1KXAA

Sindbis virus capsid, (wild-type) residues 106-264, tetragonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
total genus 34
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxaA01
1JRSA 2B7DH 2UWOA 5TCCA 2RA0A 3GYMA 1YCPH 3PMJA 1NC6A 1BMLA 1TNHA 1O2UA 4B2AA 1VCPA 1IQGA 1O3IA 1P3CA 4U32A 4PROA 5E0GA 4ZXYH 1ETSH 3SGAE 2XTTB 1LPKB 5FPSA 3VB7A 1UO6A 2V35A 3ENSB 4KTSA 4SGAE 1S0QA 2OQUA 3PM3A 4UFDH 2GGVB 4CR5A 4FUJA 5DKMA 1QB9A 2BLVA 3EA8A 1ZJKA 4RKOB 4XFQA 2QV1A 1PJPA 3DUXH 1C1QA 3QX5H 2VINA 3ODDA 2OBOA 1A61H 1GL1A 2A4QA 1Z8RA 1AQ7A 3SV8A 3ZZ3A 2Y82A 4CH8B 3SJ8A 1A7SA 3MI4A 4NFEA 3MU0A 3GYLB 1T8NA 1E34B 1HIAB 1C1SA 1P09A 4B73A 2ZDLA 2P59A 1MQ5A 4UONA 3A83A 2SNVA 1CA8B 4ESTE 4Y8XA 1GVLA 1LMWB 6GCHG 1YP9A 3U8RH 3UQOA 3TLOA 1Z71A 3L33A 4BAHB 1GI1A 3DD2H 1GI9B 4CHAC 1P01A 1GHZA 1FIZA 2FTMA 4BOHA 1G3DA 1WTHD 5TCAA 3LDXH 3PMHB 1ZMNA 2XCNA 4ISIH 1DY8A 1MKXH 1OP0A 3HGPA 3KCGH 4A1VA 4UD9H 3TK5A 1XVMA 1KLJH 1GJ5H 1IHTH 1BTWA 1BTXA 1NS3A 3RMMH 3KQBA 4ZKNU 1OP8A 4YOJA 1W3CA 1AFQB 1L1JA 2Y5GA 4FU7A 4IN1A 2Y5FA 1MTNB 1EXFA 3TITA 1NFXA 4X2YA 1NTPA 3I78A 1V2LT 1RS0A 1S81A 1C1PA 1NRPH 1XKAC 4WWYA 5GXPA 5CHAC 1TGTA 2H2ZA 2G55A 2XNIA 1OSSA 3UY9A 2QYIA 1O2HA 1HXEH 1O2TA 5EXMA 1CU1A 3HATH 2BDAA 2ESTE 4U2WA 2WV5A 1S83A 5J4SA 1ZOMA 1G3BA 1GI2A 3F6UH 1Z8GA 5JDUB 4X6OA 1KIGH 1T4UH 3TNTA 1HV7A 3U8TH 2BD2A 3T5FH 6LPRA 3S7HB 4WMEA 2Y80A 4MNXA 2BQ7B 1AGJA 2VNTA 4Y10E 1P05A 2C93B 3U69H 1EPTB 1MBQA 5AHGH 3SNDA 1G2MA 1P2MA 1WCZA 4K5ZA 3PTBA 4UEHH 2R2MB 3C1KA 1THRH 2FI5E 1NZQH 1SOZA 2A7CA 3M37A 4JYUH 5DG6A 1SSXA 1GI0A 1JMOH 3VEQB 4K2YA 2TGAA 3PWBA 1OYTH 1ZSKA 2FOHA 5PTPA 4CRCA 1SLXB 2PKAB 5FX5A 3M5LA 1W8BH 1ESBA 1O2PA 3GOVB 1BJVA 2AYWA 1LVYA 2VWOA 1HAVB 1CSOE 3RC6A 2XC0A 1ZSJA 4ZKOU 1AKSA 3D23A 1C1OA 1DWEH 1TX6A 3BEIB 4DW2U 4JK5A 4BANB 1O5BB 2QIQA 2H9HA 1GBMA 3M36A 2A32A 1ID5H 3SNEA 3FVFB 1FPHH 2QCYA 3MFJA 2ZDNA 1S5SA 5EG4A 3RDZA 3E1XB 4UFFH 1Y5UT 5C20A 1DS2E 1CBWC 3E0NB 4NZLA 1P04A 1KY9A 1B5GH 3QWCH 1YKTA 1YGCH 1XUJA 2ZFSA 1E38B 2BY9X 4A7IB 2BB4A 1RRKA 4I8JA 1GHAG 4UFEH 3M5MA 3MO3A 2V3OH 3TJUA 1SQOA 5E2PA 1K1IA 3Q00A 1P2KA 2H9TH 5L2YH 1HAGE 1TABE 1SGTA 2JH0D 1UMAH 1O3FA 4TYDA 4AG1A 1MKWK 1NPMA 4B2BA 3BTWE 6CHAB 4AFQA 4X0WU 4IC6A 5F03A 1D3TB 1Z1JA 1INCA 2UUFB 1A0LA 1F7ZA 1L1GA 1QRXA 2HNTF 3IITA 3ZV8A 2ZGXH 2GZ9A 1EUFA 1O3BA 3I77A 5DP4A 2FOBA 1TMTH 5DO4H 1Y5BT 4GHTA 3W95A 1J14A 1GHVH 4ISNA 2FS8A 4WMFA 1QL7A 4GCHG 5EW1H 1YLCA 1FN6A 2C8WB 2W7SA 2BDCA 5BPEA 1SGEE 2ZC9H 3V7TA 1C1UH 1YF4A 2XBYA 4ZAEA 1LO6A 4Q7XA 1V2RT 2J92A 3MH5A 3A7XA 3KF2A 5G4BA 4K8BA 3CS7A 3KIDU 2XBWA 3U1IB 4NA8A 2AIPA 1O2ZA 3NCLA 5A8XA 2EI7A 3RUOA 1YLDA 4M7GA 1WYKA 5EQQA 1W7GH 1ZGVA 3GCHB 1ZHRA 2H6MA 4KKDA 3BTQE 4X6MA 3RMNH 2AEIH 5ETXA 2Z94A 2XRCA 3M7QA 4MDSA 3F9EA 1NT1A 1Y3VA 1UCYE 1FAXA 3EGKH 4DGJA 1GHXH 2WPKS 4NZQA 1ANEA 1QJ7B 2BX4A 1K1OA 4I32A 3SJOA 4Y0YE 1FMGA 1ELBA 2F9UA 2J94A 3MH7A 1OYQA 4AGKA 1C5WB 4GUXA 1Q2WA 1WSSH 2HNTC 3BSQA 3BTHE 1K1JA 5ESTE 1RGQA 3QGNB 4AX9H 2HALA 5ESBA 1QQUA 1SGIB 1LHGH 5EQRA 4FXGH 5I25A 3PROA 2GT7A 2A2XH 4I33A 2J95A 1H9HE 3AAUA 3LIWA 1K21H 1JIRA 2ZHQH 4AGJA 1BTHH 2YNBA 2ZHWH 4BAOB 2BHGA 5DP7A 2WV4A 3JZ2B 1DUAA 4AYVB 1H8IH 3D49H 4NFFA 1KXEA 2CMYA 2J38A 5LPFA 2ZKSA 1FY5A 1HYLA 4GLYA 1AHTH 1N8OC 1TNLA 2W7UA 1ABJH 2ZTXA 1C5NH 3QLPH 5A2MH 1PPHE 2AERH 5DJ7A 1L0ZA 1GBEA 5T6DA 3TGIE 1BCUH 1GJ4H 1H9LB 1N6YA 4MVNA 3BEFB 1BRBE 1QFKH 4B71A 1YPHC 1UTKA 2ZTYA 1DLKB 2A4GA 3RU4E 2STBE 4JZ1A 1FY8E 1TA2A 2QAAA 4Y11E 4TY6A 2ZO3H 1XM1A 1TLDA 1SLVB 3LC5A 1HJAB 4J2YB 3VXEH 3R3GB 1O2QA 1HJ9A 5EGMA 4RKJB 2ANWA 4K1SA 1J8AA 1CT0E 3E16B 4IMQA 1C5LH 4GPGA 1O2YA 1OPHB 4DJZB 2Z9LA 1KSNA 3V12A 3SJIA 3AVZA 3A7YA 3SZNA 1G9IE 1NFWA 3WY8A 1O3NA 4D76A 1K9OE 2O8UA 4MG3A 1BHXF 4YOGA 4YESB 3SORA 1J15A 1PQ7A 3RXIA 3SNAA 1OWHA 5HGGA 1CHOF 1TNJA 3MO6A 1BMNH 3MNCA 3T62A 3SU3A 1TOMH 4IC5A 4KP0A 1FN8A 1TMUH 4AFZA 3P70B 2ZHFH 1C5RA 1QBNA 1VJAU 1LHDH 3P8NA 3EE0B 5EQSA 3MU4A 1UK2A 2A5IA 3A89A 2ALVA 1AN1E 1KDQA 2B0FA 2P3UB 3E0PB 3FANA 1IQLA 4X1RU 1GDQA 3SU6A 1ELEE 5JBAS 3MWIU 3BTEE 1DXPA 2F9NA 2NU2E 2PFEA 2W5EA 3TNSA 1MH0A 1SGFG 5EXNA 1P9SA 1T31A 1GBKA 5DP8A 2PR3A 1DFPA 1XXDA 1GMHG 1EASA 1D6RA 3HK6B 5JB8S 1EOLA 1TQ0B 1AB9C 1RTFB 3RXEA 3UQVA 1HLTH 1C1TA 4CH2B 4OS6A 5EPNA 1GHAF 4X1NU 3UPEA 5JBCS 1UK4A 1C5VA 1L1NA 1PYTD 1ACBE 1FI8A 1DVAH 1A0HB 2GX4A 3GISB 1MZDA 3KNXA 4K3JA 2Z9KA 2BQWB 1YPMH 4Z6AH 4D7GA 1GI4A 2G4TA 1LHCH 2HVXA 3B8JA 3ZZCA 3JZ1B 1GBBA 2BD9A 2WINI 1UTJA 2NU3E 4A6LA 2SGQE 1NY22 1GJ6A 4IMZA 1JBUH 1BBRH 3GY5A 2WYJA 1QURH 1GMCG 3S69A 2WPHS 1P8VC 4FUBA 3K6ZA 4O03A 2ZCHP 3A80A 3AASA 1C1VH 1QBVH 2HRVA 4MPWA 4GCHF 4BNRA 1AD8H 2Y5HA 3RU4D 2Z7FE 3BN9A 1RIWB 1H4WA 4MPVA 1Z1IA 1M9UA 2G51A 4NIWA 1BB0B 2TGPZ 2OD3B 2HPQH 4Y8ZA 5EOKA 3SW2B 4D7FA 2I6QA 1C4Y2 1K22H 1T8OA 1DPOA 1SLWB 3VFEA 3PO1B 4BXWA 5GCHG 2W3KA 1S84A 3Q3KA 1AVGH 1AZ8A 1EZUC 2C3SA 4DG4A 3PYHA 3LJOA 2ALPA 3ATIA 1QJ6B 3LGTA 1OX1A 3SV7A 1MAXA 1FQ3A 3M3SA 4Y8YA 2AIQA 4XE4A 5JBTA 3PMBB 2AMDA 1O3KA 1ELDE 4FU8A 2A4OA 