3M7TA

Crystal structure of alpha-lytic protease sb2+3 e8a/r105s mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
ANIVGGIAYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGSTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
publication title Quantifying protein unfolding cooperativity with acid sensitive probes: Interdomain salt bridge contributions to unfolding cooperativity are combined efficiently in alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 58
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7tA01
3BTQE 4K1EA 1RS0A 1P01A 4MPWA 2ZDMA 5EQQA 3DA9B 1KXDA 2PFEA 5I46H 1O2ZA 4O97A 3S0NA 1GL0E 1QURH 5BPEA 1ABJH 4RKOB 2PTCE 3M5MA 3A8BA 2SGAA 1NFXA 1O31A 1A7SA 2A4RA 4H4FA 5E8EH 1ARBA 1IAUA 3VB4A 1LMWB 3SU0A 3E16B 2OBQA 1ZSJA 2UUKB 2VIPA 6LPRA 3L3TA 1ANEA 1TONA 3DT0H 1JBUH 4Q80A 3UTUH 1O3MA 2H2ZA 3QGNB 1EXFA 2VWNA 3U8RH 1GCTB 1VJ9U 4I7YH 4I8KA 1SLWB 1Z8RA 2ESTE 2BHGA 3IWMA 3CS0A 3ENSB 1N8OB 3AASA 1JXPA 7GCHG 1YPEH 3GY3A 4LK4A 1C2EA 1W2KH 3TGIE 1GI6A 1HAIH 2SNVA 2TBSA 1TIOA 3RC4A 4BNRA 3MWIU 4MDSA 1W0YH 3RXKA 2GT7A 3ZZDA 1CBWC 4DCDA 1BTXA 1K28D 4NSYA 1XKBC 3A84A 4WVPE 1YKTA 1EASA 1KIGH 4B71A 3SU5A 1VJAU 5AFYH 3M37A 2O8LA 3L33A 1P8VC 1S85A 1AFQB 2Z9LA 1P9UA 4H6TA 3STJA 1GMDF 4WMEA 1QQ4A 1WAYB 1SVPA 1YC0A 2G51A 5T6DA 2ZGXH 4FUFA 1RTFB 4ZAEA 1BTUA 3OX7U 4FUHA 5JBTA 2WPLS 3W95A 3U9AH 3IG6B 1MCVA 2QYIA 1XUJA 2BD2A 1SL3A 2ZCKP 3KQEA 2WPKS 4YESB 1YF4A 2Q1JA 4IBLH 1V2PT 3UNRA 1MQ6A 1FDPA 4ZKSU 2IOTA 4NA9H 5LGOA 2ODQA 4B76A 1WQVH 2C4FH 2XBVA 6CHAC 4WMDA 3RMNH 1P2IA 1BBRE 1HDTH 1C5UA 1VITF 1O2LA 4Y10E 1DDJA 2PUXB 4MLFB 3L6PA 3P8GA 1QBNA 1AY6H 4ABFA 1GVLA 1C5VA 2W7UA 8ESTE 1F0SA 1BJVA 5J4QA 4GCHF 5PTPA 1ZPZA 5GCHG 3EGKH 4UE7H 3GDSA 4KTSA 1BRBE 1AVGH 3TJVA 4K1SA 2XW9A 1ZRBA 3KCGH 3PV4A 2H9HA 2A4GA 1TBRH 3PLBA 1RTKA 1GJBB 4TWYA 5EODA 4ISOA 1O2NA 4Y8ZA 3D23A 1XUFA 2BDYA 1GBAA 1K21H 5HYOA 4NG9H 4NZQA 5EG4A 1GJDB 1NY22 4O3UA 4B73A 2XCNA 1D3QB 3ELAH 2FLBH 2A4QA 1WCZA 1XUKA 3KQCA 3A83A 1EJAA 3UIRA 2FOAA 1ZHRA 2O8TA 4IW4E 3S9CA 1EPTA 1XM1A 2XWAA 3UR6A 1GCTC 2IN2A 1O3KA 2ZA5A 2BY9X 2O9QA 1KLJH 1NC6A 1L0ZA 1Q31A 2RCEA 1P9SA 2OC0A 3TH2H 2R2WU 2ZCLP 4ASHA 1N8OC 1NZQH 1BQYA 1QA0A 1O2XA 4JK5A 4A92A 1EPTB 1UVPA 1YCPK 1VGCB 1XUGA 5JBBS 1O3GA 1A3BH 2HWLB 3STIA 1Y3WA 1C1VH 1P04A 3Q3YA 4JCNA 1ZGVA 5EQSA 3UPEA 1Z6EA 4ABBA 2NU2E 1PPHE 4XSKU 2G4TA 4HFPB 1CHOF 4R8TB 1GMDG 1XMNB 4OS4A 3KIDU 1AVXA 1GCDA 1TMBH 3TH4H 1A0LA 1YBWA 3PTBA 5DPAA 5DK1A 1DLKB 5JB8S 1DY9A 5K0HA 1J9CH 4CRCA 1TRYA 1H9IE 2TIOA 1H1BA 1DY8A 1TA6A 4D8NA 4ZHLU 1G3DA 5K7RA 1QJ6B 2M5TA 2ZECA 3URCA 1K1IA 1BRCE 3SU1A 1ETRH 3TGJE 4FUBA 3ATWA 1FN6A 1EX3A 1O2SA 1H4WA 3F1SB 4FU7A 3E8LA 1V2UT 4ZUHA 4BTUB 1Q3XA 2WPHS 1VITG 3SV2H 1HXFH 4AN7A 5IDKA 4O03A 4ABIA 4Y0YE 5IYTA 1GJ6A 1SOTA 3MNCA 3BG4B 1BHXB 2FDAA 1O2GH 1YPHE 2ZZUH 4DY7B 3Q3KA 4GPGA 3UY9A 4GCHG 4Q2KA 1SGFG 1NESE 5DO4H 3Q76A 4MPUA 5T3HA 3HATH 1C4U2 1SHHB 2QF3A 5C1YA 1AIXH 4NIYA 1LKBA 2FX4A 1O2QA 1ZJKA 6GCHF 1WUNH 1CGHA 1MQ5A 1V2QT 1O3EA 4PROA 3E90B 1OS8A 3BV9B 2CJIA 1UTJA 3BEFB 3SORA 2FWWA 3SW2B 1C4V2 3MH6A 3MNSA 1NS3A 1O5FH 2XYAA 1LPGB 1SOZA 3KF2A 3ZV9A 1ESTA 1P05A 2FOEA 4INLA 4X2XA 1QB9A 1CU1A 4QT8C 1T8NA 1ZMLA 3U8TH 2VWOA 2FESH 4I8GA 4CHAB 3RXDA 1V3XA 4BXWA 1FAKH 2WV4A 3P95A 3CENA 4TY7A 1XUHA 2C8ZB 4D7FA 1GBBA 1RD3B 2ZQ2A 2FP7B 1ORFA 1TNJA 4ZXXH 2ZIQH 2G5VA 1LHGH 3W94A 2VIDA 4I8LA 2ZC9H 4CBNA 1KXCA 3T29A 4X1SU 3BF6H 3UUZA 3SI4H 3RXMA 1QJ7B 1XUIA 1BRUP 3A80A 1SI5H 1TAWA 2FI4E 1SSXA 1EPTC 1TPSA 1W8BH 1G37A 2DE9A 4B2AA 1GI3A 1HAYB 1VGCC 2AGEX 5GWZA 1O38A 2ZG0H 2FIRH 3TPIZ 2KAIA 2ODYB 5C3NA 1HAGE 2Z3CA 2B7DH 3DD2H 5DP3A 4FUEA 1AE5A 1F92A 2EI6A 4IC5A 2OC7A 1ELAA 2Z3EA 1G9IE 1F0UA 1OWDA 4X6PA 1SGNE 1ABIH 3VPKA 5T6GA 1CHOG 2AFQB 3PROA 4BTTB 1PPGE 3DHKH 1AVWA 1MKXH 2BD7A 4BXSA 3RXJA 2KAIB 2D1JA 2BVXH 3LGIA 2WPMS 2BDAA 3FP8E 1TMUH 1NN6A 1TNLA 4WWYA 2J92A 2P59A 1IQIA 1EZUC 1A4WH 4MNWA 1SR5C 2GTBA 3UREA 1P11E 2J34A 4K5ZA 2STAE 3VB6A 1S5SA 3MYWA 2BYAX 1Y3XA 1H8IH 3SV8A 3SUEA 1HAXB 5FAHA 3I77A 3SGAE 3M61U 1GG6C 1TNHA 3RXIA 1TGSZ 1C1PA 1DICA 1OP8A 1Y8TA 4K69A 1V2NT 1ZMJA 4NFFA 1B7XB 4OS7A 3RDZA 4JYVH 1P10A 3BG4C 1B5GH 1GHWH 2TRMA 2AH4X 2BY7X 3EE0B 1ESBA 1GWAA 3RXAA 4ZKOU 3SV9A 4K2YA 1CSOE 2BD8A 4ZKRU 1LVMA 1E36B 1A0HB 1KYNA 1CVWH 1THSH 2H6MA 2VGCB 1SMFE 3BTTE 6GCHG 1LDTT 3BIUH 1KSNA 3QK1A 1O3IA 2A0QB 3GICB 2HVXA 1T32A 2B0FA 1NTPA 4J1YA 4YOGA 1QL7A 4ZROA 1N1LA 3A82A 4Y76A 3U8OH 1LO6A 3TJUA 5C67A 1F5RA 2VVCA 2BZ6H 1C2HA 3RU4D 1QQUA 5E0HA 1HB0B 2ZTZA 3I78A 1V2WT 2VH0A 3A7TA 2FOHA 4JYTA 4NA7A 1MKWK 3AW0A 4AB9A 3PYHA 3TITA 2ZGBH 4JZDH 1X7AC 3PMBB 3QO6A 3RMLH 5I25A 1V2VT 1BIOA 1L4ZA 1DOJA 1W11U 3GYLB 1WOFA 1DPOA 1C2GA 1GI4A 1HPGA 1EZQA 1DFPA 2ZGJA 6ESTA 1T8MA 1IHTH 1AI8H 1EZSC 1UCYE 1WV7H 3NZIA 4WH8A 1BTHH 3PLKA 4NCYA 1FONA 3RXLA 7GCHF 3SI3H 1TABE 3LC3A 3PMHB 2Y5GA 1F0RA 2HLCA 3EA9A 2XC0A 1S83A 4AORA 2O8WA 3A89A 3VEQB 2FI5E 2R3UA 4ABDA 1QL9A 4X8SH 2FOBA 4CREA 1D4PB 1SGTA 1AUTC 1JOUB 1QTFA 3LT3A 1A1RA 1ZHPA 2Y5FA 1EZXC 1AZ8A 3RXPA 4ISIH 1GBLA 4FUCA 