4U30A

Human mesotrypsin complexed with bikunin kunitz domain 2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
b'IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-3
publication title Sequence and Conformational Specificity in Substrate Recognition: SEVERAL HUMAN KUNITZ PROTEASE INHIBITOR DOMAINS ARE SPECIFIC SUBSTRATES OF MESOTRYPSIN.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u30A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u30A02
3EYDA 2XRCA 1MTNB 1MAXA 1Z8RA 2A5IA 2OBQA 3GCTG 4B2CA 1BBRK 1FAKH 4LXBH 3UWIA 7GCHF 3KQDA 1TGSZ 1TRMA 3RU4D 2Q6FA 2W5EA 4AX9H 1C9TA 4AGJA 1CA0C 1C5ZB 2FX6A 3HGPA 1HJAB 2SNWA 2VWOA 4ZKSU 3RXHA 4GHQA 2J4IA 4X1NU 1RTKA 1SLWB 1JWTA 5FAHA 1BBRE 3EGKH 2BDIA 5EXLA 3LH1A 3O8RA 3RXLA 3S69A 2G51A 1PQ7A 3DD2H 2OD3B 3E0NB 2GP9B 1TE0A 2BVSH 1FY1A 1QQUA 2J95A 2R2MB 2VH6A 2VIVA 1F0TA 3TH2H 3OU0A 5DK1A 3NUMA 4K8BA 5LH8A 3TIUA 1LPGB 1MKXH 2OBOA 1SQTA 1ZTKA 1THSH 1HAYB 1W0YH 3T62A 3RXRA 4BXSA 2A5KA 2GKVE 3MH7A 1K1NA 5E8EH 1P2QA 3ODFA 4CH2B 5FX5A 3S9CA 2R0LA 1TYNA 1V2PT 2ZP0H 1CGIE 1UVOA 2BZAA 1UTLM 2AMDA 2ZC9H 3TH3H 2ALPA 1ZJDA 1YCPM 3SV9A 1VZQH 2ANMH 3FAOA 3OTJE 1FLEE 3UNQA 5F8TA 1SHHB 1NPMA 4MNWA 3RMOH 1PPGE 1ORFA 1HAXB 3A84A 1SLVB 1PPBH 2ULLA 3E91A 1AWFH 1ID5H 5DG6A 4ASHA 1OSSA 4IN2A 4GSOA 1CHGA 3SU4A 1G3CA 5A0BA 1OWHA 1O33A 3PO1C 1A0JA 1NRPH 1BTWA 1UVUH 1O3NA 1Y3XA 2TGPZ 2AYWA 3DHKH 4BTTB 1IQNA 4R0IA 3SUDA 2GX4A 1QA0A 1BITA 2HOBA 5JDUB 1GBCA 3LPRA 3ZZ5A 2FS8A 1TX8A 3RXSA 1AI8H 5C20A 1S0RA 3LGIA 3MNCA 4TY7A 1BTHH 1GJ7B 2STAE 3BTME 1H8IH 3GY6A 1ELEE 3GYMA 1GJ6A 2C3SA 1DLKB 3D62A 4E7NA 2QN5T 5K0HA 1AE5A 1SLUB 1LQDB 1SQAA 3TH4H 4FUGA 2A32A 3PTNA 1SGNE 2EC9H 1GBLA 1C1PA 3GCHB 3BEUA 4ISNA 4X8TH 2CV3A 3K6YA 1KXAA 2H9EH 5HGGA 1EASA 1FAXA 1N8OB 2EA3A 1FUJA 2QCYA 3GY3A 4FUJA 1HAIH 5E0GA 1DITH 2J94A 7ESTE 2A2XH 5H4IB 3EQ0H 5L2YH 1HXEH 1Y5UT 3B23B 1S84A 2FYQA 4YLQH 1C4V2 4WMFA 3A8CA 3SNCA 1UO6A 1NT1A 1J15A 3GDSA 3RXMA 1SG8B 1CA8B 1V2OT 1TOMH 1FI8A 1GHZA 2Y5FA 4K5ZA 2P8OC 1EZUC 1H9IE 4J1YA 5FHTA 3MTYA 2R3UA 3QWCH 3CS0A 3ZZ7A 1ELFA 2TGAA 5GPIB 1S81A 1O2OA 5T3HA 1JXPA 1AU8A 1SGFA 3ATWA 4NWKA 2OC7A 2ZDNA 2PLXA 2UUKB 1ZHMA 4YOJA 2AGGX 4K8YA 3VXFH 1O31A 1BMMH 3SZNA 1JBUH 1H8DH 1PPEE 1SBWA 2TGTA 1FIZA 3RLYH 3ATKA 4Q7XA 1HAVB 4YT7H 1ARCA 1MQ6A 2QF3A 5DP3A 3TK9A 1YCPK 3STJA 3QUMP 1P2NA 1TGCA 1TPPA 3ZZ4A 2NU3E 3PMHB 1O2HA 4IGDA 2JETB 3Q77A 1NROH 3V7TA 1THRH 2TGDA 1UVTH 5EQSA 3SGAE 2ESTE 4Y10E 1C5QA 4LZ4B 1D6RA 4ZXXH 1LVYA 3A81A 4ISLA 4BAHB 1SQOA 1KTTB 1P2IA 1C1QA 5GCHF 1HBTH 2ZGJA 4D76A 2FOFA 3ZV8A 1EB2A 1ZZZA 1VGCB 4DW2U 1IQKA 1IQJA 1SC8U 3UR9A 1GMCF 5SGAE 1HGTH 1RGQA 1C4Y2 3SOSA 1KYNA 1D3TB 3F6UH 7GCHG 3CENA 1WQSA 1FV9A 1C1MA 1UHBA 4J2YB 4KTSA 2FOAA 3EAJA 4OGYA 1QGFA 4AN7A 1VJ9U 1BTPA 2EI8A 4YESB 1K9OE 3ENSB 3SQHE 5FCKA 2Z3CA 1LHGH 4JYTA 4CHAB 2WPHS 1E38B 5FCRA 3QO6A 2PKSC 1DWDH 1QCPA 2WPLS 1A46H 4AFUA 1OWDA 1EAIA 2YNAA 1HAHH 1V2VT 1DWEH 3GCOA 3SO3A 4B2AA 2BMGB 1A7SA 4NFEA 2O9QA 3TLOA 2XNIA 2VINA 3RC4A 3T28A 3DT0H 1TNGA 1TNKA 4X6MA 3FP7E 1XX9A 1QR3E 1C2HA 1NRQH 2Q6GA 3RMNH 1O2TA 2I6SA 3MMGA 4B75A 1DWCH 2H1UA 1TIOA 4ZMAH 1P11E 2D1JA 1HJ8A 3LOXA 3R3GB 3M3TA 4NZQA 2B5TB 1TQ7B 2GTBA 4BAMB 1E34B 3VXEH 6CHAC 3PLKA 5AHGH 2F91A 4TWYA 4A1TA 1O3DA 1HFDA 3BG8A 3D23A 2UUFB 4MVNA 1AUJA 1TNJA 4K60A 1GWAA 2WYGA 3Q3YA 4QT8C 2ZHQH 1BRUP 1LVBA 1C5PA 4CBOA 4HI3A 1LDTT 2FMJA 2VIPA 3MH4A 2FLRH 1KLIH 2CMYA 5JBBS 1AMHA 5C1UA 1ANCA 5C67A 4JZFH 1RJXB 2A0QB 2IPHA 1L1NA 1QBOA 1HPGA 3MO3A 4YM9A 3A8BA 4MG3A 1BJUA 2ZGXH 4D9QA 1AFQB 4YOGA 1GHWH 3K65B 1V2UT 2TPIZ 2FESH 1PJPA 3A89A 1O2NA 1KDQA 4MPVA 1HV7A 4ZUHA 1M9UA 4YTAA 5C1XA 5E2PA 4OS7A 3U8TH 1E37B 1WUNH 3BG4B 3HKJB 1ETSH 2ZHDA 2ZO3H 4IBLH 3M5MA 5AFYH 3QZRA 2Y81A 1SPJA 4KTCA 4U30A 1NU7B 1LKBA 2BQWB 1P3CA 1NTPA 1NN6A 2AH4X 5JYIA 4MNYA 1K1LA 2P59A 1EUFA 4ABEA 4XSKU 1C2DA 1ELDE 1S6HA 5A2MH 2D26C 1GI9B 1MMJN 1FZZA 5GDSH 1AN1E 1HJ9A 1EZSC 2VVCA 3A80A 1CO7E 4WH8A 5JPMH 1Q31A 2GCHF 3GY2A 4X2XA 1FQ3A 1ANBA 3UR6A 4CRDA 4H6TA 1C9PA 1EQ9A 1GJDB 2P3UB 3NKKA 1J14A 4ISIH 1D3PB 4GUXA 4UFEH 1RRKA 1YGCH 1TFXA 4A7IB 4H4FA 1BMNH 1O3IA 1KLJH 5DJ7A 1AUTC 1DT2A 3SJOA 1TLDA 4E7RG 1IOEA 1YYY1 1CA0B 3KQEA 1QY6A 3O8CA 3RP2A 3UOPA 2ZFSA 2FOMB 1NFYA 1QRWA 1UVPA 2QYIA 2FDAA 1DFPA 2WV4A 1K1IA 3PWCA 1PPHE 1L4ZA 4AG1A 5DP8A 4WXVA 1SGEE 2V3OH 1TMTH 3FP8E 1C5WB 1QL7A 2OTVA 1GG6C 1JRTA 1ZSLA 1UCYH 1ARBA 5DP5A 1T8OA 3UY9A 1O5EH 1AZ8A 2ZFPH 2BDBA 1GBBA 4B73A 1AD8H 1WSSH 3GDUA 1BUIA 2B0FA 1FIWA 4AB8A 3A7WA 2GDDA 3E16B 4ISHH 1CU1A 3T27A 2ZHEH 3BSQA 1AVXA 1OP2A 1T4UH 2P3FH 3BTWE 3VB5A 3HK3B 1UTOA 5T6DA 5AVDA 4H6SB 2A4QA 2VIWA 1GI5A 1C1WH 1ETRH 1GMDF 3RXDA 1PQ5A 1BJVA 4Q2KA 1Z8JB 2XWBI 3LGWA 1LPKB 3I78A 4ABBA 2M5TA 4NSYA 3P92A 2J38A 5GCHG 1TMBH 2PHBA 4B1TA 3MU5A 3PM3A 1AE8H 2CXVA 4MPUA 3U9AH 3T5FH 3O8DA 2V35A 4O3UA 4DG4A 1DSTA 1GMCG 4UFFH 3AVZA 4NSVA 1GI6A 2FOBA 1O2VA 3PO1B 2A7HA 3A86A 1G36A 1VJAU 2J9NA 3A8DA 1GL0E 4A1VA 3TJUA 5JBCS 4MPXA 1O5GH 2QXJA 2UUJB 5EW2H 2Z3DA 4HTCH 2Q1JA 1C5LH 1WV7H 1UK2A 2GCTC 4X1RU 1GI0A 