1KXAA

Sindbis virus capsid, (wild-type) residues 106-264, tetragonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 34
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxaA01
5FHTA 4ZKSU 1C5SA 2WPJS 3NKKA 4Y7AA 1DLEA 1O38A 5CHAB 2WPIS 3VGCC 2VB0A 1TE0A 6GCHF 2C8YB 1ZTJA 4K60A 4NG9H 3Q00A 1T8OA 1NRPH 3M7TA 4ABIA 5DP3A 2Z94A 3BV9B 4O97A 3RXEA 1FLEE 3E0PB 1GVLA 1K1NA 2QXHA 3BG8A 1THSH 3LJOA 1DS2E 2V0BA 3I78A 3KQEA 2SGPE 4IW4E 3ZZ8A 1O2LA 2FS9A 1SGTA 4OS4A 1FY3A 3A89A 3KQCA 2EEKA 1UO6A 2WPHS 3PWBA 5C5OA 1OS8A 2EA3A 2IOTA 3TITA 1TPSA 4O03A 1WAYB 4BAHB 2XC0A 1QQ4A 1EAUA 1QL8A 1CT4E 4MPXA 2ZTZA 1GJAB 1O3DA 1QA7A 1ETSH 1GI9B 2GT7A 1Z8GA 1FPHH 1O2JA 3K65B 2KAIA 1BRAA 3C1KA 1O5BB 1SR5C 3KNXA 3B9FH 3VB3A 2FI3E 1PQAA 3SUDA 4AYYB 2AFQB 1C2JA 1RXPA 4Y8ZA 2OQ5A 3A8BA 3N7OA 5A8ZA 4YESB 3A85A 1SGFG 1W7GH 1PPBH 1ABIH 1O2NA 2G51A 4CRFA 2Y6TA 2QC2A 1OPHB 4Y6DA 4KP0A 1QRWA 4I8JA 1NU9A 1GG6C 1WTHD 2ZIQH 3TGIE 2ZCHP 2W7SA 5L30H 4CH2B 1O2WA 4ZH8A 1ZRBA 3BTFE 2ZDVH 3V3MA 5T6FA 3U1IB 1MCTA 1JXPA 2P8OC 4LXBH 3QLPH 3RM2H 4DGJA 1IQMA 1FDPA 2BLOA 1MBMA 1WSSH 1EPTC 1TFXA 4KELA 2GV7A 1CVWH 4ZUHA 2GZ7A 5DP5A 3SO3A 4KGAA 3URCA 1AE8H 3E91A 4X6MA 1P2MA 1B7XB 2OXSA 1OWEA 3AASA 6CHAB 4CR9A 1Y3VA 1TALA 4GPGA 4ABFA 2VGCB 1UTKA 3CP7A 4J2YB 3V12A 1P0SH 3KQBA 1EZXC 4U32A 1PQ7A 4UD9H 1GDQA 1LQDB 3TGJE 2HNTF 3QK1A 5A0BA 1O2GH 1TGBA 4ISIH 1XXDA 5BPEA 1ANEA 1ARBA 2BDYA 1O30A 3FANA 1WV7H 1NO9H 1C1NA 1YBWA 5DP8A 4K69A 3F68H 1QBVH 3SBKA 1AU8A 1OP2A 4YM9A 2FOBA 1YC0A 2XTTB 3F9GA 5JBTA 1GMCG 2R3YA 2VIWA 1ZHPA 2BMGB 4DY7B 2G5VA 1UVPA 4BAKB 4JYUH 1C2DA 1KDQB 2P3FH 1SVPA 1J15A 1P3EA 2CXVA 1O3LA 5EQSA 2XC4A 1GHBF 1SMFE 4Y0YE 5DP9A 4Q80A 3RP2A 3F9FA 1ZSJA 1BUIA 4TYDA 1K1MA 3A8DA 1G37A 1GPZA 3FP7E 3DFJA 4TWYA 2Z9KA 1RJXB 1QHRB 1C2EA 1UHBB 1DY8A 2UWOA 4B1TA 1C2IA 1H4WA 1HAPH 3BEUA 1O33A 1CO7E 3VGCB 1BBRK 3T5FH 4D76A 1Z7KA 2FX4A 4R0IA 2ZDLA 1TIOA 1AY6H 1C1VH 3MFJA 2P94A 1TGCA 2VVCA 1EZQA 2ODPA 2P95A 1LHFH 1J17T 1C2FA 3PTBA 1Z1IA 3E16B 4OS7A 2ILNA 4INLA 3UUZA 3MNSA 1CBWC 2GT8A 3P70B 3ZZ3A 1WCZA 1DXWA 4WH6A 1TPAE 1P8VC 1ZR0A 2SFAA 3A7ZA 3E0NB 2XC5A 1XUIA 2Z9LA 7GCHG 3M35A 2QA9E 5FPSA 1O0DH 2Z3CA 3ITIA 1S5SA 2F9NA 2V3HH 4I31A 5GDSH 3MNBA 1TMTH 1HAVB 2CJIA 3SJ9A 1GJCB 1TPOA 2EC9H 4KKDA 2Z9IA 2VIQA 4K1EA 3GCTG 3TU7H 1CQQA 4WF8A 3K2UA 4BXSA 1HGTH 4FXGH 1AFQC 4LK4A 4WWYA 1V2UT 4CREA 1RRKA 2G8TA 2THFB 4NCYA 4XBCA 3MO9A 3RXAA 3GICB 1G30B 2AERH 3M7QA 3U69H 3E3TA 1FQ3A 1ANDA 1O3PB 4D7GA 3UQOA 1QJ6B 1MCVA 1T4VH 4FU7A 1O2XA 2J38A 2SGEE 1RTFB 4YTAA 2BQ6B 2BQ7B 2FZZA 5DP6A 2SNWA 3UWIA 4YT6H 1CGHA 1CT2E 1XUHA 3SU4A 3BTDE 1BTHH 4Y79A 4ZMAH 1HLTH 3BG4C 2FI4E 2TRMA 3T62A 2Q1JA 4X6OA 2ZPQA 4CRCA 1UTLM 4FUIA 3A8AA 2FX6A 3VFEA 2AIPA 3RM0H 4H4FA 4WXIA 3U9AH 3QX5H 1D3PB 1GCDA 1HXEH 2ZFPH 1MMJN 1BMNH 1L1GA 1QGFA 1O36A 3I77A 4UONA 1E36B 5LH8A 3RLWH 1AZZA 3PO1C 1ESAA 1LVYA 4X1RU 3B8JA 2GCTC 1DY9A 1RIWC 2PUQH 5SGAE 2WINI 3M5OA 1TOMH 1N8OB 4WMEA 3T29A 1P9SA 3ZYEA 2BDAA 1CA0C 3RU4D 1GHZA 1V3XA 4RSPA 1YLCA 1SLUB 1UTOA 3LC3A 5EPYA 1GBTA 1SGDE 2R3UA 1ZSKA 4DURA 3RXRA 1QJ1B 1V6DA 3LU9B 5GCHG 2RDLA 5EW2H 3GY4A 4X6NA 1QCPA 1JRSA 1TLDA 1QL7A 1NRQH 3SNCA 1SLXB 1BIOA 2GCHG 4VGCC 3QDZB 2AEIH 4GCHG 1FI8A 1YPHC 1QL9A 1PQ5A 3TH2H 2Z6BD 4ZROA 4MQAA 5FBIA 2FOHA 2WUBA 2ZA5A 1ELFA 2HNTE 1AIXH 1D6RA 2GZ9A 2ZP0H 1KTSB 1FMGA 5A8YA 1BOQA 2R0LA 4DG4A 1UK2A 3RC6A 3TGKE 2QYIA 1EJAA 4AYVB 2D26C 2AMDA 3AW1A 4OS5A 3RXTA 3A87A 4JK5A 3A82A 1KYNA 2UUJB 4NSYA 4NFEA 5GIBA 2G00A 3RXCA 5E0HA 3T27A 4AB9A 5LPEA 1XMNB 3PROA 2OC8A 1K1JA 1O5GH 5EOKA 3BIUH 3RDZA 3EGKH 1MD7A 1JWTA 1OP0A 1GI4A 1C5UA 1FUJA 3DUXH 2AMPA 1BA8B 1ELBA 1EOJA 3M5LA 1XVMA 2BD4A 1HAHH 3BTHE 4IC5A 1GI2A 1YCPM 2BX4A 2CMYA 1NFWA 5GJ4B 2XBVA 4H6SB 4O3UA 2B5TB 1V2MT 4Q2KA 4OS1A 1XXFA 3BTKE 4JMYA 3DA9B 2AGEX 4MDSA 2Z3EA 2Y80A 4WXVA 1P03A 1S82A 1ZTLA 1GBJA 2GCHF 3GCOA 2PSYA 2A2XH 1CU1A 2O8TA 1VITH 2Y81A 3GISB 4GSOA 5DP7A 5EGMA 4LZ1H 1FN6A 2XXLA 3MH7A 3U8OH 3GY8A 2QV1A 1EJNA 1SG8B 5T6DA 4AN7A 3GDSA 1Z8RA 3C27B 2BVRH 1YPGH 3MYWA 2C90B 4YT7H 3RXJA 5C1UA 1QNJA 3OY5U 2ZPRA 4FVDA 2QXGA 1DX5M 3OU0A 3VXFH 1H9HE 1Y5UT 2YNAA 3RMLH 1VCQA 2IN2A 4Y0ZE 1F7ZA 1TPPA 3O8CA 3MNCA 3LPRA 3BF6H 4K5ZA 4DIHH 1RFNA 5GXPA 3ENSB 2C93B 3HK3B 1KIGH 1UVSH 1YF4A 4ISHH 5HM2A 2PTCE 1GL0E 1TX6A 1KLJH 1EZSC 1O2ZA 2QIQA 1HAOH 1TGSZ 1SQAA 1TGNA 4ABGA 2RA0A 1VZQH 5IDKA 2H9HA 1HBTH 1O3OA 8ESTE 1QFKH 3SJOA 1SSXA 1DVAH 1DANH 3PO1B 1DM4B 2BD5A 3RXMA 4MG3A 3SI3H 1BHXF 2M5TA 3E6PH 3K6YA 5TCAA 3GDUA 1VITG 2OLGA 1VCPA 3R0FA 1ZZZA 1C2KA 1O37A 3MU5A 4UDWH 3W95A 1SFQB 2GCTB 1GBHA 2CN0H 1UTJA 3H5CB 3NK8A 5HYOA 3LT3A 1XVOA 4JYVH 3HGPA 2WV5A 4A1TA 5F03A 1BBRE 5JBAS 5AHGH 5A0CA 1BMLA 2H1UA 2VGCC 3BN9A 4UFFH 5L2YH 1TNJA 1CA0B 3SU3A 1O31A 1W0YH 5DP4A 6GCHG 4LZ4B 1S0RA 1JIMA 1O3CA 5C67A 1SGYE 5FBEA 1IAUA 1BTWA 3LDXH 3F1SB 2ZHQH 1DSTA 1SQOA 2PR3A 4E05H 1SL3A 3F9HA 1ZGVA 1F5KU 1K22H 1L4ZA 3RU4E 1ZMJA 1BTXA 9LPRA 5FPTA 2ZZUH 3I29A 2BOKA 2F83A 4GVUA 1BMAA 1CSOE 2BD9A 4WMFA 2FOGA 1BQYA 4AB8A 3A8CA 4CRAA 