3A7ZA 1E34B 1V2RT 3TK5A 1WSSH 1FXYA 4CRGA 2JH6D 4X8UH 1HIAA 2GZ9A 1AO5A 1T4VH 1ZTKA 3KGPA 1HBTH 1AFEH 3AW1A 3BTEE 1AUJA 1BMMH 2VVUA 1TA2A 1O3DA 2R0LA 3SUGA 1W13U 3M5NA 3MFJA 4GLYA 2FYQA 1Z8IB 1IQJA 3KQBA 5C2ZA 4UFDH 1O2RA 1QA7A 5C5NA 5GDSH 4NWKA 2EEKA 1O32A 1PQ7A 1HIAB 4X1NU 1KXBA 1ARCA 2BVRH 3UNQA 2VU8E 2TPIZ 3T2NA 1DXWA 4IMQA 5A0AE 4X2WA 2ANMH 1ZPCA 2BLWA 2J38A 2YNBA 1O34A 3C1KA 3QTOH 4UFEH 2H9TH 1Y3VA 1BA8B 3LGWA 2H9EH 1HJAB 1C2DA 1ELTA 4HZHA 4WF8A 3P92A 1FJSA 3SHCH 4BTIB 1O2PA 1FY4A 1QL8A 3TLOA 3PMAB 4AYYB 2FI3E 4MQAA 4XFQA 2PGQB 5LPFA 3RXTA 4Y6DA 2FM2A 1ZGIA 2HNTF 2QV1A 1P2NA 3SZNA 3QWCH 5DG6A 1KLTA 3UQOA 3QX5H 5EPNA 1UK4A 2ZFFH 3U98H 4AFUA 3NXPA 1BMNH 4NIXA 1JIRA 1GI5A 1S81A 4DG4A 1BBRH 1GBDA 2ZU5A 4CRBA 1MTUA 2OCVB 3PTNA 1Z6JH 2VIWA 1O3CA 3A8AA 1GBJA 1ZLRA 2ZFQH 3BG8A 1HLTH 3QUMP 1SLUB 3PO1C 1RIWB 3MH4A 1S0QA 4I32A 3EYDA 3PWCA 4DGJA 3S9BA 5LH8A 3OTJE 1AGJA 2P8OC 2BLOA 1GJ9B 1GDQA 4U2WA 4I8HA 1YPLH 4A5TS 3LJJA 5JDUB 1LVOA 1UK3A 2Z9GA 1XX9A 2ZTYA 1T7CA 1GJ5H 4X6OA 4CR9A 2I6SA 2FTLE 2WPJS 1QB6A 1C5ZB 1TQ0B 3HK3B 2NU4E 1RRKA 1BTWA 4OS2A 1PQ8A 3T25A 1LKAA 1C5XB 3ZZ6A 5DGJA 1K1PA 4IS5A 4DW2U 3PM3A 4RKJB 4JZEH 1DSTA 3F68H 1INCA 1P57B 1AB9B 2XC5A 2PSYA 2A2QH 1H9HE 2P93A 2F9VA 2BY6X 1FNIA 5EW2H 1Q2WA 4NA8A 1Y59T 1C5QA 1NM6A 1TFXA 1E38B 4FVDA 5DP7A 1ID5H 1PQ5A 2DE8A 5JYIA 3FFGA 4JMYA 2F91A 4A1XA 4Q7XA 1YM0A 3E1XB 3BTKE 1LVYA 1GBFA 4B75A 1PYTC 2A32A 2BXUH 1Y3YA 2FO9A 1V2OT 5HM9A 1FIWA 3A87A 3ITIA 2ZO3H 2ZCHP 1HJAC 1PYTD 1S6FA 2ZDKA 1MTVA 4KKDA 3M36A 3BTGE 5AF9H 2PLXA 1BDAA 4IN2A 1NRSH 1C5SA 1GBTA 3P8OA 1TYNA 4IN1A 3D49H 4YT6H 4KELA 4LXBH 4WJG2 2Z3DA 4Q7YA 2DUCA 4DIIH 1E35B 1TBZH 1L1GA 1A5HA 1OPHB 1SB1H 1O2MA 1G30B 1S6HA 4X1QU 1WYKA 1W0ZU 4AB8A 4BANB 2Y82A 1PFXC 1CQQA 1MU6B 1B0FA 2AS9A 1C1RA 2CF9H 1SG8B 2GZ8A 1DVAH 2GV6A 2ZKSA 1LHEH 1BTZA 3EAJA 5C5OA 3RMOH 1BITA 1O2YA 1QIXB 2W3IA 4WMFA 2O8UA 2ZPSA 4U01A 5F6MA 1GI7B 3TVJB 2UWLA 1P3EA 1RIWC 1H9LB 3ATLA 2Y80A 3BEIB 1OWHA 1DSUA 2ZHDA 1MH0A 2SGPE 1M9UA 4U32A 1HAOH 1GJCB 1PPFE 2W3KA 1DX5M 2Y7ZA 5H4IB 3LOXA 1RGQA 2A5AA 3MH5A 2BX4A 3O8DA 1C1WH 4NZLA 1O3LA 1AWFH 4TPYA 5C20A 1TQ7B 5DP9A 1QGFA 1C2LA 4UDWH 1H8DH 3RXGA 1ZSKA 1A5IA 1UTNA 1T31A 1CGJE 4I8JA 4D9RA 4ABGA 1AFQC 1DM4B 2HPQH 2XBYA 2ANYA 4GHQA 2OC8A 4OS1A 1OWKA 1HV7A 2FOFA 2BD9A 3ZVDA 1TX7A 4CRAA 3B9FH 1F5KU 4X6NA 1ETSH 3GISB 1GBIA 1FIZA 1MTWA 1Z8GA 1YPMH 1O5EH 2VVVA 1TMTH 3SNDA 2A5KA 2V0BA 2EC9H 1V2LT 1MTNB 4HI3A 4RN6A 2W7SA 2A2XH 4GSOA 1GJ4H 3GCOA 3OYPA 2OLGA 2ZFRH 2P16A 4BAQB 3E0NB 3DFLA 3MNBA 5JB9S 1E0FD 4ABEA 4UFGH 1TGCA 3EDXB 4NIWA 3MHWU 1CA0B 2GX4A 4ZKNU 3T26A 1SPJA 3QZRA 2UUYA 2AMQA 3SU3A 1RTLA 1FY8E 1TGTA 3EA7A 3RXBA 3GYMA 2C8WB 3E91A 4VGCB 1UTOA 1PPEE 5A8ZA 4FUJA 3K6ZA 1DLEA 1YYY1 2VIVA 4CR5A 1T8OA 1KDQA 4BAHB 1ZTJA 2JKHA 1NPMA 3A7VA 3HKIB 5AVDA 1P2MA 1O3OA 3A81A 4AZ2B 5DP6A 2Q6FA 1J8AA 1Z7KA 3V7TA 1UVOA 3GY5A 1DUAA 4XBDA 2G55A 1C1MA 3GY2A 4E7NA 1GMCF 4B2BA 2FXRA 1KDQB 3MU8A 1WTGH 4ZMAH 1FY1A 3VGCB 2ZFSA 5L2YH 4A1VA 2CMYA 3H7OA 3ZYEA 1QR3E 3JZ2B 4K8BA 1ANCA 2FODA 5E2OA 3QLPH 3NWUA 4ISLA 2VNTA 1VCQA 1ANDA 2XRCA 3V3MA 3RXOA 1GI8B 3U1IB 3GDUA 2XBWA 1SGDE 4SGAE 1T4UH 1E37B 2YOLA 3P8NA 1MUEB 1IQLA 1BMLA 1RFNA 3T5FH 1O0DH 3M3SA 3B8JA 1C1NA 3ZV8A 1MMJN 3FP7E 3MU0A 3K9XB 4X2YA 2Q6GA 1BT7A 5HXFA 2ZPQA 2ZU4A 1NRPH 3ATKA 2HALA 2BVSH 1RXPA 2ZP0H 1AQ7A 1K9OE 4AGKA 3DFJA 4Y11E 4DVAU 2QGRA 1MBQA 1GHZA 3UOUA 1CT2E 5L6NH 2P95A 7ESTE 2WPIS 2SGFE 1ZPBA 4YOJA 1C5MD 2BMGB 3R3GB 4NFEA 2BD5A 4FUGA 1UVTH 2FOCA 3KL6A 1GVKB 1N6YA 1O5CB 2F9BH 2SNWA 1UK2A 2BQ6B 5GPIB 2BZAA 3PLPA 2OP9A 3U1JB 1JRSA 1TALA 4SGBE 3RUOA 3TJOA 2BOKA 1HAZB 1AE8H 1HRTH 5HM2A 4B2CA 1DT2A 1O2OA 2RA3A 3A88A 1F5LA 2ZDLA 1TGNA 1OWEA 1NFWA 3LJOA 3VXEH 4DT7B 1WU1A 1BMAA 1MTNC 1PJPA 1A5GH 3BIVH 1DWCH 1W7XH 1OKXA 1C9TA 3GDVA 5A0CA 3S7HB 2FZZA 4JZIA 2ASUB 1QY6A 1Z8JB 1AN1E 5TCAA 1UCYH 3QTVH 5E0JA 1NROH 2ZFTA 1O2HA 2CV3A 1ZRKA 2AERH 1YLCA 4CRFA 4WH6A 8LPRA 3RM0H 3D62A 1EUFA 1DUEA 5EGMA 1CA0C 1PPZA 3RXFA 2P3UB 1IQHA 1CA8B 1O35A 1J16A 1TBQH 2A45B 2GT8A 3FANA 2FOGA 2BD3A 2Q6DA 4VGCC 1O2IA 1C5PA 3RXRA 1O30A 1YPKH 3BSQA 1C9PA 3URDA 4R0IA 3FP6E 4LOYH 2J94A 3KN2A 9ESTA 2G52A 2A7CA 3TK9A 3F9GA 3E3TA 1IQMA 1MU8B 5ESBA 3H5CB 5A8YA 1NU9A 2AIPA 2QN5T 1ZOMA 1QRXA 1VZQH 1P2QA 5E0GA 3SV6A 2R9PA 3D65E 1UJ1A 2J2UA 4TY6A 2ZI2H 1GMCG 1RJXB 2WV5A 9LPRA 2PGBB 3VGCC 1C5LH 3PB1E 3OY6U 3LDXH 1J14A 1TPOA 1FQ3A 8KME2 1C1TA 4X1RU 4B1TA 1FV9A 3RU4E 1O5AB 4I31A 1TRMA 1C5WB 1GHBF 3A7YA 1THPB 2C8YB 1GJ7B 2WYJA 2C93B 2VB0A 2PTNA 4CHAC 2Z9JA 5FCRA 3O8BA 2AIQA 5TCCA 1S84A 1Y3UA 2OC1A 2OQ5A 1DANH 3M5LA 1IQFA 1L4DA 2RG3A 4ZXYH 1CHGA 1K1MA 1O3FA 2H5CA 1T8LA 2P3TB 2R0KA 3ZVGA 2Y6TA 1LQDB 3VB3A 1JRTA 1YGCH 4TPIZ 3M7TA 4AFSA 3ZZ4A 4CRDA 2HOBA 1G2MA 1IQKA 1Z1JA 3UQVA 2V3HH 2QAAA 5HGGA 1HFDA 1GBHA 1EKBB 1DITH 3AVZA 1TNGA 2NU0E 4B74A 1PPCE 3ZZ5A 2BDBA 2HNTC 4Y0ZE 1FY5A 4BAKB 1QRZA 1TE0A 5AHGH 2FOMB 1V2KT 1O36A 1SGYE 1D6WA 1WQSA 1G3EA 1MD7A 3LPRA 4F4OC 2WUBA 1DWBH 3TGKE 3LGYA 2V3OH 5A8XA 4O9VA 1SGIB 1ACBE 2ZDAH 2BLVA 2ZF0H 2WYGA 2TGPZ 1AKSA 