1AQ7A

Trypsin with inhibitor aeruginosin 98-b
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Atomic Structure of the Trypsin-Aeruginosin 98-B Complex
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aq7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aq7A02
2XBWA 3VB5A 3ZVCA 1JIRA 5H4IB 2R0LA 4FUHA 2C3SA 1TPSA 2FMJA 3GDVA 2PKSC 3L6PA 4CHAC 2A7CA 1EOJA 4GCHF 3RMNH 2Q6DA 3QDZB 4YM9A 3T28A 4MTBA 1OWHA 1KXFA 1S84A 2Z3DA 4WH6A 4Y8ZA 1EP6A 5A0AE 1WQSA 2HNTF 3I77A 3M61U 1EPTC 4YOIA 1O3IA 3S0NA 1O0DH 1O2GH 1ZSJA 1Z8JB 1QBNA 4X1NU 1CVWH 2P59A 1DSUA 4ZHMU 1EKBB 1EAUA 1O3MA 1PQ5A 1P09A 1GI4A 2PUQH 4YT7H 1DICA 1SVPA 5FX6A 2FIRH 5C1YA 1O3FA 3BTKE 4I31A 3GDUA 1KYNA 3MU0A 1H8IH 1G32B 1D3QB 3LH3A 1LPKB 1FN8A 1BJVA 1Y5BT 1JXPA 3UOPA 4TWYA 1LQEA 1XUFA 1H9HE 3DHKH 3D49H 1C2HA 1YPHE 2P3TB 3F1SB 2B7DH 2GZ9A 1TONA 1JOUB 2NWNA 1GWAA 8LPRA 2J94A 1KDQB 1FY4A 4IC5A 1IQMA 1QGFA 1GBHA 5EOKA 4U30A 3PMAB 3SI3H 4ABIA 1QQUA 4J1YA 1SGTA 1UK3A 1O5DH 1BIOA 1C5MD 2BD5A 1MTUA 4X1RU 4DG4A 3SOSA 1YGCH 1A61H 3TJNA 5HM9A 1OWEA 1EP5A 2IOTA 3OTJE 2QXHA 3MU5A 1MKWK 1BCUH 1JWTA 3MO9A 1K1OA 2WUBA 3PLBA 3SN8A 4JMYA 1O3LA 3SHCH 2Z9LA 2O8MA 1ZGIA 4Y79A 2BY6X 1GI0A 1C5XB 3LT3A 1AY6H 1TGBA 5F8XA 4DIIH 4ABHA 1SHYA 5F6MA 1XKBC 1EOLA 1ETSH 2PFEA 4X8TH 2ZDMA 1O31A 2QXJA 3A8BA 3P70B 1T7CA 4E06H 1KXDA 2Y7XA 1O2UA 2OC1A 2Q6GA 2BM2A 1TPPA 4Q7XA 1NRNH 5I46H 2BX3A 1VCWA 3SNEA 2FOFA 1G3BA 2IPHA 3UNRA 2R9PA 3GICB 3Q77A 4QT8C 1JRTA 1FAXA 2OLGA 1ZOMA 4A92A 1OYTH 2J4IA 4FUGA 3A80A 2QA9E 2J2UA 2SNVA 4GHTA 1ZR0A 2GCHF 1O5AB 1JMOH 2J92A 3GYLB 1XUHA 2BY9X 2B0FA 1EX3A 1Z6JH 2TRMA 3P95A 4IMQA 3MNBA 4YZUA 3RXSA 3M37A 2A5IA 3TU7H 2GZ7A 1OYQA 1LTOA 1ZLRA 5DPAA 2IN2A 3NXPA 1GBBA 1C5TA 3ZVAA 1TIOA 1BUIA 1V6DA 2PKAA 3TIUA 2DE9A 4WJG2 3F9EA 4DVAU 3T26A 2XBYA 2ZQ2A 