5HIYA

Crystal structure of pedv nsp9 mutant-c59a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
95
Chain Sequence
b'GKLKQRSIKAEGDGIVGEGKALYNNEGGRTFMYAFISDKPDLRVVKWEANTIELEPPRKFLVDSPNGAQIKYLYFVRNLNTLRRGAVLGYIGATV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 9
publication title Structure of PEDV NSP9 MUTANT C59A
rcsb
source organism Porcine epidemic diarrhea virus cv777
molecule tags Rna binding protein
total genus 17
structure length 95
sequence length 99
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5hiyA01
1QZ8A 2J98B 1UW7A 3EE7A 2J97A 5HIZA 2J98A 5HIYA 5C94A
chains in the Genus database with same CATH superfamily
1GI2A 1W7GH 2XRCA 1QJ6B 1ARBA 2FYQA 3O8BA 1ETRH 3SQHE 2R2WU 3L33A 2RA0A 1OS8A 2JJ2D 4U32A 1KXAA 3BTQE 3RXHA 4OM9A 1TONA 3ZZ7A 1Z1JA 1S0QA 2F9VA 4F4OC 6GCHG 4IC5A 1H8DH 3FP6E 1P02A 3UAIC 4BTTB 4KP0A 1ANDA 1D3DB 4Q63A 8ESTE 4ISIH 2D8WA 1LO6A 2FX4A 2J92A 2A7HA 3EE7A 4BNRA 5JB9S 1TNKA 1LPGB 1BB0B 3KQ5A 1OOKB 1CGHA 1AMHA 3O8CA 2J9NA 4I8HA 1DLEA 1K9OE 5DP9A 1GDQA 3A83A 4JK6A 4ZROA 1P03A 1O2JA 3AAVA 2GCHF 4K1EA 2V7QD 1TX7A 1NRQH 1JRSA 4CH8B 1MTVA 2ASUB 1AFEH 1LVYA 3UOPA 4E05H 4DIHH 4PROA 2C3SA 1H9IE 4DURA 3B23B 3T28A 4MG3A 1A3BH 5E0JA 4IMZA 1ZPZA 3RU4D 1MKXH 4K5ZA 2KX4A 3RM0H 2FLBH 4TY6A 4TSFD 3F68H 1S84A 3FP8E 1SFIA 3F9EA 1C5SA 1VR1H 2CHAC 2NU1E 4B75A 3S7HB 2ZHQH 4INLA 1GMDF 1HAVB 1TPOA 3ATKA 2WPJS 3JZ1B 3LOXA 1LHEH 3M5LA 3MTYA 3OTJE 1INCA 5F53A 3GY4A 1GHWH 4D9QA 4D9RA 1MU6B 2IJOB 2R0LA 4BXSA 2XBWA 3FO8D 2AERH 4IN2A 1GHBF 3TH3H 1W11U 1AO5A 3GOVB 6ESTA 4BANB 1Q3XA 3A7WA 3UY9A 1O38A 1IQEA 2OP9A 1AZZA 1LPZB 2H2ZA 2ZIQH 2ZFRH 3U8TH 3H7OA 1FX0B 3LGIA 2PUXB 2ZECA 1G2LA 5DSFA 1VITF 4AB9A 5I25A 1Z6EA 2GMTB 1G3DA 2R3YA 4LZ1H 1YYY1 1O2GH 3F9FA 1DY8A 1OWKA 1P2QA 2FDAA 1UK3A 4RI0A 2VH0A 3SNAA 1NFUA 1GI0A 2GCTC 3EGKH 4BTUB 1F0RA 2KM0A 1GBKA 4B1TA 1GVKB 3BIUH 1ARCA 2OK5A 1C5ZB 1AB9B 1EZXC 3VXEH 8LPRA 1YBWA 4UEHH 4LZ4B 1V2VT 2ZNKH 3SHAH 3TH2H 2ZDNA 1ZTLA 4DJZB 1AKSB 1E38B 2SGEE 2VWLA 1V2LT 3TK6A 3EE0B 3GCHC 2F9BH 1BOQA 4GSOA 1FY3A 1YWUA 2DE8A 1GBTA 1SHYA 4HFPB 4OS1A 1DFPA 1O2YA 3GY5A 1GJ8B 1A2CH 1Y5AT 1AVGH 3QUMP 3M7UA 3ESTA 1DXWA 2KR7A 3S9BA 5IK2D 1O3KA 3BTKE 5EU8A 1GJ4H 2WUCA 4IN1A 5EQSA 1FDPA 2QY0B 1KLTA 2SGQE 1VCWA 2F9UA 2OXSA 2VNTA 1BRCE 1C5YB 3KEEA 1GCDA 2BVXH 1ZPCA 3GDUA 4THNH 1S81A 1QGFA 1TALA 1ZRBA 3QN7A 1O2ZA 4X1QU 2BQ7B 7GCHF 3A7XA 2AYWA 1HAVA 5KGOA 4CRDA 1TMUH 1NRNH 1Y8TA 9LPRA 3BIVH 4RKJB 1V2PT 3A8BA 1RRKA 2AMDA 5JBTA 2QCYA 4KTSA 1AUTC 1L4ZA 1WDIA 1ELTA 1XVMA 2YOLA 4UONA 3SOSA 2BX4A 4A1XA 5L2YH 5ABWA 2VIOA 1ABIH 1SGTA 4AX9H 1VCPA 1EUFA 1E1RD 4MPUA 1COWD 3P8GA 4K60A 1OWHA 3F2HA 3HK6B 4NIWA 1EP6A 1C1SA 2BQWB 1YPHE 1GJ6A 3SNDA 3RXLA 4OS7A 3I77A 1DY9A 2G81E 1ESAA 1LKAA 1WQSA 2STAE 2ZFFH 2BXTH 3PLKA 4A7IB 1NT1A 2HALA 5DP6A 1YGCH 5FCKA 2ZZUH 3D49H 2O8TA 2XWAA 3ZVEA 1FPHH 1PPHE 1BBRH 3Q00A 2EEKA 3TVJB 3SJIA 4YT7H 2PTNA 2FXRA 4Q80A 1W0ZU 1DT2A 1AKSA 5TCCA 4GVUA 4RKOB 4SGAE 1SG8B 1LHDH 1SFQB 5KEDA 2VWMA 1O3EA 3WY8A 1KTSB 2C90B 1Z1IA 3RXOA 1SLXB 1HYLA 1EAXA 1FXYA 3AW0A 3T5FH 1ABJH 2ULLA 2CHAB 3DUXH 1CU1A 2WPLS 1H8HD 1DXPA 1O2NA 2TBSA 1MQ5A 1DOJA 1C9TA 4WH8A 4IBLH 2SNVA 3E3TA 3NK8A 1NC6A 2WPKS 3AK5A 4UFEH 2GJGA 1BDAA 2ZU2A 2AIPA 2LP6A 1QB1A 1O34A 2Z3EA 1C4U2 3RMMH 3M37A 1NO9H 1AIXH 3NRLA 2OTVA 4ASHA 1LKBA 1LTOA 2SGFE 2IN2A 3FFGA 2FOFA 3SV8A 2HLDD 4DCDA 3TNSA 1SGIB 4ZCNA 4X6MA 4ZH8A 3PMHB 2Y81A 3ZZCA 3SV6A 2XC5A 3I29A 4NIVA 2GZ7A 4ABEA 2VU8E 2GCTB 1S83A 1P2OA 4ACBA 1C5OH 2A31A 1G37A 1O2QA 1RTLA 3MH7A 4BAMB 4FOUC 2PFEA 3KYGA 3U69H 2O8LA 1DLKB 2FX6A 3A87A 1SGNE 3UUZA 3VB5A 3CS0A 1O33A 5FHTA 3SUEA 1SLUB 1GJAB 2KCPA 3GCHB 3PROA 4FU8A 1W7XH 4I7YH 2CF9H 1IQJA 3MNSA 1XUHA 2PGBB 1DX5M 2VVVA 5A8XA 3OAAD 1WV7H 2ZQ1A 1BBRK 4TY7A 1C5LH 3OYPA 1NRSH 1QHRB 1K1LA 1SGCA 1S6HA 2FOHA 2GCHG 1GHZA 3ZV9A 2RG3A 4AGJA 1GHVH 3SJOA 2EY4C 3MH6A 1C5XB 1NPMA 4E06H 3MQKC 1ZSJA 4ZUHA 3P17H 1KSNA 3BTHE 4HZHA 1GBDA 4ISLA 1HXEH 1A0HB 1FUJA 1MTUA 1GVZA 1ZMLA 1RTKA 2P59A 1TA2A 2UWOA 3RLYH 5A2MH 1CT2E 3P70B 4MNYA 1K0HA 1YPJH 2QF4A 4NFEA 4AC9A 3M5OA 1GMDG 4MPXA 5BPEA 2ZI2H 2F91A 2ZTZA 1A46H 1K1MA 3HK3B 3LGYA 2XXLA 2ZDLA 5B6LA 1TMTH 4F49A 4TPYA 2ZU5A 4NG9H 5EIYA 1GHBG 2J98B 3GY2A 3OE7D 3T27A 1TGTA 1HJAC 1K21H 1XUJA 2W6ID 3GY3A 1HRTH 1O3IA 1TGSZ 2O9QA 1AZ8A 1O35A 3DSOA 3PTBA 2YNAA 1MZAA 3SGBE 4R8TB 1T31A 3A8AA 1VITG 2OD3B 2XTTB 3OEED 3UFAA 3FN8A 3TJOA 1FAKH 1O5BB 2UUJB 4K69A 1QB9A 1TB6H 3A86A 5TCAA 5DP3A 1DDJA 2A2XH 3FAOA 3SW2B 3RXRA 3MFJA 2TGTA 2GX4A 1ETTH 1NFWA 2W6JD 3CNRA 1PQ8A 2BZ6H 5L30H 1EB1H 3OY6U 5JPMH 3W95A 1TNHA 2XNIA 2AH4X 2UUYA 3UB0A 3QLPH 5DP4A 2H6MA 5H4IB 2FMJA 1OXGA 7ESTE 2FESH 1AI8H 1OPHB 1RJXB 1GI7B 2K0QA 4WY3A 1NBME 2RCEA 1MTSA 4A1VA 1ZR0A 1P05A 1TYNA 2GZ8A 3VXFH 3D65E 3IITA 1BITA 5EXNA 3SV7A 5JBBS 1J15A 1Z6JH 1U6QA 3F2FA 2FOGA 4XSKU 4MQAA 1GBFA 1BTUA 1O5EH 5FPTA 2ZCKP 1C2GA 2ZQ2A 1TBQH 4U01A 1NRPH 1NZQH 2ZFPH 2BXUH 1FY4A 1QB6A 4JYTA 1J9CH 1O2KA 1O39A 2Z9LA 1EOJA 1MU8B 7GCHG 2BD3A 1P3EA 1SGRE 1T4UH 3BG4C 2HLCA 1G3BA 3URDA 1FJSA 3OX7U 3LH3A 4GHQA 4J1YA 1VCQA 4J2YB 3SN8A 2TGAA 3LC5A 3MH4A 2J98A 2B5TB 4ZXXH 3ZVFA 1MH0A 3TJUA 1QRXA 1NFYA 3M36A 2P16A 3HATH 1PFXC 3GYMA 1HAXB 1Z7KA 3ODFA 4I8LA 3A85A 3BTTE 1ELEE 1O3CA 2GT7A 2D2DA 2R2MB 1JBUH 3NZIA 3LGTA 1C2HA 2F9NA 1J17T 2JH6D 3RXJA 3MI4A 