1YP9A 1KLIH 5G4BA 1W7GH 2FLRH 5FPTA 1CT4E 3Q3XA 4NWLA 2A4OA 1JWTA 1ESAA 1NFUA 2TGTA 1HAVA 3ZVAA 3RXHA 1SLXB 1MTSA 1UTLM 4UONA 3QDZB 1TNKA 1LHDH 1CBWB 5ESTE 5CHAB 1QHRB 1PQAA 2Z7FE 4M7GA 3M3VA 2VINA 2FEQH 3SHAH 3MH7A 4X0WU 3TJNA 1D6RA 3EQ0H 3H7TA 2JH0D 4A1TA 4U30A 3B23B 1C4Y2 3RM2H 2OTVA 1O2WA 2P94A 1LVBA 3UOPA 3GCHB 5C1UA 3NUMA 2QXHA 1UHBA 4INKA 3BTDE 3SJ9A 2BXTH 4NSVA 1P02A 3MNXA 2AEIH 1O2JA 2SGDE 3FVFB 5DJ7A 1TX8A 3SGBE 2GDEH 2VGCC 1SGQE 2Z6BD 5SGAE 1TOMH 1UVUH 1SGRE 3T62A 1GI2A 1IHSH 3RLYH 1W14U 4Y8XA 3LH3A 1UHBB 5CMXH 3P70B 1GBEA 3BTFE 3ZVFA 3M5OA 3RP2A 3MO9A 1SFQB 4AGJA 1O2TA 2J4IA 1TLDA 7KMEH 5L2ZH 2ZU3A 3V0XA 3KEEA 3MOCA 2BX3A 2NU3E 4KTCA 4MTBA 1GHAF 4TWWA 1AZZA 8GCHF 1KXFA 2GZ7A 1MD8A 4ZHAA 3GY7A 4F49A 2B5TB 2FMJA 4MPXA 1O2KA 1GHBG 4ZHMU 2WINI 3PWBA 1CT0E 1FPCH 5EXLA 3UNSA 5FCKA 2CF8H 2YNAA 2VWLA 5J4SA 1TPPA 2QF0A 3QZQA 1JMOH 4X2VA 3F6UH 4XOJA 3SU4A 1J15A 3K6YA 2A7JA 1O33A 1C5NH 3M3TA 5GIBA 3SOSA 5F8XA 1VCWA 2PR3A 2Y7XA 1C2FA 2EI7A 2G5NA 4BOHA 3LIWA 1SQAA 3SN8A 3SNBA 3OY5U 4Y71A 1P12E 3LGTA 1QRWA 2ZU1A 3ZVBA 1NRRH 4MNVA 3C27B 1OOKB 1P09A 1D3TB 4YO9A 1P03A 4DURA 2V6NA 4K3JA 2I6QA 4JK6A 1QBOA 3MU5A 2BDIA 1THRH 1PPBH 3JZ1B 1GBCA 1L2EA 1YCPH 1P2KA 3GCTF 1D9IA 2ZHFH 2BOHB 3MU1A 3UWJH 2XTTB 1SLVB 1A46H 4ESTE 1AD8H 1EAWA 1ANBA 1C5TA 2AGGX 2BM2A 3FZZA 2PV9B 4MG3A 2O8MA 3QN7A 1A3EH 2V35A 2VH6A 5TJXA 4D76A 1JIMA 4THNH 3HGPA 4DJZB 1V2TT 1GMHF 5CHAC 5GJ4B 1OWJA 2ANWA 3LH1A 1AWHB 1EP6A 1SHYA 3P6ZB 4YM9A 1ETTH 2ZNKH 2F9OA 1ELDE 1O39A 2BLQA 4OGXA 1FLEE 1GPZA 1C2MA 4E05H 1MZDA 2ALPA 1O5GH 2RDLA 5JBAS 1EOJA 3BTME 3FZDA 1UMAH 1WTHD 2GD4B 1P3CA 3MMGA 3GCHC 3CP7A 1ELCA 1WBGB 1Z1IA 2BQWB 4A6LA 2ZQ1A 1L1JA 2CGAA 4CH8B 1QFKH 3HPTB 4K8YA 3ZYDA 2BD4A 3MTYA 2BDGA 1OYTH 2F9NA 2EA3A 4H6SB 1BTPA 2K1QA 1TRNA 2CHAB 2PUQH 3RMMH 2SGQE 3Q00A 3RXQA 1ELBA 3OSYA 3T28A 4AX9H 1BUIA 4UEHH 2SGEE 1A0JA 4JZFH 2JH5D 2PKSB 5HMAA 5B6OA 1C1UH 3U69H 1Y5AT 2B8OH 3ZZBA 3SU2A 1W3CA 4MNYA 5EOKA 3GY6A 1O3PB 3SU6A 4XDEA 5EPYA 5FBEA 4CH2B 2W5EA 1GHAG 2PWXA 8GCHG 2GCHF 5EW1H 2FS9A 2J9NA 3WY8A 2PW8H 1F2SE 3GOVB 1TB6H 3VB5A 5ABWA 2UUJB 1C2IA 3K65B 2Y5HA 3TNSA 4KTUA 1BBRK 1V2JT 1J17T 1BRAA 3VXFH 1QCPA 1VR1H 4Y7BA 4YLUA 5FBIA 1KXEA 3RXCA 2JETB 1ZJDA 4NGAH 1HNEE 3S7KB 1BJUA 1UTKA 3LGVA 4X6MA 1GGDB 1C1SA 1NO9H 2ZGHA 3HGNA 1SFIA 1GVZA 1MCTA 1LPZB 1DS2E 1ZYOA 2ILNA 1MZAA 3M7UA 4JZ1A 2A31A 3NPSA 4OGYA 1HJ9A 2FPZA 3I29A 3NK8A 2OINA 5EU8A 1TX6A 3SGQE 3RLWH 3MO6A 2ZGCA 1S82A 2A1DB 2UWPA 3O8CA 3GCTG 4AG1A 4WY3A 4Y7AA 1P2OA 2NU1E 1QNJA 1UTPA 1K22H 1KTTB 1GI1A 4TYDA 2PSXA 1DWDH 1HJ8A 1QJ1B 1GBKA 1NRQH 1L1NA 1AB9C 1A61H 2QCYA 1GMHG 1SGCA 2ZDNA 4FU9A 5FHTA 1VCPA 2G4UA 1GDNA 1CE5A 2Z9IA 1EJNA 4BAMB 1XXFA 1NU7B 1OP2A 3KHVA 2J95A 2UWOA 2LPRA 2HPPH 1DE7H 2R3YA 4MNXA 4AFZA 5DP8A 4KP0A 4OS5A 4O3TA 2H1UA 1TWXB 2BTCE 1CO7E 1TNIA 3BTHE 3S9AA 4XBCA 3TIUA 3Q77A 2QXJA 1NFYA 2IPHA 2XXLA 4FUIA 3LGUA 3SJOA 1IQNA 3SUFA 3P17H 2XCFA 3SQHE 3ZVEA 3TK6A 3K2UA 2RA0A 3GY8A 2XC4A 2CHAC 3A8CA 1DXPA 1GG6B 1OSSA 1HAPH 2XNIA 4X8TH 5LPEA 1HGTH 3LKWA 3ATIA 3S69A 1CGIE 1YPHC 1O5DH 2GP9B 3SUDA 4Q7ZA 2VIOA 4OS6A 2PKSC 3VFEA 2QIQA 2G81E 2P3FH 1F7ZA 3KNXA 1EAIA 4Y79A 1ZR0A 4GUXA 2A7HA 2ZEBA 4FXGH 1D3DB 1KY9A 1NT1A 2G8TA 3EA8A 1W12U 2GCHG 2ALVA 4UD9H 3ESTA 3T27A 2BB4A 5EQRA 3UWIA 1FY3A 1O5BB 1V2MT 5E2PA 3KQDA 5CE1A 2GVFA 2B9LA 2STBE 5FX6A 1G2LA 1QB1A 2GCTB 1TPAE 2ANKH 2OQUA 4WXVA 2R2MB 2BDCA 2ZPRA 4Y8YA 1D3PB 2FYRA 2JETC 1ELFA 3ZZAA 1Z71A 1MKWH 4DOQA 1GGDC 3TH3H 5FPSA 5A2MH 3VB7A 3QGJA 2QXIA 1GI9B 3ZZ3A 1K1JA 1HYLA 2BQ7B 5T6FA 2PHBA 5GXPA 3ZZ9A 2FTMA 2F9UA 1C1QA 2F3CE 3BTWE 1LTOA 2ULLA 3F9EA 3SV7A 1O3JA 1BB0B 1FMGA 4A7IB 4HGCA 2ZU2A 4E06H 3O8RA 3M7QA 1LQEA 7LPRA 1AHTH 1SBWA 2FS8A 1V6DA 1F0TA 1YCPM 1GJ8B 1O3BA 3GCNA 4ISNA 4WXIA 1LCYA 1UO6A 3MI4A 1B0EA 2C3SA 3A86A 3F9FA 2TGDA 5FPYA 4Z0KA 5BRRE 2D8WA 4KGAA 2GKVE 4FU8A 1C2JA 1TGBA 1O37A 4K1TA 4YT7H 1Y5BT 1EATA 1ZMNA 3SJKA 2GMTB 1EQ9A 4IMZA 3SJIA 1FAXA 3SNEA 2Y81A 5JBCS 3LC5A 2OXSA 2G00A 5F8TA 1ELEE 1GDUA 1YPJH 1XVOA 1ZHMA 1EB1H 4RSPA 2A5IA 2D2DA 2OBOA 3ZZ8A 2TGAA 3ATMA 2BDHA 5EXMA 4XBBA 4NIVA 2AMDA 2IJOB 4GAWA 2ZFPH 1OWIA 5DP4A 4D7GA 2OUAA 3F9HA 3DUXH 3SO3A 3AAUA 3TU7H 1S0RA 3LONA 4FVBA 1C5OH 4IC6A 1BTYA 1GHYH 2QXGA 5L30H 1C5RA 3A7XA 2VWMA 2ZWLH 3R0FA 4H42U 3ODFA 5ETXA 1SGPE 1K1OA 1ELGA 1P06A 1IQEA 1FPHH 1XXDA 2ODPA 2ZTXA 1LHCH 1EJMA 1ZZZA 1O3AA 1XVMA 3A85A 1ZTLA 4ABHA 2Z94A 1OYQA 1O2UA 3HKJB 4J2YB 3BEUA 3RXVA 1G32B 3MO3A 1TOCB 4Z6AH 4MPVA 1ZSLA 4BAOB 4AOQA 2W26A 1A2CH 1O3HA 2VJ1A 1GJAB 3ODDA 1AMHA 1DWEH 2XBXA 1SGEE 2H5DA 1O3NA 2GCTC 2CN0H 1YLDA 2ZHWH 4AFQA 1OXGA 2QC2A 1K2I1 3RXSA 3A8DA 3ZZ7A 4D9QA 2C90B 4XE4A 1OP0A 1SGFA 3ZZCA 1SQTA 2CXVA 1NRNH 3SNAA 1G36A 4INHA 1FI8A 3TNTA 1IQGA 1EAXA 1BCUH 4HTCH 4DIHH 2OD3B 2ZDVH 4ZH8A 2GGVB 1G3BA 3MU4A 3UFAA 1K1NA 3FAOA 1G3CA 5DP5A 2F83A 2PKAA 3A7WA 3ZVCA 1BOQA 3NKKA 3RC6A 3PO1B 1C5YB 1O2VA 2HNTE 3N7OA 2HGTH 3E6PH 1FZZA 3RXUA 3OU0A 1UTQA 2GV7A 2LNCA 4GVUA 2EI8A 1UTMA 1SQOA 2P8OB 3LU9B 3P8FA 1C1OA 3M35A 3E0PB 2WUCA 1QBVH 1P2JA 1V2ST 1XKAC 4YLQH 5C1XA 