1IAUA 2BMGB 3KF2A 2UUFB 1D3DB 1F0SA 1P3EA 4A5TS 1UK2A 4OS2A 3EGKH 1OWDA 1NRRH 4MNVA 4ZKNU 1MBMA 1GDQA 5FHTA 2ZP0H 5EQSA 2P16A 1O3JA 2QF3A 4Y6DA 2ZTYA 1GBJA 1SHHB 2ZTZA 4NG9H 3TJOA 2ODPA 2H1UA 2XBXA 2ZU1A 5TCCA 1RFNA 2QY0B 1EJMA 1LVMA 1TMBH 4JYUH 1UTNA 1DS2E 3U8RH 1WV7H 2V35A 2QAAA 3RXTA 1CSOE 2PTCE 3UQVA 4F49A 4JCNA 1BOQA 2F9UA 1O2HA 3RXCA 3KNXA 2CF9H 4OS7A 1MTNB 1UMAH 1K1IA 2ZECA 1VJ9U 4DOQA 3HK6B 1GHZA 1AVGH 1VITF 2NU3E 2ODYB 2VU8E 4BXSA 2R3YA 1T32A 1TA2A 2A7HA 4ISOA 3A81A 5GDSH 4O3UA 1BHXF 4NA9H 3TVJB 4ABGA 3LDXH 1SGNE 1D3TB 3SNDA 1GBCA 2GGVB 8ESTE 2OC8A 1SGDE 1TE0A 3VFEA 5JDUB 5AF9H 1ABIH 1FI8A 1XKAC 2A4QA 1GVKB 1SOZA 4R8TB 3VXFH 4IS5A 3VXEH 2P94A 1LMWB 3O8CA 4ISHH 1O38A 1QL7A 4WMDA 1C5NH 1P02A 4K1TA 2ZKSA 1TNJA 3URCA 1G36A 4SGAE 3EA7A 2FLRH 2WV5A 6GCHG 2TGAA 2ODQA 2QYIA 4B74A 3RXPA 1O2VA 4YO9A 3VB6A 1FN6A 1EXFA 1W0YH 1S0QA 2O9QA 3KIDU 1P2QA 5CHAB 4AX9H 2HVXA 4AZ2B 2OBQA 3RC5A 3A82A 2ZFFH 1ANDA 1TRNA 4D7FA 1DUEA 4ISLA 4Q7ZA 2ZFPH 2XW9A 1F7ZA 1DDJA 5C67A 3GCOA 3PMJA 2ZWLH 1Y3UA 1O5GH 3TK5A 5HGGA 2BD2A 2FXRA 1MTNC 2ZFQH 2ZFSA 1BTUA 5FBIA 1GPZA 3SV2H 1H8DH 2XC5A 1C5SA 1NC6A 2JH5D 1P2NA 1FIWA 1T8OA 3EA9A 3UFAA 4D9RA 1EUFA 2LPRA 1HCGA 3HKJB 4MNYA 4BAQB 1BRBE 2GVFA 4XOJA 1KIGH 1V2LT 3A7YA 3PTNA 2PUXB 4UFGH 1A5GH 3GY4A 3KL6A 4J2YB 3PLKA 3PM3A 1YP9A 1W13U 4GSOA 4WXIA 2A1DB 1KSNA 4I8HA 4TPYA 1GMDF 2G52A 1YPLH 1GMHF 2JH0D 3A8AA 1C1WH 2O8TA 4ISNA 1ETRH 3UTUH 1A3EH 3PTBA 3A86A 4VGCB 1ZYOA 1IQLA 3JZ1B 1XXFA 2XWAA 4MG3A 3CP7A 3E8LA 3MWIU 1SFIA 1UTKA 2BQWB 1HJ8A 2B5TB 2H6MA 1IQNA 4Z0KA 2ILNA 4K60A 4NCYA 5CHAC 1GG6C 1Y3VA 1ESAA 3R3GB 1FQ3A 1TX8A 3SW2B 3Q00A 1AKSA 2W5EA 1BJUA 1BTHH 2CMYA 1GJ9B 3BEFB 4Y10E 1SC8U 4I7YH 5SGAE 3SV6A 5E2OA 2UWLA 2EC9H 1P2MA 2ZC9H 5CE1A 1BA8B 3PWBA 4XDEA 5FBEA 4X2YA 1B5GH 2FOGA 4NIXA 1VGCB 