1ZOMA 5GXPA 2H2ZA 3GICB 2J34A 3QTOH 1P57B 1GDNA 3PROA 1SGDE 4MTBA 1ANDA 2P16A 4NA9H 1L2EA 4VGCC 1OWKA 3FZDA 3PLPA 4DY7B 2Y5HA 1A5GH 3VB6A 4OS2A 1GHBF 2B8OH 1EOJA 1O2GH 1GCDA 2PUXB 4IC5A 5ESTE 1G32B 1O2UA 2VVUA 4NFFA 1MQ5A 1C1VH 3SJ9A 1GBIA 4NA7A 4Y11E 1C2FA 3RXJA 3U69H 3RDZA 3A87A 1BHXB 1H1BA 2ODYB 2VVVA 1AQ7A 1WOFA 3MU0A 2V6NA 3V12A 1GJ8B 1VITF 1DXWA 1F0RA 1OP8A 3RXQA 3ZVBA 1EPTB 2UUYA 4Q80A 2ZQ1A 4DOQA 1T32A 1BTUA 3M37A 1K1PA 1Z7KA 3HK6B 2HRVA 2BLVA 3P17H 3ZZ9A 3SI3H 5C2ZA 4FXGH 3QDZB 1TGNA 1GBKA 2JH0D 2QA9E 1C5VA 3JZ1B 1KDQB 2YNBA 5DKMA 1L1JA 8LPRA 5TCAA 3U8RH 1FY5A 1BTZA 1NESE 3RU4E 3NXPA 5FBEA 2QGRA 4ABIA 4WWYA 1W0ZU 1EATA 2A45B 3H7OA 1GJ9B 1KTSB 2P8OB 5F03A 4ZXYH 3UQVA 3O8BA 2A5AA 3BTQE 3HKIB 2BDAA 1O37A 1TBZH 2THFB 2DE9A 1O2JA 7KMEH 3UIRA 1FY3A 2QF0A 1IHSH 3GY5A 4CR9A 2BTCE 3BTTE 4IW4E 1GDQA 2BX3A 1UTJA 3EA8A 1UMAH 4E05H 1W2KH 1T8MA 2FI5E 1THPB 2W7UA 5CHAB 4O9VA 1P8VC 1GBEA 1XKBC 1EXFA 4H42U 5HYOA 1NU9A 3LGVA 1P9UA 1P9SA 1FONA 1OWJA 1TAWA 2C8XB 2GVFA 3GISB 4I8HA 4X1SU 2VJ1A 3PTBA 1O3LA 1X7AC 2BVRH 1OP0A 2ZF0H 1FMGA 4F4OC 1O2SA 1QFKH 3MO6A 2FOEA 1QB1A 3BV9B 2B9LA 4ZAEA 5JB8S 1D3DB 2F9BH 2FXRA 3I77A 1O5BB 3MI4A 2GCHG 4YOIA 2ODPA 1ZR0A 1EZQA 2SGAA 3FP6E 3VB4A 3AW0A 4RKJB 4ABFA 3TJOA 3LONA 1VCWA 3ZVAA 2D8WA 1Z6EA 3STIA 1P10A 2EI6A 3KGPA 4JCNA 3T2NA 1RD3B 3W94A 1GMHG 3LGYA 3K2UA 2F83A 1BCUH 1W3CA 1ZMJA 2P3TB 2ZIQH 1OX1A 4JMYA 4JK6A 4GVUA 4CRAA 1HLTH 3QGNB 4CRFA 2GV7A 3TNSA 1EPTC 1MD8A 2OUAA 2HNTF 1MCVA 2F3CE 2BHGA 1C2EA 3IG6B 3M3SA 3ZYEA 1WYKA 2Z9JA 3ESTA 1SGYE 1MBQA 1C1SA 5AF9H 5IDKA 3SUFA 2PKSB 9ESTA 4KP0A 4FUCA 1DE7H 1XKAC 3QX5H 1QJ7B 2ZZUH 1TBRH 2BD5A 2VGCC 2FODA 1MUEB 4KGAA 3UTUH 4ABGA 1XM1A 5TJXA 2VU8E 1MKWH 1A3BH 2AIQA 8GCHF 4AOQA 1RS0A 2F9NA 1RIWC 5J4QA 1NFWA 3BTKE 3BTHE 7LPRA 1GJ5H 2GV6A 1JRSA 1GBJA 4THNH 2OLGA 4Y76A 2O8WA 3PLBA 1QURH 3GY7A 1V3XA 1O5AB 2H5DA 3URDA 1GMDG 4NIVA 1N6YA 1TMUH 2G81E 1LKAA 6CHAB 1GGDC 1SLXB 3MH5A 1WCZA 4ZH8A 1MCTA 2STBE 3V3MA 1BRBE 2C8ZB 4O3TA 3ZZDA 5A0AE 3RM2H 2PW8H 3SNDA 3M7QA 2F9OA 3F9FA 1O38A 1A1RA 4U01A 5J4SA 3F1SB 1CVWH 4I8KA 2OC8A 5CHAC 2K1QA 4WXIA 3UOUA 2FYRA 2PGBB 2ZGHA 3SNBA 1O3AA 1SOTA 4DT7B 4NCYA 1YKTA 4YZUA 5EXNA 1DICA 3UREA 4BOHA 2PR3A 5E2OA 1ETTH 1BBRH 3LH3A 1UK3A 3G01A 2BD2A 2TIOA 4X8SH 2ZTXA 3I29A 1OWIA 2Y82A 4MQAA 3VB3A 4B71A 4FUFA 1YPMH 2XC4A 3LC3A 2JH6D 4XBCA 1ZPBA 3SJKA 2O8LA 3M7UA 2ZFFH 4D8NA 1GHBG 5L2ZH 1EX3A 1QB6A 4MDSA 5JBAS 2BY8X 1W12U 1YPKH 4LOYH 3KL6A 4NWLA 1TGBA 2XBVA 2BYAX 2ZKSA 4UDWH 1SGRE 1VITG 5L6NH 1AWHB 4XBBA 1G37A 4ABAA 1W8BH 1O2ZA 2QY0B 1P2MA 4WY3A 3BIVH 1TPSA 1MZDA 1LTOA 3RXVA 3Q00A 3SHAH 1P06A 1O2MA 1P09A 2NU4E 3BEIB 2Y5GA 3S9AA 2A2QH 3Q3KA 5FPSA 5FPYA 2R0KA 3QZQA 3RMMH 3M5OA 2ZWLH 1CHOF 3RXIA 8ESTE 2SFAA 1G3EA 3ZZBA 2FOCA 2FOHA 2ZCHP 2ANWA 2AS9A 4YLUA 4BAOB 1SGTA 2BD3A 2G4TA 3HATH 4JYUH 1SGIB 3IWMA 2WUBA 4UD9H 1MH0A 1GCTC 1QRXA 1BA8B 1EKBB 2YOLA 4FUBA 4UFGH 3LGUA 6LPRA 2HPQH 5A8YA 3MHWU 4I33A 4AFSA 1W7XH 2OINA 1HIAA 1BIOA 2IN2A 3AW1A 1XUGA 3OSYA 3SGBE 3TPIZ 1BTXA 1PPZA 2WYJA 2W26A 2BD8A 3BTEE 1NM6A 4ABDA 2ZFQH 1CT4E 2CGAA 3E0PB 3E3TA 3RC5A 1W7GH 4I8LA 1NS3A 3KEEA 1GG6B 4FUDA 1Y3UA 2SGEE 4FU9A 2OP9A 1XXDA 4KTUA 2CHAC 2PWXA 1OYTH 4Y0YE 2ZA5A 3ZV9A 4XDEA 4DIHH 4CRGA 1VCQA 5L30H 1EPTA 3UQOA 1GDUA 1PQAA 1J8AA 2XBWA 4E06H 3ZZ3A 3P8FA 1YP9A 1P0SH 1T8LA 3RXOA 3NK8A 3SHCH 1IQEA 5EPYA 1LPZB 5E0HA 4AFZA 4U32A 2BLQA 3TGJE 1TQ0B 4OS5A 1ZLRA 3TGKE 1QL8A 1YM0A 2PGQB 5DP7A 3SJ8A 4INLA 1SGPE 4JZDH 3ATLA 1CBWC 1ZHRA 3RXKA 3TU7H 1QIXB 2C8WB 1A0LA 5ABWA 3F9EA 1PQ8A 3NPSA 3ZVFA 2Z94A 1Y8TA 3GYLB 4Y0ZE 1C5TA 1TNHA 1BTYA 5TCCA 2DE8A 4GAWA 5C1YA 3RXEA 1KLTA 4DGJA 3V13A 2FI4E 3RMLH 9LPRA 1V2WT 2UWLA 1P04A 4F49A 2ZDVH 2F9VA 4NA8A 3M5NA 4Y8ZA 1GHXH 1YBWA 1A5IA 2GCTB 1KXCA 3A7XA 5HXFA 1O3PB 3M61U 2AIPA 1CSOE 1IQGA 4A92A 2XYAA 4UONA 1D6WA 1O3FA 3HGNA 2BM2A 4VGCB 3SV2H 3QLPH 1AB9B 1TNIA 2Z9LA 2V3HH 1PYTC 1TPAE 2D2DA 2VIOA 2ZTYA 5E0JA 1O5FH 3PMBB 2OQUA 3SBKA 3UFAA 1NY22 1P01A 1ZRKA 1EAUA 1SGQE 2WPMS 4IC6A 1H9LB 4ZKNU 1TA2A 1GMHF 2P93A 1P2KA 8GCHG 2BDCA 2ZCKP 3MH6A 3EA9A 1Z6JH 1GBFA 1P2JA 3UNSA 4AGKA 2FO9A 2ZPQA 2SNVA 2W7SA 3U98H 1FJSA 1T8NA 1YCPH 5EQQA 2NU0E 3AAUA 1HAOH 1TPOA 1V2TT 3KQBA 4OGXA 4HZHA 3LIWA 1G3BA 2I6QA 2Z9KA 2ZFRH 2B7DH 2BQ6B 1BQYA 1KIGH 1LHFH 1UTQA 2EEKA 4Y79A 1XUHA 4TY6A 2C8YB 4RN6A 2O8UA 2PKAA 1VITH 3BF6H 1GHAF 1A0HB 3SU3A 1YPHC 1UJ1A 2BDGA 1F7ZA 1L0ZA 2ZTZA 4B76A 5F8ZA 3A8AA 3URCA 1ELAA 2JH5D 4GCHG 3MNXA 1C5OH 1V2MT 1QRZA 1F5KU 4I7YH 3SI4H 1UTPA 4FUIA 1AGJA 1U6QA 3GY4A 1FDPA 1XUFA 1T4VH 1Y59T 4DURA 2WPJS 2ZU2A 1KXDA 1SMFE 4BAKB 2ZGCA 4YO9A 3N7OA 3SQEE 1A2CH 3MU8A 4AYVB 1BOQA 2VB0A 1O2WA 1G30B 3K6ZA 2ZDKA 1GBMA 1RXPA 2ZGBH 3MYWA 3VGCC 1P05A 3T29A 6GCHF 1ESBA 1A4WH 3TGIE 4TPIZ 4DJZB 2HWLB 3ZVGA 4FVBA 4X6PA 2BXTH 3ZZAA 2PTCE 2BOHB 1TRYA 2AMQA 1CGJE 3H7TA 1K2I1 3D49H 3TITA 3GDVA 1GJBB 2FLBH 1GJAB 1S82A 1OYQA 1ACBE 1SB1H 4R8TB 1V2LT 1NRNH 4GPGA 4JZEH 1GJCB 4K1SA 1XVOA 1O2KA 1O2LA 2BD9A 2P95A 2PSXA 1HIAB 1QQ4A 3FVFB 1L1GA 3SU0A 4CH8B 1AFEH 4Z0KA 5DPAA 3ZYDA 3ZZCA 