1AQ7A

Trypsin with inhibitor aeruginosin 98-b
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Atomic Structure of the Trypsin-Aeruginosin 98-B Complex
pubmed rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aq7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aq7A02
4Y10E 2EA3A 4I8LA 2FS9A 1AO5A 2F9VA 4ZROA 1FN8A 4AX9H 5LH8A 3RXCA 3EDXB 1WTGH 1GHYH 4MNYA 1GJCB 4FUFA 2CF8H 1HJ9A 3JZ1B 4WMDA 3DUXH 1PPHE 3A81A 4U30A 5C1YA 1ZMJA 1SLWB 1KXAA 1WSSH 2J9NA 1QTFA 2Z9JA 1O3DA 5FCRA 1E36B 1P8VC 3U8TH 4CRDA 2F9NA 5EXLA 1QNJA 1VCWA 2PTNA 5GCHG 3E8LA 2VIOA 1AHTH 1RGQA 3RXRA 1TBQH 1C2GA 1C2KA 1Y59T 1W0YH 2Z9KA 2OLGA 5GJ4B 1CT4E 3SU4A 3GICB 1GHAF 3SGBE 3SQEE 2BD9A 3P8GA 4ZKSU 1VITF 4NGAH 2FOCA 3A80A 6ESTA 1K1OA 1BQYA 3SOSA 3UIRA 2PFEA 2FZZA 1YGCH 2Y5FA 1Q2WA 1ANEA 4H6TA 1ELGA 2P59A 2VINA 1DLKB 4U32A 1BJVA 1UCYH 7KMEH 2ZCKP 2XCFA 2XC4A 1GVKB 1ZR0A 5EXNA 2A45B 1GL1A 1BITA 3RXEA 2BD7A 4BNRA 3NZIA 1O3GA 2B7DH 1IHSH 4GVUA 8GCHG 4RN6A 3QO6A 2G52A 1W10U 5K7RA 3K2UA 1DUAA 2Z94A 1T8OA 2GMTC 3FVFB 4JZFH 2D8WA 1K1JA 3RXGA 4B75A 3TNSA 2RDLA 1KLTA 1NN6A 1SFIA 2BDCA 1TMTH 1CGIE 1MAYA 1CA8B 2ZDKA 4A92A 1MH0A 1TPOA 5T6FA 1AB9B 3Q3XA 1A0JA 1O2ZA 4INLA 4AORA 2Z3DA 2C8WB 1BTPA 4ABBA 1O5GH 3SUFA 4ABDA 1ELAA 4CHAB 3MH7A 5SGAE 3GY6A 1GMCG 1SGYE 1OWDA 3I78A 2BZAA 2O8UA 2ZGHA 3GY8A 4X6MA 1PQ7A 2KAIA 1SOZA 2G8TA 2PKAA 1HAOH 1O3NA 2PHBA 4X1QU 1QR3E 3TJVA 2XCNA 1LDTT 1O2LA 1P3EA 3V12A 2PR3A 2NU0E 3VB4A 1DOJA 2ZGJA 4MPUA 3PYHA 4IC5A 4DOQA 2OC8A 1TRYA 1VGCB 2O8TA 2UUJB 3BTFE 1OP2A 4MNVA 3LDXH 3H7TA 1Y3YA 3HGPA 5LPRA 2BD5A 2AIQA 3AASA 1HAXB 1K1NA 4AG1A 1PQAA 1O39A 3GY3A 2JETB 1BTZA 3VGCB 3VB6A 5AFZH 2BMGB 5ETXA 4GHQA 2FYRA 1JBUH 2A4GA 4ISOA 2M5TA 4FUDA 3GYLB 1EATA 1SI5H 5F8XA 3MH4A 5HMAA 3P70B 3SU0A 2ZHEH 2H2ZA 3R3GB 2QF0A 2ANWA 2R3YA 1FJSA 1XUJA 4MTBA 2O8LA 1CA0C 2ZHQH 3SJIA 2PUXB 4XDEA 1O2XA 1WBGB 1YKTA 3DA9B 5C5OA 1AKSB 4E7NA 1ZTKA 2BVSH 1TA6A 1QBNA 4KP0A 2O8WA 4IMZA 1SSXA 4Q7XA 4F49A 2K1QA 1TABE 1TOMH 2JH5D 2JH0D 1TX6A 1EP6A 1E37B 1KLIH 3LC5A 1BTWA 2ZDNA 1WAYB 1C2IA 3BTEE 1GBLA 3ZVDA 1HCGA 1BIOA 2ZIQH 2OC1A 1QQUA 1EOJA 1MU8B 4LZ1H 1O2YA 1AZ8A 1OP8A 1RXPA 1UVSH 1UVOA 2AGIX 1P05A 3ATIA 2HWLB 3BEFB 1Z8GA 1EUFA 3SV9A 3HK6B 1BJUA 1TGSZ 3GCHC 2BX4A 2XC5A 3TJUA 2DE8A 1NT1A 2G5NA 1OPHB 3UR6A 3RXUA 1TFXA 3AAVA 1QJ6B 3BF6H 2BY6X 2CF9H 4INKA 3ZYEA 4Y8ZA 4OS2A 2VH6A 3HATH 1LVBA 1ZRBA 3A7ZA 4NG9H 1HPGA 2ASUB 2QGRA 2F9PA 1ELCA 3M3SA 3TU7H 4CH8B 1A2CH 2GTBA 4X8TH 2QN5T 4O9VA 3SUEA 4ASHA 1DY9A 1QL8A 4ZKOU 1GBKA 2G5VA 2TBSA 4YOGA 1C5OH 2WPJS 2BD3A 5E0JA 3A7TA 4TPYA 4Y79A 1RFNA 3GCTF 2ZFSA 3HKJB 3Q00A 5EXMA 1QA7A 2ULLA 2RA3A 1FY5A 3ZZ3A 4J2YB 4HTCH 1O3IA 2AMPA 1ELEE 4A6LA 5DJ7A 1LMWB 1AE8H 5DPAA 1O34A 1TYNA 1P57B 3NWUA 3SU2A 1TMUH 1YPHE 3EA8A 4I8HA 1GBHA 1O2WA 1O3LA 4KTCA 3MU0A 5F8TA 3BTKE 1AUTC 1UO6A 1S82A 1BRCE 3RMNH 5GPIB 1GMHF 1SR5C 4K69A 3MNBA 1OWHA 5EGMA 3IITA 3RMMH 4YLUA 2A4QA 1DFPA 1TONA 3EE0B 4FUIA 1LO6A 2XC0A 5FBIA 3SO3A 7GCHF 3MO6A 1YPLH 1KYNA 2ALVA 1AVGH 4OS6A 3KNXA 1GPZA 2A1DB 2F9OA 1W0ZU 3TIUA 2PLXA 2BLWA 2D2DA 1P3CA 2ZTXA 1DVAH 1DDJA 2OC7A 2HRVA 5EQSA 2J38A 1G2LA 4NIXA 1GBMA 1G37A 2HPPH 1ORFA 3TVJB 2F91A 5E2OA 5FX5A 3LGIA 2XYAA 1ID5H 2P94A 3SNAA 4UONA 2A7JA 3RXFA 4CR9A 2ANMH 2GVFA 1E38B 1A7SA 1SQAA 1MZDA 1LVOA 5GXPA 2C3SA 2ZDAH 1T8LA 2WYJA 1W2KH 4WXIA 4UFEH 3M3TA 3T5FH 4FUCA 1O2IA 1TPAE 1A46H 3MTYA 2SGFE 2H5DA 4BTIB 2SGQE 3UOUA 1C4U2 1V2ST 2Z9LA 2BHGA 3QZRA 2GDEH 4FUGA 1O2HA 3F68H 1LPZB 1ZZZA 2VWLA 4D7FA 4D9RA 1SMFE 4CH2B 5LPEA 1F2SE 2AERH 1TNLA 1AB9C 1DX5M 3BEIB 2ZFTA 3S9CA 3UR9A 1XXDA 4ZH8A 1GJ4H 1IQJA 1Z8JB 1JOUB 4UFGH 1TAWA 3OY6U 4JZEH 2GZ8A 1Z1IA 4AFQA 1T31A 3UOPA 5J4QA 1MU6B 2GMTB 1UHBA 3NK8A 2VIVA 2BQWB 5C20A 1ZRKA 1XMNB 2QYIA 1J8AA 2VIPA 1IQNA 1UTQA 1UTJA 3UNSA 1BBRK 1GI6A 4Q7ZA 1UVPA 2IJOB 1ABJH 4ZHAA 1GJAB 3LGYA 1H4WA 4RKOB 1BT7A 2SGPE 2BZ6H 4R0IA 4Z6AH 5DP5A 3RXKA 2CGAA 1XX9A 1YLCA 1ZGIA 4YOJA 3ZZAA 1TBRH 5A0AE 3A7WA 2BDAA 4B1TA 1HIAB 1L1JA 5T6GA 6CHAC 5C67A 1ETTH 1C5YB 1NFUA 3KIDU 3SNCA 1ANDA 1RIWC 4Y7BA 3L33A 1O2VA 4NWKA 1HXFH 1KLJH 3QN7A 4QT8C 2JETC 1G36A 1O2MA 2ZU3A 5ESBA 3KQBA 4KGAA 4A5TS 2Y82A 2HNTE 3LU9B 2SNWA 1FPCH 3E90B 1FLEE 1W12U 5EU8A 1EJNA 5JBAS 5BPEA 1C1RA 1SLXB 5A8YA 4FU7A 5TCCA 1AI8H 3PLPA 4GCHG 1C1SA 4D76A 1SLUB 4XBDA 1LHFH 3T29A 1SB1H 1O2GH 2VIDA 2ZFQH 2FEQH 2YOLA 3N7OA 3QWCH 4ISIH 4X1NU 3UNRA 3QUMP 1ANCA 1FY4A 2ZGBH 3GDSA 1DWEH 1HBTH 3MFJA 1UCYK 4BAQB 4I8JA 1NRQH 1CA0B 3F1SB 1RTKA 2W7UA 3PWCA 4ESTE 4M7GA 4Y76A 1EPTA 1OXGA 3W94A 3CP7A 1SGDE 1WUNH 2NU1E 1ELDE 3RLYH 3P92A 4ZHLU 2BD2A 2VIWA 3GISB 2WPHS 3UY9A 4H42U 1THPB 3RC5A 4X8VH 2BVXH 1ZJKA 1TX7A 2FI4E 1V2VT 3MO9A 4FVDA 3RMOH 1GWAA 1QA0A 4K1SA 8KME2 1BTHH 2ZG0H 5LPFA 5AFYH 2ZKSA 1EZSC 1XUFA 1M9UA 4JZIA 4D7GA 1CHOG 2ILNA 1C9TA 3T28A 1IHTH 1UTOA 2BLOA 2OBQA 2FMJA 2UUFB 1GI8B 1ESAA 3M5LA 2FOMB 4AOQA 2A31A 3PMJA 2SNVA 1P11E 2C8ZB 3MI4A 1AGJA 1E35B 3SJOA 3I29A 2D1JA 5G4BA 3RUOA 3ZZ7A 5JB9S 3E3TA 1Y3WA 3G01A 2VGCC 1Z71A 2TIOA 3P6ZB 3P95A 2GV6A 1HRTH 1BRBE 4NWLA 