2C8ZB 3EA8A 4X2VA 1RIWB 1PPZA 3P8OA 1RJXB 4Z6AH 2FI3E 1MU6B 1AVXA 1LCYA 1GBEA 1RS0A 4F4OC 1F5LA 1YCPH 5JPMH 1O2TA 1B7XB 5AFYH 2HRVA 1DVAH 4XBCA 3ZVDA 1QFKH 1YYY1 2UWOA 1TNIA 1C1MA 5DGJA 3ZZ4A 5EGMA 4K1SA 2R3UA 2F9VA 3RMMH 1HV7A 1UJ1A 1ARCA 1SGYE 1ZJKA 1FXYA 1GL0E 1MQ5A 1SGEE 1T8LA 1N1LA 1P2IA 2FPZA 3BTHE 3MH5A 2AS9A 1GDNA 1O2NA 2ZDLA 1ZTLA 3QGNB 3Q3XA 1ZGVA 3TGKE 1S0RA 3TK6A 2BVSH 1OOKB 1K1LA 1QURH 1HBTH 1VITG 2QXIA 1EZUC 4A1VA 3UOUA 3TLOA 1HRTH 5C5OA 1EPTA 3ODDA 3UR6A 1BRUP 2ZO3H 3MO3A 1P12E 1V2PT 3MU1A 3QZQA 3V7TA 1INCA 2JH6D 1TBRH 1IQJA 1VGCC 2JKHA 1W8BH 1AVWA 2CXVA 3P8NA 1UVPA 1C9PA 1XM1A 1C2MA 1SGFG 4AOQA 3UQOA 1VITH 1O30A 1QRZA 1WYKA 1DSTA 1UVOA 1WTHD 1Y8TA 2ZPSA 3SGAE 4YLUA 4DJZB 4YOGA 1WU1A 1C5UA 2J34A 2C8XB 2OINA 4MPXA 1BBRH 1PPCE 1HAVB 1THRH 1QCPA 4UD9H 2V3OH 2HWLB 2R0KA 4MPWA 5E0HA 1TNGA 1A1RA 1QRXA 2GV7A 1XVMA 1HDTH 2QF0A 3F9FA 1SGCA 3P92A 2BLVA 3VEQB 4I33A 1X7AC 1TNKA 1DWBH 4NA7A 3TH3H 4JYTA 2YOLA 2HPQH 3BV9B 4AFSA 4YLQH 1SGIB 1C4U2 1TB6H 3RXKA 1HJAB 3ZZ7A 3ZYDA 1PYTD 2AIPA 3EE0B 4FXGH 3QWCH 4FVBA 4BAMB 2ZHEH 1S83A 4ZHLU 1YPHC 3M35A 1FAKH 1ELCA 1SLWB 1O3KA 2C4FH 5DP6A 5JB9S 5E8EH 4NA8A 5GJ4B 1F0TA 3A89A 1GBIA 1GL1A 1JRSA 2ZGXH 1Z1IA 4I8JA 4B71A 2ANWA 1RD3B 4INLA 4NSVA 5F8ZA 3RXAA 2QGRA 2GMTC 1WSSH 2F9NA 4MQAA 4DW2U 1SFQB 4K8YA 1SLXB 1ZHRA 1Z71A 1E38B 1NPMA 1GMDG 3MMGA 3IWMA 1CO7E 1GMHG 1OP8A 4ZXXH 1K1PA 2JETC 3O8DA 1SGQE 5JB8S 2AMDA 3BTTE 4GPGA 5C5NA 3H7TA 3B9FH 3QZRA 4AORA 3V12A 3GY7A 4OS1A 1NFYA 3ITIA 5E0GA 5DP5A 1BTYA 2STAE 4YOJA 3EQ0H 4CH8B 2EA3A 1MZDA 1O39A 2H5CA 2FLBH 3EAJA 2A32A 2A4GA 1O2IA 3MH4A 1HAXB 2HPPH 3SHAH 1FPCH 3MTYA 2HALA 1OWKA 2OUAA 3AVZA 2A5KA 2ZFRH 2BY5X 4IN2A 4Y8YA 4HGCA 2G00A 3G01A 1TYNA 2G4UA 2FOBA 2VNTA 3LGVA 3ZV9A 3S7HB 2HNTE 3RXGA 2RG3A 1CBWB 1GBDA 1VJAU 1QA0A 2D1JA 