1VITH 1BZXE 1K1LA 4I33A 2PKAB 2HRVA 1SC8U 3PMJA 1Y5UT 4IGDA 3HK6B 2F9PA 3CS7A 1MKXK 1YPGH 2GMTC 2C8XB 1C2KA 1KXAA 1AKSB 2ZHQH 1GHXH 2AGIX 2QY0B 1EAUA 4YZUA 4YOIA 1HUTH 3G01A 1BHXF 1HAHH 1HAVB 2NWNA 5JPMH 3V12A 1KTSB 1U6QA 5FXLA 2THFB 1UCYK 5EXNA 3IITA 1W10U 3SBKA 3NCLA 2AYWA 4X8VH 1ELVA 3GY4A 4X1PU 1GHVH 5A0BA 5LPRA 4LZ1H 1MAYA 2BY5X 4AYVB 5A09A 4YTAA 2Z9KA 2FX6A 4CBOA 5DKMA 4AG2A 3SNCA 2AMPA 2GDDA 3BN9A 4K60A 3SQEE 1EB2A 1EOLA 1GBMA 2VIQA 4JYUH 3UR9A 4ABAA 1MBMA 1GI0A 3AAVA 4ABJA 5AFZH 6CHAB 4FUDA 4E7RG 4ISHH 4GHTA 1AU8A 3RC5A 1N6XA 4UFFH 5F03A 3RXEA 1HXEH 5F8ZA 1FN8A 4MVNA 2BY8X 1EP5A 1IOEA 1FUJA 3V13A 3RU4T 1HCGA 1P0SH 1MAXA 2XWBI 1LHFH 2ZHEH 1UVSH 2SFAA 5FX5A 2QA9E 5GCHF 2D26C 1OX1A 2UUFB 3SJ8A 1LPKB 1GL1A 4LZ4B
chains in the Genus database with same CATH superfamily
3BTQE 4K1EA 1RS0A 3AK5A 1P01A 4MPWA 2ZDMA 5EQQA 3DA9B 1KXDA 2PFEA 5I46H 1O2ZA 4O97A 3S0NA 1GL0E 1QURH 5BPEA 1ABJH 4RKOB 2PTCE 3M5MA 3A8BA 2SGAA 1NFXA 1O31A 1A7SA 2A4RA 4H4FA 5E8EH 5B6LA 1ARBA 1IAUA 3VB4A 1LMWB 3SU0A 3E16B 2OBQA 1ZSJA 2UUKB 2VIPA 6LPRA 3L3TA 1ANEA 1TONA 3DT0H 1JBUH 4Q80A 3UTUH 1O3MA 2H2ZA 1QZ8A 3QGNB 1EXFA 2VWNA 3U8RH 2WPDD 1GCTB 1VJ9U 4I7YH 4I8KA 1SLWB 1Z8RA 2ESTE 2BHGA 3IWMA 3CS0A 3ENSB 1N8OB 3AASA 1JXPA 7GCHG 1YPEH 3GY3A 4LK4A 1C2EA 1W2KH 3TGIE 1GI6A 1HAIH 2SNVA 2TBSA 2EQNA 1TIOA 3RC4A 4BNRA 3MWIU 4MDSA 1W0YH 3RXKA 2GT7A 3ZZDA 1CBWC 4DCDA 1BTXA 1K28D 4NSYA 1XKBC 4B6EA 3A84A 4WVPE 1YKTA 1EASA 1KIGH 4B71A 3SU5A 1VJAU 5AFYH 3M37A 2O8LA 3L33A 1P8VC 1S85A 1AFQB 2Z9LA 1P9UA 4H6TA 3STJA 1GMDF 4WMEA 4P02A 1QQ4A 4ACAA 1WAYB 1SVPA 1YC0A 2G51A 5T6DA 2ZGXH 4FUFA 1RTFB 4ZAEA 1BTUA 3OX7U 4FUHA 5JBTA 2WPLS 3W95A 3U9AH 3IG6B 1MCVA 2QYIA 1XUJA 2BD2A 1SL3A 2ZCKP 3KQEA 2WPKS 4YESB 1YF4A 2Q1JA 4IBLH 1V2PT 3UNRA 1MQ6A 1FDPA 4ZKSU 2IOTA 4NA9H 5LGOA 2ODQA 4B76A 1WQVH 2C4FH 2XBVA 6CHAC 4WMDA 1K0HA 3RMNH 1P2IA 1BBRE 1HDTH 1C5UA 1VITF 1O2LA 4Y10E 4FOUC 1DDJA 2PUXB 4MLFB 3L6PA 3P8GA 1QBNA 1AY6H 4ABFA 2KCYA 1GVLA 1C5VA 2W7UA 8ESTE 1F0SA 1BJVA 5J4QA 4GCHF 5PTPA 1ZPZA 5GCHG 3EGKH 4UE7H 3GDSA 4KTSA 1BRBE 1AVGH 3TJVA 4K1SA 2XW9A 2KCAA 1ZRBA 3KCGH 3PV4A 2H9HA 2A4GA 1TBRH 3PLBA 3DSOA 1RTKA 1GJBB 4TWYA 5EODA 4ISOA 1O2NA 4Y8ZA 3D23A 1XUFA 2BDYA 1GBAA 1K21H 5HYOA 5DN6D 4NG9H 4NZQA 5EG4A 1GJDB 1NY22 4O3UA 4B73A 2XCNA 1D3QB 3ELAH 2FLBH 2A4QA 1WCZA 1XUKA 1UW7A 3KQCA 3A83A 1EJAA 3UIRA 2FOAA 1ZHRA 2O8TA 4IW4E 3S9CA 1EPTA 1XM1A 2XWAA 3UR6A 1GCTC 2IN2A 1O3KA 2ZA5A 2BY9X 2O9QA 1KLJH 1NC6A 1L0ZA 1Q31A 2RCEA 1P9SA 2OC0A 3TH2H 2R2WU 2ZCLP 3PV2A 1N8OC 4ASHA 1NZQH 1BQYA 1QA0A 1O2XA 4JK5A 4A92A 1EPTB 1UVPA 1YCPK 1VGCB 1XUGA 5JBBS 1O3GA 1A3BH 2HWLB 3STIA 1Y3WA 1C1VH 1P04A 3Q3YA 4JCNA 1ZGVA 2W6JD 5EQSA 4RI0A 3UPEA 1Z6EA 4ABBA 2NU2E 1PPHE 4XSKU 2G4TA 3F0PA 4HFPB 1CHOF 4R8TB 1GMDG 1XMNB 4OS4A 3KIDU 1AVXA 1GCDA 1TMBH 3TH4H 3MQKC 1A0LA 1YBWA 3PTBA 5DPAA 5DK1A 3F2GA 2CK3D 1DLKB 5JB8S 1DY9A 5K0HA 1J9CH 4CRCA 1TRYA 1H9IE 2TIOA 1H1BA 1DY8A 1TA6A 4D8NA 4ZHLU 1G3DA 5K7RA 1QJ6B 2M5TA 2ZECA 3URCA 1K1IA 1BRCE 3SU1A 1ETRH 3TGJE 4FUBA 3ATWA 1FN6A 1EX3A 1O2SA 1H4WA 3EE7A 3F1SB 4FU7A 3E8LA 1V2UT 4ZUHA 4BTUB 1Q3XA 2WPHS 1VITG 3SV2H 1HXFH 4AN7A 5IDKA 4O03A 4ABIA 4Y0YE 5IYTA 1GJ6A 1SOTA 3MNCA 3BG4B 1BHXB 2FDAA 1O2GH 1YPHE 2ZZUH 4DY7B 3Q3KA 4GPGA 3UY9A 4GCHG 4Q2KA 1SGFG 1NESE 5DO4H 3Q76A 4MPUA 5T3HA 3HATH 1C4U2 1SHHB 2QF3A 5C1YA 1AIXH 4NIYA 1LKBA 2FX4A 1O2QA 1ZJKA 6GCHF 1WUNH 1CGHA 1MQ5A 1V2QT 1O3EA 4PROA 1BMFD 1OS8A 3E90B 3BV9B 2CJIA 1UTJA 3BEFB 3SORA 2FWWA 3SW2B 1C4V2 3MH6A 3MNSA 1NS3A 1O5FH 2XYAA 1LPGB 1SOZA 3KF2A 3ZV9A 1ESTA 1P05A 2FOEA 4INLA 4X2XA 1QB9A 1CU1A 4QT8C 1T8NA 1ZMLA 3U8TH 2VWOA 2FESH 2J5UA 4I8GA 4CHAB 3RXDA 1V3XA 4BXWA 1FAKH 2WV4A 3P95A 3CENA 4XRNA 4TY7A 1XUHA 2C8ZB 4D7FA 1GBBA 1RD3B 2ZQ2A 2FP7B 1ORFA 1TNJA 4ZXXH 2ZIQH 2G5VA 1LHGH 3W94A 2VIDA 4I8LA 2ZC9H 4CBNA 1KXCA 3T29A 4X1SU 3BF6H 3UUZA 3SI4H 3RXMA 1QJ7B 1XUIA 1BRUP 3A80A 1SI5H 1TAWA 2FI4E 1SSXA 1EPTC 1TPSA 1W8BH 1G37A 2DE9A 4B2AA 1GI3A 1HAYB 1VGCC 2AGEX 5GWZA 1O38A 2ZG0H 2FIRH 3TPIZ 2KAIA 2ODYB 5C3NA 1HAGE 2Z3CA 2B7DH 3DD2H 5DP3A 2JJ1D 4FUEA 1AE5A 1F92A 2EI6A 4IC5A 2OC7A 1ELAA 2Z3EA 1G9IE 1F0UA 1OWDA 4X6PA 3FOAA 1SGNE 1ABIH 3VPKA 5T6GA 3N7EA 1CHOG 2AFQB 3PROA 4BTTB 1PPGE 3DHKH 1AVWA 1MKXH 2BD7A 4BXSA 3RXJA 2KAIB 2D1JA 2BVXH 3LGIA 2WPMS 2BDAA 3FP8E 1TMUH 1NN6A 1TNLA 4WWYA 2J92A 2P59A 1IQIA 1EZUC 2L6OA 1A4WH 3H09A 4MNWA 1SR5C 2GTBA 3UREA 1P11E 2J34A 4K5ZA 2STAE 3VB6A 4P00A 1S5SA 3MYWA 5EJZA 2BYAX 1Y3XA 3WW7A 1H8IH 3SV8A 3SUEA 1HAXB 5FAHA 3I77A 3SGAE 3M61U 1GG6C 1TNHA 3RXIA 1TGSZ 1C1PA 1DICA 1OP8A 5GNDA 1Y8TA 4K69A 1V2NT 1ZMJA 4NFFA 4ASUD 1B7XB 4OS7A 3RDZA 4JYVH 1P10A 3BG4C 1B5GH 1GHWH 2TRMA 3OFND 2AH4X 2BY7X 3EE0B 1ESBA 1GWAA 3RXAA 4ZKOU 3SV9A 4K2YA 1CSOE 2BD8A 4ZKRU 1LVMA 1E36B 1A0HB 1KYNA 1CVWH 1THSH 2H6MA 2VGCB 1SMFE 3BTTE 6GCHG 1LDTT 3BIUH 1KSNA 3QK1A 1O3IA 2A0QB 3GICB 2HVXA 1T32A 2B0FA 1NTPA 4J1YA 4YOGA 2V7QD 1QL7A 4ZROA 1N1LA 3A82A 4Y76A 3U8OH 1LO6A 3TJUA 1YY3A 5C67A 1F5RA 2VVCA 2BZ6H 1C2HA 3RU4D 1QQUA 5E0HA 1HB0B 2ZTZA 3I78A 3SZEA 1V2WT 2VH0A 