1L1NA 5A09A 1H8IH 2Z9GA 3ZZ5A 8LPRA 3SHCH 1EPTA 1ARCA 2PUXB 2ZFTA 2A7CA 1YCPH 2PLXA 4HI3A 1C5XB 4NIWA 1E38B 3JZ1B 1DT2A 2ZGCA 3NUMA 1TBRH 2ZQ1A 2ULLA 4WMDA 1A46H 5JYIA 2K1QA 1FONA 4B73A 5C5NA 3LOXA 2XWAA 3NZIA 4AFZA 1T8NA 4ZAEA 4I8HA 3RXHA 2OBOA 4Z0KA 4M7GA 2OCVB 5EU8A 1GI7B 1PPHE 5FAHA 3SQEE 2HOBA 3OY6U 1Y5BT 1V2OT 5JPMH 2C4FH 4OGXA 3BTQE 4AFUA 2TGPZ 1WUNH 3BEIB 3CS0A 3AAVA 1GGDC 3QGJA 4UEHH 1G2MA 1OWJA 2AS9A 1ZTKA 2FM2A 1P11E 5E8EH 5TJXA 1TB6H 2SGAA 1FY5A 4ZXYH 1AE5A 1HIAB 2Q6GA 1EB2A 3RXKA 2ZCKP 1O2VA 2PKAB 2CV3A 1RD3B 4Y7BA 3RMMH 2GTBA 1YCPK 3MH4A 3UPEA 1IQEA 3P8NA 1KLTA 3MU1A 2BM2A 1GJ6A 2GV6A 7KMEH 5GWZA 1M9UA 2OC1A 1TWXB 1Q3XA 1O2HA 3URDA 4DOQA 1C5YB 2ZGBH 1KXEA 1UCYH 2B9LA 4X1SU 2G81E 1TQ0B 4K3JA 1AB9B 2A7JA 5FCKA 2XWBI 1S83A 1SGRE 1HRTH 2J94A 3HKIB 3ATWA 1GMHF 2UUFB 1ZLRA 1CHOG 1PQ8A 5E2OA 4I32A 5LPRA 1EQ9A 3EA9A 2OC7A 3GYLB 5T6GA 3KCGH 1GDNA 1XUJA 3ZZDA 2WYGA 1H1BA 3HATH 1INCA 3G01A 2GD4B 1IOEA 1G3DA 4FUFA 1P3CA 2EI8A 3AVZA 5I46H 2F9BH 2GX4A 4IGDA 1MZDA 2A4RA 3VXEH 2PW8H 2P16A 1UMAH 1A2CH 2ZEBA 1GHBG 1O2YA 1O34A 1OXGA 1IQIA 2CHAB 1GBKA 5JB9S 1E37B 1NU7B 1DWEH 3MO6A 1GJ8B 1RS0A 1GI1A 1RTLA 3SHAH 2BOHB 2XNIA 1C5MD 2J95A 1P04A 1UCYK 2BXTH 1TAWA 2H9EH 2JH0D 1GBIA 1V2JT 3VB7A 1LKAA 2ZU5A 4JK6A 1BTPA 1F0TA 5A2MH 1K9OE 2AGGX 2JH6D 3KL6A 2RG3A 4Q7YA 3RXIA 3GDVA 1K21H 4FUDA 1C5OH 1AO5A 1GHYH 4HZHA 3ZVFA 2W5EA 1Y3YA 1JIRA 2ZFSA 3MI4A 1N8OC 1O3EA 5HXFA 1EJMA 1QA0A 1N6XA 1CHOF 3DFLA 1HFDA 4DJZB 1C5LH 1ID5H 3H7OA 1YLDA 4D7FA 4X1PU 5J4QA 3SGQE 3SI4H 3TK9A 5LPFA 2WV4A 1DXPA 1TNHA 3KEEA 1U6QA 2C8XB 5LGOA 1TGTA 1QY6A 1V2WT 3P8GA 2ZU3A 2B7DH 2FMJA 1LO6A 2W7UA 1LPZB 5EXNA 3UR6A 1W12U 2Y5HA 2QF0A 5JBCS 1C4V2 1VGCB 2BDBA 1A5HA 3MU8A 2WPKS 3TH4H 2AMQA 5AFZH 2ODQA 3T2NA 4AX9H 1SQTA 2A0QB 4IC6A 1S0QA 2C8ZB 5HMAA 3A86A 1DFPA 2O8LA 2A1DB 2A4QA 5C20A 1OYTH 1DOJA 1VCWA 1PYTD 3IITA 1F5LA 2ZPSA 4WVPE 1HCGA 4TY7A 1SB1H 4KTUA 3BIVH 3SV7A 3MH5A 1GGDB 1Y8TA 1OKXA 1H9IE 4XFQA 2XCNA 2A7HA 3BTWE 1AKSA 4ZXXH 3EA8A 4HGCA 5TCCA 4BXWA 2JETC 1PPZA 3ZV8A 1Y59T 1AWFH 4IMQA 4Y8XA 1A1RA 1EATA 2SGDE 3UIRA 1QTFA 2EI6A 2WYJA 1S6FA 2GDEH 1E34B 3KF2A 2ZHFH 1GI0A 3O8BA 1O5AB 3TNTA 3SJ8A 6ESTA 4AG2A 1V2VT 4YOJA 1VJ9U 1K1LA 3K9XB 1O2KA 3L3TA 1QB9A 1G3CA 4JZEH 1N1LA 1FV9A 1JMOH 3WY8A 4LOYH 1ANBA 3IG6B 1YPJH 4D9QA 1O39A 4BNRA 2P3UB 3KN2A 3IWMA 3FP8E 4Y11E 2ZHEH 1B0FA 2F9OA 1UVOA 3GY7A 4TWWA 3NCLA 3TH3H 5DPAA 3S9BA 1D9IA 3Q76A 3RMOH 4B76A 3ZV9A 4TPYA 2BLVA 1F92A 1ESBA 3EE0B 2NU3E 1QB6A 3PWCA 1SGPE 4X1QU 3SORA 2ANYA 2A5IA 1UVUH 2HNTC 1Y3WA 2VIVA 1QRZA 1PPFE 3ZZ6A 4GHQA 2AGIX 1FPCH 4I33A 3M3VA 3QTVH 1SLWB 1EXFA 4NZQA 3GY5A 2PV9B 1W13U 2HPQH 3A88A 2P93A 3GYMA 3TJNA 4B75A 4UE7H 1YPMH 4KTCA 3SU0A 4CR5A 2FXRA 1PYTC 4DVAU 2VU8E 1KXAA 3O8DA 2FS8A 4MNXA 3SNBA 1O3FA 3HK6B 4E7NA 2O9QA 3ZYDA 7ESTE 1BTYA 1GHAF 1SC8U 1BJUA 1FIZA 1FJSA 2BY7X 5F8ZA 2J92A 5DJ7A 1HAYB 5DKMA 1ZYOA 4CBNA 1LTOA 1WTGH 1P02A 3RXBA 3LIWA 1ACBE 4Y71A 2BQWB 4THNH 4AORA 4JZDH 1NC6A 5HM9A 4X2YA 1TRYA 1TYNA 8KME2 2VIDA 1C1MA 1EUFA 1SGQE 1Z8JB 4OGYA 4A5TS 3D49H 4CRBA 1C5PA 4JYTA 2FOCA 3LGYA 2LPRA 2HPPH 5I25A 4RKOB 2BD8A 1QB1A 2PGBB 1OP8A 1F5RA 1F0RA 2CGAA 2FPZA 4ABAA 1MQ6A 1LHDH 2ODYB 3V0XA 2XW9A 1VJAU 1OWHA 1J8AA 2PKSB 1AN1E 1A4WH 2A2QH 4INHA 2AIQA 2OUAA 3FFGA 2BLQA 5F6MA 4I8KA 1AUTC 1GMDG 3SV8A 5DO4H 2Y5GA 1P2JA 1OX1A 1O3JA 3LGTA 5A0AE 2KAIB 5A8XA 1HJ8A 3ZZ9A 1MKXH 1UK3A 3SQHE 4BANB 5PTPA 1IQJA 2HLCA 1GBMA 4ISOA 4NWLA 3A7YA 4DW2U 1XUKA 3P8OA 2BZ6H 1ZMLA 2ZO3H 2OQUA 2JETB 1XUFA 4K1SA 4RKJB 1LHGH 2FTMA 5B6OA 2ZTXA 3ATKA 4YZUA 1UTNA 5C1XA 2Y7ZA 1SBWA 3RXSA 3VB4A 1GCTC 4NSVA 3RUOA 1DDJA 2I6SA 2ZWLH 2Z9JA 3RXUA 3SZNA 2W3IA 1ZHMA 3SN8A 3ODFA 3TK6A 2DE9A 1O2QA 5JDUB 2B0FA 3UNQA 5EXLA 2ZQ2A 3SU5A 1C5RA 1HUTH 1GVKB 1KDQA 1SGIB 4X8TH 1D3QB 1UCYE 2QAAA 3AW0A 3PMJA 1O2RA 3PLBA 5EODA 5T3HA 2BDCA 3EA7A 3TK5A 2CF8H 1EKBB 1GI6A 2ZTYA 3D23A 3S7KB 1L2EA 1MKXK 4GAWA 1MU6B 1UHBA 2IPHA 1ELAA 1QIXB 1P2QA 3DT0H 1XX9A 1BB0B 4ZKOU 1FNIA 1O2MA 1W0ZU 2VWMA 2XCFA 4AGKA 1AB9C 1GMDF 2ZFRH 3F6UH 4A1XA 1SGNE 1JRTA 3QN7A 1DWBH 2PSXA 1B0EA 1CE5A 1TNGA 1HB0B 1MTUA 2A4GA 1O35A 2SGQE 2ZGXH 1PPGE 3QTOH 1T4UH 1DUEA 1A5IA 4FUHA 4B74A 1TX8A 2RA3A 1AQ7A 2HRVA 3B23B 3LGIA 3PLPA 1ETRH 4FUBA 3P92A 3NPSA 2FDAA 1KXCA 1FY8E 1BITA 1PJPA 3TLOA 4X0WU 5E0GA 3STIA 2Z7FE 1AHTH 4NIYA 4MNYA 1GBFA 1ZPCA 1LVMA 3M3SA 1Y5AT 2ZHWH 1KLIH 3SV9A 1GJ5H 4ABHA 3QZRA 1LCYA 2VVVA 1P2OA 4X2VA 1MD8A 1ETTH 1HAVA 2ALVA 2CHAC 3U1JB 2ZKSA 1SFIA 1C2GA 1WQVH 3FAOA 1N6YA 1CA8B 2GDDA 2RCEA 2FYRA 1O3AA 5C1YA 3SUFA 5C3NA 2GMTC 4XBBA 2J34A 1EAWA 1GI5A 1ORFA 1TBQH 1K28D 3A7VA 1D6WA 1A5GH 1S84A 1UTQA 1ZOMA 3AAUA 4ISNA 1AD8H 1ESTA 2F91A 4ISLA 3OSYA 3K6ZA 2ESTE 1NFXA 1QJ7B 3A7TA 2UUYA 2B8OH 1BRCE 3KIDU 4SGAE 4AZ2B 3BSQA 1O2UA 1FAXA 1P12E 4GUXA 1DE7H 2SNVA 1HNEE 1NS3A 1K1IA 3BTME 4ABBA 1S85A 1E35B 2J4IA 2VNTA 4H42U 4ZHAA 3SGAE 2ZDMA 1LVBA 2R2WU 2BTCE 4BAQB 4IS5A 2ALPA 3A84A 4JZ1A 5FXLA 3BTTE 1TA2A 3SOSA 5J4SA 2ZHDA 8GCHG 2STBE 4YO9A 3SV2H 1K1PA 1THPB 2GZ8A 1C2MA 3SJKA 