 3F0PA 1KDQB 1MBMA 3PWBA 1OKXA 1SGEE 3R3GB 1LHFH 3A7XA 4NZQA 3ZZ8A 1CHOF 3ATLA 3UUZA 3F3BA 2J98A 1SGPE 3SZEA 1FIWA 3MU8A 2IJOB 1LHEH 2B7DH 1EPTB 2O8WA 1BUIA 1YPHC 2WZQA 5L6NH 1HIAB 2GCHF 2FOGA 1EAXA 1ELEE 2BM2A 1C4Y2 1GG6C 2HLCA 1HXFH 1W12U 1CA8B 1K28D 2Z94A 3MTYA 4XSKU 4X1SU 4ABAA 3KCGH 1BB0B 3IITA 4Q80A 4AGKA 1ZGVA 4Y8ZA 4F55A 1SGNE 1AKSB 1HFDA 3HKIB 3F6UH 5HKKD 3TJVA 3GCTF 2AH4X 3NWUA 2HPPH 1LMWB 1MBQA 2LPRA 3M3TA 1Y3XA 1C1RA 2EQNA 3ATKA 1VZQH 1C1QA 3Q3YA 5BRRE 3M7TA 3PM3A 1SC8U 2TRMA 4I31A 1A2CH 3ZZ7A 1OX1A 3M5NA 3R0FA 2HVYB 3U28C 1CSOE 1BMNH 1QQUA 1XUFA 1Z1JA 1MTWA 5DP4A 1E0FD 1H8HD 5EQQA 2P8OC 2IN2A 1TGBA 2F9NA 3G01A 1ELBA 1UO6A 1P2IA 1E1RD 4DJZB 2AMPA 3C1KA 3SJ8A 4YZUA 1TX7A 1P9UA 3SNDA 1ZRBA 1A0JA 1C5RA 4WMEA 2ODYB 1A7SA 4Y8XA 3O8BA 4JZIA 2STAE 1DM4B 1PPBH 1AWFH 4ABDA 1D3DB 2PKAA 1XUIA 2BD2A 3RM0H 2W3IA 4I8KA 1SPJA 5ESTE 2SFAA 2OC0A 1C1SA 1OP8A 2B5TB 2UWLA 9ESTA 2ALVA 4LZ1H 3TK5A 1ZMJA 3RC4A 4ZKRU 4YM9A 5EJLA 3SO3A 3SV9A 1PPCE 1O32A 1YPLH 3QWCH 2WV9A 2GTBA 5F53A 4LXBH 2KCYA 2ANKH 1S84A 4SGAE 3E0PB 5EODA 1V2RT 2PUXB 3GS9A 1SB1H 2F9OA 1O3JA 5H4IB 4AYYB 3RXLA 1SFQB 1SGRE 3U1JB 1ANDA 1GBHA 1AGJA 1O2YA 2CXVA 2F3CE 2BOHB 1NT1A 4FUEA 2J92A 1SQTA 2O8LA 2NU1E 1TB6H 3DSOA 4GSOA 4FUDA 2UWPA 2CV3A 1HAYB 1PQ7A 1GPZA 5F8TA 2ZHQH 1ETTH 1O2LA 2ODQA 1EJAA 4I8GA 3ZZBA 3MNBA 3S9BA 2DE8A 2WV4A 3BF6H 4JK6A 4WH8A 3T27A 1CHGA 4YO9A 2BHGA 1SOZA 4AX9H 1X7AC 1EKBB 1RJXB 4TSFD 3WY8A 5EOKA 5JB9S 1TA6A 2QV1A 1DVAH 1HIAA 1EATA 1QB9A 1QL8A 1W7XH 4XBBA 4B74A 3TLOA 2OK5A 3WWFA 2UUFB 4Q4LA 1UK3A 1SI5H 2BYAX 3GDUA 3K9XB 2SGDE 3K6ZA 1GBFA 1TIOA 1GHZA 4IW4E 3A8BA 1G2MA 1XVMA 2G5NA 4X1NU 4Y71A 4CHAC 1O2OA 1BHXB 1P11E 4LZ4B 1ZPBA 1O2IA 3TK6A 2XNIA 3RXKA 2AMQA 5HYOA 1OWDA 2R9PA 1BJUA 1EPTA 1FI8A 5C17A 1C1TA 3NRLA 4O97A 3ENSB 3PRDA 2ZGXH 2XBXA 1MKXH 1O3DA 1P04A 2I6SA 3KQCA 3VB7A 1Z8IB 1GDUA 1O2JA 2ZGBH 4RKOB 4ZCNA 1MTUA 1SGYE 3QN7A 3TH4H 1C5MD 1WYKA 1O3FA 2A5KA 