4JZIA 5F6MA 1AB9C 1O2RA 1LMWB 4I8GA 1CHOG 2F9UA 4UFDH 1Q3XA 1V2RT 1NRSH 3MOCA 1O36A 2RDLA 5K7RA 4AYYB 2Q6DA 1LHCH 1YPLH 1C2LA 3S9BA 4SGAE 2XWAA 1AVWA 3D65E 3ZVEA 4D9RA 1AY6H 3LDXH 2ZPRA 1S83A 3T26A 2Y80A 1D3QB 1YF4A 1GI4A 4Y6DA 5HM2A 4GLYA 1O3EA 1ZJKA 2PTNA 2BY9X 2ZNKH 5HM9A 3U1JB 1G3DA 2XCFA 4Q7YA 1TRNA 1V2JT 2QXGA 3U8OH 2QV1A 4Y7AA 1O3BA 1EP5A 4X6NA 3RXFA 1BZXE 1K1OA 3E1XB 3KCGH 2Y7ZA 2G5VA 1DY9A 1YLDA 2QAAA 1DPOA 1NRRH 2VGCB 3GCNA 3OY5U 3E8LA 1YPGH 1C5XB 2ZDAH 2CN0H 4INHA 5DP6A 1C4U2 3BIUH 3ZZ8A 1C5SA 3LC5A 4INKA 3VPKA 1IHTH 1HRTH 4FU7A 1SR5C 1OXGA 1XUIA 1UTKA 2XC5A 2ZU5A 1J16A 1EOLA 1SSXA 2GMTC 4Y7BA 1YPEH 3A7VA 1RIWB 1Z1JA 5EXMA 1FY8E 2TBSA 3ELAH 4ZHAA 1V2QT 3VFEA 3AASA 2XBXA 1ZHPA 5C3NA 5JB9S 2P94A 4NIYA 4GHTA 5C5NA 3T25A 4BTIB 1SGCA 3LKWA 3C1KA 1GGDB 1DY8A 2C4FH 4TWWA 3NZIA 1ZGIA 2LNCA 2AEIH 4IMZA 2JKHA 3K9XB 2AFQB 5LPEA 3A7ZA 1W13U 2RA0A 5IYTA 1SOZA 4FUEA 4Y8XA 6ESTA 4XFQA 3SGQE 1OKXA 2HLCA 4IN1A 1A61H 4DVAU 1YC0A 2FI3E 2ZG0H 1Z8GA 1Z1IA 1DM4B 1TWXB 3MU4A 1LHEH 2PSYA 2HNTC 2O8MA 1NC6A 2AGEX 2ANKH 1ANEA 2SGFE 1WTGH 4BXWA 3QK1A 1TABE 1FPHH 1XXFA 2QC2A 1OWEA 1GBAA 2PUQH 2Z3EA 4X8UH 2BB4A 5FPTA 1ELGA 2WUCA 3A85A 2HGTH 3P70B 3SU5A 3SNEA 2W3IA 5JBTA 1Y3YA 1NFXA 1ZSJA 1UVSH 1D4PB 5EOKA 1C1RA 3SORA 5I46H 1IQLA 2PKAB 3C27B 1ZRBA 1LVMA 3MNSA 5C5OA 4ZROA 2BZ6H 3TJVA 1C1OA 4ABHA 1KSNA 1WBGB 2FS9A 3NCLA 3DUXH 1HCGA 5LGOA 1SVPA 1C2JA 2HVXA 3FANA 1F5RA 1E36B 3TK6A 1L4DA 4BNRA 1BMLA 5GIBA 2H6MA 1TB6H 2R9PA 1PFXC 1PYTD 4DCDA 1TONA 1UK4A 2W3KA 1O35A 2DUCA 1GVZA 2BD4A 3A7TA 2ZDMA 1GHAG 1ZPCA 4U2WA 1G9IE 4K69A 5DGJA 5EU8A 1MTNC 1G2LA 4CRBA 5BRRE 3OY6U 1HNEE 3LJOA 2QXHA 1GCTB 4X2YA 1TX6A 2LPRA 2WINI 5DP4A 2FOGA 4Q7ZA 1HJAC 2ZI2H 5F8XA 2H9HA 1C1TA 1V2NT 2ALVA 1C2KA 2WPKS 1UTMA 1FXYA 2ANYA 3L3TA 1KXBA 1DUEA 1O34A 2J2UA 2ZU3A 1RFNA 2R2WU 2H5CA 1AKSA 1AO5A 2GZ9A 2OXSA 2FM2A 2H9TH 2FZZA 4WH6A 3JZ2B 2XW9A 2SGQE 4HFPB 1MAYA 1DUAA 1JOUB 2BDYA 3RLWH 1O39A 1S85A 3MU1A 3SN8A 3SJIA 5ETXA 3TJNA 6GCHG 1BHXF 2CHAB 1BRCE 1QJ1B 1Y3VA 1AVGH 4ESTE 1DX5M 2ZPSA 3P95A 3EE0B 3ZVDA 4JYVH 8KME2 1J9CH 2KAIA 3ZZ6A 2XTTB 4A5TS 2HPPH 2ZFTA 1N6XA 3L33A 3P8GA 1DDJA 2F9PA 4AORA 1LHDH 1A3EH 1B0EA 1SHYA 1CGHA 1KY9A 2ASUB 1GI3A 2Z9IA 3P8OA 1BDAA 4GCHF 2VIDA 1MZAA 4X2VA 2IOTA 2FP7B 3ITIA 3HPTB 1C1UH 5EGMA 5PTPA 3SW2B 1BMAA 1FNIA 1CBWB 5EODA 3B9FH 1SL3A 1C5UA 3RC6A 1O0DH 2BY5X 1YPHE 3VEQB 1IAUA 4LZ1H 4WF8A 2BQ7B 3SUEA 2RA3A 2ZU4A 4X1PU 3SV7A 2A4RA 2GT8A 2ZQ2A 3M3VA 2VH0A 2GT7A 1W10U 1IQIA 1MD7A 1O5DH 1AZZA 2UWPA 1GVLA 1GBHA 5GJ4B 3AAVA 4IMQA 2QIQA 1C5RA 1K21H 3LT3A 1GL1A 2VWLA 3F68H 3ZVCA 1QNJA 2TRMA 1O2PA 1LO6A 2FPZA 3BTGE 5T6FA 1C2IA 4BAQB 2A4GA 3L6PA 1ZSKA 1NFUA 1MTVA 1UCYK 2RCEA 4M7GA 1GHVH 3OYPA 4OS4A 1ESTA 2QXIA 4I8JA 1QBNA 1Y3WA 5FX6A 1ZMLA 4A6LA 2SGDE 3MWIU 1Z8IB 1EB1H 4NG9H 4K1EA 1O2YA 3P8NA 5DP9A 4WMEA 1C2MA 1UCYE 1MTSA 1G2MA 3QN7A 2RG3A 2OQ5A 2Z6BD 1UTNA 4SGBE 4OS1A 1F92A 2GDEH 1EJMA 2ODQA 4ZKRU 1GVKB 3GCHC 1WTHD 4MLFB 3RUOA 1HAPH 2FTMA 1O3GA 4O97A 1GHYH 4FU8A 2GGVB 4NZLA 2PV9B 4NGAH 1N8OC 1O3MA 1JMOH 1HAGE 3LU9B 3KHVA 2Y7XA 4WVPE 2CF8H 2UWOA 4NIXA 1V2ST 2FTLE 1K1MA 1NO9H 2A1DB 1O2QA 5A0CA 1Q2WA 2VNTA 4BTUB 1WAYB 1DVAH 2A4OA 2VWNA 2R3YA 3KNXA 1SGFG 1E35B 1CQQA 5EW1H 1V2KT 1EJAA 2C90B 1HAZB 2ZEBA 4RKOB 1DSUA 1E0FD 3ATIA 1OS8A 1ZPZA 3SNAA 1TNLA 2BDHA 3EDXB 2ILNA 2PFEA 1YLCA 3GCTF 3IITA 3MO9A 3ODDA 3E90B 3M5LA 1F2SE 2A7CA 1CT2E 3FZZA 2ZU1A 3Q76A 1FN6A 1ABIH 3TK5A 1PPFE 2G8TA 1JIMA 5CE1A 2IJOB 1OOKB 3SU2A 3S0NA 1QTFA 5ESBA 1F5LA 1O3CA 3RXTA 4FUHA 3RXUA 3CP7A 3V0XA 4D7GA 1TA6A 1ZTLA 4X1QU 1LCYA 3QTVH 1O3HA 5EG4A 3SV8A 3VB7A 1N1LA 2FWWA 3GOVB 1AIXH 4Z6AH 4D7FA 3RXPA 3KQCA 1P02A 2FX4A 2G5NA 5LPRA 1P3EA 5HMAA 1WU1A 3SUGA 4CBNA 1V6DA 2XXLA 4X6OA 5FXLA 3DA9B 3VGCB 1VCPA 5G4BA 1WQVH 3CS7A 2BY6X 2BY7X 4JZ1A 1O32A 1KXEA 1ZGVA 3RU4T 1XMNB 1HB0B 3RXAA 3KN2A 4I31A 1HDTH 2BX4A 4KKDA 1QB9A 1INCA 3LJJA 1BRAA 5GWZA 2JETC 4MNXA 2V0BA 1O5CB 1QHRB 3PWBA 2ZCLP 2C93B 2CF9H 5LPFA 1QA7A 3UWJH 1S0QA 1C5NH 4CREA 2NU1E 1W11U 2BVXH 1O30A 3OX7U 1MBMA 2NU2E 1ELBA 2ZECA 1DWBH 3PMJA 4RSPA 1GI7B 2J92A 5FBIA 3TNTA 1H9HE 2CJIA 4ZKOU 5I25A 1DS2E 1D9IA 4KELA 4UEHH 1O3OA 1VGCC 4X0WU 1GBDA 1GI8B 1AKSB 1HYLA 1RTFB 4X2WA 1FY4A 1LVOA 3M35A 4CRCA 1MKXK 4K1TA 1ELTA 1O3KA 3M7TA 1O3JA 1JIRA 3A88A 1AHTH 1GPZA 1XUJA 1ZMNA 2VWMA 1C1NA 3ATMA 1T7CA 1Y5AT 5EPNA 2HNTE 4A1XA 1O2XA 2BXUH 3LGTA 4MPWA 4FVDA 2HALA 3R0FA 1B7XB 1ELVA 2OC0A 3P6ZB 4AG2A 4DIIH 2KAIB 1H4WA 3WY8A 3MNBA 4CHAC 4O03A 3UPEA 5EQRA 3B8JA 2FIRH 3BN9A 3Q3XA 1C5YB 4ZHMU 2G00A 3A82A 3KF2A 1YPJH 1Z71A 1SFIA 1F0UA 3PB1E 4AB9A 5B6OA 1ZYOA 3F9HA 3BEFB 1BT7A 2GD4B 1ABJH 2Y6TA 4UE7H 1C2GA 1DLEA 3E6PH 4MNVA 3PV4A 2VIQA 1EJNA 1PPCE 4B74A 1CT0E 1HXFH 1CE5A 2BOKA 2GMTB 4WMDA 2WPIS 3SU6A 2G55A 2BLOA 1EAWA 3S7KB 1Y5BT 3FFGA 3U1IB 4LK4A 2O8TA 1GBTA 4ZHLU 2OC1A 3GY8A 1S6FA 3UNRA 1FPCH 1VR1H 1T31A 2ZDLA 1B0FA 5AFZH 2Z7FE 2XC0A 4CR5A 1SFQB 1W14U 1IQHA 2Z9GA 3M36A 2A31A 4K2YA 4HGCA 1S5SA 4I32A 2A7JA 3RXCA 3QGJA 1TGTA 1TOCB 3S7HB 1KXFA 3DFJA 4YT6H 1P2OA 1NZQH 1ZTJA 1QJ6B 4X8VH 2BD7A 4ABJA 1GJ4H 1J17T 4BANB 1A5HA 3A83A 4ISOA 1B5GH 4AFQA 2AGIX 1ESAA 3KIDU 3PMAB 1XUKA 1IQMA 4TYDA 1AFQC 1UHBB 4WJG2 4XOJA 3H5CB 2EI7A 1BB0B 4JK5A 2AMPA 1MTWA 1EZXC 2XBYA 3BTDE 1C5MD 5DO4H 1GI1A 1MTUA 4AZ2B 1TX7A 1MU6B 2NWNA 5A8XA 4PROA 1GI2A 2FEQH 4TPYA 1FN8A 4XE4A 3BG4C 1P03A 3NWUA 1TALA 1DOJA 1K28D 1IQFA 4K3JA 2AERH 1MKWK 3EA7A 4B2BA 2GZ7A 1EP6A 3A7YA 1XVMA 1P12E 1QL9A 1F0SA 1O2IA 4XBDA 1K22H 1OPHB 4Y8YA 3SV6A 1RTLA 3RM0H 3RXGA 1ELCA 4NIWA 4IS5A 3DFLA 1DXPA 1LQEA 2XCNA 3W95A 1MU8B 5A8ZA 2SGPE 2ZHWH 3SU1A 2GZ8A 2G4UA 1DANH 3BTFE 5A09A 1K1JA 5BPEA 3F9GA 3TVJB 2G52A 2WV5A 1TBQH 2BLWA 1QBVH 3PYHA 3MFJA 1HAVA 5CMXH 1HUTH 4OS6A 3RXBA 3UUZA 2OCVB 1EAXA 4Y71A 5T6GA 1SI5H 2ZHFH