2GTBA 3BTME 4UFFH 1LHDH 1C2IA 1GGDB 3M36A 3ZZ3A 1UTQA 1B0FA 2ZPQA 1ZPBA 3A87A 1UCYH 1EJNA 4X6MA 1TQ7B 3A84A 3F9GA 4XE4A 1D9IA 1KLTA 1TNHA 2ZU4A 3OY6U 3BG4B 1IQGA 2CF8H 2XTTB 1KLJH 2F9PA 5G4BA 1V2TT 1AN1E 1OP0A 3ATLA 3RXRA 1E35B 2XC4A 4NSYA 3O8RA 5HM2A 2BQ6B 1EB2A 2UUYA 3HATH 3RC6A 6GCHF 4ISIH 2SGAA 1Z6EA 1QY6A 1EQ9A 3ZV8A 1NZQH 4Q2KA 2FX6A 1GI7B 1TRMA 3GCHC 1TBQH 2FS8A 1C4V2 3SU3A 3CENA 2R2MB 1G37A 1QIXB 1TX6A 3SU0A 5GWZA 1O2SA 1GHVH 3BEUA 1G30B 5T6DA 2Q6FA 2ZGJA 2G51A 1ZSKA 4JZEH 1TMUH 1P0SH 2M5TA 3D62A 5K7RA 4KTUA 3ZZCA 1O5EH 2VIWA 1W12U 4LK4A 3T27A 2WYJA 1SQAA 1MMJN 2G5NA 2Z7FE 4AYYB 2OCVB 2F9OA 2FYRA 1VR1H 2NU0E 2ZFTA 3UR9A 3ATWA 4WMFA 2ANYA 1GGDC 3ZVEA 1PQ8A 1Y5AT 4BAOB 1C5OH 1THSH 3BG8A 1TGCA 3FP6E 3DT0H 4XBBA 3L33A 3O8BA 3ZYEA 3E90B 4UFDH 1DPOA 6CHAB 3ZZDA 3RDZA 2ZDKA 2PTNA 2BD3A 1LPGB 3MH7A 1F0RA 3RC4A 1HFDA 3AW1A 5J4SA 4K2YA 1ELTA 1XXDA 1RXPA 5TCAA 1DT2A 1NO9H 3KQCA 3RXMA 1FMGA 4CREA 1FY1A 3GISB 3LC3A 1K28D 4NGAH 3TH4H 1C1QA 2O8WA 1UTOA 2Z6BD 2CV3A 4A1XA 2ZDVH 4X6PA 1XX9A 1C5YB 1HB0B 2THFB 2WPHS 1CT2E 3M5NA 4X6NA 3ZVBA 4AG2A 1JBUH 1Z8IB 3ELAH 2VWMA 1AHTH 1QJ7B 1G3DA 3Q3YA 1V2KT 1W14U 1FDPA 2I6QA 1B0EA 1GJBB 1TAWA 4IC6A 5F03A 1NY22 1J14A 2OQUA 2SGFE 3E16B 4AGKA 2BX4A 1ACBE 1HAGE 1KXAA 3RP2A 3EDXB 4BAHB 3HKIB 1TX7A 3TNTA 1HXFH 3FZZA 2ZI2H 4NZLA 5DJ7A 5ESTE 1YC0A 4ZKSU 3SQHE 5DP8A 1C4Y2 2ZNKH 2ZCLP 1UVSH 3ATKA 3RM0H 1GI2A 3RXDA 2EEKA 4DGJA 2Q1JA 3LJOA 1H1BA 4FU9A 3BTDE 2OTVA 3RXQA 3KQEA 3U8OH 1UTPA 4ZH8A 1T8NA 2ZG0H 1F5KU 2A4OA 4Y8XA 1WAYB 2VB0A 1V2QT 1HJ9A 4H6TA 1DY8A 1THPB 1O3BA 3LU9B 4B75A 3SNCA 1AB9B 2NU4E 2AGGX 1BBRE 1E34B 3U69H 3GY8A 4BANB 1AFQB 2BDBA 2HOBA 1DY9A 1A5HA 1LHEH 4FUDA 3S9AA 4ZAEA 4OS4A 1J15A 2FZZA 1OWJA 5L2YH 4NWKA 2W3KA 1C1UH 2CGAA 1IQKA 1PPHE 2Z9JA 4RKOB 1DX5M 2OD3B 3H7OA 3TPIZ 