1UVUH 2SGDE 3Q76A 4CBNA 1Q31A 2J4IA 3PMAB 1VZQH 5C1YA 2LNCA 1WQSA 1ZMLA 2A31A 1ZJDA 2B8OH 1A3BH 3P8GA 1P10A 3MO9A 1KXAA 1SI5H 3S0NA 2FWWA 1EJAA 1QY6A 3OY6U 1GGDB 1TRYA 2F91A 5IDKA 4FUFA 5LPEA 1AKSB 2QXIA 3UWJH 2CXVA 1VGCC 2VJ1A 4LZ4B 4U01A 1V2TT 2ZFFH 2UUKB 3GY6A 4H6TA 1TBQH 3M3VA 2DUCA 2A5KA 3RLYH 1BOQA 3KGPA 1SGYE 2GCTB 2TGDA 3NPSA 1W14U 4UFGH 1GG6B 3LOXA 2BD3A 1A3EH 2V6NA 4XOJA 1SFQB 4LZ1H 1Y59T 3RXKA 4R8TB 1SVPA 2ZNKH 1P2NA 2WPIS 4Y7BA 1P11E 4ABFA 2Y7XA 4GAWA 2ZQ1A 1C5YB 1G30B 3RXGA 3A87A 1HAXB 3ATLA 1TNKA 1J17T 4BXSA 4KTCA 3SUGA 1A46H 2OLGA 2NU4E 4AFSA 7KMEH 1QNJA 2BDGA 3MNBA 1C2LA 2Z3EA 1C4V2 1NRNH 3P95A 1KXCA 1SC8U 1TMBH 1C5MD 4WXIA 2SGAA 2BQ6B 2FPZA 2Z9IA 1Y3UA 5EPYA 3A7TA 4E06H 4X8UH 2PSYA 1MU8B 4H4FA 1MD8A 2GDDA 3T26A 1C2KA 3ESTA 1ELCA 1JOUB 2JETB 3A84A 2ZTZA 1ZTKA 2ILNA 1IQFA 3BTTE 4AYYB 3UNQA 1TGCA 4A1TA 4FVDA 5A09A 4ZHLU 3FZDA 1VITG 1GJAB 3ZVAA 2BY6X 3LPRA 1FY4A 1ESAA 1SGNE 2HWLB 3F68H 1ZTJA 4JK6A 1O30A 2FI4E 3S9AA 1WV7H 1BTPA 4DT7B 4ABBA 1TFXA 3MU5A 1OXGA 2THFB 2AS9A 1SOTA 1VCQA 4ISLA 2BVXH 2FOAA 1ELTA 2OC7A 5DPAA 1LHEH 1SGRE 2BM2A 3LGYA 2TIOA 2XC5A 5FBIA 3TK6A 2A7JA 2FDAA 3DFLA 3QZQA 1TRNA 1GBCA 1HDTH 1O5FH 3GDSA 1GMHF 2H1UA 1LPGB 4K8YA 1QRZA 4ABEA 3BEUA 4AORA 3O8BA 1KTSB 2ZPQA 4YOIA 4YM9A 4BTUB 2Y7ZA 2ZU1A 1MTVA 1HBTH 3F9GA 1HJ8A 1ZHMA 1GBLA 1ZSLA 3EQ0H 1G36A 4IGDA 1O37A 3SQEE 1O2KA 3SU0A 2ANMH 3RXSA 2IPHA 3E91A 2EEKA 3NZIA 3ZZ5A 4F4OC 2R3YA 4YT7H 4ABHA 1TA6A 1V2OT 4B76A 1OS8A 1DICA 3M61U 3ZVDA 2GTBA 4ZMAH 4H42U 3SV2H 1NO9H 8GCHG 1IQHA 4WH6A 2BYAX 8KME2 1FJSA 1GMCF 1YM0A 1KYNA 2QGRA 1F92A 1C2FA 1HGTH 1O31A 2F83A 1TNIA 4ISHH 5JBBS 1Y8TA 4B75A 2PUXB 5FPYA 1O39A 2FX4A 5HXFA 5JPMH 4D8NA 3Q3YA 3MMGA 4Y0ZE 4K1TA 1NU7B 3UNRA 3OYPA 1OWEA 2GV6A 1NRQH 3UR6A 1Z8IB 1T8MA 1LKAA 3RMLH 1S85A 3A7VA 3ZVCA 2FTLE 1GVKB 2CHAC 1HPGA 1NFYA 5GCHF 1EP6A 2OUAA 5FPTA 1SGPE 3BTFE 5DGJA 1TALA 3RXDA 4YZUA 3QDZB 1OWDA 4ISOA 1W13U 1HB0B 1LQEA 1BBRK 3GY3A 5T3HA 1CHOG 3G01A 3SOSA 3SQHE 1SGDE 1AE5A 3FP6E 1O3GA 1ZMJA 3SJKA 1CVWH 1YPJH 4Y76A 3K6YA 3LT3A 4FUDA 1GBFA 1XVOA 1GMDF 1H8DH 5K7RA 3OX7U 1MTUA 1O2OA 3DHKH 4I7YH 1O5CB 1SFIA 1NESE 1WTGH 3Q77A 1A2CH 1O2GH 2HOBA 1TPSA 4AOQA 4ASHA 3A8AA 1O2LA 2BVRH 1B7XB 2ZI2H 3STJA 1E36B 1CGJE 3GICB 3UTUH 5E0JA 4O3TA 2FS9A 2WUCA 1E35B 1W7XH 4JZIA 4MTBA 1CE5A 2RDLA 1KDQB 2Q6DA 2G00A 2VH6A 2Q6GA 2BY7X 1O3JA 1C2HA 5TJXA 4OS5A 1GJCB 4X2VA 2QF0A 2ANKH 1O38A 1XUFA 1V2KT 3MU8A 3RM2H 1CA0B 1SGQE 2PGBB 4Y79A 1TAWA 3TVJB 3W94A 4CRBA 1GCTC 1CQQA 3RXOA 1C9TA 3SU5A 4NSVA 1QGFA 4E7RG 1O3AA 2R3UA 1SQAA 3CS0A 1DDJA 4I8LA 1THSH 2GMTB 8ESTE 2A2QH 3QO6A 3QZRA 5GWZA 1GHBF 9LPRA 1ANCA 2VGCC 1JIMA 1UVTH 2C4FH 1LHFH 3FAOA 1A5GH 2FI3E 4QT8C 3AAVA 2RG3A 3SI3H 4HZHA 2GZ7A 1K2I1 2B5TB 2GP9B 3TH2H 1H9IE 1RTKA 2FXRA 2EC9H 5T6GA 2NWNA 1HRTH 4I8GA 4I8KA 1OWKA 3PLKA 2TBSA 1Y3WA 1GHYH 1A5HA 1KXDA 1O36A 4YT6H 1YCPK 3VGCC 1THPB 1Y3YA 1B0EA 4YLUA 2P95A 1EX3A 1G3CA 1GGDC 3AW0A 2VB0A 3E8LA 2ZA5A 5K0HA 2TPIZ 5C1XA 4MPUA 3QTOH 2BD8A 2EI8A 1LCYA 1VITF 1IHSH 8LPRA 3GDUA 2M5TA 1GJ7B 1PYTC 1ZRBA 2I6SA 1GG6C 1K1LA 1G32B 2UWLA 3M3TA 4CRGA 1DT2A 1TONA 3DFJA 1TPAE 3KQEA 2VVVA 5C2ZA 2ZGHA 3UOPA 4DURA 3T29A 5F6MA 1RFNA 3PLPA 1SBWA 4A5TS 2BX3A 3FFGA 1GI3A 1FDPA 3A86A 1UVPA 3ZVFA 2KAIA 3NKKA 1TPPA 2VWLA 2BD5A 1ARBA 1J9CH 2JH6D 1GI7B 1CGIE 1KTTB 2BDYA 1ETRH 1GBAA 3LU9B 1TRMA 4TWWA 2Y81A 1TPOA 2FP7B 5AFZH 3N7OA 2OBQA 1TB6H 1GVZA 2BDIA 1IQJA 2G5VA 1EAWA 3SUDA 5DK1A 1H1BA 1SLUB 3UUZA 4DIIH 1DSTA 2WPJS 4B1TA 4DCDA 1AWFH 2O9QA 4AFUA 2EI6A 4K60A 3VB4A 1AE8H 1S6HA 1AFEH 1MKXK 1QRWA 2D26C 2PHBA 1TGBA 2GT8A 4HFPB 7GCHF 1ETTH 2O8LA 1C2GA 1TGSZ 8GCHF 1ELVA 1A4WH 1C5ZB 1DY9A 3B23B 2ZDKA 3O8CA 5JB9S 1TGNA 1QB1A 4NA9H 3EDXB 4K1EA 3RMOH 3V0XA 1BQYA 1MZAA 3RXMA 1IQEA 2OC8A 3SV9A 2YNAA 2ZQ2A 4UE7H 4JZEH 1QR3E 2VIQA 1C1RA 1QTFA 1QBOA 3BTKE 4X1QU 1PPFE 3UWIA 2A5AA 1AFQC 1EAUA 1C5PA 2GZ8A 1BTZA 3SJ9A 3RXCA 1GCDA 1XMNB 1MTNC 3S7KB 4XSKU 1GWAA 5BRRE 3A82A 1P03A 4YTAA 2VIDA 2SGPE 2SGFE 3R0FA 3PV4A 3SNBA 3RXLA 4INKA 1W11U 1FV9A 1ANBA 3HGNA 3VXFH 2H5CA 1GDUA 2VVUA 4TPIZ 4AN7A 1MQ6A 1QJ1B 2G52A 1D3DB 2ZDMA 5AF9H 5CHAB 1T7CA 4ABJA 3MU1A 1DE7H 1SMFE 1XUGA 5E2OA 2AFQB 3TU7H 3RXFA 2PGQB 1TYNA 3A85A 1P0SH 1QCPA 3E3TA 5LH8A 3A8CA 1MCTA 2FOEA 3PLBA 3MNSA 2ODPA 2BTCE 2B9LA 2ZG0H 2AGEX 2PSXA 4X1PU 1P2JA 2DE9A 3SU4A 2BY8X 1EAIA 1MAYA 4NCYA 2FOCA 1ZPBA 1WU1A 2QN5T 4WJG2 2SGEE 1NM6A 1P3EA 1C5OH 3RXBA 1EPTC 1V2QT 1UTMA 2AGIX 4ABAA 3A88A 2WUBA 1IQIA 4IW4E 2FODA 2ZPRA 1QL8A 2QA9E 2GVFA 3ZZ6A 1AUJA 1C5QA 3VGCB 1EOJA 1TX7A 2J9NA 4XBBA 1EATA 2SFAA 2XWAA 3GCTF 4DIHH 4FU9A 3A7WA 2VH0A 3SN8A 1O2RA 2VIPA 4IN2A 4JZDH 2UUYA 1LTOA 1GDNA 4NIYA 7ESTE 3FP7E 4MQAA 1A1RA 3ATMA 3LGUA 1O33A 1O3MA 5C67A 4TPYA 1KLIH 4DOQA 3UR9A 1G3EA 2HPPH 1V2MT 1YCPM 3BG4B 1LVBA 1T32A 1UVSH 3TJVA 4TY7A 4BAKB 3URDA 3F9FA 1O2XA 4OS2A 1CBWB 1XXFA 3RXVA 2OXSA 1KXFA 4VGCB 5EW2H 1BBRE 2Z9GA 1FPCH 4RSPA 1P2OA 1BTUA 6ESTA 2XW9A 3RXQA 1D3PB 1P06A 7LPRA 4AB8A 2C8ZB 2R0KA 1CA0C 5F8ZA 1SHHB 1DWBH 1GMDG 4NA7A 1F0TA 