chains in the Genus database with same CATH superfamily
3EYDA 2XRCA 1MTNB 1MAXA 1Z8RA 2A5IA 2OBQA 3GCTG 4B2CA 1BBRK 1FAKH 4LXBH 2QE7D 3UWIA 7GCHF 3KQDA 1TGSZ 1TRMA 3RU4D 2Q6FA 3CNRA 2W5EA 4AX9H 1C9TA 4AGJA 1CA0C 1C5ZB 2FX6A 3HGPA 1HJAB 2SNWA 2VWOA 4ZKSU 3RXHA 4GHQA 2J4IA 4X1NU 1RTKA 1SLWB 1JWTA 5FAHA 1BBRE 3EGKH 2BDIA 5EXLA 3LH1A 3O8RA 3RXLA 3S69A 2G51A 1PQ7A 3DD2H 2OD3B 3E0NB 2GP9B 1TE0A 2BVSH 1FY1A 1QQUA 2J95A 2R2MB 2VH6A 2VIVA 1F0TA 3TH2H 3OU0A 5DK1A 3NUMA 2L6OA 4K8BA 5LH8A 3TIUA 1LPGB 1MKXH 2OBOA 1SQTA 1ZTKA 1THSH 1HAYB 1W0YH 3T62A 3RXRA 4BXSA 2A5KA 2K0QA 2GKVE 3MH7A 1K1NA 5E8EH 1P2QA 3ODFA 4CH2B 5FX5A 3S9CA 2R0LA 1TYNA 1WXRA 1V2PT 2ZP0H 5B6LA 1CGIE 1UVOA 3F3BA 2BZAA 1UTLM 2AMDA 1QZ8A 2ZC9H 3TH3H 2ALPA 1ZJDA 1YCPM 3SV9A 1VZQH 2ANMH 3F2FA 3FAOA 3OTJE 1FLEE 3UNQA 5F8TA 1SHHB 1NPMA 4MNWA 3RMOH 1PPGE 1ORFA 1HAXB 3A84A 1SLVB 1PPBH 2ULLA 3E91A 1AWFH 1ID5H 5DG6A 4ASHA 1OSSA 4IN2A 4GSOA 1CHGA 3SU4A 1G3CA 5A0BA 1OWHA 1O33A 3PO1C 1A0JA 1NRPH 1YY3A 1BTWA 1COWD 1UVUH 1O3NA 1Y3XA 2TGPZ 2AYWA 3DHKH 4BTTB 1IQNA 4R0IA 2RFKC 3SUDA 2GX4A 1QA0A 3PV2A 1BITA 2HOBA 5JDUB 1GBCA 3LPRA 3ZZ5A 2FS8A 1TX8A 3RXSA 1AI8H 5C20A 1S0RA 4YXWD 3LGIA 3MNCA 4TY7A 1BTHH 1GJ7B 2STAE 3BTME 1H8IH 3GY6A 1ELEE 3GYMA 1GJ6A 2C3SA 1DLKB 3D62A 4E7NA 2QN5T 5K0HA 1AE5A 1SLUB 1LQDB 1SQAA 3TH4H 4FUGA 2A32A 3PTNA 1SGNE 2EC9H 1GBLA 3FOAA 1C1PA 3GCHB 3BEUA 4ISNA 4X8TH 2CV3A 3K6YA 1KXAA 2H9EH 5HGGA 1EASA 1FAXA 1N8OB 2EA3A 1FUJA 2QCYA 3GY3A 4FUJA 1NBME 1HAIH 5E0GA 1YWUA 1DITH 3PRBA 2J94A 7ESTE 2A2XH 5H4IB 3EQ0H 5L2YH 1HXEH 1Y5UT 3B23B 1S84A 2FYQA 4YLQH 1C4V2 4WMFA 3A8CA 3SNCA 1UO6A 1NT1A 1J15A 3GDSA 3RXMA 1SG8B 1CA8B 1V2OT 1TOMH 1FI8A 1GHZA 2Y5FA 4K5ZA 2P8OC 1EZUC 1H9IE 4J1YA 5FHTA 3MTYA 2R3UA 3QWCH 3CS0A 1K0HA 3ZZ7A 1ELFA 2TGAA 5HIZA 5GPIB 1S81A 1O2OA 5T3HA 1JXPA 2QF5A 1AU8A 1SGFA 3ATWA 4NWKA 2OC7A 2ZDNA 2PLXA 3OFND 2UUKB 1ZHMA 1E1RD 4YOJA 2AGGX 4K8YA 3VXFH 1O31A 1BMMH 3SZNA 1JBUH 1H8DH 1PPEE 1SBWA 2TGTA 1FIZA 3OEED 3RLYH 3ATKA 4Q7XA 1HAVB 4YT7H 1ARCA 1MQ6A 2QF3A 5DP3A 3TK9A 1YCPK 3STJA 3QUMP 1P2NA 1TGCA 1TPPA 3GS9A 3ZZ4A 2NU3E 3PMHB 1O2HA 4IGDA 2JETB 3Q77A 1NROH 3V7TA 1THRH 2TGDA 1UVTH 5EQSA 3SGAE 2ESTE 4Y10E 1C5QA 4LZ4B 1D6RA 4ZXXH 1LVYA 3A81A 4ISLA 4BAHB 1SQOA 1KTTB 1P2IA 1C1QA 5GCHF 1HBTH 2ZGJA 4D76A 2FOFA 3ZV8A 1EB2A 1ZZZA 1VGCB 4DW2U 1IQKA 1IQJA 1SC8U 3UR9A 1GMCF 5SGAE 1HGTH 1RGQA 1C4Y2 3SOSA 1KYNA 1D3TB 3F6UH 7GCHG 3CENA 4B6EA 1WQSA 1FV9A 1C1MA 1UHBA 4J2YB 4KTSA 2FOAA 3EAJA 4OGYA 1QGFA 4TT3D 4AN7A 1VJ9U 1BTPA 2EI8A 4YESB 1K9OE 3ENSB 3SQHE 5FCKA 2Z3CA 1LHGH 4JYTA 4CHAB 1KMHB 2WPHS 1E38B 5FCRA 2JDID 3QO6A 2PKSC 1DWDH 1QCPA 2WPLS 1A46H 4AFUA 1OWDA 3F2GA 1EAIA 2YNAA 1HAHH 1V2VT 1DWEH 3GCOA 3SO3A 4B2AA 2BMGB 1A7SA 4NFEA 2O9QA 3TLOA 2XNIA 2VINA 3RC4A 3T28A 3DT0H 1TNGA 1TNKA 4X6MA 3FP7E 1XX9A 1QR3E 1C2HA 1NRQH 2Q6GA 3RMNH 1O2TA 2I6SA 3MMGA 4B75A 1DWCH 2H1UA 1TIOA 4ZMAH 1P11E 2D1JA 1HJ8A 3LOXA 3R3GB 3M3TA 4NZQA 2B5TB 1TQ7B 2GTBA 4BAMB 1E34B 1OHHD 3VXEH 6CHAC 3PLKA 5AHGH 2F91A 4TWYA 4A1TA 1O3DA 1HFDA 3BG8A 3D23A 2UUFB 4MVNA 1AUJA 1TNJA 4K60A 1GWAA 2WYGA 3Q3YA 4QT8C 2ZHQH 1BRUP 1LVBA 1C5PA 4CBOA 4HI3A 1LDTT 2FMJA 2VIPA 3MH4A 2FLRH 1KLIH 2CMYA 5JBBS 1AMHA 5C1UA 1ANCA 5C67A 4JZFH 1RJXB 2A0QB 2IPHA 1L1NA 1QBOA 1HPGA 3MO3A 4YM9A 3A8BA 4MG3A 1BJUA 2ZGXH 4D9QA 1AFQB 4YOGA 1GHWH 1UW7A 3K65B 1V2UT 3KQ5A 2TPIZ 2FESH 1PJPA 3A89A 1O2NA 1KDQA 4MPVA 1HV7A 4ZUHA 1M9UA 4YTAA 5C1XA 5E2PA 4OS7A 3U8TH 1E37B 1WUNH 3BG4B 3HKJB 1ETSH 2ZHDA 2ZO3H 4IBLH 3M5MA 5AFYH 3QZRA 2Y81A 1SPJA 4KTCA 4U30A 2WZQA 1NU7B 1LKBA 2BQWB 1P3CA 1NTPA 1NN6A 2AH4X 5JYIA 4MNYA 1K1LA 2P59A 1EUFA 3N7EA 4ABEA 4XSKU 1C2DA 1ELDE 1S6HA 5A2MH 2D26C 1GI9B 1MMJN 5KECA 1FZZA 5GDSH 1AN1E 1HJ9A 1EZSC 2VVCA 5C0TA 3A80A 3DSGA 1CO7E 4WH8A 5JPMH 1Q31A 2GCHF 1H8HD 3GY2A 1E79D 4X2XA 1FQ3A 1ANBA 3UR6A 4CRDA 4H6TA 1C9PA 1EQ9A 1GJDB 2P3UB 3NKKA 1J14A 4ISIH 1D3PB 4GUXA 4UFEH 1RRKA 1YGCH 1TFXA 4A7IB 4H4FA 1BMNH 1O3IA 1KLJH 5DJ7A 1AUTC 1DT2A 3SJOA 1TLDA 2KCYA 4E7RG 5EJLA 1IOEA 1YYY1 1CA0B 3KQEA 1QY6A 3O8CA 3RP2A 3UOPA 2ZFSA 2FOMB 1NFYA 1QRWA 1UVPA 2QYIA 2FDAA 1DFPA 2WV4A 1K1IA 3PWCA 1PPHE 1L4ZA 4AG1A 5DP8A 4WXVA 1SGEE 2V3OH 1TMTH 3FP8E 1C5WB 1QL7A 2OTVA 1GG6C 1JRTA 1ZSLA 3N7DA 1UCYH 1ARBA 5DP5A 1T8OA 3UY9A 4AC9A 1O5EH 1AZ8A 2ZFPH 2BDBA 1GBBA 4B73A 1AD8H 1WSSH 