3M7TA

Crystal structure of alpha-lytic protease sb2+3 e8a/r105s mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
ANIVGGIAYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGSTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-lytic protease
publication title Quantifying protein unfolding cooperativity with acid sensitive probes: Interdomain salt bridge contributions to unfolding cooperativity are combined efficiently in alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
total genus 58
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3m7tA01
2AGGX 3KQBA 2VIWA 1C2JA 2K1QA 1LMWB 1BCUH 5DP6A 2ZI2H 1E36B 5DPAA 4KTUA 2A0QB 2VIDA 1NPMA 4UDWH 1UJ1A 2FOEA 2ZU4A 3SV9A 2FLRH 3E90B 3GDUA 1CHOF 1E38B 1O3CA 1SFQB 2BDIA 3FVFB 4K60A 4UFDH 5EXMA 1GHVH 5LPFA 1AO5A 1EB2A 4X6OA 1EQ9A 3BIVH 1WAYB 2QIQA 1HLTH 2GVFA 1O3HA 3BTTE 2G51A 4Z0KA 5EXNA 1SVPA 3WY8A 2B0FA 1DDJA 5FBIA 4FXGH 1C5MD 1GI3A 3FZZA 1HAGE 1K2I1 1RTLA 1OP0A 4MPWA 4RKJB 2IJOB 1P2QA 3DA9B 2AS9A 2GGVB 3RXMA 1GBCA 5FXLA 1EKBB 1K21H 1ABJH 3LGUA 2BD7A 1RIWB 1A5HA 1ARCA 1TMTH 2AIPA 1UTLM 4NIWA 1LO6A 1N8OB 2FOBA 1VCQA 2Q6GA 2A32A 3M5OA 1Y5AT 5EW1H 1Z8JB 3IITA 1GBIA 4M7GA 1EP5A 2I6SA 4JZEH 3SU3A 1UTNA 3EQ0H 2BDCA 4D7FA 1P2MA 2ZC9H 1P57B 1TX7A 1NFWA 1QBVH 2VVCA 3RC6A 3KN2A 2G8TA 1NU9A 2NWNA 5E0GA 1G30B 2ANYA 1TOMH 1Y59T 5FAHA 2A1DB 1WCZA 1IHSH 4Y0ZE 3EA8A 1KYNA 2R2MB 3BG4B 5FPSA 1J17T 6LPRA 1F0RA 4A92A 1O5EH 2FYRA 1QRXA 3SQHE 1TNHA 2BY9X 4FUEA 4VGCC 1FQ3A 1O5GH 2J9NA 2UWLA 3MU4A 3SN8A 2ZGCA 1TBQH 1PPBH 5GXPA 3P95A 1NESE 1SGEE 1G36A 1VZQH 3GCTG 2BB4A 2V0BA 1GGDC 5AFZH 3QLPH 2VWLA 1GHYH 1ZRKA 2HNTC 2ZHWH 1L1GA 5EODA 3U9AH 1XUJA 1C2DA 3MNXA 3VB5A 1AWHB 4HFPB 1SHYA 2BD4A 3GCHB 2BY8X 2XCFA 1GBBA 2R3UA 1EZQA 3A82A 5AHGH 1D6RA 1GJCB 1FPCH 2ZTYA 1MKWH 4YT7H 3VXFH 3H7OA 1V2RT 3NCLA 2IPHA 1GI6A 2ZPSA 2GD4B 1T32A 3KNXA 1ZOMA 1LHCH 1NM6A 4NIYA 1BTPA 4B2AA 1QGFA 1EPTA 1LTOA 4WY3A 3K6YA 1AVWA 2O8MA 1C1RA 3E0PB 3BG8A 3NWUA 1QHRB 2O8UA 4GUXA 5C1YA 1S0RA 4FUFA 4DJZB 1GVLA 2BY6X 3ENSB 1AKSA 1V2WT 3KQEA 3LGYA 3O8CA 3Q3YA 5T3HA 1TX8A 5FCKA 3UUZA 4YOIA 1SB1H 1C1MA 5T6DA 5HYOA 1K1PA 1V2OT 2SGQE 2KAIA 1HAHH 5L30H 2WPHS 5F8TA 2WPIS 8LPRA 1O5AB 1OWJA 1GL0E 1XUHA 4Y8XA 4TY6A 5C67A 1DS2E 1C5NH 2R0LA 1D4PB 1ESTA 4X6PA 1WQSA 3KQDA 4JZ1A 3UFAA 2PUQH 1H9HE 1JBUH 4FVDA 3RXPA 4CRFA 1UTQA 1EZXC 3V12A 3AW0A 3M36A 1TNJA 3LDXH 2NU2E 2ZHFH 3URCA 1H4WA 2BVSH 1DXPA 4KTCA 4RSPA 2HOBA 1S83A 4E7NA 1OYQA 1IQIA 4CR9A 4VGCB 2FX6A 3RXIA 3SJ8A 3PM3A 1HAYB 4ZMAH 2NU0E 3RU4E 2VVVA 1K1JA 3TITA 1MZDA 1ORFA 2WINI 5F03A 3GY6A 1HIAB 3TH4H 1P8VC 1O2GH 5DK1A 1TGTA 1DFPA 3EYDA 4DG4A 1O5BB 1QL8A 4YZUA 4U01A 4F4OC 3OU0A 1C5TA 3TGJE 1T8LA 3E91A 1BTYA 1BTHH 1V2QT 3GY5A 1GHXH 4UFGH 2BHGA 1GHAF 2AFQB 1W7XH 2ZDKA 1C2GA 3UR9A 1RGQA 2A4GA 5DO4H 3BEUA 9ESTA 3FANA 3O8RA 2R2WU 3DT0H 3F9GA 1Z7KA 4AX9H 1O2XA 2BD8A 2ASUB 1KXFA 2FODA 3BTHE 1MUEB 1JXPA 3RXLA 1RRKA 1ZPCA 1PQAA 2PGBB 5GPIB 2PTNA 3BIUH 2PKSC 4WJG2 1PPGE 1IQHA 5TCCA 1TMUH 5A2MH 3A80A 1YP9A 3PWBA 3MU5A 2F9UA 1YPJH 2GP9B 2Y5HA 4UONA 5FBEA 1T4VH 2BDGA 2BY7X 4LZ1H 1GBEA 3E16B 1ZGVA 4A5TS 2ZIQH 5DP4A 2F83A 5EPYA 1UK4A 5T6FA 1W11U 4R0IA 4GSOA 3SGAE 1ID5H 2OLGA 3SJKA 1ZPBA 4Y11E 1G32B 5EU8A 3M7QA 1GJAB 3I77A 3OX7U 1Y5UT 1SLWB 3AAUA 2ZCHP 3U1JB 1V3XA 2H9HA 3ATLA 4YTAA 1C2IA 1SGIB 1FUJA 2R0KA 1GPZA 2ZFRH 3ZZDA 4DW2U 4ABEA 2FOAA 3QO6A 3L3TA 5EXLA 3F68H 3Q3XA 1TOCB 1ZSJA 2F9VA 3SUDA 3U98H 3DHKH 3TIUA 5ESTE 1P2JA 1YLDA 1A46H 1EUFA 3P8NA 1BMLA 1F5RA 1GI7B 2A7JA 3SHAH 1IQMA 1GI9B 4NIVA 3O8DA 4NFFA 2XW9A 3SNCA 1OP2A 2ILNA 4CR5A 3UQOA 2BX4A 4A7IB 4CH8B 6CHAB 1AGJA 1N6YA 4B1TA 4MPVA 2XC5A 3GYMA 2FS8A 2Z3CA 3ZZ7A 1O33A 3NXPA 1SLUB 1CGJE 1UCYK 2XBYA 2FLBH 1LPKB 3ITIA 2RA3A 1HRTH 1NY22 1MMJN 5TCAA 4X2VA 1C1VH 1JIMA 2XBWA 1NRRH 1SGPE 4WH8A 1AN1E 1GJ4H 1SMFE 4B73A 2VIQA 3HK3B 1EPTB 1GVKB 1TFXA 2VGCB 3RUOA 1O3MA 2Z3DA 3BTME 4KKDA 4CH2B 5LPEA 3IWMA 1KXCA 1G9IE 2Q6DA 1KLTA 1F0UA 1C5UA 2ANKH 4IGDA 4NSYA 1HB0B 1AKSB 1V2VT 2BVRH 1DWEH 2XBXA 4I8HA 1J15A 1V2TT 4JK5A 4HGCA 2KAIB 3JZ1B 1U6QA 1GMDF 1WYKA 1O3AA 1GHAG 1XXDA 4WXIA 2Q1JA 2ANWA 2OBOA 1SGRE 1ELGA 2VVUA 1TALA 1YKTA 2CV3A 3TJOA 3UOPA 4ABHA 4O3UA 1F92A 1P3EA 1O3LA 1DPOA 4D9RA 3A88A 2WPKS 2BD9A 4JYUH 3RDZA 1KIGH 2FP7B 3Q3KA 3FAOA 2HNTE 5PTPA 2WV4A 3MNCA 4H6TA 3F9HA 4A1VA 1ARBA 2BXTH 2FPZA 1O37A 1SI5H 3QUMP 3STJA 1C2LA 1PPFE 1TNGA 2PLXA 4JMYA 1GWAA 2CF9H 5LGOA 3MOCA 1LCYA 1YCPM 3RXJA 3ATMA 2ZU2A 1THRH 1LVBA 2OCVB 5EQRA 1EOJA 1UTKA 2BX3A 1G2MA 4CHAC 4BAQB 2J95A 3M5MA 4GHQA 2BD5A 3BTGE 1TGSZ 4UD9H 3L6PA 2A2XH 4FUBA 4NGAH 4JYVH 1A3EH 1L4DA 5DKMA 1DSTA 4H4FA 1SG8B 3GCNA 1TPPA 1O2LA 1HXEH 1O5DH 3QK1A 1DY8A 2Y81A 4J1YA 4U2WA 1NRNH 1C2EA 2PFEA 1YCPH 1Q31A 3SZNA 1O34A 7GCHG 1KLJH 2FI5E 1NN6A 3A83A 3PTNA 1WUNH 2RG3A 3G01A 1ZTKA 5FCRA 1C5VA 4KELA 1KDQA 4GAWA 4YM9A 3T25A 1UTPA 6ESTA 3KF2A 1UCYH 4DOQA 1ZTLA 1B0FA 1D3QB 1PFXC 2HALA 3LGTA 2C8WB 5JDUB 2XTTB 3GY4A 4DIIH 1HJ9A 1BHXF 5JBBS 3OY6U 1SPJA 4K2YA 1LVOA 2XBVA 5EQSA 3SJIA 1K1NA 3B23B 2DE8A 2ZTZA 1P0SH 2Z3EA 4A1XA 4ZXXH 1N8OC 2FX4A 