2VIVA 2BXUH 6CHAC 3H5CB 2Z9JA 1O3DA 3BIVH 1MTSA 1HAYB 2G4UA 1ZPZA 3BF6H 1EKBB 1O34A 1ZGIA 2TGTA 3MH6A 4ZKRU 1EQ9A 3L3TA 3LGIA 3LKWA 4Z0KA 3T25A 1C2MA 3H7OA 2XWBI 3MYWA 5LPRA 1GI8B 1FUJA 2FOGA 2BD4A 2P3TB 2VIOA 3ATKA 1TQ7B 3T2NA 4F49A 1BJUA 2R2WU 1K1NA 1TBRH 4NIXA 3U98H 1NROH 3ZZBA 4UDWH 4JMYA 5AFYH 3V13A 1DX5M 3QK1A 4FUCA 1A0JA 4X8VH 1YC0A 2FMJA 3K65B 2CGAA 2F9BH 2GKVE 2OQ5A 2ZFRH 1CHGA 3CENA 3GCHC 4Y7AA 4WMDA 4INHA 1OP2A 3CP7A 1ANDA 2IN2A 1O2NA 1K1PA 3RXTA 2BY5X 4ABDA 2TRMA 1VJ9U 1GHBG 4NWKA 1O2JA 1ZRKA 2ZDAH 1IAUA 2Z6BD 2ZF0H 3K9XB 1UTQA 2VIWA 2D2DA 3O8DA 2D1JA 3F1SB 3OU0A 1HAZB 1C2DA 2YOLA 3ODFA 5FBEA 1Z8JB 2DE8A 4RN6A 5I46H 4WY3A 1F2SE 2BOHB 2GV7A 2VVCA 4XBCA 2BLQA 3TGKE 2ODYB 2XC4A 1AO5A 1PQ8A 3OY5U 2F9PA 3FP8E 1CT2E 2PKSB 1GI5A 1V6DA 5C1UA 1QL9A 1SB1H 1AZZA 2ZU2A 1L4DA 3O8RA 1PFXC 1V2WT 5GJ4B 1F0UA 2BZ6H 1PPGE 2ZDVH 1ZZZA 1SR5C 1V2ST 3UOUA 2P93A 3S9BA 1C2IA 3ZVBA 1WBGB 5CE1A 2FX6A 4BTIB 2GD4B 3M7TA 5F8XA 4I31A 3ZVEA 3SI4H 1GBTA 2A4RA 2UWPA 4GVUA 1C9PA 1Z7KA 1C5SA 3VB6A 1SL3A 1N8OB 3PB1E 1QA7A 1EB2A 2ZFPH 4CRDA 1MTWA 4HGCA 2GCHG 2OP9A 3RC5A 3T27A 1SGFA 1YBWA 4X8SH 4CBOA 1KXBA 3C27B 1HAOH 2XXLA 1HNEE 1O5EH 2QXJA 3MNXA 4CRAA 2P8OB 1QA0A 1HJAC 3U1JB 1OWJA 3HKJB 3BIUH 1K28D 1MD7A 2H5DA 4LXBH 2ZHEH 3ZZ7A 2OTVA 1W0YH 1O32A 1GHWH 1MCVA 3P8OA 4OGXA 2BXTH 3GY8A 1E0FD 2ZPSA 2ZU5A 4HI3A 2OCVB 4ABIA 3RXRA 2KAIB 3ITIA 3A8BA 2FIRH 1BUIA 1IQNA 3IWMA 3PWCA 3TPIZ 1S6FA 1C5TA 4AG2A 2VWMA 1W10U 7GCHG 1C4U2 2ZFTA 2Z3CA 3TIUA 5J4QA 2BLWA 3MTYA 3VPKA 3LJJA 1ZPCA 1SG8B 2R9PA 2ZGCA 1O5AB 9ESTA 3K2UA 3LGWA 1ZTLA 1EZQA 4X6NA 1S0RA 2WYGA 1P02A 3MOCA 1T4VH 1YPKH 2F9VA 2JH5D 2PTCE 2FO9A 3HPTB 1UK3A 1CGHA 4X8TH 2A45B 2ZCLP 4XDEA 3RXAA 1ORFA 1UTOA 2BDHA 2XBVA 1FAKH 2ZP0H 4Y71A 1HAIH 2FYQA 1B0FA 2Q1JA 4Q7YA 1FY1A 3V3MA 1JWTA 3D65E 4SGBE 5L2ZH 5HM9A 1BMMH 1L4ZA 4AB9A 1V2UT 2P16A 1AB9B 5A8YA 3SU1A 1DWDH 4OS4A 4A1XA 4OS1A 3SO3A 1TX8A 3KN2A 2J2UA 1G2LA 4I8HA 3RM0H 1BHXB 1F5KU 5L6NH 3KHVA 4ZROA 1MBMA 3A7ZA 4BAQB 1FXYA 1QQ4A 2A7HA 4U30A 1PPCE 1XUHA 2BMGB 3UFAA 3KL6A 2ZEBA 3E90B 5IYTA 1E37B 2QF3A 1O3EA 3A81A 1C1WH 2O8TA 3TK9A 1RD3B 1NN6A 3SGQE 3FZZA 2AMQA 3DA9B 3SNCA 1WQVH 3U8OH 1XX9A 5HMAA 2O8WA 1L2EA 2AH4X 3M5NA 2NU0E 2WPMS 3RU4T 1NRRH 3NUMA 1RIWC 1O35A 1Q3XA 1XUKA 2OC1A 2Q6FA 2F3CE 1D6WA 3UNSA 3BG4C 2IOTA 3BTME 3GCNA 1O2SA 4X2XA 1VR1H 2K1QA 1AUTC 3PO1C 2ZGJA 2QXGA 3OTJE 1ZYOA 5T6FA 1IQMA 1HCGA 1GPZA 5DP6A 3OSYA 4ZXXH 5FXLA 4VGCC 1V2JT 2P3FH 1NFUA 2QXHA 2RCEA 4GSOA 5CMXH 2PUQH 4A92A 3GCTG 1UHBB 3ZZ4A 1EZXC 1ZR0A 3GY4A 1HAPH 1EP5A 1EZSC 5JYIA 1UTNA 3LGVA 3F9HA 2XBXA 3QN7A 1O2MA 1SQTA 4WF8A 1AU8A 3TJNA 3P92A 1EJNA 3I29A 1ELFA 1G37A 1GJ8B 1LQDB 1LPZB 1F0SA 1UTPA 4FUEA 3M35A 4O9VA 1BZXE 2FM2A 1ZLRA 2J34A 1HIAA 3B9FH 3PTNA 3SGBE 4BAMB 1DLEA 1F0RA 1GI6A 1K1MA 2W3IA 3Q3XA 1FIWA 4DVAU 1C5UA 1O2VA 3TJOA 1DUEA 2PW8H 1UCYH 1ARCA 3ATWA 4WXVA 1BITA 1GBJA 2XYAA 5F8TA 3DT0H 2LPRA 4KELA 1VGCB 3SBKA 3BTGE 2AMPA 1GJBB 1LVMA 1IQKA 4DY7B 1WUNH 4Y6DA 1VCWA 3KQDA 2GCTC 4O97A 1ESTA 4MLFB 1DOJA 1F5LA 1DSUA 2G5NA 5FHTA 2PWXA 3S9CA 2GCHF 2IJOB 4ZHAA 3VB5A 4KTUA 4JYVH 4E05H 2WPLS 1GBIA 6GCHF 1Z6EA 1BT7A 2CF8H 2ZHDA 1BDAA 2ZECA 1DWCH 3LC3A 1CT4E 1MU6B 1O3LA 3EAJA 5DP3A 4NG9H 5ABWA 5EXLA 1V2NT 4IBLH 2ZCKP 2CF9H 4WH8A 2ANYA 2ZIQH 2HGTH 5GPIB 4BTTB 1FONA 2ZZUH 4FVBA 2PKSC 1UJ1A 2P94A 5A0AE 3QUMP 3SHCH 1P9UA 2BVSH 2JETC 3A8DA 3ELAH 4Q2KA 4X6PA 1NRSH 2CV3A 4JZFH 1YPLH 3HK3B 1UTLM 3EYDA 3M7UA 1BRUP 5SGAE 1AY6H 5C5NA 4YO9A 1LVOA 1P12E 3NXPA 2HNTE 4D9RA 1VITH 3P6ZB 1YPEH 1C2EA 2FEQH 4WVPE 2V3HH 4CHAB 1O5GH 5FCRA 2Y6TA 3RXUA 1EPTA 2XCFA 2ZU3A 3L6PA 5C5OA 4FUIA 2UUJB 1HXFH 4LOYH 2SNWA 1PQ5A 4Q80A 3ZZ9A 5A8ZA 1D4PB 2QY0B 1EJMA 1MMJN 3UREA 4X2WA 2P8OC 4B74A 1V2VT 3AW1A 1P57B 4NWLA 4FUGA 3P17H 1AI8H 3RXJA 1O3HA 2FYRA 2PKAA 1U6QA 2ZFQH 3BV9B 4ZUHA 1HFDA 4E7NA 1Y3XA 1HAVA 2QC2A 2R0LA 4X1SU 1OKXA 1UVOA 1YPHE 1ZHPA 3ZYDA 3SV6A 3M5OA 2A1DB 1BTYA 1SGCA 1DITH 1TBZH 3E6PH 3LONA 5FCKA 1GL0E 1AIXH 1GJ9B 3LH3A 2FOMB 1O3OA 3GCOA 1BRAA 1TOCB 1AVXA 1O2IA 1QIXB 1PPBH 1Y5AT 2BOKA 1TE0A 2FESH 2OINA 1C1MA 3SUEA 1C5XB 5H4IB 4MNVA 4YLQH 3ZZDA 4HTCH 3RXHA 1LDTT 1P2QA 1TWXB 1O3CA 5GIBA 2CJIA 1PPZA 5C3NA 1DM4B 1YYY1 1UHBA 1W12U 4INLA 2W26A 5A0BA 2V0BA 2O8MA 2C8XB 1AMHA 1J16A 2ZWLH 4CREA 1FY3A 3EA7A 1N1LA 2VU8E 3EA9A 3U9AH 2RA3A 1W0ZU 1V2PT 4D9QA 1O0DH 1S82A 3TGJE 3H7TA 3UIRA 1FNIA 3GY7A 5DP5A 1O5DH 1Z6JH 1QHRB 4J1YA 1CO7E 1BRCE 2FZZA 2CHAB 1IOEA 1GBHA 3SHAH 1RJXB 1V3XA 1OOKB 1F5RA 1A5IA 1C2JA 4TWYA 3TH3H 1D3QB 2G8TA 1QB6A 2GDEH 2ULLA 1C1NA 1P2IA 4FUHA 1O3PB 3URCA 1NU9A 3STIA 4CRFA 2ZGBH 3GY2A 2FOFA 1T8LA 4O3UA 1TIOA 3TH4H 2JKHA 4GHQA 1BIOA 2VWNA 4H6SB 1KLTA 1HAHH 3P8FA 3RP2A 2A0QB 5E0HA 2PLXA 4KGAA 1ELGA 1LKBA 1ELAA 1D9IA 2D8WA 2ZU4A 2C90B 4NSYA 2BLOA 3NWUA 2FLBH 1BA8B 1GJDB 3GDVA 4JYTA 5DP9A 5FAHA 1RXPA 1XUIA 1EAXA 4K69A 4THNH 3NK8A 1EB1H 2HLCA 5AVDA 1SPJA 4OGYA 3IG6B 1OWIA 1JXPA 3LH1A 4NGAH 3ZZAA 4IS5A 2FLRH 3BTDE 3ZV9A 3MH4A 3T28A 3QGJA 3KEEA 1ABIH 4OS7A 1N6XA 3VB3A 3QTVH 1WAYB 4ZHMU 4Q7ZA 1YPGH 4MPXA 1WOFA 4XBDA 3BG8A 1RTLA 4CR9A 1XKBC 1GCTB 2CN0H 2ODQA 1W2KH 2GMTC 1JRTA 4ABGA 4AZ2B 4ZKSU 2ASUB 4ZH8A 4B2CA 2OC0A 2Z3DA 3ZYEA 5EU8A 2EA3A 2H9EH 2BD7A 2G81E 1UCYK 1TNGA 2STAE 1PQAA 2PV9B 2VGCB 4MNWA 1AVWA 5FX6A 5HYOA 4JCNA 5HM2A 3D62A 1GBDA 4NIVA 5EODA 1DXWA 1FLEE 3SU2A 1MKWH 3HKIB 1HUTH 2C8YB 3KQCA 1AWHB 2BZAA 4LK4A 1FZZA 3RXPA 2F9OA 1O2WA 4R0IA 5GDSH 5L30H 2AGGX 2NU1E 2BDBA 5A0CA 1DANH 3SUFA 3MHWU 1SHYA 2PTNA 1PPEE 4MNYA 5LGOA 3RLWH 3RC4A 1BMAA 1X7AC 5E8EH 5B6OA 1MUEB 3ZZ8A 3ZVGA