1D3TB 4JCNA 3UFAA 5CMXH 6LPRA 3TIUA 1K1OA 1P2NA 1TRNA 1GHXH 2PWXA 1QRXA 4IMZA 2O8UA 1C1WH 1C5TA 2BY9X 2J9NA 3RXGA 2V35A 3TVJB 4F49A 1Y3XA 2ZDKA 1NROH 1VGCC 1A61H 2TBSA 1PPEE 3RC4A 1HJAC 1YM0A 1MTVA 1MH0A 1GMHG 2ZI2H 4Q7XA 4GHTA 1OOKB 1BTZA 1DWDH 1XM1A 1GHVH 4F4OC 5L2ZH 1KTTB 3SV6A 1JOUB 4BOHA 4A6LA 3MU4A 4ASHA 1XUGA 2NU4E 3UNSA 2FESH 1T32A 1Q31A 4INKA 1O2TA 1NY22 2OD3B 3FZDA 4ZKNU 1BMMH 4J1YA 3DHKH 1GCTB 1ZRKA 3GY6A 1GBCA 3M5NA 1V2NT 1TABE 1C2LA 5F8XA 3UOPA 1EZUC 1TNLA 2STAE 4B2BA 1Z6JH 5DGJA 1AVGH 9ESTA 2GVFA 3D62A 1MBQA 3A80A 5DG6A 1HYLA 4HFPB 1O5CB 2BYAX 3RXDA 4NWKA 1AZ8A 1KY9A 3RXPA 4B71A 5BRRE 3UWJH 8GCHF 3UNRA 4MPVA 1J14A 1UTPA 4O9VA 2VWOA 4O3TA 1HAXB 1KXDA 1NFYA 2J2UA 1W11U 4JZIA 2DE8A 4A7IB 1TQ7B 2FOMB 3PB1E 4AFQA 2HVXA 1K2I1 1SPJA 3M7UA 1F2SE 5DK1A 2F9UA 1FY1A 1A0HB 3V7TA 3QGNB 4YOGA 2QY0B 4WJG2 1IQKA 2BLWA 1FY4A 2G52A 3VB6A 1LHCH 4BTIB 1FN8A 1GJ4H 1V2ST 3VB5A 2BXUH 4XOJA 4A1VA 1EX3A 1Y3UA 1V2TT 1NFUA 1C1RA 1P57B 1BDAA 3PYHA 3UREA 1V2KT 3U98H 2F9VA 1BZXE 1P06A 3TJVA 4MLFB 1GJDB 2YNBA 4PROA 5CE1A 3M61U 1T7CA 1SLVB 1Z71A 1A3EH 2BD3A 1GI3A 2Y5FA 1PFXC 2GMTB 1MUEB 2Q6DA 1O3GA 2WUCA 4K8BA 1O2PA 3ZZCA 2ANWA 1ELDE 1OWDA 1C4U2 2H5CA 2QXJA 4TY6A 1WU1A 2QF3A 4RN6A 3SW2B 5L6NH 2G5NA 3Q77A 1AMHA 3ZZBA 1C1SA 3SNEA 1Z8IB 3KQDA 2FI5E 4QT8C 4CRDA 1ZSLA 2VVUA 4U2WA 2XRCA 1SHYA 1O3IA 3ZVBA 2H5DA 3ESTA 5EXMA 2PFEA 3NWUA 1AI8H 1KSNA 5K0HA 4UFGH 2BX3A 1L4DA 1KXFA 2A5AA 1NRSH 3T25A 1SI5H 3LH3A 3QZQA 2A31A 1W14U 2ZDNA 4MPUA 1EP5A 3O8RA 3U8TH 1AVWA 2DUCA 1BBRH 3ATIA 1NESE 4GLYA 4A92A 1ELCA 4X2XA 3TJUA 2YOLA 2UWPA 2VIPA 1SOZA 3MWIU 2FLRH 3T28A 2W26A 4MTBA 3PTNA 1O2SA 3LONA 4E7RG 1NTPA 3MMGA 3QWCH 1MTNB 1TONA 1H8DH 3D65E 4WY3A 1HXFH 1SOTA 3F9EA 1HAIH 1YKTA 1TOCB 4BTTB 1HJAB 1RGQA 3L6PA 1TX7A 2BD2A 4FUGA 4CHAC 1A3BH 3EQ0H 3STJA 2FYQA 1FXYA 1SGFA 1MU8B 3M5MA 1P09A 1IHSH 5EPNA 3M37A 1G36A 3TPIZ 1ELTA 5EQRA 4FUJA 2PKSC 1IQFA 1O2IA 3FVFB 4BTUB 2FOFA 4HTCH 1TRMA 4XBDA 3RXOA 2BDHA 4XE4A 3BEFB 1MQ5A 1OSSA 3PV4A 2NU2E 3FZZA 4NA8A 2R9PA 4X2WA 3GOVB 1C5NH 2R0KA 1AUJA 4DIIH 4DCDA 5FPYA 5JBBS 5HGGA 1ZJDA 3ZVAA 2BDIA 3GCHC 3LGVA 1LVOA 1EP6A 3H7TA 3FP6E 1D3DB 1THRH 2P3TB 2ZGJA 2IJOB 1O3HA 1MTSA 1DPOA 4NGAH 3NXPA 1CT0E 2V3OH 1YYY1 4U01A 4UFDH 3VPKA 1DUAA 2TPIZ 1O2OA 3LKWA 3RC5A 1LMWB 1IQGA 4U30A 4ABEA 1C1UH 1AGJA 1VR1H 5K7RA 4FVBA 1ABJH 2HALA 5FX6A 1TNIA 2XBXA 3W94A 5G4BA 4IN2A 4K1TA 1UJ1A 1C2HA 4UFEH 1P2IA 1BCUH 1T8LA 1YPEH 2ZC9H 2UUKB 1C5WB 4JZFH 1GMCF 4BAOB 1Z6EA 2XBYA 1W8BH 1GHAG 2FIRH 1XKAC 1GDUA 5GPIB 3U8RH 1P01A 2OC0A 1BHXB 1C9TA 2QCYA 3PMBB 2BZAA 4Y8YA 2VINA 3LJJA 1MZAA 3ZVEA 2P59A 2PGQB 2ZNKH 4AG1A 3JZ2B 2BVXH 2HWLB 2A32A 2TGTA 2OTVA 1TNKA 4FUCA 3RU4T 1MAYA 4ABJA 1NRRH 2OINA 1C1QA 1MKWH 1HAGE 1XKBC 2JH5D 3CS7A 2ASUB 5IYTA 3ZZAA 2NWNA 3MOCA 1O3MA 1GHWH 4FU9A 1EB1H 1BRUP 4FU8A 5C2ZA 1LDTT 1GG6B 2FOAA 1G3EA 2HGTH 4X8UH 3GY2A 1O3NA 5AF9H 1OWKA 3SU6A 3PM3A 1HIAA 4XDEA 2PKAA 1YPLH 2FLBH 1HPGA 2P8OB 3PMHB 2FODA 1QR3E 1A0LA 2TIOA 4ZHLU 3S69A 1EPTB 2V6NA 4E06H 4D9RA 2PHBA 4IBLH 2ZDAH 4NFFA 5EQQA 5AFYH 2W3KA 1WBGB 1J9CH 7GCHF 1PPCE 2ZGHA 4YLQH 1NT1A 4YOIA 4Q7ZA 3ELAH 3Q3KA 1KXBA 1UTMA 2D2DA 3Q3YA 2H9TH 1C1OA 3E1XB 3EDXB 4K2YA 2O8WA 4B2AA 2CF9H 2QGRA 2WPMS 1GBBA 3GCTF 1C4Y2 1LPGB 5FCRA 3ODDA 3A83A 2ZG0H 1P9UA 2I6QA 1DLKB 1MKWK 1DSUA 3UQVA 4MNVA 1S6HA 3MTYA 3S9AA 2BY8X 3RLYH 3ZZ7A 1G32B 4IN1A 1GBLA 3SJIA 4X1NU 2FO9A 4K8YA 5FX5A 3SGBE 2ZECA 4NIXA 2ZU2A 4D8NA 7LPRA 1ZPZA 1ZHRA 2BB4A 2G4UA 5E0JA 1L1JA 2ANMH 1EASA 1DITH 1NRNH 4OS6A 4CHAB 1V2QT 2BY5X 1TMUH 1MTWA 2QXIA 3L33A 1GJ9B 1JBUH 1NZQH 2F9PA 2AYWA 1IQNA 4XSKU 5AVDA 3S9CA 1W7XH 1DICA 3UOUA 2A4OA 1EAXA 2GKVE 4R8TB 2D1JA 4CH8B 4ZKRU 1GBEA 3E90B 1O3KA 3SU1A 1O5EH 3ATMA 1QBNA 4MPWA 4B2CA 1X7AC 1SGCA 2Y7XA 4Z6AH 4OS2A 1HV7A 3PLKA 1GJBB 2FTLE 2TGDA 3LC5A 3UTUH 3GCHB 1YPKH 3DD2H 1GBAA 1TMBH 4DT7B 1G9IE 2EI7A 2VWLA 2ZCLP 3RXLA 3A7WA 1OYQA 3HKJB 3LGUA 1E0FD 1MAXA 2SGFE 1H9LB 1BRBE 1ZGIA 1SHHB 1LHEH 1C5ZB 1AWHB 1ANCA 1J16A 4CRGA 1HAZB 3E8LA 3ZVGA 3MO3A 1AFEH 1CBWB 3ZVCA 3ZVDA 1A7SA 2A5KA 2H6MA 1HDTH 3OTJE 3EAJA 1ELEE 1O3BA 1NPMA 1BTUA 1OWIA 5CHAC 4TPIZ 1O5FH 1GI8B 1A0JA 1GVZA 2NU1E 2BY6X 3SNDA 3GY3A 2VJ1A 2D8WA 3S7HB 3MNXA 1W10U 2ZU1A 2ANKH 4ABDA 5GCHF 1YP9A 1LPKB 3P95A 3QO6A 1BJVA 1CGIE 1AFQB 1FIWA 1P2KA 2G4TA 2TGAA 3P17H 4BAMB 2Q6FA 4GCHF 1UVTH 3R3GB 1IHTH 1C9PA 3A7XA 3EYDA 4I8LA 2OP9A 3TNSA 1YPHE 3SUEA 1C1TA 2BDGA 4FUEA 1HJ9A 4KTSA 3M3TA 4NA9H 4Y10E 5ETXA 2GGVB 2PTNA 1NM6A 1G2LA 2VH0A 3HPTB 3OX7U 3SU2A 5ABWA 1S81A 4NIVA 4AOQA 3ZZ4A 4H6TA 2R2MB 2XBWA 3PMAB 1O5DH 4ESTE 1F0SA 1F0UA 2C3SA 2FP7B 2WPLS 3LGWA 4I7YH 2ZFFH 1YGCH 4WH8A 3BG4B 2OBQA 4NZLA 2H2ZA 1P05A 3BTGE 1C5QA 4YLUA 2ZU4A 1GJ7B 1V2PT 1EAIA 3KHVA 4MVNA 5H4IB 1Q2WA 5E2PA 3T26A 1GBDA 1EOLA 2VIOA 2ZF0H 3RXQA 1NN6A 3RXVA 1LQEA 1W3CA 3P6ZB 2BD7A 1C1PA 4CBOA 2FOEA 3Q3XA 1TBZH 3P8FA 2A45B 3UR9A 3M36A 1V2LT 1B5GH 4AGJA 1AVXA 1RIWB 2Z3DA 1DWCH 2BVSH 1WOFA 1GWAA 3UY9A 2FEQH 2NU0E 4ZHMU 5F8TA 1P10A 6CHAC 1C5VA 4X8SH 3BTEE 1L0ZA 1QQUA 1ZPBA 2O8MA 1GL1A 3TJOA 3V13A 1LKBA 3VEQB 1QBOA 4X8VH 5EW1H 3LH1A 1AKSB 1QURH 1ZMNA 3CENA 1ELGA 3QUMP 2VWNA 1RTKA 5JB8S 1BT7A 2VH6A 3A81A 1IQHA 4SGBE 3RMNH 1W2KH 2AH4X 2JKHA 4I8GA 3MH6A 3SUGA 1ZJKA 2QN5T 1FZZA 1FAKH 1D4PB 3ATLA 4VGCB 4MNWA 2XYAA 2C8WB 2G55A 2Y82A 1CGJE 4X6PA 2UWLA 1WQSA 3HGNA 1MTNC 1Z1JA 2FWWA 1V2RT 4AFSA 5EG4A 1ELVA 1TA6A 4Y76A 5ESBA 3S0NA 4NA7A 3MHWU 3SNAA 1UK4A 1T31A 2LNCA 3OYPA 2F3CE 1IQLA 5ESTE 1G3BA 3KGPA 1VITF 2ZFQH 1SGEE 2GP9B 3RXFA 1T8MA 1O32A 1CHGA 2BHGA 1WYKA 3MU0A 3GCNA