2SGAA 1O2NA 3RMOH 3RXKA 2LNCA 1HJAB 1FPHH 2J38A 1ZMNA 4YT6H 3UIRA 2VB0A 2GZ9A 5EOKA 4KP0A 4NA8A 4X2YA 1TPOA 3ZVGA 1SLXB 4NWLA 1EAWA 2QC2A 1UTMA 4AB8A 3TK6A 2Q6FA 5C2ZA 4ISLA 3QTVH 2ALPA 1G3DA 3W94A 1HV7A 2Z7FE 3EGKH 4FUCA 2TRMA 3TLOA 5E8EH 3BG4C 3SU2A 1ANEA 4BAHB 1RS0A 1C4Y2 4DURA 4I8JA 3Q76A 2AIQA 2OQUA 1KY9A 1CGHA 1E35B 3PTBA 3AVZA 1QL9A 4B71A 2VWOA 4ABIA 1VJ9U 2FWWA 3H5CB 1KLIH 1S6FA 4BAKB 4K69A 1GMDG 2YOLA 1O2HA 4IBLH 3QZRA 2HPPH 3ATWA 5FX6A 3RMLH 3ZZCA 2F3CE 1D6WA 3TGIE 1UHBA 3NUMA 1YPEH 1O3FA 2EI8A 3A7TA 3PMJA 2BMGB 1ZPZA 3ODDA 1F0TA 1HBTH 5DP5A 1FN6A 3TK5A 1XXFA 1ANCA 1GBLA 3GCHC 3U8RH 1O2RA 1LVMA 4XDEA 2Z9IA 1FJSA 1EAXA 1EAUA 1GMCG 3MWIU 2A7HA 2PW8H 1XM1A 1P02A 3E6PH 4NWKA 2O8LA 5G4BA 2BY5X 1MCVA 3SGBE 1LHFH 1QFKH 2EI6A 1AUTC 4ZROA 3TVJB 1M9UA 3RP2A 4AGJA 2A31A 1A4WH 1WSSH 1A1RA 1P3CA 1WBGB 2STBE 5FPTA 2H1UA 4BNRA 5HXFA 4LK4A 2HPQH 3SHCH 4K3JA 4K8BA 4WMDA 4BAOB 1YPKH 1C9PA 1C1PA 2D2DA 3KCGH 2PTCE 4YOGA 3T29A 2HVXA 1OSSA 2SNVA 3ZYDA 2ZGXH 1W0YH 2CF8H 1P2IA 2QAAA 1Q2WA 1ELEE 2H9EH 2AH4X 4K1SA 5EGMA 2Y80A 1GBAA 1YPHC 4YO9A 4TPIZ 1BIOA 1A0LA 5JB9S 2W3KA 1GCDA 4X0WU 5A09A 3UPEA 1TPAE 1TNIA 1QB9A 2OC8A 1THSH 1FY1A 2O9QA 4X8VH 1HGTH 5E2PA 1GBFA 5BPEA 5A0BA 5JBTA 1H9IE 1DXWA 3BTWE 5C3NA 1MTSA 3A89A 2G00A 3ZVAA 2Z6BD 1AFQB 1E37B 3C1KA 3MU8A 2ZFQH 9LPRA 1BTZA 2DE9A 1GCTB 2QCYA 1RXPA 2B8OH 2GZ8A 1UVSH 2EC9H 2ZDNA 1ELFA 3UNQA 1JOUB 1QJ7B 1CT2E 3TJNA 1BQYA 5I25A 2OD3B 1C5XB 3U1IB 1XUIA 1CU1A 3STIA 1GHBF 1Y8TA 5GDSH 4ZKSU 2VH6A 1T31A 5CHAB 4IMZA 1BRBE 3UOUA 1MQ5A 2GT7A 2ZTXA 5HMAA 3BSQA 4IMQA 2Z9GA 1BTUA 1TX6A 1QCPA 1FY4A 3NZIA 3BTFE 2CGAA 3D65E 3SU1A 3RC4A 2O8TA 1CO7E 1FAKH 1T8OA 2XYAA 1SGYE 4HTCH 2A5KA 3PLKA 1INCA 3EA9A 1HYLA 4BTIB 4GVUA 4LXBH 1G2LA 4DCDA 1GMHG 4R8TB 1SGDE 1IQJA 2BVXH 2ZGHA 3SORA 1PPCE 1O2OA 4CBNA 1BMAA 2FTMA 3OSYA 3P70B 2ZCLP 2ZNKH 1ETRH 1JIRA 2BXUH 3BTKE 4OS7A 2WYGA 4AZ2B 4Y76A 3QZQA 4IC6A 1OWIA 1W3CA 1LKAA 4AN7A 1KDQB 1PJPA 3LC3A 5T6GA 4DGJA 4O3TA 1YLCA 3U8OH 1HPGA 1W7GH 3QWCH 4Y8ZA 2VIOA 1C2FA 1HAPH 4Y71A 4XBBA 1IHTH 4X2XA 1O2KA 1S6HA 1C5LH 2A2QH 4WF8A 3LT3A 3M37A 2C4FH 3GISB 1P11E 1P9UA 1A2CH 4JCNA 1OWKA 4ABFA 4THNH 5F6MA 5C5NA 3DD2H 4DT7B 4I8GA 1BBRK 4MLFB 3DUXH 4X2WA 1BHXB 1Y3XA 1C1NA 1K1IA 1QRZA 1HCGA 2ZPRA 5DP7A 3NK8A 4K5ZA 1IQNA 2WUCA 3R0FA 1O2WA 3T5FH 1O3PB 1NO9H 1EB1H 3ZZAA 4AFZA 3O8BA 1L4ZA 1O0DH 1C9TA 3RXBA 1CVWH 4AGKA 2Y5FA 1GJDB 4SGBE 1KXEA 1A0HB 2JKHA 5CE1A 1HDTH 2P95A 4X8UH 3MHWU 2SGEE 3LGWA 4AFUA 1S84A 3A7YA 3ZYEA 2G4UA 3A8DA 7KMEH 4I7YH 1CBWB 4OS1A 1ZJKA 1EATA 1ZYOA 1TYNA 2FO9A 3B8JA 4PROA 5DP8A 2FI3E 1ELCA 2A5IA 1J9CH 3M5LA 3RXEA 1Y5BT 2BDHA 1TRYA 5A0CA 4TPYA 3PWCA 1KTSB 2JH6D 1C1SA 1C5QA 1OS8A 2FM2A 2P3UB 2ZWLH 2UUKB 1YPLH 1UHBB 3ZZBA 3L33A 6CHAC 2BQ7B 1OX1A 1W10U 4Y79A 2SFAA 3ZV8A 4HZHA 2QF0A 2BLVA 2WPMS 2OTVA 4YLUA 2EA3A 3ATIA 1GJ8B 2AYWA 3P8FA 3RXCA 4D7GA 5J4SA 2ZHDA 5SGAE 4B2BA 2BZAA 2ZDMA 3UY9A 1MD8A 1SHHB 1DT2A 5FHTA 3IG6B 1C1OA 1YYY1 1BTWA 2ZQ1A 1TRNA 4ISOA 4DIHH 3SNEA 1AB9B 5EG4A 1GHBG 3MYWA 4GLYA 1KXAA 2W7UA 3BTEE 1BMNH 1EPTC 2VGCC 4X1PU 1K9OE 1GG6B 2ZDLA 1GI5A 2P3TB 3M5NA 1BOQA 1V6DA 3LH3A 3RM2H 1SQOA 2HLCA 1ZHMA 5FX5A 4MTBA 1ZR0A 1LKBA 5E2OA 5A0AE 8GCHF 5HM9A 1W12U 1PPEE 3JZ2B 3S7HB 4SGAE 3OYPA 2AERH 1QJ1B 3MI4A 3MMGA 1O31A 8ESTE 4JZDH 3MH4A 3RLWH 2PV9B 5I46H 1O2TA 1QTFA 4F49A 2TPIZ 1YPMH 1C5YB 1UTOA 2W7SA 1V2JT 2QYIA 2D1JA 4X8SH 1UVPA 1AVGH 2OUAA 4ISHH 4MPXA 2VH0A 1CT0E 2W5EA 1H9LB 4INKA 2QXGA 1O2IA 1ZZZA 1F0SA 1B0EA 5J4QA 3BEFB 3TGKE 1ANBA 1DANH 5A8XA 7GCHF 1KTTB 1GJ5H 1H1BA 4INLA 3VGCB 4DVAU 1ZLRA 4KTSA 1ELAA 2CHAB 2Z9LA 1YBWA 1ZJDA 4JK6A 5CMXH 1BBRH 1AD8H 3RXQA 2A4QA 3RMNH 2W26A 2FYQA 1O3NA 1AE8H 1RFNA 1SOTA 3LGIA 2AGEX 2XC0A 1K28D 5GCHF 1YCPK 3RXHA 4WMFA 4OGXA 1OWEA 1EX3A 1GBKA 3T27A 3P6ZB 3KGPA 1O2JA 1B7XB 1ZSLA 2QY0B 3SI3H 4MNXA 2PUXB 2GKVE 2FZZA 4B74A 3MNBA 3A7XA 1O32A 2C8XB 2B7DH 2THFB 3SJOA 4ZKOU 3ZVCA 3V7TA 1QRWA 1LQEA 4Q80A 4OS4A 1UK3A 2Z9JA 1WTGH 3RXUA 3S9CA 5LH8A 2OINA 2NU1E 1NFXA 2ZU3A 1YPHE 2OC1A 1W8BH 1Y3UA 2XRCA 4AG2A 4B2CA 3PO1B 2STAE 4A6LA 3SOSA 1N1LA 4U32A 2FOMB 3DFJA 4CRCA 4Y8YA 4AG1A 3P17H 3SU6A 3FP7E 1Z1JA 2F9BH 1F7ZA 1WOFA 3HPTB 3ZZ8A 1TRMA 5ETXA 4AFQA 2SNWA 2Z9KA 5A8ZA 2WPJS 1NU7B 5C1UA 1GBMA 2GDEH 2RDLA 2ZDAH 2BQWB 7ESTE 3T26A 4RKOB 2QV1A 3ESTA 4Z6AH 1C5ZB 1TNLA 3RC5A 1EAIA 1TIOA 3GOVB 4Q2KA 5LPRA 2FI4E 8KME2 3VEQB 1T4UH 1A7SA 2SGPE 3QTOH 2J2UA 1NROH 2VJ1A 3TNSA 1ZTJA 1P2NA 1PPHE 5IYTA 1MTNB 3S0NA 1HJAC 1LDTT 5GIBA 1P2KA 1ABIH 1TA2A 3MO9A 3ZZ3A 1KSNA 1AUJA 3M35A 3Q00A 1A61H 1O3KA 2FDAA 4K1EA 4NA7A 1BB0B 5HM2A 1O3BA 3ODFA 1GMCF 1OOKB 4BTTB 1NRQH 4B75A 1EJAA 2QXHA 1WU1A 4ABBA 1MCTA 1JRSA 1TE0A 3V0XA 1ETTH 1SQTA 1V2UT 1W2KH 2C8YB 1E34B 3GDVA 3BF6H 3K65B 5H4IB 3MTYA 3DFLA 3QN7A 1GHWH 2ZKSA 1C1TA 8GCHG 1O3JA 3R3GB 1BJVA 1GI2A 2FIRH 3FZDA 2UWOA 5L6NH 3F9FA 1DWBH 3HGPA 3VB4A 1LHGH 3RXSA 2BOHB 1FDPA 2BOKA 2O8WA 1QY6A 2FESH 2GT8A 3T2NA 1BJUA 2C90B 3LPRA 2GV6A 2ZHQH 3RXGA 1T8NA 1G3CA 1O5CB 1AZ8A 1AFEH 4I32A 3RU4D 1OKXA 4UEHH 1A5GH 2AGIX 2H5DA 4Q7YA 1HXFH 2ZP0H 1TNKA 2QF3A 