chains in the Genus database with same CATH superfamily
1JRSA 2EQNA 2B7DH 2UWOA 5TCCA 2RA0A 3FN8A 3GYMA 1YCPH 3PMJA 1NC6A 1BMLA 1TNHA 1O2UA 4B2AA 1VCPA 1IQGA 1O3IA 1P3CA 4U32A 4PROA 5E0GA 4ZXYH 1ETSH 3SGAE 3MQKC 2XTTB 1LPKB 4TT3D 5FPSA 3VB7A 1UO6A 2V35A 3ENSB 4KTSA 4SGAE 1S0QA 2OQUA 3PM3A 4UFDH 2GGVB 4CR5A 4FUJA 5DKMA 1QB9A 2BLVA 3EA8A 1ZJKA 4RKOB 4XFQA 2JJ2D 1PJPA 2QV1A 3DUXH 1C1QA 3QX5H 2VINA 3ODDA 2OBOA 1A61H 1GL1A 2A4QA 1Z8RA 1AQ7A 3SV8A 3ZZ3A 2Y82A 4CH8B 3SJ8A 1A7SA 2JIZD 3MI4A 4NFEA 3MU0A 3GYLB 1T8NA 1E34B 1HIAB 1C1SA 1P09A 4B73A 2ZDLA 2P59A 1MQ5A 4UONA 3A83A 3F0OA 2SNVA 1CA8B 4ESTE 4Y8XA 1GVLA 1LMWB 6GCHG 1YP9A 3U8RH 3UQOA 3TLOA 1Z71A 3L33A 4BAHB 1GI1A 3DD2H 1GI9B 4CHAC 1P01A 1GHZA 1FIZA 2FTMA 4BOHA 1G3DA 1WTHD 5TCAA 3LDXH 3PMHB 1ZMNA 2XCNA 4ISIH 1DY8A 1MKXH 1OP0A 3HGPA 3KCGH 4A1VA 4UD9H 3TK5A 1XVMA 2WSSD 1KLJH 1GJ5H 1IHTH 1BTWA 1BTXA 1NS3A 3RMMH 3KQBA 4ZKNU 1OP8A 4YOJA 1W3CA 1AFQB 1L1JA 2Y5GA 4FU7A 4IN1A 1WXRA 2Y5FA 1MTNB 1EXFA 3TITA 1NFXA 4X2YA 1NTPA 3I78A 1V2LT 1RS0A 1S81A 1C1PA 1NRPH 3EE7A 1XKAC 4WWYA 5GXPA 5CHAC 5EIYA 4OM9A 1TGTA 1SKYE 2H2ZA 2G55A 2XNIA 3U28C 1OSSA 3UY9A 2QYIA 1O2HA 1HXEH 1O2TA 5EXMA 1CU1A 3HATH 2BDAA 2ESTE 4U2WA 2WV5A 1S83A 5J4SA 1ZOMA 1G3BA 1GI2A 3F6UH 1Z8GA 5JDUB 4X6OA 1KIGH 2KR7A 3GS9A 1T4UH 3TNTA 1HV7A 3U8TH 2BD2A 3T5FH 6LPRA 3S7HB 4WMEA 2Y80A 4MNXA 2BQ7B 1AGJA 2VNTA 4Y10E 1P05A 2C93B 3U69H 1EPTB 3PV5A 1MBQA 5AHGH 3SNDA 1G2MA 1P2MA 1WCZA 1E1QD 4K5ZA 3PTBA 4UEHH 2R2MB 3C1KA 1THRH 2FI5E 1NZQH 1SOZA 2A7CA 3M37A 4JYUH 5DG6A 1SSXA 1GI0A 1JMOH 3VEQB 4K2YA 4P00A 2TGAA 3PWBA 1OYTH 1ZSKA 2FOHA 5PTPA 4CRCA 1SLXB 2PKAB 5FX5A 3M5LA 1W8BH 1ESBA 1O2PA 3GOVB 1BJVA 2AYWA 1LVYA 2VWOA 1HAVB 1CSOE 3RC6A 2XC0A 1ZSJA 4ZKOU 1AKSA 3D23A 1C1OA 1DWEH 1TX6A 3BEIB 4DW2U 4JK5A 4BANB 1O5BB 2QIQA 2H9HA 1GBMA 3M36A 2A32A 1ID5H 3SNEA 3FVFB 1FPHH 2QCYA 3MFJA 2ZDNA 1S5SA 5EG4A 3KQ5A 3RDZA 3E1XB 1S6LA 4UFFH 1Y5UT 5C20A 1DS2E 1CBWC 3E0NB 4NZLA 1P04A 1KY9A 1B5GH 3QWCH 2EY4C 3WWBA 1YKTA 1YGCH 1XUJA 2ZFSA 1E38B 2BY9X 4A7IB 2BB4A 1RRKA 4I8JA 1GHAG 4UFEH 3M5MA 3MO3A 2V3OH 3TJUA 1SQOA 5E2PA 1K1IA 3Q00A 1P2KA 2H9TH 5L2YH 1HAGE 1TABE 1SGTA 2JH0D 1UMAH 1O3FA 4TYDA 4AG1A 1MKWK 1NPMA 4B2BA 3BTWE 6CHAB 4AFQA 4X0WU 4IC6A 5F03A 1D3TB 2YMSC 1Z1JA 1INCA 2UUFB 1A0LA 1F7ZA 1L1GA 1QRXA 2HNTF 3IITA 3ZV8A 2ZGXH 2GZ9A 1EUFA 1O3BA 3I77A 5DP4A 2FOBA 1TMTH 2KCOA 5DO4H 1Y5BT 4GHTA 3W95A 1J14A 1GHVH 4ISNA 5C0TA 2FS8A 4WMFA 1QL7A 4GCHG 5EW1H 1YLCA 1FN6A 2C8WB 2W7SA 2BDCA 5BPEA 1SGEE 2ZC9H 3V7TA 1C1UH 1YF4A 2XBYA 4ZAEA 1LO6A 4Q7XA 1V2RT 2J92A 3MH5A 3F2GA 3A7XA 3KF2A 5G4BA 4K8BA 3CS7A 3KIDU 2XBWA 3N7DA 3U1IB 4NA8A 2AIPA 1O2ZA 3NCLA 5A8XA 2EI7A 2KM0A 3RUOA 1YLDA 4M7GA 1WYKA 5EQQA 1W7GH 1ZGVA 3GCHB 1ZHRA 2H6MA 4KKDA 3BTQE 4X6MA 3RMNH 2AEIH 5ETXA 2Z94A 2XRCA 3M7QA 4MDSA 3F9EA 1NT1A 1Y3VA 1UCYE 1FAXA 3EGKH 3UAIC 1GHXH 2WPKS 4NZQA 4DGJA 1ANEA 1QJ7B 2BX4A 1K1OA 4I32A 3SJOA 4Y0YE 4HG6A 1FMGA 1ELBA 2F9UA 2J94A 3KYGA 3MH7A 1OYQA 4AGKA 1C5WB 4GUXA 1Q2WA 1WSSH 2HNTC 3BSQA 3BTHE 1K1JA 5ESTE 1RGQA 2PP6A 3QGNB 4AX9H 2HALA 5ESBA 1QQUA 1SGIB 3KYFA 1LHGH 5EQRA 4FXGH 5I25A 3PROA 2GT7A 2A2XH 4I33A 2J95A 1H9HE 3AAUA 3LIWA 1K21H 1JIRA 2ZHQH 4AGJA 1BTHH 2YNBA 4Z1MD 2ZHWH 4BAOB 2BHGA 5DP7A 2WV4A 3JZ2B 1DUAA 4AYVB 1H8IH 3D49H 4NFFA 2K8IA 1KXEA 2CMYA 2J38A 5LPFA 2ZKSA 1FY5A 1HYLA 4GLYA 1AHTH 1N8OC 1TNLA 2W7UA 3OTPA 1ABJH 2ZTXA 1C5NH 3QLPH 5A2MH 1PPHE 2AERH 5DJ7A 1L0ZA 1GBEA 5T6DA 3TGIE 1BCUH 1GJ4H 1H9LB 1N6YA 4MVNA 1H8ED 3BEFB 1BRBE 1QFKH 2OK5A 1NBME 1YPHC 4B71A 1UTKA 2ZTYA 1DLKB 2A4GA 3RU4E 2STBE 4DT4A 4JZ1A 1FY8E 1TA2A 4FOUC 2QAAA 4Y11E 4TY6A 2ZO3H 1XM1A 1TLDA 1SLVB 3LC5A 1HJAB 4J2YB 3VXEH 3R3GB 5T1VA 1O2QA 1HJ9A 5EGMA 4RKJB 2ANWA 4K1SA 1J8AA 1CT0E 3E16B 4IMQA 1C5LH 4GPGA 1O2YA 1OPHB 4DJZB 2Z9LA 1KSNA 3V12A 3SJIA 3AVZA 3A7YA 3SZNA 1G9IE 1NFWA 3WY8A 1O3NA 4D76A 1K9OE 2O8UA 4MG3A 1BHXF 4YOGA 2YMSD 4YESB 3SORA 1J15A 1PQ7A 3RXIA 3SZEA 3SNAA 1OWHA 5HGGA 1CHOF 1TNJA 3MO6A 1BMNH 3MNCA 3T62A 3SU3A 1TOMH 4IC5A 4KP0A 1FN8A 1TMUH 4AFZA 1EFRD 3P70B 2ZHFH 1C5RA 1QBNA 1VJAU 1LHDH 3P8NA 3EE0B 5EQSA 5HIZA 3MU4A 1UK2A 2A5IA 3A89A 2ALVA 1AN1E 1KDQA 2B0FA 2P3UB 3E0PB 3FANA 1IQLA 2W6ID 4X1RU 1GDQA 3SU6A 1ELEE 5JBAS 3MWIU 3BTEE 1DXPA 2F9NA 3VG8A 2NU2E 2PFEA 2W5EA 3TNSA 3DCLA 1MH0A 1SGFG 5EXNA 1P9SA 1T31A 1GBKA 5DP8A 2PR3A 1DFPA 1XXDA 1GMHG 1EASA 1D6RA 3HK6B 1H8HD 5JB8S 1EOLA 1TQ0B 1AB9C 1RTFB 3RXEA 3UQVA 5IK2D 1HLTH 1C1TA 4CH2B 4OS6A 5EPNA 1GHAF 4X1NU 3UPEA 5JBCS 1UK4A 