3GDUA 1BUIA 2B0FA 2W6ID 1FIWA 4AB8A 2VBCA 3A7WA 2GDDA 3E16B 4ISHH 1CU1A 3T27A 2ZHEH 3BSQA 1AVXA 1OP2A 1T4UH 2P3FH 3BTWE 3VB5A 3HK3B 1UTOA 5T6DA 5AVDA 4H6SB 2A4QA 2VIWA 1GI5A 1C1WH 1ETRH 1GMDF 3RXDA 1PQ5A 1BJVA 4Q2KA 1Z8JB 2XWBI 3LGWA 1LPKB 3I78A 4ABBA 2M5TA 4NSYA 3P92A 2J38A 5GCHG 1TMBH 2PHBA 4B1TA 3MU5A 3PM3A 1AE8H 2CXVA 4MPUA 3U9AH 3T5FH 3O8DA 2V35A 4O3UA 4DG4A 2F43B 1DSTA 1GMCG 4UFFH 3AVZA 5DSFA 4NSVA 1GI6A 2FOBA 1O2VA 3PO1B 2A7HA 3A86A 1G36A 1VJAU 2J9NA 3A8DA 1GL0E 4A1VA 3TJUA 5JBCS 4MPXA 1O5GH 2QXJA 2UUJB 5EW2H 2Z3DA 4HTCH 2Q1JA 1C5LH 1WV7H 1UK2A 2GCTC 4X1RU 1GI0A 1ZOMA 5GXPA 2H2ZA 3GICB 2J34A 3QTOH 1P57B 1GDNA 3PROA 1SGDE 4MTBA 1ANDA 2P16A 4NA9H 1L2EA 4VGCC 1OWKA 3FZDA 3PLPA 4DY7B 2Y5HA 1A5GH 3VB6A 4OS2A 1GHBF 2B8OH 1EOJA 1O2GH 1GCDA 2PUXB 4IC5A 5ESTE 1G32B 1O2UA 2VVUA 2V7QD 3SYJA 4NFFA 1MQ5A 1C1VH 3SJ9A 1GBIA 4NA7A 4Y11E 1C2FA 3RXJA 3U69H 3RDZA 3A87A 1BHXB 1H1BA 2ODYB 4F48B 2VVVA 1AQ7A 1WOFA 3MU0A 2V6NA 3V12A 1GJ8B 1VITF 1DXWA 1F0RA 1OP8A 3RXQA 3ZVBA 1EPTB 2UUYA 4Q80A 2ZQ1A 4DOQA 4F55A 1E1QD 1T32A 1BTUA 3M37A 1K1PA 1Z7KA 3HK6B 2HRVA 2BLVA 3P17H 3ZZ9A 2HVYB 3SI3H 5C2ZA 4FXGH 3QDZB 1TGNA 1GBKA 2JH0D 2QA9E 1C5VA 3JZ1B 1KDQB 2YNBA 5DKMA 1L1JA 8LPRA 5TCAA 3U8RH 1FY5A 1BTZA 1NESE 3RU4E 3NXPA 5FBEA 2QGRA 4ABIA 4WWYA 1W0ZU 1EATA 2A45B 4XRNA 3H7OA 1GJ9B 1KTSB 2P8OB 5F03A 4ZXYH 3UQVA 3O8BA 3PRDA 2A5AA 3BTQE 1SKYE 3HKIB 2PP6A 2BDAA 1O37A 1TBZH 2THFB 2DE9A 1O2JA 7KMEH 2CK3D 3UIRA 1FY3A 2QF0A 1IHSH 3GY5A 2M2AA 4CR9A 2BTCE 3BTTE 4IW4E 1GDQA 2BX3A 1UTJA 3EA8A 1UMAH 4E05H 1W2KH 1T8MA 2FI5E 1THPB 2W7UA 5CHAB 4P02A 4O9VA 1P8VC 1GBEA 1XKBC 1EXFA 4H42U 5HYOA 1NU9A 3LGVA 1P9UA 1P9SA 1FONA 1OWJA 1TAWA 2C8XB 2GVFA 3GISB 4I8HA 4X1SU 2VJ1A 3PTBA 1O3LA 2J5UA 1X7AC 2BVRH 1OP0A 2ZF0H 4OM9A 1FMGA 4F4OC 1O2SA 1QFKH 3MO6A 2FOEA 1QB1A 3BV9B 2B9LA 4ZAEA 5JB8S 1D3DB 2F9BH 2FXRA 3I77A 1O5BB 3MI4A 2GCHG 4YOIA 2ODPA 1ZR0A 1EZQA 2SGAA 3FP6E 3VB4A 3AW0A 4RKJB 4ABFA 3TJOA 3LONA 1VCWA 3ZVAA 2D8WA 1Z6EA 3PV5A 3STIA 1P10A 2EI6A 3KGPA 4JCNA 3T2NA 1RD3B 3W94A 1GMHG 3AK5A 3LGYA 3K2UA 3OE7D 2F83A 1BCUH 1W3CA 1ZMJA 2P3TB 2ZIQH 1YLNA 1OX1A 4JMYA 4JK6A 4GVUA 4CRAA 1HLTH 3QGNB 4CRFA 2GV7A 3TNSA 1EPTC 1MD8A 2OUAA 2HNTF 1MCVA 2F3CE 2BHGA 1C2EA 3IG6B 3M3SA 5KEDA 3ZYEA 1WYKA 2Z9JA 3ESTA 1SGYE 1MBQA 3WW7A 1C1SA 5AF9H 1WDIA 4DT4A 5IDKA 3SUFA 2PKSB 9ESTA 4KP0A 4FUCA 1DE7H 1XKAC 3QX5H 1QJ7B 4TSFD 2ZZUH 1TBRH 2BD5A 2VGCC 2FODA 1MUEB 4KGAA 3UTUH 4ABGA 1XM1A 5TJXA 2VU8E 1MKWH 1A3BH 2AIQA 8GCHF 4AOQA 1RS0A 2F9NA 1RIWC 5J4QA 1NFWA 3BTKE 3BTHE 7LPRA 1GJ5H 2GV6A 1JRSA 1GBJA 2YMSC 2OLGA 4THNH 4Y76A 2O8WA 3PLBA 1QURH 3GY7A 1V3XA 1O5AB 2H5DA 3URDA 1GMDG 4NIVA 1N6YA 1TMUH 2G81E 1LKAA 6CHAB 1GGDC 1SLXB 3MH5A 1WCZA 4ZH8A 1MCTA 2K8IA 2STBE 3V3MA 1BRBE 2C8ZB 4O3TA 3ZZDA 5A0AE 3RM2H 2PW8H 3SNDA 3M7QA 2F9OA 3F9FA 1O38A 1A1RA 4U01A 5J4SA 3F1SB 1CVWH 3FO8D 4I8KA 2OC8A 5CHAC 2K1QA 1W0JD 4WXIA 3UOUA 2FYRA 2PGBB 2ZGHA 3SNBA 1O3AA 3MQKC 1SOTA 3UB0A 4DT7B 4NCYA 1YKTA 4YZUA 5EXNA 1DICA 3UREA 4BOHA 2PR3A 5E2OA 1ETTH 1BBRH 3LH3A 1UK3A 3G01A 2BD2A 2TIOA 4X8SH 2ZTXA 3I29A 1OWIA 2Y82A 4MQAA 3VB3A 4B71A 4FUFA 1YPMH 2XC4A 3LC3A 2JH6D 4XBCA 1ZPBA 3SJKA 2O8LA 3M7UA 2ZFFH 4D8NA 1GHBG 5L2ZH 1EX3A 1QB6A 4MDSA 5JBAS 2BY8X 4RT0A 1W12U 1YPKH 4LOYH 3KL6A 4NWLA 1TGBA 2XBVA 2BYAX 2ZKSA 4UDWH 1SGRE 1VITG 5L6NH 1AWHB 4XBBA 1G37A 4ABAA 2W6JD 1W8BH 1O2ZA 2QY0B 1P2MA 4WY3A 3BIVH 1TPSA 1MZDA 1LTOA 2KFWA 3RXVA 5C0UA 3Q00A 3SHAH 1P06A 1O2MA 1P09A 2JIZD 2NU4E 3BEIB 2Y5GA 3S9AA 2A2QH 3Q3KA 5FPSA 5FPYA 2AHME 2R0KA 3QZQA 3RMMH 3M5OA 2ZWLH 1CHOF 3RXIA 8ESTE 2SFAA 1G3EA 3ZZBA 2FOCA 2FOHA 2ZCHP 2KX4A 2ANWA 2AS9A 4YLUA 4BAOB 1SGTA 2BD3A 2G4TA 3HATH 4JYUH 1SGIB 3IWMA 2WUBA 4UD9H 4ASUD 1MH0A 1GCTC 1QRXA 1BA8B 1EKBB 2YOLA 4FUBA 4UFGH 3LGUA 1H8ED 6LPRA 2HPQH 5A8YA 3MHWU 4I33A 4AFSA 1W7XH 3SZEA 2OINA 2QF4A 1HIAA 1BIOA 3FKSD 2IN2A 3AW1A 1XUGA 3OSYA 3SGBE 3TPIZ 1BTXA 1PPZA 2WYJA 2W26A 2BD8A 3BTEE 1NM6A 4ABDA 2EY4C 2ZFQH 1CT4E 2CGAA 3E0PB 3E3TA 1W0KD 3RC5A 1W7GH 4I8LA 1NS3A 3KEEA 1GG6B 2GJGA 4FUDA 3EE7A 1Y3UA 2SGEE 4FU9A 2OP9A 1XXDA 4KTUA 2CHAC 2PWXA 1OYTH 4Y0YE 2ZA5A 3ZV9A 4XDEA 4DIHH 4CRGA 2RDEA 1VCQA 5L30H 1EPTA 3UQOA 1GDUA 2OK5A 1PQAA 1J8AA 2XBWA 4E06H 3ZZ3A 3P8FA 1YP9A 1P0SH 1T8LA 3RXOA 3NK8A 3SHCH 1IQEA 5EPYA 5CDFE 1LPZB 5E0HA 4AFZA 4U32A 2BLQA 3TGJE 1TQ0B 4OS5A 1ZLRA 3TGKE 2XNDD 1QL8A 1YM0A 2PGQB 5DP7A 3SJ8A 3OEHD 4INLA 1SGPE 4JZDH 3ATLA 1CBWC 1ZHRA 3RXKA 3TU7H 1QIXB 2C8WB 1A0LA 5ABWA 3F9EA 1PQ8A 3DSPA 3NPSA 3ZVFA 2Z94A 1Y8TA 3GYLB 4Y0ZE 1C5TA 1TNHA 1BTYA 5TCCA 2DE8A 4GAWA 5C1YA 1SQRA 3RXEA 1KLTA 4DGJA 2KM0A 3V13A 2FI4E 3RMLH 9LPRA 1V2WT 2UWLA 1P04A 4F49A 2ZDVH 2JJ2D 2IJD1 2F9VA 4NA8A 3M5NA 4Y8ZA 1GHXH 1YBWA 1A5IA 2GCTB 1KXCA 3A7XA 5HXFA 1O3PB 3M61U 2AIPA 1CSOE 1IQGA 4A92A 2XYAA 5C94A 4UONA 1D6WA 1O3FA 3HGNA 2BM2A 4VGCB 3SV2H 3QLPH 1AB9B 1TNIA 2Z9LA 2V3HH 2WSSD 1PYTC 1TPAE 2D2DA 2VIOA 2ZTYA 5E0JA 1O5FH 3PMBB 4RT1A 2OQUA 3SBKA 3UFAA 1NY22 1P01A 1ZRKA 1EAUA 4XD7D 1SGQE 2WPMS 4IC6A 1H9LB 4ZKNU 1TA2A 1GMHF 2P93A 1P2KA 8GCHG 2BDCA 2ZCKP 