4TPIZ 3GICB 1FAXA 1QB6A 1ZR0A 2FXRA 5A2MH 1F5RA 2NU4E 1D6WA 3SUEA 1PPZA 4RKJB 1H9IE 3ESTA 1O2NA 1YPKH 1DWEH 3LT3A 1UK2A 2BD8A 1NRSH 2H5DA 1UTOA 3LGTA 3QUMP 1LPGB 3S9AA 3AK5A 1GJ8B 3LH3A 5FAHA 1EJMA 4FUGA 2FLBH 2ZIQH 1QR3E 2J98B 2SNWA 3RXIA 9LPRA 3E91A 4AFQA 5A09A 2ANYA 1MCTA 1ZTJA 1NM6A 2AEIH 3A87A 3L33A 1H4WA 2R2MB 4D9QA 1IQNA 1C4V2 2B8OH 2ZO3H 1FXYA 1L1JA 1FPCH 3AAUA 4I8LA 4NFEA 1HAOH 1Y3WA 4U30A 3S9CA 1P10A 1SL3A 3BG8A 3QGJA 3UAIC 3A8CA 1TONA 4X1RU 2ESTE 1P9SA 3OTPA 1ZZZA 1O36A 1HGTH 1RIWC 1AFEH 2OINA 2TGTA 2ZCLP 2F9VA 4ABHA 1KLIH 1TPSA 1XUJA 1TMTH 1A4WH 1S85A 1HAXB 3ZZDA 1K0HA 2BD3A 1KSNA 5SGAE 1TQ7B 3B9FH 4ISNA 2P16A 2Z3EA 4B6FA 1HAGE 3C27B 5C0TA 2ZPSA 2IPQX 3KNXA 1UVSH 1L4ZA 2QIQA 4I32A 4YOGA 2Z9LA 1B0FA 4AB8A 3F9HA 1C2EA 3A82A 2OBOA 1AHTH 4MNYA 1IQFA 5FCRA 1BRAA 1EXFA 2CF9H 1YPGH 1GCTB 1OWHA 2F9UA 1LHGH 1GJ7B 2UUKB 3BEFB 4CH8B 2J5UA 2ZHDA 5G4BA 3F2FA 3P8GA 3GY4A 1IQJA 1OWJA 3V12A 3FN8A 1C5QA 1V2ST 3MH7A 1FY3A 4ISHH 5E2PA 4DW2U 2FOMB 3BEIB 3O8RA 2AFQB 2FYRA 2WPMS 2Y5GA 1RTKA 2P3TB 4Q7ZA 3PTBA 2FM2A 3ZZ9A 1TGCA 1ESAA 2OC1A 4NIXA 1O31A 2XTTB 3SI4H 2C90B 6CHAB 1WCZA 4IS5A 2YNAA 3V3MA 1EP6A 3TU7H 3A81A 1FY1A 1W8BH 4YESB 4X2XA 3BSQA 5DSFA 1V2QT 4DY7B 1HAIH 1SLWB 3QO6A 1NO9H 5HGGA 4WXIA 2ZTXA 1RD3B 4VGCB 2OUAA 1SG8B 3SUFA 1QL9A 5J4SA 3F2HA 3ZVAA 2TGAA 1W14U 3BTDE 3MO3A 1GI9B 3DA9B 1P2QA 4B1TA 1LHDH 1E38B 2O9QA 2A45B 3BTGE 4BANB 1P09A 1V6DA 4YLUA 4JCNA 1OP0A 3LPRA 5L30H 1VITG 3UPEA 2J95A 2Y81A 1E37B 1MCVA 2K0QA 3H7TA 4MPUA 1SGIB 4D76A 2FI4E 4Q2KA 1ARCA 3BEUA 3TVJB 5FPTA 3EYDA 5FX5A 5GCHF 4MLFB 3I29A 2XCNA 1XVOA 4IN2A 1C5VA 1P2OA 3Q77A 3UQVA 3BTKE 4X8UH 1HJ9A 4WWYA 1C2LA 4IMZA 4UFFH 1TE0A 5C0UA 1C1PA 1GMCF 1BITA 1O3PB 1S6HA 2ZU3A 3DCLA 1Z8RA 1XUKA 2FWWA 2PV9B 2EC9H 3B8JA 5TCCA 1ID5H 3RXQA 1LQEA 1TNGA 1YPMH 1YLDA 1BTUA 2VIPA 2ZZUH 3GDSA 5EXMA 2ZDKA 1DSTA 1LPKB 3ZZCA 1JBUH 1J14A 1UTNA 5A0AE 2AYWA 5C1YA 3T26A 2ZCKP 4IGDA 1PPEE 2XNDD 2ZDMA 