3A7TA 2FOHA 4JYTA 4NA7A 1MKWK 3AW0A 4AB9A 3PYHA 3TITA 2F43B 2ZGBH 4JZDH 1X7AC 3PMBB 3QO6A 3RMLH 5I25A 1V2VT 2XOKD 1BIOA 1L4ZA 1DOJA 1W11U 3GYLB 1WOFA 1DPOA 1C2GA 1GI4A 1HPGA 1EZQA 1DFPA 2ZGJA 3F3BA 6ESTA 1T8MA 1IHTH 1AI8H 1EZSC 1UCYE 1WV7H 3NZIA 4WH8A 1BTHH 3PLKA 4NCYA 1FONA 3RXLA 7GCHF 3SI3H 1TABE 3LC3A 3PMHB 2Y5GA 1F0RA 2HLCA 3EA9A 2XC0A 1S83A 4AORA 2O8WA 3A89A 3VEQB 2FI5E 2R3UA 5F53A 4ABDA 2RDEA 1QL9A 4X8SH 2FOBA 4CREA 1D4PB 1SGTA 1AUTC 1JOUB 1QTFA 3LT3A 1A1RA 1ZHPA 2Y5FA 1EZXC 1AZ8A 1H8ED 3RXPA 4ISIH 1GBLA 4FUCA 3A7ZA 1E34B 1V2RT 3TK5A 1WSSH 1FXYA 4CRGA 2JH6D 4X8UH 1HIAA 2GZ9A 1AO5A 1T4VH 1ZTKA 3KGPA 1HBTH 1AFEH 3AW1A 3BTEE 1AUJA 1BMMH 2VVUA 1TA2A 1O3DA 2R0LA 3SUGA 1W13U 3M5NA 3MFJA 4GLYA 3PRDA 2FYQA 1Z8IB 5HIYA 1IQJA 3KQBA 5C2ZA 4UFDH 1O2RA 1QA7A 5C5NA 5GDSH 4NWKA 2EEKA 1O32A 1PQ7A 5CDFE 1HIAB 4X1NU 1KXBA 1ARCA 2BVRH 3UNQA 2VU8E 2TPIZ 3T2NA 1DXWA 4IMQA 5A0AE 4X2WA 2ANMH 1ZPCA 2BLWA 2J38A 2YNBA 1O34A 3C1KA 3QTOH 4UFEH 1FX0B 2H9TH 1Y3VA 1BA8B 4XD7D 1NBMD 3LGWA 2H9EH 1HJAB 1C2DA 1NBME 1ELTA 4HZHA 4WF8A 3P92A 1FJSA 3SHCH 4BTIB 1O2PA 1FY4A 1QL8A 3TLOA 3PMAB 4AYYB 2FI3E 4MQAA 4XFQA 2PGQB 5LPFA 3RXTA 4Y6DA 2FM2A 2WSSD 1ZGIA 2HNTF 2QV1A 1P2NA 3SZNA 3QWCH 5DG6A 1KLTA 3UQOA 3QX5H 5EPNA 1UK4A 2ZFFH 3U98H 4AFUA 3NXPA 1BMNH 4NIXA 1JIRA 2M2AA 1GI5A 1S81A 4DG4A 1BBRH 1GBDA 2ZU5A 4CRBA 1MTUA 2OCVB 3PTNA 1Z6JH 3CNRA 2VIWA 1O3CA 3A8AA 4AC9A 1GBJA 1ZLRA 2ZFQH 3BG8A 1HLTH 3QUMP 1SLUB 3PO1C 1RIWB 3MH4A 1S0QA 4I32A 3EYDA 3PWCA 4DGJA 3S9BA 5LH8A 3OTJE 1AGJA 2P8OC 2BLOA 1GJ9B 1GDQA 4U2WA 4I8HA 1YPLH 4A5TS 3LJJA 5JDUB 1LVOA 1UK3A 2YMSB 2Z9GA 1XX9A 2ZTYA 1T7CA 1GJ5H 5C94A 4X6OA 4CR9A 2I6SA 2FTLE 2WPJS 1QB6A 1C5ZB 1TQ0B 3HK3B 2NU4E 1RRKA 1BTWA 4OS2A 1PQ8A 3T25A 1LKAA 1C5XB 3ZZ6A 3N99A 5DGJA 1K1PA 4IS5A 4DW2U 4DT4A 2IJD1 3PM3A 4RKJB 4JZEH 1DSTA 3F68H 1INCA 1P57B 1AB9B 1SQRA 2XC5A 2PSYA 1MABB 2A2QH 3F0OA 1H9HE 2P93A 2F9VA 2BY6X 1FNIA 5EW2H 1Q2WA 4NA8A 1Y59T 1C5QA 1NM6A 1TFXA 1E38B 4FVDA 3KQ5A 5DP7A 1ID5H 1PQ5A 2DE8A 5JYIA 3FFGA 4JMYA 2F91A 4A1XA 4Q7XA 1YM0A 3E1XB 3BTKE 1LVYA 3OE7D 1GBFA 4B75A 1PYTC 2A32A 2BXUH 1Y3YA 2FO9A 1V2OT 5HM9A 1FIWA 3A87A 3ITIA 2ZO3H 2ZCHP 1HJAC 1PYTD 1S6FA 2ZDKA 1MTVA 4KKDA 3M36A 3BTGE 5AF9H 2PLXA 2KCOA 1BDAA 4IN2A 1NRSH 1C5SA 1GBTA 3P8OA 1TYNA 4IN1A 3D49H 4YT6H 4KELA 4LXBH 4WJG2 2Z3DA 4Q7YA 2DUCA 5KECA 4DIIH 1E35B 2KR7A 1TBZH 1L1GA 1A5HA 1OPHB 4F55A 1SB1H 1O2MA 1G30B 1S6HA 4X1QU 1WYKA 1W0ZU 4AB8A 4BANB 2KX4A 2Y82A 1PFXC 1CQQA 1MU6B 1B0FA 2AS9A 1C1RA 2CF9H 1SG8B 1VKYA 2GZ8A 1DVAH 3OTPA 2GV6A 2ZKSA 1LHEH 1BTZA 3EAJA 5C5OA 3RMOH 1BITA 1O2YA 1QIXB 2W3IA 4WMFA 2O8UA 2ZPSA 4U01A 4ZCNA 5F6MA 1GI7B 3TVJB 2UWLA 1P3EA 1RIWC 1H9LB 3ATLA 1YLNA 2Y80A 3BEIB 1OWHA 1DSUA 2ZHDA 1MH0A 2SGPE 1M9UA 4U32A 1HAOH 1GJCB 1PPFE 2W3KA 1DX5M 2Y7ZA 5H4IB 3LOXA 2WHXA 1RGQA 2A5AA 3MH5A 2BX4A 3O8DA 1C1WH 4NZLA 2LP6A 1O3LA 1AWFH 4TPYA 5C20A 1TQ7B 5DP9A 1QGFA 1C2LA 4UDWH 1H8DH 3RXGA 1ZSKA 1A5IA 1UTNA 1T31A 1CGJE 4I8JA 2HVYB 4D9RA 4ABGA 2EY4C 1AFQC 1DM4B 2HPQH 2XBYA 2ANYA 4GHQA 2OC8A 4OS1A 1OWKA 1HV7A 3WWFA 2FOFA 2BD9A 3ZVDA 1TX7A 4CRAA 3B9FH 1F5KU 4X6NA 1ETSH 3GISB 1GBIA 1FIZA 1MTWA 1Z8GA 1YPMH 3FKSD 1O5EH 2VVVA 1TMTH 3SNDA 2A5KA 2V0BA 2EC9H 1V2LT 1MTNB 4HI3A 4RT1A 4RN6A 2W7SA 2A2XH 4GSOA 1GJ4H 3GCOA 3OYPA 2OLGA 2ZFRH 2P16A 4BAQB 3E0NB 3DFLA 3MNBA 5JB9S 1E0FD 4ABEA 4UFGH 1TGCA 5HIZA 3EDXB 4NIWA 3MHWU 1CA0B 2GX4A 4ZKNU 3T26A 1SPJA 3QZRA 2L74A 2UUYA 2AMQA 3SU3A 2JIZD 1RTLA 1FY8E 1TGTA 3EA7A 3RXBA 3GYMA 2C8WB 1E1RD 3E91A 4VGCB 1UTOA 1PPEE 5A8ZA 4FUJA 3K6ZA 1DLEA 1YYY1 2VIVA 4CR5A 1T8OA 1KDQA 4BAHB 1ZTJA 2JKHA 1NPMA 2LELA 3A7VA 3HKIB 5AVDA 1P2MA 1O3OA 3A81A 4AZ2B 5KGOA 5DP6A 2Q6FA 1J8AA 1Z7KA 3V7TA 1UVOA 3GY5A 1DUAA 4XBDA 2G55A 1C1MA 3GY2A 4E7NA 1GMCF 4B2BA 2FXRA 1KDQB 3MU8A 1WTGH 4ZMAH 5C0UA 1FY1A 3VGCB 2ZFSA 5L2YH 4A1VA 2CMYA 3H7OA 3ZYEA 1QR3E 3JZ2B 4K8BA 1ANCA 1EFRD 2FODA 5E2OA 3QLPH 3NWUA 4ISLA 2VNTA 1VCQA 1ANDA 2XRCA 3V3MA 3RXOA 1GI8B 3U1IB 3GDUA 2XBWA 1SGDE 4SGAE 1T4UH 1E37B 2YOLA 3P8NA 1MUEB 1IQLA 1BMLA 1RFNA 3W1EA 3T5FH 1O0DH 3M3SA 3B8JA 1C1NA 3ZV8A 1MMJN 3FP7E 3MU0A 3K9XB 4X2YA 2Q6GA 1BT7A 5HXFA 2ZPQA 2ZU4A 1NRPH 3ATKA 2HALA 2BVSH 1RXPA 2ZP0H 1AQ7A 1K9OE 4AGKA 3DFJA 4Y11E 4DVAU 2QGRA 1MBQA 1GHZA 3UOUA 1CT2E 5L6NH 2P95A 7ESTE 2WPIS 2SGFE 1ZPBA 4YOJA 1C5MD 2BMGB 3R3GB 4NFEA 2BD5A 4FUGA 1UVTH 2FOCA 3KL6A 1GVKB 4RT0A 1N6YA 1O5CB 2F9BH 2SNWA 1UK2A 2BQ6B 5GPIB 2BZAA 3PLPA 2OP9A 3U1JB 1JRSA 1TALA 4SGBE 3RUOA 3TJOA 2BOKA 1HAZB 1AE8H 1HRTH 5HM2A 3UAIC 4B2CA 1DT2A 1O2OA 2RA3A 3A88A 1F5LA 2ZDLA 1TGNA 1OWEA 1NFWA 3LJOA 3FN8A 3VXEH 4DT7B 1WU1A 1BMAA 1MTNC 1PJPA 1A5GH 3BIVH 1DWCH 1W7XH 1OKXA 1C9TA 3GDVA 5A0CA 3S7HB 2FZZA 4JZIA 2ASUB 1QY6A 1Z8JB 1AN1E 5TCAA 1UCYH 3QTVH 5E0JA 1NROH 2PP6A 2ZFTA 1O2HA 2CV3A 1ZRKA 2AERH 1YLCA 4CRFA 4WH6A 8LPRA 3RM0H 3D62A 1EUFA 1DUEA 5EGMA 1CA0C 1PPZA 3RXFA 2P3UB 1IQHA 1CA8B 1O35A 1J16A 1TBQH 2A45B 2GT8A 3FANA 2FOGA 2BD3A 2Q6DA 4VGCC 1O2IA 1C5PA 3RXRA 1O30A 1YPKH 3BSQA 1C9PA 3URDA 2QF5A 4R0IA 1W0KD 3FP6E 4LOYH 2J94A 3KN2A 9ESTA 2G52A 2A7CA 3TK9A 