chains in the Genus database with same CATH superfamily
5FHTA 4ZKSU 1C5SA 2WPJS 3NKKA 4Y7AA 1DLEA 1O38A 5CHAB 5EIYA 2WPIS 3VGCC 2VB0A 1TE0A 6GCHF 2C8YB 4YXWD 1ZTJA 4K60A 4NG9H 3Q00A 1T8OA 1NRPH 2JDID 3M7TA 4ABIA 5DP3A 2Z94A 3BV9B 4O97A 3RXEA 1FLEE 3E0PB 4RI0A 2OK5A 1GVLA 1K1NA 2QXHA 3BG8A 1THSH 3LJOA 1VKYA 1DS2E 2V0BA 3I78A 3KQEA 2SGPE 4IW4E 3ZZ8A 1O2LA 2FS9A 1SGTA 4OS4A 1FY3A 3A89A 3KQCA 2EEKA 1UO6A 2WPHS 3SZEA 3PWBA 5C5OA 1OS8A 2EA3A 2IOTA 3TITA 1TPSA 4O03A 1WAYB 4BAHB 2XC0A 1QQ4A 1EAUA 1QL8A 1CT4E 4MPXA 2ZTZA 1GJAB 1O3DA 1QA7A 1ETSH 1GI9B 2GT7A 1Z8GA 1FPHH 1O2JA 3K65B 2KAIA 1BRAA 3C1KA 1O5BB 1SR5C 3KNXA 3B9FH 3VB3A 2FI3E 1PQAA 3SUDA 5GNDA 4AYYB 2AFQB 1C2JA 1RXPA 4Y8ZA 2OQ5A 3A8BA 3N7OA 5A8ZA 4YESB 3A85A 1SGFG 1W7GH 1PPBH 1ABIH 1O2NA 2G51A 4CRFA 2Y6TA 2QC2A 1OPHB 4Y6DA 4KP0A 1QRWA 4I8JA 1COWD 1NU9A 1GG6C 1WTHD 2ZIQH 3TGIE 2ZCHP 2W7SA 5L30H 4CH2B 1O2WA 4ZH8A 1ZRBA 3BTFE 2ZDVH 3V3MA 5T6FA 3U1IB 1MCTA 1JXPA 2P8OC 4LXBH 3QLPH 3RM2H 4DGJA 1IQMA 1FDPA 2BLOA 1MBMA 5EJLA 1WSSH 1EPTC 1TFXA 4KELA 2GV7A 1CVWH 4ZUHA 2GZ7A 5DP5A 3SO3A 4KGAA 3URCA 1AE8H 3E91A 4X6MA 1P2MA 1B7XB 2OXSA 2IJD1 1OWEA 3AASA 6CHAB 4CR9A 1Y3VA 3W1EA 1TALA 4GPGA 4P00A 4ABFA 2VGCB 1UTKA 3CP7A 4J2YB 3V12A 1P0SH 3KQBA 1EZXC 4U32A 1PQ7A 4UD9H 1GDQA 1LQDB 3TGJE 2HNTF 3QK1A 5A0BA 1O2GH 1TGBA 4ISIH 1E79D 1XXDA 5BPEA 1ANEA 1ARBA 3GS9A 2BDYA 1O30A 3FANA 5C17A 1WV7H 1NO9H 2K0QA 1C1NA 2QF5A 1YBWA 5DP8A 4K69A 3F68H 1QBVH 3SBKA 1AU8A 1OP2A 4YM9A 2FOBA 1YC0A 2XTTB 3F9GA 5JBTA 1GMCG 2R3YA 2JJ2D 2VIWA 1ZHPA 2BMGB 4DY7B 2G5VA 1UVPA 4BAKB 4JYUH 4F55A 1C2DA 1KDQB 2P3FH 1SVPA 1J15A 1P3EA 2CXVA 1O3LA 5EQSA 2XC4A 1GHBF 1SMFE 4Y0YE 3N7EA 4Q80A 3RP2A 5DP9A 3F9FA 1ZSJA 1BUIA 4TYDA 1K1MA 3A8DA 1G37A 1GPZA 3FP7E 3DFJA 4TWYA 2Z9KA 1RJXB 4XRNA 5T1VA 1QHRB 1C2EA 1UHBB 1DY8A 2UWOA 4B1TA 1C2IA 1H4WA 1HAPH 3BEUA 1O33A 1CO7E 3VGCB 1BBRK 3T5FH 4D76A 1Z7KA 2FX4A 4R0IA 2ZDLA 1TIOA 1AY6H 1C1VH 1NBMD 3MFJA 2P94A 1TGCA 2VVCA 1EZQA 2ODPA 2P95A 1LHFH 1J17T 1C2FA 3PTBA 1Z1IA 3E16B 2WHXA 4OS7A 2ILNA 4INLA 3UUZA 3MNSA 1CBWC 2GT8A 3P70B 3ZZ3A 1WCZA 1DXWA 4WH6A 1TPAE 1P8VC 1ZR0A 2SFAA 3A7ZA 3E0NB 3KYGA 2XC5A 1XUIA 2Z9LA 7GCHG 1EFRD 3M35A 2QA9E 5FPSA 1O0DH 2Z3CA 3ITIA 1S5SA 2F9NA 2V3HH 4I31A 5GDSH 3MNBA 1TMTH 1HAVB 2CJIA 3SJ9A 1GJCB 1TPOA 2EC9H 4KKDA 2Z9IA 2VIQA 4K1EA 3GCTG 2KM0A 3TU7H 1CQQA 4WF8A 3K2UA 2JIZD 3N7DA 4BXSA 1HGTH 4FXGH 1AFQC 4LK4A 4WWYA 1V2UT 4OM9A 4CREA 1RRKA 2G8TA 2THFB 4NCYA 4XBCA 3MO9A 3RXAA 3GICB 1G30B 2AERH 3M7QA 2V3MA 3U69H 3E3TA 1FQ3A 1ANDA 1O3PB 1W0KD 4D7GA 3UQOA 1QJ6B 1MCVA 3CNRA 1T4VH 4FU7A 1O2XA 2J38A 2SGEE 2RDEA 1RTFB 4YTAA 2BQ6B 2XNDD 2BQ7B 3UAIC 2FZZA 5DP6A 2SNWA 3UWIA 4YT6H 1CGHA 1CT2E 1XUHA 3SU4A 3BTDE 1BTHH 4Y79A 4ZMAH 1HLTH 2KZ4A 3BG4C 2FI4E 3FOAA 2TRMA 3T62A 2Q1JA 4X6OA 2ZPQA 4CRCA 1UTLM 4FUIA 3A8AA 2FX6A 3VFEA 2AIPA 3RM0H 4H4FA 4WXIA 2KFWA 3U9AH 3QX5H 1D3PB 1GCDA 1HXEH 2ZFPH 1MMJN 1BMNH 2KCOA 1L1GA 1QGFA 1O36A 3I77A 4UONA 1E36B 5LH8A 3VG8A 3RLWH 1AZZA 3PO1C 1ESAA 1LVYA 4X1RU 3B8JA 2GCTC 1DY9A 1KMHB 1RIWC 2PUQH 5SGAE 2WINI 3M5OA 1TOMH 4ACAA 1N8OB 4WMEA 3T29A 1P9SA 3ZYEA 2BDAA 1CA0C 3RU4D 1GHZA 1V3XA 4RSPA 1YLCA 4HG6A 1SLUB 1UTOA 3LC3A 5EPYA 1GBTA 1SGDE 2R3UA 1ZSKA 4DURA 3RXRA 1QJ1B 1V6DA 3LU9B 5GCHG 2RDLA 5EW2H 3GY4A 4X6NA 4Q63A 2VBCA 1QCPA 1JRSA 1TLDA 1QL7A 1NRQH 3SNCA 1SLXB 1BIOA 2GCHG 4VGCC 3QDZB 2AEIH 1YWUA 4GCHG 1FI8A 1YPHC 1QL9A 1PQ5A 3TH2H 2Z6BD 4ZROA 4MQAA 5FBIA 2FOHA 2WUBA 2ZA5A 1ELFA 2HNTE 1AIXH 1D6RA 4ASUD 2GZ9A 2ZP0H 3PV5A 1KTSB 3FN8A 1FMGA 5A8YA 1BOQA 2R0LA 4DG4A 1UK2A 3RC6A 3TGKE 2QYIA 1EJAA 4AYVB 2D26C 2AMDA 3AW1A 4OS5A 3RXTA 3A87A 4JK5A 3A82A 1KYNA 2UUJB 4NSYA 4NFEA 5GIBA 2G00A 3RXCA 5E0HA 3T27A 4AB9A 5LPEA 1XMNB 3PROA 2OC8A 1K1JA 1O5GH 3DCLA 5EOKA 3BIUH 3RDZA 3EGKH 1MD7A 1JWTA 1OP0A 1GI4A 1C5UA 1FUJA 3DUXH 2AMPA 1BA8B 1ELBA 1EOJA 3M5LA 1XVMA 2BD4A 1HAHH 3BTHE 4IC5A 1GI2A 1YCPM 2BX4A 2CMYA 1NFWA 5GJ4B 2XBVA 4H6SB 4O3UA 2B5TB 1V2MT 4Q2KA 4OS1A 1XXFA 3BTKE 4JMYA 3DA9B 3F0OA 2AGEX 4MDSA 2Z3EA 2Y80A 4WXVA 1P03A 1S82A 1ZTLA 1GBJA 2XOKD 2GCHF 3GCOA 2V7QD 2PSYA 2A2XH 1CU1A 2O8TA 1VITH 2Y81A 3GISB 4GSOA 5DP7A 5EGMA 5B6LA 4LZ1H 1FN6A 2XXLA 3MH7A 3U8OH 3GY8A 2QV1A 1EJNA 1SG8B 5T6DA 4AN7A 3GDSA 1Z8RA 3C27B 2BVRH 1YPGH 3MYWA 2C90B 4YT7H 3RXJA 5C1UA 1QNJA 3OY5U 2ZPRA 4FVDA 2QXGA 1DX5M 3OU0A 3VXFH 1H9HE 1Y5UT 2YNAA 3RMLH 1VCQA 2IN2A 4Y0ZE 1F7ZA 1TPPA 3O8CA 3MNCA 3LPRA 3BF6H 4K5ZA 4DIHH 1RFNA 5GXPA 3ENSB 2C93B 3HK3B 1KIGH 1UVSH 1YF4A 4ISHH 5HM2A 2PTCE 1GL0E 