1C5VA 1L1NA 1PYTD 1ACBE 1FI8A 1DVAH 1A0HB 2GX4A 3GISB 1MZDA 3KNXA 4K3JA 2Z9KA 3OEHD 2WV9A 2BQWB 1YPMH 4Z6AH 2J5UA 1GI4A 2G4TA 1LHCH 2HVXA 3B8JA 3ZZCA 4D7GA 3JZ1B 1GBBA 2BD9A 3UB0A 2WINI 1UTJA 2NU3E 4A6LA 2SGQE 1NY22 1GJ6A 4FETA 4IMZA 1JBUH 1BBRH 3GY5A 2WYJA 1QURH 1GMCG 3S69A 2WPHS 2K0QA 4ASUD 1P8VC 4FUBA 3K6ZA 4O03A 2ZCHP 3A80A 3AASA 1C1VH 1QBVH 2HRVA 4MPWA 4GCHF 4BNRA 1AD8H 2Y5HA 3PV2A 3RU4D 2Z7FE 3BN9A 1RIWB 1H4WA 4MPVA 1Z1IA 1M9UA 1MABB 2G51A 4NIWA 1BB0B 2TGPZ 2OD3B 2HPQH 4Y8ZA 5EOKA 3SW2B 4D7FA 2I6QA 1C4Y2 1K22H 1T8OA 1DPOA 1SLWB 3VFEA 3PO1B 3ZIAD 4BXWA 5GCHG 2W3KA 1S84A 3Q3KA 1AVGH 1AZ8A 1EZUC 2C3SA 2QF4A 4DG4A 3PYHA 3LJOA 2ALPA 3ATIA 1QJ6B 3LGTA 1VKYA 1OX1A 3SV7A 1MAXA 1FQ3A 3M3SA 4Y8YA 2AIQA 4XE4A 3F2FA 5JBTA 3PMBB 2AMDA 1O3KA 1ELDE 4FU8A 2A4OA 1UVUH 2SGDE 3Q76A 5DSFA 1Q31A 4CBNA 2J4IA 3PMAB 1VZQH 4XRNA 5C1YA 2LNCA 1WQSA 1ZMLA 2A31A 1ZJDA 3SYJA 2B8OH 1A3BH 3P8GA 1P10A 3MO9A 1KXAA 1SI5H 2GJGA 3S0NA 3PRBA 2FWWA 1EJAA 1QY6A 2L6OA 3OY6U 1GGDB 1TRYA 2F91A 5IDKA 4FUFA 5LPEA 1AKSB 2QXIA 3UWJH 2CXVA 1VGCC 2VJ1A 4LZ4B 4U01A 1V2TT 2ZFFH 2UUKB 3GY6A 4H6TA 1TBQH 3M3VA 2J97A 2DUCA 2A5KA 3RLYH 1BOQA 3KGPA 1SGYE 2GCTB 2TGDA 3NPSA 1W14U 4UFGH 1GG6B 3LOXA 2BD3A 1A3EH 2V6NA 4XOJA 1SFQB 4LZ1H 1Y59T 3RXKA 4R8TB 3FKSD 1SVPA 2ZNKH 1P2NA 2WPIS 4Y7BA 1P11E 4ABFA 2Y7XA 4GAWA 2ZQ1A 1C5YB 1G30B 3RXGA 3A87A 1HAXB 3ATLA 1TNKA 1J17T 4BXSA 4KTCA 3SUGA 1A46H 2OLGA 2NU4E 4AFSA 7KMEH 1QNJA 2BDGA 3MNBA 1C2LA 2Z3EA 1C4V2 1NRNH 3P95A 1KXCA 1SC8U 1TMBH 1C5MD 4WXIA 2SGAA 2BQ6B 2IJD1 2FPZA 3N99A 2Z9IA 1Y3UA 5EPYA 3A7TA 4ACBA 4E06H 4X8UH 2PSYA 1MU8B 4H4FA 1E79D 1MD8A 2GDDA 3T26A 1C2KA 3ESTA 1ELCA 1JOUB 2JETB 3A84A 2ZTZA 1ZTKA 2ILNA 1IQFA 3BTTE 4AYYB 3UNQA 1TGCA 4A1TA 4FVDA 5A09A 4ZHLU 3FZDA 1VITG 1GJAB 3ZVAA 2BY6X 3LPRA 1FY4A 1ESAA 1SGNE 2HWLB 3F68H 1ZTJA 4JK6A 1O30A 2FI4E 3S9AA 1WV7H 1BTPA 2WZQA 4DT7B 4ABBA 1TFXA 3MU5A 1OXGA 2THFB 2AS9A 1SOTA 1VCQA 5C17A 4ISLA 2BVXH 2FOAA 1ELTA 2OC7A 5DPAA 3FO8D 5CDFE 1LHEH 1SGRE 5KEDA 2BM2A 3LGYA 2TIOA 2XC5A 5FBIA 3TK6A 2A7JA 2FDAA 3DFLA 3QZQA 2RFKC 1TRNA 1GBCA 1HDTH 1O5FH 3GDSA 1GMHF 2H1UA 1LPGB 4K8YA 1QRZA 4ABEA 3BEUA 4AORA 3O8BA 1KTSB 2ZPQA 4YOIA 4YM9A 4BTUB 2Y7ZA 2ZU1A 4I86A 1MTVA 1HBTH 3F9GA 1HJ8A 1ZHMA 1GBLA 1ZSLA 3EQ0H 1G36A 4IGDA 1O37A 3SQEE 1O2KA 3SU0A 2ANMH 3RXSA 2IPHA 3E91A 2EEKA 3NZIA 3ZZ5A 4F4OC 2R3YA 4YT7H 4ABHA 1TA6A 4P02A 1V2OT 4B76A 1OS8A 1DICA 3M61U 3ZVDA 2GTBA 4ZMAH 4H42U 3SV2H 1NO9H 8GCHG 1IQHA 4WH6A 2BYAX 8KME2 1FJSA 1GMCF 1YM0A 1KYNA 2QGRA 1F92A 1C2FA 1HGTH 1O31A 2F83A 1TNIA 4ISHH 5JBBS 1Y8TA 4B75A 2PUXB 5FPYA 1O39A 2FX4A 5HXFA 5JPMH 4D8NA 3Q3YA 3MMGA 4Y0ZE 4AC9A 4K1TA 1NU7B 3UNRA 3OYPA 1OWEA 2GV6A 1NRQH 3UR6A 1Z8IB 1T8MA 1LKAA 3RMLH 2WHXA 1S85A 3A7VA 3ZVCA 2FTLE 1GVKB 2CHAC 1HPGA 1NFYA 5GCHF 1EP6A 2OUAA 5FPTA 1SGPE 3BTFE 5DGJA 1TALA 2AHME 3RXDA 4YZUA 3QDZB 1OWDA 4ISOA 1W13U 1HB0B 1LQEA 2F4LA 1BBRK 3GY3A 5T3HA 1CHOG 3G01A 3SOSA 3SQHE 1SGDE 1AE5A 3FP6E 1O3GA 1ZMJA 3SJKA 1CVWH 1YPJH 4Y76A 3K6YA 3LT3A 4FUDA 5C94A 1GBFA 1XVOA 1GMDF 1H8DH 5K7RA 3OX7U 1MTUA 1O2OA 3DHKH 3H09A 1O5CB 1SFIA 2J98A 4I7YH 1NESE 1WTGH 3Q77A 1A2CH 1O2GH 2HOBA 4F48B 1TPSA 4AOQA 4ASHA 3A8AA 1O2LA 2BVRH 1B7XB 2ZI2H 3STJA 1E36B 1CGJE 3GICB 3UTUH 5E0JA 4O3TA 2FS9A 2WUCA 1E35B 1W7XH 4JZIA 4MTBA 1CE5A 2RDLA 1KDQB 2Q6DA 2G00A 2VH6A 2Q6GA 2BY7X 1O3JA 1C2HA 2HLDD 5TJXA 4OS5A 1GJCB 4X2VA 2QF0A 2ANKH 1O38A 1XUFA 1V2KT 3MU8A 3RM2H 5DN6D 1CA0B 1SGQE 2PGBB 4Y79A 1TAWA 3TVJB 3W94A 4CRBA 1GCTC 1CQQA 2VBCA 3RXOA 1C9TA 3SU5A 4NSVA 1QGFA 4E7RG 1O3AA 2R3UA 1SQAA 3CS0A 1DDJA 4I8LA 1THSH 2GMTB 8ESTE 2A2QH 3QO6A 3QZRA 5GWZA 1GHBF 9LPRA 1ANCA 2VGCC 1JIMA 1UVTH 2C4FH 1LHFH 3FAOA 1A5GH 2FI3E 4QT8C 3AAVA 2RG3A 3W1EA 3SI3H 4HZHA 2GZ7A 1K2I1 2B5TB 2GP9B 3TH2H 1H9IE 1RTKA 2FXRA 2EC9H 5T6GA 2NWNA 1HRTH 4I8GA 4I8KA 1OWKA 3PLKA 2TBSA 1Y3WA 1GHYH 1A5HA 1KXDA 1O36A 4YT6H 1SQRA 1YCPK 3VGCC 1THPB 1Y3YA 1B0EA 4YLUA 1EX3A 2P95A 5C0UA 1G3CA 1GGDC 3AW0A 2VB0A 4Q63A 3E8LA 2ZA5A 5K0HA 2TPIZ 5C1XA 4MPUA 3QTOH 2BD8A 2EI8A 1LCYA 1VITF 1IHSH 8LPRA 1E1RD 3GDUA 2M5TA 5EJ1A 1GJ7B 2M2AA 1PYTC 1ZRBA 2I6SA 1GG6C 1K1LA 1G32B 2UWLA 3M3TA 5HIYA 4CRGA 1DT2A 1TONA 3DFJA 1TPAE 3KQEA 2VVVA 5C2ZA 2ZGHA 3UOPA 4DURA 3T29A 5F6MA 1RFNA 3PLPA 1SBWA 4A5TS 2BX3A 3FFGA 1GI3A 1FDPA 3A86A 1UVPA 3ZVFA 2KAIA 3NKKA 1TPPA 2VWLA 2BD5A 1ARBA 1J9CH 2JH6D 1GI7B 1CGIE 1KTTB 2BDYA 1ETRH 1GBAA 3LU9B 2RDEA 1TRMA 4TWWA 2Y81A 1TPOA 2FP7B 5AFZH 1W0JD 3N7OA 2OBQA 1TB6H 1GVZA 2BDIA 1IQJA 2G5VA 1K0HA 3DSPA 1EAWA 3SUDA 5DK1A 1H1BA 1SLUB 3UUZA 4DIIH 1DSTA 2WPJS 4B1TA 4DCDA 1AWFH 2O9QA 4AFUA 2EI6A 4K60A 3VB4A 1AE8H 1S6HA 1AFEH 1MKXK 1QRWA 2D26C 2PHBA 1TGBA 2GT8A 4HFPB 7GCHF 1ETTH 2O8LA 1C2GA 1TGSZ 8GCHF 1ELVA 1A4WH 1C5ZB 1DY9A 3B23B 2ZDKA 3O8CA 5JB9S 1TGNA 1QB1A 5B6LA 4NA9H 3EDXB 4K1EA 3RMOH 3V0XA 1BQYA 1MZAA 3RXMA 1IQEA 2OC8A 3SV9A 2YNAA 2ZQ2A 4UE7H 4JZEH 1QR3E 2VIQA 1C1RA 1QTFA 1QBOA 3BTKE 4X1QU 4B6FA 1PPFE 3UWIA 2A5AA 1AFQC 1EAUA 1C5PA 2GZ8A 1BTZA 3SJ9A 3RXCA 1GCDA 1XMNB 1MTNC 3S7KB 4XSKU 