3DT0H 4FVDA 4U2WA 1DFPA 5CHAC 1O3OA 4GHTA 1NFUA 1JRTA 2F9PA 4OS5A 1XX9A 5DGJA 3UR9A 2G00A 1NC6A 1E34B 3P70B 2WV5A 2Z9IA 1KY9A 2XCFA 1AVGH 2C8YB 1Q2WA 3LGIA 5JBBS 2C8ZB 1ZRKA 1OYQA 3GCOA 3Q76A 1NFWA 2EI6A 4Y7AA 2BDGA 4NZLA 5L2YH 1DT2A 1GHWH 4GVUA 3RXVA 4R8TB 2A2QH 2GJGA 2SGAA 4ZXXH 2A4RA 1BMAA 3HK3B 2KX4A 1V2VT 5DP9A 2FS8A 1GBTA 5DJ7A 1H8IH 3DUXH 3GCHB 2BY8X 3RDZA 4AYVB 3URDA 3U8OH 3PTNA 1IOEA 4XBCA 1EZXC 3ZVCA 2BDBA 1NRNH 2JH0D 1SGFA 1DXPA 1QCPA 1HJAC 2BLVA 1MQ6A 7LPRA 3SN8A 1HNEE 4K2YA 5AF9H 3UQOA 4FUJA 1EB2A 1TBRH 3SNCA 4Y7BA 1K21H 1QBOA 3E16B 3GY3A 4DIIH 1FIZA 1W0JD 4UEHH 8GCHF 3SJIA 1AUJA 2BZ6H 1S5SA 1A5IA 4OGYA 3E3TA 2W7SA 1MABB 4FUFA 4BAQB 4O3UA 1O3CA 2CF8H 4HI3A 2FP7B 1BBRH 1O3AA 2KAIB 4JZDH 2XC0A 1AMHA 4YT6H 1AI8H 1AD8H 1RFNA 1O5GH 2D1JA 2JETB 3T29A 2BLOA 4AZ2B 5JB8S 2AERH 2F43B 1VJ9U 2QA9E 2HLDD 2C8XB 3JZ1B 3ZVGA 4CRDA 1S6FA 3RXPA 2A2XH 1C4U2 2WYGA 1WTGH 2Z7FE 2M2AA 3M36A 1BDAA 2PHBA 3BN9A 3P8FA 4DT7B 1HXEH 3K2UA 2AMDA 1EQ9A 2HPQH 1BTHH 2FPZA 2WYJA 5FBEA 1LVBA 1YPHE 3SV2H 3SQHE 3QGNB 1LHCH 1QGFA 3FO8D 2XBWA 1NFXA 1QNJA 1BBRK 4A6LA 3FKSD 1UCYE 5C67A 1JIMA 1FZZA 4WH6A 1W11U 2QC2A 3KIDU 5DK1A 3ODFA 2D2DA 2O8MA 2ZU4A 1O33A 2P3UB 2H9EH 1V2TT 2BY6X 3DSGA 4WJG2 1W13U 1BJVA 1K9OE 4ZXYH 1EJNA 3D62A 3MOCA 2WPDD 1JRSA 3LGWA 2QY0B 1TPOA 2KCOA 3QLPH 1K2I1 2ZC9H 4BXWA 4UONA 5AFYH 4ZUHA 3QTVH 2XC5A 4PROA 1NTPA 2RG3A 1GBCA 2ZDLA 3ZV8A 4GCHF 2C93B 2G8TA 4ISLA 4TY6A 3TJUA 2V0BA 1YF4A 2HWLB 4K8BA 1DWBH 3KQEA 1GCDA 4CRFA 4ZHAA 1TPPA 1HAZB 3BIVH 3MMGA 3BG4C 1F0TA 1P01A 1K1PA 4BAMB 2KM0A 1RXPA 3BG4B 1YCPK 4JMYA 1KXCA 2BLWA 2JH5D 2YMSC 1KXEA 3TJOA 1A1RA 4YLQH 3LJOA 3RMLH 1A3EH 5A8YA 2YNBA 4ZHLU 1QRZA 2HVXA 2BQWB 1NZQH 1EAWA 4B75A 3OSYA 2R3YA 3OFND 2TPIZ 2JJ2D 3A86A 5CHAB 1C5SA 1AFQC 4IBLH 1E79D 4SGBE 2ULLA 5HIYA 2ZPQA 1BTPA 1XXFA 2CN0H 1PYTC 3MU4A 3RXEA 1KIGH 1P3CA 1NRPH 1VGCB 2WUCA 2GGVB 4M9FA 1LO6A 2P95A 4UFGH 3ZZ5A 4A1XA 3KF2A 3E1XB 2VH0A 1TAWA 