1C2LA 3GYLB 2Y7XA 1M9UA 1MABB 1Y59T 3U98H 2A5KA 3V12A 1XKBC 3M5MA 3SU0A 2KCYA 2P3UB 1QQUA 2IJD1 5J4SA 5EJ1A 2ZEBA 4BXWA 3N7EA 2A1DB 3UQVA 4CRGA 4K1TA 1AHTH 2OQ5A 1GBIA 5EJZA 1LHFH 5GCHF 5GDSH 2F43B 1O3DA 3LKWA 3OFND 5FCRA 3TU7H 1P3CA 1C4Y2 2QF0A 4I32A 4A1TA 1WU1A 3SUGA 3U1JB 4K8BA 1CHGA 2ZHFH 2ZU1A 3GICB 4NIXA 1O3FA 1SOTA 2C8ZB 4Y79A 1PPFE 1HNEE 2KFWA 2P3TB 2ZCLP 2W26A 1ZHMA 2RDEA 1EZUC 1KLIH 3PWCA 4M9FA 3MO6A 4ZXYH 1QJ1B 3DFJA 1PPBH 3CS7A 1UCYH 4MDSA 3SJ9A 1O2LA 3M3VA 3TH4H 1O0DH 2L74A 3TGIE 4NSVA 1P04A 1B0EA 1GCTC 1C4V2 1B7XB 1HJAB 2C8YB 1K1OA 3K2UA 2M5TA 3LPRA 4NIYA 1HBTH 1T8NA 2GV6A 1OYTH 2O8WA 4CH2B 2FS9A 2VGCC 5C67A 4XDEA 1C5TA 3H7TA 1O2IA 1Z8IB 2ANKH 3AW1A 5LPRA 1S0RA 3TJVA 2WPDD 1ZRKA 1K1IA 1HPGA 4ISNA 2EI8A 2VBCA 4X8VH 2R0KA 1Y3UA 3Q3KA 2BOKA 4Y7BA 7LPRA 2ZFTA 2Y5GA 4K2YA 1FQ3A 1O3AA 2BD5A 1XVOA 1IQLA 5C94A 4OGXA 2ANWA 4YLQH 2FZZA 2VIDA 4CBOA 3SU6A 1WQVH 2CGAA 4AOQA 4ZMAH 3IWMA 3NWUA 1QA7A 1SSXA 3EYDA 3RXPA 1QL7A 1G36A 3SU2A 3QX5H 4O9VA 2G4UA 4X6OA 4KELA 1UK2A 4ZKOU 4IW4E 2VB0A 3S69A 4AG2A 4B6EA 5DP7A 1G3CA 1C1PA 3PMAB 4WMEA 1T7CA 1YPMH 2F3CE 3K6ZA 4AFUA 1Q2WA 3DSPA 3EDXB 1EX3A 1EB2A 1YPGH 1YPKH 3TIUA 1ETSH 2ZDVH 3W1EA 3RXDA 1GBEA 2QN5T 4P02A 1W2KH 4E7RG 2A7JA 2OC8A 2KAIB 3STJA 1MBMA 2FOAA 3LGWA 2ESTE 3CENA 3E16B 2FM2A 1GHXH 2XC0A 1ZMNA 5F03A 2BHGA 4Y0ZE 1C2IA 1DM4B 1GJBB 1P06A 3BG4B 3QGJA 3WWFA 1Z8GA 1W14U 2G51A 3A82A 4NWLA 2ZDAH 1Q31A 3SV9A 1NN6A 3ZZ6A 5C20A 3ZVGA 2BMGB 1A0LA 1UCYK 2CN0H 1A5GH 1MUEB 5BRRE 1W13U 1TQ0B 3OY5U 4Z1MD 1BTYA 2ALPA 3U8RH 2ZU4A 1FIWA 1A1RA 4OGYA 3RC6A 1V2WT 1P57B 4IMQA 2SGAA 3LONA 1V2RT 3QZRA 1OP2A 4IGDA 2O8MA 2A0QB 3KYFA 3GCTF 1TX6A 3A80A 1PJPA 1GI6A 3OU0A 1FY8E 5F6MA 4AGKA 1JOUB 2TGDA 4TPIZ 4Y11E 2ZP0H 2HGTH 1H8IH 4Y8ZA 3U28C 3RDZA 2V0BA 5GPIB 3GDSA 2G8TA 1TPSA 1ELBA 3MNXA 1V2ST 4B2BA 3RXMA 4I8GA 5FX6A 5E2OA 2BDAA 4GUXA 4NZQA 3MU4A 2D26C 2J34A 2QAAA 1HCGA 3ATMA 1JIRA 5AHGH 1A3EH 4NA8A 4ASUD 1MCVA 3BF6H 3M3SA 1W0JD 3GY8A 5EXMA 4X2YA 2F9OA 1G2MA 2OBOA 4DG4A 2ZFSA 1Y3YA 2ZF0H 4ISOA 4ABFA 4CRBA 1ZHPA 2NU2E 4YXWD 3RMLH 1FONA 1ZGVA 3UPEA 1QNJA 2FODA 1H1BA 1L4DA 2QF5A 3UWJH 1V2QT 1P2KA 3DFLA 1L1JA 1P8VC 3SJ8A 5CDFE 3RM2H 2G52A 2KAIA 3DHKH 3SZNA 3VB3A 1SOZA 4JK5A 3N7OA 1NBMD 1SLWB 1D9IA 1GCTB 1TPPA 4ACAA 2ODPA 3LIWA 1ZYOA 4MTBA 2R9PA 2CK3D 2PWXA 8GCHF 1E1QD 1L2EA 1E0FD 1TOCB 2VGCB 1AE5A 1ZGIA 1VJAU 2EI7A 2HRVA 1CA8B 1FY1A 3HGPA 3SI3H 2J4IA 1FI8A 3SHCH 1F0TA 4INKA 4U2WA 1N8OC 1GBMA 3T29A 2ODQA 1DVAH 4XBDA 1O2OA 3M5NA 1QRZA 1DPOA 2C8WB 4SGBE 1AVWA 4HI3A 3A8CA 2GTBA 1O36A 2ZA5A 2A5IA 1IQMA 1D6WA 4KGAA 5T1VA 1K1JA 1FZZA 1T32A 4CRFA 1MZDA 2XWBI 4AFSA 2WPIS 1OP8A 2AGGX 4XBBA 3M3TA 2BDIA 1BMLA 2WPMS 5F8ZA 1G3EA 1BMAA 1TRYA 2PR3A 3PO1C 1JMOH 1NROH 2I6QA 1AWHB 2NU4E 1P2MA 3BTFE 3FANA 3LC3A 1EJMA 1YKTA 1C5MD 2BYAX 2DE9A 2OUAA 3PV4A 2Q6GA 4ZKNU 1A7SA 2NU3E 5LGOA 2TRMA 2WV5A 2WZQA 2B8OH 2I6SA 1GPZA 3BTME 1GBLA 1ELCA 3RXAA 1UVOA 1P09A 3RMNH 3Q77A 1CBWC 1Z8JB 4JZIA 5F8TA 1FPCH 4FUDA 1BTWA 2BDBA 2Z9KA 2Z94A 4VGCC 3RLWH 1V3XA 1F5LA 1BQYA 2C8XB 5GCHG 4U30A 4FUEA 1EZQA 4CRCA 4B6FA 1A61H 3TPIZ 1O2XA 1DWCH 2AGEX 5C17A 4FUGA 2XYAA 1UTJA 2VIWA 1TGBA 3KHVA 1W0KD 1A0JA 5FBEA 1D3TB 3LJOA 4Q2KA 1YCPH 2XC4A 1AU8A 3PV5A 5JB8S 1NFXA 4MPWA 4XBCA 3A7TA 2V35A 2A5AA 4JZFH 3SI4H 3C27B 1D3QB 2PV9B 1UO6A 3RXSA 3PB1E 2WV4A 1X7AC 5HM2A 1ELAA 1A5IA 2ZGCA 1GJDB 4DT7B 1WOFA 1GBAA 2WHXA 2BY9X 3LH1A 2FS8A 1GDNA 2VVCA 1C1NA 1P9SA 5FPYA 4D7GA 1NY22 2ZG0H 2ILNA 1D6RA 2OBQA 1GBCA 3NXPA 3T25A 2J38A 2VIPA 3UQOA 5GIBA 5K0HA 1WBGB 2HVYB 2M2AA 5EPYA 1SKYE 1GI9B 1RIWC 3VG8A 1HAYB 1TABE 4FUFA 2Y80A 1QIXB 2P94A 5AF9H 1BTXA 2ALVA 1K1NA 1QTFA 2Z6BD 1KY9A 1O2UA 1GG6C 2V3MA 3SZEA 3L6PA 1FAXA 1TLDA 3ATLA 2HWLB 1TNJA 1YPLH 1YC0A 3GY7A 3DCLA 2QE7D 1BT7A 1UTQA 3P8NA 1W12U 1WAYB 3MU8A 1N6YA 3B8JA 1IOEA 2GKVE 1O5FH 2B7DH 4X6PA 3E6PH 1EPTC 4FUIA 1UVPA 2RA3A 3S7KB 1SB1H 1O2HA 2CV3A 4BAKB 1HAGE 5C0TA 2BY8X 1BRAA 1IQIA 5A8YA 3KL6A 1TPAE 2OC7A 5T3HA 1YM0A 3T26A 5HKKD 8KME2 3A81A 1GJ7B 3ZVCA 4B74A 3M7QA 5JDUB 1ZOMA 2XCFA 4YOIA 1TAWA 2J97A 3EAJA 5C3NA 2Z9IA 2BB4A 4K1SA 1ESTA 1GWAA 1H4WA 1TNIA 3T62A 1O30A 3BSQA 1AUJA 1GBHA 1AY6H 2PHBA 2BD7A 1GMCF 4ZHLU 5JBAS 2V3OH 1H9LB 5HIZA 2NU0E 5FPSA 2H9HA 1N8OB 1YCPK 2EI6A 2FPZA 5HM9A 3BV9B 1T4VH 3RU4E 2QF3A 4DOQA 1CGIE 1ZMJA 1C2EA 3BN9A 3PTNA 4F55A 1TNLA 1GI4A 1XX9A 3SNEA 3A7YA 3ZZ8A 1BRUP 1W8BH 1KYNA 1YLCA 1CQQA 5EW2H 1ANCA 1S82A 1LVMA 3V13A 1YLDA 3ZV8A 1HJ9A 1YF4A 1IHTH 2W5EA 1ZTJA 2W3IA 3GCTG 3EA8A 2IPHA 3PO1B 1C5NH 3E91A 2OC0A 3SGQE 2WYJA 5A8ZA 2QYIA 4Y6DA 1GI3A 4BTIB 4M7GA 4NA9H 3GCNA 3MYWA 3QK1A 2A4GA 3SU5A 2FOCA 1BTZA 2ANYA 1VKYA 1CBWB 3VB4A 2XBYA 2G4TA 1DWEH 3LDXH 4NCYA 4VGCB 3O8DA 3GCOA 3LU9B 2AIQA 1GJCB 1CVWH 1VITH 1HAZB 2FP7B 2FWWA 2XBXA 3ZVDA 1YLNA 1QRWA 4UE7H 2AMPA 4XFQA 2BVRH 2FOEA 2JH5D 4K3JA 4ABBA 1OWIA 2ZKSA 3KNXA 1BMMH 1BZXE 1BTPA 3BEIB 3D23A 2K1QA 1ZHRA 5C5NA 2IPQX 1P2JA 2PSYA 1DITH 1EXFA 1O3MA 1AD8H 5IDKA 1RXPA 1NRRH 3JZ2B 2ZGXH 2J2UA 4TT3D 1MMJN 1TWXB 1O2TA 2PTCE 2THFB 2YNBA 1P12E 2Y5HA 1PQ5A 5DPAA 3URCA 4DGJA 5HGGA 3BTDE 1A5HA 3QTOH 1T8MA 1G9IE 4CREA 2EQNA 1HJ8A 1QBNA 1JWTA 2GDEH 3SJKA 8GCHG 4FUBA 5A0CA 5I46H 1OX1A 1PPCE 3RXFA 1DE7H 3DT0H 2A4OA 3QGNB 4B73A 1GHYH 1SQTA 1B0FA 4JZEH 4GAWA 3O8RA 1DANH 2HNTF 1ESBA 1RIWB 3PMBB 4Y0YE 1UK4A 1TOMH 2J5UA 1CGJE 2OLGA 