1TX6A 1H8HD 2M2AA 1KLJH 2K8IA 1EZSC 1YLNA 1O2ZA 2QIQA 1HAOH 1TGSZ 1SQAA 1TGNA 4ABGA 2RA0A 1VZQH 5IDKA 2H9HA 1HBTH 1O3OA 8ESTE 1QFKH 3SJOA 1SSXA 1DVAH 1DANH 3PO1B 1DM4B 2BD5A 3RXMA 4MG3A 3SI3H 1BHXF 2M5TA 3E6PH 3K6YA 5TCAA 5C0UA 3GDUA 1VITG 2OLGA 1VCPA 3R0FA 1ZZZA 2EQNA 1C2KA 1O37A 3MU5A 4UDWH 3W95A 1SFQB 2GCTB 1GBHA 2CN0H 1UTJA 3H5CB 3NK8A 5HYOA 3LT3A 1XVOA 4JYVH 3HGPA 2WV5A 4A1TA 5F03A 1BBRE 5JBAS 5AHGH 3PRDA 1BMLA 2H1UA 2VGCC 3BN9A 5A0CA 4UFFH 5L2YH 1TNJA 1CA0B 3SU3A 1O31A 1W0YH 5DP4A 6GCHG 4LZ4B 1S0RA 1JIMA 1O3CA 5C67A 1SGYE 5CDFE 5FBEA 1IAUA 1BTWA 3LDXH 5HIYA 3F1SB 2ZHQH 1DSTA 1SQOA 2PR3A 4E05H 1SL3A 3F9HA 1ZGVA 1F5KU 1K22H 1L4ZA 3RU4E 1ZMJA 1BTXA 2J98B 9LPRA 5FPTA 2ZZUH 3I29A 2BOKA 2F83A 4GVUA 1BMAA 1CSOE 2BD9A 4WMFA 2FOGA 3FKSD 1BQYA 4AB8A 3A8CA 4CRAA 1L1NA 5A09A 1H8IH 2Z9GA 3ZZ5A 8LPRA 3SHCH 1EPTA 1ARCA 2PUXB 2ZFTA 2A7CA 1YCPH 2PLXA 4HI3A 1C5XB 4NIWA 2EY4C 1E38B 3JZ1B 1DT2A 2ZGCA 3NUMA 1TBRH 2ZQ1A 2ULLA 4WMDA 1A46H 2QF4A 2K1QA 1FONA 4B73A 5C5NA 3LOXA 2XWAA 3NZIA 4AFZA 5JYIA 1T8NA 4ZAEA 2YMSD 4I8HA 3RXHA 2OBOA 4Z0KA 4M7GA 2OCVB 5EU8A 1GI7B 1PPHE 5FAHA 3SQEE 2HOBA 3OY6U 1Y5BT 1V2OT 5JPMH 2C4FH 4OGXA 3KYFA 3BTQE 4AFUA 2TGPZ 1WUNH 3BEIB 3CS0A 3AAVA 1GGDC 3QGJA 4UEHH 1G2MA 1OWJA 2AS9A 1ZTKA 2FM2A 1P11E 5E8EH 5TJXA 1TB6H 2SGAA 1FY5A 4ZXYH 1AE5A 1HIAB 2Q6GA 1EB2A 3RXKA 2ZCKP 1O2VA 2PKAB 2CV3A 1RD3B 4Y7BA 3RMMH 2GTBA 1YCPK 3MH4A 3UPEA 1IQEA 3P8NA 1KLTA 1SKYE 2BM2A 1GJ6A 2GV6A 3MU1A 7KMEH 5GWZA 1M9UA 2OC1A 1TWXB 1Q3XA 1O2HA 3URDA 4DOQA 3DSOA 1C5YB 2ZGBH 1KXEA 1UCYH 2B9LA 4X1SU 2G81E 1TQ0B 4K3JA 1AB9B 2A7JA 5FCKA 2XWBI 1S83A 1SGRE 1HRTH 2J94A 5DN6D 3HKIB 3ATWA 1GMHF 2UUFB 1ZLRA 1CHOG 1PQ8A 5E2OA 4I32A 5LPRA 1EQ9A 3EA9A 2OC7A 3GYLB 5T6GA 3KCGH 1GDNA 1XUJA 3ZZDA 2WYGA 1H1BA 2W6ID 3HATH 1INCA 3G01A 2GD4B 1IOEA 1G3DA 4FUFA 1P3CA 2EI8A 3AVZA 5I46H 2F9BH 2GX4A 4IGDA 1MZDA 2A4RA 3VXEH 2PW8H 2P16A 1UMAH 1A2CH 2L6OA 3U28C 2ZEBA 1GHBG 1O2YA 1O34A 1OXGA 1IQIA 2CHAB 1GBKA 5JB9S 1E37B 1NU7B 1DWEH 3MO6A 1GJ8B 3ZIAD 1RS0A 1GI1A 1RTLA 3SHAH 3NRLA 2BOHB 2XNIA 1C5MD 2J95A 1P04A 1UCYK 2BXTH 5KGOA 1TAWA 2H9EH 2JH0D 1GBIA 1V2JT 2YMSC 3VB7A 1LKAA 2ZU5A 2L74A 4JK6A 1BTPA 1F0TA 5A2MH 3H09A 1K9OE 2AGGX 2JH6D 3KL6A 2RG3A 3PV2A 4Q7YA 3RXIA 3GDVA 1K21H 4FUDA 1C5OH 1AO5A 1GHYH 1WXRA 4HZHA 3ZVFA 2W5EA 3WWBA 1Y3YA 1JIRA 2ZFSA 3MI4A 1N8OC 1O3EA 5HXFA 1EJMA 1QA0A 1N6XA 1CHOF 3DFLA 1HFDA 4DJZB 1C5LH 1ID5H 3H7OA 1YLDA 4D7FA 4X1PU 5J4QA 3SGQE 3SI4H 3TK9A 5LPFA 2WV4A 1DXPA 1TNHA 3KEEA 1U6QA 2C8XB 2J97A 5LGOA 1TGTA 1QY6A 1V2WT 3P8GA 2WSSD 2W6JD 2ZU3A 3DSPA 2B7DH 2FMJA 1LO6A 2W7UA 1LPZB 5EXNA 3UR6A 1W12U 2Y5HA 2QF0A 5JBCS 3WWFA 1C4V2 1VGCB 2BDBA 1A5HA 3MU8A 2WPKS 3TH4H 2AMQA 5AFZH 2ODQA 3T2NA 4AX9H 1SQTA 2A0QB 4IC6A 1S0QA 2C8ZB 5HMAA 3A86A 1DFPA 2O8LA 2A1DB 2A4QA 5C20A 1OYTH 1DOJA 1VCWA 1PYTD 3IITA 1F5LA 2ZPSA 4WVPE 5CHBA 1HCGA 4TY7A 1SB1H 4KTUA 3BIVH 3SV7A 3MH5A 1GGDB 1Y8TA 1OKXA 1H9IE 4XFQA 2XCNA 2A7HA 3BTWE 4Z1MD 1AKSA 3OEHD 3EA8A 4ZXXH 4HGCA 5TCCA 4BXWA 2JETC 1PPZA 3ZV8A 1Y59T 1AWFH 4IMQA 4Y8XA 1A1RA 1EATA 2SGDE 3UIRA 1QTFA 2EI6A 2WYJA 1S6FA 2GDEH 1E34B 3KF2A 2ZHFH 1GI0A 3O8BA 1O5AB 3TNTA 3SJ8A 6ESTA 4AG2A 1V2VT 4YOJA 1VJ9U 1K1LA 3K9XB 1O2KA 3L3TA 1QB9A 1G3CA 4JZEH 1N1LA 1FV9A 1JMOH 3WY8A 4LOYH 1ANBA 3IG6B 1YPJH 4D9QA 1O39A 4BNRA 2P3UB 3KN2A 3IWMA 3FP8E 4Y11E 2WPDD 2ZHEH 1B0FA 2F9OA 1UVOA 3GY7A 4TWWA 3NCLA 3TH3H 5DPAA 3S9BA 1D9IA 3Q76A 3RMOH 4B76A 3KQ5A 3ZV9A 4TPYA 2BLVA 1F92A 1ESBA 3EE0B 2NU3E 2F4LA 1QB6A 3PWCA 2F43B 1SGPE 4X1QU 4RT1A 3SORA 2J5UA 2ANYA 2A5IA 1UVUH 2HNTC 1Y3WA 5C94A 2VIVA 1QRZA 1PPFE 3ZZ6A 5IK2D 2WZQA 4GHQA 2AGIX 1FPCH 4I33A 3M3VA 3QTVH 1SLWB 1EXFA 4NZQA 3GY5A 2PV9B 1W13U 2HPQH 3A88A 2YMSB 2P93A 3GYMA 3TJNA 4B75A 4UE7H 1YPMH 4KTCA 3SU0A 4CR5A 2FXRA 1PYTC 4RT0A 4DVAU 2VU8E 1KXAA 3O8DA 2FS8A 4MNXA 3SNBA 1O3FA 3HK6B 4E7NA 2O9QA 3ZYDA 7ESTE 1BTYA 1GHAF 1SC8U 1BJUA 1FIZA 4AC9A 1FJSA 2BY7X 5F8ZA 2J92A 5DJ7A 1HAYB 5DKMA 1ZYOA 4CBNA 1LTOA 1WTGH 1P02A 3RXBA 1SQRA 3LIWA 1ACBE 4Y71A 2BQWB 4THNH 4AORA 4JZDH 1NC6A 5HM9A 2KCAA 4X2YA 1TRYA 1TYNA 1OHHD 8KME2 2VIDA 1C1MA 1EUFA 1SGQE 1Z8JB 4OGYA 4A5TS 3D49H 4CRBA 1C5PA 4JYTA 2FOCA 3LGYA 2LPRA 2HPPH 5I25A 4RKOB 2BD8A 3EE7A 1QB1A 2PGBB 1OP8A 1F5RA 1F0RA 2CGAA 2FPZA 4ABAA 1MQ6A 1LHDH 2ODYB 3V0XA 2XW9A 1VJAU 1OWHA 1J8AA 2PKSB 1E1RD 1AN1E 1A4WH 2A2QH 4INHA 2AIQA 2OUAA 3FFGA 2BLQA 5F6MA 4I8KA 1AUTC 1GMDG 3SV8A 5DO4H 2Y5GA 1P2JA 1OX1A 1O3JA 3LGTA 5A0AE 2KAIB 5A8XA 1HJ8A 3ZZ9A 1MKXH 1UK3A 3SQHE 4BANB 5PTPA 1IQJA 2HLCA 1GBMA 4ISOA 4NWLA 3A7YA 4DW2U 1XUKA 3P8OA 2BZ6H 1ZMLA 2ZO3H 2OQUA 2JETB 1XUFA 4K1SA 4RKJB 1LHGH 2FTMA 3OTPA 5B6OA 2ZTXA 3ATKA 4YZUA 1UTNA 5C1XA 2Y7ZA 1SBWA 3RXSA 3VB4A 1GCTC 4NSVA 3RUOA 1DDJA 2I6SA 2ZWLH 2Z9JA 3RXUA 3SZNA 2W3IA 1ZHMA 3SN8A 3ODFA 3TK6A 2DE9A 1O2QA 5JDUB 2B0FA 3UNQA 5EXLA 2ZQ2A 3SU5A 1C5RA 1HUTH 1GVKB 1KDQA 1SGIB 4X8TH 1D3QB 1UCYE 2QAAA 3AW0A 3PMJA 1O2RA 3PLBA 5EODA 1WDIA 5T3HA 2BDCA 3EA7A 3TK5A 2CF8H 1EKBB 1GI6A 2ZTYA 3D23A 3S7KB 1L2EA 1MKXK 4GAWA 1MU6B 1UHBA 