3GY2A 1O3OA 3UREA 1GI1A 3LU9B 1FY8E 4GHTA 1V2NT 4MNVA 4WVPE 1QNJA 4X6MA 3ZVFA 4BAMB 2VWNA 2BM2A 1XVOA 5AVDA 3T62A 1DICA 1DOJA 2R9PA 3SV8A 4IN2A 1TLDA 2PR3A 5GCHG 1GJ9B 1ELBA 1K22H 2OXSA 1O2MA 1S81A 3BTQE 5GJ4B 1W0ZU 2BDYA 2H2ZA 2FOCA 3A8AA 3SU4A 1NZQH 4J2YB 3V13A 1P10A 2PKAA 1BTXA 3RXAA 2BQ6B 1SGNE 4CREA 1DUEA 1T8MA 1DM4B 1VITF 4FU9A 3SV7A 5ABWA 1A3BH 3PV4A 2ZHEH 4MNYA 3VFEA 1O2VA 1VCWA 3UR6A 3M7UA 1P01A 1GDQA 1EP6A 2BLQA 3S7KB 4AFSA 1QA0A 1VCPA 4ZUHA 4AYVB 1GHZA 1E0FD 4ASHA 1ESBA 3QX5H 1OP8A 1CA8B 1XVMA 1O3EA 2QXIA 1HAZB 2TGAA 1AFQC 2AMPA 1GMHF 2ESTE 2Y7ZA 3ELAH 3FP8E 1GCTC 5EW2H 1V2MT 1TWXB 1QIXB 1UVTH 1GDUA 5BRRE 1XMNB 2QGRA 1LPZB 1V2KT 4ABGA 1DE7H 1ELDE 3M3VA 2RA0A 1FONA 4Q7XA 3ZVBA 1C5PA 5CHAC 1FV9A 4IC5A 4X1RU 1D9IA 5EPNA 3EAJA 2FS9A 4AB9A 1GBDA 1LPGB 1V2LT 4NG9H 1SGQE 1Z71A 1OWDA 1SL3A 2HNTF 2ZG0H 1TPSA 4ABDA 3RXDA 5HGGA 3PLBA 4MQAA 1VJAU 2C93B 1K1LA 1RJXB 4FUDA 1L2EA 3URDA 3TNTA 1BBRE 5K0HA 1O36A 1VGCB 5AF9H 2DUCA 2ULLA 2ZFSA 2C3SA 1SGFA 3A86A 3H7TA 1NFUA 2XNIA 2P8OB 1DVAH 1Z8IB 2FMJA 5IDKA 3A7VA 3GY8A 2P94A 5DG6A 1MAYA 2BTCE 3A8BA 1NRPH 2PHBA 1P05A 2CN0H 1XUKA 4UE7H 1YPGH 3SQEE 1AIXH 1NT1A 1QA7A 1SC8U 4TWWA 2D26C 3QGNB 1CA0B 3VB7A 1C5WB 2GCHF 1PPZA 4QT8C 1GBTA 2BLOA 3LJOA 3UWJH 3GDSA 2Y6TA 4YESB 3MH7A 4YLQH 4RN6A 1D3DB 3CENA 4HI3A 1DWDH 2BDBA 2HWLB 3A81A 1C2KA 1ZGIA 5AFYH 3M3TA 1N6XA 4NSVA 4WMEA 2GMTB 1OYTH 1SR5C 4TY7A 1HAIH 1L1NA 1W13U 1UMAH 4NA9H 1FZZA 2WYJA 1RD3B 3TK9A 1QL7A 2WUBA 3U69H 4ZHLU 4O97A 1HJ8A 4INHA 1ZHPA 4IW4E 4A1TA 2IOTA 1THPB 2GCTB 2YNAA 2ZFPH 1BRUP 3AW1A 4H42U 1NTPA 3SJ9A 4U30A 3TU7H 5E0HA 1QURH 1MU6B 1AVXA 2SGFE 1AHTH 1O3DA 1XUFA 3A7WA 4BXWA 1K1OA 4YOJA 2HRVA 2GTBA 1QBNA 3BN9A 1V2ST 4FVBA 4DY7B 3SGQE 4BANB 2F9OA 1GJ6A 3BTDE 3TPIZ 1Q3XA 1TBZH 3VPKA 2ZPQA 3MFJA 5GWZA 2TIOA 2VIVA 1CBWC 1MQ6A 3KEEA 1VITG 3HGNA 1O3IA 4ZKNU 1XKBC 4CRDA 3UNRA 4X1QU 4O9VA 4B76A 3FP6E 4MDSA 1Z8GA 2JETB 4TYDA 3VB6A 1CQQA 2G81E 4CRBA 2Y82A 4BXSA 3PMAB 4E05H 1GL1A 3LGVA 1GI4A 1TGNA 2A4RA 3D49H 3E1XB 2VWMA 4GCHF 3ZV9A 2FTLE 2ANMH 2G4TA 1BUIA 1D3PB 3P8GA 1VITH 1C5SA 1TAWA 1C4U2 4XBDA 4JZIA 1JMOH 4OS2A 5B6OA 1CGIE 1MKXK 3SW2B 1FIZA 2W3IA 2BLWA 2WV5A 2FOHA 3M7TA 2AMDA 3K2UA 1SOZA 3M3SA 4NZQA 4D8NA 1SGCA 1AB9C 2F9PA 2XCNA 1F2SE 5C20A 3RU4T 1C1UH 3MO6A 1GG6C 4E7RG 6GCHF 4AYYB 2D8WA 1EZSC 2ZU1A 3RXRA 4NZLA 4CBOA 3CS0A 2CMYA 1SGFG 1MZAA 1GBJA 2LPRA 3EA7A 2ZEBA 1O2UA 2EEKA 1EJNA 1F5KU 4X1NU 1MBQA 1SLVB 2CXVA 2PKAB 1EZUC 2V35A 3PB1E 3PMHB 1O2PA 1SQAA 1UCYE 5JB8S 3K6ZA 4XBCA 2ODQA 5C5OA 1SFIA 2OC0A 3RLYH 1FI8A 4FUHA 1EJMA 1PYTD 2G5NA 1G3BA 4Y10E 1NFYA 3HK6B 4H6SB 3PROA 2GCHG 2VINA 1MU8B 2P16A 1CHOG 1TQ7B 5DJ7A 1BA8B 1P12E 3V3MA 3S69A 1IOEA 4K1TA 1GDNA 1YGCH 3RXTA 4MVNA 2BD2A 3ZZ4A 2VNTA 1KXDA 5F8XA 2F9NA 3VGCC 4MPUA 4CRAA 2XWAA 2CHAC 2OP9A 1TA6A 3SU0A 1GVZA 1PYTC 2J92A 1TMBH 3K9XB 5ESBA 3MU1A 2TGDA 4X6NA 4XOJA 2BD3A 4O03A 2GV7A 2UUJB 1TONA 3T28A 1ZHRA 1TBRH 3P92A 1DWCH 3F1SB 3E3TA 3ZZ5A 1W14U 1DLEA 2ZZUH 1GGDB 2ODYB 5DP3A 3F6UH 1SSXA 4ZKRU 4FUJA 3ZZ6A 4ISNA 3Q77A 1G3EA 1ZMJA 1WV7H 1RTFB 1CSOE 1LQDB 3PO1C 2BZ6H 3U8TH 1LHDH 1HAVA 3D23A 4IS5A 3UTUH 4X1SU 1QB1A 3PYHA 4K8YA 4Y0YE 4BOHA 1UO6A 3S9BA 1FAXA 1XUGA 1IQKA 1AWFH 1MKXH 1V2PT 1AY6H 2B9LA 2ZFTA 4KGAA 4D9QA 3I29A 1NC6A 1F5LA 3W95A 1QB6A 3RXFA 1S85A 5JYIA 4GCHG 1P9SA 2M5TA 4E06H 2YNBA 3MO3A 1ZMLA 2VIPA 2CJIA 3SO3A 2JH0D 1OPHB 2P93A 4I31A 3RMMH 1O2YA 1PQ7A 2JH5D 2WPLS 3EDXB 1K1MA 1MTNC 3SUFA 4D76A 3SUGA 1BMMH 1MAXA 3MH6A 1NRSH 3M61U 1GI0A 2GZ7A 4Q7ZA 3LOXA 1FY3A 3P8OA 1O5FH 1DY9A 6GCHG 3ZVDA 3SNBA 1T7CA 1XKAC 2A4OA 3ATKA 2XC4A 2H6MA 2RCEA 1FNIA 1IQLA 1BDAA 5A8YA 1BRCE 5L2ZH 2R3YA 1UK2A 5DGJA 1GBHA 1S5SA 2QA9E 1GJ7B 1DSUA 1HAXB 3SNDA 3C27B 2PWXA 3SNAA 3VXEH 2ZCKP 3GY7A 1O2QA 1P04A 2G52A 3F9EA 2SGDE 3BEIB 1BITA 3TH3H 4GPGA 1AZZA 2BDAA 3RXOA 5JBCS 1MD7A 1P09A 2G5VA 1J8AA 1TGBA 2ZU5A 3KL6A 2AMQA 1HFDA 3TH2H 1Y3YA 2QN5T 1UVOA 4OS6A 3QGJA 1TABE 3OY5U 1ETSH 1AMHA 3PLPA 1KXBA 2XWBI 4I8LA 1GI8B 4NIXA 3HATH 3FFGA 1C2HA 3LKWA 1SGTA 2TGPZ 4XFQA 1QQ4A 2F91A 1S82A 2GX4A 2PSYA 2FXRA 1VR1H 1C1WH 2HGTH 3E8LA 2ZQ2A 1JWTA 1LVYA 3LONA 1FLEE 1ACBE 5FPYA 3SBKA 3UNSA 1CHGA 1ESAA 3TJVA 2PKSB 5E0JA 4LZ4B 2A5AA 4FU7A 1J14A 4OGYA 3AAVA 3GICB 1FN8A 1MH0A 2OBQA 1JRTA 3KIDU 3KHVA 1B5GH 1QQUA 1MTVA 1RTKA 3EE0B 1QBOA 4FUIA 4AOQA 5EQQA 1BT7A 1HAOH 4NFEA 1ELTA 1Y3VA 2Z94A 2UWPA 2G55A 2V6NA 2PSXA 4ZH8A 1SBWA 1YF4A 3A84A 3LIWA 1Z6JH 3E0NB 1PQ8A 5L2YH 1TB6H 1A5IA 1ZRBA 1TGCA 2P3FH 1EOLA 2V3OH 3LH1A 4MNWA 1XX9A 3SU5A 3RM0H 2QXJA 1J16A 5TJXA 1HUTH 3VB3A 3A8CA 4UFFH 5JPMH 3MNSA 1QJ6B 1P03A 1EASA 1FIWA 2FOFA 5F8ZA 3LC5A 5C1XA 3UQVA 4FUGA 3SUEA 2ZECA 1O38A 1X7AC 5K7RA 2NU4E 1IAUA 1MTUA 1L1JA 1BRAA 4NCYA 2AEIH 1HNEE 1H8DH 3GYLB 3HKJB 3B9FH 1ELVA 1H8IH 1O30A 1G37A 1WTHD 2VU8E 4MG3A 4ABJA 1C4V2 4ZHAA 4JZFH 3SI4H 2BYAX 1D3TB 1VGCC 3SV6A 3NKKA 3S9AA 1AQ7A 4Y7AA 3HKIB 5JBAS 1CE5A 2OQ5A 1NS3A 1MBMA 1C2MA 2ODPA 2P8OC 2ZF0H 2ZA5A 1A0JA 2Y5GA 4WWYA 2V3HH 1FMGA 1C5OH 2UUYA 4OS5A 4ZHMU 4Y7BA 1MTWA 3KQCA 1CA0C 1O3GA 2OC7A 4I33A 1HAVB 1YC0A 1P2OA 1QR3E 1UTJA 