5LH8A 5FAHA 3P8OA 1EJAA 3D62A 4MPVA 5C0UA 4UD9H 1GBBA 1A4WH 1GG6B 6LPRA 2TGPZ 1O3GA 1THRH 2CJIA 2PSXA 3V3MA 2BDYA 3ITIA 3RXKA 1BHXB 1MQ6A 4X8SH 2VJ1A 3RXVA 3KIDU 3U9AH 3V0XA 2G00A 4DY7B 1O3OA 1N6XA 2FOBA 1OWEA 4HG6A 1AGJA 1IQGA 1ELFA 4B71A 1EPTB 3FOAA 1QZ8A 3RC4A 3EA7A 1O5AB 3MNCA 4X2XA 5CHAC 5EJLA 2JDID 4Y8YA 1DUAA 5AFYH 1ID5H 1P10A 1O2PA 2V6NA 3P95A 1LHGH 1AFQC 1MCTA 2P93A 3K9XB 1O2WA 3A88A 4GHTA 4B2AA 3DSGA 1SC8U 2HVXA 3UR9A 5EPNA 1S5SA 1BJVA 3Q3YA 1VGCC 1Y5BT 2Q6DA 1UTKA 3MH5A 1FMGA 1NESE 1UTOA 4Q7ZA 1SQOA 2SFAA 4ABJA 4D8NA 4AFZA 1BMFD 2PW8H 4ZKRU 5TJXA 1YPHC 1V2MT 3TGJE 3KQEA 5EQRA 5A0AE 2QIQA 1QR3E 2AFQB 4X1NU 1EJNA 3RUOA 3QTVH 1XUFA 1BUIA 4NA7A 1C2MA 1QY6A 4BOHA 4YOJA 3W94A 3BEUA 5HMAA 4Q7YA 9ESTA 4CHAC 2P8OC 3V7TA 3ZVAA 3VEQB 2ZPQA 5GXPA 2OINA 2ZC9H 3E1XB 1K2I1 1GGDC 1MKWH 1VJ9U 1UTMA 1ZJDA 1AE8H 1ZTKA 2UWPA 1JRTA 1V2KT 1SBWA 4Y8XA 3M35A 2BY6X 2ODYB 3KQDA 5EOKA 2STBE 3UR6A 2PKSC 2SGDE 1SQAA 3VGCC 4BAQB 1O37A 3BTWE 3PRDA 1MTWA 1TRMA 2ZHWH 1WXRA 4KKDA 1O3HA 4WVPE 3ZZAA 3F6UH 4ABIA 3PWBA 4MNWA 1Z8RA 3KGPA 4ZKSU 1NU9A 2HPPH 2AHME 2B0FA 2J95A 3UOUA 4HGCA 3F1SB 3KN2A 1CA0C 3E8LA 3BTEE 1C5WB 4WXVA 1GMHF 2H9TH 4AFQA 3TGKE 1GHAF 2ZHEH 3FZZA 3P8FA 1GJ5H 1PPEE 3Q76A 1NU7B 1BA8B 1EPTA 1THSH 3AVZA 3RU4T 2UWLA 5JYIA 1HV7A 3ATIA 1P01A 3MMGA 3ZYEA 2GVFA 3OSYA 4MNVA 1ANEA 2AGIX 2FI5E 1E36B 4JCNA 5AVDA 1UW7A 1QL8A 1C1QA 4YZUA 2F9PA 2OC1A 5EXLA 1C5QA 1OWDA 1O2MA 3KF2A 3NUMA 4A5TS 1G32B 4GCHF 4RN6A 1P9UA 3BTGE 2BLVA 2BX3A 4QT8C 1V2NT 3GS9A 2JJ1D 1NTPA 2LNCA 4YT6H 1ZSLA 4AYVB 4WWYA 1TE0A 2RDLA 4D7FA 2IOTA 4CR9A 1TIOA 1O2VA 4RT0A 1C1MA 1XUGA 1S6FA 1SR5C 1PPZA 2UUFB 1V2JT 2VH6A 3FKSD 3KQCA 1CT0E 2EC9H 2PUQH 4X1SU 2O8UA 3MO9A 2BD9A 1MBQA 2ZCHP 2HPQH 1GMCG 1TGNA 4K8YA 1O2SA 1C5UA 1OSSA 3RXUA 4UFDH 2FTMA 1C2DA 2HNTE 5FL7D 1H9HE 2BLQA 1UTNA 2BTCE 2VIVA 5EG4A 1IQNA 3CP7A 4UFGH 3PLPA 1HB0B 1MKWK 3AASA 5CE1A 2KCOA 1TA6A 5AFZH 1DUEA 1KXBA 2WUBA 4WMDA 3LGUA 1SGFG 2Z9GA 4A6LA 4KTUA 1O3LA 1Y5UT 3H09A 4I31A 2GDDA 1EP5A 1O3BA 3BEFB 2P3FH 1FIZA 3HGNA 2FI3E 2AEIH 4O03A 3H5CB 5JBCS 1JIMA 5CHAB 1CT4E 1SGEE 1EASA 4ESTE 1BJUA 1KXEA 2QGRA 1KXFA 1JXPA 2GD4B 1AFQB 1NS3A 2ZTXA 2BM2A 3SU1A 4FXGH 3K65B 1HLTH 3ELAH 2CMYA 1VGCB 2BD8A 4XRNA 1BBRE 2YMSD 4BAHB 1QQ4A 2WYGA 3MOCA 3B9FH 1QA0A 3I78A 2ZGHA 1BIOA 4I33A 3TK9A 1PYTD 4Y7AA 3L3TA 2OQUA 3U8OH 1PQ7A 1GDUA 1Y3VA 4TYDA 3ATWA 3MHWU 4NGAH 4JMYA 2FO9A 4FU7A 2QC2A 2YMSC 2H9EH 1F5RA 2Q1JA 2ZO3H 5ESTE 4DVAU 2Y7ZA 5HXFA 1CHOF 1UTPA 3SGAE 1PYTC 4H4FA 2QXHA 5T6GA 4O97A 4CHAB 1RS0A 2P8OB 2WPHS 3F3BA 5A09A 1C1RA 1C1WH 4H42U 1F5KU 3GISB 4WMFA 2WSSD 1C5VA 4YLUA 1MD8A 5A0BA 1HAIH 3ZYDA 2A45B 3FP7E 1D3PB 1GGDB 1TFXA 2FYRA 1EATA 3SQEE 4UFFH 3SNCA 1ZSKA 4P00A 4AYYB 2WINI 5E0GA 1EOLA 4JYVH 5FXLA 1TX8A 2JH0D 2KZ4A 4O3TA 1SGQE 2W3KA 1XKAC 1K28D 3RXCA 1LMWB 4AZ2B 2A32A 2PKSB 1QBVH 4WXIA 3VGCB 2D1JA 1CSOE 3OEHD 4I8KA 2GP9B 2BDGA 2LELA 2BLOA 2LPRA 2BD2A 5G4BA 1OYQA 2DUCA 2PLXA 1SLVB 3BG8A 1K1PA 1V2OT 1SHHB 3NKKA 1EAWA 1OWJA 1YCPM 3MO3A 2K8IA 1CA0B 1UHBB 1GVLA 1T8LA 1QL9A 4H6TA 5ETXA 3IG6B 1V2TT 1GI1A 1MKXK 3RC5A 4FETA 2QXJA 1C2KA 3QWCH 5F8XA 2BVSH 3F0OA 3SNBA 3QO6A 4D76A 1XUKA 3FVFB 1V2UT 3DA9B 3NPSA 4CRAA 5C1YA 1UJ1A 2GZ9A 4JYUH 1SVPA 2SNWA 2ZGJA 3C1KA 4X0WU 1BTHH 1K22H 3SORA 1AVXA 3QZQA 2QA9E 1PQAA 4WF8A 4NFFA 2A4RA 4RSPA 4YESB 4ABAA 3ZZ3A 3RP2A 1E34B 3G01A 1XM1A 1MAYA 5T6DA 1RGQA 4NSYA 4JZDH 1IAUA 1IHSH 4AN7A 3ZVBA 1QJ7B 1Z71A 2OCVB 1FV9A 1YP9A 2ZPRA 1ZZZA 5FX5A 3R0FA 1HAPH 2BDHA 1F2SE 1O32A 2ZPSA 1ZPBA 2HOBA 1C5RA 2ZDMA 4Z0KA 3RXBA 1UVTH 2W7SA 1WCZA 4ABGA 1H8ED 2G5NA 2J94A 4X2WA 1UVSH 3FZDA 4RT1A 2VIQA 3PRBA 3ODDA 1S85A 5PTPA 3RMOH 4A92A 1MAXA 3LGVA 1KTTB 3E90B 4O3UA 1C2FA 1KMHB 3A84A 2UUKB 3P6ZB 2JETC 3OTPA 4DW2U 5L2ZH 1NM6A 3MWIU 1RFNA 1XMNB 3VPKA 1F92A 2Z3CA 2VWNA 2Y5FA 3F2GA 4ABHA 1ACBE 1J8AA 2SGPE 3ENSB 4ZHMU 1O5DH 3HKIB 2GGVB 3NCLA 1TQ7B 3TLOA 5DGJA 2V3HH 2Y6TA 5KECA 1O2RA 1SL3A 1YY3A 2QXIA 2PP6A 4MNXA 3A89A 2PGQB 1UHBA 1SPJA 1UTLM 4Y10E 3TNTA 1DSTA 5HIYA 2R3UA 1DWBH 4Y71A 5C2ZA 4FVDA 3KQBA 1GMHG 4DIIH 1TGCA 4X6NA 5J4QA 1GHAG 3M61U 1GI8B 2ZTYA 2TIOA 1P0SH 1MTNC 3F9HA 4X1RU 5E2PA 4XE4A 1T8OA 3E0NB 1AQ7A 1AWFH 2YMSB 1E35B 5K7RA 4LOYH 2G55A 1ORFA 2F83A 1L1GA 3F9GA 3SUDA 3EA9A 3LJJA 2A7CA 1J14A 4GCHG 6GCHF 2QV1A 1P2NA 3ZZBA 5LPFA 1LHCH 1HIAB 4UDWH 1UVUH 1E37B 3UTUH 5C1XA 3LT3A 1LQDB 1KXCA 1O5GH 1OHHD 1LVBA 1C1VH 1QFKH 5DN6D 3HKJB 1TBZH 2H5CA 2C4FH 1KDQB 4OS4A 1F7ZA 1UMAH 3STIA 1O3NA 5LPEA 5EQQA 2JKHA 3RXQA 4ZAEA 1IQFA 4LXBH 4GPGA 3EQ0H 5L6NH 4ABDA 1LVOA 1QBOA 1FN6A 1DICA 4OS6A 5DK1A 5GWZA 3N7DA 2FLRH 2FTLE 4WH6A 3GDVA 2BD4A 3VB6A 1THPB 4X2VA 2BY5X 5CHBA 4F48B 1LQEA 1L1NA 1EKBB 1C9PA 3MU0A 4LK4A 1C2JA 1TMBH 3F0PA 5E0HA 1FN8A 2ZDKA 3UNRA 3N99A 1WTHD 4MVNA 4YOGA 4Y76A 2VINA 4TWWA 1LDTT 5ESBA 2VVUA 2H5DA 1ANBA 1O3JA 1AN1E 1F0SA 3S9CA 3KCGH 3RXGA 3RXEA 3SYJA 2XNDD 3ZZDA 1FNIA 1GJ9B 3SO3A 2HNTC 1SMFE 4I86A 4YM9A 1EQ9A 1ELGA 2FI4E 1SI5H 1C1TA 5SGAE 3ZIAD 1W10U 4FU9A 1BHXF 4MLFB 3PMJA 1G30B 2FIRH 4YTAA 2C93B 4I8JA 1HGTH 3A7VA 1F0UA 3WWBA 1CE5A 2RFKC 2CXVA 2CF8H 1B5GH 2BOHB 4AG1A 2GT8A 6CHAC 1ZJKA 1HAHH 3UNSA 1ELVA 4CBNA 2BDCA 1KLJH 1BMNH 4HTCH 1GBJA 1KIGH 3TJNA 1CHOG 2ZU3A 1LCYA 1LPKB 1BCUH 1SQRA 4H6SB 2ANMH 1HIAA 2Y82A 3UREA 1SGDE 2B9LA 2EA3A 2H1UA 2JETB 4Q4LA 5HYOA 1HUTH 2A4QA 1UCYE 1WYKA 