3F0PA 3MH6A 3EA9A 1Z6JH 1GBFA 1P2JA 3UNSA 4AGKA 2FO9A 2ZPQA 2SNVA 2W7SA 3U98H 1FJSA 1T8NA 1YCPH 5EQQA 2NU0E 3AAUA 1HAOH 5CHBA 1TPOA 1V2TT 3KQBA 2IPQX 4OGXA 4HZHA 3LIWA 1G3BA 2I6QA 2Z9KA 2ZFRH 2B7DH 2BQ6B 2HLDD 1BQYA 1KIGH 1LHFH 1UTQA 3OTPA 2EEKA 4Y79A 1XUHA 4TY6A 2C8YB 4RN6A 2O8UA 2PKAA 1VITH 3BF6H 1GHAF 1A0HB 3SU3A 1YPHC 1UJ1A 5EIYA 2BDGA 1F7ZA 5C17A 1L0ZA 2ZTZA 4B76A 5F8ZA 3A8AA 3URCA 1ELAA 2JH5D 4GCHG 3MNXA 1C5OH 1V2MT 1QRZA 1F5KU 4I7YH 3NRLA 3SI4H 2YMSD 1UTPA 4FUIA 1AGJA 1EFRD 1U6QA 3GY4A 1FDPA 1XUFA 1T4VH 1Y59T 4DURA 2WPDD 2WPJS 2ZU2A 1KXDA 1SMFE 4BAKB 2ZGCA 4YO9A 3N7OA 3SQEE 1A2CH 3MU8A 4AYVB 2KZ4A 1BOQA 2VB0A 1O2WA 1G30B 3K6ZA 2ZDKA 1GBMA 1RXPA 2ZGBH 3MYWA 3VGCC 1P05A 3T29A 6GCHF 1ESBA 1A4WH 3TGIE 4TPIZ 4DJZB 2HWLB 3ZVGA 4FVBA 4X6PA 2BXTH 3ZZAA 2PTCE 3F0OA 2BOHB 1TRYA 2AMQA 1CGJE 3H7TA 1K2I1 3D49H 3TITA 3GDVA 1GJBB 2FLBH 1GJAB 1S82A 1OYQA 1ACBE 1SB1H 4R8TB 4Q4LA 1V2LT 3VG8A 1NRNH 4GPGA 4JZEH 2JJ1D 1GJCB 4K1SA 1XVOA 1O2KA 1O2LA 2BD9A 2P95A 2PSXA 1HIAB 1QQ4A 3FVFB 1L1GA 3SU0A 4CH8B 1AFEH 4Z0KA 5DPAA 3ZYDA 3ZZCA 4JZIA 5F6MA 1AB9C 1O2RA 1LMWB 4I8GA 1CHOG 2F9UA 4UFDH 1Q3XA 1V2RT 1NRSH 3MOCA 1O36A 2RDLA 5K7RA 4AYYB 2Q6DA 1LHCH 1YPLH 1C2LA 3S9BA 4SGAE 2XWAA 1AVWA 3D65E 3ZVEA 4D9RA 1AY6H 3LDXH 2ZPRA 1S83A 3T26A 2Y80A 1D3QB 1YF4A 1GI4A 4Y6DA 5HM2A 4GLYA 1O3EA 1ZJKA 2PTNA 2BY9X 2ZNKH 5HM9A 3U1JB 1G3DA 2XCFA 4Q7YA 3F2HA 1TRNA 1V2JT 2QXGA 3U8OH 2QV1A 4Y7AA 1O3BA 1EP5A 4X6NA 3RXFA 1BZXE 1K1OA 3E1XB 3W1EA 3KCGH 2Y7ZA 2G5VA 1DY9A 1YLDA 2QAAA 1DPOA 1NRRH 2VGCB 3GCNA 3OY5U 3E8LA 1YPGH 1C5XB 2ZDAH 2CN0H 4INHA 5DP6A 1C4U2 3BIUH 3ZZ8A 1C5SA 3LC5A 4INKA 3VPKA 1IHTH 1HRTH 4FU7A 1SR5C 1OXGA 1XUIA 1UTKA 2XC5A 2ZU5A 1J16A 1EOLA 1SSXA 2GMTC 4Y7BA 1YPEH 3A7VA 1RIWB 1Z1JA 2KCPA 1FY8E 2TBSA 5EXMA 3ELAH 4ZHAA 2YMSB 1V2QT 3VFEA 3AASA 2XBXA 1ZHPA 5C3NA 5JB9S 2P94A 4NIYA 4GHTA 2EQNA 5C5NA 3T25A 4BTIB 2J97A 1SGCA 5HKKD 3LKWA 3DCLA 3C1KA 1GGDB 1DY8A 2C4FH 4TWWA 3NZIA 1ZGIA 2LNCA 2AEIH 4IMZA 2JKHA 3K9XB 2AFQB 5LPEA 3A7ZA 1W13U 3WWBA 2RA0A 5IYTA 1SOZA 4FUEA 4Y8XA 6ESTA 4XFQA 3SGQE 1OKXA 2HLCA 4IN1A 1A61H 4DVAU 1YC0A 4FETA 2FI3E 2XOKD 2ZG0H 1Z8GA 1Z1IA 1DM4B 1TWXB 3MU4A 1LHEH 2PSYA 2HNTC 2O8MA 1NC6A 2AGEX 2ANKH 1ANEA 2SGFE 1WTGH 4BXWA 3QK1A 1TABE 1FPHH 1XXFA 2QC2A 1OWEA 1GBAA 2PUQH 2Z3EA 4X8UH 2BB4A 5FPTA 1ELGA 2WUCA 3A85A 2HGTH 3P70B 3SU5A 3SNEA 2W3IA 5JBTA 1Y3YA 1NFXA 1ZSJA 1UVSH 1D4PB 5EOKA 1C1RA 3SORA 5I46H 1IQLA 2PKAB 3C27B 1ZRBA 1LVMA 3MNSA 5C5OA 4ZROA 2BZ6H 3TJVA 1C1OA 4B6FA 4ABHA 1KSNA 1WBGB 2FS9A 3NCLA 3DUXH 1HCGA 5LGOA 1SVPA 1C2JA 2HVXA 3FANA 1F5RA 1E36B 3TK6A 1L4DA 4BNRA 2LELA 2KCAA 1BMLA 5GIBA 1NBMD 2H6MA 1TB6H 2R9PA 1PFXC 1PYTD 4DCDA 1TONA 1UK4A 2W3KA 1O35A 2DUCA 1GVZA 2BD4A 3A7TA 2ZDMA 1GHAG 1ZPCA 4U2WA 1G9IE 4K69A 5DGJA 5EU8A 1MTNC 1G2LA 4CRBA 5BRRE 2F4LA 5KGOA 3OY6U 1HNEE 3LJOA 2QXHA 1GCTB 4X2YA 1TX6A 2LPRA 2WINI 5DP4A 2FOGA 3U28C 4Q7ZA 1HJAC 2ZI2H 5F8XA 5DN6D 2H9HA 1C1TA 1V2NT 2ALVA 1C2KA 2WPKS 1UTMA 1FXYA 2ANYA 3L3TA 1KXBA 1DUEA 1O34A 2J2UA 2ZU3A 1RFNA 2R2WU 2H5CA 1AKSA 1AO5A 5GNDA 2GZ9A 2OXSA 2FM2A 2H9TH 2FZZA 4WH6A 5HIYA 3JZ2B 2XW9A 2SGQE 4HFPB 1MAYA 1DUAA 1JOUB 2BDYA 3RLWH 1O39A 1S85A 3MU1A 3SN8A 3SJIA 5ETXA 3TJNA 6GCHG 1BHXF 1BMFD 1BRCE 1QJ1B 2CHAB 2L74A 1Y3VA 1AVGH 4ESTE 1DX5M 2ZPSA 3P95A 3EE0B 3ZVDA 2WV9A 4JYVH 8KME2 1J9CH 2KAIA 3ZZ6A 2XTTB 4A5TS 2HPPH 2ZFTA 1N6XA 3L33A 3P8GA 3H09A 1DDJA 2F9PA 4AORA 1LHDH 1A3EH 1B0EA 1SHYA 1CGHA 1KY9A 2ASUB 1GI3A 2Z9IA 3P8OA 1BDAA 4GCHF 2VIDA 1MZAA 4X2VA 2IOTA 2FP7B 5F53A 3ITIA 3HPTB 5EJZA 1C1UH 5EGMA 5PTPA 3SW2B 1BMAA 1FNIA 1CBWB 5EODA 3B9FH 1SL3A 1C5UA 3RC6A 1O0DH 2BY5X 1YPHE 3VEQB 1IAUA 4LZ1H 4WF8A 2BQ7B 3SUEA 2RA3A 2ZU4A 4X1PU 3KYFA 4RI0A 1S6LA 2A4RA 2GT8A 3SV7A 2ZQ2A 3M3VA 3OAAD 2VH0A 2GT7A 1W10U 1IQIA 1MD7A 1O5DH 1AZZA 2UWPA 1GVLA 1GBHA 5GJ4B 3AAVA 4IMQA 2QIQA 1C5RA 1K21H 3LT3A 1GL1A 2VWLA 3F68H 3ZVCA 1QNJA 2TRMA 1O2PA 1LO6A 2FPZA 3BTGE 5T6FA 1C2IA 4BAQB 2A4GA 3L6PA 1ZSKA 1NFUA 1MTVA 1UCYK 2RCEA 4M7GA 1GHVH 3OYPA 4OS4A 1ESTA 2QXIA 4I8JA 1QBNA 1Y3WA 5FX6A 1ZMLA 4A6LA 2SGDE 3MWIU 1Z8IB 1EB1H 4NG9H 2J98A 4K1EA 1O2YA 3P8NA 5DP9A 4WMEA 1C2MA 1UCYE 1MTSA 1G2MA 3QN7A 2RG3A 2OQ5A 2Z6BD 1UTNA 4SGBE 4OS1A 1F92A 2GDEH 1EJMA 2ODQA 4ZKRU 1GVKB 3GCHC 1WTHD 4MLFB 3RUOA 1HAPH 2FTMA 1O3GA 4O97A 1GHYH 3FN8A 4FU8A 2GGVB 4NZLA 2PV9B 4NGAH 1N8OC 1O3MA 1JMOH 1HAGE 3LU9B 3KHVA 2Y7XA 3ZIAD 4WVPE 2CF8H 2UWOA 4NIXA 1V2ST 2FTLE 1K1MA 1NO9H 2A1DB 1O2QA 5A0CA 1Q2WA 2VNTA 4ACBA 4BTUB 1WAYB 1DVAH 2A4OA 2VWNA 2R3YA 3KNXA 1SGFG 1E35B 1CQQA 5EW1H 1V2KT 1EJAA 2C90B 1HAZB 2ZEBA 4RKOB 1DSUA 1E0FD 3ATIA 1OS8A 1ZPZA 3SNAA 1TNLA 2BDHA 3EDXB 4ACAA 2ILNA 2PFEA 2WHXA 1YLCA 3GCTF 3IITA 3MO9A 3ODDA 3E90B 3M5LA 1F2SE 2A7CA 1CT2E 3FZZA 2ZU1A 3Q76A 1FN6A 1ABIH 3TK5A 1PPFE 2G8TA 1JIMA 5CE1A 2IJOB 1OOKB 3SU2A 3S0NA 1QTFA 5ESBA 1F5LA 1O3CA 3RXTA 4FUHA 3RXUA 3CP7A 3V0XA 4D7GA 1TA6A 1ZTLA 4X1QU 1LCYA 3QTVH 1O3HA 5EG4A 3SV8A 3VB7A 1N1LA 2FWWA 3N99A 3GOVB 1AIXH 4Z6AH 4D7FA 3RXPA 3KQCA 1P02A 2FX4A 2G5NA 5LPRA 1P3EA 5HMAA 1WU1A 3SUGA 4CBNA 1V6DA 