1TOCB 2VWOA 1O2SA 2PWXA 4MNXA 3GCTG 1C9TA 4AFSA 1RTLA 2PGQB 1V2MT 2ZPRA 1C5YB 1YP9A 5EQRA 5LGOA 3H09A 4AFZA 1OWEA 2BD7A 1O2GH 2NU3E 1YPEH 1T32A 1WBGB 2PLXA 1AB9B 3UOPA 2B0FA 3CP7A 2VIDA 4K8YA 3ATIA 3GDVA 3LH1A 1J8AA 1GMHG 2UUYA 3PYHA 4ABFA 3KEEA 1J17T 1D3TB 1Z71A 2ZTYA 4KELA 4B73A 4AFUA 2RFKC 3PO1C 4D7FA 4AGJA 2A4OA 3EGKH 3A88A 2VWMA 1BMLA 1FY5A 5DP7A 3FZDA 1JMOH 1G3DA 1O5CB 1Z8GA 2P3FH 2RDLA 1TA2A 4ZAEA 3OY6U 2NU2E 2OQUA 3PLKA 3BTWE 1O5BB 3WWBA 1YBWA 3P6ZB 2VIVA 1O2XA 2YOLA 3M3VA 2Y7ZA 3GY8A 3GCHC 1G30B 2O8TA 1LKAA 1UVOA 5F03A 2WPHS 3P92A 1CVWH 1O3GA 5HMAA 1UTKA 2W6ID 1AB9C 2C4FH 3PMAB 1CBWC 2J4IA 2Z9KA 4B6EA 2Y80A 3E8LA 1ZGIA 3RXBA 1TRMA 4NIWA 1TBQH 3KQDA 4J2YB 1PPFE 3LGVA 1BHXF 2O8UA 4DVAU 2PW8H 2BQ6B 1ZHRA 3HKJB 3LONA 3RXDA 2P8OB 4ACAA 3A84A 4ZMAH 4CR9A 1FUJA 1V2PT 1KXFA 1DSUA 2NWNA 1WTHD 4CRCA 5F8ZA 4NGAH 1AUTC 2F4LA 4UD9H 1O3NA 4ZHMU 3BV9B 2C3SA 1W0KD 3PROA 1FAKH 1FPHH 2FOFA 5DP5A 3EE0B 2Q1JA 1QB1A 1ZMNA 2WSSD 3M35A 4J1YA 1HAPH 1ORFA 2WINI 1IQEA 4Z6AH 1O35A 1QY6A 2ZEBA 5E2OA 2G55A 2ZFPH 4MVNA 5FPYA 1H8ED 4WMFA 4CRGA 1BRCE 2WPLS 2BY9X 4A5TS 1O2VA 1N6YA 2YMSD 2J38A 4NSVA 1NY22 1MAYA 1V2LT 2EI8A 1C5NH 2ZGHA 3I78A 3LC5A 3E90B 3W95A 3RM2H 1WDIA 2THFB 3A7YA 4TWYA 2AIPA 2HNTC 2J2UA 1NU7B 5GDSH 1SGCA 2KFWA 4FVBA 1XMNB 4FUCA 1HRTH 2VIWA 1DWCH 3ZZAA 1AVWA 1BTYA 1MTNC 1CGIE 1NU9A 1YC0A 3QTOH 2XYAA 3VFEA 1AWHB 2DE9A 2WPIS 3MH6A 1ESTA 2FZZA 4XE4A 1O5EH 1H9LB 4KTCA 4X2WA 2OLGA 1O2ZA 4KKDA 2PTNA 5T3HA 3D23A 1MU8B 3MI4A 4D9RA 1P05A 3S69A 3I77A 1ACBE 3SI3H 4VGCC 1XKBC 3UNSA 2FO9A 2Y82A 1VCQA 4AB9A 5GPIB 3S0NA 5IDKA 2BDIA 3KL6A 4KTSA 3VB4A 3ZIAD 2PKSC 1ZPZA 3M3SA 5C1UA 1THSH 1GI7B 2VNTA 3IWMA 3TK9A 5EW1H 4K69A 5E0HA 3V0XA 1W7GH 2ZP0H 1MKWK 3RXOA 1YLNA 4X8TH 4A1TA 4TT3D 4BOHA 3HPTB 3UOUA 1ZHMA 2AGEX 1K1IA 1GDQA 7GCHG 1GI1A 3SV8A 5K7RA 1RGQA 3LOXA 2ZNKH 3O8DA 1DX5M 3PMHB 1U6QA
chains in the Genus database with same CATH topology