1O2NA 4CBOA 1DXWA 2HGTH 2VVUA 1H8IH 2VIQA 1LQDB 3TGKE 1YPKH 2ZQ1A 1HYLA 3A87A 3I77A 1W13U 4WJG2 5L30H 2G4UA 1C1WH 1C2DA 3KF2A 2STBE 5EQRA 3A88A 1KDQA 3D62A 4I33A 4AFZA 4BANB 2SFAA 1TGCA 3M5OA 2R9PA 3MNCA 2P3FH 3IG6B 1QHRB 1BBRH 2P3UB 1P2NA 3GCOA 1T7CA 5AVDA 2CHAC 1ABIH 4A1TA 1H9HE 1C5WB 5A0BA 4IW4E 1DLEA 1P0SH 4J1YA 4MVNA 2EI6A 2PGQB 2ZHDA 5E8EH 3KQDA 2FOGA 1Z6EA 5E0GA 5DKMA 2Y7ZA 1SGQE 2H5CA 5CMXH 1VJ9U 5DP6A 1AY6H 3RXTA 3A83A 2J4IA 1K21H 1P01A 4AN7A 1VCPA 1K1MA 1FDPA 4NIYA 1DUEA 3QX5H 2ZGXH 1NFYA 2BM2A 4YT7H 2IN2A 2GGVB 3GOVB 5HM9A 1MTSA 2ZPSA 5C1UA 3FP7E 2FPZA 2Y80A 2QXGA 1Y5UT 3O8DA 2C8YB 4CR5A 1GBFA 1B5GH 1RTFB 1Y3UA 3MOCA 2ZC9H 5TJXA 4FU9A 4Y7AA 2GT7A 1LVYA 7ESTE 1CT2E 1IQIA 1L1GA 1LHEH 1O2SA 2I6QA 2XXLA 3IWMA 3MU5A 2G51A 3K6ZA 3P17H 4ZKNU 3ZZ9A 4AB9A 4TWYA 3QLPH 1QL9A 4E05H 2BDBA 4IN1A 1A5HA 2HLCA 3EA7A 2FOAA 2A7HA 2ZU2A 3E6PH 3ZZ8A 2HPQH 1YBWA 4Y8YA 5DG6A 4XBCA 5C2ZA 3A8DA 1GBAA 3VPKA 9ESTA 1S0QA 2HALA 4LK4A 2ODPA 2G00A 1GJ5H 1SC8U 3QTVH 4NSVA 1O3CA 3ZVFA 5FPSA 3SV6A 5ESTE 1AZZA 2Y6TA 2V3OH 1Y3VA 1FY1A 2ZU1A 1NFXA 2P8OC 3WY8A 1SGNE 1Z8IB 3UUZA 3RXVA 3K6YA 1NTPA 3R0FA 1K2I1 1ETRH 2WPIS 3F9FA 3SORA 2AIPA 1ZHRA 2FTMA 1T4VH 1GJ6A 3W95A 4X8UH 3MYWA 4Y0YE 5FXLA 2SGEE 1LHCH 3S9BA 1OSSA 2BY8X 3P8OA 3NUMA 1DE7H 2FX4A 1C5TA 3RP2A 2HOBA 4OS7A 4WY3A 4K60A 2ALPA 2ZA5A 4AYVB 1O2UA 2ODYB 4ZXXH 1S6FA 5BRRE 2LNCA 3VB3A 1GBDA 4IC6A 1D3TB 1VCQA 1PQ8A 1XUHA 1CVWH 1KXFA 3E16B 4WVPE 3FP6E 1UK2A 2ZF0H 5HXFA 1UTMA 1W8BH 1UCYE 3GY5A 4NZQA 1FUJA 1AD8H 1C1MA 3SJ9A 1CGJE 1UHBB 3NPSA 2NU2E 1F92A 3MH5A 4INHA 1IQFA 1CBWC 4E7RG 3F6UH 1WYKA 1GVZA 1LPGB 1MQ6A 1BB0B 1TGTA 1YPHC 2F3CE 4XBBA 2J92A 1AWFH 2QXHA 3H5CB 2O8MA 2J34A 6GCHF 2ZWLH 2GDDA 1F0TA 2P16A 1JIRA 1N1LA 1YLDA 1O2JA 2BY5X 1NS3A 1TQ0B 1ZSKA 6CHAB 2ZPQA 1GHAG 1RIWB 3SBKA 1VITG 3T27A 2C90B 3LONA 3TH4H 1NC6A 1G3DA 4B71A 2ZU4A 3GDUA 1A0LA 1HAYB 4IGDA 1C2EA 4JK6A 1GHWH 1WU1A 2XBYA 1LCYA 1TQ7B 2BVRH 4NIVA 1G30B 5EPYA 1VJAU 1WV7H 1YPGH 2UWOA 4ZXYH 1O3KA 4OGXA 2CN0H 1AIXH 1GHZA 3MNSA 1ZGVA 3UWIA 1GCDA 2BQ7B 5A09A 1CU1A 1O35A 1MD7A 5E2PA 1D6WA 4X2XA 1HAPH 2F83A 2AMQA 1HUTH 1DITH 2WPKS 2H1UA 2FOBA 3M7QA 3A89A 1EZUC 3BTME 1S84A 2OC0A 3QGJA 1GJ7B 6LPRA 3BTTE 4BOHA 1QY6A 1V2JT 3ODFA 3QK1A 1OWIA 1IQEA 2PSXA 1GI9B 2Q6DA 3KCGH 5DP8A 3GDVA 4X6NA 1C5LH 1WQSA 1ARBA 4OS4A 2PTCE 4A1VA 1FAKH 1VZQH 1BOQA 2UWLA 4IN2A 2BOKA 1KSNA 3Q3KA 2UUYA 5J4SA 2V0BA 3STIA 1Y5AT 4I8KA 4RKJB 3RXPA 1TGNA 4WH8A 1FXYA 3LGTA 2UUKB 2G4TA 1AN1E 3ODDA 2A4RA 5EODA 1O2TA 2BX3A 3Q3YA 4KELA 3CS0A 4OS1A 1V2WT 1QRXA 1O3BA 3OX7U 1AWHB 2BB4A 1A61H 4FVBA 3GY4A 2BXUH 9LPRA 5IYTA 4UEHH 1SG8B 1O30A 3MU4A 3ZVGA 5I46H 2UWPA 2VGCB 4E06H 1AMHA 4OGYA 2FI5E 1W3CA 3SI4H 4NFEA 1NRRH 2EC9H 4H4FA 3CENA 3SGAE 3RXMA 2BLVA 3FFGA 1D4PB 2FO9A 1C5SA 3KL6A 2Q1JA 3ESTA 3LKWA 4U01A 3V7TA 4NA8A 2GT8A 1V2TT 1B7XB 4BAOB 1ZTLA 2ZP0H 4BAMB 4KKDA 4NFFA 3ELAH 4FU8A 4CRBA 1RD3B 1HNEE 1C9PA 2QC2A 5B6OA 1FY3A 1A1RA 5LGOA 1KDQB 4O3UA 2CHAB 2Z6BD 1P2IA 2HNTC 2OP9A 5GWZA 1MMJN 1C2MA 1F5RA 3M35A 4TY6A 3A85A 1ACBE 1YPJH 3MU8A 4UD9H 1CSOE 4CRFA 1EZXC 1SLVB 2A5IA 3M5NA 3PMHB 1SGFG 3ZZ4A 1QRWA 1THRH 1W11U 1RTLA 4X6PA 2J95A 4NA9H 1TALA 5K0HA 4I7YH 1C5MD 1WOFA 1Y8TA 3ZV8A 1LPKB 3EGKH 1TNIA 4X1SU 1QBOA 1QFKH 1OWJA 4IS5A 1G3CA 4X2VA 1LTOA 1BMMH 1PJPA 1F0UA 1FIWA 1AQ7A 5FAHA 4VGCC 1C1TA 1Z7KA 1XXFA 1C1OA 5DGJA 1GHBF 3VB7A 1GDNA 1V6DA 1UTKA 5FCKA 3T62A 1MUEB 2BQ6B 3UFAA 1BHXB 3OY5U 1GHXH 3RXBA 4YOIA 3A7VA 1O5EH 1LHDH 5C1XA 2VWMA 3A8AA 1TLDA 1IQKA 1UK4A 2OQUA 1CT0E 1UTPA 2AEIH 2DUCA 3P8FA 5A2MH 2GCHF 1GMDF 2FS8A 1O37A 1S85A 3H7OA 4B2BA 1EASA 1TGBA 2ZO3H 5JYIA 5JPMH 1HV7A 2HVXA 3TK5A 1GI0A 1GHVH 3SW2B 3GCTG 4WH6A 1J9CH 1S83A 4Q2KA 1PPZA 4WWYA 2NU4E 1MAXA 2P8OB 2RCEA 4YLQH 1GJ8B 2FIRH 2ZCLP 1QB6A 4HFPB 3TJOA 1DANH 1C5QA 4KTUA 2CV3A 3E1XB 1O2QA 1XVMA 3U98H 4YM9A 1W14U 3ZV9A 4F4OC 3HK3B 2Z9GA 1FNIA 1GMHG 1FN6A 4O97A 1BUIA 4A1XA 1S81A 5DP3A 2F9UA 1MTUA 1Q31A 5DP9A 2FLRH 1ZPZA 1GI5A 3U1JB 1TE0A 1ZSJA 7GCHG 2PSYA 3RXOA 3L6PA 5EW2H 3FAOA 1D3DB 4WMFA 1AFQC 4MQAA 2P95A 2TRMA 1P9UA 3PO1B 3K65B 4X1RU 4Q7YA 1HXEH 3SHCH 1TPPA 2TGTA 3F9EA 1SGTA 1O5FH 1AVXA 1QL7A 3PM3A 1L4ZA 1F5KU 4YO9A 3MH6A 2A7CA 1WQVH 2IPHA 4THNH 1LKBA 4XE4A 1CBWB 1UTNA 2KAIB 2PKAB 2Q6FA 3LGWA 4UDWH 5JB8S 3U9AH 3B9FH 1JMOH 3MU1A 2R0KA 1RS0A 1IQMA 2AH4X 1W7GH 4DGJA 3RXHA 4K8BA 3M37A 4FUHA 2WUCA 4ZUHA 3HPTB 4Y0ZE 4D9QA 1SGFA 1W7XH 4BAHB 2A32A 1F7ZA 1HLTH 1OYTH 3BTWE 1AKSA 1TNKA 5H4IB 2ZTZA 3SNEA 2AFQB 1O36A 1D3QB 3LC3A 1H9LB 2QF3A 4ABHA 2VB0A 1U6QA 1C1UH 1GBJA 1ZPBA 3CS7A 3TJNA 1SVPA 1GBTA 1TRNA 5C3NA 1ZLRA 2G55A 3KN2A 4DVAU 3LIWA 2Y81A 2PKSC 2OUAA 3OSYA 3MHWU 8ESTE 3F9HA 4CRCA 4R8TB 2A2XH 2OINA 4GUXA 5HM2A 2GX4A 4I32A 3A8CA 1NZQH 1EJAA 3GY2A 1NRSH 1SOTA 3UQOA 3KQEA 1GCTC 3FZDA 1EPTC 1PPCE 1MKWH 2FLBH 3ATMA 3SNBA 3BIVH 1X7AC 1G32B 5CHAC 1HJAC 3BG8A 4YESB 3ZZBA 3VXFH 2VWNA 5GCHF 1ZOMA 5A8ZA 1KXDA 1P09A 4PROA 1F0RA 3BTHE 2PGBB 4JMYA 4A7IB 1C1PA 4H6SB 2Z3CA 4HZHA 3TH2H 3V0XA 2JKHA 3BV9B 3PMBB 1UVUH 3U1IB 1BDAA 5F03A 1AU8A 