2IPHA 5DSFA 1ELAA 1QIXB 1P2QA 3DT0H 1XX9A 1BB0B 4ZKOU 1FNIA 1O2MA 1W0ZU 2VWMA 2XCFA 4AGKA 1AB9C 1GMDF 2ZFRH 3F6UH 4A1XA 1SGNE 1JRTA 4P02A 3QN7A 1DWBH 2PSXA 1B0EA 1CE5A 1TNGA 1HB0B 1MTUA 2A4GA 1O35A 2SGQE 2ZGXH 1PPGE 3QTOH 1T4UH 1DUEA 1A5IA 4FUHA 4B74A 1TX8A 2RA3A 1AQ7A 2HRVA 3B23B 3LGIA 3PLPA 1ETRH 4FUBA 3P92A 3NPSA 2FDAA 1KXCA 1FY8E 1BITA 1PJPA 3TLOA 4X0WU 5E0GA 3STIA 2Z7FE 1AHTH 4NIYA 4MNYA 1GBFA 1ZPCA 1LVMA 3M3SA 1Y5AT 1QZ8A 2ZHWH 1KLIH 3SV9A 1GJ5H 4ABHA 5KEDA 3QZRA 1LCYA 2VVVA 1P2OA 4X2VA 1MD8A 1ETTH 1HAVA 2ALVA 2CHAC 3U1JB 2ZKSA 4I86A 1SFIA 1C2GA 1WQVH 3FAOA 1N6YA 1CA8B 2GDDA 2RCEA 2FYRA 1O3AA 5C1YA 3SUFA 5C3NA 2GMTC 4XBBA 2J34A 1EAWA 1GI5A 1ORFA 1TBQH 2HVYB 1K28D 3A7VA 1D6WA 1A5GH 1S84A 1UTQA 1ZOMA 3AAUA 4ISNA 1AD8H 1ESTA 2F91A 4ISLA 3OSYA 3K6ZA 2ESTE 1NFXA 1QJ7B 3A7TA 2UUYA 2B8OH 1BRCE 3KIDU 4SGAE 4AZ2B 3BSQA 1O2UA 1FAXA 1P12E 4GUXA 1DE7H 2SNVA 1HNEE 1NS3A 1K1IA 3BTME 4ABBA 1S85A 1E35B 1MABB 2J4IA 2VNTA 4H42U 4ZHAA 3SGAE 2ZDMA 1LVBA 2R2WU 2BTCE 4BAQB 4IS5A 2ALPA 3A84A 4JZ1A 5FL7D 5FXLA 3BTTE 1TA2A 3SOSA 5J4SA 2ZHDA 8GCHG 2STBE 4YO9A 3SV2H 1K1PA 1THPB 2GZ8A 1C2MA 3SJKA 1D3TB 4JCNA 3PRBA 3UFAA 5CMXH 6LPRA 3TIUA 1K1OA 1P2NA 1TRNA 1GHXH 2PWXA 1QRXA 4IMZA 2O8UA 1C1WH 1C5TA 2BY9X 2J9NA 3RXGA 2V35A 3TVJB 4F49A 1Y3XA 2ZDKA 1NROH 1VGCC 1A61H 2TBSA 3SYJA 1PPEE 3RC4A 1HJAC 1YM0A 1BMFD 4F48B 1MTVA 1MH0A 5EJ1A 1GMHG 2ZI2H 4Q7XA 4GHTA 1OOKB 1BTZA 1DWDH 1XM1A 1GHVH 5KECA 1K0HA 4F4OC 5L2ZH 1KTTB 3SV6A 1JOUB 4BOHA 4A6LA 3MU4A 4ASHA 1XUGA 2NU4E 3UNSA 2FESH 1T32A 1Q31A 4INKA 1O2TA 1NY22 2OD3B 3FZDA 4ZKNU 1BMMH 3F0PA 4J1YA 3DHKH 1GCTB 1ZRKA 3GY6A 4TT3D 1GBCA 3M5NA 1V2NT 1TABE 1C2LA 3N99A 5F8XA 3UOPA 2KCYA 1EZUC 1TNLA 2STAE 4B2BA 1Z6JH 5DGJA 1AVGH 9ESTA 2GVFA 3D62A 1MBQA 3A80A 5DG6A 1HYLA 4HFPB 1O5CB 2BYAX 3RXDA 4NWKA 1AZ8A 1KY9A 3RXPA 4B71A 5BRRE 3UWJH 8GCHF 3UNRA 4MPVA 1J14A 2PP6A 1UTPA 4O9VA 2VWOA 2GJGA 4O3TA 1HAXB 1KXDA 1NFYA 2J2UA 1W11U 4JZIA 2DE8A 4A7IB 1TQ7B 2FOMB 3PB1E 4AFQA 2HVXA 1K2I1 1SPJA 2IPQX 3M7UA 1F2SE 5DK1A 4B6FA 2F9UA 1FY1A 1A0HB 3V7TA 3QGNB 4YOGA 2QY0B 4WJG2 1IQKA 2BLWA 1FY4A 2G52A 3VB6A 1LHCH 4BTIB 1FN8A 1GJ4H 1V2ST 3VB5A 2BXUH 4XOJA 4A1VA 1EX3A 1Y3UA 1V2TT 1NFUA 1C1RA 1P57B 1BDAA 5HIZA 3F2HA 3PYHA 3UREA 1V2KT 3U98H 2F9VA 1BZXE 1P06A 3TJVA 4MLFB 1GJDB 2YNBA 4PROA 3F3BA 5CE1A 3M61U 1T7CA 1SLVB 1Z71A 1A3EH 2BD3A 1GI3A 2Y5FA 1PFXC 2GMTB 1MUEB 2Q6DA 1O3GA 2WUCA 4K8BA 1O2PA 3ZZCA 2ANWA 1ELDE 1OWDA 1C4U2 2H5CA 2QXJA 4TY6A 1WU1A 2QF3A 3OEED 4RN6A 3SW2B 5L6NH 2G5NA 3Q77A 1AMHA 3ZZBA 1C1SA 3SNEA 1Z8IB 3KQDA 2FI5E 4QT8C 4CRDA 1ZSLA 2VVUA 4U2WA 2XRCA 1SHYA 1O3IA 3ZVBA 2H5DA 3ESTA 5EXMA 2PFEA 5HKKD 3NWUA 1AI8H 1KSNA 5K0HA 4UFGH 2BX3A 1L4DA 1KXFA 2A5AA 1NRSH 3T25A 4ZCNA 1SI5H 3LH3A 3QZQA 2A31A 1W14U 2ZDNA 4MPUA 1EP5A 3O8RA 3U8TH 1AVWA 2DUCA 1BBRH 3AK5A 3ATIA 1NESE 4GLYA 4A92A 1ELCA 4X2XA 3TJUA 2YOLA 2UWPA 2VIPA 1SOZA 3MWIU 2FLRH 3T28A 2W26A 4MTBA 3PTNA 1O2SA 3LONA 4E7RG 1NTPA 3OE7D 3MMGA 3QWCH 1MTNB 1TONA 1H8DH 3D65E 4WY3A 1HXFH 1S6LA 1SOTA 3F9EA 1HAIH 1YKTA 1TOCB 4BTTB 1HJAB 1RGQA 3L6PA 1TX7A 2BD2A 4FUGA 4CHAC 1A3BH 3EQ0H 3STJA 2FYQA 1FXYA 1SGFA 1MU8B 3M5MA 1P09A 1IHSH 5EPNA 3M37A 1G36A 3TPIZ 1ELTA 5EQRA 4FUJA 2PKSC 1IQFA 1O2IA 3FVFB 4BTUB 2FOFA 4HTCH 1TRMA 4XBDA 3RXOA 2BDHA 4XE4A 3BEFB 1MQ5A 3FO8D 3OFND 1OSSA 3PV4A 2NU2E 3FZZA 4NA8A 2R9PA 4X2WA 3GOVB 1C5NH 2R0KA 1AUJA 4DIIH 4DCDA 5FPYA 5JBBS 5HGGA 1ZJDA 3ZVAA 2BDIA 3GCHC 3LGVA 1LVOA 1EP6A 3H7TA 3FP6E 1D3DB 1THRH 2P3TB 2ZGJA 2IJOB 1O3HA 1MTSA 1DPOA 4NGAH 3NXPA 1CT0E 2J98A 2V3OH 1YYY1 4U01A 4UFDH 3VPKA 1DUAA 2TPIZ 1O2OA 3LKWA 3RC5A 1LMWB 1IQGA 4U30A 4ABEA 1C1UH 2LELA 1AGJA 1VR1H 5K7RA 4FVBA 1ABJH 2HALA 5FX6A 1TNIA 2XBXA 3W94A 5G4BA 4IN2A 4K1TA 1UJ1A 1C2HA 4UFEH 1FX0B 1T8LA 1BCUH 1P2IA 1YPEH 2ZC9H 4B6EA 2UUKB 1C5WB 4JZFH 1GMCF 4BAOB 1Z6EA 2XBYA 1W8BH 1GHAG 2LP6A 2FIRH 1XKAC 1GDUA 2AHME 5GPIB 3U8RH 3F2FA 1P01A 2OC0A 1BHXB 1C9TA 2QCYA 3PMBB 2BZAA 4Y8YA 2VINA 3LJJA 1MZAA 3ZVEA 2P59A 2PGQB 2ZNKH 4AG1A 3JZ2B 2BVXH 2HWLB 2A32A 2TGTA 2OTVA 1TNKA 4FUCA 3RU4T 1MAYA 4ABJA 1NRRH 2QE7D 2OINA 1H8ED 1C1QA 1MKWH 1HAGE 1XKBC 2JH5D 3CS7A 2ASUB 5IYTA 3ZZAA 2NWNA 3MOCA 1O3MA 1GHWH 4FU9A 1EB1H 1BRUP 4FU8A 5C2ZA 1LDTT 1GG6B 2FOAA 1G3EA 2HGTH 4X8UH 3GY2A 1O3NA 5AF9H 1OWKA 3SU6A 3PM3A 1HIAA 4XDEA 2PKAA 1YPLH 2FLBH 1HPGA 4FETA 2P8OB 3PMHB 2FODA 1QR3E 1A0LA 2TIOA 4ZHLU 3S69A 3OAAD 1EPTB 4XD7D 2V6NA 4E06H 4D9RA 2WV9A 2PHBA 4IBLH 2ZDAH 4NFFA 5EQQA 5AFYH 2W3KA 1WBGB 1J9CH 7GCHF 1PPCE 2ZGHA 4YLQH 1NT1A 4YOIA 4Q7ZA 3ELAH 3Q3KA 1KXBA 1UTMA 2D2DA 3Q3YA 2H9TH 2KR7A 1C1OA 3E1XB 3EDXB 4K2YA 2O8WA 4B2AA 2CF9H 2QGRA 2WPMS 1GBBA 3GCTF 1C4Y2 2CK3D 1LPGB 2RFKC 5FCRA 3ODDA 3A83A 2ZG0H 3WW7A 4FOUC 1P9UA 3MQKC 2I6QA 1DLKB 1MKWK 1DSUA 3UQVA 4MNVA 1S6HA 3MTYA 3S9AA 2BY8X 3RLYH 3ZZ7A 1G32B 4IN1A 1UW7A 1GBLA 3SJIA 4X1NU 2FO9A 4K8YA 5FX5A 3SGBE 2ZECA 4NIXA 2ZU2A 4D8NA 7LPRA 1ZPZA 1ZHRA 2G4UA 2BB4A 5E0JA 1L1JA 2ANMH 1EASA 1DITH 1NRNH 4OS6A 4CHAB 1V2QT 2BY5X 1TMUH 1MTWA 2QXIA 3L33A 1GJ9B 1JBUH 