2A45B 1DUAA 3QDZB 2EI7A 2J4IA 3NPSA 1DITH 2ZGBH 3A87A 2ZGJA 1C1QA 3A85A 3ZZ9A 3I78A 4TWYA 1O39A 2P59A 2GMTC 4XE4A 4ZXYH 1FXYA 1GJBB 1P06A 1LHEH 4WH6A 2H9TH 2B5TB 1O2SA 1OXGA 3UWIA 1Z6EA 4ESTE 2J94A 3GCOA 4I8KA 3OTJE 4ABAA 1L0ZA 1DLKB 2IN2A 1IQFA 1YM0A 3AASA 2FOGA 4AORA 5DP9A 4UFEH 3GY3A 1O35A 2ALVA 1FY5A 2J34A 1RIWC 1Z1IA 2GCTC 1CT4E 3CS7A 2NU3E 2TGTA 3GCTF 2ZO3H 4LOYH 2GDDA 2H5CA 1UVUH 1S0QA 2PGQB 4BTUB 1Z8RA 3TJUA 1TQ0B 1AE5A 4JYTA 3SV2H 7LPRA 4XSKU 1ANDA 3MU0A 3CP7A 1O2ZA 4IN1A 1AU8A 1IQEA 2ZDVH 1PQ5A 1DX5M 1BZXE 2C8ZB 3N7OA 2UUFB 3D62A 3A7ZA 3ZVEA 1OWHA 4X8TH 4CRGA 2XXLA 1C5RA 3RXVA 3MH5A 2ZFFH 1ZSKA 2A7CA 2Y7XA 4ZAEA 4Y6DA 1HIAA 4WXVA 1WQVH 3PMBB 4ISIH 2JETC 1MKWK 4FU8A 2I6QA 1EXFA 2FEQH 3LJJA 3BV9B 1Y3WA 1IQGA 2TBSA 4CHAB 1AI8H
chains in the Genus database with same CATH superfamily
2AGGX 3KQBA 2VIWA 1C2JA 2K1QA 1LMWB 1BCUH 5DP6A 2ZI2H 1E36B 5DPAA 4KTUA 2A0QB 2VIDA 1NPMA 4UDWH 1UJ1A 2FOEA 2ZU4A 3SV9A 2M2AA 3OE7D 2FLRH 3E90B 3GDUA 1CHOF 1E38B 1O3CA 1SFQB 2BDIA 3FVFB 4K60A 4UFDH 5EXMA 1GHVH 5LPFA 1AO5A 1EB2A 4X6OA 1EQ9A 3BIVH 1WAYB 2QIQA 1HLTH 2GVFA 1O3HA 3BTTE 2G51A 4Z0KA 5EXNA 1SVPA 3WY8A 2B0FA 1DDJA 2QF5A 4FXGH 5FBIA 1C5MD 3PV5A 1GI3A 3FZZA 1HAGE 1K2I1 1RTLA 1OP0A 4MPWA 4RKJB 2IJOB 1P2QA 3DA9B 2AS9A 2GGVB 3RXMA 1GBCA 5FXLA 1EKBB 1K21H 1ABJH 2OK5A 3LGUA 2BD7A 1RIWB 1A5HA 1ARCA 1TMTH 2AIPA 1UTLM 4NIWA 1LO6A 1N8OB 2FOBA 1VCQA 2Q6GA 2A32A 3M5OA 1Y5AT 5EW1H 1Z8JB 3IITA 1GBIA 4M7GA 3F3BA 1EP5A 2I6SA 4JZEH 3SU3A 1UTNA 3EQ0H 2BDCA 4D7FA 1P2MA 2ZC9H 1P57B 1TX7A 1NFWA 1QBVH 1W0KD 2VVCA 3RC6A 3KN2A 2G8TA 1NU9A 2NWNA 5E0GA 3OTPA 1G30B 2ANYA 1TOMH 1Y59T 5FAHA 2A1DB 1WCZA 1IHSH 4Y0ZE 3EA8A 1KYNA 2R2MB 3BG4B 5FPSA 1J17T 6LPRA 1F0RA 4A92A 1O5EH 2FYRA 1QRXA 5KEDA 3SQHE 1TNHA 2BY9X 4FUEA 4VGCC 1FQ3A 1O5GH 2J9NA 2EY4C 2UWLA 3MU4A 3SN8A 2ZGCA 1TBQH 1PPBH 5GXPA 3P95A 1NESE 1SGEE 1G36A 1VZQH 3GCTG 2BB4A 2V0BA 4F55A 1GGDC 5AFZH 3QLPH 2VWLA 1GHYH 1ZRKA 2HNTC 2ZHWH 1L1GA 5EODA 3U9AH 1XUJA 1C2DA 3MNXA 3VB5A 1AWHB 4HFPB 1SHYA 2BD4A 3GCHB 2BY8X 2XCFA 1GBBA 2R3UA 1EZQA 3A82A 3FOAA 1D6RA 5AHGH 1GJCB 1FPCH 2ZTYA 1MKWH 4YT7H 3VXFH 3H7OA 1V2RT 3NCLA 2IPHA 1GI6A 2ZPSA 2GD4B 1T32A 3KNXA 1ZOMA 1LHCH 1NM6A 4NIYA 1BTPA 4B2AA 1QGFA 1EPTA 1LTOA 4WY3A 3K6YA 1AVWA 2O8MA 1C1RA 3E0PB 3BG8A 3NWUA 1QHRB 2O8UA 4GUXA 5C1YA 1S0RA 4FUFA 4DJZB 1GVLA 2BY6X 3ENSB 1AKSA 1V2WT 3KQEA 3LGYA 3O8CA 3Q3YA 5T3HA 4HG6A 1TX8A 5FCKA 3UUZA 4YOIA 2QF4A 1QZ8A 1SB1H 1C1MA 5T6DA 5HYOA 1K1PA 1V2OT 2SGQE 2KAIA 1HAHH 5L30H 2WPHS 5F8TA 2WPIS 8LPRA 1O5AB 1OWJA 1GL0E 1XUHA 4Y8XA 4TY6A 5C67A 1DS2E 1C5NH 2R0LA 1D4PB 1ESTA 4X6PA 1WQSA 3KQDA 4JZ1A 2KCPA 3UFAA 2PUQH 1H9HE 1JBUH 4FVDA 3RXPA 4CRFA 1UTQA 1EZXC 3V12A 3AW0A 3M36A 1TNJA 3LDXH 2NU2E 2ZHFH 3URCA 1H4WA 5HKKD 2BVSH 1DXPA 4KTCA 4RSPA 2HOBA 1S83A 4E7NA 3DSOA 1OYQA 1IQIA 4CR9A 4VGCB 2FX6A 3RXIA 3SJ8A 3PM3A 1HAYB 4ZMAH 2NU0E 3RU4E 2VVVA 1K1JA 3TITA 1MZDA 1NBMD 1ORFA 2WINI 5F03A 3GY6A 1HIAB 3TH4H 1P8VC 1O2GH 5DK1A 1TGTA 1DFPA 3EYDA 4DG4A 1O5BB 1QL8A 4YZUA 4U01A 4F4OC 3OU0A 1C5TA 3TGJE 1T8LA 3OAAD 3E91A 1BTYA 1BTHH 1V2QT 3GY5A 1GHXH 4UFGH 5B6LA 2BHGA 1GHAF 2AFQB 1W7XH 2ZDKA 1C2GA 2JJ1D 2W6JD 3UR9A 1RGQA 2A4GA 5DO4H 3BEUA 9ESTA 3FANA 3O8RA 2R2WU 3DT0H 3F9GA 2KR7A 1Z7KA 4AX9H 1O2XA 2BD8A 2ASUB 1KXFA 2FODA 3BTHE 1MUEB 1JXPA 1W0JD 3RXLA 1RRKA 1ZPCA 1PQAA 2PGBB 5GPIB 2PTNA 3BIUH 2PKSC 4WJG2 1PPGE 4M9FA 1IQHA 5TCCA 1TMUH 5A2MH 3A80A 1YP9A 3PWBA 3MU5A 2F9UA 1YPJH 2GP9B 2Y5HA 4UONA 5FBEA 1T4VH 2BDGA 2HLDD 2BY7X 4LZ1H 1GBEA 3E16B 1ZGVA 4A5TS 2ZIQH 5DP4A 2F83A 5EPYA 1UK4A 5T6FA 1W11U 4R0IA 2LP6A 4GSOA 2KCAA 3SGAE 1ID5H 2OLGA 3SJKA 1ZPBA 4Y11E 1G32B 5EU8A 3M7QA 1GJAB 3I77A 3OX7U 1Y5UT 1SLWB 3AAUA 2ZCHP 3N7EA 3U1JB 1V3XA 3F0OA 2H9HA 3ATLA 4Q63A 4YTAA 1C2IA 1SGIB 1FUJA 2R0KA 1GPZA 2ZFRH 3ZZDA 4DW2U 4ABEA 2FOAA 3QO6A 3L3TA 2V7QD 5EXLA 3F68H 3Q3XA 1TOCB 1ZSJA 2F9VA 3SUDA 3U98H 3DHKH 3TIUA 5ESTE 1P2JA 1YLDA 1A46H 1EUFA 3P8NA 1BMLA 2YMSD 3PV2A 1F5RA 1GI7B 2A7JA 3SHAH 1IQMA 1GI9B 4NIVA 3O8DA 4NFFA 2XW9A 3SNCA 1OP2A 2ILNA 4CR5A 3UQOA 2BX4A 4A7IB 4CH8B 6CHAB 3N99A 1AGJA 1N6YA 5C17A 4B1TA 4MPVA 2XC5A 3GYMA 2FS8A 2Z3CA 3ZZ7A 1O33A 3NXPA 1SLUB 1CGJE 2K0QA 1UCYK 2XBYA 2FLBH 1LPKB 3ITIA 2RA3A 1HRTH 1NY22 1MMJN 5TCAA 4X2VA 1C1VH 1JIMA 2XBWA 3F2FA 1NRRH 1SGPE 4WH8A 1AN1E 1GJ4H 1SMFE 4B73A 2VIQA 3HK3B 1EPTB 1GVKB 1TFXA 2VGCB 3RUOA 1O3MA 2Z3DA 3BTME 4KKDA 4CH2B 5LPEA 3IWMA 1KXCA 1G9IE 2Q6DA 1KLTA 2KFWA 1F0UA 1C5UA 2ANKH 4IGDA 4NSYA 1HB0B 1AKSB 1V2VT 2BVRH 1DWEH 5DN6D 2XBXA 4I8HA 1J15A 1V2TT 4JK5A 4HGCA 2KAIB 3JZ1B 1U6QA 4ACBA 1GMDF 1WYKA 1O3AA 1GHAG 1XXDA 4WXIA 2Q1JA 2ANWA 2OBOA 1SGRE 1ELGA 2VVUA 1TALA 1YKTA 2CV3A 3TJOA 3UOPA 4ABHA 4O3UA 1F92A 1P3EA 1O3LA 1DPOA 4D9RA 3A88A 2WPKS 2BD9A 4JYUH 5C94A 3RDZA 1KIGH 2FP7B 3Q3KA 3FAOA 2HNTE 5PTPA 2WV4A 3MNCA 2WHXA 4H6TA 3F9HA 4A1VA 1ARBA 2BXTH 2FPZA 1O37A 1SI5H 3QUMP 3STJA 1C2LA 1PPFE 1TNGA 2PLXA 4JMYA 1GWAA 2CF9H 5LGOA 3MOCA 1LCYA 1YCPM 3RXJA 3ATMA 2ZU2A 1THRH 4FOUC 1LVBA 2OCVB 5EQRA 1EOJA 1UTKA 2BX3A 1G2MA 4CHAC 4BAQB 2J95A 3M5MA 4GHQA 2BD5A 