3F9GA 3E3TA 1IQMA 1MU8B 5ESBA 3H5CB 5A8YA 1NU9A 2AIPA 2QN5T 1ZOMA 1QRXA 1VZQH 2OK5A 1P2QA 5E0GA 3SV6A 2R9PA 3D65E 1UJ1A 2J2UA 4TY6A 2W6ID 2ZI2H 1GMCG 1RJXB 2WV5A 9LPRA 2PGBB 3VGCC 1C5LH 3PB1E 3OY6U 3LDXH 1J14A 1TPOA 1FQ3A 8KME2 1C1TA 4X1RU 4B1TA 1FV9A 3RU4E 1O5AB 4I31A 1TRMA 1C5WB 1GHBF 3A7YA 1THPB 2C8YB 1GJ7B 2WYJA 2C93B 2VB0A 2PTNA 4CHAC 2Z9JA 5FCRA 3O8BA 2AIQA 5TCCA 1S84A 1Y3UA 2OC1A 2OQ5A 1DANH 3M5LA 3WWBA 1IQFA 1L4DA 2RG3A 4ZXYH 1CHGA 1K1MA 1O3FA 2H5CA 1T8LA 2P3TB 2R0KA 3ZVGA 2Y6TA 1LQDB 3VB3A 1JRTA 1YGCH 4TPIZ 3M7TA 4AFSA 3ZZ4A 1OHHD 4CRDA 2HOBA 1G2MA 1IQKA 1Z1JA 3UQVA 2V3HH 2QAAA 5HGGA 1HFDA 1GBHA 1EKBB 1DITH 3AVZA 1TNGA 2NU0E 2KFWA 4B74A 1PPCE 3ZZ5A 2BDBA 2HNTC 4Y0ZE 1FY5A 4BAKB 1QRZA 1TE0A 5AHGH 2FOMB 1V2KT 1O36A 1SGYE 1D6WA 1WQSA 1G3EA 1MD7A 2AHME 3LPRA 4F4OC 2WUBA 1DWBH 3TGKE 3LGYA 2V3OH 5A8XA 4O9VA 1SGIB 1ACBE 2ZDAH 2BLVA 2ZF0H 2WYGA 2TGPZ 1AKSA 1YP9A 1KLIH 5C0TA 5G4BA 1W7GH 2FLRH 5FPTA 1CT4E 3F2HA 3Q3XA 4NWLA 2A4OA 1JWTA 1ESAA 1NFUA 2TGTA 1HAVA 3ZVAA 3RXHA 1SLXB 1MTSA 4OM9A 1UTLM 4UONA 3QDZB 1TNKA 1LHDH 1CBWB 2KZ4A 5ESTE 5CHAB 1QHRB 1PQAA 2Z7FE 4M7GA 3M3VA 2VINA 2FEQH 3SHAH 3MH7A 4X0WU 2K0QA 3TJNA 1D6RA 3EQ0H 3H7TA 2JH0D 4A1TA 4U30A 3B23B 1C4Y2 3RM2H 2OTVA 1O2WA 2P94A 1LVBA 3UOPA 3GCHB 5C1UA 1SKYE 3NUMA 2QXHA 1UHBA 4INKA 3BTDE 3SJ9A 2BXTH 4NSVA 1P02A 3MNXA 2AEIH 1O2JA 2SGDE 3FVFB 5DJ7A 1TX8A 3SGBE 2GDEH 2VGCC 1SGQE 2Z6BD 5SGAE 1TOMH 1UVUH 1SGRE 3T62A 1GI2A 1IHSH 3RLYH 1W14U 4Y8XA 3LH3A 1UHBB 5CMXH 3P70B 1GBEA 3BTFE 3ZVFA 3M5OA 3RP2A 3MO9A 1SFQB 3VG8A 1O2TA 4AGJA 2J4IA 1TLDA 7KMEH 5L2ZH 2ZU3A 2K8IA 3V0XA 4ACBA 3KEEA 3MOCA 2BX3A 2NU3E 4KTCA 4MTBA 1GHAF 4TWWA 4YXWD 1AZZA 8GCHF 5DSFA 1KXFA 2GZ7A 1MD8A 4ZHAA 3GY7A 4F49A 2B5TB 2FMJA 4MPXA 1O2KA 1GHBG 4ZHMU 2WINI 3PWBA 1FPCH 1CT0E 1KMHB 5EXLA 3UNSA 5FCKA 2CF8H 2YNAA 2VWLA 5J4SA 1TPPA 2QF0A 3QZQA 1JMOH 4X2VA 2JDID 3F6UH 3OAAD 4XOJA 3SU4A 1J15A 3K6YA 2A7JA 1O33A 1C5NH 3M3TA 5GIBA 5T1VA 3SOSA 5F8XA 1VCWA 2J98A 2PR3A 2Y7XA 5EJLA 1C2FA 2EI7A 2G5NA 2JJ2D 4BOHA 3LIWA 1SQAA 3SN8A 3SNBA 3OY5U 4Y71A 1P12E 2RFKC 3LGTA 1QRWA 2ZU1A 3ZVBA 1NRRH 4MNVA 3C27B 1OOKB 1P09A 1D3TB 4YO9A 1P03A 5IK2D 4DURA 2V6NA 2J98B 3DSPA 2I6QA 4JK6A 1QBOA 3MU5A 4K3JA 2BDIA 1THRH 1PPBH 3JZ1B 1GBCA 1L2EA 1YCPH 1P2KA 3GCTF 1D9IA 2ZHFH 2BOHB 3MU1A 3UWJH 2XTTB 1SLVB 5KEDA 1A46H 4ESTE 1AD8H 1EAWA 1ANBA 1C5TA 2AGGX 2BM2A 3FZZA 2PV9B 4MG3A 2O8MA 3QN7A 1A3EH 2V35A 2VH6A 5TJXA 4D76A 1JIMA 4THNH 3HGPA 4DJZB 5EJ1A 1V2TT 1GMHF 5CHAC 5GJ4B 1OWJA 2ANWA 3LH1A 1AWHB 1EP6A 1SHYA 3P6ZB 4YM9A 1ETTH 2ZNKH 2F9OA 1ELDE 1O39A 2BLQA 4OGXA 1W0JD 1FLEE 1GPZA 1C2MA 2GJGA 4E05H 1MZDA 2ALPA 1O5GH 2RDLA 5JBAS 1EOJA 3BTME 3FZDA 1UMAH 1WTHD 2GD4B 1P3CA 3MMGA 3GCHC 3CP7A 1ELCA 1WBGB 1Z1IA 2BQWB 4A6LA 2ZQ1A 1L1JA 2CGAA 4CH8B 1QFKH 3HPTB 4K8YA 3ZYDA 2BD4A 3MTYA 2BDGA 1OYTH 2F9NA 2EA3A 4H6SB 1BTPA 2K1QA 2QE7D 3UB0A 1TRNA 2CHAB 3NRLA 2PUQH 3RMMH 2SGQE 3Q00A 3RXQA 1E1QD 1ELBA 3OSYA 3T28A 4AX9H 1BUIA 4UEHH 2SGEE 1A0JA 4JZFH 5C17A 2JH5D 2PKSB 5HMAA 5B6OA 1C1UH 3U69H 2KCPA 1H8HD 1Y5AT 4B6FA 2B8OH 3ZZBA 3SU2A 1W3CA 4MNYA 5EOKA 3GY6A 1O3PB 3SU6A 4XDEA 5EPYA 5FBEA 4CH2B 2W5EA 1GHAG 2PWXA 8GCHG 2GCHF 5EW1H 2FS9A 2J9NA 3WY8A 2PW8H 1F2SE 3GOVB 1TB6H 3VB5A 5ABWA 3KYGA 2UUJB 1C2IA 3K65B 2Y5HA 1COWD 3TNSA 4KTUA 1BBRK 1V2JT 2J97A 1J17T 1BRAA 3VXFH 1QCPA 1VR1H 4Y7BA 4YLUA 5FBIA 1KXEA 3RXCA 2JETB 1ZJDA 4NGAH 1HNEE 3S7KB 1BJUA 1UTKA 3LGVA 4X6MA 1GGDB 1C1SA 1NO9H 2ZGHA 3HGNA 3FO8D 1SFIA 1GVZA 1MCTA 1LPZB 1DS2E 1ZYOA 2ILNA 1MZAA 3M7UA 2YMSC 4JZ1A 2A31A 3NPSA 4OGYA 4F48B 1HJ9A 2FPZA 3I29A 3NK8A 2OINA 5EU8A 1TX6A 3SGQE 2YMSD 3RLWH 3MO6A 2ZGCA 1S82A 2A1DB 2UWPA 3O8CA 3GCTG 4AG1A 1S6LA 4WY3A 4Y7AA 1P2OA 2NU1E 1QNJA 1UTPA 1K22H 1KTTB 1GI1A 4TYDA 2PSXA 1DWDH 1HJ8A 1QJ1B 1GBKA 1NRQH 1L1NA 1AB9C 1A61H 2QCYA 1GMHG 1SGCA 2ZDNA 4FU9A 5FHTA 1VCPA 4Z1MD 2G4UA 1GDNA 1CE5A 2Z9IA 1EJNA 3N7DA 4BAMB 1XXFA 1NU7B 1OP2A 3KHVA 5FL7D 2J95A 2UWOA 2LPRA 2HPPH 1DE7H 2R3YA 4MNXA 4AFZA 5DP8A 4KP0A 4OS5A 4O3TA 2H1UA 3DCLA 1TWXB 2BTCE 1CO7E 1TNIA 2V3MA 3BTHE 3S9AA 3OEHD 4XBCA 3TIUA 3Q77A 2QXJA 1NFYA 2IPHA 2XXLA 4FUIA 4Q4LA 3LGUA 3ZIAD 3SJOA 1IQNA 3SUFA 3P17H 2XCFA 3SQHE 3ZVEA 3TK6A 3K2UA 2RA0A 3GY8A 2XC4A 2CHAC 3A8CA 1DXPA 1GG6B 1OSSA 1HAPH 2XNIA 4X8TH 5LPEA 1HGTH 3LKWA 4FETA 3ATIA 3S69A 1CGIE 1YPHC 1O5DH 2GP9B 3SUDA 4Q7ZA 2VIOA 1WDIA 4OS6A 2PKSC 3VFEA 2QIQA 2G81E 2P3FH 1F7ZA 3KNXA 1EAIA 4Y79A 1YWUA 1ZR0A 4GUXA 2A7HA 2ZEBA 4FXGH 1D3DB 1KY9A 1NT1A 2G8TA 3EA8A 1W12U 2GCHG 2ALVA 4UD9H 3ESTA 3T27A 2BB4A 5EQRA 3UWIA 1FY3A 1O5BB 1V2MT 5E2PA 3KQDA 5CE1A 2GVFA 2B9LA 2STBE 5FX6A 1G2LA 1QB1A 2GCTB 1TPAE 2ANKH 2OQUA 2WZQA 4WXVA 2R2MB 2BDCA 2ZPRA 4Y8YA 1D3PB 2FYRA 2JETC 1ELFA 3ZZAA 1Z71A 1MKWH 4DOQA 1GGDC 3TH3H 5FPSA 2WV9A 1WXRA 5A2MH 3VB7A 3QGJA 2QXIA 1GI9B 3ZZ3A 1K1JA 1HYLA 2BQ7B 5T6FA 2PHBA 5GXPA 3ZZ9A 2FTMA 2F9UA 1C1QA 2F3CE 3BTWE 1LTOA 2ULLA 3F9EA 3SV7A 1O3JA 1BB0B 1FMGA 4A7IB 3PRBA 4HGCA 2ZU2A 4E06H 3O8RA 3M7QA 1LQEA 7LPRA 1AHTH 1SBWA 2FS8A 1V6DA 1F0TA 1YCPM 1GJ8B 1O3BA 3GCNA 4ISNA 4WXIA 1LCYA 1UO6A 3MI4A 