1GWAA 5BRRE 3A82A 1P03A 4YTAA 2VIDA 2SGPE 2SGFE 2LP6A 3R0FA 3PV4A 3SNBA 3RXLA 4INKA 1W11U 1FV9A 1ANBA 3HGNA 3VXFH 2H5CA 1GDUA 2VVUA 4TPIZ 4AN7A 1MQ6A 1QJ1B 2G52A 1D3DB 2ZDMA 5AF9H 5CHAB 1T7CA 4ABJA 3MU1A 1DE7H 1SMFE 1XUGA 5E2OA 2AFQB 3N7EA 3TU7H 3RXFA 2PGQB 1TYNA 3A85A 1P0SH 1QCPA 3E3TA 5LH8A 3A8CA 1MCTA 2FOEA 3PLBA 3PRDA 3MNSA 2ODPA 2BTCE 2B9LA 2ZG0H 2AGEX 2PSXA 4X1PU 1P2JA 2DE9A 3SU4A 2BY8X 1EAIA 1MAYA 4NCYA 2FOCA 1ZPBA 3AK5A 1WU1A 3OE7D 2QN5T 4WJG2 2SGEE 5EJZA 1NM6A 1P3EA 1C5OH 3RXBA 1EPTC 1V2QT 1UTMA 2AGIX 4ABAA 3A88A 2F43B 2WUBA 1IQIA 5HKKD 4IW4E 2FODA 2ZPRA 4B6EA 1QL8A 2QA9E 2GVFA 3ZZ6A 1AUJA 1C5QA 3VGCB 1EOJA 1TX7A 2J9NA 4XBBA 1EATA 3OAAD 2SFAA 2XWAA 3GCTF 4DIHH 4FU9A 4RT0A 3A7WA 2VH0A 3SN8A 1O2RA 2VIPA 4IN2A 4JZDH 2UUYA 1LTOA 1GDNA 4NIYA 7ESTE 3FP7E 4MQAA 1A1RA 3ATMA 3LGUA 1NBMD 5KGOA 1O33A 1O3MA 3F2HA 5C67A 4TPYA 1KLIH 4DOQA 3UR9A 1G3EA 2HPPH 1V2MT 1YCPM 3BG4B 1LVBA 1T32A 1UVSH 3TJVA 4TY7A 4BAKB 2WPDD 3URDA 3F9FA 1O2XA 4OS2A 1CBWB 1XXFA 3RXVA 2OXSA 1KXFA 4VGCB 5EW2H 1BBRE 2Z9GA 2XOKD 1FPCH 4RSPA 1P2OA 1BTUA 6ESTA 2XW9A 3RXQA 1D3PB 1P06A 7LPRA 4AB8A 2C8ZB 2R0KA 3WW7A 2KZ4A 1CA0C 5F8ZA 1SHHB 1DWBH 1GMDG 4NA7A 1F0TA 2VIVA 2BXUH 6CHAC 3H5CB 2Z9JA 1O3DA 3BIVH 1MTSA 1HAYB 2G4UA 1ZPZA 3BF6H 1EKBB 1O34A 1ZGIA 2TGTA 3MH6A 4ZKRU 1EQ9A 3L3TA 3LGIA 3LKWA 2YMSB 4Z0KA 3T25A 1C2MA 3H7OA 2XWBI 3MYWA 5LPRA 1GI8B 1FUJA 2FOGA 2BD4A 2KCYA 2P3TB 2VIOA 3ATKA 1TQ7B 3T2NA 4F49A 1BJUA 2R2WU 1K1NA 1TBRH 4NIXA 3U98H 1NROH 3ZZBA 2J98B 2QF5A 4UDWH 4JMYA 5AFYH 3V13A 1DX5M 3QK1A 4FUCA 1A0JA 4X8VH 1YC0A 2FMJA 3K65B 2CGAA 2F9BH 2GKVE 2OQ5A 3F3BA 4XD7D 2ZFRH 1CHGA 3CENA 3GCHC 4Y7AA 1KMHB 4WMDA 4INHA 1OP2A 3CP7A 1ANDA 2IN2A 1O2NA 1K1PA 3RXTA 2BY5X 4ABDA 2TRMA 1VJ9U 1GHBG 4NWKA 1O2JA 1ZRKA 2ZDAH 1IAUA 2Z6BD 2ZF0H 3K9XB 1UTQA 2VIWA 2D2DA 3O8DA 2D1JA 3F1SB 3OU0A 1HAZB 1C2DA 2YOLA 3ODFA 5FBEA 1Z8JB 2DE8A 4RN6A 5I46H 4WY3A 1F2SE 2BOHB 2GV7A 2VVCA 4XBCA 2BLQA 3TGKE 2ODYB 2XC4A 1AO5A 1PQ8A 3OY5U 1YY3A 2F9PA 3FP8E 1UW7A 1CT2E 2PKSB 1GI5A 1V6DA 5C1UA 1QL9A 1SB1H 3DSOA 1AZZA 2ZU2A 1L4DA 3O8RA 1PFXC 1V2WT 5GJ4B 1F0UA 2BZ6H 2KCAA 1PPGE 2ZDVH 1ZZZA 1SR5C 1V2ST 3UOUA 2P93A 3S9BA 1C2IA 3ZVBA 1WBGB 2JDID 5CE1A 2FX6A 4BTIB 2GD4B 3M7TA 5F8XA 4I31A 3ZVEA 3NRLA 3SI4H 1GBTA 2A4RA 2UWPA 4GVUA 1C9PA 2QE7D 1Z7KA 1C5SA 3VB6A 1SL3A 1N8OB 3PB1E 1QA7A 1EB2A 2ZFPH 4CRDA 1MTWA 4HGCA 2GCHG 2OP9A 3RC5A 3T27A 1SGFA 5F53A 1YBWA 4X8SH 4CBOA 3OEED 1KXBA 3C27B 1HAOH 2XXLA 1HNEE 1O5EH 2W6JD 2QXJA 3MNXA 4CRAA 2P8OB 1QA0A 1HJAC 3U1JB 1OWJA 3HKJB 3BIUH 1K28D 1MD7A 2H5DA 3CNRA 5GNDA 4LXBH 2ZHEH 3ZZ7A 2OTVA 1W0YH 1O32A 1GHWH 1MCVA 3P8OA 4OGXA 2BXTH 3GY8A 1E0FD 2ZPSA 2ZU5A 4HI3A 2OCVB 4ABIA 3RXRA 2KAIB 3ITIA 3A8BA 2FIRH 1BUIA 1IQNA 3IWMA 3PWCA 3TPIZ 1S6FA 1C5TA 4AG2A 2VWMA 1W10U 7GCHG 1C4U2 2ZFTA 2Z3CA 3TIUA 5J4QA 2BLWA 3MTYA 3VPKA 3LJJA 1ZPCA 1SG8B 2R9PA 2ZGCA 1O5AB 9ESTA 3K2UA 3LGWA 1ZTLA 1EZQA 4X6NA 1S0RA 2WYGA 1P02A 3MOCA 1T4VH 1YPKH 2F9VA 2JH5D 2PTCE 2FO9A 3HPTB 1UK3A 1CGHA 4X8TH 2A45B 2ZCLP 4XDEA 3RXAA 1ORFA 1UTOA 2BDHA 2XBVA 1FAKH 2ZP0H 4Y71A 1HAIH 2FYQA 1B0FA 2Q1JA 4Q7YA 1FY1A 3V3MA 1JWTA 3D65E 4SGBE 5L2ZH 5HM9A 1BMMH 1L4ZA 4AB9A 1V2UT 2P16A 1AB9B 5A8YA 3SU1A 1DWDH 4OS4A 4A1XA 4OS1A 3SO3A 1TX8A 3KN2A 2J2UA 1G2LA 4I8HA 3RM0H 1BHXB 1F5KU 5L6NH 3KHVA 4ZROA 1MBMA 3A7ZA 4BAQB 1FXYA 1QQ4A 2A7HA 4U30A 1PPCE 1XUHA 2BMGB 3UFAA 3KL6A 2ZEBA 3E90B 5IYTA 1E37B 2QF3A 1O3EA 3A81A 1WDIA 4RI0A 1C1WH 2O8TA 3TK9A 1RD3B 1NN6A 3SGQE 3FZZA 2AMQA 3DA9B 3SNCA 1WQVH 3U8OH 1XX9A 5HMAA 2O8WA 1L2EA 2AH4X 3M5NA 2NU0E 2WPMS 3RU4T 1NRRH 3NUMA 1RIWC 1O35A 1Q3XA 1XUKA 3WWFA 2OC1A 2Q6FA 3F0PA 2F3CE 1D6WA 3UNSA 3BG4C 2IOTA 3BTME 3GCNA 1O2SA 4X2XA 1VR1H 2K1QA 1AUTC 3PO1C 2ZGJA 2QXGA 3OTJE 1ZYOA 5T6FA 1IQMA 1HCGA 1GPZA 5DP6A 3OSYA 4ZXXH 5FXLA 2HVYB 4VGCC 1V2JT 2P3FH 1NFUA 2QXHA 2RCEA 4GSOA 5CMXH 2PUQH 4A92A 3GCTG 1UHBB 3ZZ4A 1EZXC 1ZR0A 3GY4A 1HAPH 1EP5A 1EZSC 5JYIA 1UTNA 3LGVA 3F9HA 2XBXA 3QN7A 1O2MA 1SQTA 4WF8A 1AU8A 3TJNA 1YWUA 3P92A 1EJNA 3I29A 1ELFA 1G37A 1GJ8B 1LQDB 1LPZB 1F0SA 1UTPA 4FUEA 3M35A 4O9VA 1BZXE 2FM2A 1ZLRA 2J34A 1HIAA 3B9FH 3PTNA 3SGBE 4BAMB 1DLEA 1F0RA 1GI6A 1K1MA 2W3IA 3Q3XA 1FIWA 4DVAU 1C5UA 1O2VA 3TJOA 1DUEA 2PW8H 4ACAA 1BMFD 1UCYH 1ARCA 3ATWA 4WXVA 1BITA 1GBJA 2IPQX 2XYAA 5F8TA 3DT0H 2LPRA 4KELA 1VGCB 3SBKA 3BTGE 2AMPA 1GJBB 1LVMA 1IQKA 4DY7B 1WUNH 4Y6DA 1VCWA 3KQDA 2GCTC 4O97A 1ESTA 4MLFB 1DOJA 1F5LA 1DSUA 2G5NA 5FHTA 2PWXA 2V3MA 3S9CA 2GCHF 2IJOB 4ZHAA 3VB5A 4KTUA 4JYVH 4E05H 2WPLS 1GBIA 6GCHF 1Z6EA 1BT7A 2CF8H 2ZHDA 1BDAA 2ZECA 1DWCH 3LC3A 1CT4E 1MU6B 1O3LA 3EAJA 5DP3A 4NG9H 5ABWA 5EXLA 1V2NT 4IBLH 2ZCKP 2CF9H 4WH8A 2ANYA 2ZIQH 2HGTH 5GPIB 4BTTB 3OFND 1FONA 2ZZUH 4FVBA 2PKSC 1UJ1A 2P94A 5A0AE 3QUMP 3SHCH 1P9UA 2BVSH 2JETC 3A8DA 3ELAH 4Q2KA 4X6PA 1NRSH 2CV3A 4JZFH 1YPLH 3HK3B 1UTLM 3EYDA 3M7UA 1BRUP 5SGAE 1AY6H 5C5NA 4YO9A 2XNDD 1LVOA 1P12E 3NXPA 2HNTE 4D9RA 1VITH 2KCPA 3P6ZB 1YPEH 1C2EA 4F55A 2FEQH 4WVPE 1FX0B 1QZ8A 2V3HH 2L74A 4CHAB 1O5GH 2KX4A 5FCRA 2Y6TA 3RXUA 1EPTA 