2XXLA 4X6OA 5FXLA 3WWFA 3DA9B 3VGCB 1VCPA 5G4BA 1WQVH 3CS7A 2BY6X 2BY7X 4JZ1A 1O32A 1KXEA 1ZGVA 3RU4T 1XMNB 1HB0B 3RXAA 3KN2A 4I31A 1HDTH 2BX4A 4KKDA 1QB9A 1INCA 3LJJA 1BRAA 5GWZA 2JETC 4MNXA 2V0BA 1O5CB 1QHRB 3PWBA 2ZCLP 2C93B 2CF9H 4HG6A 5LPFA 1QA7A 3UWJH 3DSOA 1S0QA 1C5NH 4CREA 2NU1E 1W11U 2BVXH 1O30A 3OX7U 4Z1MD 2KR7A 1MBMA 2NU2E 1ELBA 2ZECA 1DWBH 3PMJA 4RSPA 1GI7B 2J92A 5FBIA 3TNTA 1H9HE 2CJIA 4ZKOU 5I25A 1DS2E 1D9IA 4KELA 4UEHH 1O3OA 1VGCC 4X0WU 1GBDA 1GI8B 1AKSB 1HYLA 1RTFB 4X2WA 1FY4A 1LVOA 3M35A 4CRCA 1MKXK 4K1TA 1ELTA 1O3KA 3M7TA 1O3JA 1JIRA 3A88A 5EJ1A 1AHTH 1GPZA 1XUJA 1ZMNA 2VWMA 1C1NA 3ATMA 1T7CA 1Y5AT 5EPNA 2HNTE 4A1XA 1O2XA 2BXUH 3LGTA 4FOUC 4FVDA 4MPWA 2HALA 3R0FA 1B7XB 1ELVA 2OC0A 1FX0B 3P6ZB 4AG2A 4DIIH 2KAIB 1H4WA 3WY8A 3MNBA 4CHAC 4M9FA 4O03A 3UAIC 3UPEA 5EQRA 1VKYA 3B8JA 2FIRH 3BN9A 5FL7D 3Q3XA 1C5YB 4ZHMU 2G00A 3A82A 3KF2A 1YPJH 5T1VA 1Z71A 1SFIA 1F0UA 3PB1E 1MABB 4AB9A 5B6OA 1ZYOA 3F9HA 3BEFB 1BT7A 2GD4B 1ABJH 2Y6TA 4UE7H 1C2GA 1DLEA 3E6PH 4MNVA 3PV4A 2VIQA 1EJNA 1PPCE 4B74A 1CT0E 1HXFH 1CE5A 2BOKA 2GMTB 4WMDA 2WPIS 3SU6A 2G55A 2BLOA 1EAWA 3S7KB 4ZCNA 1Y5BT 3FFGA 3U1IB 4LK4A 2O8TA 1GBTA 4ZHLU 2OC1A 3GY8A 1S6FA 3UNRA 1FPCH 1VR1H 1T31A 2ZDLA 1B0FA 5AFZH 5IK2D 2Z7FE 2XC0A 4CR5A 1SFQB 1W14U 1IQHA 2Z9GA 4P00A 3M36A 2A31A 4K2YA 4HGCA 1S5SA 4I32A 2A7JA 3RXCA 3QGJA 1TGTA 1TOCB 3S7HB 1KXFA 3DFJA 4YT6H 1P2OA 1NZQH 1ZTJA 1QJ6B 4X8VH 2BD7A 4ABJA 1GJ4H 1J17T 4BANB 1A5HA 2J98B 3A83A 4ISOA 1B5GH 4AFQA 2AGIX 1ESAA 3KIDU 3PMAB 1XUKA 1IQMA 4TYDA 1AFQC 1UHBB 4WJG2 4XOJA 3H5CB 4Q63A 2EI7A 1BB0B 4JK5A 2AMPA 1MTWA 1EZXC 2XBYA 3BTDE 1C5MD 5DO4H 1GI1A 1MTUA 4AZ2B 1TX7A 1MU6B 2LP6A 2NWNA 5A8XA 4PROA 1GI2A 2FEQH 4TPYA 1FN8A 4XE4A 3BG4C 1P03A 4I86A 3NWUA 1TALA 1DOJA 1K28D 1IQFA 4K3JA 2AERH 1MKWK 3EA7A 4B2BA 2GZ7A 1EP6A 2KCOA 3A7YA 1XVMA 1P12E 1QL9A 1F0SA 1O2IA 4XBDA 1K22H 1OPHB 4Y8YA 3SV6A 1RTLA 3RM0H 3RXGA 1ELCA 4NIWA 4IS5A 3DFLA 1DXPA 1LQEA 2XCNA 3W95A 1MU8B 5A8ZA 3KYGA 2SGPE 2ZHWH 3SU1A 2GZ8A 2G4UA 1DANH 3BTFE 5A09A 1K1JA 5BPEA 3F9GA 2V3MA 3TVJB 2G52A 2WV5A 1TBQH 2BLWA 1QBVH 3PYHA 3MFJA 1HAVA 5CMXH 1HUTH 4OS6A 3RXBA 3UUZA 2OCVB 1EAXA 4Y71A 5T6GA 1SI5H 2ZHFH
chains in the Genus database with same CATH topology
3EYDA 2XRCA 1MTNB 1MAXA 1Z8RA 2A5IA 2OBQA 3GCTG 4B2CA 1BBRK 1FAKH 4LXBH 3UWIA 7GCHF 3KQDA 1TGSZ 1TRMA 3RU4D 2Q6FA 2W5EA 4AX9H 1C9TA 4AGJA 1CA0C 1C5ZB 2FX6A 3HGPA 1HJAB 2SNWA 2VWOA 4ZKSU 3RXHA 4GHQA 2J4IA 4X1NU 1RTKA 1SLWB 1JWTA 5FAHA 1BBRE 3EGKH 2BDIA 5EXLA 3LH1A 3O8RA 3RXLA 3S69A 2G51A 1PQ7A 3DD2H 2OD3B 3E0NB 2GP9B 1TE0A 2BVSH 1FY1A 1QQUA 2J95A 2R2MB 2VH6A 2VIVA 1F0TA 3TH2H 3OU0A 5DK1A 3NUMA 4K8BA 5LH8A 3TIUA 1LPGB 1MKXH 2OBOA 1SQTA 1ZTKA 1THSH 1HAYB 1W0YH 3T62A 3RXRA 4BXSA 2A5KA 2GKVE 3MH7A 1K1NA 5E8EH 1P2QA 3ODFA 4CH2B 5FX5A 3S9CA 2R0LA 1TYNA 1V2PT 2ZP0H 1CGIE 1UVOA 2BZAA 1UTLM 2AMDA 2ZC9H 3TH3H 2ALPA 1ZJDA 1YCPM 3SV9A 1VZQH 2ANMH 3FAOA 3OTJE 1FLEE 3UNQA 5F8TA 1SHHB 1NPMA 4MNWA 3RMOH 1PPGE 1ORFA 1HAXB 3A84A 1SLVB 1PPBH 2ULLA 3E91A 1AWFH 1ID5H 5DG6A 4ASHA 1OSSA 4IN2A 4GSOA 1CHGA 3SU4A 1G3CA 5A0BA 1OWHA 1O33A 3PO1C 1A0JA 1NRPH 1BTWA 1UVUH 1O3NA 1Y3XA 2TGPZ 2AYWA 3DHKH 4BTTB 1IQNA 4R0IA 3SUDA 2GX4A 1QA0A 1BITA 2HOBA 5JDUB 1GBCA 3LPRA 3ZZ5A 2FS8A 1TX8A 3RXSA 1AI8H 5C20A 1S0RA 3LGIA 3MNCA 4TY7A 1BTHH 1GJ7B 2STAE 3BTME 1H8IH 3GY6A 1ELEE 3GYMA 1GJ6A 2C3SA 1DLKB 3D62A 4E7NA 2QN5T 5K0HA 1AE5A 1SLUB 1LQDB 1SQAA 3TH4H 4FUGA 2A32A 3PTNA 1SGNE 2EC9H 1GBLA 1C1PA 3GCHB 3BEUA 4ISNA 4X8TH 2CV3A 3K6YA 1KXAA 2H9EH 5HGGA 1EASA 1FAXA 1N8OB 2EA3A 1FUJA 2QCYA 3GY3A 4FUJA 1HAIH 5E0GA 1DITH 2J94A 7ESTE 2A2XH 5H4IB 3EQ0H 5L2YH 1HXEH 1Y5UT 3B23B 1S84A 2FYQA 4YLQH 1C4V2 4WMFA 3A8CA 3SNCA 1UO6A 1NT1A 1J15A 3GDSA 3RXMA 1SG8B 1CA8B 1V2OT 1TOMH 1FI8A 1GHZA 2Y5FA 4K5ZA 2P8OC 1EZUC 1H9IE 4J1YA 5FHTA 3MTYA 2R3UA 3QWCH 3CS0A 3ZZ7A 1ELFA 2TGAA 5GPIB 1S81A 1O2OA 5T3HA 1JXPA 1AU8A 1SGFA 3ATWA 4NWKA 2OC7A 2ZDNA 2PLXA 2UUKB 1ZHMA 4YOJA 2AGGX 4K8YA 3VXFH 1O31A 1BMMH 3SZNA 1JBUH 1H8DH 1PPEE 1SBWA 2TGTA 1FIZA 3RLYH 3ATKA 4Q7XA 1HAVB 4YT7H 1ARCA 1MQ6A 2QF3A 5DP3A 3TK9A 1YCPK 3STJA 3QUMP 1P2NA 1TGCA 1TPPA 3ZZ4A 2NU3E 3PMHB 1O2HA 4IGDA 2JETB 3Q77A 1NROH 3V7TA 1THRH 2TGDA 1UVTH 5EQSA 3SGAE 2ESTE 4Y10E 1C5QA 4LZ4B 1D6RA 4ZXXH 1LVYA 3A81A 4ISLA 4BAHB 1SQOA 1KTTB 1P2IA 1C1QA 5GCHF 1HBTH 2ZGJA 4D76A 2FOFA 3ZV8A 1EB2A 1ZZZA 1VGCB 4DW2U 1IQKA 1IQJA 1SC8U 3UR9A 1GMCF 5SGAE 1HGTH 1RGQA 1C4Y2 3SOSA 1KYNA 1D3TB 3F6UH 7GCHG 3CENA 1WQSA 1FV9A 1C1MA 1UHBA 4J2YB 4KTSA 2FOAA 3EAJA 4OGYA 1QGFA 4AN7A 1VJ9U 1BTPA 2EI8A 4YESB 1K9OE 3ENSB 3SQHE 5FCKA 2Z3CA 1LHGH 4JYTA 4CHAB 2WPHS 1E38B 5FCRA 3QO6A 2PKSC 1DWDH 1QCPA 2WPLS 1A46H 4AFUA 1OWDA 1EAIA 2YNAA 1HAHH 1V2VT 1DWEH 3GCOA 3SO3A 4B2AA 2BMGB 1A7SA 4NFEA 2O9QA 3TLOA 2XNIA 2VINA 3RC4A 3T28A 3DT0H 1TNGA 1TNKA 4X6MA 3FP7E 1XX9A 1QR3E 1C2HA 1NRQH 2Q6GA 3RMNH 1O2TA 2I6SA 3MMGA 4B75A 1DWCH 2H1UA 1TIOA 4ZMAH 1P11E 2D1JA 1HJ8A 3LOXA 3R3GB 3M3TA 4NZQA 2B5TB 1TQ7B 2GTBA 4BAMB 1E34B 3VXEH 6CHAC 3PLKA 5AHGH 2F91A 4TWYA 4A1TA 1O3DA 1HFDA 