1KXBA 1DPOA 4BAKB 3RXLA 1EB1H 1GI1A 4UFFH 1O31A 1P04A 2FYQA 1PPBH 1QJ7B 2TGPZ 1CE5A 1GBBA 2ZECA 1SGPE 3E0NB 1OX1A 1O0DH 4NZLA 2A5AA 1XUGA 1HGTH 1P10A 1GJBB 2ZZUH 2A0QB 2ZDVH 1EAIA 3RXSA 4OS5A 1FZZA 1TMBH 1WTHD 1ARCA 8GCHF 3KGPA 2SGAA 4AG2A 3FANA 2TGAA 1ZHMA 3U8OH 3MNXA 1HB0B 3ATLA 2FODA 1SPJA 5E0HA 2A5KA 3MMGA 4BTUB 3VXEH 4Y6DA 2YNBA 5EQQA 3S7KB 4AB8A 5TCAA 1H8DH 1C5RA 1YYY1 1SQTA 1YPMH 2C4FH 4O03A 4X0WU 4DJZB 3D23A 1HAGE 1V2OT 2QXIA 3VEQB 1WCZA 3SU1A 1E0FD 2OCVB 5JBBS 1J16A 1OP0A 1C2JA 1GMCF 2BDGA 3HKIB 1YP9A 2ZCHP 3JZ2B 4MNXA 3RU4E 3SUDA 4B2AA 3TH3H 2QCYA 1XKBC 1MD8A 1DT2A 3ZVAA 1FPHH 1ZJDA 2O9QA 1SQOA 1G3BA 1GI4A 5CE1A 3EA9A 1O32A 3S7HB 1DSTA 3KEEA 1P12E 1L1NA 1KIGH 1BTUA 3AAUA 4JYTA 2ZI2H 1TIOA 2W3KA 1BBRE 1C1VH 1S6HA 2B5TB 2ZDMA 4SGBE 1DSUA 1JWTA 1XM1A 1EQ9A 3QZQA 2HNTF 4ISLA 5L2YH 1C2HA 4BXSA 3SHAH 4VGCB 1BRAA 3A7YA 3RM2H 1GBEA 1NESE 3M36A 1XVOA 2VNTA 4X6OA 1GVLA 3ZZ5A 1VR1H 2VH0A 1HAVA 1LHGH 1N8OC 1HAHH 2OD3B 1PPEE 3ZZ6A 3BEUA 1MZAA 3GCNA 3AW1A 1Q3XA 1IQGA 4Y71A 5GDSH 1FV9A 1MQ5A 1N6YA 3SGQE 1AUJA 4GAWA 3EYDA 4K1TA 1O5CB 3S9AA 3NKKA 4GHTA 1MKXK 4XFQA 2CJIA 1QBVH 3T25A 3BG4C 5DK1A 1ZSLA 1C5NH 5F8ZA 1O2OA 3DFLA 2ZHFH 4O3TA 3UNQA 2VVVA 2W26A 1KTSB 1GI2A 1NRPH 2BLQA 4JYUH 2AMDA 1K22H 1EP5A 4ZHMU 4CRGA 3L3TA 2BTCE 2W7SA 1JIMA 2BXTH 3PO1C 1G2MA 5JBCS 2AYWA 1K9OE 2OBOA 1O5BB 2R0LA 2W3IA 3SQHE 1HIAA 2H9TH 1SGRE 4ABAA 1ESTA 1EX3A 1O5AB 1HDTH 1EOLA 1V2UT 2GCTC 4YT6H 4WF8A 2ZFRH 3BTDE 1TWXB 3RU4T 2XBVA 2QXJA 3URDA 1DWCH 4LXBH 3M7TA 4GLYA 4AZ2B 1O3HA 1AFEH 1NU7B 1H9IE 2THFB 4ABEA 1JRTA 1V2MT 1QJ1B 1AFQB 1S5SA 2FESH 4BXWA 1P2QA 5EPNA 2J94A 3SNDA 1BCUH 2F9BH 1NROH 4FUJA 1QIXB 4RSPA 3S69A 1TBZH 3GYMA 4MLFB 1XKAC 3RLWH 3SU3A 3TGIE 4I8GA 4K1EA 1F5LA 1FIZA 1ZMNA 2YNAA 3PTBA 2WPLS 1PFXC 1A4WH 2Z7FE 4SGAE 1NPMA 4WXVA 2FTLE 1D9IA 3SV2H 1EB2A 2H9EH 1XUKA 5L6NH 3B23B 3SU5A 1GDUA 2Y5HA 4X8SH 1C5ZB 1OOKB 3K9XB 3T2NA 1OWKA 3STJA 4K8YA 1GJDB 1C1QA 2BY9X 3F9GA 4I31A 1NM6A 1DWBH 3UWJH 1ELBA 1FI8A 4DT7B 1OS8A 2JH6D 1A3EH 2AS9A 2H9HA 2VVCA 1GI7B 4ABIA 1LVMA 5AHGH 1YPEH 8LPRA 2A2QH 3A86A 1MCVA 3Q76A 2QAAA 1GI3A 5EG4A 3C1KA 3O8BA 2QIQA 1K1PA 3QDZB 4AGJA 1MTVA 3BTGE 1YCPM 4DIIH 2FOHA 3LH3A 2R2MB 3PLKA 2PKSB 2FP7B 3PLBA 3A8BA 1BRUP 3O8CA 4TWWA 1MTNC 1TX8A 1TRMA 2FI3E 3OU0A 2PWXA 2OXSA 3KQCA 1BTYA 1GCTB 2EEKA 1EPTB 2BY7X 2DE9A 1O2RA 3C27B 1CGHA 2B9LA 1E34B 4HI3A 5CHAB 3T26A 2ZNKH 1HJAB 2P93A 3UREA 1CQQA 4MPXA 4ZKRU 1TB6H 3QGNB 2BD8A 1C4V2 1CO7E 1GGDC 3DFJA 5DO4H 2BOHB 1LQEA 4JZ1A 1D6RA 1KXEA 5HYOA 2ZPRA 1MKXH 1TOCB 1SFQB 1GG6C 3LGUA 1BA8B 2XRCA 3MO3A 6GCHG 1TA2A 3LGVA 3A84A 1KY9A 2GZ9A 3ATKA 1C5XB 5JBTA 3UQVA 1S0RA 4AGKA 2G81E 2XW9A 4ISHH 2EI7A 1V2KT 1T8NA 1TNJA 1SGEE 5F6MA 4AYYB 1KXCA 3D49H 2ZTYA 4MPWA 3ZVEA 1O3JA 1D3PB 3SV8A 1A0HB 2WINI 4Y8XA 1N6XA 3BSQA 3U69H 1A5GH 1KTTB 1IQHA 1C4Y2 4FXGH 3SZNA 3AW0A 3V13A 1HAIH 5EW1H 1SHYA 3SJKA 1O2KA 2SGDE 5FPTA 4FUBA 2STAE 1OYQA 2OTVA 2ESTE 4NCYA 3ZVCA 2ZGCA 3RC4A 1TPSA 3TITA 5I25A 1Z8RA 1O3AA 1V2RT 2ANKH 1C2LA 1YCPK 1G9IE 2RG3A 1ELFA 1BZXE 1EAXA 1MBQA 1ZHPA 3VB5A 3DT0H 1CHGA 3A7XA 1FMGA 1P02A 4TYDA 3URCA 1PYTC 4MDSA 3KHVA 2QA9E 3BIUH 1INCA 1JRSA 3E91A 1O3PB 1FONA 2PW8H 3BN9A 2Y7XA 3PTNA 4K2YA 2V35A 2GZ7A 4AFUA 3EQ0H 1ANBA 2BYAX 2ZQ2A 1RRKA 1UK3A 2ZU5A 3UPEA 2RA0A 4FUEA 1V2PT 4GSOA 3NCLA 4IMQA 2Q6GA 3RXDA 3PB1E 3ITIA 1Z1JA 1OKXA 1T4UH 5T3HA 1MTWA 3SV7A 2WV5A 3LH1A 3GY7A 4DIHH 1MKWK 1P2MA 1O3MA 1RJXB 1V2NT 2FXRA 3RC6A 3RXIA 4CREA 4LOYH 2LPRA 1ESBA 4CRAA 1EKBB 3LPRA 3M7UA 2V6NA 4DW2U 1O33A 2FOEA 2P3TB 5C5NA 3EAJA 1ELVA 1OWEA 4XSKU 1DY8A 1HJ8A 1HFDA 1J14A 4GCHF 4DY7B 2NWNA 1PPFE 4B2CA 1P06A 3SUGA 3RXJA 3LT3A 5IDKA 3ZZDA 1N8OB 1BHXF 3HGNA 2AGEX 1C5VA 2C93B 2XTTB 1A5IA 4IBLH 3V3MA 3SJ8A 3PWBA 2CMYA 4UFDH 4DG4A 1C1NA 1H1BA 1HAVB 2ODQA 4X2YA 2WYGA 4K5ZA 1EXFA 1UMAH 1K1IA 1PYTD 2VU8E 4X1PU 1O5DH 1QB1A 3BG4B 4JK5A 3ENSB 2TPIZ 4X2WA 2J2UA 3RDZA 1VITH 4CHAC 2ZEBA 1P2JA 5FPYA 5T6DA 2V3HH 5A8XA 4ZMAH 3B8JA 1C5UA 2TGDA 3P8NA 1UTLM 1CHOF 1MCTA 1Z6JH 3NXPA 1ZYOA 2ZDLA 1UJ1A 1NFWA 3M5MA 3RXQA 1YF4A 1ELTA 2I6SA 2PV9B 3QTOH 4ABGA 3TK6A 1MBMA 1IAUA 1PQ5A 3TPIZ 2IOTA 3UTUH 2A4OA 5GIBA 3TK9A 3DHKH 4ZAEA 4MPVA 2GCTB 1EAUA 2FX6A 2EI8A 4MNWA 2ZFPH 1VGCC 3S0NA 2WV4A 1XUIA 2Z3EA 4YZUA 4LZ4B 2BDHA 2BD4A 1Y5BT 1QURH 2CXVA 1FAXA 4JCNA 2GKVE 1FQ3A 2BDYA 1K28D 1EAWA 3SU6A 1P2OA 2H6MA 1GHBG 3VFEA 1EZQA 3LJJA 3BTQE 1V2QT 3VGCC 7LPRA 1T8MA 2QV1A 1NY22 3TNTA 3FZZA 1YCPH 1B0EA 3RMLH 3OYPA 1P9SA 3MWIU 2XBWA 2FDAA 4BTTB 4DCDA 2ZFFH 3LJOA 3LOXA 1J17T 4CBNA 3SI3H 1IQLA 1GBCA 2GCHG 4U2WA 5PTPA 1GMDG 1SGCA 4JYVH 1Y3XA 1L2EA 1C2FA 1EJMA 3FP8E 4B74A 5L2ZH 1YM0A 2ZHWH 3ATWA 1B0FA 2OQ5A 3A82A 1C5PA 1PPGE 3Q77A 2FOFA 2VWOA 4MG3A 3RXAA 4HGCA 1NRNH 5FHTA 4GPGA 2ANYA 4B76A 1QB9A 5DP7A 1V2LT 2FWWA 2GV7A 3ZVBA 3ZYDA 1A3BH 3TLOA 1P2KA 1DS2E 1L4DA 4NIWA 4JZDH 4DURA 1L0ZA 1AVWA 4WMEA 1GL0E 4UE7H 2WUBA 3D65E 4ABFA 3PV4A 1V3XA 4Q80A 1G3EA 4B73A 5FX6A 3M3VA 1NO9H 1SHHB 4ABJA 1HAZB 1MTNB 4AFSA 5AF9H 2B0FA 1TNHA 1J15A 1P03A 5DP4A 1DM4B 1ZPCA 2XWBI 2AGGX 2FM2A 2PUQH 2W5EA 3DD2H 1BTXA 1F0SA 1IOEA 3TGJE 1QCPA 1ETSH 1DWDH 2Y5GA 1K1LA 1GDQA 4K3JA 1YC0A 4TY7A 5ABWA 2NU3E 5HGGA 3O8RA 4NSYA 3PMAB 1JXPA 3RM0H 2GP9B 5EOKA 3E0PB 1O3FA 2QY0B 1O3EA 3RU4D 2GD4B 1BMNH 1GJ9B 1BMLA 1THSH 4YTAA 2WPMS 4KTSA 2R2WU 1GGDB 1O3OA 1TNGA 2Z9IA 2VJ1A 3GCHB 2XWAA 4Z0KA 4TPIZ 1QGFA 1T32A 1GG6B 2XBXA 1SL3A 1AE5A 2D26C 1UVTH 1BMAA 1SBWA 3ZZCA 2B8OH 1LKAA 1O38A 2XNIA 2R3UA 1DXPA 1GBIA 1QRZA 2C8XB 5FBEA 5JDUB 3M61U 3U8RH 1DICA 1FY8E 3SN8A 4XOJA 5A0CA 4NA7A 4D8NA 2BDIA 1SGIB 4Y11E 1QQ4A 3OTJE 1ZMLA 4ISNA 1NU9A 1ZTJA 3AVZA 1O2PA 3PROA