3SU3A 1GL0E 1KDQA 2G5VA 1EAUA 5C5OA 2JIZD 3HPTB 1IQHA 4XD7D 2XBVA 4NZLA 3SUFA 5EW1H 5FBIA 1KXDA 1BRBE 2BLWA 4OS2A 3T2NA 4DT4A 2F4LA 2NWNA 1DS2E 3M7TA 1W0YH 1XUIA 4AB8A 1W3CA 1IQKA 1FLEE 2A2QH 2XCNA 2ZWLH 3GY6A 1FY5A 2GV7A 1P11E 1XXDA 2P95A 1D4PB 2WV9A 1N1LA 3MU1A 1RD3B 1O5CB 1YPEH 7KMEH 1MTNB 1XXFA 2Z9JA 4INHA 2XOKD 2PKAB 4Z6AH 5T6FA 4X1PU 4Q7XA 1RTFB 3UWIA 4JZ1A 5DJ7A 3TITA 4B76A 3MU5A 2BZAA 1C1OA 2Z3DA 1E79D 1Y3WA 1ZLRA 3PM3A 1WUNH 4YO9A 3VB7A 1DSUA 4WJG2 5EODA 3PV2A 2TPIZ 1SGPE 1EAIA 1WSSH 1C1UH 2FOMB 1TRNA 3RXTA 4KTCA 2BQ6B 4AORA 2Z7FE 4ISHH 4TWYA 1HFDA 1PPGE 1V6DA 3U1IB 1J16A 1HAOH 2AMQA 2Q6FA 3ZZ4A 1OKXA 2W7UA 1L0ZA 1C5PA 1EZSC 3UNQA 4E7NA 2FEQH 2GMTC 4BAOB 3WW7A 4FVBA 5DG6A 3S0NA 2L6OA 2VWOA 1TNGA 1SGYE 1QCPA 2XW9A 4B2CA 1AB9C 3SU4A 3S9AA 2KCAA 3R3GB 2BY7X 4NWKA 3K6YA 3A8DA 5GNDA 1GL1A 3AAUA 1HDTH 1Y3XA 1GI5A 4FUCA 3Q3XA 4R0IA 2AS9A 1ELDE 5EGMA 4GLYA 5DKMA 4XOJA 1OP0A 3RXIA 1HXFH 1O3PB 3A7ZA 4X8UH 1DWDH 2QXGA 1P2IA 5IYTA 1O31A 3E0PB 3PLBA 5DO4H 3ZZ9A 1TBRH 2ZHDA 1CO7E 4FUHA 1S6LA 1MD7A 2ZGBH 1EFRD 1SGFA 3ZZ5A 3P92A 3DD2H 1WTGH 4IC6A 3MNBA 1QURH 4X8TH 2PKAA 5C1UA 5B6OA 5DP5A 3QDZB 5E8EH 5GJ4B 3UIRA 3SBKA 3VFEA 3TK5A 6CHAB 4ZHAA 4FUJA 1VZQH 5DP8A 5CMXH 4CR5A 3SV2H 4OS5A 4IS5A 2ZFQH 3PYHA
chains in the Genus database with same CATH topology
1QZ8A 2J98B 1UW7A 3EE7A 2J97A 5HIZA 2J98A 5HIYA 5C94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ8 A;  2J98 B;  1UW7 A;  3EE7 A;  2J97 A;  5HIZ A;  2J98 A;  5HIY A;  5C94 A; 
#chains in the Genus database with same CATH topology
 1GI2 A;  1W7G H;  2XRC A;  1QJ6 B;  1ARB A;  2FYQ A;  3O8B A;  1ETR H;  3SQH E;  2R2W U;  3L33 A;  2RA0 A;  1OS8 A;  2JJ2 D;  4U32 A;  1KXA A;  3BTQ E;  3RXH A;  4OM9 A;  1TON A;  3ZZ7 A;  1Z1J A;  1S0Q A;  2F9V A;  4F4O C;  6GCH G;  4IC5 A;  1H8D H;  3FP6 E;  1P02 A;  3UAI C;  4BTT B;  4KP0 A;  1AND A;  1D3D B;  4Q63 A;  8EST E;  4ISI H;  2D8W A;  1LO6 A;  2FX4 A;  2J92 A;  2A7H A;  3EE7 A;  4BNR A;  5JB9 S;  1TNK A;  1LPG B;  1BB0 B;  3KQ5 A;  1OOK B;  1CGH A;  1AMH A;  3O8C A;  2J9N A;  4I8H A;  1DLE A;  1K9O E;  5DP9 A;  1GDQ A;  3A83 A;  4JK6 A;  4ZRO A;  1P03 A;  1O2J A;  3AAV A;  2GCH F;  4K1E A;  2V7Q D;  1TX7 A;  1NRQ H;  1JRS A;  4CH8 B;  1MTV A;  2ASU B;  1AFE H;  1LVY A;  3UOP A;  4E05 H;  4DIH H;  4PRO A;  2C3S A;  1H9I E;  4DUR A;  3B23 B;  3T28 A;  4MG3 A;  1A3B H;  5E0J A;  4IMZ A;  1ZPZ A;  3RU4 D;  1MKX H;  4K5Z A;  2KX4 A;  3RM0 H;  2FLB H;  4TY6 A;  4TSF D;  3F68 H;  1S84 A;  3FP8 E;  1SFI A;  3F9E A;  1C5S A;  1VR1 H;  2CHA C;  2NU1 E;  4B75 A;  3S7H B;  2ZHQ H;  4INL A;  1GMD F;  1HAV B;  1TPO A;  3ATK A;  2WPJ S;  3JZ1 B;  3LOX A;  1LHE H;  3M5L A;  3MTY A;  3OTJ E;  1INC A;  5F53 A;  3GY4 A;  1GHW H;  4D9Q A;  4D9R A;  1MU6 B;  2IJO B;  2R0L A;  4BXS A;  2XBW A;  3FO8 D;  2AER H;  4IN2 A;  1GHB F;  3TH3 H;  1W11 U;  1AO5 A;  3GOV B;  6EST A;  4BAN B;  1Q3X A;  3A7W A;  3UY9 A;  1O38 A;  1IQE A;  2OP9 A;  1AZZ A;  1LPZ B;  2H2Z A;  2ZIQ H;  2ZFR H;  3U8T H;  3H7O A;  1FX0 B;  3LGI A;  2PUX B;  2ZEC A;  1G2L A;  5DSF A;  1VIT F;  4AB9 A;  5I25 A;  1Z6E A;  2GMT B;  1G3D A;  2R3Y A;  4LZ1 H;  1YYY 1;  1O2G H;  3F9F A;  1DY8 A;  1OWK A;  1P2Q A;  2FDA A;  1UK3 A;  4RI0 A;  2VH0 A;  3SNA A;  1NFU A;  1GI0 A;  2GCT C;  3EGK H;  4BTU B;  1F0R A;  2KM0 A;  1GBK A;  4B1T A;  1GVK B;  3BIU H;  1ARC A;  2OK5 A;  1C5Z B;  1AB9 B;  1EZX C;  3VXE H;  8LPR A;  1YBW A;  4UEH H;  4LZ4 B;  1V2V T;  2ZNK H;  3SHA H;  3TH2 H;  2ZDN A;  1ZTL A;  4DJZ B;  1AKS B;  1E38 B;  2SGE E;  2VWL A;  1V2L T;  3TK6 A;  3EE0 B;  3GCH C;  2F9B H;  1BOQ A;  4GSO A;  1FY3 A;  1YWU A;  2DE8 A;  1GBT A;  1SHY A;  4HFP B;  4OS1 A;  1DFP A;  1O2Y A;  3GY5 A;  1GJ8 B;  1A2C H;  1Y5A T;  1AVG H;  3QUM P;  3M7U A;  3EST A;  1DXW A;  2KR7 A;  3S9B A;  5IK2 D;  1O3K A;  3BTK E;  5EU8 A;  1GJ4 H;  2WUC A;  4IN1 A;  5EQS A;  1FDP A;  2QY0 B;  1KLT A;  2SGQ E;  1VCW A;  2F9U A;  2OXS A;  2VNT A;  1BRC E;  1C5Y B;  3KEE A;  1GCD A;  2BVX H;  1ZPC A;  3GDU A;  4THN H;  1S81 A;  1QGF A;  1TAL A;  1ZRB A;  3QN7 A;  1O2Z A;  4X1Q U;  2BQ7 B;  7GCH F;  3A7X A;  2AYW A;  1HAV A;  5KGO A;  4CRD A;  1TMU H;  1NRN H;  1Y8T A;  9LPR A;  3BIV H;  4RKJ B;  1V2P T;  3A8B A;  1RRK A;  2AMD A;  5JBT A;  2QCY A;  4KTS A;  1AUT C;  1L4Z A;  1WDI A;  1ELT A;  1XVM A;  2YOL A;  4UON A;  3SOS A;  2BX4 A;  4A1X A;  5L2Y H;  5ABW A;  2VIO A;  1ABI H;  1SGT A;  4AX9 H;  1VCP A;  1EUF A;  1E1R D;  4MPU A;  1COW D;  3P8G A;  4K60 A;  1OWH A;  3F2H A;  3HK6 B;  4NIW A;  1EP6 A;  1C1S A;  2BQW B;  1YPH E;  1GJ6 A;  3SND A;  3RXL A;  4OS7 A;  3I77 A;  1DY9 A;  2G81 E;  1ESA A;  1LKA A;  1WQS A;  2STA E;  2ZFF H;  2BXT H;  3PLK A;  4A7I B;  1NT1 A;  2HAL A;  5DP6 A;  1YGC H;  5FCK A;  2ZZU H;  3D49 H;  2O8T A;  2XWA A;  3ZVE A;  1FPH H;  1PPH E;  1BBR H;  3Q00 A;  2EEK A;  3TVJ B;  3SJI A;  4YT7 H;  2PTN A;  2FXR A;  4Q80 A;  1W0Z U;  1DT2 A;  1AKS A;  5TCC A;  4GVU A;  4RKO B;  4SGA E;  1SG8 B;  1LHD H;  1SFQ B;  5KED A;  2VWM A;  1O3E A;  3WY8 A;  1KTS B;  2C90 B;  1Z1I A;  3RXO A;  1SLX B;  1HYL A;  1EAX A;  1FXY A;  3AW0 A;  3T5F H;  1ABJ H;  2ULL A;  2CHA B;  3DUX H;  1CU1 A;  2WPL S;  1H8H D;  1DXP A;  1O2N A;  2TBS A;  1MQ5 A;  1DOJ A;  1C9T A;  4WH8 