1C2KA 1YM0A 4UFEH 4FU7A 1MTVA 1GBAA 4IN1A 2ZWLH 1QIXB 4NIVA 3VGCC 3TIUA 3AASA 2PFEA 5E8EH 2A31A 1EPTC 3M5OA 1ANBA 1ELFA 3BIUH 1C1VH 1VCWA 4U32A 2ZHFH 3SJ9A 2TGPZ 1TLDA 3RXCA 1GWAA 1J15A 1EAIA 3LC3A 3M5MA 3RXHA 1TOMH 4FUIA 4NFFA 3SNBA 2VVCA 3ZVFA 6GCHG 4K1EA 1GBDA 2JH6D 1MKWH 2VIOA 1D4PB 4WVPE 1ZSKA 2Z3CA 1YPJH 1ELAA 3GYMA 1GHVH 3BTHE 2NU0E 3GY6A 2ZF0H 1T31A 3RXTA 1UTJA 1WQVH 1GBBA 5GWZA 2FYQA 1ANCA 1W0YH 1BQYA 4NCYA 2ZGCA 4LK4A 3SUGA 1G3EA 3F9GA 1UTLM 3U8RH 3OU0A 1T8NA 1TRNA 3LGUA 2GCTB 1O3KA 3UWJH 1JXPA 2XC4A 2J34A 2GV6A 4X6NA 1GJ4H 3RXJA 1GJBB 5FPSA 1Y5BT 5JBCS 2Z9JA 2GX4A 1BTZA 4FUBA 3S7HB 4XFQA 2ZKSA 2BY5X 3LJJA 3NCLA 1A3BH 1AN1E 1CQQA 4Q7YA 4E7RG 4X8SH 2W3KA 3NXPA 2ZFFH 1QJ1B 2G4TA 3MU5A 1L1NA 1GCTC 2ZDAH 2FIRH 3FAOA 3GY7A 1BTXA 4DG4A 2BLQA 1JIRA 1UTQA 1HAHH 4B2BA 3PWCA 3SV7A 3M7QA 1C2JA 2A1DB 4Y0ZE 1HLTH 4K1TA 2PGBB 5J4QA 2OBQA 3AW0A 3FZZA 2XW9A 1LDTT 5LH8A 4UFDH 1IHTH 4B2CA 2QAAA 1G37A 1C9PA 6LPRA 1K22H 2FOBA 3RP2A 1K1LA 1MZAA 3LGYA 4NA7A 1ZTLA 1GGDB 1KXDA 1QJ6B 2SGPE 3VB3A 4Y6DA 4X8VH 1TNIA 3RMMH 1GJAB 5PTPA 3H7OA 1UHBB 4X1QU 2WPJS 1C2IA 2OC7A 1ARBA 4WF8A 1NESE 1DY8A 1UCYK 2HGTH 5ABWA 3UIRA 3SOSA 4YOJA 3MHWU 3KN2A 1WV7H 1HAVA 4UE7H 1L1GA 3AW1A 3D65E 5C1XA 4F4OC 4A1VA 1EB1H 1C1NA 1EOLA 1TFXA 1Y3VA 1O2MA 1QHRB 3A7WA 2PKSB 1B0EA 4Y79A 1L0ZA 1CE5A 1KXAA 1LVYA 3SJKA 5C5NA 2H9TH 2ZQ2A 2FX6A 1FONA 2FOCA 1A5GH 3SV6A 1O5AB 3A7TA 2D8WA 1MQ5A 2VB0A 4ABBA 1AE8H 2ZU2A 5L2ZH 1P2MA 4TPYA 4DURA 4Y0YE 1V3XA 3RXGA 2PKAB 1A61H 1E35B 1ELDE 4X2YA 1GHYH 2Y7XA 2SNVA 3OTJE 2CMYA 2IOTA 4JYTA 1HPGA 2A4GA 1UTMA 2V6NA 3SNEA 4K3JA 2G51A 4BAKB 1B7XB 1FJSA 1FLEE 2V3OH 4TYDA 3MH5A 1CU1A 4AORA 2ZU1A 1A0LA 3LU9B 1HJ8A 1F0UA 2SGQE 1JWTA 1HUTH 2OC8A 2BX4A 3VGCB 4O9VA 1VGCC 3D49H 4XBDA 2ANMH 3PLPA 3KQBA 3OY5U 2BX3A 4MPWA 4FUHA 1ABIH 3FP7E 3SU6A 5EPYA 2RA0A 3ZVEA 2GMTC 1F0SA 1F7ZA 2QN5T 4FU9A 1ETSH 4BTUB 5EGMA 1YKTA 3F1SB 3ELAH 1P3EA 4DIHH 1CA0C 2FX4A 1HYLA 1ZSJA 3MWIU 4MG3A 