chains in the Genus database with same CATH superfamily
4Y10E 2EA3A 4I8LA 1UW7A 2FS9A 1AO5A 2F9VA 4ZROA 1FN8A 4AX9H 1WXRA 5LH8A 1YLNA 3RXCA 3EDXB 1WTGH 1GHYH 4MNYA 1GJCB 4FUFA 2CF8H 3OE7D 1HJ9A 3JZ1B 4WMDA 3DUXH 1PPHE 3A81A 4U30A 5C1YA 1ZMJA 1SLWB 1KXAA 1WSSH 2YMSC 2J9NA 1QTFA 2Z9JA 1O3DA 5FCRA 4DT4A 1E36B 1P8VC 3U8TH 4CRDA 2F9NA 5F53A 5EXLA 1QNJA 1VCWA 2PTNA 5GCHG 3E8LA 2VIOA 1E1QD 1AHTH 1RGQA 3RXRA 1TBQH 1C2GA 1C2KA 1Y59T 1W0YH 4AC9A 2Z9KA 2OLGA 5GJ4B 1CT4E 3SU4A 3GICB 1BMFD 1GHAF 3SGBE 2WV9A 3SQEE 2BD9A 3P8GA 4ZKSU 1VITF 4NGAH 2FOCA 1W0KD 3A80A 6ESTA 1K1OA 1BQYA 3SOSA 3UIRA 2PFEA 2FZZA 1YGCH 2Y5FA 1Q2WA 1ANEA 4H6TA 1ELGA 2P59A 2VINA 1DLKB 4U32A 1BJVA 1UCYH 7KMEH 2ZCKP 2XCFA 2XC4A 1GVKB 1ZR0A 5EXNA 2A45B 1GL1A 2QF4A 1BITA 3RXEA 2BD7A 4BNRA 3NZIA 1O3GA 2B7DH 1IHSH 4RT1A 4GVUA 2KZ4A 8GCHG 4RN6A 3QO6A 2G52A 1W10U 5K7RA 3K2UA 1DUAA 2Z94A 1T8OA 2GMTC 3FVFB 4JZFH 2D8WA 2L6OA 1K1JA 3RXGA 4B75A 3TNSA 2RDLA 1KLTA 1NN6A 3N7DA 1SFIA 2BDCA 2YMSD 1TMTH 1CGIE 1MAYA 1CA8B 2ZDKA 4A92A 1MH0A 1TPOA 5T6FA 1AB9B 3Q3XA 1A0JA 1O2ZA 4INLA 4AORA 2Z3DA 2C8WB 1BTPA 4ABBA 1O5GH 3SUFA 4ABDA 1ELAA 4CHAB 3MH7A 5SGAE 3GY6A 1GMCG 1SGYE 1OWDA 3I78A 2BZAA 2O8UA 2ZGHA 3GY8A 4X6MA 1PQ7A 2KAIA 1SOZA 2G8TA 2PKAA 1HAOH 3GS9A 1O3NA 2PHBA 4X1QU 1QR3E 3TJVA 2XCNA 1LDTT 1O2LA 1P3EA 3V12A 2PR3A 2NU0E 3VB4A 1DOJA 2K8IA 2ZGJA 4MPUA 3PYHA 4IC5A 4DOQA 2V7QD 2OC8A 1TRYA 1VGCB 2O8TA 2UUJB 3BTFE 1OP2A 4MNVA 5C0UA 3LDXH 3H7TA 1Y3YA 3HGPA 5LPRA 2BD5A 2AIQA 3AASA 1HAXB 1K1NA 4AG1A 1PQAA 1O39A 2J98B 3GY3A 2JETB 1BTZA 2XOKD 3VGCB 3VB6A 5AFZH 2BMGB 5ETXA 4GHQA 2FYRA 1JBUH 2A4GA 4ISOA 2M5TA 4FUDA 3GYLB 1EATA 1SI5H 5F8XA 3MH4A 5HMAA 3P70B 3SU0A 2ZHEH 2H2ZA 3R3GB 2QF0A 2ANWA 3UAIC 2R3YA 1FJSA 1XUJA 4MTBA 2O8LA 1CA0C 2ZHQH 3SJIA 2PUXB 4XDEA 1O2XA 1WBGB 1YKTA 3DA9B 5C5OA 1AKSB 4E7NA 1ZTKA 1MABB 2BVSH 1TA6A 1QBNA 4KP0A 2O8WA 4IMZA 1SSXA 4Q7XA 4F49A 2K1QA 1TABE 1TOMH 2JH5D 2JH0D 5CDFE 1TX6A 1EP6A 1E37B 1KLIH 3LC5A 2HVYB 1BTWA 2ZDNA 1WAYB 1C2IA 3BTEE 1GBLA 3ZVDA 1HCGA 1BIOA 3N99A 2ZIQH 2OC1A 1QQUA 1EOJA 1MU8B 4LZ1H 1O2YA 1AZ8A 1OP8A 1RXPA 1UVSH 1UVOA 2AGIX 1P05A 3ATIA 2HWLB 3BEFB 1Z8GA 1EUFA 3SV9A 3HK6B 1BJUA 1TGSZ 3GCHC 2BX4A 2XC5A 3TJUA 2DE8A 1NT1A 2G5NA 1OPHB 3UR6A 3RXUA 1TFXA 3AAVA 2WSSD 1QJ6B 3BF6H 2BY6X 2CF9H 4INKA 3ZYEA 4Y8ZA 4OS2A 2VH6A 3HATH 1LVBA 1EFRD 1ZRBA 3A7ZA 4NG9H 1HPGA 2ASUB 2QGRA 2F9PA 3WW7A 1ELCA 3M3SA 3TU7H 4CH8B 1A2CH 2GTBA 4X8TH 2QN5T 4O9VA 3SUEA 4ASHA 1DY9A 1QL8A 4ZKOU 1SKYE 1GBKA 2G5VA 2TBSA 4YOGA 1C5OH 2WPJS 2BD3A 5E0JA 3A7TA 4TPYA 4Y79A 1RFNA 3GCTF 2ZFSA 3HKJB 3Q00A 5EXMA 1QA7A 2ULLA 2RA3A 1FY5A 3ZZ3A 4J2YB 4HTCH 1O3IA 2AMPA 1ELEE 4A6LA 2V3MA 1LMWB 1AE8H 5DJ7A 5DPAA 1O34A 1TYNA 1P57B 3NWUA 3SU2A 1TMUH 1YPHE 3EA8A 4I8HA 1GBHA 1O2WA 1O3LA 4KTCA 3MU0A 5F8TA 3BTKE 1AUTC 1UO6A 2F4LA 1S82A 1BRCE 3RMNH 3DCLA 5GPIB 1GMHF 1SR5C 4K69A 1NBME 3MNBA 1OWHA 5EGMA 3IITA 3RMMH 4YLUA 5EJZA 2A4QA 1DFPA 1TONA 3EE0B 4FUIA 5HIZA 1LO6A 2XC0A 5FBIA 3SO3A 7GCHF 3MO6A 2KCOA 1YPLH 1KYNA 2ALVA 1AVGH 4OS6A 3EE7A 3KNXA 1GPZA 2A1DB 2F9OA 1W0ZU 3TIUA 2PLXA 2BLWA 2D2DA 1P3CA 2ZTXA 1DVAH 1DDJA 2OC7A 2HRVA 5EQSA 2YMSB 2J38A 1G2LA 2KX4A 1GBMA 1G37A 2HPPH 4NIXA 1ORFA 3TVJB 2F91A 5E2OA 5FX5A 3LGIA 2XYAA 1ID5H 2P94A 3SNAA 4UONA 2A7JA 3RXFA 4CR9A 2ANMH 2GVFA 4Q63A 1E38B 1A7SA 1SQAA 1MZDA 1LVOA 5GXPA 2C3SA 1SQRA 2ZDAH 1T8LA 2JJ1D 2WYJA 1W2KH 4WXIA 4UFEH 3M3TA 3DSOA 3T5FH 4FUCA 1O2IA 1TPAE 1A46H 3MTYA 2SGFE 2H5DA 4BTIB 2SGQE 3UOUA 1C4U2 1V2ST 2Z9LA 2BHGA 3QZRA 2GDEH 4FUGA 1O2HA 3F68H 1LPZB 1ZZZA 2VWLA 4D7FA 4D9RA 1SMFE 4CH2B 5LPEA 1F2SE 2AERH 1TNLA 1AB9C 1DX5M 3BEIB 2ZFTA 3S9CA 3UR9A 1XXDA 4ZH8A 1GJ4H 1IQJA 1Z8JB 1JOUB 4TT3D 4UFGH 1TAWA 3OY6U 4JZEH 2GZ8A 1Z1IA 4AFQA 1T31A 3UOPA 5J4QA 1MU6B 2GMTB 1UHBA 3NK8A 2VIVA 3VG8A 4F48B 2BQWB 5C20A 1ZRKA 1XMNB 2QYIA 1J8AA 2VIPA 3DSGA 1IQNA 1UTQA 1UTJA 3UNSA 1BBRK 1GI6A 4Q7ZA 1UVPA 2IJOB 1ABJH 4ZHAA 1GJAB 3LGYA 1H4WA 4RKOB 1BT7A 2SGPE 2BZ6H 4R0IA 4Z6AH 5DP5A 3RXKA 2CGAA 1XX9A 1YLCA 1ZGIA 4YOJA 3ZZAA 1TBRH 5A0AE 3A7WA 2BDAA 4B1TA 1HIAB 3F2HA 1L1JA 5T6GA 6CHAC 5C67A 1ETTH 1C5YB 1NFUA 3KIDU 3SNCA 1ANDA 1RIWC 4Y7BA 3L33A 1O2VA 4NWKA 1HXFH 1KLJH 3QN7A 4QT8C 2JETC 1G36A 1O2MA 2ZU3A 3SZEA 5ESBA 2HLDD 5KGOA 3KQBA 4KGAA 1H8HD 4A5TS 2Y82A 2HNTE 3FOAA 3LU9B 2SNWA 1FPCH 3E90B 1FLEE 1W12U 5EU8A 1EJNA 5JBAS 5BPEA 1C1RA 1SLXB 5A8YA 4FU7A 5TCCA 1AI8H 3PLPA 4GCHG 1C1SA 4D76A 1SLUB 4XBDA 5KEDA 1LHFH 3T29A 1SB1H 