1B0EA 2C3SA 3A86A 3F9FA 2TGDA 5FPYA 4Z0KA 5BRRE 2D8WA 4KGAA 2HLDD 2GKVE 4FU8A 1C2JA 1TGBA 1O37A 4K1TA 4YT7H 1Y5BT 1EATA 1ZMNA 3SJKA 2GMTB 3PV5A 1EQ9A 4IMZA 3SJIA 1FAXA 3SNEA 2Y81A 5JBCS 3LC5A 2OXSA 4Q63A 2G00A 3KYFA 5F8TA 3U28C 1ELEE 1GDUA 4I86A 1YPJH 1XVOA 1ZHMA 1EB1H 4RSPA 2A5IA 2D2DA 2OBOA 3ZZ8A 2TGAA 3ATMA 2BDHA 5EXMA 4XBBA 4NIVA 2AMDA 2IJOB 4GAWA 2ZFPH 1OWIA 5DP4A 4D7GA 2OUAA 3F9HA 3GS9A 3DUXH 3SO3A 3AAUA 3TU7H 1S0RA 3LONA 4FVBA 1C5OH 4IC6A 1BTYA 1E79D 1GHYH 2QXGA 5EIYA 5L30H 1C5RA 3A7XA 2VWMA 2ZWLH 3R0FA 4H42U 3ODFA 5ETXA 1SGPE 1K1OA 1ELGA 1P06A 1IQEA 1FPHH 1XXDA 2ODPA 2ZTXA 1LHCH 1EJMA 1ZZZA 1O3AA 1XVMA 3A85A 1ZTLA 4ABHA 2QF4A 2Z94A 1OYQA 1O2UA 3HKJB 4J2YB 3BEUA 3RXVA 1G32B 5HKKD 3MO3A 1TOCB 4Z6AH 4MPVA 1ZSLA 4BAOB 4AOQA 2W26A 1A2CH 1O3HA 2VJ1A 1GJAB 4HG6A 3ODDA 1AMHA 1DWEH 2IPQX 1SGEE 2XBXA 3F2FA 2F4LA 2H5DA 1O3NA 2GCTC 2CN0H 1YLDA 2ZHWH 4AFQA 1OXGA 2QC2A 1K2I1 3RXSA 3A8DA 3ZZ7A 4D9QA 2C90B 4XE4A 1OP0A 1SGFA 3ZZCA 1SQTA 2CXVA 1NRNH 3SNAA 2KM0A 1G36A 4INHA 1FI8A 3TNTA 3SYJA 4TSFD 1IQGA 4TT3D 1EAXA 1BCUH 4HTCH 4DIHH 2OD3B 2ZDVH 4ZH8A 2GGVB 1G3BA 3MU4A 3UFAA 1K1NA 3FAOA 1G3CA 5DP5A 2F83A 2PKAA 3A7WA 3ZVCA 1BOQA 3NKKA 3RC6A 3PO1B 1C5YB 1O2VA 2HNTE 3N7OA 2HGTH 3E6PH 1FZZA 3RXUA 3OU0A 1UTQA 2GV7A 2LNCA 4GVUA 2EI8A 1UTMA 1SQOA 2P8OB 3LU9B 3P8FA 1C1OA 3M35A 3E0PB 2WUCA 1QBVH 1P2JA 1V2ST 1XKAC 4YLQH 5C1XA 1VITH 1BZXE 1K1LA 4I33A 2PKAB 2HRVA 1SC8U 3PMJA 1Y5UT 4IGDA 3HK6B 2F9PA 3CS7A 1MKXK 1YPGH 2GMTC 2C8XB 1C2KA 1KXAA 1AKSB 2ZHQH 1GHXH 2AGIX 2QY0B 1EAUA 4YZUA 4YOIA 1HUTH 3G01A 1BHXF 1HAHH 1HAVB 2NWNA 5JPMH 3V12A 1KTSB 1U6QA 5FXLA 2THFB 1UCYK 5EXNA 3IITA 1W10U 3SBKA 3NCLA 2AYWA 4X8VH 1ELVA 2XNDD 3GY4A 4X1PU 1GHVH 5A0BA 5LPRA 4LZ1H 1MAYA 2BY5X 4AYVB 5A09A 4YTAA 2Z9KA 2FX6A 4CBOA 5DKMA 4AG2A 3SNCA 2AMPA 2GDDA 3BN9A 4K60A 3SQEE 1EB2A 1EOLA 1GBMA 2VIQA 4M9FA 4JYUH 3UR9A 4ABAA 1MBMA 1GI0A 3AAVA 4ABJA 5AFZH 6CHAB 4FUDA 4E7RG 4ISHH 4GHTA 1AU8A 3RC5A 1N6XA 4UFFH 5F03A 3RXEA 1HXEH 5F8ZA 1FN8A 4MVNA 2BY8X 1EP5A 1IOEA 1FUJA 2VBCA 3V13A 3RU4T 3OEED 1HCGA 1P0SH 1MAXA 2XWBI 1LHFH 3DSGA 2ZHEH 1UVSH 2SFAA 5FX5A 2QA9E 5GCHF 2D26C 1OX1A 2UUFB 3SJ8A 5CHBA 1LPKB 1GL1A 4LZ4B
chains in the Genus database with same CATH topology
3BTQE 4K1EA 1RS0A 1P01A 4MPWA 2ZDMA 5EQQA 3DA9B 1KXDA 2PFEA 5I46H 1O2ZA 4O97A 3S0NA 1GL0E 1QURH 5BPEA 1ABJH 4RKOB 2PTCE 3M5MA 3A8BA 2SGAA 1NFXA 1O31A 1A7SA 2A4RA 4H4FA 5E8EH 1ARBA 1IAUA 3VB4A 1LMWB 3SU0A 3E16B 2OBQA 1ZSJA 2UUKB 2VIPA 6LPRA 3L3TA 1ANEA 1TONA 3DT0H 1JBUH 4Q80A 3UTUH 1O3MA 2H2ZA 3QGNB 1EXFA 2VWNA 3U8RH 1GCTB 1VJ9U 4I7YH 4I8KA 1SLWB 1Z8RA 2ESTE 2BHGA 3IWMA 3CS0A 3ENSB 1N8OB 3AASA 1JXPA 7GCHG 1YPEH 3GY3A 4LK4A 1C2EA 1W2KH 3TGIE 1GI6A 1HAIH 2SNVA 2TBSA 1TIOA 3RC4A 4BNRA 3MWIU 4MDSA 1W0YH 3RXKA 2GT7A 3ZZDA 1CBWC 4DCDA 1BTXA 1K28D 4NSYA 1XKBC 3A84A 4WVPE 1YKTA 1EASA 1KIGH 4B71A 3SU5A 1VJAU 5AFYH 3M37A 2O8LA 3L33A 1P8VC 1S85A 1AFQB 2Z9LA 1P9UA 4H6TA 3STJA 1GMDF 4WMEA 1QQ4A 1WAYB 1SVPA 1YC0A 2G51A 5T6DA 2ZGXH 4FUFA 1RTFB 4ZAEA 1BTUA 3OX7U 4FUHA 5JBTA 2WPLS 3W95A 3U9AH 3IG6B 1MCVA 2QYIA 1XUJA 2BD2A 1SL3A 2ZCKP 3KQEA 2WPKS 4YESB 1YF4A 2Q1JA 4IBLH 1V2PT 3UNRA 1MQ6A 1FDPA 4ZKSU 2IOTA 4NA9H 5LGOA 2ODQA 4B76A 1WQVH 2C4FH 2XBVA 6CHAC 4WMDA 3RMNH 1P2IA 1BBRE 1HDTH 1C5UA 1VITF 1O2LA 4Y10E 1DDJA 2PUXB 4MLFB 3L6PA 3P8GA 1QBNA 1AY6H 4ABFA 1GVLA 1C5VA 2W7UA 8ESTE 1F0SA 1BJVA 5J4QA 4GCHF 5PTPA 1ZPZA 5GCHG 3EGKH 4UE7H 3GDSA 4KTSA 1BRBE 1AVGH 3TJVA 4K1SA 2XW9A 1ZRBA 3KCGH 3PV4A 2H9HA 2A4GA 1TBRH 3PLBA 1RTKA 1GJBB 4TWYA 5EODA 4ISOA 1O2NA 4Y8ZA 3D23A 1XUFA 2BDYA 1GBAA 1K21H 5HYOA 4NG9H 4NZQA 5EG4A 1GJDB 1NY22 4O3UA 4B73A 2XCNA 1D3QB 3ELAH 2FLBH 2A4QA 1WCZA 1XUKA 3KQCA 3A83A 1EJAA 3UIRA 2FOAA 1ZHRA 2O8TA 4IW4E 3S9CA 1EPTA 1XM1A 2XWAA 3UR6A 1GCTC 2IN2A 1O3KA 2ZA5A 2BY9X 2O9QA 1KLJH 1NC6A 1L0ZA 1Q31A 2RCEA 1P9SA 2OC0A 3TH2H 2R2WU 2ZCLP 4ASHA 1N8OC 1NZQH 1BQYA 1QA0A 1O2XA 4JK5A 4A92A 1EPTB 1UVPA 1YCPK 1VGCB 1XUGA 5JBBS 1O3GA 1A3BH 2HWLB 3STIA 1Y3WA 1C1VH 1P04A 3Q3YA 4JCNA 1ZGVA 5EQSA 3UPEA 1Z6EA 4ABBA 2NU2E 1PPHE 4XSKU 2G4TA 4HFPB 1CHOF 4R8TB 1GMDG 1XMNB 4OS4A 3KIDU 1AVXA 1GCDA 1TMBH 3TH4H 1A0LA 1YBWA 3PTBA 5DPAA 5DK1A 1DLKB 5JB8S 1DY9A 5K0HA 1J9CH 4CRCA 1TRYA 1H9IE 2TIOA 1H1BA 1DY8A 1TA6A 4D8NA 4ZHLU 1G3DA 5K7RA 1QJ6B 2M5TA 2ZECA 3URCA 1K1IA 1BRCE 3SU1A 1ETRH 3TGJE 4FUBA 3ATWA 1FN6A 1EX3A 1O2SA 1H4WA 3F1SB 4FU7A 3E8LA 1V2UT 4ZUHA 4BTUB 1Q3XA 2WPHS 1VITG 3SV2H 1HXFH 4AN7A 5IDKA 4O03A 4ABIA 4Y0YE 5IYTA 1GJ6A 1SOTA 3MNCA 3BG4B 1BHXB 2FDAA 1O2GH 1YPHE 2ZZUH 4DY7B 3Q3KA 4GPGA 3UY9A 4GCHG 4Q2KA 1SGFG 1NESE 5DO4H 3Q76A 4MPUA 5T3HA 3HATH 1C4U2 1SHHB 2QF3A 5C1YA 1AIXH 4NIYA 1LKBA 2FX4A 1O2QA 1ZJKA 6GCHF 1WUNH 1CGHA 1MQ5A 1V2QT 1O3EA 4PROA 3E90B 1OS8A 3BV9B 2CJIA 1UTJA 3BEFB 3SORA 2FWWA 3SW2B 1C4V2 3MH6A 3MNSA 1NS3A 1O5FH 2XYAA 1LPGB 1SOZA 3KF2A 3ZV9A 1ESTA 1P05A 2FOEA 4INLA 4X2XA 1QB9A 1CU1A 4QT8C 1T8NA 1ZMLA 3U8TH 2VWOA 2FESH 4I8GA 4CHAB 3RXDA 1V3XA 4BXWA 1FAKH 2WV4A 3P95A 3CENA 4TY7A 1XUHA 2C8ZB 4D7FA 1GBBA 1RD3B 2ZQ2A 2FP7B 1ORFA 1TNJA 4ZXXH 2ZIQH 2G5VA 