1D3PB 1L2EA 1UTLM 1DITH 4B2AA 1P2JA 2VWLA 1A0LA 1PPBH 1LHFH 5BPEA 5DG6A 3S7KB 5EW2H 1L1NA 2A7JA 1IHSH 3RXLA 1A7SA 2XC0A 1O2JA 1SB1H 1V2NT 4A7IB 1H9LB 7LPRA 1M9UA 5EODA 3QUMP 3V3MA 1AD8H 1V2UT 2BB4A 1BTXA 1Z7KA 3BEIB 2TGTA 1GHBG 1FIZA 2ZTXA 3SJOA 1MCVA 4AN7A 1ZMJA 3K2UA 5A0BA 2I6SA 5LH8A 4NZQA 4FUBA 1QL9A 3TK9A 1CHOG 5C1UA 2GDDA 4CRFA 1CT0E 1L1GA 3SV9A 2ZEBA 1AB9C 3B23B 4O03A 5EPYA 4KGAA 4R0IA 4GAWA 4X2WA 2BXUH 3C27B 5A2MH 1T8MA 1TMTH 3OX7U 3A88A 2NU1E 1MZAA 1AZ8A 5C2ZA 1AFQC 4NIVA 2B8OH 2F3CE 4Y71A 1IHTH 1P9UA 2EI7A 1AUJA 1O3DA 2V6NA 5EQRA 1TPOA 1PQ7A 3A7XA 1C2LA 5DKMA 4AFZA 2PW8H 1TNLA 1GVZA 2PR3A 1NFXA 1O37A 2ANKH 1LO6A 2BY8X 3OY5U 1C5WB 1O3CA 4JZDH 4HFPB 2ZHWH 2ZF0H 1V2WT 1FLEE 2QXGA 1TGSZ 7ESTE 1MTWA 1W2KH 3E1XB 3M3VA 2AIQA 1GI8B 3KQDA 1D6RA 3HK3B 2FODA 2SGEE 1AWHB 2TGPZ 2BY7X 1Q2WA 1GI6A 1UTJA 3LKWA 1E37B 4THNH 2FWWA 5K0HA 1NU7B 1YCPK 2ZU5A 2XBVA 5T6FA 1SI5H 4TYDA 5LPEA 4I8GA 1DANH 2KAIA 1HAOH 4E7NA 1MBQA 1UCYE 3T25A 1GI1A 1O2YA 3SORA 3ZZ6A 1O3AA 3M7QA 1W10U 1BMMH 1O2ZA 1C5RA 1GJDB 3SQEE 5JBTA 1P2KA 1LKBA 1S82A 4IBLH 4O97A 2G5VA 1WQVH 2G8TA 3HGNA 1GDUA 3MH6A 7GCHF 4CBNA 4IN1A 3A8DA 1YPEH 4DCDA 3K9XB 4MPVA 2BOKA 4AYVB 2VIOA 4CRDA 2P3FH 1O2PA 1AU8A 1LVOA 4Y11E 2J95A 4DIHH 1QBOA 1KTTB 1C5LH 4TPIZ 4HTCH 1N6YA 1KXBA 1P05A 3T5FH 3STJA 5FPTA 1O35A 2IJOB 3SJ8A 3SV8A 5T6GA 1OP2A 4OGYA 4CR9A 3SJ9A 1C1VH 4LXBH 1N8OB 3ZZAA 4O9VA 4X8VH 2BQ7B 2C90B 1HAVA 1UTMA 3URDA 1O2LA 3E6PH 3RXEA 1HYLA 1LQDB 4CRCA 1XUKA 2WYGA 1L1JA 1AQ7A 3PLPA 1ZPZA 1TGTA 1YPKH 1KXEA 3SNBA 1FY5A 1HIAB 1WOFA 3RXHA 3AW0A 1A5IA 1C2JA 4VGCC 1SR5C 3Q76A 1KLIH 3LGIA 4YESB 1W7GH 1GJCB 4K69A 1SMFE 4B2BA 1BMNH 8GCHG 2ZU3A 3QX5H 3LJJA 1BDAA 1P04A 9LPRA 1K1MA 2BDGA 2FTMA 1BBRK 1V2OT 1O3GA 1QB1A 4ABDA 3S9BA 3P6ZB 1XUJA 5HYOA 4FUFA 2GV6A 1ZJDA 2Z3CA 4BXWA 