A;  4IBL H;  2SNV A;  3E3T A;  3NK8 A;  1NC6 A;  2WPK S;  3AK5 A;  4UFE H;  2GJG A;  1BDA A;  2ZU2 A;  2AIP A;  2LP6 A;  1QB1 A;  1O34 A;  2Z3E A;  1C4U 2;  3RMM H;  3M37 A;  1NO9 H;  1AIX H;  3NRL A;  2OTV A;  4ASH A;  1LKB A;  1LTO A;  2SGF E;  2IN2 A;  3FFG A;  2FOF A;  3SV8 A;  2HLD D;  4DCD A;  3TNS A;  1SGI B;  4ZCN A;  4X6M A;  4ZH8 A;  3PMH B;  2Y81 A;  3ZZC A;  3SV6 A;  2XC5 A;  3I29 A;  4NIV A;  2GZ7 A;  4ABE A;  2VU8 E;  2GCT B;  1S83 A;  1P2O A;  4ACB A;  1C5O H;  2A31 A;  1G37 A;  1O2Q A;  1RTL A;  3MH7 A;  4BAM B;  4FOU C;  2PFE A;  3KYG A;  3U69 H;  2O8L A;  1DLK B;  2FX6 A;  3A87 A;  1SGN E;  3UUZ A;  3VB5 A;  3CS0 A;  1O33 A;  5FHT A;  3SUE A;  1SLU B;  1GJA B;  2KCP A;  3GCH B;  3PRO A;  4FU8 A;  1W7X H;  4I7Y H;  2CF9 H;  1IQJ A;  3MNS A;  1XUH A;  2PGB B;  1DX5 M;  2VVV A;  5A8X A;  3OAA D;  1WV7 H;  2ZQ1 A;  1BBR K;  4TY7 A;  1C5L H;  3OYP A;  1NRS H;  1QHR B;  1K1L A;  1SGC A;  1S6H A;  2FOH A;  2GCH G;  1GHZ A;  3ZV9 A;  2RG3 A;  4AGJ A;  1GHV H;  3SJO A;  2EY4 C;  3MH6 A;  1C5X B;  1NPM A;  4E06 H;  3MQK C;  1ZSJ A;  4ZUH A;  3P17 H;  1KSN A;  3BTH E;  4HZH A;  1GBD A;  4ISL A;  1HXE H;  1A0H B;  1FUJ A;  1MTU A;  1GVZ A;  1ZML A;  1RTK A;  2P59 A;  1TA2 A;  2UWO A;  3RLY H;  5A2M H;  1CT2 E;  3P70 B;  4MNY A;  1K0H A;  1YPJ H;  2QF4 A;  4NFE A;  4AC9 A;  3M5O A;  1GMD G;  4MPX A;  5BPE A;  2ZI2 H;  2F91 A;  2ZTZ A;  1A46 H;  1K1M A;  3HK3 B;  3LGY A;  2XXL A;  2ZDL A;  5B6L A;  1TMT H;  4F49 A;  4TPY A;  2ZU5 A;  4NG9 H;  5EIY A;  1GHB G;  2J98 B;  3GY2 A;  3OE7 D;  3T27 A;  1TGT A;  1HJA C;  1K21 H;  1XUJ A;  2W6I D;  3GY3 A;  1HRT H;  1O3I A;  1TGS Z;  2O9Q A;  1AZ8 A;  1O35 A;  3DSO A;  3PTB A;  2YNA A;  1MZA A;  3SGB E;  4R8T B;  1T31 A;  3A8A A;  1VIT G;  2OD3 B;  2XTT B;  3OEE D;  3UFA A;  3FN8 A;  3TJO A;  1FAK H;  1O5B B;  2UUJ B;  4K69 A;  1QB9 A;  1TB6 H;  3A86 A;  5TCA A;  5DP3 A;  1DDJ A;  2A2X H;  3FAO A;  3SW2 B;  3RXR A;  3MFJ A;  2TGT A;  2GX4 A;  1ETT H;  1NFW A;  2W6J D;  3CNR A;  1PQ8 A;  2BZ6 H;  5L30 H;  1EB1 H;  3OY6 U;  5JPM H;  3W95 A;  1TNH A;  2XNI A;  2AH4 X;  2UUY A;  3UB0 A;  3QLP H;  5DP4 A;  2H6M A;  5H4I B;  2FMJ A;  1OXG A;  7EST E;  2FES H;  1AI8 H;  1OPH B;  1RJX B;  1GI7 B;  2K0Q A;  4WY3 A;  1NBM E;  2RCE A;  1MTS A;  4A1V A;  1ZR0 A;  1P05 A;  1TYN A;  2GZ8 A;  3VXF H;  3D65 E;  3IIT A;  1BIT A;  5EXN A;  3SV7 A;  5JBB S;  1J15 A;  1Z6J H;  1U6Q A;  3F2F A;  2FOG A;  4XSK U;  4MQA A;  1GBF A;  1BTU A;  1O5E H;  5FPT A;  2ZCK P;  1C2G A;  2ZQ2 A;  1TBQ H;  4U01 A;  1NRP H;  1NZQ H;  2ZFP H;  2BXU H;  1FY4 A;  1QB6 A;  4JYT A;  1J9C H;  1O2K A;  1O39 A;  2Z9L A;  1EOJ A;  1MU8 B;  7GCH G;  2BD3 A;  1P3E A;  1SGR E;  1T4U H;  3BG4 C;  2HLC A;  1G3B A;  3URD A;  1FJS A;  3OX7 U;  3LH3 A;  4GHQ A;  4J1Y A;  1VCQ A;  4J2Y B;  3SN8 A;  2TGA A;  3LC5 A;  3MH4 A;  2J98 A;  2B5T B;  4ZXX H;  3ZVF A;  1MH0 A;  3TJU A;  1QRX A;  1NFY A;  3M36 A;  2P16 A;  3HAT H;  1PFX C;  3GYM A;  1HAX B;  1Z7K A;  3ODF A;  4I8L A;  3A85 A;  3BTT E;  1ELE E;  1O3C A;  2GT7 A;  2D2D A;  2R2M B;  1JBU H;  3NZI A;  3LGT A;  1C2H A;  2F9N A;  1J17 T;  2JH6 D;  3RXJ A;  3MI4 A;  1C2L A;  3GYL B;  2Y7X A;  1M9U A;  1MAB B;  1Y59 T;  3U98 H;  2A5K A;  3V12 A;  1XKB C;  3M5M A;  3SU0 A;  2KCY A;  2P3U B;  1QQU A;  2IJD 1;  5J4S A;  5EJ1 A;  2ZEB A;  4BXW A;  3N7E A;  2A1D B;  3UQV A;  4CRG A;  4K1T A;  1AHT H;  2OQ5 A;  1GBI A;  5EJZ A;  1LHF H;  5GCH F;  5GDS H;  2F43 B;  1O3D A;  3LKW A;  3OFN D;  5FCR A;  3TU7 H;  1P3C A;  1C4Y 2;  2QF0 A;  4I32 A;  4A1T A;  1WU1 A;  3SUG A;  3U1J B;  4K8B A;  1CHG A;  2ZHF H;  2ZU1 A;  3GIC B;  4NIX A;  1O3F A;  1SOT A;  2C8Z B;  4Y79 A;  1PPF E;  1HNE E;  2KFW A;  2P3T B;  2ZCL P;  2W26 A;  1ZHM A;  2RDE A;  1EZU C;  1KLI H;  3PWC A;  4M9F A;  3MO6 A;  4ZXY H;  1QJ1 B;  3DFJ A;  1PPB H;  3CS7 A;  1UCY H;  4MDS A;  3SJ9 A;  1O2L A;  3M3V A;  3TH4 H;  1O0D H;  2L74 A;  3TGI E;  4NSV A;  1P04 A;  1B0E A;  1GCT C;  1C4V 2;  1B7X B;  1HJA B;  2C8Y B;  1K1O A;  3K2U A;  2M5T A;  3LPR A;  4NIY A;  1HBT H;  1T8N A;  2GV6 A;  1OYT H;  2O8W A;  4CH2 B;  2FS9 A;  2VGC C;  5C67 A;  4XDE A;  1C5T A;  3H7T A;  1O2I A;  1Z8I B;  2ANK H;  3AW1 A;  5LPR A;  1S0R A;  3TJV A;  2WPD D;  1ZRK A;  1K1I A;  1HPG A;  4ISN A;  2EI8 A;  2VBC A;  4X8V H;  2R0K A;  1Y3U A;  3Q3K A;  2BOK A;  4Y7B A;  7LPR A;  2ZFT A;  2Y5G A;  4K2Y A;  1FQ3 A;  1O3A A;  2BD5 A;  1XVO A;  1IQL A;  5C94 A;  4OGX A;  2ANW A;  4YLQ H;  2FZZ A;  2VID A;  4CBO A;  3SU6 A;  1WQV H;  2CGA A;  4AOQ A;  4ZMA H;  3IWM A;  3NWU A;  1QA7 A;  1SSX A;  3EYD A;  3RXP A;  1QL7 A;  1G36 A;  3SU2 A;  3QX5 H;  4O9V A;  2G4U A;  4X6O A;  4KEL A;  1UK2 A;  4ZKO U;  4IW4 E;  2VB0 A;  3S69 A;  4AG2 A;  4B6E A;  5DP7 A;  1G3C A;  1C1P A;  3PMA B;  4WME A;  1T7C A;  1YPM H;  2F3C E;  3K6Z A;  4AFU A;  1Q2W A;  3DSP A;  3EDX B;  1EX3 A;  1EB2 A;  1YPG H;  1YPK H;  3TIU A;  1ETS H;  2ZDV H;  3W1E A;  3RXD A;  1GBE A;  2QN5 T;  4P02 A;  1W2K H;  4E7R G;  2A7J A;  2OC8 A;  2KAI B;  3STJ A;  1MBM A;  2FOA A;  3LGW A;  2EST E;  3CEN A;  3E16 B;  2FM2 A;  1GHX H;  2XC0 A;  1ZMN A;  5F03 A;  2BHG A;  4Y0Z E;  1C2I A;  1DM4 B;  1GJB B;  1P06 A;  3BG4 B;  3QGJ A;  3WWF A;  1Z8G A;  1W14 U;  