2XCFA 2ZU3A 3L6PA 5C5OA 4FUIA 2UUJB 1HXFH 4LOYH 2SNWA 1PQ5A 4Q80A 3ZZ9A 5A8ZA 1D4PB 2QY0B 1EJMA 1MMJN 3UREA 4X2WA 2P8OC 4B74A 1V2VT 3AW1A 1P57B 4NWLA 4FUGA 3P17H 1AI8H 3RXJA 1O3HA 2FYRA 2PKAA 1U6QA 2ZFQH 3BV9B 4ZUHA 1HFDA 4E7NA 1Y3XA 1HAVA 2QC2A 2R0LA 4X1SU 1OKXA 1UVOA 1YPHE 1ZHPA 3ZYDA 3SV6A 3M5OA 2A1DB 1BTYA 3FOAA 1SGCA 1DITH 1TBZH 3E6PH 3LONA 5FCKA 1GL0E 1AIXH 1GJ9B 3LH3A 2FOMB 1O3OA 3GCOA 1BRAA 1TOCB 1AVXA 1O2IA 1QIXB 1PPBH 1Y5AT 2BOKA 1TE0A 2FESH 2OINA 4ZCNA 1C1MA 3SUEA 1C5XB 5H4IB 4MNVA 4YLQH 3ZZDA 4HTCH 3RXHA 1LDTT 1P2QA 1TWXB 1O3CA 2CK3D 5GIBA 2CJIA 1PPZA 5C3NA 1DM4B 1YYY1 1UHBA 1W12U 4INLA 2W26A 5A0BA 2V0BA 2O8MA 2C8XB 1AMHA 1J16A 2ZWLH 4CREA 1FY3A 3EA7A 1N1LA 2VU8E 3EA9A 3U9AH 2RA3A 1W0ZU 1V2PT 4D9QA 1O0DH 1S82A 3TGJE 3H7TA 3UIRA 1FNIA 3GY7A 2KFWA 5DP5A 1O5DH 1Z6JH 1QHRB 4J1YA 1CO7E 1BRCE 2FZZA 2CHAB 1IOEA 1GBHA 3SHAH 1RJXB 1V3XA 1OOKB 1F5RA 1A5IA 1C2JA 4TWYA 3TH3H 5KECA 1D3QB 2G8TA 1QB6A 2GDEH 2ULLA 1C1NA 1P2IA 4FUHA 1O3PB 3URCA 1NU9A 3STIA 4CRFA 2ZGBH 3GY2A 2FOFA 1T8LA 4O3UA 1OHHD 1TIOA 3TH4H 2JKHA 4GHQA 2V7QD 1BIOA 2VWNA 4H6SB 1COWD 1KLTA 1HAHH 4RT1A 3P8FA 3RP2A 2A0QB 2LELA 5E0HA 2PLXA 4KGAA 5CHBA 1ELGA 1LKBA 1ELAA 1D9IA 2D8WA 2ZU4A 2C90B 4NSYA 2BLOA 3NWUA 2FLBH 1BA8B 1GJDB 3GDVA 4JYTA 5DP9A 5FAHA 1RXPA 1XUIA 1EAXA 4K69A 4THNH 3NK8A 1EB1H 2HLCA 5AVDA 1SPJA 4OGYA 3IG6B 1OWIA 1JXPA 1YLNA 3LH1A 5EJLA 4YXWD 4NGAH 3ZZAA 4IS5A 3DSGA 2FLRH 3BTDE 3ZV9A 5FL7D 3MH4A 3T28A 3QGJA 3KEEA 1ABIH 4OS7A 1N6XA 1W0KD 3VB3A 3QTVH 1WAYB 4ZHMU 4Q7ZA 1YPGH 4MPXA 1WOFA 4XBDA 3BG8A 1RTLA 4CR9A 1XKBC 1GCTB 2CN0H 2ODQA 1W2KH 2GMTC 1JRTA 4ABGA 4AZ2B 4ZKSU 2ASUB 4ZH8A 4B2CA 2OC0A 2Z3DA 3ZYEA 5EU8A 2EA3A 2H9EH 2BD7A 2G81E 1UCYK 1TNGA 2STAE 1PQAA 2PV9B 2VGCB 4TSFD 4MNWA 1AVWA 5FX6A 5HYOA 4JCNA 5HM2A 3D62A 1GBDA 4NIVA 5EODA 1DXWA 1FLEE 3SU2A 1MKWH 3HKIB 1HUTH 2C8YB 3KQCA 1AWHB 2BZAA 4LK4A 1FZZA 3RXPA 2F9OA 1O2WA 4R0IA 5GDSH 5L30H 2AGGX 2NU1E 2BDBA 5A0CA 1DANH 3SUFA 3MHWU 1SHYA 2PTNA 1PPEE 4MNYA 4Q4LA 5LGOA 2JJ1D 3RLWH 4M9FA 3RC4A 1BMAA 1X7AC 5E8EH 5B6OA 1MUEB 3ZZ8A 3ZVGA
chains in the Genus database with same CATH topology
1JRSA 2B7DH 2UWOA 5TCCA 2RA0A 3GYMA 1YCPH 3PMJA 1NC6A 1BMLA 1TNHA 1O2UA 4B2AA 1VCPA 1IQGA 1O3IA 1P3CA 4U32A 4PROA 5E0GA 4ZXYH 1ETSH 3SGAE 2XTTB 1LPKB 5FPSA 3VB7A 1UO6A 2V35A 3ENSB 4KTSA 4SGAE 1S0QA 2OQUA 3PM3A 4UFDH 2GGVB 4CR5A 4FUJA 5DKMA 1QB9A 2BLVA 3EA8A 1ZJKA 4RKOB 4XFQA 2QV1A 1PJPA 3DUXH 1C1QA 3QX5H 2VINA 3ODDA 2OBOA 1A61H 1GL1A 2A4QA 1Z8RA 1AQ7A 3SV8A 3ZZ3A 2Y82A 4CH8B 3SJ8A 1A7SA 3MI4A 4NFEA 3MU0A 3GYLB 1T8NA 1E34B 1HIAB 1C1SA 1P09A 4B73A 2ZDLA 2P59A 1MQ5A 4UONA 3A83A 2SNVA 1CA8B 4ESTE 4Y8XA 1GVLA 1LMWB 6GCHG 1YP9A 3U8RH 3UQOA 3TLOA 1Z71A 3L33A 4BAHB 1GI1A 3DD2H 1GI9B 4CHAC 1P01A 1GHZA 1FIZA 2FTMA 4BOHA 1G3DA 1WTHD 5TCAA 3LDXH 3PMHB 1ZMNA 2XCNA 4ISIH 1DY8A 1MKXH 1OP0A 3HGPA 3KCGH 4A1VA 4UD9H 3TK5A 1XVMA 1KLJH 1GJ5H 1IHTH 1BTWA 1BTXA 1NS3A 3RMMH 3KQBA 4ZKNU 1OP8A 4YOJA 1W3CA 1AFQB 1L1JA 2Y5GA 4FU7A 4IN1A 2Y5FA 1MTNB 1EXFA 3TITA 1NFXA 4X2YA 1NTPA 3I78A 1V2LT 1RS0A 1S81A 1C1PA 1NRPH 1XKAC 4WWYA 5GXPA 5CHAC 1TGTA 2H2ZA 2G55A 2XNIA 1OSSA 3UY9A 2QYIA 1O2HA 1HXEH 1O2TA 5EXMA 1CU1A 3HATH 2BDAA 2ESTE 4U2WA 2WV5A 1S83A 5J4SA 1ZOMA 1G3BA 1GI2A 3F6UH 1Z8GA 5JDUB 4X6OA 1KIGH 1T4UH 3TNTA 1HV7A 3U8TH 2BD2A 3T5FH 6LPRA 3S7HB 4WMEA 2Y80A 4MNXA 2BQ7B 1AGJA 2VNTA 4Y10E 1P05A 2C93B 3U69H 1EPTB 1MBQA 5AHGH 3SNDA 1G2MA 1P2MA 1WCZA 4K5ZA 3PTBA 4UEHH 2R2MB 3C1KA 1THRH 2FI5E 1NZQH 1SOZA 2A7CA 3M37A 4JYUH 5DG6A 1SSXA 1GI0A 1JMOH 3VEQB 4K2YA 2TGAA 3PWBA 1OYTH 1ZSKA 2FOHA 5PTPA 4CRCA 1SLXB 2PKAB 5FX5A 3M5LA 1W8BH 1ESBA 1O2PA 3GOVB 1BJVA 2AYWA 1LVYA 2VWOA 1HAVB 1CSOE 3RC6A 2XC0A 1ZSJA 4ZKOU 1AKSA 3D23A 1C1OA 1DWEH 1TX6A 3BEIB 4DW2U 4JK5A 4BANB 1O5BB 2QIQA 2H9HA 1GBMA 3M36A 2A32A 1ID5H 3SNEA 3FVFB 1FPHH 2QCYA 3MFJA 2ZDNA 1S5SA 5EG4A 3RDZA 3E1XB 4UFFH 1Y5UT 5C20A 1DS2E 1CBWC 3E0NB 4NZLA 1P04A 1KY9A 1B5GH 3QWCH 1YKTA 1YGCH 1XUJA 2ZFSA 1E38B 2BY9X 4A7IB 2BB4A 1RRKA 4I8JA 1GHAG 4UFEH 3M5MA 3MO3A 2V3OH 3TJUA 1SQOA 5E2PA 1K1IA 3Q00A 1P2KA 2H9TH 5L2YH 1HAGE 1TABE 1SGTA 2JH0D 1UMAH 1O3FA 4TYDA 4AG1A 1MKWK 1NPMA 4B2BA 3BTWE 6CHAB 4AFQA 4X0WU 4IC6A 5F03A 1D3TB 1Z1JA 1INCA 2UUFB 1A0LA 1F7ZA 1L1GA 1QRXA 2HNTF 3IITA 3ZV8A 2ZGXH 2GZ9A 1EUFA 1O3BA 3I77A 5DP4A 2FOBA 1TMTH 5DO4H 1Y5BT 4GHTA 3W95A 1J14A 1GHVH 4ISNA 2FS8A 4WMFA 1QL7A 4GCHG 5EW1H 1YLCA 1FN6A 2C8WB 2W7SA 2BDCA 5BPEA 1SGEE 2ZC9H 3V7TA 1C1UH 1YF4A 2XBYA 4ZAEA 1LO6A 4Q7XA 1V2RT 2J92A 3MH5A 3A7XA 3KF2A 5G4BA 4K8BA 3CS7A 3KIDU 2XBWA 3U1IB 4NA8A 2AIPA 1O2ZA 3NCLA 5A8XA 2EI7A 3RUOA 1YLDA 4M7GA 1WYKA 5EQQA 1W7GH 1ZGVA 3GCHB 1ZHRA 2H6MA 4KKDA 3BTQE 4X6MA 3RMNH 2AEIH 5ETXA 2Z94A 2XRCA 3M7QA 4MDSA 3F9EA 1NT1A 1Y3VA 1UCYE 1FAXA 3EGKH 4DGJA 1GHXH 2WPKS 4NZQA 1ANEA 1QJ7B 2BX4A 1K1OA 4I32A 3SJOA 4Y0YE 1FMGA 1ELBA 2F9UA 2J94A 3MH7A 1OYQA 4AGKA 1C5WB 4GUXA 1Q2WA 1WSSH 2HNTC 3BSQA 3BTHE 1K1JA 5ESTE 1RGQA 3QGNB 4AX9H 2HALA 5ESBA 1QQUA 1SGIB 1LHGH 5EQRA 4FXGH 5I25A 3PROA 2GT7A 2A2XH 4I33A 