4OGXA 3Q3KA 2GT7A 3K65B 1QQ4A 4A1TA 3DFJA 2H9TH 1VZQH 1AE5A 1DOJA 3LGYA 2BZ6H 4RN6A 6ESTA 3JZ2B 5E0JA 5C20A 2AERH 3M3SA 3RMOH 2GP9B 4A6LA 2ASUB 2VIDA 5LGOA 1VCQA 2AGIX 3LOXA 3FP8E 2HNTC 1OPHB 3QN7A 3SUDA 1RIWC 3DUXH 1NS3A 4X6OA 2BZAA 4CH2B 4BOHA 3UPEA 2F83A 2FP7B 1MH0A 1GCTB 1SQTA 1BTZA 3M5MA 1CA8B 3I78A 1AGJA 1BMLA 3RLYH 1V2MT 1ELEE 1Y5UT 3GY5A 2Y5HA 1C5QA 1YPJH 4E05H 2UUJB 1DLKB 2P8OB 3IITA 3UUZA 2BDCA 1HXEH 1Y3WA 3ZZBA 5PTPA 3RU4E 3TGIE 5HXFA 1ZTKA 5IDKA 1GHYH 4TY6A 2BLWA 3KN2A 3A7ZA 3BIUH 4U32A 5IYTA 2VWOA 2P3UB 1BTPA 1QL8A 4KP0A 1BTWA 4IMZA 1TBZH 1F2SE 4ZROA 3SGBE 1NROH 1EJAA 1HLTH 4MNXA 5F8TA 1FZZA 4Q7YA 4GVUA 1OWIA 5EG4A 4MNWA 1MKXH 1YPMH 2AH4X 2ZDNA 1ELGA 4NFFA 2ZPRA 2G55A 4FU8A 1A0JA 1BQYA 4BTUB 1O5BB 1HAIH 4WF8A 4CRAA 2B9LA 2HGTH 1QJ1B 4FUIA 1S5SA 2CHAB 1J9CH 2F91A 2Y80A 4X8UH 2J38A 1W0ZU 4OS5A 1DUAA 2FOEA 4MDSA 2F9BH 3T29A 2BVXH 4ABJA 4D7GA 3TH2H 2GDEH 2WUCA 4GHQA 1OSSA 4BNRA 1NRQH 1Z1JA 1EAWA 4HZHA 4ZMAH 1A0HB 1CGIE 1ELAA 2FOCA 4LZ1H 1UCYK 3CS7A 3U1IB 1YCPM 4JZFH 3ZVGA 3SBKA 4X0WU 1DXPA 1V2RT 4I32A 2DE8A 5LPFA 3VPKA 2FI5E 2A2XH 3SUGA 1SGPE 4D9QA 1FV9A 1KDQA 2CN0H 1BMAA 1TABE 5L30H 4OS6A 4H6SB 2BDYA 2BD8A 4RKJB 2XNIA 7GCHG 1RTLA 3BN9A 3A85A 1S6HA 1HJAC 3BTEE 2GT8A 2UUKB 1BB0B 2FYQA 2NU2E 4Y0YE 3QLPH 5FCRA 3FANA 1WUNH 4K3JA 4DT7B 3E91A 2PLXA 3M7UA 1D6WA 3PO1B 4NWLA 3E0NB 4IGDA 4Y76A 1NTPA 1BHXB 1QRWA 1P2OA 3MHWU 4X1SU 2VWNA 2CHAC 3ESTA 2XCFA 1HUTH 1MAYA 2EI8A 2ULLA 3UNQA 3SNAA 2OXSA 2BHGA 4NFEA 5EXNA 1TRYA 1O2WA 2A45B 3GY6A 4IW4E 1GVLA 1YBWA 2RA0A 1ELDE 5FAHA 2HLCA 1AIXH 2J9NA 1KTSB 2WPIS 1ZZZA 3ENSB 3P8GA 2GX4A 1NN6A 1C2GA 2SGPE 1NM6A 3NCLA 5CMXH 3A7TA 2VIPA 3EYDA 4Y7AA 4YT6H 1ZRKA 1CQQA 3U9AH 2BLQA 3UNSA 4NIYA 1PFXC 1SSXA 2BDHA 2VH6A 3RXJA 1BRAA 1GJ5H 4ZHAA 3ZVFA 2H5DA 3FZDA 4JK6A 2P95A 3KHVA 