2G51 A;  3A82 A;  4NWL A;  2ZDA H;  1Q31 A;  3SV9 A;  1NN6 A;  3ZZ6 A;  5C20 A;  3ZVG A;  2BMG B;  1A0L A;  1UCY K;  2CN0 H;  1A5G H;  1MUE B;  5BRR E;  1W13 U;  1TQ0 B;  3OY5 U;  4Z1M D;  1BTY A;  2ALP A;  3U8R H;  2ZU4 A;  1FIW A;  1A1R A;  4OGY A;  3RC6 A;  1V2W T;  1P57 B;  4IMQ A;  2SGA A;  3LON A;  1V2R T;  3QZR A;  1OP2 A;  4IGD A;  2O8M A;  2A0Q B;  3KYF A;  3GCT F;  1TX6 A;  3A80 A;  1PJP A;  1GI6 A;  3OU0 A;  1FY8 E;  5F6M A;  4AGK A;  1JOU B;  2TGD A;  4TPI Z;  4Y11 E;  2ZP0 H;  2HGT H;  1H8I H;  4Y8Z A;  3U28 C;  3RDZ A;  2V0B A;  5GPI B;  3GDS A;  2G8T A;  1TPS A;  1ELB A;  3MNX A;  1V2S T;  4B2B A;  3RXM A;  4I8G A;  5FX6 A;  5E2O A;  2BDA A;  4GUX A;  4NZQ A;  3MU4 A;  2D26 C;  2J34 A;  2QAA A;  1HCG A;  3ATM A;  1JIR A;  5AHG H;  1A3E H;  4NA8 A;  4ASU D;  1MCV A;  3BF6 H;  3M3S A;  1W0J D;  3GY8 A;  5EXM A;  4X2Y A;  2F9O A;  1G2M A;  2OBO A;  4DG4 A;  2ZFS A;  1Y3Y A;  2ZF0 H;  4ISO A;  4ABF A;  4CRB A;  1ZHP A;  2NU2 E;  4YXW D;  3RML H;  1FON A;  1ZGV A;  3UPE A;  1QNJ A;  2FOD A;  1H1B A;  1L4D A;  2QF5 A;  3UWJ H;  1V2Q T;  1P2K A;  3DFL A;  1L1J A;  1P8V C;  3SJ8 A;  5CDF E;  3RM2 H;  2G52 A;  2KAI A;  3DHK H;  3SZN A;  3VB3 A;  1SOZ A;  4JK5 A;  3N7O A;  1NBM D;  1SLW B;  1D9I A;  1GCT B;  1TPP A;  4ACA A;  2ODP A;  3LIW A;  1ZYO A;  4MTB A;  2R9P A;  2CK3 D;  2PWX A;  8GCH F;  1E1Q D;  1L2E A;  1E0F D;  1TOC B;  2VGC B;  1AE5 A;  1ZGI A;  1VJA U;  2EI7 A;  2HRV A;  1CA8 B;  1FY1 A;  3HGP A;  3SI3 H;  2J4I A;  1FI8 A;  3SHC H;  1F0T A;  4INK A;  4U2W A;  1N8O C;  1GBM A;  3T29 A;  2ODQ A;  1DVA H;  4XBD A;  1O2O A;  3M5N A;  1QRZ A;  1DPO A;  2C8W B;  4SGB E;  1AVW A;  4HI3 A;  3A8C A;  2GTB A;  1O36 A;  2ZA5 A;  2A5I A;  1IQM A;  1D6W A;  4KGA A;  5T1V A;  1K1J A;  1FZZ A;  1T32 A;  4CRF A;  1MZD A;  2XWB I;  4AFS A;  2WPI S;  1OP8 A;  2AGG X;  4XBB A;  3M3T A;  2BDI A;  1BML A;  2WPM S;  5F8Z A;  1G3E A;  1BMA A;  1TRY A;  2PR3 A;  3PO1 C;  1JMO H;  1NRO H;  2I6Q A;  1AWH B;  2NU4 E;  1P2M A;  3BTF E;  3FAN A;  3LC3 A;  1EJM A;  1YKT A;  1C5M D;  2BYA X;  2DE9 A;  2OUA A;  3PV4 A;  2Q6G A;  4ZKN U;  1A7S A;  2NU3 E;  5LGO A;  2TRM A;  2WV5 A;  2WZQ A;  2B8O H;  2I6S A;  1GPZ A;  3BTM E;  1GBL A;  1ELC A;  3RXA A;  1UVO A;  1P09 A;  3RMN H;  3Q77 A;  1CBW C;  1Z8J B;  4JZI A;  5F8T A;  1FPC H;  4FUD A;  1BTW A;  2BDB A;  2Z9K A;  2Z94 A;  4VGC C;  3RLW H;  1V3X A;  1F5L A;  1BQY A;  2C8X B;  5GCH G;  4U30 A;  4FUE A;  1EZQ A;  4CRC A;  4B6F A;  1A61 H;  3TPI Z;  1O2X A;  1DWC H;  2AGE X;  5C17 A;  4FUG A;  2XYA A;  1UTJ A;  2VIW A;  1TGB A;  3KHV A;  1W0K D;  1A0J A;  5FBE A;  1D3T B;  3LJO A;  4Q2K A;  1YCP H;  2XC4 A;  1AU8 A;  3PV5 A;  5JB8 S;  1NFX A;  4MPW A;  4XBC A;  3A7T A;  2V35 A;  2A5A A;  4JZF H;  3SI4 H;  3C27 B;  1D3Q B;  2PV9 B;  1UO6 A;  3RXS A;  3PB1 E;  2WV4 A;  1X7A C;  5HM2 A;  1ELA A;  1A5I A;  2ZGC A;  1GJD B;  4DT7 B;  1WOF A;  1GBA A;  2WHX A;  2BY9 X;  3LH1 A;  2FS8 A;  1GDN A;  2VVC A;  1C1N A;  1P9S A;  5FPY A;  4D7G A;  1NY2 2;  2ZG0 H;  2ILN A;  1D6R A;  2OBQ A;  1GBC A;  3NXP A;  3T25 A;  2J38 A;  2VIP A;  3UQO A;  5GIB A;  5K0H A;  1WBG B;  2HVY B;  2M2A A;  5EPY A;  1SKY E;  1GI9 B;  1RIW C;  3VG8 A;  1HAY B;  1TAB E;  4FUF A;  2Y80 A;  1QIX B;  2P94 A;  5AF9 H;  1BTX A;  2ALV A;  1K1N A;  1QTF A;  2Z6B D;  1KY9 A;  1O2U A;  1GG6 C;  2V3M A;  3SZE A;  3L6P A;  1FAX A;  1TLD A;  3ATL A;  2HWL B;  1TNJ A;  1YPL H;  1YC0 A;  3GY7 A;  3DCL A;  2QE7 D;  1BT7 A;  1UTQ A;  3P8N A;  1W12 U;  1WAY B;  3MU8 A;  1N6Y A;  3B8J A;  1IOE A;  2GKV E;  1O5F H;  2B7D H;  4X6P A;  3E6P H;  1EPT C;  4FUI A;  1UVP A;  2RA3 A;  3S7K B;  1SB1 H;  1O2H A;  2CV3 A;  4BAK B;  1HAG E;  5C0T A;  2BY8 X;  1BRA A;  1IQI A;  5A8Y A;  3KL6 A;  1TPA E;  2OC7 A;  5T3H A;  1YM0 A;  3T26 A;  5HKK D;  8KME 2;  3A81 A;  1GJ7 B;  3ZVC A;  4B74 A;  3M7Q A;  5JDU B;  1ZOM A;  2XCF A;  4YOI A;  1TAW A;  2J97 A;  3EAJ A;  5C3N A;  2Z9I A;  2BB4 A;  4K1S A;  1EST A;  1GWA A;  1H4W A;  1TNI A;  3T62 A;  1O30 A;  3BSQ A;  1AUJ A;  1GBH A;  1AY6 H;  2PHB A;  2BD7 A;  1GMC F;  4ZHL U;  5JBA S;  2V3O H;  1H9L B;  5HIZ A;  2NU0 E;  5FPS A;  2H9H A;  1N8O B;  1YCP K;  2EI6 A;  2FPZ A;  5HM9 A;  3BV9 B;  1T4V H;  3RU4 E;  2QF3 A;  4DOQ A;  1CGI E;  1ZMJ A;  1C2E A;  3BN9 A;  3PTN A;  4F55 A;  1TNL A;  1GI4 A;  1XX9 A;  3SNE A;  3A7Y A;  3ZZ8 A;  1BRU P;  1W8B H;  1KYN A;  1YLC A;  1CQQ A;  5EW2 H;  1ANC A;  1S82 A;  1LVM A;  3V13 A;  1YLD A;  3ZV8 A;  1HJ9 A;  1YF4 A;  1IHT H;  2W5E A;  1ZTJ A;  2W3I A;  3GCT G;  3EA8 A;  2IPH A;  3PO1 B;  1C5N H;  3E91 A;  2OC0 A;  3SGQ E;  2WYJ A;  5A8Z A;  2QYI A;  4Y6D A;  1GI3 A;  4BTI B;  4M7G A;  4NA9 H;  3GCN A;  3MYW A;  3QK1 A;  2A4G A;  3SU5 A;  2FOC A;  1BTZ A;  2ANY A;  1VKY A;  1CBW B;  3VB4 A;  2XBY A;  2G4T A;  1DWE H;  3LDX H;  4NCY A;  4VGC B;  3O8D A;  3GCO A;  3LU9 B;  2AIQ A;  1GJC B;  1CVW H;  1VIT H;  1HAZ B;  2FP7 B;  2FWW A;  2XBX A;  3ZVD A;  1YLN A;  1QRW A;  4UE7 H;  2AMP A;  4XFQ A;  2BVR H;  2FOE A;  2JH5 D;  4K3J A;  4ABB A;  1OWI A;  2ZKS A;  3KNX A;  1BMM H;  1BZX E;  1BTP A;  3BEI B;  3D23 A;  2K1Q A;  1ZHR A;  5C5N A;  2IPQ X;  1P2J A;  2PSY A;  1DIT H;  1EXF A;  1O3M A;  1AD8 H;  5IDK A;  1RXP A;  