1NZQH 2F9PA 2AYWA 1IQNA 4XSKU 5AVDA 3S9CA 1W7XH 1DICA 3UOUA 2A4OA 1EAXA 2GKVE 4R8TB 2D1JA 4CH8B 4ZKRU 1GBEA 3E90B 1O3KA 3SU1A 1O5EH 3ATMA 1QBNA 4MPWA 4B2CA 1X7AC 5F53A 1SGCA 2Y7XA 4Z6AH 4OS2A 1HV7A 2KX4A 3PLKA 1GJBB 2FTLE 2TGDA 3LC5A 3UTUH 3GCHB 1YPKH 3DD2H 1GBAA 4M9FA 1TMBH 4DT7B 1G9IE 2EI7A 2VWLA 2ZCLP 3RXLA 1E1QD 3A7WA 1OYQA 3HKJB 3LGUA 1E0FD 1MAXA 2SGFE 1H9LB 1BRBE 1ZGIA 1SHHB 3UB0A 1LHEH 1C5ZB 1AWHB 4ACBA 1ANCA 1J16A 4CRGA 1HAZB 3E8LA 3ZVGA 3MO3A 1AFEH 1CBWB 3ZVCA 3ZVDA 1A7SA 2A5KA 2H6MA 1HDTH 1NBME 3EAJA 3OTJE 1ELEE 1O3BA 1NPMA 1BTUA 1OWIA 5EJZA 5CHAC 4TPIZ 1O5FH 1GI8B 1A0JA 1GVZA 2NU1E 2BY6X 3SNDA 3GY3A 2VJ1A 2D8WA 3S7HB 3F2GA 2KCPA 3MNXA 1W10U 2ZU1A 2ANKH 4ABDA 5GCHF 1YY3A 1YP9A 1LPKB 1W0JD 3P95A 3QO6A 1BJVA 1CGIE 1AFQB 1FIWA 1P2KA 2G4TA 4DT4A 2TGAA 3P17H 4BAMB 2Q6FA 4GCHF 1UVTH 3R3GB 1IHTH 1C9PA 3A7XA 3EYDA 4I8LA 2OP9A 3TNSA 1YPHE 3SUEA 1C1TA 2BDGA 4FUEA 1HJ9A 4KTSA 3M3TA 4NA9H 4Y10E 5ETXA 2GGVB 2PTNA 1NM6A 1G2LA 2VH0A 3HPTB 3OX7U 3SU2A 5ABWA 1S81A 4NIVA 4AOQA 3ZZ4A 4H6TA 2R2MB 2XBWA 3PMAB 1O5DH 4ESTE 1F0SA 1F0UA 2C3SA 2FP7B 2WPLS 3LGWA 4I7YH 2ZFFH 1YGCH 4WH8A 3BG4B 2OBQA 4NZLA 2H2ZA 1P05A 3BTGE 1C5QA 4YLUA 2ZU4A 1GJ7B 1V2PT 1EAIA 3KHVA 4MVNA 5H4IB 1Q2WA 5E2PA 3T26A 1GBDA 1EOLA 2VIOA 2ZF0H 3RXQA 1NN6A 3RXVA 1LQEA 1W3CA 3P6ZB 2BD7A 1C1PA 4CBOA 2FOEA 3Q3XA 1TBZH 3P8FA 2A45B 3UR9A 3M36A 1V2LT 1B5GH 4AGJA 1AVXA 1RIWB 2Z3DA 5C0TA 1DWCH 2BVSH 1WOFA 1GWAA 3UY9A 2FEQH 2NU0E 4ZHMU 5F8TA 1P10A 6CHAC 1C5VA 4Q4LA 4X8SH 3BTEE 1L0ZA 1QQUA 1ZPBA 2O8MA 1GL1A 3TJOA 3V13A 1LKBA 3VEQB 1QBOA 4X8VH 5EW1H 3LH1A 1AKSB 1QURH 1ZMNA 3CENA 1ELGA 3QUMP 2VWNA 1RTKA 5JB8S 1BT7A 2VH6A 3A81A 1IQHA 4SGBE 3RMNH 1W2KH 2AH4X 2JKHA 4I8GA 3MH6A 3SUGA 1ZJKA 2QN5T 1FZZA 1FAKH 1D4PB 3ATLA 4VGCB 4MNWA 2XYAA 2C8WB 2G55A 2Y82A 1CGJE 4X6PA 2UWLA 3DSGA 1WQSA 2HLDD 3HGNA 1MTNC 1Z1JA 2FWWA 1V2RT 4AFSA 5EG4A 1ELVA 1TA6A 4Y76A 5ESBA 3S0NA 4TSFD 4NA7A 3MHWU 3SNAA 1UK4A 1T31A 2JJ1D 2LNCA 3OYPA 2F3CE 1IQLA 5ESTE 1G3BA 3KGPA 1VITF 2ZFQH 1SGEE 2GP9B 3RXFA 1T8MA 1O32A 1CHGA 2BHGA 1WYKA 3MU0A 3GCNA
chains in the Genus database with same CATH topology
5FHTA 4ZKSU 1C5SA 2WPJS 3NKKA 4Y7AA 1DLEA 1O38A 5CHAB 2WPIS 3VGCC 2VB0A 1TE0A 6GCHF 2C8YB 1ZTJA 4K60A 4NG9H 3Q00A 1T8OA 1NRPH 3M7TA 4ABIA 5DP3A 2Z94A 3BV9B 4O97A 3RXEA 1FLEE 3E0PB 1GVLA 1K1NA 2QXHA 3BG8A 1THSH 3LJOA 1DS2E 2V0BA 3I78A 3KQEA 2SGPE 4IW4E 3ZZ8A 1O2LA 2FS9A 1SGTA 4OS4A 1FY3A 3A89A 3KQCA 2EEKA 1UO6A 2WPHS 3PWBA 5C5OA 1OS8A 2EA3A 2IOTA 3TITA 1TPSA 4O03A 1WAYB 4BAHB 2XC0A 1QQ4A 1EAUA 1QL8A 1CT4E 4MPXA 2ZTZA 1GJAB 1O3DA 1QA7A 1ETSH 1GI9B 2GT7A 1Z8GA 1FPHH 1O2JA 3K65B 2KAIA 1BRAA 3C1KA 1O5BB 1SR5C 3KNXA 3B9FH 3VB3A 2FI3E 1PQAA 3SUDA 4AYYB 2AFQB 1C2JA 1RXPA 4Y8ZA 2OQ5A 3A8BA 3N7OA 5A8ZA 4YESB 3A85A 1SGFG 1W7GH 1PPBH 1ABIH 1O2NA 2G51A 4CRFA 2Y6TA 2QC2A 1OPHB 4Y6DA 4KP0A 1QRWA 4I8JA 1NU9A 1GG6C 1WTHD 2ZIQH 3TGIE 2ZCHP 2W7SA 5L30H 4CH2B 1O2WA 4ZH8A 1ZRBA 3BTFE 2ZDVH 3V3MA 5T6FA 3U1IB 1MCTA 1JXPA 2P8OC 4LXBH 3QLPH 3RM2H 4DGJA 1IQMA 1FDPA 2BLOA 1MBMA 1WSSH 1EPTC 1TFXA 4KELA 2GV7A 1CVWH 4ZUHA 2GZ7A 5DP5A 3SO3A 4KGAA 3URCA 1AE8H 3E91A 4X6MA 1P2MA 1B7XB 2OXSA 1OWEA 3AASA 6CHAB 4CR9A 1Y3VA 1TALA 4GPGA 4ABFA 2VGCB 1UTKA 3CP7A 4J2YB 3V12A 1P0SH 3KQBA 1EZXC 4U32A 1PQ7A 4UD9H 1GDQA 1LQDB 3TGJE 2HNTF 3QK1A 5A0BA 1O2GH 1TGBA 4ISIH 1XXDA 5BPEA 1ANEA 1ARBA 2BDYA 1O30A 3FANA 1WV7H 1NO9H 1C1NA 1YBWA 5DP8A 4K69A 3F68H 1QBVH 3SBKA 1AU8A 1OP2A 4YM9A 2FOBA 1YC0A 2XTTB 3F9GA 5JBTA 1GMCG 2R3YA 2VIWA 1ZHPA 2BMGB 4DY7B 2G5VA 1UVPA 4BAKB 4JYUH 1C2DA 1KDQB 2P3FH 1SVPA 1J15A 1P3EA 2CXVA 1O3LA 5EQSA 2XC4A 1GHBF 1SMFE 4Y0YE 5DP9A 4Q80A 3RP2A 3F9FA 1ZSJA 1BUIA 4TYDA 1K1MA 3A8DA 1G37A 1GPZA 3FP7E 3DFJA 4TWYA 2Z9KA 1RJXB 1QHRB 1C2EA 1UHBB 1DY8A 2UWOA 4B1TA 1C2IA 1H4WA 1HAPH 3BEUA 1O33A 1CO7E 3VGCB 1BBRK 3T5FH 4D76A 1Z7KA 2FX4A 4R0IA 2ZDLA 1TIOA 1AY6H 1C1VH 3MFJA 2P94A 1TGCA 2VVCA 1EZQA 2ODPA 2P95A 1LHFH 1J17T 1C2FA 3PTBA 1Z1IA 3E16B 4OS7A 2ILNA 4INLA 3UUZA 3MNSA 1CBWC 2GT8A 3P70B 3ZZ3A 1WCZA 1DXWA 4WH6A 1TPAE 1P8VC 1ZR0A 2SFAA 3A7ZA 3E0NB 2XC5A 1XUIA 2Z9LA 7GCHG 3M35A 2QA9E 5FPSA 1O0DH 2Z3CA 3ITIA 1S5SA 2F9NA 2V3HH 4I31A 5GDSH 3MNBA 1TMTH 1HAVB 2CJIA 3SJ9A 1GJCB 1TPOA 2EC9H 4KKDA 2Z9IA 2VIQA 4K1EA 3GCTG 3TU7H 1CQQA 4WF8A 3K2UA 4BXSA 1HGTH 4FXGH 1AFQC 4LK4A 4WWYA 1V2UT 4CREA 1RRKA 2G8TA 2THFB 4NCYA 4XBCA 3MO9A 3RXAA 3GICB 1G30B 2AERH 3M7QA 3U69H 3E3TA 1FQ3A 1ANDA 1O3PB 4D7GA 3UQOA 1QJ6B 1MCVA 1T4VH 4FU7A 1O2XA 2J38A 2SGEE 1RTFB 4YTAA 2BQ6B 2BQ7B 2FZZA 5DP6A 2SNWA 3UWIA 4YT6H 1CGHA 1CT2E 1XUHA 3SU4A 3BTDE 1BTHH 4Y79A 4ZMAH 1HLTH 3BG4C 2FI4E 2TRMA 3T62A 2Q1JA 4X6OA 2ZPQA 4CRCA 1UTLM 4FUIA 3A8AA 2FX6A 3VFEA 2AIPA 3RM0H 4H4FA 4WXIA 3U9AH 3QX5H 1D3PB 1GCDA 1HXEH 2ZFPH 1MMJN 1BMNH 1L1GA 1QGFA 1O36A 3I77A 4UONA 1E36B 5LH8A 3RLWH 1AZZA 3PO1C 1ESAA 1LVYA 4X1RU 3B8JA 2GCTC 1DY9A 1RIWC 2PUQH 5SGAE 2WINI 3M5OA 1TOMH 1N8OB 4WMEA 3T29A 1P9SA 3ZYEA 2BDAA 1CA0C 3RU4D 1GHZA 1V3XA 4RSPA 1YLCA 1SLUB 1UTOA 3LC3A 5EPYA 1GBTA 1SGDE 2R3UA 1ZSKA 