2YMSB 3BTGE 1TGSZ 2JIZD 4UD9H 3L6PA 2A2XH 4FUBA 4NGAH 4JYVH 1A3EH 1L4DA 5DKMA 1DSTA 4H4FA 1SG8B 3GCNA 1TPPA 1VKYA 1O2LA 1HXEH 1O5DH 3QK1A 1DY8A 2Y81A 4J1YA 4U2WA 1NRNH 2JJ2D 1C2EA 2PFEA 1YCPH 1Q31A 3SZNA 1O34A 7GCHG 1KLJH 2FI5E 1NN6A 3A83A 3PTNA 1WUNH 3N7DA 2RG3A 3G01A 1ZTKA 5FCRA 1C5VA 4KELA 1KDQA 4GAWA 2EQNA 2WZQA 4YM9A 3T25A 1UTPA 6ESTA 3KF2A 2J97A 1UCYH 4DOQA 1ZTLA 1B0FA 1D3QB 1PFXC 2HALA 3LGTA 2C8WB 5JDUB 2XTTB 3GY4A 4DIIH 1HJ9A 1BHXF 5JBBS 3OY6U 1SPJA 4K2YA 1LVOA 2XBVA 5EQSA 3SJIA 1K1NA 3B23B 2DE8A 2ZTZA 1P0SH 2Z3EA 4A1XA 4ZXXH 1N8OC 2FX4A 2SGAA 1O2NA 3RMOH 3RXKA 2LNCA 1HJAB 1FPHH 2J38A 1ZMNA 4YT6H 3UIRA 2VB0A 2GZ9A 5EOKA 4KP0A 4NA8A 4X2YA 1TPOA 3ZVGA 1SLXB 4NWLA 1EAWA 2QC2A 1UTMA 4AB8A 3TK6A 2Q6FA 5C2ZA 4ISLA 3QTVH 2ALPA 1G3DA 3W94A 1HV7A 3F2HA 2Z7FE 3EGKH 4FUCA 2TRMA 3TLOA 1NBME 5E8EH 3BG4C 3SU2A 1ANEA 4BAHB 1RS0A 1C4Y2 1K0HA 4DURA 4I8JA 3Q76A 2AIQA 2OQUA 1KY9A 1CGHA 1E35B 3PTBA 3AVZA 1QL9A 4B71A 2VWOA 4ABIA 1VJ9U 2FWWA 3H5CB 1KLIH 1S6FA 4BAKB 4K69A 1GMDG 2YOLA 1O2HA 4IBLH 3QZRA 2HPPH 3ATWA 3CNRA 5FX6A 3RMLH 3ZZCA 5EIYA 2F3CE 1D6WA 3TGIE 1UHBA 3NUMA 1YPEH 1O3FA 2EI8A 3A7TA 3PMJA 2BMGB 1ZPZA 3ODDA 1F0TA 1HBTH 5DP5A 1FN6A 3TK5A 1XXFA 1ANCA 1GBLA 3GCHC 3U8RH 1O2RA 1LVMA 4XDEA 2Z9IA 1FJSA 1EAXA 1EAUA 1GMCG 3KYGA 3MWIU 2A7HA 2PW8H 1XM1A 1P02A 3E6PH 4NWKA 2O8LA 5G4BA 2BY5X 1MCVA 3SGBE 1LHFH 1QFKH 2EI6A 1AUTC 4ZROA 3TVJB 1M9UA 3RP2A 4AGJA 2A31A 1A4WH 1WSSH 1A1RA 1P3CA 1WBGB 2STBE 5FPTA 2H1UA 4BNRA 5HXFA 4LK4A 2HPQH 3SHCH 4K3JA 4K8BA 4WMDA 4BAOB 1YPKH 3SZEA 1C9PA 1C1PA 2D2DA 3KCGH 2PTCE 4YOGA 3T29A 2HVXA 1OSSA 2SNVA 3ZYDA 2ZGXH 1W0YH 2CF8H 1P2IA 2QAAA 1Q2WA 1ELEE 2H9EH 2AH4X 4K1SA 5EGMA 2Y80A 1GBAA 1YPHC 4YO9A 4TPIZ 1BIOA 1A0LA 5JB9S 2W3KA 1GCDA 4X0WU 5A09A 3F2GA 3UPEA 1TPAE 1TNIA 1QB9A 2OC8A 1H8HD 1THSH 1FY1A 2O9QA 4X8VH 1HGTH 5E2PA 1GBFA 5BPEA 5A0BA 5JBTA 1H9IE 4F48B 1DXWA 3BTWE 5C3NA 1MTSA 3A89A 2G00A 3ZVAA 2Z6BD 1AFQB 1E37B 3C1KA 3MU8A 2ZFQH 4ZCNA 9LPRA 1BTZA 2DE9A 1GCTB 2QCYA 1RXPA 2B8OH 2GZ8A 3OEHD 1UVSH 2EC9H 2ZDNA 1ELFA 3UNQA 1JOUB 1QJ7B 1CT2E 3TJNA 1BQYA 5I25A 2OD3B 1C5XB 3U1IB 1XUIA 1CU1A 3STIA 1UW7A 1GHBF 1Y8TA 5GDSH 4ZKSU 2VH6A 1T31A 5CHAB 4IMZA 1BRBE 3UOUA 4XRNA 1MQ5A 2GT7A 2ZTXA 5HMAA 3BSQA 4IMQA 2Z9GA 1BTUA 1TX6A 1QCPA 4RT0A 1FY4A 3NZIA 3BTFE 2CGAA 3D65E 3SU1A 3RC4A 2O8TA 1CO7E 1FAKH 1T8OA 2XYAA 1SGYE 4HTCH 2A5KA 3PLKA 1INCA 3EA9A 5DSFA 1HYLA 4BTIB 4GVUA 4LXBH 1G2LA 1OHHD 4DCDA 1GMHG 4R8TB 1SGDE 1IQJA 2BVXH 2ZGHA 3SORA 3WWBA 1PPCE 1O2OA 4CBNA 1BMAA 2FTMA 3OSYA 3P70B 2ZCLP 2ZNKH 1ETRH 1JIRA 2BXUH 3BTKE 4OS7A 2WYGA 2IPQX 4AZ2B 4Y76A 3QZQA 1FX0B 4IC6A 1OWIA 5CHBA 1W3CA 1LKAA 4AN7A 1KDQB 1PJPA 3LC3A 5T6GA 4DGJA 4O3TA 1YLCA 3U8OH 1HPGA 1W7GH 3QWCH 4Y8ZA 2VIOA 1C2FA 1HAPH 4Y71A 4XBBA 1IHTH 4X2XA 1O2KA 1S6HA 1C5LH 2A2QH 4WF8A 3LT3A 3M37A 2C4FH 3GISB 1P11E 1P9UA 1A2CH 4JCNA 1OWKA 4ABFA 4THNH 2RDEA 5F6MA 5C5NA 3DD2H 4DT7B 4I8GA 1BBRK 2CK3D 4MLFB 3DUXH 4X2WA 1BHXB 1Y3XA 1C1NA 1K1IA 1QRZA 1HCGA 2ZPRA 5DP7A 3NK8A 4K5ZA 1IQNA 2WUCA 3R0FA 1O2WA 3T5FH 1O3PB 1NO9H 1EB1H 4P02A 3ZZAA 4AFZA 3O8BA 3MQKC 1L4ZA 1O0DH 1C9TA 3RXBA 1CVWH 4AGKA 2Y5FA 1GJDB 4SGBE 1KXEA 1A0HB 2JKHA 5CE1A 1HDTH 2P95A 4X8UH 3MHWU 2SGEE 3LGWA 4AFUA 1S84A 3A7YA 3ZYEA 2G4UA 3A8DA 7KMEH 4I7YH 1CBWB 4OS1A 1ZJKA 1EATA 1ZYOA 1TYNA 2FO9A 3B8JA 4PROA 5DP8A 2FI3E 1ELCA 2A5IA 1J9CH 3M5LA 3RXEA 5GNDA 1Y5BT 2BDHA 1TRYA 5A0CA 4TPYA 3PWCA 1KTSB 2JH6D 1C1SA 1C5QA 1OS8A 2FM2A 2P3UB 2ZWLH 2UUKB 1YPLH 1UHBB 3ZZBA 3L33A 6CHAC 2BQ7B 1OX1A 1W10U 4Y79A 2SFAA 3ZV8A 4HZHA 2QF0A 2BLVA 4TSFD 2WPMS 2OTVA 4YLUA 2EA3A 3ATIA 5HIZA 1GJ8B 2AYWA 3P8FA 3RXCA 4D7GA 5J4SA 2ZHDA 5SGAE 4B2BA 2BZAA 2ZDMA 3UY9A 1MD8A 1SHHB 1DT2A 5FHTA 3IG6B 1C1OA 3UB0A 1YYY1 1BTWA 2ZQ1A 1TRNA 3SYJA 4ISOA 4DIHH 3SNEA 1AB9B 5EG4A 1GHBG 3MYWA 4GLYA 1KXAA 2W7UA 3BTEE 1BMNH 1EPTC 2VGCC 4X1PU 1K9OE 1GG6B 2ZDLA 1GI5A 2P3TB 3M5NA 1BOQA 1V6DA 3LH3A 3RM2H 1SQOA 2HLCA 1ZHMA 5FX5A 4MTBA 1ZR0A 1LKBA 5E2OA 5A0AE 8GCHF 5HM9A 1W12U 1PPEE 3JZ2B 3S7HB 4SGAE 3OYPA 2AERH 1QJ1B 3MI4A 3MMGA 1O31A 2QE7D 8ESTE 4JZDH 3MH4A 3RLWH 2PV9B 5I46H 1O2TA 1QTFA 4F49A 2TPIZ 1YPMH 1C5YB 1UTOA 2W7SA 1V2JT 2QYIA 2D1JA 4X8SH 5F53A 1UVPA 1AVGH 2OUAA 1E79D 4ISHH 4MPXA 2VH0A 1CT0E 1YWUA 2W5EA 1H9LB 4INKA 1YLNA 2QXGA 1O2IA 1ZZZA 1F0SA 1B0EA 2IJD1 5J4QA 3BEFB 3TGKE 1ANBA 1DANH 5A8XA 7GCHF 1KTTB 1GJ5H 1H1BA 4INLA 3VGCB 4DVAU 1ZLRA 4KTSA 1ELAA 2CHAB 2Z9LA 1YBWA 1ZJDA 4JK6A 5CMXH 1BBRH 1AD8H 3RXQA 2A4QA 3RMNH 2W26A 2FYQA 1O3NA 1AE8H 1RFNA 1SOTA 3LGIA 2AGEX 2KCYA 1K28D 2XC0A 1YCPK 5GCHF 4WMFA 3RXHA 4OGXA 1OWEA 1EX3A 1GBKA 3T27A 3P6ZB 2L74A 1O2JA 3KGPA 1B7XB 1ZSLA 2QY0B 3SI3H 3PRBA 4MNXA 2PUXB 2GKVE 2FZZA 4B74A 3MNBA 3A7XA 1O32A 2C8XB 2B7DH 2THFB 3SJOA 4ZKOU 2YMSC 3V7TA 3ZVCA 1QRWA 1LQEA 4Q80A 2KM0A 4OS4A 1UK3A 2Z9JA 1WTGH 3RXUA 3S9CA 5LH8A 2OINA 3PRDA 2NU1E 1NFXA 2ZU3A 1YPHE 2K8IA 2OC1A 1W8BH 1Y3UA 2XRCA 4AG2A 4B2CA 3PO1B 2STAE 4A6LA 3SOSA 1N1LA 4U32A 2FOMB 3DFJA 4CRCA 4Y8YA 4AG1A 3ZIAD 3P17H 3SU6A 3FP7E 1Z1JA 2F9BH 3DCLA 1F7ZA 1WOFA 3HPTB 3ZZ8A 1TRMA 5ETXA 4AFQA 2SNWA 