1LHGH 3W94A 2VIDA 4I8LA 2ZC9H 4CBNA 1KXCA 3T29A 4X1SU 3BF6H 3UUZA 3SI4H 3RXMA 1QJ7B 1XUIA 1BRUP 3A80A 1SI5H 1TAWA 2FI4E 1SSXA 1EPTC 1TPSA 1W8BH 1G37A 2DE9A 4B2AA 1GI3A 1HAYB 1VGCC 2AGEX 5GWZA 1O38A 2ZG0H 2FIRH 3TPIZ 2KAIA 2ODYB 5C3NA 1HAGE 2Z3CA 2B7DH 3DD2H 5DP3A 4FUEA 1AE5A 1F92A 2EI6A 4IC5A 2OC7A 1ELAA 2Z3EA 1G9IE 1F0UA 1OWDA 4X6PA 1SGNE 1ABIH 3VPKA 5T6GA 1CHOG 2AFQB 3PROA 4BTTB 1PPGE 3DHKH 1AVWA 1MKXH 2BD7A 4BXSA 3RXJA 2KAIB 2D1JA 2BVXH 3LGIA 2WPMS 2BDAA 3FP8E 1TMUH 1NN6A 1TNLA 4WWYA 2J92A 2P59A 1IQIA 1EZUC 1A4WH 4MNWA 1SR5C 2GTBA 3UREA 1P11E 2J34A 4K5ZA 2STAE 3VB6A 1S5SA 3MYWA 2BYAX 1Y3XA 1H8IH 3SV8A 3SUEA 1HAXB 5FAHA 3I77A 3SGAE 3M61U 1GG6C 1TNHA 3RXIA 1TGSZ 1C1PA 1DICA 1OP8A 1Y8TA 4K69A 1V2NT 1ZMJA 4NFFA 1B7XB 4OS7A 3RDZA 4JYVH 1P10A 3BG4C 1B5GH 1GHWH 2TRMA 2AH4X 2BY7X 3EE0B 1ESBA 1GWAA 3RXAA 4ZKOU 3SV9A 4K2YA 1CSOE 2BD8A 4ZKRU 1LVMA 1E36B 1A0HB 1KYNA 1CVWH 1THSH 2H6MA 2VGCB 1SMFE 3BTTE 6GCHG 1LDTT 3BIUH 1KSNA 3QK1A 1O3IA 2A0QB 3GICB 2HVXA 1T32A 2B0FA 1NTPA 4J1YA 4YOGA 1QL7A 4ZROA 1N1LA 3A82A 4Y76A 3U8OH 1LO6A 3TJUA 5C67A 1F5RA 2VVCA 2BZ6H 1C2HA 3RU4D 1QQUA 5E0HA 1HB0B 2ZTZA 3I78A 1V2WT 2VH0A 3A7TA 2FOHA 4JYTA 4NA7A 1MKWK 3AW0A 4AB9A 3PYHA 3TITA 2ZGBH 4JZDH 1X7AC 3PMBB 3QO6A 3RMLH 5I25A 1V2VT 1BIOA 1L4ZA 1DOJA 1W11U 3GYLB 1WOFA 1DPOA 1C2GA 1GI4A 1HPGA 1EZQA 1DFPA 2ZGJA 6ESTA 1T8MA 1IHTH 1AI8H 1EZSC 1UCYE 1WV7H 3NZIA 4WH8A 1BTHH 3PLKA 4NCYA 1FONA 3RXLA 7GCHF 3SI3H 1TABE 3LC3A 3PMHB 2Y5GA 1F0RA 2HLCA 3EA9A 2XC0A 1S83A 4AORA 2O8WA 3A89A 3VEQB 2FI5E 2R3UA 4ABDA 1QL9A 4X8SH 2FOBA 4CREA 1D4PB 1SGTA 1AUTC 1JOUB 1QTFA 3LT3A 1A1RA 1ZHPA 2Y5FA 1EZXC 1AZ8A 3RXPA 4ISIH 1GBLA 4FUCA 3A7ZA 1E34B 1V2RT 3TK5A 1WSSH 1FXYA 4CRGA 2JH6D 4X8UH 1HIAA 2GZ9A 1AO5A 1T4VH 1ZTKA 3KGPA 1HBTH 1AFEH 3AW1A 3BTEE 1AUJA 1BMMH 2VVUA 1TA2A 1O3DA 2R0LA 3SUGA 1W13U 3M5NA 3MFJA 4GLYA 2FYQA 1Z8IB 1IQJA 3KQBA 5C2ZA 4UFDH 1O2RA 1QA7A 5C5NA 5GDSH 4NWKA 2EEKA 1O32A 1PQ7A 1HIAB 4X1NU 1KXBA 1ARCA 2BVRH 3UNQA 2VU8E 2TPIZ 3T2NA 1DXWA 4IMQA 5A0AE 4X2WA 2ANMH 1ZPCA 2BLWA 2J38A 2YNBA 1O34A 3C1KA 3QTOH 4UFEH 2H9TH 1Y3VA 1BA8B 3LGWA 2H9EH 1HJAB 1C2DA 1ELTA 4HZHA 4WF8A 3P92A 1FJSA 3SHCH 4BTIB 1O2PA 1FY4A 1QL8A 3TLOA 3PMAB 4AYYB 2FI3E 4MQAA 4XFQA 2PGQB 5LPFA 3RXTA 4Y6DA 2FM2A 1ZGIA 2HNTF 2QV1A 1P2NA 3SZNA 3QWCH 5DG6A 1KLTA 3UQOA 3QX5H 5EPNA 1UK4A 2ZFFH 3U98H 4AFUA 3NXPA 1BMNH 4NIXA 1JIRA 1GI5A 1S81A 4DG4A 1BBRH 1GBDA 2ZU5A 4CRBA 1MTUA 2OCVB 3PTNA 1Z6JH 2VIWA 1O3CA 3A8AA 1GBJA 1ZLRA 2ZFQH 3BG8A 1HLTH 3QUMP 1SLUB 3PO1C 1RIWB 3MH4A 1S0QA 4I32A 3EYDA 3PWCA 4DGJA 3S9BA 5LH8A 3OTJE 1AGJA 2P8OC 2BLOA 1GJ9B 1GDQA 4U2WA 4I8HA 1YPLH 4A5TS 3LJJA 5JDUB 1LVOA 1UK3A 2Z9GA 1XX9A 2ZTYA 1T7CA 1GJ5H 4X6OA 4CR9A 2I6SA 2FTLE 2WPJS 1QB6A 1C5ZB 1TQ0B 3HK3B 2NU4E 1RRKA 1BTWA 4OS2A 1PQ8A 3T25A 1LKAA 1C5XB 3ZZ6A 5DGJA 1K1PA 4IS5A 4DW2U 3PM3A 4RKJB 4JZEH 1DSTA 3F68H 1INCA 1P57B 1AB9B 2XC5A 2PSYA 2A2QH 1H9HE 2P93A 2F9VA 2BY6X 1FNIA 5EW2H 1Q2WA 4NA8A 1Y59T 1C5QA 1NM6A 1TFXA 1E38B 4FVDA 5DP7A 1ID5H 1PQ5A 2DE8A 5JYIA 3FFGA 4JMYA 2F91A 4A1XA 4Q7XA 1YM0A 3E1XB 3BTKE 1LVYA 1GBFA 4B75A 1PYTC 2A32A 2BXUH 1Y3YA 2FO9A 1V2OT 5HM9A 1FIWA 3A87A 3ITIA 2ZO3H 2ZCHP 1HJAC 1PYTD 1S6FA 2ZDKA 1MTVA 4KKDA 3M36A 3BTGE 5AF9H 2PLXA 1BDAA 4IN2A 1NRSH 1C5SA 1GBTA 3P8OA 1TYNA 4IN1A 3D49H 4YT6H 4KELA 4LXBH 4WJG2 2Z3DA 4Q7YA 2DUCA 4DIIH 1E35B 1TBZH 1L1GA 1A5HA 1OPHB 1SB1H 1O2MA 1G30B 1S6HA 4X1QU 1WYKA 1W0ZU 4AB8A 4BANB 2Y82A 1PFXC 1CQQA 1MU6B 1B0FA 2AS9A 1C1RA 2CF9H 1SG8B 2GZ8A 1DVAH 2GV6A 2ZKSA 1LHEH 1BTZA 3EAJA 5C5OA 3RMOH 1BITA 1O2YA 1QIXB 2W3IA 4WMFA 2O8UA 2ZPSA 4U01A 5F6MA 1GI7B 3TVJB 2UWLA 1P3EA 1RIWC 1H9LB 3ATLA 2Y80A 3BEIB 1OWHA 1DSUA 2ZHDA 1MH0A 2SGPE 1M9UA 4U32A 1HAOH 1GJCB 1PPFE 2W3KA 1DX5M 2Y7ZA 5H4IB 3LOXA 1RGQA 2A5AA 3MH5A 2BX4A 3O8DA 1C1WH 4NZLA 1O3LA 1AWFH 4TPYA 5C20A 1TQ7B 5DP9A 1QGFA 1C2LA 4UDWH 1H8DH 3RXGA 1ZSKA 1A5IA 1UTNA 1T31A 1CGJE 4I8JA 4D9RA 4ABGA 1AFQC 1DM4B 2HPQH 2XBYA 2ANYA 4GHQA 2OC8A 4OS1A 1OWKA 1HV7A 2FOFA 2BD9A 3ZVDA 1TX7A 4CRAA 3B9FH 1F5KU 4X6NA 1ETSH 3GISB 1GBIA 1FIZA 1MTWA 1Z8GA 1YPMH 1O5EH 2VVVA 1TMTH 3SNDA 2A5KA 2V0BA 2EC9H 1V2LT 1MTNB 4HI3A 4RN6A 2W7SA 2A2XH 4GSOA 1GJ4H 3GCOA 3OYPA 2OLGA 2ZFRH 2P16A 4BAQB 3E0NB 3DFLA 3MNBA 5JB9S 1E0FD 4ABEA 4UFGH 1TGCA 3EDXB 4NIWA 3MHWU 1CA0B 2GX4A 4ZKNU 3T26A 1SPJA 3QZRA 2UUYA 2AMQA 3SU3A 1RTLA 1FY8E 1TGTA 3EA7A 3RXBA 3GYMA 2C8WB 3E91A 4VGCB 1UTOA 1PPEE 5A8ZA 4FUJA 3K6ZA 1DLEA 1YYY1 2VIVA 4CR5A 1T8OA 1KDQA 4BAHB 1ZTJA 2JKHA 1NPMA 3A7VA 3HKIB 5AVDA 1P2MA 1O3OA 3A81A 4AZ2B 5DP6A 2Q6FA 1J8AA 1Z7KA 3V7TA 1UVOA 3GY5A 1DUAA 4XBDA 2G55A 1C1MA 3GY2A 4E7NA 1GMCF 4B2BA 2FXRA 1KDQB 3MU8A 1WTGH 4ZMAH 1FY1A 3VGCB 2ZFSA 5L2YH 4A1VA 2CMYA 3H7OA 3ZYEA 1QR3E 3JZ2B 4K8BA 1ANCA 2FODA 5E2OA 3QLPH 3NWUA 4ISLA 2VNTA 1VCQA 1ANDA 2XRCA 3V3MA 3RXOA 1GI8B 3U1IB 3GDUA 2XBWA 1SGDE 4SGAE 1T4UH 1E37B 2YOLA 3P8NA 1MUEB 1IQLA 1BMLA 1RFNA 3T5FH 1O0DH 3M3SA 3B8JA 1C1NA 3ZV8A 1MMJN 3FP7E 3MU0A 3K9XB 4X2YA 2Q6GA 1BT7A 5HXFA 2ZPQA 2ZU4A 1NRPH 3ATKA 2HALA 2BVSH 1RXPA 2ZP0H 1AQ7A 1K9OE 4AGKA 3DFJA 4Y11E