2J95A 1H9HE 3AAUA 3LIWA 1K21H 1JIRA 2ZHQH 4AGJA 1BTHH 2YNBA 2ZHWH 4BAOB 2BHGA 5DP7A 2WV4A 3JZ2B 1DUAA 4AYVB 1H8IH 3D49H 4NFFA 1KXEA 2CMYA 2J38A 5LPFA 2ZKSA 1FY5A 1HYLA 4GLYA 1AHTH 1N8OC 1TNLA 2W7UA 1ABJH 2ZTXA 1C5NH 3QLPH 5A2MH 1PPHE 2AERH 5DJ7A 1L0ZA 1GBEA 5T6DA 3TGIE 1BCUH 1GJ4H 1H9LB 1N6YA 4MVNA 3BEFB 1BRBE 1QFKH 4B71A 1YPHC 1UTKA 2ZTYA 1DLKB 2A4GA 3RU4E 2STBE 4JZ1A 1FY8E 1TA2A 2QAAA 4Y11E 4TY6A 2ZO3H 1XM1A 1TLDA 1SLVB 3LC5A 1HJAB 4J2YB 3VXEH 3R3GB 1O2QA 1HJ9A 5EGMA 4RKJB 2ANWA 4K1SA 1J8AA 1CT0E 3E16B 4IMQA 1C5LH 4GPGA 1O2YA 1OPHB 4DJZB 2Z9LA 1KSNA 3V12A 3SJIA 3AVZA 3A7YA 3SZNA 1G9IE 1NFWA 3WY8A 1O3NA 4D76A 1K9OE 2O8UA 4MG3A 1BHXF 4YOGA 4YESB 3SORA 1J15A 1PQ7A 3RXIA 3SNAA 1OWHA 5HGGA 1CHOF 1TNJA 3MO6A 1BMNH 3MNCA 3T62A 3SU3A 1TOMH 4IC5A 4KP0A 1FN8A 1TMUH 4AFZA 3P70B 2ZHFH 1C5RA 1QBNA 1VJAU 1LHDH 3P8NA 3EE0B 5EQSA 3MU4A 1UK2A 2A5IA 3A89A 2ALVA 1AN1E 1KDQA 2B0FA 2P3UB 3E0PB 3FANA 1IQLA 4X1RU 1GDQA 3SU6A 1ELEE 5JBAS 3MWIU 3BTEE 1DXPA 2F9NA 2NU2E 2PFEA 2W5EA 3TNSA 1MH0A 1SGFG 5EXNA 1P9SA 1T31A 1GBKA 5DP8A 2PR3A 1DFPA 1XXDA 1GMHG 1EASA 1D6RA 3HK6B 5JB8S 1EOLA 1TQ0B 1AB9C 1RTFB 3RXEA 3UQVA 1HLTH 1C1TA 4CH2B 4OS6A 5EPNA 1GHAF 4X1NU 3UPEA 5JBCS 1UK4A 1C5VA 1L1NA 1PYTD 1ACBE 1FI8A 1DVAH 1A0HB 2GX4A 3GISB 1MZDA 3KNXA 4K3JA 2Z9KA 2BQWB 1YPMH 4Z6AH 4D7GA 1GI4A 2G4TA 1LHCH 2HVXA 3B8JA 3ZZCA 3JZ1B 1GBBA 2BD9A 2WINI 1UTJA 2NU3E 4A6LA 2SGQE 1NY22 1GJ6A 4IMZA 1JBUH 1BBRH 3GY5A 2WYJA 1QURH 1GMCG 3S69A 2WPHS 1P8VC 4FUBA 3K6ZA 4O03A 2ZCHP 3A80A 3AASA 1C1VH 1QBVH 2HRVA 4MPWA 4GCHF 4BNRA 1AD8H 2Y5HA 3RU4D 2Z7FE 3BN9A 1RIWB 1H4WA 4MPVA 1Z1IA 1M9UA 2G51A 4NIWA 1BB0B 2TGPZ 2OD3B 2HPQH 4Y8ZA 5EOKA 3SW2B 4D7FA 2I6QA 1C4Y2 1K22H 1T8OA 1DPOA 1SLWB 3VFEA 3PO1B 4BXWA 5GCHG 2W3KA 1S84A 3Q3KA 1AVGH 1AZ8A 1EZUC 2C3SA 4DG4A 3PYHA 3LJOA 2ALPA 3ATIA 1QJ6B 3LGTA 1OX1A 3SV7A 1MAXA 1FQ3A 3M3SA 4Y8YA 2AIQA 4XE4A 5JBTA 3PMBB 2AMDA 1O3KA 1ELDE 4FU8A 2A4OA 1UVUH 2SGDE 3Q76A 4CBNA 1Q31A 2J4IA 3PMAB 1VZQH 5C1YA 2LNCA 1WQSA 1ZMLA 2A31A 1ZJDA 2B8OH 1A3BH 3P8GA 1P10A 3MO9A 1KXAA 1SI5H 3S0NA 2FWWA 1EJAA 1QY6A 3OY6U 1GGDB 1TRYA 2F91A 5IDKA 4FUFA 5LPEA 1AKSB 2QXIA 3UWJH 2CXVA 1VGCC 2VJ1A 4LZ4B 4U01A 1V2TT 2ZFFH 2UUKB 3GY6A 4H6TA 1TBQH 3M3VA 2DUCA 2A5KA 3RLYH 1BOQA 3KGPA 1SGYE 2GCTB 2TGDA 3NPSA 1W14U 4UFGH 1GG6B 3LOXA 2BD3A 1A3EH 2V6NA 4XOJA 1SFQB 4LZ1H 1Y59T 3RXKA 4R8TB 1SVPA 2ZNKH 1P2NA 2WPIS 4Y7BA 1P11E 4ABFA 2Y7XA 4GAWA 2ZQ1A 1C5YB 1G30B 3RXGA 3A87A 1HAXB 3ATLA 1TNKA 1J17T 4BXSA 4KTCA 3SUGA 1A46H 2OLGA 2NU4E 4AFSA 7KMEH 1QNJA 2BDGA 3MNBA 1C2LA 2Z3EA 1C4V2 1NRNH 3P95A 1KXCA 1SC8U 1TMBH 1C5MD 4WXIA 2SGAA 2BQ6B 2FPZA 2Z9IA 1Y3UA 5EPYA 3A7TA 4E06H 4X8UH 2PSYA 1MU8B 4H4FA 1MD8A 2GDDA 3T26A 1C2KA 3ESTA 1ELCA 1JOUB 2JETB 3A84A 2ZTZA 1ZTKA 2ILNA 1IQFA 3BTTE 4AYYB 3UNQA 1TGCA 4A1TA 4FVDA 5A09A 4ZHLU 3FZDA 1VITG 1GJAB 3ZVAA 2BY6X 3LPRA 1FY4A 1ESAA 1SGNE 2HWLB 3F68H 1ZTJA 4JK6A 1O30A 2FI4E 3S9AA 1WV7H 1BTPA 4DT7B 4ABBA 1TFXA 3MU5A 1OXGA 2THFB 2AS9A 1SOTA 1VCQA 4ISLA 2BVXH 2FOAA 1ELTA 2OC7A 5DPAA 1LHEH 1SGRE 2BM2A 3LGYA 2TIOA 2XC5A 5FBIA 3TK6A 2A7JA 2FDAA 3DFLA 3QZQA 1TRNA 1GBCA 1HDTH 1O5FH 3GDSA 1GMHF 2H1UA 1LPGB 4K8YA 1QRZA 4ABEA 3BEUA 4AORA 3O8BA 1KTSB 2ZPQA 4YOIA 4YM9A 4BTUB 2Y7ZA 2ZU1A 1MTVA 1HBTH 3F9GA 1HJ8A 1ZHMA 1GBLA 1ZSLA 3EQ0H 1G36A 4IGDA 1O37A 3SQEE 1O2KA 3SU0A 2ANMH 3RXSA 2IPHA 3E91A 2EEKA 3NZIA 3ZZ5A 4F4OC 2R3YA 4YT7H 4ABHA 1TA6A 1V2OT 4B76A 1OS8A 1DICA 3M61U 3ZVDA 2GTBA 4ZMAH 4H42U 3SV2H 1NO9H 8GCHG 1IQHA 4WH6A 2BYAX 8KME2 1FJSA 1GMCF 1YM0A 1KYNA 2QGRA 1F92A 1C2FA 1HGTH 1O31A 2F83A 1TNIA 4ISHH 5JBBS 1Y8TA 4B75A 2PUXB 5FPYA 1O39A 2FX4A 5HXFA 5JPMH 4D8NA 3Q3YA 3MMGA 4Y0ZE 4K1TA 1NU7B 3UNRA 3OYPA 1OWEA 2GV6A 1NRQH 3UR6A 1Z8IB 1T8MA 1LKAA 3RMLH 1S85A 3A7VA 3ZVCA 2FTLE 1GVKB 2CHAC 1HPGA 1NFYA 5GCHF 1EP6A 2OUAA 5FPTA 1SGPE 3BTFE 5DGJA 1TALA 3RXDA 4YZUA 3QDZB 1OWDA 4ISOA 1W13U 1HB0B 1LQEA 1BBRK 3GY3A 5T3HA 1CHOG 3G01A 3SOSA 3SQHE 1SGDE 1AE5A 3FP6E 1O3GA 1ZMJA 3SJKA 1CVWH 1YPJH 4Y76A 3K6YA 3LT3A 4FUDA 1GBFA 1XVOA 1GMDF 1H8DH 5K7RA 3OX7U 1MTUA 1O2OA 3DHKH 4I7YH 1O5CB 1SFIA 1NESE 1WTGH 3Q77A 1A2CH 1O2GH 2HOBA 1TPSA 4AOQA 4ASHA 3A8AA 1O2LA 2BVRH 1B7XB 2ZI2H 3STJA 1E36B 1CGJE 3GICB 3UTUH 5E0JA 4O3TA 2FS9A 2WUCA 1E35B 1W7XH 4JZIA 4MTBA 1CE5A 2RDLA 1KDQB 2Q6DA 2G00A 2VH6A 2Q6GA 2BY7X 1O3JA 1C2HA 5TJXA 4OS5A 1GJCB 4X2VA 2QF0A 2ANKH 1O38A 1XUFA 1V2KT 3MU8A 3RM2H 1CA0B 1SGQE 2PGBB 4Y79A 1TAWA 3TVJB 3W94A 4CRBA 1GCTC 1CQQA 3RXOA 1C9TA 3SU5A 4NSVA 1QGFA 4E7RG 1O3AA 2R3UA 1SQAA 3CS0A 1DDJA 4I8LA 1THSH 2GMTB 8ESTE 2A2QH 3QO6A 3QZRA 5GWZA 1GHBF 9LPRA 1ANCA 2VGCC 1JIMA 1UVTH 2C4FH 1LHFH 3FAOA 1A5GH 2FI3E 4QT8C 3AAVA 2RG3A 3SI3H 4HZHA 2GZ7A 1K2I1 2B5TB 2GP9B 3TH2H 1H9IE 1RTKA 2FXRA 2EC9H 5T6GA 2NWNA 1HRTH 4I8GA 4I8KA 1OWKA 3PLKA 2TBSA 1Y3WA 1GHYH 1A5HA 1KXDA 1O36A 4YT6H 1YCPK 3VGCC 1THPB 1Y3YA 1B0EA 4YLUA 2P95A 1EX3A 1G3CA 1GGDC 3AW0A 2VB0A 3E8LA 2ZA5A 5K0HA 2TPIZ 5C1XA 4MPUA 3QTOH 2BD8A 2EI8A 1LCYA 1VITF 1IHSH 8LPRA 3GDUA 2M5TA 1GJ7B 1PYTC 1ZRBA 2I6SA 1GG6C