2Z9KA 5A8ZA 2WPJS 4P00A 1NU7B 5C1UA 1GBMA 2GDEH 2RDLA 2ZDAH 2BQWB 7ESTE 3T26A 4RKOB 2QV1A 3ESTA 4Z6AH 1C5ZB 1TNLA 3RC5A 1EAIA 1TIOA 3GOVB 4Q2KA 5LPRA 2FI4E 8KME2 3VEQB 1T4UH 1A7SA 2SGPE 3QTOH 2J2UA 1NROH 2VJ1A 3TNSA 2V3MA 1ZTJA 1P2NA 1PPHE 5IYTA 1MTNB 3S0NA 1HJAC 1LDTT 5GIBA 1P2KA 1ABIH 1TA2A 3MO9A 3ZZ3A 1KSNA 1AUJA 3M35A 3Q00A 1A61H 3WWFA 1O3KA 2FDAA 4K1EA 4NA7A 1BB0B 5HM2A 1O3BA 3ODFA 1GMCF 1OOKB 4BTTB 1NRQH 4B75A 5FL7D 1EJAA 2QXHA 1WU1A 4ABBA 1MCTA 1JRSA 1TE0A 3V0XA 1ETTH 1SQTA 1V2UT 1W2KH 2C8YB 1E34B 3GDVA 3BF6H 3K65B 5H4IB 3MTYA 3DFLA 3QN7A 3DSGA 1GHWH 2ZKSA 1C1TA 8GCHG 1O3JA 3R3GB 1BJVA 1GI2A 2FIRH 3FZDA 2UWOA 5L6NH 3F9FA 1DWBH 3HGPA 2J5UA 3VB4A 1LHGH 3RXSA 2BOHB 1FDPA 2BOKA 1SKYE 2O8WA 1QY6A 2FESH 2GT8A 3T2NA 1BJUA 2C90B 3LPRA 2GV6A 2ZHQH 3RXGA 1T8NA 1G3CA 1O5CB 1AZ8A 3OFND 1AFEH 2GJGA 4I32A 3RU4D 1OKXA 2HVYB 4UEHH 1A5GH 2AGIX 2H5DA 1EFRD 1HXFH 4Q7YA 2ZP0H 1TNKA 2QF3A 3GY2A 1O3OA 3UREA 4OM9A 1GI1A 3LU9B 1FY8E 4GHTA 3AK5A 1V2NT 4MNVA 4WVPE 1QNJA 4X6MA 3ZVFA 2J98A 4BAMB 2VWNA 2BM2A 1XVOA 5AVDA 3T62A 1DICA 1DOJA 2R9PA 3SV8A 4IN2A 1TLDA 2PR3A 5GCHG 1GJ9B 1ELBA 1K22H 2OXSA 1O2MA 1S81A 1SQRA 3BTQE 5T1VA 5GJ4B 1W0ZU 2BDYA 2H2ZA 2FOCA 3A8AA 3SU4A 1NZQH 4J2YB 3V13A 1P10A 2JDID 2PKAA 1BTXA 3RXAA 2BQ6B 1SGNE 4CREA 1DUEA 1T8MA 1DM4B 1VITF 4FU9A 3SV7A 5ABWA 1A3BH 3PV4A 2ZHEH 4MNYA 3VFEA 1O2VA 1VCWA 3UR6A 3M7UA 1P01A 2F4LA 1GDQA 1EP6A 2BLQA 3S7KB 4AFSA 1QA0A 1VCPA 4ZUHA 4AYVB 1GHZA 1E0FD 4ASHA 1ESBA 3QX5H 1OP8A 1CA8B 1XVMA 1O3EA 2QXIA 1HAZB 2TGAA 1AFQC 2AMPA 1GMHF 1YY3A 2ESTE 2Y7ZA 3ELAH 3FP8E 1GCTC 5EW2H 1V2MT 1TWXB 1QIXB 1S6LA 1UVTH 1GDUA 2WPDD 5BRRE 1XMNB 2QGRA 1LPZB 1V2KT 4ABGA 2PP6A 1DE7H 1ELDE 3M3VA 2RA0A 4I86A 1FONA 4Q7XA 3ZVBA 1C5PA 5CHAC 1FV9A 5EJLA 4IC5A 4X1RU 1D9IA 5EPNA 3EAJA 2FS9A 4AB9A 1GBDA 1LPGB 1V2LT 2KX4A 4NG9H 1SGQE 1Z71A 1OWDA 1SL3A 2HNTF 2ZG0H 1TPSA 4ABDA 3RXDA 5HGGA 3PLBA 4MQAA 2LELA 1VJAU 2C93B 1K1LA 1RJXB 4FUDA 1L2EA 3URDA 3TNTA 1BBRE 5K0HA 1O36A 1VGCB 5AF9H 2DUCA 2ULLA 2ZFSA 2C3SA 4RT1A 1SGFA 3A86A 3H7TA 1NFUA 2XNIA 4YXWD 2P8OB 1DVAH 1Z8IB 2FMJA 5IDKA 3A7VA 3GY8A 2P94A 5DG6A 1MAYA 2BTCE 3A8BA 1NRPH 2PHBA 1P05A 2CN0H 1XUKA 4UE7H 3H09A 1YPGH 3SQEE 1AIXH 1NT1A 5C0TA 1QA7A 1SC8U 4TWWA 2D26C 3QGNB 1CA0B 3VB7A 1C5WB 2GCHF 1PPZA 4QT8C 1GBTA 2F43B 2BLOA 3LJOA 3UWJH 3GDSA 2Y6TA 4YESB 3MH7A 4YLQH 4RN6A 1D3DB 3CENA 4HI3A 1DWDH 2BDBA 2HWLB 3A81A 1C2KA 1ZGIA 5AFYH 3M3TA 1N6XA 4NSVA 4WMEA 2GMTB 1OYTH 1SR5C 4TY7A 1HAIH 1L1NA 1W13U 1UMAH 4NA9H 1FZZA 2WYJA 1RD3B 3TK9A 2KZ4A 1QL7A 2WUBA 3U69H 4ZHLU 4O97A 2VBCA 1HJ8A 5EJZA 4INHA 1ZHPA 4IW4E 4A1TA 2IOTA 1THPB 2GCTB 2YNAA 2ZFPH 1BRUP 3AW1A 4H42U 1NTPA 3SJ9A 4U30A 3TU7H 5E0HA 1QURH 1MU6B 1AVXA 2SGFE 1AHTH 1O3DA 1XUFA 3A7WA 4BXWA 1K1OA 4YOJA 2HRVA 5IK2D 2GTBA 1QBNA 4XD7D 3BN9A 1V2ST 4FVBA 4DY7B 4ACAA 3SGQE 4BANB 2F9OA 1GJ6A 3BTDE 3TPIZ 1Q3XA 1TBZH 3VPKA 2ZPQA 3MFJA 5GWZA 2TIOA 2VIVA 1CBWC 1MQ6A 3KEEA 1VITG 3HGNA 1O3IA 4ZKNU 1XKBC 4CRDA 5CDFE 3UNRA 4X1QU 1E1RD 4O9VA 4B76A 3FP6E 4MDSA 1Z8GA 2JETB 4TYDA 3VB6A 1CQQA 2G81E 4CRBA 2Y82A 4BXSA 3PMAB 4E05H 5C0UA 1GL1A 3LGVA 1GI4A 1TGNA 2A4RA 3D49H 3E1XB 2VWMA 4GCHF 1COWD 3ZV9A 2FTLE 2ANMH 2G4TA 1BUIA 1D3PB 3P8GA 1VITH 1C5SA 1TAWA 1C4U2 4XBDA 4JZIA 1JMOH 4OS2A 5B6OA 1CGIE 1MKXK 3SW2B 1FIZA 2W3IA 2BLWA 2WV5A 2FOHA 3M7TA 2AMDA 3K2UA 1SOZA 3M3SA 4NZQA 4D8NA 1SGCA 1AB9C 2F9PA 2XCNA 2J98B 1H8ED 1F2SE 5C20A 3RU4T 1C1UH 2XNDD 3MO6A 1GG6C 4E7RG 6GCHF 4AYYB 2D8WA 1EZSC 2ZU1A 3RXRA 4NZLA 4CBOA 3CS0A 2CMYA 2W6ID 1SGFG 1MZAA 1GBJA 2LPRA 3EA7A 2ZEBA 1O2UA 2EEKA 1EJNA 1F5KU 4X1NU 1MBQA 4Q4LA 5KGOA 1SLVB 2CXVA 2PKAB 1EZUC 2V35A 3PB1E 3PMHB 5HIYA 5KECA 1O2PA 1SQAA 1UCYE 5JB8S 3K6ZA 4XBCA 2ODQA 5C5OA 1SFIA 2OC0A 3RLYH 4DT4A 3FN8A 1FI8A 4FUHA 1EJMA 1PYTD 2G5NA 1G3BA 3NRLA 4Y10E 1NFYA 3HK6B 4H6SB 3PROA 2GCHG 2VINA 1MU8B 2P16A 1CHOG 1TQ7B 5DJ7A 1BA8B 1P12E 3V3MA 3S69A 1IOEA 4K1TA 1GDNA 1YGCH 3RXTA 4MVNA 2BD2A 3ZZ4A 2VNTA 1KXDA 5F8XA 2F9NA 3VGCC 4MPUA 4CRAA 2XWAA 2CHAC 2OP9A 1TA6A 3WW7A 3SU0A 1GVZA 1PYTC 2J92A 1TMBH 3K9XB 5ESBA 3MU1A 2TGDA 4X6NA 4XOJA 2BD3A 4O03A 2GV7A 2UUJB 1TONA 3T28A 1ZHRA 1TBRH 3P92A 5EJ1A 1DWCH 3F1SB 3E3TA 2AHME 3ZZ5A 1W14U 1DLEA 2ZZUH 1GGDB 2ODYB 5DP3A 3F6UH 1SSXA 4ZKRU 3FKSD 4FUJA 3ZZ6A 4ISNA 3Q77A 1G3EA 3VG8A 1ZMJA 1WV7H 1RTFB 1CSOE 2WV9A 4B6FA 1LQDB 3PO1C 2BZ6H 3U8TH 1LHDH 1HAVA 3D23A 4IS5A 3UTUH 4X1SU 1QB1A 3PYHA 3FO8D 4K8YA 4Y0YE 4BOHA 1UO6A 3S9BA 1FAXA 1XUGA 1IQKA 1AWFH 1MKXH 1V2PT 1AY6H 2B9LA 2ZFTA 4KGAA 4D9QA 3I29A 1NC6A 1F5LA 3W95A 1QB6A 3RXFA 1S85A 5JYIA 4GCHG 1P9SA 2M5TA 4E06H 2YNBA 3MO3A 1KMHB 1ZMLA 2VIPA 2CJIA 3SO3A 2JH0D 1OPHB 2P93A 4I31A 3RMMH 1O2YA 1PQ7A 2JH5D 2WPLS 4ASUD 3EDXB 4FETA 1K1MA 1MTNC 3SUFA 4D76A 3SUGA 1BMMH 1MAXA 3DSPA 3MH6A 1NRSH 3M61U 1BMFD 1GI0A 2GZ7A 4Q7ZA 3LOXA 1FY3A 3P8OA 1O5FH 1DY9A 6GCHG 3ZVDA 3SNBA 1T7CA 1XKAC 2A4OA 3ATKA 2XC4A 4B6EA 2H6MA 2RCEA 1FNIA 1IQLA 1BDAA 5A8YA 1BRCE 5L2ZH 2R3YA 1UK2A 5DGJA 1GBHA 1S5SA 2QA9E 1GJ7B 1DSUA 1WDIA 1HAXB 2KCOA 3SNDA 3C27B 2PWXA 3SNAA 3VXEH 2ZCKP 3GY7A 4RI0A 1O2QA 1P04A 2G52A 3F9EA 