1O2GH 2VIDA 2ZFQH 2FEQH 2YOLA 3N7OA 3QWCH 4ISIH 4X1NU 3UNRA 3QUMP 1ANCA 1FY4A 2ZGBH 5HKKD 3GDSA 2JJ2D 1DWEH 1HBTH 3MFJA 1UCYK 4BAQB 4I8JA 1NRQH 1CA0B 3F1SB 1RTKA 1E79D 2W7UA 3PWCA 4ESTE 4M7GA 4Y76A 4Z1MD 1EPTA 1OXGA 3W94A 3CP7A 1SGDE 1WUNH 2NU1E 1ELDE 3RLYH 3P92A 4ZHLU 2BD2A 2VIWA 3GISB 2WPHS 3UY9A 4H42U 1THPB 3RC5A 4X8VH 2BVXH 1ZJKA 1TX7A 2FI4E 1V2VT 3MO9A 4FVDA 3RMOH 1GWAA 1QA0A 4K1SA 8KME2 1BTHH 2ZG0H 5LPFA 5AFYH 2ZKSA 1EZSC 1XUFA 1M9UA 4JZIA 4D7GA 1CHOG 2ILNA 1C9TA 3T28A 1IHTH 1UTOA 2BLOA 2OBQA 2FMJA 2UUFB 1GI8B 1ESAA 3M5LA 2FOMB 4AOQA 2A31A 3FKSD 3PMJA 2SNVA 1P11E 3W1EA 2C8ZB 4B6FA 3MI4A 1AGJA 5FL7D 1E35B 3SJOA 3I29A 2D1JA 5G4BA 3RUOA 4ZCNA 3ZZ7A 5JB9S 3E3TA 1Y3WA 3G01A 2VGCC 1Z71A 2KCAA 2TIOA 3P6ZB 3P95A 2GV6A 1HRTH 1BRBE 4NWLA 1O2NA 4CBOA 1DXWA 2HGTH 2VVUA 1H8IH 2VIQA 1LQDB 3TGKE 1YPKH 2ZQ1A 1HYLA 3A87A 3I77A 1W13U 4WJG2 5L30H 2G4UA 1C1WH 1C2DA 3KF2A 2STBE 5EQRA 3A88A 1KDQA 5DN6D 3D62A 4I33A 4AFZA 4BANB 2SFAA 1TGCA 3M5OA 2R9PA 3MNCA 2P3FH 3IG6B 1QHRB 1BBRH 2P3UB 1P2NA 3GCOA 1T7CA 3FO8D 5AVDA 2CHAC 1ABIH 4A1TA 1H9HE 1C5WB 5A0BA 3AK5A 4IW4E 1DLEA 1P0SH 4J1YA 4MVNA 2EI6A 2PGQB 2ZHDA 5E8EH 3KQDA 2FOGA 1Z6EA 5E0GA 5DKMA 2Y7ZA 1SGQE 2H5CA 5CMXH 1VJ9U 5DP6A 1AY6H 3RXTA 3A83A 2J4IA 3UB0A 1K21H 1P01A 4AN7A 1VCPA 1K1MA 1FDPA 4NIYA 1DUEA 3QX5H 2ZGXH 1NFYA 2BM2A 4YT7H 2IN2A 2GGVB 3GOVB 3PV2A 5HM9A 1MTSA 2ZPSA 5C1UA 3FP7E 2FPZA 2Y80A 2QXGA 1Y5UT 3O8DA 4YXWD 2C8YB 4CR5A 1GBFA 1B5GH 1RTFB 1Y3UA 3MOCA 2ZC9H 5TJXA 4FU9A 4Y7AA 2GT7A 1LVYA 7ESTE 1CT2E 1IQIA 1L1GA 1LHEH 1O2SA 2I6QA 2XXLA 3IWMA 3MU5A 2G51A 3K6ZA 3P17H 4ZKNU 3ZZ9A 4AB9A 4TWYA 3QLPH 1QL9A 4E05H 2BDBA 4IN1A 1A5HA 2HLCA 3EA7A 2FOAA 2A7HA 2ZU2A 3E6PH 3ZZ8A 2HPQH 1YBWA 4Y8YA 5DG6A 4XBCA 5C2ZA 3A8DA 1GBAA 3VPKA 9ESTA 1S0QA 2HALA 2WHXA 2ODPA 2K0QA 4LK4A 2G00A 1GJ5H 1SC8U 3QTVH 4NSVA 1O3CA 3ZVFA 5FPSA 3SV6A 5ESTE 1AZZA 2Y6TA 4OM9A 2V3OH 1Y3VA 1FY1A 2ZU1A 1NFXA 2P8OC 3WY8A 1SGNE 1Z8IB 1QZ8A 3UUZA 3RXVA 3K6YA 1NTPA 3R0FA 1K2I1 1ETRH 2WPIS 3F9FA 3SORA 2AIPA 1ZHRA 4XD7D 2FTMA 1T4VH 1GJ6A 3W95A 4X8UH 3MYWA 4Y0YE 5FXLA 2SGEE 1LHCH 3S9BA 1OSSA 2BY8X 3P8OA 3NUMA 1DE7H 2FX4A 1C5TA 3RP2A 2HOBA 4OS7A 4WY3A 4K60A 2ALPA 2ZA5A 3NRLA 4AYVB 1O2UA 2ODYB 4ZXXH 1S6FA 5BRRE 2LNCA 3VB3A 1GBDA 4IC6A 1D3TB 1VCQA 1PQ8A 1XUHA 1CVWH 1KXFA 3E16B 4WVPE 3FP6E 1UK2A 2ZF0H 5HXFA 1UTMA 1W8BH 1UCYE 3GY5A 4NZQA 4ACBA 1FUJA 1AD8H 1C1MA 3SJ9A 1CGJE 1UHBB 3NPSA 2NU2E 1F92A 3MH5A 4INHA 1IQFA 1CBWC 4E7RG 3F6UH 1WYKA 1GVZA 1LPGB 1MQ6A 1BB0B 1TGTA 1YPHC 2F3CE 4XBBA 2J92A 1AWFH 2QXHA 3H5CB 2O8MA 2J34A 6GCHF 2ZWLH 2GDDA 1F0TA 1JIRA 1YLDA 1N1LA 2P16A 1O2JA 2BY5X 2IJD1 1NS3A 1TQ0B 1ZSKA 6CHAB 2ZPQA 1GHAG 1RIWB 3SBKA 1VITG 3T27A 2C90B 3LONA 3TH4H 1NC6A 1G3DA 4B71A 2ZU4A 3GDUA 1A0LA 1HAYB 3DSPA 4IGDA 1C2EA 4JK6A 1GHWH 1WU1A 2XBYA 1LCYA 1TQ7B 2BVRH 4NIVA 1G30B 5EPYA 1VJAU 1WV7H 1YPGH 2UWOA 4ZXYH 2IPQX 1O3KA 4OGXA 2CN0H 1AIXH 1GHZA 3MNSA 1ZGVA 3UWIA 1GCDA 2BQ7B 1K0HA 5A09A 1CU1A 1O35A 1MD7A 5E2PA 1D6WA 4X2XA 1HAPH 2F83A 2AMQA 3SYJA 1HUTH 1DITH 2WPKS 2H1UA 2FOBA 3M7QA 3A89A 1EZUC 3BTME 1S84A 2OC0A 3QGJA 1GJ7B 6LPRA 3BTTE 4Q4LA 4BOHA 1QY6A 1V2JT 3ODFA 3F2FA 1OWIA 3QK1A 1IQEA 2PSXA 1GI9B 2Q6DA 3KCGH 5DP8A 3GDVA 4X6NA 1C5LH 1WQSA 1ARBA 4OS4A 2PTCE 4A1VA 1FAKH 1VZQH 1BOQA 2UWLA 4IN2A 2BOKA 1KSNA 3Q3KA 2UUYA 5J4SA 2V0BA 3STIA 1Y5AT 4I8KA 4RKJB 2GJGA 3RXPA 1NBMD 1TGNA 4WH8A 1FXYA 3LGTA 2UUKB 2G4TA 1AN1E 3ODDA 2XNDD 2A4RA 5EODA 1O2TA 2BX3A 3Q3YA 4KELA 3CS0A 4OS1A 1V2WT 1QRXA 1O3BA 3OX7U 1AWHB 5C17A 2BB4A 1A61H 4FVBA 3GY4A 2BXUH 9LPRA 5IYTA 4UEHH 1SG8B 1O30A 3MU4A 3ZVGA 5I46H 2UWPA 2VGCB 4E06H 1AMHA 4OGYA 2FI5E 1W3CA 3SI4H 4NFEA 1NRRH 2EC9H 4H4FA 3CENA 3SGAE 3RXMA 2BLVA 3FFGA 1D4PB 2FO9A 1C5SA 3KL6A 2Q1JA 3ESTA 3LKWA 4U01A 3V7TA 2EY4C 4NA8A 2GT8A 1V2TT 4RI0A 1B7XB 4BAOB 1ZTLA 2ZP0H 4BAMB 4KKDA 4NFFA 3ELAH 2AHME 4FU8A 4CRBA 1RD3B 3PRDA 1HNEE 1C9PA 2QC2A 5B6OA 1FY3A 1A1RA 5LGOA 1KDQB 4O3UA 2CHAB 2Z6BD 1P2IA 2HNTC 2OP9A 5GWZA 1MMJN 1C2MA 1F5RA 3M35A 4TY6A 3A85A 1ACBE 1YPJH 3MU8A 4UD9H 1CSOE 4CRFA 1EZXC 1SLVB 2A5IA 3M5NA 3PMHB 1SGFG 3ZZ4A 1QRWA 1THRH 1W11U 1RTLA 4X6PA 2J95A 3F2GA 4NA9H 1TALA 5K0HA 4I7YH 1C5MD 1WOFA 1Y8TA 3ZV8A 1LPKB 3EGKH 1TNIA 4X1SU 4I86A 1QBOA 1QFKH 1OWJA 4IS5A 1G3CA 4X2VA 1LTOA 1BMMH 1PJPA 1F0UA 1FIWA 1AQ7A 5FAHA 4VGCC 1C1TA 1Z7KA 1XXFA 1C1OA 5DGJA 1GHBF 3VB7A 1GDNA 1V6DA 1UTKA 5FCKA 3T62A 1MUEB 2BQ6B 3UFAA 1BHXB 3OY5U 1GHXH 3RXBA 4YOIA 3A7VA 1O5EH 1LHDH 5C1XA 2VWMA 3A8AA 1TLDA 1IQKA 1UK4A 2OQUA 1CT0E 1UTPA 2AEIH 2DUCA 3P8FA 5A2MH 2GCHF 1GMDF 2FS8A 1O37A 1S85A 3H7OA 4B2BA 1EASA 1TGBA 2ZO3H 5DSFA 5JYIA 5JPMH 1HV7A 2HVXA 3TK5A 1GI0A 3PV5A 1GHVH 3SW2B 3GCTG 4WH6A 1J9CH 1S83A 4Q2KA 1PPZA 4WWYA 2NU4E 1MAXA 2P8OB 2RCEA 4YLQH 1GJ8B 2FIRH 2ZCLP 1QB6A 4HFPB 3TJOA 1DANH 1C5QA 4KTUA 2CV3A 2F43B 3E1XB 1O2QA 1XVMA 3U98H 4YM9A 1W14U 3ZV9A 4F4OC 3HK3B 2Z9GA 1FNIA 1GMHG 1FN6A 4O97A 1BUIA 4A1XA 1S81A 5DP3A 2F9UA 1MTUA 1Q31A 5DP9A 2FLRH 1ZPZA 1GI5A 3U1JB 1TE0A 1ZSJA 7GCHG 2PSYA 3RXOA 1KMHB 3L6PA 5EW2H 3FAOA 1D3DB 