1NRR H;  3JZ2 B;  2ZGX H;  2J2U A;  4TT3 D;  1MMJ N;  1TWX B;  1O2T A;  2PTC E;  2THF B;  2YNB A;  1P12 E;  2Y5H A;  1PQ5 A;  5DPA A;  3URC A;  4DGJ A;  5HGG A;  3BTD E;  1A5H A;  3QTO H;  1T8M A;  1G9I E;  4CRE A;  2EQN A;  1HJ8 A;  1QBN A;  1JWT A;  2GDE H;  3SJK A;  8GCH G;  4FUB A;  5A0C A;  5I46 H;  1OX1 A;  1PPC E;  3RXF A;  1DE7 H;  3DT0 H;  2A4O A;  3QGN B;  4B73 A;  1GHY H;  1SQT A;  1B0F A;  4JZE H;  4GAW A;  3O8R A;  1DAN H;  2HNT F;  1ESB A;  1RIW B;  3PMB B;  4Y0Y E;  1UK4 A;  1TOM H;  2J5U A;  1CGJ E;  2OLG A;  5LH8 A;  5FAH A;  3P8O A;  1EJA A;  3D62 A;  4MPV A;  5C0U A;  4UD9 H;  1GBB A;  1A4W H;  1GG6 B;  6LPR A;  2TGP Z;  1O3G A;  1THR H;  2CJI A;  2PSX A;  3V3M A;  2BDY A;  3ITI A;  3RXK A;  1BHX B;  1MQ6 A;  4X8S H;  2VJ1 A;  3RXV A;  3KID U;  3U9A H;  3V0X A;  2G00 A;  4DY7 B;  1O3O A;  1N6X A;  2FOB A;  1OWE A;  4HG6 A;  1AGJ A;  1IQG A;  1ELF A;  4B71 A;  1EPT B;  3FOA A;  1QZ8 A;  3RC4 A;  3EA7 A;  1O5A B;  3MNC A;  4X2X A;  5CHA C;  5EJL A;  2JDI D;  4Y8Y A;  1DUA A;  5AFY H;  1ID5 H;  1P10 A;  1O2P A;  2V6N A;  3P95 A;  1LHG H;  1AFQ C;  1MCT A;  2P93 A;  3K9X B;  1O2W A;  3A88 A;  4GHT A;  4B2A A;  3DSG A;  1SC8 U;  2HVX A;  3UR9 A;  5EPN A;  1S5S A;  1BJV A;  3Q3Y A;  1VGC C;  1Y5B T;  2Q6D A;  1UTK A;  3MH5 A;  1FMG A;  1NES E;  1UTO A;  4Q7Z A;  1SQO A;  2SFA A;  4ABJ A;  4D8N A;  4AFZ A;  1BMF D;  2PW8 H;  4ZKR U;  5TJX A;  1YPH C;  1V2M T;  3TGJ E;  3KQE A;  5EQR A;  5A0A E;  2QIQ A;  1QR3 E;  2AFQ B;  4X1N U;  1EJN A;  3RUO A;  3QTV H;  1XUF A;  1BUI A;  4NA7 A;  1C2M A;  1QY6 A;  4BOH A;  4YOJ A;  3W94 A;  3BEU A;  5HMA A;  4Q7Y A;  9EST A;  4CHA C;  2P8O C;  3V7T A;  3ZVA A;  3VEQ B;  2ZPQ A;  5GXP A;  2OIN A;  2ZC9 H;  3E1X B;  1K2I 1;  1GGD C;  1MKW H;  1VJ9 U;  1UTM A;  1ZJD A;  1AE8 H;  1ZTK A;  2UWP A;  1JRT A;  1V2K T;  1SBW A;  4Y8X A;  3M35 A;  2BY6 X;  2ODY B;  3KQD A;  5EOK A;  2STB E;  3UR6 A;  2PKS C;  2SGD E;  1SQA A;  3VGC C;  4BAQ B;  1O37 A;  3BTW E;  3PRD A;  1MTW A;  1TRM A;  2ZHW H;  1WXR A;  4KKD A;  1O3H A;  4WVP E;  3ZZA A;  3F6U H;  4ABI A;  3PWB A;  4MNW A;  1Z8R A;  3KGP A;  4ZKS U;  1NU9 A;  2HPP H;  2AHM E;  2B0F A;  2J95 A;  3UOU A;  4HGC A;  3F1S B;  3KN2 A;  1CA0 C;  3E8L A;  3BTE E;  1C5W B;  4WXV A;  1GMH F;  2H9T H;  4AFQ A;  3TGK E;  1GHA F;  2ZHE H;  3FZZ A;  3P8F A;  1GJ5 H;  1PPE E;  3Q76 A;  1NU7 B;  1BA8 B;  1EPT A;  1THS H;  3AVZ A;  3RU4 T;  2UWL A;  5JYI A;  1HV7 A;  3ATI A;  1P01 A;  3MMG A;  3ZYE A;  2GVF A;  3OSY A;  4MNV A;  1ANE A;  2AGI X;  2FI5 E;  1E36 B;  4JCN A;  5AVD A;  1UW7 A;  1QL8 A;  1C1Q A;  4YZU A;  2F9P A;  2OC1 A;  5EXL A;  1C5Q A;  1OWD A;  1O2M A;  3KF2 A;  3NUM A;  4A5T S;  1G32 B;  4GCH F;  4RN6 A;  1P9U A;  3BTG E;  2BLV A;  2BX3 A;  4QT8 C;  1V2N T;  3GS9 A;  2JJ1 D;  1NTP A;  2LNC A;  4YT6 H;  1ZSL A;  4AYV B;  4WWY A;  1TE0 A;  2RDL A;  4D7F A;  2IOT A;  4CR9 A;  1TIO A;  1O2V A;  4RT0 A;  1C1M A;  1XUG A;  1S6F A;  1SR5 C;  1PPZ A;  2UUF B;  1V2J T;  2VH6 A;  3FKS D;  3KQC A;  1CT0 E;  2EC9 H;  2PUQ H;  4X1S U;  2O8U A;  3MO9 A;  2BD9 A;  1MBQ A;  2ZCH P;  2HPQ H;  1GMC G;  1TGN A;  4K8Y A;  1O2S A;  1C5U A;  1OSS A;  3RXU A;  4UFD H;  2FTM A;  1C2D A;  2HNT E;  5FL7 D;  1H9H E;  2BLQ A;  1UTN A;  2BTC E;  2VIV A;  5EG4 A;  1IQN A;  3CP7 A;  4UFG H;  3PLP A;  1HB0 B;  1MKW K;  3AAS A;  5CE1 A;  2KCO A;  1TA6 A;  5AFZ H;  1DUE A;  1KXB A;  2WUB A;  4WMD A;  3LGU A;  1SGF G;  2Z9G A;  4A6L A;  4KTU A;  1O3L A;  1Y5U T;  3H09 A;  4I31 A;  2GDD A;  1EP5 A;  1O3B A;  3BEF B;  2P3F H;  1FIZ A;  3HGN A;  2FI3 E;  2AEI H;  4O03 A;  3H5C B;  5JBC S;  1JIM A;  5CHA B;  1CT4 E;  1SGE E;  1EAS A;  4EST E;  1BJU A;  1KXE A;  2QGR A;  1KXF A;  1JXP A;  2GD4 B;  1AFQ B;  1NS3 A;  2ZTX A;  2BM2 A;  3SU1 A;  4FXG H;  3K65 B;  1HLT H;  3ELA H;  2CMY A;  1VGC B;  2BD8 A;  4XRN A;  1BBR E;  2YMS D;  4BAH B;  1QQ4 A;  2WYG A;  3MOC A;  3B9F H;  1QA0 A;  3I78 A;  2ZGH A;  1BIO A;  4I33 A;  3TK9 A;  1PYT D;  4Y7A A;  3L3T A;  2OQU A;  3U8O H;  1PQ7 A;  1GDU A;  1Y3V A;  4TYD A;  3ATW A;  3MHW U;  4NGA H;  4JMY A;  2FO9 A;  4FU7 A;  2QC2 A;  2YMS C;  2H9E H;  1F5R A;  2Q1J A;  2ZO3 H;  5EST E;  4DVA U;  2Y7Z A;  5HXF A;  1CHO F;  1UTP A;  3SGA E;  1PYT C;  4H4F A;  2QXH A;  5T6G A;  4O97 A;  4CHA B;  1RS0 A;  2P8O B;  2WPH S;  3F3B A;  5A09 A;  1C1R A;  1C1W H;  4H42 U;  1F5K U;  3GIS B;  4WMF A;  2WSS D;  1C5V A;  4YLU A;  1MD8 A;  5A0B A;  1HAI H;  3ZYD A;  2A45 B;  3FP7 E;  1D3P B;  1GGD B;  1TFX A;  2FYR A;  1EAT A;  3SQE E;  4UFF H;  3SNC A;  1ZSK A;  4P00 A;  4AYY B;  2WIN I;  5E0G A;  1EOL A;  4JYV H;  5FXL A;  1TX8 A;  2JH0 D;  2KZ4 A;  4O3T A;  1SGQ E;  2W3K A;  1XKA C;  1K28 D;  3RXC A;  1LMW B;  4AZ2 B;  2A32 A;  2PKS B;  1QBV H;  4WXI A;  3VGC B;  2D1J A;  1CSO E;  3OEH D;  4I8K A;  2GP9 B;  2BDG A;  2LEL A;  2BLO A;  2LPR A;  2BD2 A;  5G4B A;  1OYQ A;  2DUC A;  2PLX A;  1SLV B;  3BG8 A;  1K1P A;  1V2O T;  1SHH B;  3NKK A;  1EAW A;  1OWJ A;  1YCP M;  3MO3 A;  2K8I A;  1CA0 B;  1UHB B;  1GVL A;  1T8L A;  1QL9 A;  4H6T A;  5ETX A;  3IG6 B;  1V2T T;  1GI1 A;  1MKX K;  3RC5 A;  4FET A;  2QXJ A;  1C2K A;  3QWC H;  5F8X A;  2BVS H;  3F0O A;  3SNB A;  3QO6 A;  4D76 A;  1XUK A;  3FVF B;  1V2U