2SGDE 3BEIB 1BITA 3TH3H 4GPGA 1AZZA 2BDAA 3RXOA 5JBCS 1MD7A 1P09A 2G5VA 1J8AA 1TGBA 2ZU5A 3KL6A 4TT3D 2AMQA 1HFDA 3TH2H 1Y3YA 2QN5T 1UVOA 4OS6A 3QGJA 1TABE 3OY5U 1ETSH 1AMHA 3PLPA 1KXBA 2XWBI 4I8LA 1GI8B 4NIXA 3HATH 3FFGA 1C2HA 3LKWA 1SGTA 2TGPZ 4XFQA 1QQ4A 2F91A 1S82A 2GX4A 2PSYA 2FXRA 1VR1H 3OEED 1C1WH 2HGTH 3E8LA 3KQ5A 2ZQ2A 1JWTA 2L6OA 1LVYA 3LONA 4AC9A 1FLEE 1ACBE 3GS9A 5FPYA 3SBKA 3UNSA 1CHGA 1ESAA 3TJVA 2PKSB 5E0JA 4LZ4B 4Z1MD 2A5AA 4FU7A 1J14A 4OGYA 3AAVA 3GICB 1FN8A 1MH0A 2OBQA 1JRTA 3KIDU 3KHVA 1B5GH 1QQUA 1MTVA 1RTKA 3EE0B 1QBOA 4FUIA 4AOQA 5EQQA 1BT7A 1HAOH 2RFKC 4NFEA 1ELTA 1Y3VA 2Z94A 2UWPA 2G55A 2V6NA 2PSXA 4ZH8A 1SBWA 1YF4A 3A84A 3LIWA 1Z6JH 3E0NB 1PQ8A 5L2YH 1TB6H 1A5IA 1ZRBA 1TGCA 2P3FH 1EOLA 2V3OH 3LH1A 4MNWA 1XX9A 3SU5A 3RM0H 2QXJA 1J16A 5TJXA 1HUTH 3VB3A 3A8CA 3UAIC 4UFFH 5JPMH 3MNSA 1QJ6B 1P03A 1EASA 1FIWA 2FOFA 5F8ZA 3LC5A 5C1XA 3UQVA 4FUGA 3SUEA 2ZECA 1O38A 1WXRA 1X7AC 5K7RA 2NU4E 1IAUA 1MTUA 1L1JA 1BRAA 4NCYA 2AEIH 1HNEE 1H8DH 3GYLB 3HKJB 3B9FH 1ELVA 1H8IH 1O30A 1G37A 1WTHD 2VU8E 4MG3A 4ABJA 1C4V2 4ZHAA 4JZFH 3SI4H 2BYAX 1D3TB 1VGCC 3SV6A 1E1QD 3NKKA 3S9AA 1AQ7A 4Y7AA 3HKIB 5JBAS 1CE5A 2OQ5A 1NS3A 1MBMA 1C2MA 2ODPA 2P8OC 2ZF0H 2ZA5A 1A0JA 2Y5GA 4WWYA 2V3HH 1FMGA 1C5OH 2UUYA 4OS5A 4ZHMU 4Y7BA 1MTWA 3KQCA 1CA0C 1O3GA 2OC7A 3EE7A 4I33A 1HAVB 1YC0A 1P2OA 1QR3E 1UTJA 2A45B 1DUAA 3QDZB 2EI7A 2J4IA 3NPSA 1DITH 2ZGBH 3A87A 2ZGJA 1C1QA 3A85A 3ZZ9A 3I78A 4TWYA 1O39A 2P59A 2GMTC 4XE4A 4ZXYH 1FXYA 1GJBB 1P06A 1LHEH 4WH6A 2H9TH 2B5TB 1O2SA 1OXGA 2XOKD 3UWIA 1Z6EA 4ESTE 2J94A 3U28C 3GCOA 4I8KA 3OTJE 4ABAA 1L0ZA 1DLKB 2IN2A 1IQFA 1YM0A 3AASA 3KYFA 2FOGA 4AORA 5DP9A 4UFEH 3GY3A 1O35A 2ALVA 1FY5A 2J34A 1RIWC 1Z1IA 2GCTC 1CT4E 3CS7A 2NU3E 2TGTA 3GCTF 2ZO3H 4LOYH 2GDDA 2H5CA 1MABB 1UVUH 1S0QA 2PGQB 4BTUB 1Z8RA 3W1EA 3TJUA 1TQ0B 1AE5A 4JYTA 3SV2H 7LPRA 4XSKU 1ANDA 3MU0A 3CP7A 1O2ZA 4IN1A 1AU8A 1IQEA 2ZDVH 3F0PA 1PQ5A 1DX5M 1BZXE 2C8ZB 3N7OA 2UUFB 2WSSD 3A7ZA 3D62A 1OWHA 4X8TH 3ZVEA 2XXLA 4CRGA 1C5RA 3RXVA 3MH5A 2ZFFH 1ZSKA 2A7CA 2Y7XA 4ZAEA 4Y6DA 1HIAA 4WXVA 1WQVH 3PMBB 4ISIH 2JETC 1MKWK 4FU8A 2I6QA 1EXFA 2FEQH 3LJJA 3BV9B 1Y3WA 1IQGA 2TBSA 4CHAB 1AI8H
chains in the Genus database with same CATH topology
2AGGX 3KQBA 2VIWA 1C2JA 2K1QA 1LMWB 1BCUH 5DP6A 2ZI2H 1E36B 5DPAA 4KTUA 2A0QB 2VIDA 1NPMA 4UDWH 1UJ1A 2FOEA 2ZU4A 3SV9A 2FLRH 3E90B 3GDUA 1CHOF 1E38B 1O3CA 1SFQB 2BDIA 3FVFB 4K60A 4UFDH 5EXMA 1GHVH 5LPFA 1AO5A 1EB2A 4X6OA 1EQ9A 3BIVH 1WAYB 2QIQA 1HLTH 2GVFA 1O3HA 3BTTE 2G51A 4Z0KA 5EXNA 1SVPA 3WY8A 2B0FA 1DDJA 5FBIA 4FXGH 1C5MD 1GI3A 3FZZA 1HAGE 1K2I1 1RTLA 1OP0A 4MPWA 4RKJB 2IJOB 1P2QA 3DA9B 2AS9A 2GGVB 3RXMA 1GBCA 5FXLA 1EKBB 1K21H 1ABJH 3LGUA 2BD7A 1RIWB 1A5HA 1ARCA 1TMTH 2AIPA 1UTLM 4NIWA 1LO6A 1N8OB 2FOBA 1VCQA 2Q6GA 2A32A 3M5OA 1Y5AT 5EW1H 1Z8JB 3IITA 1GBIA 4M7GA 1EP5A 2I6SA 4JZEH 3SU3A 1UTNA 3EQ0H 2BDCA 4D7FA 1P2MA 2ZC9H 1P57B 1TX7A 1NFWA 1QBVH 2VVCA 3RC6A 3KN2A 2G8TA 1NU9A 2NWNA 5E0GA 1G30B 2ANYA 1TOMH 1Y59T 5FAHA 2A1DB 1WCZA 1IHSH 4Y0ZE 3EA8A 1KYNA 2R2MB 3BG4B 5FPSA 1J17T 6LPRA 1F0RA 4A92A 1O5EH 2FYRA 1QRXA 3SQHE 1TNHA 2BY9X 4FUEA 4VGCC 1FQ3A 1O5GH 2J9NA 2UWLA 3MU4A 3SN8A 2ZGCA 1TBQH 1PPBH 5GXPA 3P95A 1NESE 1SGEE 1G36A 1VZQH 3GCTG 2BB4A 2V0BA 1GGDC 5AFZH 3QLPH 2VWLA 1GHYH 1ZRKA 2HNTC 2ZHWH 1L1GA 5EODA 3U9AH 1XUJA 1C2DA 3MNXA 3VB5A 1AWHB 4HFPB 1SHYA 2BD4A 3GCHB 2BY8X 2XCFA 1GBBA 2R3UA 1EZQA 3A82A 5AHGH 1D6RA 1GJCB 1FPCH 2ZTYA 1MKWH 4YT7H 3VXFH 3H7OA 1V2RT 3NCLA 2IPHA 1GI6A 2ZPSA 2GD4B 1T32A 3KNXA 1ZOMA 1LHCH 1NM6A 4NIYA 1BTPA 4B2AA 1QGFA 1EPTA 1LTOA 4WY3A 3K6YA 1AVWA 2O8MA 1C1RA 3E0PB 3BG8A 3NWUA 1QHRB 2O8UA 4GUXA 5C1YA 1S0RA 4FUFA 4DJZB 1GVLA 2BY6X 3ENSB 1AKSA 1V2WT 3KQEA 3LGYA 3O8CA 3Q3YA 5T3HA 1TX8A 5FCKA 3UUZA 4YOIA 1SB1H 1C1MA 5T6DA 5HYOA 1K1PA 1V2OT 2SGQE 2KAIA 1HAHH 5L30H 2WPHS 5F8TA 2WPIS 8LPRA 1O5AB 1OWJA 1GL0E 1XUHA 4Y8XA 4TY6A 5C67A 1DS2E 1C5NH 2R0LA 1D4PB 1ESTA 4X6PA 1WQSA 3KQDA 4JZ1A 3UFAA 2PUQH 1H9HE 1JBUH 4FVDA 3RXPA 4CRFA 1UTQA 1EZXC 3V12A 3AW0A 3M36A 1TNJA 3LDXH 2NU2E 2ZHFH 3URCA 1H4WA 2BVSH 1DXPA 4KTCA 4RSPA 2HOBA 1S83A 4E7NA 1OYQA 1IQIA 4CR9A 4VGCB 2FX6A 3RXIA 3SJ8A 3PM3A 1HAYB 4ZMAH 2NU0E 3RU4E 2VVVA 1K1JA 3TITA 1MZDA 1ORFA 2WINI 5F03A 3GY6A 1HIAB 3TH4H 1P8VC 1O2GH 5DK1A 1TGTA 1DFPA 3EYDA 4DG4A 1O5BB 1QL8A 4YZUA 4U01A 4F4OC 3OU0A 1C5TA 3TGJE 1T8LA 3E91A 1BTYA 1BTHH 1V2QT 3GY5A 1GHXH 4UFGH 2BHGA 1GHAF 2AFQB 1W7XH 2ZDKA 1C2GA 3UR9A 1RGQA 2A4GA 5DO4H 3BEUA 9ESTA 3FANA 3O8RA 2R2WU 3DT0H 3F9GA 1Z7KA 4AX9H 1O2XA 2BD8A 2ASUB 1KXFA 2FODA 3BTHE 1MUEB 1JXPA 3RXLA 1RRKA 1ZPCA 1PQAA 2PGBB 5GPIB 2PTNA 3BIUH 2PKSC 4WJG2 1PPGE 1IQHA 5TCCA 1TMUH 5A2MH 3A80A 1YP9A 3PWBA 3MU5A 2F9UA 1YPJH 2GP9B 2Y5HA 4UONA 5FBEA 1T4VH 2BDGA 2BY7X 4LZ1H 1GBEA 3E16B 1ZGVA 4A5TS 2ZIQH 5DP4A 2F83A 5EPYA 1UK4A 5T6FA 1W11U 4R0IA 4GSOA 3SGAE 1ID5H 2OLGA 3SJKA 1ZPBA 4Y11E 1G32B 5EU8A 3M7QA 1GJAB 3I77A 3OX7U 1Y5UT 1SLWB 3AAUA 2ZCHP 3U1JB 1V3XA 2H9HA 3ATLA 4YTAA 1C2IA 1SGIB 1FUJA 2R0KA 1GPZA 2ZFRH 3ZZDA 4DW2U 4ABEA 2FOAA 3QO6A 3L3TA 5EXLA 3F68H 