4WMFA 1AFQC 4MQAA 2P95A 2TRMA 1P9UA 3PO1B 3K65B 4X1RU 4Q7YA 1HXEH 3SHCH 1TPPA 3OTPA 2TGTA 3F9EA 1SGTA 1O5FH 1AVXA 1QL7A 3PM3A 1L4ZA 1F5KU 4YO9A 3MH6A 2A7CA 1WQVH 2IPHA 4THNH 1E1RD 1LKBA 4XE4A 2J98A 1CBWB 1UTNA 2KAIB 2PKAB 2Q6FA 3LGWA 4UDWH 5JB8S 3U9AH 3B9FH 1JMOH 3MU1A 2R0KA 1RS0A 3MQKC 1IQMA 2AH4X 1W7GH 4DGJA 3RXHA 4K8BA 3M37A 4FUHA 2WUCA 4ZUHA 3HPTB 4Y0ZE 4D9QA 1SGFA 1W7XH 2VBCA 4BAHB 2A32A 1F7ZA 1HLTH 1OYTH 3BTWE 1AKSA 1TNKA 5H4IB 2ZTZA 3SNEA 2AFQB 1O36A 1D3QB 3LC3A 1H9LB 2QF3A 2LP6A 4ABHA 2VB0A 1U6QA 1C1UH 5EJ1A 1GBJA 1ZPBA 3CS7A 3TJNA 1SVPA 1GBTA 1TRNA 5C3NA 2QF5A 1ZLRA 2G55A 3KN2A 4DVAU 3LIWA 2Y81A 2PKSC 2OUAA 3OSYA 3MHWU 8ESTE 3F9HA 4CRCA 4R8TB 2A2XH 2OINA 4GUXA 1OHHD 5HM2A 2GX4A 4I32A 3A8CA 1NZQH 1EJAA 3GY2A 1NRSH 1SOTA 3UQOA 3KQEA 1GCTC 3FZDA 1EPTC 1PPCE 1MKWH 2FLBH 3ATMA 3SNBA 2CK3D 1X7AC 3BIVH 1G32B 5CHAC 1HJAC 3BG8A 4YESB 3ZZBA 4TSFD 3VXFH 2W6JD 2VWNA 5GCHF 1ZOMA 5A8ZA 1KXDA 1P09A 4PROA 1F0RA 3BTHE 3ZIAD 2PGBB 4JMYA 4A7IB 1C1PA 4H6SB 2Z3CA 4HZHA 3TH2H 3V0XA 2JKHA 3BV9B 3PMBB 1UVUH 3U1IB 1BDAA 5F03A 1AU8A 1KXBA 1DPOA 2KFWA 4BAKB 3RXLA 1EB1H 1GI1A 4UFFH 1O31A 1P04A 2FYQA 1PPBH 1QJ7B 2TGPZ 1CE5A 1GBBA 2ZECA 1SGPE 3E0NB 1OX1A 1O0DH 4NZLA 4B6EA 2L74A 2A5AA 1XUGA 1HGTH 1P10A 1GJBB 2ZZUH 2A0QB 2ZDVH 1EAIA 3RXSA 4OS5A 1FZZA 1TMBH 1WTHD 1ARCA 8GCHF 3KGPA 2SGAA 4AG2A 5C94A 3FANA 2TGAA 1ZHMA 3U8OH 3MNXA 1HB0B 3ATLA 2FODA 1SPJA 5E0HA 2A5KA 3MMGA 4BTUB 3VXEH 4Y6DA 2YNBA 5EQQA 3S7KB 4AB8A 5TCAA 1H8DH 1C5RA 1YYY1 1SQTA 1YPMH 2C4FH 4O03A 4X0WU 4DJZB 3D23A 1HAGE 1V2OT 2QXIA 3VEQB 1WCZA 3SU1A 1E0FD 2OCVB 5JBBS 1J16A 1OP0A 1C2JA 1GMCF 2BDGA 3HKIB 1YP9A 2ZCHP 3JZ2B 4MNXA 3RU4E 3SUDA 4B2AA 5EJLA 3F0PA 3TH3H 2QCYA 1XKBC 1MD8A 1DT2A 3F0OA 3ZVAA 1FPHH 1ZJDA 2KR7A 2O9QA 1SQOA 1G3BA 1GI4A 5CE1A 3EA9A 1O32A 3S7HB 1DSTA 3KEEA 1P12E 1L1NA 1KIGH 4HG6A 1BTUA 3AAUA 4JYTA 2ZI2H 1TIOA 1WDIA 2W3KA 1BBRE 1C1VH 1H8ED 1S6HA 2B5TB 2ZDMA 4SGBE 1DSUA 1JWTA 1XM1A 1EQ9A 3QZQA 2HNTF 4ISLA 5L2YH 1C2HA 4BXSA 3SHAH 4VGCB 1BRAA 3A7YA 3RM2H 1GBEA 1NESE 3M36A 1XVOA 2VNTA 4X6OA 1GVLA 3ZZ5A 1VR1H 2VH0A 1HAVA 1LHGH 1N8OC 5CHBA 1HAHH 2OD3B 1PPEE 3ZZ6A 3BEUA 1MZAA 3GCNA 3AW1A 1Q3XA 1IQGA 4Y71A 5GDSH 1FV9A 1MQ5A 1N6YA 3SGQE 1AUJA 4GAWA 3EYDA 4K1TA 1O5CB 3S9AA 3NKKA 4GHTA 1MKXK 4XFQA 2CJIA 1QBVH 3T25A 3BG4C 5DK1A 1ZSLA 1C5NH 5F8ZA 5C0TA 1O2OA 2M2AA 3DFLA 2ZHFH 4O3TA 3UNQA 2VVVA 2W26A 5KECA 1KTSB 1GI2A 1NRPH 2BLQA 4JYUH 2AMDA 1K22H 1EP5A 4ZHMU 4CRGA 3L3TA 2BTCE 2W7SA 1JIMA 2BXTH 3PO1C 1G2MA 5JBCS 2AYWA 1K9OE 2OBOA 3U28C 1O5BB 2R0LA 2W3IA 3SQHE 1HIAA 2H9TH 1SGRE 4ABAA 1ESTA 1EX3A 1O5AB 4ACAA 1HDTH 1EOLA 1V2UT 2GCTC 4YT6H 4WF8A 5EIYA 2ZFRH 3BTDE 1TWXB 3RU4T 2XBVA 2QXJA 3URDA 1DWCH 4LXBH 3M7TA 4GLYA 4AZ2B 1O3HA 1AFEH 1NU7B 1H9IE 2THFB 4ABEA 1JRTA 1V2MT 1QJ1B 1AFQB 1S5SA 2FESH 4BXWA 1P2QA 5EPNA 2J94A 3SNDA 1BCUH 2F9BH 1NROH 4FUJA 1QIXB 4RSPA 3S69A 1TBZH 3GYMA 4MLFB 1XKAC 3RLWH 3SU3A 3TGIE 4I8GA 4K1EA 1F5LA 1FIZA 1ZMNA 2YNAA 3PTBA 2WPLS 1PFXC 1A4WH 2Z7FE 4SGAE 1NPMA 4WXVA 2FTLE 1D9IA 3SV2H 1EB2A 2H9EH 1XUKA 5L6NH 3B23B 3SU5A 1GDUA 2Y5HA 4X8SH 1C5ZB 1OOKB 3K9XB 3T2NA 1OWKA 3STJA 4K8YA 1GJDB 1C1QA 2BY9X 3F9GA 4I31A 1NM6A 1DWBH 3UWJH 1ELBA 3WWFA 1FI8A 4DT7B 1OS8A 2JH6D 1A3EH 2AS9A 2H9HA 2VVCA 1GI7B 4ABIA 1LVMA 5AHGH 1YPEH 8LPRA 2A2QH 3A86A 1MCVA 3Q76A 2QAAA 1GI3A 5EG4A 3C1KA 3O8BA 1FX0B 2QIQA 1K1PA 3QDZB 4AGJA 1MTVA 3BTGE 1YCPM 5B6LA 4DIIH 2FOHA 3LH3A 2W6ID 2R2MB 3PLKA 2PKSB 2FP7B 3PLBA 3A8BA 1BRUP 3O8CA 4TWWA 1MTNC 1TX8A 1TRMA 2FI3E 3F3BA 3OU0A 2PWXA 2OXSA 3KQCA 1BTYA 1GCTB 2EEKA 1EPTB 2BY7X 2DE9A 1O2RA 3C27B 1CGHA 2B9LA 1E34B 2KM0A 4HI3A 5CHAB 3T26A 2ZNKH 1HJAB 2P93A 3UREA 1CQQA 4MPXA 4ZKRU 1TB6H 3QGNB 2BD8A 1C4V2 1CO7E 1GGDC 3DFJA 5DO4H 2BOHB 1LQEA 4JZ1A 1D6RA 1KXEA 5HYOA 2RFKC 1VKYA 4FETA 2ZPRA 1MKXH 1TOCB 1SFQB 3KYGA 1GG6C 3LGUA 1BA8B 2XRCA 3MO3A 6GCHG 1TA2A 3LGVA 3A84A 1KY9A 2GZ9A 3ATKA 1C5XB 5JBTA 3UQVA 1S0RA 4AGKA 2G81E 2XW9A 4ISHH 2EI7A 1V2KT 1T8NA 1TNJA 1SGEE 5F6MA 4AYYB 1KXCA 3D49H 2ZTYA 4MPWA 3ZVEA 1O3JA 1D3PB 3SV8A 1A0HB 2WINI 4Y8XA 1N6XA 3BSQA 3U69H 1A5GH 1KTTB 1IQHA 1C4Y2 4FXGH 3SZNA 3AW0A 3V13A 1HAIH 5EW1H 1SHYA 3SJKA 1O2KA 2SGDE 4P00A 4XRNA 5FPTA 4FUBA 2STAE 1OYQA 2OTVA 2ESTE 4NCYA 3ZVCA 3CNRA 2ZGCA 2J5UA 4FOUC 3RC4A 1TPSA 3TITA 5I25A 1Z8RA 1O3AA 1V2RT 3PRBA 2ANKH 1C2LA 1YCPK 1G9IE 2RG3A 1ELFA 1BZXE 1EAXA 1MBQA 1ZHPA 3VB5A 3DT0H 1CHGA 3A7XA 1FMGA 1P02A 4TYDA 3URCA 1PYTC 4MDSA 3KHVA 2QA9E 3BIUH 1INCA 1JRSA 3E91A 1O3PB 1FONA 2PW8H 3BN9A 2Y7XA 3PTNA 4K2YA 2V35A 2GZ7A 4AFUA 1COWD 3EQ0H 1ANBA 2BYAX 2ZQ2A 1RRKA 1UK3A 2ZU5A 3UPEA 2RA0A 4FUEA 1V2PT 4GSOA 3NCLA 4IMQA 2Q6GA 3RXDA 3PB1E 3ITIA 1Z1JA 1OKXA 1T4UH 5T3HA 1MTWA 3SV7A 2WV5A 3LH1A 3GY7A 4DIHH 1MKWK 1P2MA 1O3MA 1RJXB 2WPDD 1V2NT 2FXRA 3RC6A 3RXIA 4CREA 4LOYH 2LPRA 1ESBA 4CRAA 1EKBB 3LPRA 3KQ5A 3M7UA 2V6NA 4DW2U 1O33A 2FOEA 2P3TB 5C5NA 3EAJA 1ELVA 1OWEA 4M9FA 4XSKU 1DY8A 1HJ8A 2WZQA 1HFDA 1J14A 4GCHF 4DY7B 3OFND 2NWNA 1PPFE 4B2CA 1P06A 4RT0A 3SUGA 3RXJA 3LT3A 5IDKA 3ZZDA 1N8OB 1BHXF 3HGNA 2AGEX 