3BG8A 3D23A 2UUFB 4MVNA 1AUJA 1TNJA 4K60A 1GWAA 2WYGA 3Q3YA 4QT8C 2ZHQH 1BRUP 1LVBA 1C5PA 4CBOA 4HI3A 1LDTT 2FMJA 2VIPA 3MH4A 2FLRH 1KLIH 2CMYA 5JBBS 1AMHA 5C1UA 1ANCA 5C67A 4JZFH 1RJXB 2A0QB 2IPHA 1L1NA 1QBOA 1HPGA 3MO3A 4YM9A 3A8BA 4MG3A 1BJUA 2ZGXH 4D9QA 1AFQB 4YOGA 1GHWH 3K65B 1V2UT 2TPIZ 2FESH 1PJPA 3A89A 1O2NA 1KDQA 4MPVA 1HV7A 4ZUHA 1M9UA 4YTAA 5C1XA 5E2PA 4OS7A 3U8TH 1E37B 1WUNH 3BG4B 3HKJB 1ETSH 2ZHDA 2ZO3H 4IBLH 3M5MA 5AFYH 3QZRA 2Y81A 1SPJA 4KTCA 4U30A 1NU7B 1LKBA 2BQWB 1P3CA 1NTPA 1NN6A 2AH4X 5JYIA 4MNYA 1K1LA 2P59A 1EUFA 4ABEA 4XSKU 1C2DA 1ELDE 1S6HA 5A2MH 2D26C 1GI9B 1MMJN 1FZZA 5GDSH 1AN1E 1HJ9A 1EZSC 2VVCA 3A80A 1CO7E 4WH8A 5JPMH 1Q31A 2GCHF 3GY2A 4X2XA 1FQ3A 1ANBA 3UR6A 4CRDA 4H6TA 1C9PA 1EQ9A 1GJDB 2P3UB 3NKKA 1J14A 4ISIH 1D3PB 4GUXA 4UFEH 1RRKA 1YGCH 1TFXA 4A7IB 4H4FA 1BMNH 1O3IA 1KLJH 5DJ7A 1AUTC 1DT2A 3SJOA 1TLDA 4E7RG 1IOEA 1YYY1 1CA0B 3KQEA 1QY6A 3O8CA 3RP2A 3UOPA 2ZFSA 2FOMB 1NFYA 1QRWA 1UVPA 2QYIA 2FDAA 1DFPA 2WV4A 1K1IA 3PWCA 1PPHE 1L4ZA 4AG1A 5DP8A 4WXVA 1SGEE 2V3OH 1TMTH 3FP8E 1C5WB 1QL7A 2OTVA 1GG6C 1JRTA 1ZSLA 1UCYH 1ARBA 5DP5A 1T8OA 3UY9A 1O5EH 1AZ8A 2ZFPH 2BDBA 1GBBA 4B73A 1AD8H 1WSSH 3GDUA 1BUIA 2B0FA 1FIWA 4AB8A 3A7WA 2GDDA 3E16B 4ISHH 1CU1A 3T27A 2ZHEH 3BSQA 1AVXA 1OP2A 1T4UH 2P3FH 3BTWE 3VB5A 3HK3B 1UTOA 5T6DA 5AVDA 4H6SB 2A4QA 2VIWA 1GI5A 1C1WH 1ETRH 1GMDF 3RXDA 1PQ5A 1BJVA 4Q2KA 1Z8JB 2XWBI 3LGWA 1LPKB 3I78A 4ABBA 2M5TA 4NSYA 3P92A 2J38A 5GCHG 1TMBH 2PHBA 4B1TA 3MU5A 3PM3A 1AE8H 2CXVA 4MPUA 3U9AH 3T5FH 3O8DA 2V35A 4O3UA 4DG4A 1DSTA 1GMCG 4UFFH 3AVZA 4NSVA 1GI6A 2FOBA 1O2VA 3PO1B 2A7HA 3A86A 1G36A 1VJAU 2J9NA 3A8DA 1GL0E 4A1VA 3TJUA 5JBCS 4MPXA 1O5GH 2QXJA 2UUJB 5EW2H 2Z3DA 4HTCH 2Q1JA 1C5LH 1WV7H 1UK2A 2GCTC 4X1RU 1GI0A 1ZOMA 5GXPA 2H2ZA 3GICB 2J34A 3QTOH 1P57B 1GDNA 3PROA 1SGDE 4MTBA 1ANDA 2P16A 4NA9H 1L2EA 4VGCC 1OWKA 3FZDA 3PLPA 4DY7B 2Y5HA 1A5GH 3VB6A 4OS2A 1GHBF 2B8OH 1EOJA 1O2GH 1GCDA 2PUXB 4IC5A 5ESTE 1G32B 1O2UA 2VVUA 4NFFA 1MQ5A 1C1VH 3SJ9A 1GBIA 4NA7A 4Y11E 1C2FA 3RXJA 3U69H 3RDZA 3A87A 1BHXB 1H1BA 2ODYB 2VVVA 1AQ7A 1WOFA 3MU0A 2V6NA 3V12A 1GJ8B 1VITF 1DXWA 1F0RA 1OP8A 3RXQA 3ZVBA 1EPTB 2UUYA 4Q80A 2ZQ1A 4DOQA 1T32A 1BTUA 3M37A 1K1PA 1Z7KA 3HK6B 2HRVA 2BLVA 3P17H 3ZZ9A 3SI3H 5C2ZA 4FXGH 3QDZB 1TGNA 1GBKA 2JH0D 2QA9E 1C5VA 3JZ1B 1KDQB 2YNBA 5DKMA 1L1JA 8LPRA 5TCAA 3U8RH 1FY5A 1BTZA 1NESE 3RU4E 3NXPA 5FBEA 2QGRA 4ABIA 4WWYA 1W0ZU 1EATA 2A45B 3H7OA 1GJ9B 1KTSB 2P8OB 5F03A 4ZXYH 3UQVA 3O8BA 2A5AA 3BTQE 3HKIB 2BDAA 1O37A 1TBZH 2THFB 2DE9A 1O2JA 7KMEH 3UIRA 1FY3A 2QF0A 1IHSH 3GY5A 4CR9A 2BTCE 3BTTE 4IW4E 1GDQA 2BX3A 1UTJA 3EA8A 1UMAH 4E05H 1W2KH 1T8MA 2FI5E 1THPB 2W7UA 5CHAB 4O9VA 1P8VC 1GBEA 1XKBC 1EXFA 4H42U 5HYOA 1NU9A 3LGVA 1P9UA 1P9SA 1FONA 1OWJA 1TAWA 2C8XB 2GVFA 3GISB 4I8HA 4X1SU 2VJ1A 3PTBA 1O3LA 1X7AC 2BVRH 1OP0A 2ZF0H 1FMGA 4F4OC 1O2SA 1QFKH 3MO6A 2FOEA 1QB1A 3BV9B 2B9LA 4ZAEA 5JB8S 1D3DB 2F9BH 2FXRA 3I77A 1O5BB 3MI4A 2GCHG 4YOIA 2ODPA 1ZR0A 1EZQA 2SGAA 3FP6E 3VB4A 3AW0A 4RKJB 4ABFA 3TJOA 3LONA 1VCWA 3ZVAA 2D8WA 1Z6EA 3STIA 1P10A 2EI6A 3KGPA 4JCNA 3T2NA 1RD3B 3W94A 1GMHG 3LGYA 3K2UA 2F83A 1BCUH 1W3CA 1ZMJA 2P3TB 2ZIQH 1OX1A 4JMYA 4JK6A 4GVUA 4CRAA 1HLTH 3QGNB 4CRFA 2GV7A 3TNSA 1EPTC 1MD8A 2OUAA 2HNTF 1MCVA 2F3CE 2BHGA 1C2EA 3IG6B 3M3SA 3ZYEA 1WYKA 2Z9JA 3ESTA 1SGYE 1MBQA 1C1SA 5AF9H 5IDKA 3SUFA 2PKSB 9ESTA 4KP0A 4FUCA 1DE7H 1XKAC 3QX5H 1QJ7B 2ZZUH 1TBRH 2BD5A 2VGCC 2FODA 1MUEB 4KGAA 3UTUH 4ABGA 1XM1A 5TJXA 2VU8E 1MKWH 1A3BH 2AIQA 8GCHF 4AOQA 1RS0A 2F9NA 1RIWC 5J4QA 1NFWA 3BTKE 3BTHE 7LPRA 1GJ5H 2GV6A 1JRSA 1GBJA 4THNH 2OLGA 4Y76A 2O8WA 3PLBA 1QURH 3GY7A 1V3XA 1O5AB 2H5DA 3URDA 1GMDG 4NIVA 1N6YA 1TMUH 2G81E 1LKAA 6CHAB 1GGDC 1SLXB 3MH5A 1WCZA 4ZH8A 1MCTA 2STBE 3V3MA 1BRBE 2C8ZB 4O3TA 3ZZDA 5A0AE 3RM2H 2PW8H 3SNDA 3M7QA 2F9OA 3F9FA 1O38A 1A1RA 4U01A 5J4SA 3F1SB 1CVWH 4I8KA 2OC8A 5CHAC 2K1QA 4WXIA 3UOUA 2FYRA 2PGBB 2ZGHA 3SNBA 1O3AA 1SOTA 4DT7B 4NCYA 1YKTA 4YZUA 5EXNA 1DICA 3UREA 4BOHA 2PR3A 5E2OA 1ETTH 1BBRH 3LH3A 1UK3A 3G01A 2BD2A 2TIOA 4X8SH 2ZTXA 3I29A 1OWIA 2Y82A 4MQAA 3VB3A 4B71A 4FUFA 1YPMH 2XC4A 3LC3A 2JH6D 4XBCA 1ZPBA 3SJKA 2O8LA 3M7UA 2ZFFH 4D8NA 1GHBG 5L2ZH 1EX3A 1QB6A 4MDSA 5JBAS 2BY8X 1W12U 1YPKH 4LOYH 3KL6A 4NWLA 1TGBA 2XBVA 2BYAX 2ZKSA 4UDWH 1SGRE 1VITG 5L6NH 1AWHB 4XBBA 1G37A 4ABAA 1W8BH 1O2ZA 2QY0B 1P2MA 4WY3A 3BIVH 1TPSA 1MZDA 1LTOA 3RXVA 3Q00A 3SHAH 1P06A 1O2MA 1P09A 2NU4E 3BEIB 2Y5GA 3S9AA 2A2QH 3Q3KA 5FPSA 5FPYA 2R0KA 3QZQA 3RMMH 3M5OA 2ZWLH 1CHOF 3RXIA 8ESTE 2SFAA 1G3EA 3ZZBA 2FOCA 2FOHA 2ZCHP 2ANWA 2AS9A 4YLUA 4BAOB 1SGTA 2BD3A 2G4TA 3HATH 4JYUH 1SGIB 3IWMA 2WUBA 4UD9H 1MH0A 1GCTC 1QRXA 1BA8B 1EKBB 2YOLA 4FUBA 4UFGH 3LGUA 6LPRA 2HPQH 5A8YA 3MHWU 4I33A 4AFSA 1W7XH 2OINA 1HIAA 1BIOA 2IN2A 3AW1A 1XUGA 3OSYA 3SGBE 3TPIZ 1BTXA 1PPZA 2WYJA 2W26A 2BD8A 3BTEE 1NM6A 4ABDA 2ZFQH 1CT4E 2CGAA 3E0PB 3E3TA 3RC5A 1W7GH 4I8LA 1NS3A 3KEEA 1GG6B 4FUDA 1Y3UA 2SGEE 4FU9A 2OP9A 1XXDA 4KTUA 2CHAC 2PWXA 1OYTH 4Y0YE 2ZA5A 3ZV9A 4XDEA 4DIHH 4CRGA 1VCQA 5L30H 1EPTA 3UQOA 1GDUA