T;  3DA9 B;  3NPS A;  4CRA A;  5C1Y A;  1UJ1 A;  2GZ9 A;  4JYU H;  1SVP A;  2SNW A;  2ZGJ A;  3C1K A;  4X0W U;  1BTH H;  1K22 H;  3SOR A;  1AVX A;  3QZQ A;  2QA9 E;  1PQA A;  4WF8 A;  4NFF A;  2A4R A;  4RSP A;  4YES B;  4ABA A;  3ZZ3 A;  3RP2 A;  1E34 B;  3G01 A;  1XM1 A;  1MAY A;  5T6D A;  1RGQ A;  4NSY A;  4JZD H;  1IAU A;  1IHS H;  4AN7 A;  3ZVB A;  1QJ7 B;  1Z71 A;  2OCV B;  1FV9 A;  1YP9 A;  2ZPR A;  1ZZZ A;  5FX5 A;  3R0F A;  1HAP H;  2BDH A;  1F2S E;  1O32 A;  2ZPS A;  1ZPB A;  2HOB A;  1C5R A;  2ZDM A;  4Z0K A;  3RXB A;  1UVT H;  2W7S A;  1WCZ A;  4ABG A;  1H8E D;  2G5N A;  2J94 A;  4X2W A;  1UVS H;  3FZD A;  4RT1 A;  2VIQ A;  3PRB A;  3ODD A;  1S85 A;  5PTP A;  3RMO H;  4A92 A;  1MAX A;  3LGV A;  1KTT B;  3E90 B;  4O3U A;  1C2F A;  1KMH B;  3A84 A;  2UUK B;  3P6Z B;  2JET C;  3OTP A;  4DW2 U;  5L2Z H;  1NM6 A;  3MWI U;  1RFN A;  1XMN B;  3VPK A;  1F92 A;  2Z3C A;  2VWN A;  2Y5F A;  3F2G A;  4ABH A;  1ACB E;  1J8A A;  2SGP E;  3ENS B;  4ZHM U;  1O5D H;  3HKI B;  2GGV B;  3NCL A;  1TQ7 B;  3TLO A;  5DGJ A;  2V3H H;  2Y6T A;  5KEC A;  1O2R A;  1SL3 A;  1YY3 A;  2QXI A;  2PP6 A;  4MNX A;  3A89 A;  2PGQ B;  1UHB A;  1SPJ A;  1UTL M;  4Y10 E;  3TNT A;  1DST A;  5HIY A;  2R3U A;  1DWB H;  4Y71 A;  5C2Z A;  4FVD A;  3KQB A;  1GMH G;  4DII H;  1TGC A;  4X6N A;  5J4Q A;  1GHA G;  3M61 U;  1GI8 B;  2ZTY A;  2TIO A;  1P0S H;  1MTN C;  3F9H A;  4X1R U;  5E2P A;  4XE4 A;  1T8O A;  3E0N B;  1AQ7 A;  1AWF H;  2YMS B;  1E35 B;  5K7R A;  4LOY H;  2G55 A;  1ORF A;  2F83 A;  1L1G A;  3F9G A;  3SUD A;  3EA9 A;  3LJJ A;  2A7C A;  1J14 A;  4GCH G;  6GCH F;  2QV1 A;  1P2N A;  3ZZB A;  5LPF A;  1LHC H;  1HIA B;  4UDW H;  1UVU H;  1E37 B;  3UTU H;  5C1X A;  3LT3 A;  1LQD B;  1KXC A;  1O5G H;  1OHH D;  1LVB A;  1C1V H;  1QFK H;  5DN6 D;  3HKJ B;  1TBZ H;  2H5C A;  2C4F H;  1KDQ B;  4OS4 A;  1F7Z A;  1UMA H;  3STI A;  1O3N A;  5LPE A;  5EQQ A;  2JKH A;  3RXQ A;  4ZAE A;  1IQF A;  4LXB H;  4GPG A;  3EQ0 H;  5L6N H;  4ABD A;  1LVO A;  1QBO A;  1FN6 A;  1DIC A;  4OS6 A;  5DK1 A;  5GWZ A;  3N7D A;  2FLR H;  2FTL E;  4WH6 A;  3GDV A;  2BD4 A;  3VB6 A;  1THP B;  4X2V A;  2BY5 X;  5CHB A;  4F48 B;  1LQE A;  1L1N A;  1EKB B;  1C9P A;  3MU0 A;  4LK4 A;  1C2J A;  1TMB H;  3F0P A;  5E0H A;  1FN8 A;  2ZDK A;  3UNR A;  3N99 A;  1WTH D;  4MVN A;  4YOG A;  4Y76 A;  2VIN A;  4TWW A;  1LDT T;  5ESB A;  2VVU A;  2H5D A;  1ANB A;  1O3J A;  1AN1 E;  1F0S A;  3S9C A;  3KCG H;  3RXG A;  3RXE A;  3SYJ A;  2XND D;  3ZZD A;  1FNI A;  1GJ9 B;  3SO3 A;  2HNT C;  1SMF E;  4I86 A;  4YM9 A;  1EQ9 A;  1ELG A;  2FI4 E;  1SI5 H;  1C1T A;  5SGA E;  3ZIA D;  1W10 U;  4FU9 A;  1BHX F;  4MLF B;  3PMJ A;  1G30 B;  2FIR H;  4YTA A;  2C93 B;  4I8J A;  1HGT H;  3A7V A;  1F0U A;  3WWB A;  1CE5 A;  2RFK C;  2CXV A;  2CF8 H;  1B5G H;  2BOH B;  4AG1 A;  2GT8 A;  6CHA C;  1ZJK A;  1HAH H;  3UNS A;  1ELV A;  4CBN A;  2BDC A;  1KLJ H;  1BMN H;  4HTC H;  1GBJ A;  1KIG H;  3TJN A;  1CHO G;  2ZU3 A;  1LCY A;  1LPK B;  1BCU H;  1SQR A;  4H6S B;  2ANM H;  1HIA A;  2Y82 A;  3URE A;  1SGD E;  2B9L A;  2EA3 A;  2H1U A;  2JET B;  4Q4L A;  5HYO A;  1HUT H;  2A4Q A;  1UCY E;  1WYK A;  3SU3 A;  1GL0 E;  1KDQ A;  2G5V A;  1EAU A;  5C5O A;  2JIZ D;  3HPT B;  1IQH A;  4XD7 D;  2XBV A;  4NZL A;  3SUF A;  5EW1 H;  5FBI A;  1KXD A;  1BRB E;  2BLW A;  4OS2 A;  3T2N A;  4DT4 A;  2F4L A;  2NWN A;  1DS2 E;  3M7T A;  1W0Y H;  1XUI A;  4AB8 A;  1W3C A;  1IQK A;  1FLE E;  2A2Q H;  2XCN A;  2ZWL H;  3GY6 A;  1FY5 A;  2GV7 A;  1P11 E;  1XXD A;  2P95 A;  1D4P B;  2WV9 A;  1N1L A;  3MU1 A;  1RD3 B;  1O5C B;  1YPE H;  7KME H;  1MTN B;  1XXF A;  2Z9J A;  4INH A;  2XOK D;  2PKA B;  4Z6A H;  5T6F A;  4X1P U;  4Q7X A;  1RTF B;  3UWI A;  4JZ1 A;  5DJ7 A;  3TIT A;  4B76 A;  3MU5 A;  2BZA A;  1C1O A;  2Z3D A;  1E79 D;  1Y3W A;  1ZLR A;  3PM3 A;  1WUN H;  4YO9 A;  3VB7 A;  1DSU A;  4WJG 2;  5EOD A;  3PV2 A;  2TPI Z;  1SGP E;  1EAI A;  1WSS H;  1C1U H;  2FOM B;  1TRN A;  3RXT A;  4KTC A;  2BQ6 B;  4AOR A;  2Z7F E;  4ISH H;  4TWY A;  1HFD A;  1PPG E;  1V6D A;  3U1I B;  1J16 A;  1HAO H;  2AMQ A;  2Q6F A;  3ZZ4 A;  1OKX A;  2W7U A;  1L0Z A;  1C5P A;  1EZS C;  3UNQ A;  4E7N A;  2FEQ H;  2GMT C;  4BAO B;  3WW7 A;  4FVB A;  5DG6 A;  3S0N A;  2L6O A;  2VWO A;  1TNG A;  1SGY E;  1QCP A;  2XW9 A;  4B2C A;  1AB9 C;  3SU4 A;  3S9A A;  2KCA A;  3R3G B;  2BY7 X;  4NWK A;  3K6Y A;  3A8D A;  5GND A;  1GL1 A;  3AAU A;  1HDT H;  1Y3X A;  1GI5 A;  4FUC A;  3Q3X A;  4R0I A;  2AS9 A;  1ELD E;  5EGM A;  4GLY A;  5DKM A;  4XOJ A;  1OP0 A;  3RXI A;  1HXF H;  1O3P B;  3A7Z A;  4X8U H;  1DWD H;  2QXG A;  1P2I A;  5IYT A;  1O31 A;  3E0P B;  3PLB A;  5DO4 H;  3ZZ9 A;  1TBR H;  2ZHD A;  1CO7 E;  4FUH A;  1S6L A;  1MD7 A;  2ZGB H;  1EFR D;  1SGF A;  3ZZ5 A;  3P92 A;  3DD2 H;  1WTG H;  4IC6 A;  3MNB A;  1QUR H;  4X8T H;  2PKA A;  5C1U A;  5B6O A;  5DP5 A;  3QDZ B;  5E8E H;  5GJ4 B;  3UIR A;  3SBK A;  3VFE A;  3TK5 A;  6CHA B;  4ZHA A;  4FUJ A;  1VZQ H;  5DP8 A;  5CMX H;  4CR5 A;  3SV2 H;  4OS5 A;  4IS5 A;  2ZFQ H;  3PYH A; 
#chains in the Genus database with same CATH homology
 1QZ8 A;  2J98 B;  1UW7 A;  3EE7 A;  2J97 A;  5HIZ A;  2J98 A;  5HIY A;  5C94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...