1S0QA 1G2LA 3RLWH 1V2JT 1THRH 3B23B 3FP8E 1PYTD 1LTOA 5LPEA 2GCTC 1MH0A 3DFJA 2VWLA 3DD2H 3QK1A 2OTVA 2WPKS 1LKBA 2ZFQH 1GL1A 3OX7U 3PLBA 3RXAA 4RSPA 1CBWB 5E0JA 4DGJA 1AZ8A 1F5KU 2GP9B 4BXSA 3UNRA 2BDHA 1ETRH 1QJ7B 3MNCA 1MAXA 1O3BA 2A5IA 5JBAS 1O2RA 1Q31A 2BTCE 1EAUA 1SFIA 1FY8E 1QTFA 1DPOA 1FN6A 3LIWA 3LKWA 1HCGA 1CO7E 2Y5HA 2ZFTA 5K0HA 1QRXA 4ISIH 5FX6A 1WSSH 2F9BH 3SORA 1F92A 1LPZB 2LNCA 1O3IA 3VXFH 2JETC 3RMOH 4O03A 3ZV9A 3O8CA 4ASHA 4CBNA 3N7OA 1Y5AT 5CMXH 1ZLRA 3PMJA 1GGDC 4R0IA 3MO6A 4ABJA 2PR3A 1Z8JB 3A7ZA 1UCYH 1QBVH 2FS9A 5DP3A 1XUGA 1S81A 3F68H 5A8XA 1XUHA 5F6MA 3AVZA 3KGPA 1GHXH 3SJOA 4AOQA 1O3MA 4CRAA 1BT7A 2BD9A 1GJ5H 2EEKA 1TX8A 2QF3A 4INKA 4ZKNU 3RU4E 1TGNA 2QF0A 1D9IA 4ZKSU 4UDWH 5TCAA 2ZDNA 1TPAE 2CGAA 2R0LA 1ZTKA 3NK8A 3EA9A 1WQSA 3Q3XA 4B76A 3GCNA 1GVLA 1GMCG 2TGDA 3EAJA 3VB6A 1GBEA 3QDZB 4X2VA 4AG1A 4BTTB 1O2WA 2J9NA 2XRCA 1TX6A 2H2ZA 1T8OA 3SBKA 1L2EA 1TQ0B 5T6FA 4OS7A 3RC5A 3TNSA 3RXFA 1OP2A 1ELVA 1IQKA 1DDJA 4BTIB 1BCUH 1SGQE 5DPAA 3FP6E 3TH2H 2D26C 1TNJA 1O5FH 3M5LA 1YCPH 1UVUH 2ASUB 1ELGA 1SQOA 4HGCA 2BD4A 2G4UA 1YYY1 4MDSA 5I25A 2IPHA 3NZIA 1DITH 4D8NA 1OS8A 4DOQA 1FQ3A 1CT0E 1H8DH 2F83A 2R0KA 1C5TA 3A8AA 5E0GA 4B2AA 2FLRH 5EG4A 1WU1A 2HNTE 1HJAB 2STBE 1G36A 3QZRA 4F49A 3TH3H 1P02A 2VIQA 4INHA 1BZXE 1EP5A 2GV7A 1AY6H 4CR5A 4E7NA 2H1UA 3RXMA 2P59A 2VVVA 4HTCH 1VCPA 1GHAG 2Z6BD 4KP0A 1SLVB 5FBIA 4OGXA 4X6MA 2GZ9A 1C2FA 1CA0B 5DO4H 2HNTF 2FI5E 3STJA 1ZHPA 4BAHB 1LVMA 3RLYH 2GDDA 2OD3B 4GHQA 2GKVE 1UK4A 1HDTH 6ESTA 1D3QB 1P12E 1FNIA 3EA7A 2DUCA 1GI3A 4Y10E 1AO5A 1P2NA 1ZSLA 1G3BA 1DY9A 1T8MA 1C5UA 1V2NT 2I6QA 4XOJA 4Z0KA 4Q7XA 5HXFA 4ABGA 1P0SH 3F9FA 2W7UA 4WXVA 1C5ZB 2FOAA 3VEQB 1P03A 4IC5A 1Y59T 2CHAB 1GBKA 2ZTZA 4GUXA 5JYIA 1P57B 4GPGA 3PV4A 1BTWA 1ELCA 1H1BA 4I7YH 3W94A 2BQ7B 2FDAA 4HFPB 1OSSA 2VU8E 1IQLA 1J16A 8ESTE 4K60A 5IYTA 4ISOA 2BOKA 3M37A 1QL7A 4NWLA 1RTFB 1GI8B 1TABE 4JZ1A 4Y11E 1O2HA 4K1SA 2BDCA 