3Q3XA 1TOCB 1ZSJA 2F9VA 3SUDA 3U98H 3DHKH 3TIUA 5ESTE 1P2JA 1YLDA 1A46H 1EUFA 3P8NA 1BMLA 1F5RA 1GI7B 2A7JA 3SHAH 1IQMA 1GI9B 4NIVA 3O8DA 4NFFA 2XW9A 3SNCA 1OP2A 2ILNA 4CR5A 3UQOA 2BX4A 4A7IB 4CH8B 6CHAB 1AGJA 1N6YA 4B1TA 4MPVA 2XC5A 3GYMA 2FS8A 2Z3CA 3ZZ7A 1O33A 3NXPA 1SLUB 1CGJE 1UCYK 2XBYA 2FLBH 1LPKB 3ITIA 2RA3A 1HRTH 1NY22 1MMJN 5TCAA 4X2VA 1C1VH 1JIMA 2XBWA 1NRRH 1SGPE 4WH8A 1AN1E 1GJ4H 1SMFE 4B73A 2VIQA 3HK3B 1EPTB 1GVKB 1TFXA 2VGCB 3RUOA 1O3MA 2Z3DA 3BTME 4KKDA 4CH2B 5LPEA 3IWMA 1KXCA 1G9IE 2Q6DA 1KLTA 1F0UA 1C5UA 2ANKH 4IGDA 4NSYA 1HB0B 1AKSB 1V2VT 2BVRH 1DWEH 2XBXA 4I8HA 1J15A 1V2TT 4JK5A 4HGCA 2KAIB 3JZ1B 1U6QA 1GMDF 1WYKA 1O3AA 1GHAG 1XXDA 4WXIA 2Q1JA 2ANWA 2OBOA 1SGRE 1ELGA 2VVUA 1TALA 1YKTA 2CV3A 3TJOA 3UOPA 4ABHA 4O3UA 1F92A 1P3EA 1O3LA 1DPOA 4D9RA 3A88A 2WPKS 2BD9A 4JYUH 3RDZA 1KIGH 2FP7B 3Q3KA 3FAOA 2HNTE 5PTPA 2WV4A 3MNCA 4H6TA 3F9HA 4A1VA 1ARBA 2BXTH 2FPZA 1O37A 1SI5H 3QUMP 3STJA 1C2LA 1PPFE 1TNGA 2PLXA 4JMYA 1GWAA 2CF9H 5LGOA 3MOCA 1LCYA 1YCPM 3RXJA 3ATMA 2ZU2A 1THRH 1LVBA 2OCVB 5EQRA 1EOJA 1UTKA 2BX3A 1G2MA 4CHAC 4BAQB 2J95A 3M5MA 4GHQA 2BD5A 3BTGE 1TGSZ 4UD9H 3L6PA 2A2XH 4FUBA 4NGAH 4JYVH 1A3EH 1L4DA 5DKMA 1DSTA 4H4FA 1SG8B 3GCNA 1TPPA 1O2LA 1HXEH 1O5DH 3QK1A 1DY8A 2Y81A 4J1YA 4U2WA 1NRNH 1C2EA 2PFEA 1YCPH 1Q31A 3SZNA 1O34A 7GCHG 1KLJH 2FI5E 1NN6A 3A83A 3PTNA 1WUNH 2RG3A 3G01A 1ZTKA 5FCRA 1C5VA 4KELA 1KDQA 4GAWA 4YM9A 3T25A 1UTPA 6ESTA 3KF2A 1UCYH 4DOQA 1ZTLA 1B0FA 1D3QB 1PFXC 2HALA 3LGTA 2C8WB 5JDUB 2XTTB 3GY4A 4DIIH 1HJ9A 1BHXF 5JBBS 3OY6U 1SPJA 4K2YA 1LVOA 2XBVA 5EQSA 3SJIA 1K1NA 3B23B 2DE8A 2ZTZA 1P0SH 2Z3EA 4A1XA 4ZXXH 1N8OC 2FX4A 2SGAA 1O2NA 3RMOH 3RXKA 2LNCA 1HJAB 1FPHH 2J38A 1ZMNA 4YT6H 3UIRA 2VB0A 2GZ9A 5EOKA 4KP0A 4NA8A 4X2YA 1TPOA 3ZVGA 1SLXB 4NWLA 1EAWA 2QC2A 1UTMA 4AB8A 3TK6A 2Q6FA 5C2ZA 4ISLA 3QTVH 2ALPA 1G3DA 3W94A 1HV7A 2Z7FE 3EGKH 4FUCA 2TRMA 3TLOA 5E8EH 3BG4C 3SU2A 1ANEA 4BAHB 1RS0A 1C4Y2 4DURA 4I8JA 3Q76A 2AIQA 2OQUA 1KY9A 1CGHA 1E35B 3PTBA 3AVZA 1QL9A 4B71A 2VWOA 4ABIA 1VJ9U 2FWWA 3H5CB 1KLIH 1S6FA 4BAKB 4K69A 1GMDG 2YOLA 1O2HA 4IBLH 3QZRA 2HPPH 3ATWA 5FX6A 3RMLH 3ZZCA 2F3CE 1D6WA 3TGIE 1UHBA 3NUMA 1YPEH 1O3FA 2EI8A 3A7TA 3PMJA 2BMGB 1ZPZA 3ODDA 1F0TA 1HBTH 5DP5A 1FN6A 3TK5A 1XXFA 1ANCA 1GBLA 3GCHC 3U8RH 1O2RA 1LVMA 4XDEA 2Z9IA 1FJSA 1EAXA 1EAUA 1GMCG 3MWIU 2A7HA 2PW8H 1XM1A 1P02A 3E6PH 4NWKA 2O8LA 5G4BA 2BY5X 1MCVA 3SGBE 1LHFH 1QFKH 2EI6A 1AUTC 4ZROA 3TVJB 1M9UA 3RP2A 4AGJA 2A31A 1A4WH 1WSSH 1A1RA 1P3CA 1WBGB 2STBE 5FPTA 2H1UA 4BNRA 5HXFA 4LK4A 2HPQH 3SHCH 4K3JA 4K8BA 4WMDA 4BAOB 1YPKH 1C9PA 1C1PA 2D2DA 3KCGH 2PTCE 4YOGA 3T29A 2HVXA 1OSSA 2SNVA 3ZYDA 2ZGXH 1W0YH 2CF8H 1P2IA 2QAAA 1Q2WA 1ELEE 2H9EH 2AH4X 4K1SA 5EGMA 2Y80A 1GBAA 1YPHC 4YO9A 4TPIZ 1BIOA 1A0LA 5JB9S 2W3KA 1GCDA 4X0WU 5A09A 3UPEA 1TPAE 1TNIA 1QB9A 2OC8A 1THSH 1FY1A 2O9QA 4X8VH 1HGTH 5E2PA 1GBFA 5BPEA 5A0BA 5JBTA 1H9IE 1DXWA 3BTWE 5C3NA 1MTSA 3A89A 2G00A 3ZVAA 2Z6BD 1AFQB 1E37B 3C1KA 3MU8A 2ZFQH 9LPRA 1BTZA 2DE9A 1GCTB 2QCYA 1RXPA 2B8OH 2GZ8A 1UVSH 2EC9H 2ZDNA 1ELFA 3UNQA 1JOUB 1QJ7B 1CT2E 3TJNA 1BQYA 5I25A 2OD3B 1C5XB 3U1IB 1XUIA 1CU1A 3STIA 1GHBF 1Y8TA 5GDSH 4ZKSU 2VH6A 1T31A 5CHAB 4IMZA 1BRBE 3UOUA 1MQ5A 2GT7A 2ZTXA 5HMAA 3BSQA 4IMQA 2Z9GA 1BTUA 1TX6A 1QCPA 1FY4A 3NZIA 3BTFE 2CGAA 3D65E 3SU1A 3RC4A 2O8TA 1CO7E 1FAKH 1T8OA 2XYAA 1SGYE 4HTCH 2A5KA 3PLKA 1INCA 3EA9A 1HYLA 4BTIB 4GVUA 4LXBH 1G2LA 4DCDA 1GMHG 4R8TB 1SGDE 1IQJA 2BVXH 2ZGHA 3SORA 1PPCE 1O2OA 4CBNA 1BMAA 2FTMA 3OSYA 3P70B 2ZCLP 2ZNKH 1ETRH 1JIRA 2BXUH 3BTKE 4OS7A 2WYGA 4AZ2B 4Y76A 3QZQA 4IC6A 1OWIA 1W3CA 1LKAA 4AN7A 1KDQB 1PJPA 3LC3A 5T6GA 4DGJA 4O3TA 1YLCA 3U8OH 1HPGA 1W7GH 3QWCH 4Y8ZA 2VIOA 1C2FA 1HAPH 4Y71A 4XBBA 1IHTH 4X2XA 1O2KA 1S6HA 1C5LH 2A2QH 4WF8A 3LT3A 3M37A 2C4FH 3GISB 1P11E 1P9UA 1A2CH 4JCNA 1OWKA 4ABFA 4THNH 5F6MA 5C5NA 3DD2H 4DT7B 4I8GA 1BBRK 4MLFB 3DUXH 4X2WA 1BHXB 1Y3XA 1C1NA 1K1IA 1QRZA 1HCGA 2ZPRA 5DP7A 3NK8A 4K5ZA 1IQNA 2WUCA 3R0FA 1O2WA 3T5FH 1O3PB 1NO9H 1EB1H 3ZZAA 4AFZA 3O8BA 1L4ZA 1O0DH 1C9TA 3RXBA 1CVWH 4AGKA 2Y5FA 1GJDB 4SGBE 1KXEA 1A0HB 2JKHA 5CE1A 1HDTH 2P95A 4X8UH 3MHWU 2SGEE 3LGWA 4AFUA 1S84A 3A7YA 3ZYEA 2G4UA 3A8DA 7KMEH 4I7YH 1CBWB 4OS1A 1ZJKA 1EATA 1ZYOA 1TYNA 2FO9A 3B8JA 4PROA 5DP8A 2FI3E 1ELCA 2A5IA 1J9CH 3M5LA 3RXEA 1Y5BT 2BDHA 1TRYA 5A0CA 4TPYA 3PWCA 1KTSB 2JH6D 1C1SA 1C5QA 1OS8A 2FM2A 2P3UB 2ZWLH 2UUKB 1YPLH 1UHBB 3ZZBA 3L33A 6CHAC 2BQ7B 1OX1A 1W10U 4Y79A 2SFAA 3ZV8A 4HZHA 2QF0A 2BLVA 2WPMS 2OTVA 4YLUA 2EA3A 3ATIA 1GJ8B 2AYWA 3P8FA 3RXCA 4D7GA 5J4SA 2ZHDA 5SGAE 4B2BA 2BZAA 2ZDMA 3UY9A 1MD8A 1SHHB 1DT2A 5FHTA 3IG6B 1C1OA 1YYY1 1BTWA 2ZQ1A 1TRNA 4ISOA 4DIHH 3SNEA 1AB9B 5EG4A 1GHBG 3MYWA 4GLYA 1KXAA 2W7UA 3BTEE 1BMNH 1EPTC 2VGCC 4X1PU 1K9OE 1GG6B 2ZDLA 1GI5A 2P3TB 3M5NA 1BOQA 1V6DA 3LH3A 3RM2H 1SQOA 2HLCA 1ZHMA 5FX5A 4MTBA 1ZR0A 1LKBA 5E2OA 5A0AE 8GCHF 5HM9A 1W12U 1PPEE 3JZ2B 3S7HB 4SGAE 3OYPA 2AERH 1QJ1B 3MI4A 3MMGA 1O31A 8ESTE 4JZDH 3MH4A 3RLWH 2PV9B 5I46H 1O2TA 1QTFA 4F49A 2TPIZ 1YPMH 1C5YB 1UTOA 2W7SA 1V2JT 2QYIA 2D1JA 4X8SH 1UVPA 1AVG