1C5VA 2C93B 2XTTB 2OK5A 1A5IA 1W0JD 4IBLH 3V3MA 3SJ8A 3PWBA 2CMYA 2LELA 4UFDH 4DG4A 1C1NA 1H1BA 1HAVB 2ODQA 4X2YA 2WYGA 4K5ZA 1EXFA 1UMAH 1K1IA 1PYTD 2VU8E 2EQNA 1O5DH 4X1PU 1QB1A 2KCYA 3BG4B 4JK5A 3ENSB 2TPIZ 4X2WA 2J2UA 2PP6A 3N7EA 3RDZA 1VITH 4CHAC 2ZEBA 1P2JA 5FPYA 5T6DA 2V3HH 5A8XA 4ZMAH 1YWUA 3B8JA 2QE7D 1C5UA 2TGDA 3P8NA 1UTLM 1CHOF 1MCTA 1Z6JH 3NXPA 1ZYOA 2ZDLA 1UJ1A 1NFWA 3M5MA 3RXQA 1YF4A 1ELTA 2I6SA 2PV9B 3QTOH 4ABGA 3TK6A 1MBMA 1IAUA 1PQ5A 3TPIZ 2IOTA 3UTUH 2A4OA 5GIBA 3TK9A 3DHKH 4ZAEA 4MPVA 2GCTB 1EAUA 5T1VA 2RDEA 2FX6A 2EI8A 4MNWA 2ZFPH 1VGCC 3S0NA 2WV4A 1XUIA 2Z3EA 4YZUA 4LZ4B 2BDHA 2BD4A 1Y5BT 1QURH 2CXVA 1FAXA 4JCNA 2GKVE 1FQ3A 2BDYA 1K28D 1EAWA 3SU6A 1P2OA 2H6MA 1GHBG 3VFEA 1EZQA 3LJJA 3BTQE 1V2QT 3VGCC 7LPRA 1T8MA 2QV1A 1NY22 3TNTA 3FZZA 1S6LA 1YCPH 1B0EA 3RMLH 3OYPA 3OAAD 4F55A 1P9SA 3MWIU 2XBWA 2FDAA 4BTTB 4DCDA 2ZFFH 3LJOA 3LOXA 1J17T 4CBNA 3SI3H 1IQLA 1GBCA 2GCHG 4U2WA 5PTPA 1GMDG 1SGCA 4JYVH 1Y3XA 1L2EA 1C2FA 1EJMA 3FP8E 4B74A 5L2ZH 1YM0A 2ZHWH 3ATWA 1B0FA 2OQ5A 3A82A 1C5PA 1PPGE 3Q77A 2FOFA 2VWOA 4MG3A 3RXAA 4HGCA 1NRNH 5FHTA 4GPGA 2ANYA 4B76A 1QB9A 5DP7A 1V2LT 2FWWA 2GV7A 3ZVBA 2JDID 3ZYDA 1A3BH 3TLOA 1P2KA 1DS2E 1L4DA 4NIWA 4JZDH 4DURA 5HIYA 1L0ZA 1AVWA 4WMEA 1GL0E 4UE7H 2WUBA 3D65E 4ABFA 3PV4A 1V3XA 3FN8A 1YY3A 4Q80A 5IK2D 1G3EA 4B73A 5FX6A 3M3VA 1NO9H 1SHHB 4ABJA 1HAZB 1MTNB 4AFSA 5AF9H 2B0FA 1TNHA 1J15A 1P03A 5DP4A 1DM4B 1ZPCA 2XWBI 2AGGX 2FM2A 2PUQH 2W5EA 3DD2H 4P02A 1BTXA 1F0SA 1IOEA 3TGJE 1QCPA 1ETSH 1DWDH 2Y5GA 1K1LA 1GDQA 4K3JA 1YC0A 4TY7A 2KCPA 5ABWA 2NU3E 5HGGA 3O8RA 4NSYA 3PMAB 1JXPA 3RM0H 2GP9B 5EOKA 3E0PB 1O3FA 2QY0B 1O3EA 3RU4D 2GD4B 1BMNH 1GJ9B 1BMLA 1THSH 4YTAA 2WPMS 4KTSA 2R2WU 1GGDB 1O3OA 1TNGA 2Z9IA 4ASUD 2VJ1A 3GCHB 2J97A 2XWAA 3WWBA 4Z0KA 4TPIZ 5GNDA 1QGFA 1T32A 1GG6B 3KYFA 2XBXA 1SL3A 1AE5A 2D26C 1UVTH 3H09A 1BMAA 1SBWA 3ZZCA 2B8OH 1LKAA 1O38A 2XNIA 2R3UA 1DXPA 1GBIA 1QRZA 2C8XB 3OEED 5FBEA 5JDUB 3M61U 3U8RH 1DICA 1FY8E 3SN8A 4XOJA 5A0CA 4NA7A 4D8NA 3OEHD 2BDIA 1SGIB 4Y11E 1QQ4A 3OTJE 1ZMLA 4ISNA 1NU9A 1ZTJA 3AVZA 1O2PA 3PROA 2JIZD
chains in the Genus database with same CATH topology
4Y10E 2EA3A 4I8LA 2FS9A 1AO5A 2F9VA 4ZROA 1FN8A 4AX9H 5LH8A 3RXCA 3EDXB 1WTGH 1GHYH 4MNYA 1GJCB 4FUFA 2CF8H 1HJ9A 3JZ1B 4WMDA 3DUXH 1PPHE 3A81A 4U30A 5C1YA 1ZMJA 1SLWB 1KXAA 1WSSH 2J9NA 1QTFA 2Z9JA 1O3DA 5FCRA 1E36B 1P8VC 3U8TH 4CRDA 2F9NA 5EXLA 1QNJA 1VCWA 2PTNA 5GCHG 3E8LA 2VIOA 1AHTH 1RGQA 3RXRA 1TBQH 1C2GA 1C2KA 1Y59T 1W0YH 2Z9KA 2OLGA 5GJ4B 1CT4E 3SU4A 3GICB 1GHAF 3SGBE 3SQEE 2BD9A 3P8GA 4ZKSU 1VITF 4NGAH 2FOCA 3A80A 6ESTA 1K1OA 1BQYA 3SOSA 3UIRA 2PFEA 2FZZA 1YGCH 2Y5FA 1Q2WA 1ANEA 4H6TA 1ELGA 2P59A 2VINA 1DLKB 4U32A 1BJVA 1UCYH 7KMEH 2ZCKP 2XCFA 2XC4A 1GVKB 1ZR0A 5EXNA 2A45B 1GL1A 1BITA 3RXEA 2BD7A 4BNRA 3NZIA 1O3GA 2B7DH 1IHSH 4GVUA 8GCHG 4RN6A 3QO6A 2G52A 1W10U 5K7RA 3K2UA 1DUAA 2Z94A 1T8OA 2GMTC 3FVFB 4JZFH 2D8WA 1K1JA 3RXGA 4B75A 3TNSA 2RDLA 1KLTA 1NN6A 1SFIA 2BDCA 1TMTH 1CGIE 1MAYA 1CA8B 2ZDKA 4A92A 1MH0A 1TPOA 5T6FA 1AB9B 3Q3XA 1A0JA 1O2ZA 4INLA 4AORA 2Z3DA 2C8WB 1BTPA 4ABBA 1O5GH 3SUFA 4ABDA 1ELAA 4CHAB 3MH7A 5SGAE 3GY6A 1GMCG 1SGYE 1OWDA 3I78A 2BZAA 2O8UA 2ZGHA 3GY8A 4X6MA 1PQ7A 2KAIA 1SOZA 2G8TA 2PKAA 1HAOH 1O3NA 2PHBA 4X1QU 1QR3E 3TJVA 2XCNA 1LDTT 1O2LA 1P3EA 3V12A 2PR3A 2NU0E 3VB4A 1DOJA 2ZGJA 4MPUA 3PYHA 4IC5A 4DOQA 2OC8A 1TRYA 1VGCB 2O8TA 2UUJB 3BTFE 1OP2A 4MNVA 3LDXH 3H7TA 1Y3YA 3HGPA 5LPRA 2BD5A 2AIQA 3AASA 1HAXB 1K1NA 4AG1A 1PQAA 1O39A 3GY3A 2JETB 1BTZA 3VGCB 3VB6A 5AFZH 2BMGB 5ETXA 4GHQA 2FYRA 1JBUH 2A4GA 4ISOA 2M5TA 4FUDA 3GYLB 1EATA 1SI5H 5F8XA 3MH4A 5HMAA 3P70B 3SU0A 2ZHEH 2H2ZA 3R3GB 2QF0A 2ANWA 2R3YA 1FJSA 1XUJA 4MTBA 2O8LA 1CA0C 2ZHQH 3SJIA 2PUXB 4XDEA 1O2XA 1WBGB 1YKTA 3DA9B 5C5OA 1AKSB 4E7NA 1ZTKA 2BVSH 1TA6A 1QBNA 4KP0A 2O8WA 4IMZA 1SSXA 4Q7XA 4F49A 2K1QA 1TABE 1TOMH 2JH5D 2JH0D 1TX6A 1EP6A 1E37B 1KLIH 3LC5A 1BTWA 2ZDNA 1WAYB 1C2IA 3BTEE 1GBLA 3ZVDA 1HCGA 1BIOA 2ZIQH 2OC1A 1QQUA 1EOJA 1MU8B 4LZ1H 1O2YA 1AZ8A 1OP8A 1RXPA 1UVSH 1UVOA 2AGIX 1P05A 3ATIA 2HWLB 3BEFB 1Z8GA 1EUFA 3SV9A 3HK6B 1BJUA 1TGSZ 3GCHC 2BX4A 2XC5A 3TJUA 2DE8A 1NT1A 2G5NA 1OPHB 3UR6A 3RXUA 1TFXA 3AAVA 1QJ6B 3BF6H 2BY6X 2CF9H 4INKA 3ZYEA 4Y8ZA 4OS2A 2VH6A 3HATH 1LVBA 1ZRBA 3A7ZA 4NG9H 1HPGA 2ASUB 2QGRA 2F9PA 1ELCA 3M3SA 3TU7H 4CH8B 1A2CH 2GTBA 4X8TH 2QN5T 4O9VA 3SUEA 4ASHA 1DY9A 1QL8A 4ZKOU 1GBKA 2G5VA 2TBSA 4YOGA 1C5OH 2WPJS 2BD3A 5E0JA 3A7TA 4TPYA 4Y79A 1RFNA 3GCTF 2ZFSA 3HKJB 3Q00A 5EXMA 1QA7A 2ULLA 2RA3A 1FY5A 3ZZ3A 4J2YB 4HTCH 1O3IA 2AMPA 1ELEE 4A6LA 5DJ7A 1LMWB 1AE8H 5DPAA 1O34A 1TYNA 1P57B 3NWUA 3SU2A 1TMUH 1YPHE 3EA8A 4I8HA 1GBHA 1O2WA 1O3LA 4KTCA 3MU0A 5F8TA 3BTKE 1AUTC 1UO6A 1S82A 1BRCE 3RMNH 5GPIB 1GMHF 1SR5C 4K69A 3MNBA 1OWHA 5EGMA 3IITA 3RMMH 4YLUA 2A4QA 1DFPA 1TONA 3EE0B 4FUIA 1LO6A 2XC0A 5FBIA 3SO3A 7GCHF 3MO6A 1YPLH 1KYNA 2ALVA 1AVGH 4OS6A 3KNXA 1GPZA 2A1DB 2F9OA 1W0ZU 3TIUA 2PLXA 2BLWA 2D2DA 1P3CA 2ZTXA 1DVAH 1DDJA 2OC7A 2HRVA 5EQSA 2J38A 1G2LA 4NIXA 1GBMA 1G37A 