3NPSA 1TGTA 1W3CA 3MU1A 1GI2A 2AGIX 2XBVA 1HV7A 2HOBA 3MO9A 4E06H 5LPRA 2BY7X 2GVFA 4JK5A 4H6TA 3OYPA 1BMMH 4MQAA 1O39A 5A0BA 4I8JA 3UFAA 3FANA 3RMNH 1W0ZU 1T4VH 3BTQE 1WAYB 1ZPCA 2AGGX 1UVPA 2PSXA 3HGPA 2A5AA 3NKKA 2GZ8A 1QQ4A 4LOYH 3K6YA 3RU4D 4ABIA 1IQHA 4Y76A 2ZFSA 1CGJE 2H5CA 4BNRA 2ODPA 1TNLA 2J94A 2AIQA 1GBLA 2ZQ1A 1TYNA 2FTLE 1B5GH 1GBIA 1MZDA 1E36B 1RS0A 3ODDA 1CT2E 5ETXA 4OS4A 2G5VA 1VITF 4NIYA 4OS2A 1K1OA 3SW2B 8GCHG 1GBJA 3A80A 1DLEA 2A7HA 4TWWA 3ZZ4A 2K1QA 2VGCC 1UJ1A 4ZH8A 3DHKH 3U69H 1DWDH 5DP8A 4JZFH 5GCHG 1W2KH 3MH4A 3NUMA 5A8ZA 2BB4A 3GYLB 4NA8A 1J9CH 1H9HE 3A85A 5EW2H 1Z7KA 3SNAA 1DE7H 2GMTB 1O38A 1OPHB 2H6MA 5BPEA 4X6PA 1CGHA 1Y3UA 1M9UA 3VB5A 4CREA 3ZYDA 2R3UA 1DOJA 5C20A 1VITH 1GJCB 1N8OC 1SGFG 4ABEA 1SBWA 1GJ6A 1C5WB 2JKHA 1YGCH 4YT7H 2W26A 2GD4B 1KLJH 1GI0A 3PB1E 4A7IB 1DICA 4Y8YA 1GMDG 1EZQA 4OS1A 1UHBA 2ILNA 1C5PA 1F5LA 1NN6A 2KAIA 4E05H 1SLUB 3E0NB 1WOFA 1S83A 2QXGA 3A7VA 2AS9A 4K5ZA 3BTEE 1NRQH 1EZUC 1KDQA 1T7CA 3HGNA 1C2MA 1G32B 1MD8A 1XKAC 3RXRA 2XWBI 1NS3A 1O3HA 3T28A 1PFXC 2HALA 4H6SB 1XM1A 2ZG0H 5T6GA 2G52A 2G81E 4WMDA 3UREA 1Y3YA 1PQ8A 2FESH 3SU3A 1T4UH 1C5XB 5C3NA 4X6OA 2VVUA 3V7TA 1BBRE 1QRWA 2ZHEH 3GY5A 1KLTA 4JYVH 2W5EA 2ZU5A 4A92A 2TIOA 1ANEA 5DP6A 2Z9GA 4ZROA 3BTME 3SGBE 1EASA 4JZEH 3TPIZ 1GL0E 1GVZA 2ZCHP 3CENA 3CS0A 1P06A 4ZKOU 4X1PU 1G9IE 4WY3A 1C2HA 5ESBA 1N6XA 1HB0B 4I33A 1TWXB 1O2UA 3RU4T 1QFKH 2FEQH 2Y5FA 1GBMA 3L6PA 1QURH 5EXLA 4MTBA 3M61U 5JPMH 1NROH 1KTTB 1MD7A 1N8OB 4H42U 1ESBA 1GDNA 2Q6FA 1ZJKA 3F9EA 2RA3A 1AZZA 2V35A 2P93A 2QXHA 3UY9A 1Q3XA 1DANH 2F91A 1K1MA 1C1WH 1O2TA 1LCYA 2BDAA 2EA3A 1SGTA 1BIOA 2M5TA 3M7UA 1GI4A 1D3PB 3URCA 3ATMA 3DFLA 1O5DH 4FXGH 3P17H 3P8OA 1O37A 3KHVA 3U98H 5JDUB 1CHOG 2UWOA 1K1NA 3SHCH 4NA9H 1DLKB 3TNTA 3UWIA 1MKXK 3L3TA 1SR5C 1O3EA 1EZSC 3E6PH 3GY2A 3RUOA 3STIA 1G3CA 5C2ZA 3ZZ6A 2GZ7A 1F0RA 1NFYA 5LPFA 1MMJN 3IG6B 3T2NA 2XXLA 1THPB 2UUJB 2ZECA 1AE5A 