2A31A 3GY3A 1HAPH 2ZGCA 2ESTE 1GBFA 2VVCA 1GHBF 3V13A 4TWWA 3LIWA 8KME2 5I25A 5GCHG 1UHBB 1Q3XA 3GCNA 1CHOF 1GJ6A 1O2QA 1C5PA 3QGJA 3AASA 1Z8GA 2XWBI 1C2KA 1C5VA 3UIRA 3N7OA 1ZMNA 1QA7A 4ZXYH 2ZHQH 1TGNA 1FPHH 3WY8A 5A8ZA 5C3NA 1QR3E 3IG6B 3UWIA 3SU2A 1GHXH 4X2XA 2ZGHA 5EU8A 3PO1C 2STBE 2A5AA 4YTAA 2GCTB 1J17T 1J16A 1CBWC 1MD8A 1SPJA 3MU8A 3RXBA 3ATIA 4UEHH 3NWUA 3FAOA 1SL3A 3RXIA 2W7UA 3I29A 1WBGB 3SUEA 2PWXA 1XMNB 1TQ0B 3BTFE 3LGUA 3LC5A 2Y5FA 3RXFA 2SGQE 2A0QB 1ARBA 4Q80A 4ESTE 3MI4A 2QC2A 1AI8H 3BG4C 4RSPA 5L2ZH 1PJPA 2GZ8A 2K1QA 1CU1A 5ETXA 2D2DA 5A8YA 4K1EA 1LVYA 1G3EA 3NKKA 1HAHH 1XVOA 2VIVA 4JYVH 1IQHA 4WMEA 3GDSA 1P57B 3NK8A 5JBAS 4Y7BA 1VCPA 1ELBA 1ESBA 1L4DA 4JK5A 2AEIH 1F0UA 1QBVH 1NESE 2G4TA 3LH1A 1AMHA 2AYWA 1K1NA 9ESTA 2ZHFH 1C1OA 3MYWA 1K1JA 1BZXE 3D23A 5DO4H 2BOHB 1GMCG 2GCTC 1NFUA 1RGQA 3PYHA 2PSYA 1DWDH 1ID5H 3ATMA 2FDAA 2FX4A 3F9HA 1QTFA 2LNCA 3U98H 1ESTA 3MNSA 2RA3A 3C1KA 1SLUB 2C8YB 3PB1E 1QB6A 2QV1A 4PROA 3DA9B 2ALPA 3PMHB 6LPRA 1MKWH 2BTCE 4LOYH 4O3TA 3SUFA 3RMLH 3M7TA 4H4FA 4K5ZA 3BIVH 4I8LA 4WWYA 5EXLA 4ABFA 1UO6A 1O33A 1MTSA 6CHAC 2BLOA 2QIQA 4AB9A 1O2MA 4WVPE 1P8VC 1ZSLA 2ZGBH 4B1TA 1FNIA 2Y81A 3K6ZA 1KY9A 2OC0A 5FPSA 2Z9IA 2V0BA 3HPTB 2W26A 8GCHF 1ETTH 2GD4B 1TALA 2ZHDA 1AUTC 4KTSA 4DY7B 4B2CA 4X1PU 2AMPA 2FEQH 3RXVA 1K21H 1OS8A 2CJIA 2TPIZ 1IQFA 1XUGA 2BD9A 1P06A 1IQIA 1QJ6B 3KQBA 2VJ1A 3SGQE 1O3PB 1MQ6A 1P9SA 5JBCS 5HMAA 3ZZ5A 1RTKA 3NPSA 4DURA 2AMQA 1DWCH 1ANEA 3VGCB 2D26C 1GHAF 4ZUHA 1F92A 2O8UA 1G9IE 2ZU2A 1GCDA 3GCTG 1RRKA 3AAVA 3GYMA 1PPEE 2FTLE 2ALVA 2V3HH 2G81E 2OC7A 1P01A 1P10A 5BRRE 3BF6H 1CT4E 1O5CB 1GI5A 3LPRA 2FM2A 1U6QA 1GI3A 3GOVB 1GJ8B 1H9IE 1E0FD 1O34A 4GCHG 1CGJE 4AB8A 4BTTB 2O8LA 2H9HA 4GUXA 3A7VA 5FXLA 2TGDA 1NT1A 5DP3A 1A46H 3F68H 2RCEA 2OP9A 2XXLA 3KGPA 