2HPPH 1ORFA 3TVJB 2F91A 5E2OA 5FX5A 3LGIA 2XYAA 1ID5H 2P94A 3SNAA 4UONA 2A7JA 3RXFA 4CR9A 2ANMH 2GVFA 1E38B 1A7SA 1SQAA 1MZDA 1LVOA 5GXPA 2C3SA 2ZDAH 1T8LA 2WYJA 1W2KH 4WXIA 4UFEH 3M3TA 3T5FH 4FUCA 1O2IA 1TPAE 1A46H 3MTYA 2SGFE 2H5DA 4BTIB 2SGQE 3UOUA 1C4U2 1V2ST 2Z9LA 2BHGA 3QZRA 2GDEH 4FUGA 1O2HA 3F68H 1LPZB 1ZZZA 2VWLA 4D7FA 4D9RA 1SMFE 4CH2B 5LPEA 1F2SE 2AERH 1TNLA 1AB9C 1DX5M 3BEIB 2ZFTA 3S9CA 3UR9A 1XXDA 4ZH8A 1GJ4H 1IQJA 1Z8JB 1JOUB 4UFGH 1TAWA 3OY6U 4JZEH 2GZ8A 1Z1IA 4AFQA 1T31A 3UOPA 5J4QA 1MU6B 2GMTB 1UHBA 3NK8A 2VIVA 2BQWB 5C20A 1ZRKA 1XMNB 2QYIA 1J8AA 2VIPA 1IQNA 1UTQA 1UTJA 3UNSA 1BBRK 1GI6A 4Q7ZA 1UVPA 2IJOB 1ABJH 4ZHAA 1GJAB 3LGYA 1H4WA 4RKOB 1BT7A 2SGPE 2BZ6H 4R0IA 4Z6AH 5DP5A 3RXKA 2CGAA 1XX9A 1YLCA 1ZGIA 4YOJA 3ZZAA 1TBRH 5A0AE 3A7WA 2BDAA 4B1TA 1HIAB 1L1JA 5T6GA 6CHAC 5C67A 1ETTH 1C5YB 1NFUA 3KIDU 3SNCA 1ANDA 1RIWC 4Y7BA 3L33A 1O2VA 4NWKA 1HXFH 1KLJH 3QN7A 4QT8C 2JETC 1G36A 1O2MA 2ZU3A 5ESBA 3KQBA 4KGAA 4A5TS 2Y82A 2HNTE 3LU9B 2SNWA 1FPCH 3E90B 1FLEE 1W12U 5EU8A 1EJNA 5JBAS 5BPEA 1C1RA 1SLXB 5A8YA 4FU7A 5TCCA 1AI8H 3PLPA 4GCHG 1C1SA 4D76A 1SLUB 4XBDA 1LHFH 3T29A 1SB1H 1O2GH 2VIDA 2ZFQH 2FEQH 2YOLA 3N7OA 3QWCH 4ISIH 4X1NU 3UNRA 3QUMP 1ANCA 1FY4A 2ZGBH 3GDSA 1DWEH 1HBTH 3MFJA 1UCYK 4BAQB 4I8JA 1NRQH 1CA0B 3F1SB 1RTKA 2W7UA 3PWCA 4ESTE 4M7GA 4Y76A 1EPTA 1OXGA 3W94A 3CP7A 1SGDE 1WUNH 2NU1E 1ELDE 3RLYH 3P92A 4ZHLU 2BD2A 2VIWA 3GISB 2WPHS 3UY9A 4H42U 1THPB 3RC5A 4X8VH 2BVXH 1ZJKA 1TX7A 2FI4E 1V2VT 3MO9A 4FVDA 3RMOH 1GWAA 1QA0A 4K1SA 8KME2 1BTHH 2ZG0H 5LPFA 5AFYH 2ZKSA 1EZSC 1XUFA 1M9UA 4JZIA 4D7GA 1CHOG 2ILNA 1C9TA 3T28A 1IHTH 1UTOA 2BLOA 2OBQA 2FMJA 2UUFB 1GI8B 1ESAA 3M5LA 2FOMB 4AOQA 2A31A 3PMJA 2SNVA 1P11E 2C8ZB 3MI4A 1AGJA 1E35B 3SJOA 3I29A 2D1JA 5G4BA 3RUOA 3ZZ7A 5JB9S 3E3TA 1Y3WA 3G01A 2VGCC 1Z71A 2TIOA 3P6ZB 3P95A 2GV6A 1HRTH 1BRBE 4NWLA 1O2NA 4CBOA 1DXWA 2HGTH 2VVUA 1H8IH 2VIQA 1LQDB 3TGKE 1YPKH 2ZQ1A 1HYLA 3A87A 3I77A 1W13U 4WJG2 5L30H 2G4UA 1C1WH 1C2DA 3KF2A 2STBE 5EQRA 3A88A 1KDQA 3D62A 4I33A 4AFZA 4BANB 2SFAA 1TGCA 3M5OA 2R9PA 3MNCA 2P3FH 3IG6B 1QHRB 1BBRH 2P3UB 1P2NA 3GCOA 1T7CA 5AVDA 2CHAC 1ABIH 4A1TA 1H9HE 1C5WB 5A0BA 4IW4E 1DLEA 1P0SH 4J1YA 4MVNA 2EI6A 2PGQB 2ZHDA 5E8EH 3KQDA 2FOGA 1Z6EA 5E0GA 5DKMA 2Y7ZA 1SGQE 2H5CA 5CMXH 1VJ9U 5DP6A 1AY6H 3RXTA 3A83A 2J4IA 1K21H 1P01A 4AN7A 1VCPA 1K1MA 1FDPA 4NIYA 1DUEA 3QX5H 2ZGXH 1NFYA 2BM2A 4YT7H 2IN2A 2GGVB 3GOVB 5HM9A 1MTSA 2ZPSA 5C1UA 3FP7E 2FPZA 2Y80A 2QXGA 1Y5UT 3O8DA 2C8YB 4CR5A 1GBFA 1B5GH 1RTFB 1Y3UA 3MOCA 2ZC9H 5TJXA 4FU9A 4Y7AA 2GT7A 1LVYA 7ESTE 1CT2E 1IQIA 1L1GA 1LHEH 1O2SA 2I6QA 2XXLA 3IWMA 3MU5A 2G51A 3K6ZA 3P17H 4ZKNU 3ZZ9A 4AB9A 4TWYA 3QLPH 1QL9A 4E05H 2BDBA 4IN1A 1A5HA 2HLCA 3EA7A 2FOAA 2A7HA 2ZU2A 3E6PH 3ZZ8A 2HPQH 1YBWA 4Y8YA 5DG6A 4XBCA 5C2ZA 3A8DA 1GBAA 3VPKA 9ESTA 1S0QA 2HALA 4LK4A 2ODPA 2G00A 1GJ5H 1SC8U 3QTVH 4NSVA 1O3CA 3ZVFA 5FPSA 3SV6A 5ESTE 1AZZA 2Y6TA 2V3OH 1Y3VA 1FY1A 2ZU1A 1NFXA 2P8OC 3WY8A 1SGNE 1Z8IB 3UUZA 3RXVA 3K6YA 1NTPA 3R0FA 1K2I1 1ETRH 2WPIS 3F9FA 3SORA 2AIPA 1ZHRA 2FTMA 1T4VH 1GJ6A 3W95A 4X8UH 3MYWA 4Y0YE 5FXLA 2SGEE 1LHCH 3S9BA 1OSSA 2BY8X 3P8OA 3NUMA 1DE7H 2FX4A 1C5TA 3RP2A 2HOBA 4OS7A 4WY3A 4K60A 2ALPA 2ZA5A 4AYVB 1O2UA 2ODYB 4ZXXH 1S6FA 5BRRE 2LNCA 3VB3A 1GBDA 4IC6A 1D3TB 1VCQA 1PQ8A 1XUHA 1CVWH 1KXFA 3E16B 4WVPE 3FP6E 1UK2A 2ZF0H 5HXFA 1UTMA 1W8BH 1UCYE 3GY5A 4NZQA 1FUJA 1AD8H 1C1MA 3SJ9A 1CGJE 1UHBB 3NPSA 2NU2E 1F92A 3MH5A 4INHA 1IQFA 1CBWC 4E7RG 3F6UH 1WYKA 1GVZA 1LPGB 1MQ6A 1BB0B 1TGTA 1YPHC 2F3CE 4XBBA 2J92A 1AWFH 2QXHA 3H5CB 2O8MA 2J34A 6GCHF 2ZWLH 2GDDA 1F0TA 2P16A 1JIRA 1N1LA 1YLDA 1O2JA 2BY5X 1NS3A 1TQ0B 1ZSKA 6CHAB 2ZPQA 1GHAG 1RIWB 3SBKA 1VITG 3T27A 2C90B 3LONA 3TH4H 1NC6A 1G3DA 4B71A 2ZU4A 3GDUA 1A0LA 1HAYB 4IGDA 1C2EA 4JK6A 1GHWH 1WU1A 2XBYA 1LCYA 1TQ7B 2BVRH 4NIVA 1G30B 5EPYA 1VJAU 1WV7H 1YPGH 2UWOA 4ZXYH 1O3KA 4OGXA 2CN0H 1AIXH 1GHZA 3MNSA 1ZGVA 3UWIA 1GCDA 2BQ7B 5A09A 1CU1A 1O35A 1MD7A 5E2PA 1D6WA 4X2XA 1HAPH 2F83A 2AMQA 1HUTH 1DITH 2WPKS 2H1UA 2FOBA 3M7QA 3A89A 1EZUC 3BTME 1S84A 2OC0A 3QGJA 1GJ7B 6LPRA 3BTTE 4BOHA 1QY6A 1V2JT 3ODFA 3QK1A 1OWIA 1IQEA 2PSXA 1GI9B 2Q6DA 3KCGH 5DP8A 3GDVA 4X6NA 1C5LH 1WQSA 1ARBA 4OS4A 2PTCE 4A1VA 1FAKH 1VZQH 1BOQA 2UWLA 4IN2A 2BOKA 1KSNA 3Q3KA 2UUYA 5J4SA 2V0BA 3STIA 1Y5AT 4I8KA 4RKJB 3RXPA 1TGNA 4WH8A 1FXYA 3LGTA 2UUKB 2G4TA 1AN1E 3ODDA 2A4RA 5EODA 1O2TA 2BX3A 3Q3YA 4KELA 3CS0A 4OS1A 1V2WT 1QRXA 1O3BA 3OX7U 1AWHB 2BB4A 1A61H 4FVBA 3GY4A 2BXUH 9LPRA 5IYTA 4UEHH 1SG8B 1O30A 3MU4A 3ZVGA 5I46H 2UWPA 2VGCB 4E06H 1AMHA 4OGYA 2FI5E 1W3CA 3SI4H 4NFEA 1NRRH 2EC9H 4H4FA 3CENA 3SGAE 3RXMA 2BLVA 3FFGA 1D4PB 2FO9A 1C5SA 3KL6A 2Q1JA 3ESTA 3LKWA 4U01A 3V7TA 4NA8A 2GT8A 1V2TT 1B7XB 4BAOB 1ZTLA 2ZP0H 4BAMB 4KKDA 4NFFA 3ELAH 4FU8A 4CRBA 1RD3B 1HNEE 1C9PA 2QC2A 5B6OA 1FY3A 1A1RA 5LGOA 1KDQB 4O3UA 2CHAB 2Z6BD 1P2IA 2HNTC 2OP9A 5GWZA 1MMJN 1C2MA 1F5RA 3M35A 4TY6A 3A85A 1ACBE 1YPJH 3MU8A 4UD9H 1CSOE 4CRFA 1EZXC 1SLVB 2A5IA 3M5NA 3PMHB 1SGFG 3ZZ4A 1QRWA 1THRH 1W11U 1RTLA