2BMGB 2V3HH 4CH2B 1QA7A 1A46H 1EUFA 4MPXA 1GI5A 1PJPA 3SU1A 6CHAC 2BDYA 1GHBF 1IQGA 2ZA5A 1WUNH 2SGEE 1P8VC 3AAVA 2A7JA 1O2KA 3RC6A 4RN6A 1IQIA 5CE1A 1SMFE 2BVRH 2A0QB 3H5CB 1FV9A 1UMAH 4KGAA 4THNH 3SU4A 3ATWA 1C1OA 2A32A 3TJNA 2FTMA 2ZFRH 3VPKA 4B71A 3ITIA 1K1JA 1BRUP 3GISB 4D7GA 1INCA 2TBSA 2PSYA 1XXDA 1MU6B 2PTCE 3SGQE 1PPHE 1SQAA 2BXUH 3K65B 3MNXA 4YTAA 1Y8TA 1UVTH 4NSYA 1UTPA 1SGDE 3SQEE 3BTTE 3JZ2B 3EA8A 1SSXA 1LQDB 1O2QA 1HAVB 4CRBA 7GCHF 2ZGJA 1NPMA 1KXBA 4GCHG 2HRVA 7ESTE 2QGRA 3Q3KA 8KME2 2VWNA 4FU8A 1TNKA 3SZNA 2FMJA 4BAOB 3MU0A 1V2KT 4M7GA 4AG2A 1TGSZ 3ZYEA 3ZVDA 1LVOA 1ZOMA 1RRKA 2BZAA 2ZI2H 5EPNA 3VXEH 3T62A 1EX3A 4O3TA 3TGKE 1OXGA 4GAWA 3ZVBA 4NWKA 1P2JA 3LDXH 2CJIA 5EQSA 4INLA 2QYIA 2ANWA 2QXJA 3RXUA 3UNQA 1MTNB 7KMEH 1GI6A 3T5FH 1JOUB 1SHYA 3FFGA 1SOTA 1DS2E 5B6OA 1OWIA 4I8HA 4ESTE 3CS7A 2R2WU 1N1LA 3UTUH 5GIBA 3Q00A 1L4DA 3MFJA 1V2OT 1TNHA 5HM2A 1GJ9B 2OP9A 1DUEA 2VH6A 3EDXB 3GOVB 2OCVB 2RCEA 3HK6B 3SGAE 2OQ5A 3SUDA 1O30A 5EXNA 1FMGA 4OS6A 2P94A 1YCPM 1PPGE 2XBYA 1A5HA 1S0RA 2GT8A 2XWAA 3SHAH 1TBZH 1P2KA 1O3LA 1GG6B 4KTUA 2Y6TA 1IQMA 1GJDB 1KTSB 2BVXH 1RIWB 1AIXH 1F2SE 2BD5A 3SU0A 1OOKB 3HATH 1SHHB 2EI7A 1EOJA 4TY7A 1GHBG 1SLXB 2QXIA 4MPVA 1S82A 3U8TH 2PUQH 2A7CA 5AFZH 6GCHF 3ZZ3A 3FVFB 5HM9A 3V13A 1FN8A 2FOEA 5TJXA 4QT8C 3PMBB 3U9AH 1KYNA 1PQ5A 3TGIE 4YOIA 3UR6A 5DG6A 3TITA 8LPRA 2SGFE 4MNVA 5C5OA 1GHAF 3EQ0H 2CHAC 3SU2A 5I46H 1TMUH 2FI3E 2GDEH 5FCKA 4MNWA 1FY4A 4HZHA 1O2PA 1ZMLA 1GMDF 1ZJDA 2VGCB 1GVKB 1CT4E 4U01A 1C2DA 2Q6GA 2ALPA 1D6RA 4X0WU 1TRYA 1OWKA 1W10U 3QZQA 1TMBH 2OXSA 1MUEB 1Z1IA 4AN7A 3PO1B 2C8WB 1BRBE 1QBNA 1AVXA 5GXPA 2GT7A 3A83A 1ELTA 2A4QA 1BOQA 1Y5UT 1C1UH 3S7KB 4CBOA 4IMQA 1TALA 3MYWA 2Z3DA 4CHAB 1BA8B 4DCDA 1DXWA 3SU5A 1IAUA 2H9HA 1C5OH 2GCHG 1O0DH 5AVDA 2BVSH 2ZHWH 1C2GA 5DKMA 3TGJE 2VJ1A 1OYTH 1V2UT 4H4FA 1SVPA 1AFQB 5AHGH 1C1MA 1V2WT 5A0CA 3U1IB 1NRRH 3QX5H 1FDPA 1IHSH 3P95A 5FXLA 1A0HB 1Z6EA