4DURA 3RXRA 1QJ1B 1V6DA 3LU9B 5GCHG 2RDLA 5EW2H 3GY4A 4X6NA 1QCPA 1JRSA 1TLDA 1QL7A 1NRQH 3SNCA 1SLXB 1BIOA 2GCHG 4VGCC 3QDZB 2AEIH 4GCHG 1FI8A 1YPHC 1QL9A 1PQ5A 3TH2H 2Z6BD 4ZROA 4MQAA 5FBIA 2FOHA 2WUBA 2ZA5A 1ELFA 2HNTE 1AIXH 1D6RA 2GZ9A 2ZP0H 1KTSB 1FMGA 5A8YA 1BOQA 2R0LA 4DG4A 1UK2A 3RC6A 3TGKE 2QYIA 1EJAA 4AYVB 2D26C 2AMDA 3AW1A 4OS5A 3RXTA 3A87A 4JK5A 3A82A 1KYNA 2UUJB 4NSYA 4NFEA 5GIBA 2G00A 3RXCA 5E0HA 3T27A 4AB9A 5LPEA 1XMNB 3PROA 2OC8A 1K1JA 1O5GH 5EOKA 3BIUH 3RDZA 3EGKH 1MD7A 1JWTA 1OP0A 1GI4A 1C5UA 1FUJA 3DUXH 2AMPA 1BA8B 1ELBA 1EOJA 3M5LA 1XVMA 2BD4A 1HAHH 3BTHE 4IC5A 1GI2A 1YCPM 2BX4A 2CMYA 1NFWA 5GJ4B 2XBVA 4H6SB 4O3UA 2B5TB 1V2MT 4Q2KA 4OS1A 1XXFA 3BTKE 4JMYA 3DA9B 2AGEX 4MDSA 2Z3EA 2Y80A 4WXVA 1P03A 1S82A 1ZTLA 1GBJA 2GCHF 3GCOA 2PSYA 2A2XH 1CU1A 2O8TA 1VITH 2Y81A 3GISB 4GSOA 5DP7A 5EGMA 4LZ1H 1FN6A 2XXLA 3MH7A 3U8OH 3GY8A 2QV1A 1EJNA 1SG8B 5T6DA 4AN7A 3GDSA 1Z8RA 3C27B 2BVRH 1YPGH 3MYWA 2C90B 4YT7H 3RXJA 5C1UA 1QNJA 3OY5U 2ZPRA 4FVDA 2QXGA 1DX5M 3OU0A 3VXFH 1H9HE 1Y5UT 2YNAA 3RMLH 1VCQA 2IN2A 4Y0ZE 1F7ZA 1TPPA 3O8CA 3MNCA 3LPRA 3BF6H 4K5ZA 4DIHH 1RFNA 5GXPA 3ENSB 2C93B 3HK3B 1KIGH 1UVSH 1YF4A 4ISHH 5HM2A 2PTCE 1GL0E 1TX6A 1KLJH 1EZSC 1O2ZA 2QIQA 1HAOH 1TGSZ 1SQAA 1TGNA 4ABGA 2RA0A 1VZQH 5IDKA 2H9HA 1HBTH 1O3OA 8ESTE 1QFKH 3SJOA 1SSXA 1DVAH 1DANH 3PO1B 1DM4B 2BD5A 3RXMA 4MG3A 3SI3H 1BHXF 2M5TA 3E6PH 3K6YA 5TCAA 3GDUA 1VITG 2OLGA 1VCPA 3R0FA 1ZZZA 1C2KA 1O37A 3MU5A 4UDWH 3W95A 1SFQB 2GCTB 1GBHA 2CN0H 1UTJA 3H5CB 3NK8A 5HYOA 3LT3A 1XVOA 4JYVH 3HGPA 2WV5A 4A1TA 5F03A 1BBRE 5JBAS 5AHGH 5A0CA 1BMLA 2H1UA 2VGCC 3BN9A 4UFFH 5L2YH 1TNJA 1CA0B 3SU3A 1O31A 1W0YH 5DP4A 6GCHG 4LZ4B 1S0RA 1JIMA 1O3CA 5C67A 1SGYE 5FBEA 1IAUA 1BTWA 3LDXH 3F1SB 2ZHQH 1DSTA 1SQOA 2PR3A 4E05H 1SL3A 3F9HA 1ZGVA 1F5KU 1K22H 1L4ZA 3RU4E 1ZMJA 1BTXA 9LPRA 5FPTA 2ZZUH 3I29A 2BOKA 2F83A 4GVUA 1BMAA 1CSOE 2BD9A 4WMFA 2FOGA 1BQYA 4AB8A 3A8CA 4CRAA 1L1NA 5A09A 1H8IH 2Z9GA 3ZZ5A 8LPRA 3SHCH 1EPTA 1ARCA 2PUXB 2ZFTA 2A7CA 1YCPH 2PLXA 4HI3A 1C5XB 4NIWA 1E38B 3JZ1B 1DT2A 2ZGCA 3NUMA 1TBRH 2ZQ1A 2ULLA 4WMDA 1A46H 5JYIA 2K1QA 1FONA 4B73A 5C5NA 3LOXA 2XWAA 3NZIA 4AFZA 1T8NA 4ZAEA 4I8HA 3RXHA 2OBOA 4Z0KA 4M7GA 2OCVB 5EU8A 1GI7B 1PPHE 5FAHA 3SQEE 2HOBA 3OY6U 1Y5BT 1V2OT 5JPMH 2C4FH 4OGXA 3BTQE 4AFUA 2TGPZ 1WUNH 3BEIB 3CS0A 3AAVA 1GGDC 3QGJA 4UEHH 1G2MA 1OWJA 2AS9A 1ZTKA 2FM2A 1P11E 5E8EH 5TJXA 1TB6H 2SGAA 1FY5A 4ZXYH 1AE5A 1HIAB 2Q6GA 1EB2A 3RXKA 2ZCKP 1O2VA 2PKAB 2CV3A 1RD3B 4Y7BA 3RMMH 2GTBA 1YCPK 3MH4A 3UPEA 1IQEA 3P8NA 1KLTA 3MU1A 2BM2A 1GJ6A 2GV6A 7KMEH 5GWZA 1M9UA 2OC1A 1TWXB 1Q3XA 1O2HA 3URDA 4DOQA 1C5YB 2ZGBH 1KXEA 1UCYH 2B9LA 4X1SU 2G81E 1TQ0B 4K3JA 1AB9B 2A7JA 5FCKA 2XWBI 1S83A 1SGRE 1HRTH 2J94A 3HKIB 3ATWA 1GMHF 2UUFB 1ZLRA 1CHOG 1PQ8A 5E2OA 4I32A 5LPRA 1EQ9A 3EA9A 2OC7A 3GYLB 5T6GA 3KCGH 1GDNA 1XUJA 3ZZDA 2WYGA 1H1BA 3HATH 1INCA 3G01A 2GD4B 1IOEA 1G3DA 4FUFA 1P3CA 2EI8A 3AVZA 5I46H 2F9BH 2GX4A 4IGDA 1MZDA 2A4RA 3VXEH 2PW8H 2P16A 1UMAH 1A2CH 2ZEBA 1GHBG 1O2YA 1O34A 1OXGA 1IQIA 2CHAB 1GBKA 5JB9S 1E37B 1NU7B 1DWEH 3MO6A 1GJ8B 1RS0A 1GI1A 1RTLA 3SHAH 2BOHB 2XNIA 1C5MD 2J95A 1P04A 1UCYK 2BXTH 1TAWA 2H9EH 2JH0D 1GBIA 1V2JT 3VB7A 1LKAA 2ZU5A 4JK6A 1BTPA 1F0TA 5A2MH 1K9OE 2AGGX 2JH6D 3KL6A 2RG3A 4Q7YA 3RXIA 3GDVA 1K21H 4FUDA 1C5OH 1AO5A 1GHYH 4HZHA 3ZVFA 2W5EA 1Y3YA 1JIRA 2ZFSA 3MI4A 1N8OC 1O3EA 5HXFA 1EJMA 1QA0A 1N6XA 1CHOF 3DFLA 1HFDA 4DJZB 1C5LH 1ID5H 3H7OA 1YLDA 4D7FA 4X1PU 5J4QA 3SGQE 3SI4H 3TK9A 5LPFA 2WV4A 1DXPA 1TNHA 3KEEA 1U6QA 2C8XB 5LGOA 1TGTA 1QY6A 1V2WT 3P8GA 2ZU3A 2B7DH 2FMJA 1LO6A 2W7UA 1LPZB 5EXNA 3UR6A 1W12U 2Y5HA 2QF0A 5JBCS 1C4V2 1VGCB 2BDBA 1A5HA 3MU8A 2WPKS 3TH4H 2AMQA 5AFZH 2ODQA 3T2NA 4AX9H 1SQTA 2A0QB 4IC6A 1S0QA 2C8ZB 5HMAA 3A86A 1DFPA 2O8LA 2A1DB 2A4QA 5C20A 1OYTH 1DOJA 1VCWA 1PYTD 3IITA 1F5LA 2ZPSA 4WVPE 1HCGA 4TY7A 1SB1H 4KTUA 3BIVH 3SV7A 3MH5A 1GGDB 1Y8TA 1OKXA 1H9IE 4XFQA 2XCNA 2A7HA 3BTWE 1AKSA 4ZXXH 3EA8A 4HGCA 5TCCA 4BXWA 2JETC 1PPZA 3ZV8A 1Y59T 1AWFH 4IMQA 4Y8XA 1A1RA 1EATA 2SGDE 3UIRA 1QTFA 2EI6A 2WYJA 1S6FA 2GDEH 1E34B 3KF2A 2ZHFH 1GI0A 3O8BA 1O5AB 3TNTA 3SJ8A 6ESTA 4AG2A 1V2VT 4YOJA 1VJ9U 1K1LA 3K9XB 1O2KA 3L3TA 1QB9A 1G3CA 4JZEH 1N1LA 1FV9A 1JMOH 3WY8A 4LOYH 1ANBA 3IG6B 1YPJH 4D9QA 1O39A 4BNRA 2P3UB 3KN2A 3IWMA 3FP8E 4Y11E 2ZHEH 1B0FA 2F9OA 1UVOA 3GY7A 4TWWA 3NCLA 3TH3H 5DPAA 3S9BA 1D9IA 3Q76A 3RMOH 4B76A 3ZV9A 4TPYA 2BLVA 1F92A 1ESBA 3EE0B 2NU3E 1QB6A 3PWCA 1SGPE 4X1QU 3SORA 2ANYA 2A5IA 1UVUH 2HNTC 1Y3WA 2VIVA 1QRZA 1PPFE 3ZZ6A 4GHQA 2AGIX 1FPCH 4I33A 3M3VA 3QTVH 1SLWB 1EXFA 4NZQA 3GY5A 2PV9B 1W13U 2HPQH 3A88A 2P93A 3GYMA 3TJNA 4B75A 4UE7H 1YPMH 4KTCA 3SU0A 4CR5A 2FXRA 1PYTC 4DVAU 2VU8E 1KXAA 3O8DA 2FS8A 4MNXA 3SNBA 1O3FA 3HK6B 4E7NA 2O9QA 3ZYDA 7ESTE 1BTYA 1GHAF 1SC8U 1BJUA 1FIZA 1FJSA 2BY7X 5F8ZA 2J92A 5DJ7A 1HAYB 5DKMA 1ZYOA 4CBNA 1LTOA 1WTGH 1P02A 3RXBA 3LIWA 1ACBE 4Y71A 2BQWB 4THNH 4AORA 4JZDH 1NC6A 5HM9A 4X2YA 1TRYA 1TYNA 8KME2 2VIDA 1C1MA 1EUFA 1SGQE 1Z8JB 4OGYA 4A5TS 3D49H 4CRBA </