1NU9A 5B6OA 1L4ZA 1MCTA 3FP7E 1V2ST 5DK1A 1GJAB 2ZDAH 3SU4A 1O3OA 2YNAA 5L6NH 2PKAB 2FI4E 4UDWH 2ZQ1A 3RXOA 4ZKOU 2UWPA 4GLYA 1UK4A 2SFAA 4CRGA 4AFQA 1OX1A 1PPFE 3RLWH 2FOHA 4INKA 1NRPH 4KELA 1BRCE 2PGBB 1ANBA 3MNXA 2P93A 3AAUA 3SU6A 3DFLA 1P03A 5JYIA 3GY2A 1ZHMA 1QHRB 2XYAA 1ZPCA 1CGHA 1GG6B 3S69A 1PYTC 2BD7A 3SO3A 3VGCC 4E7RG 3BTGE 5C1XA 4LZ4B 2BYAX 3QK1A 3H5CB 1YLCA 4X1QU 3E0PB 3SZNA 3V0XA 2VIQA 3BTQE 4FUJA 4KTCA 2C93B 1FONA 1HIAA 1QNJA 1C2EA 1FY3A 3RM2H 3SJIA 1GHWH 1O2RA 2FS9A 2Z3EA 1A4WH 4I8KA 4U2WA 1HAYB 1C9TA 1GJ7B 3QO6A 4XFQA 4U01A 5FPYA 1AE8H 3D65E 1O3HA 1UVUH 1K22H 2WPLS 1ZMLA 2VVUA 2XCNA 1QB9A 3KCGH 2ZIQH 3MOCA 2AGEX 1HNEE 2TBSA 1O2XA 2VVVA 1TFXA 5LPRA 4FUEA 1SG8B 3B8JA 3A8CA 2PV9B 1EZXC 4MPUA 4ABBA 2ZCHP 4K8BA 1AZZA 2BDIA 1ELFA 2WINI 1KXCA 3BSQA 7KMEH 5A0CA 4TY7A 1FJSA 2FOMB 3CS0A 1EAXA 1HGTH 3QTVH 1TPAE 2XRCA 3PV4A 4UFEH 2H2ZA 1LKAA 2VH0A 1GBAA 3SU1A 5EXMA 1W3CA 5ESBA 3PWCA 1YF4A 1W7XH 1C1PA 2BD4A 3U8TH 3SU5A 3LGWA 3P17H 1Y59T 2PHBA 2ZCKP 2GCHG 1PQAA 1MUEB 1EB1H 1Y3YA 2SGDE 1CA0B 5TJXA 2FOAA 4HI3A 1TOCB 3T62A 5FCKA 3TITA 1V2JT 1EAIA 4NIWA 3ZZ8A 4D76A 4MVNA 1L0ZA 1OKXA 3S9CA 1YKTA 1GBLA 5GIBA 3T2NA 4B73A 5DP4A 3TGJE 4B76A 5GXPA 4ASHA 1J8AA 4JZ1A 3SJKA 1IQEA 1O32A 1LHGH 3FFGA 1O5FH 1SBWA 1Z8RA 3M3TA 4XSKU 3L3TA 1AO5A 2PSXA 5A8XA 3NUMA 3RUOA 1ZRBA 1SQOA 1E36B 1O3NA 1ELVA 4ZKRU 1TA6A 2Y82A 4ABAA 5GCHF 1EATA 3NZIA 1OXGA 3UWJH 2H9EH 4WXVA 1FY8E 1K9OE 3QTOH 2PGQB 2BVRH 2VGCB 3K6YA 1C1TA 2TIOA 3MFJA 1SOTA 1XUIA 1S81A 3KEEA 1ORFA 1EASA 5ABWA 4AG1A 5JBBS 1TOMH 4JZIA 4XBDA 3SV7A 4D8NA 4H42U 1G2MA 1AFEH 3MO6A 5EQQA 1GHAG 3MU4A 1RTFB 1MKXK 1ABJH 1GBTA 2R2WU 4FU7A 1YM0A 3M5LA 3STIA 1DLEA 1ZTJA 5EPNA 5AVDA 2KAIB 1A3BH 3TJUA 1DFPA 1WCZA 1MAXA 1T4UH 5A09A 3PMBB 1CA0C 3HGPA 1N8OC 2RDLA 4MLFB 4CBOA 3OU0A 1P11E 1C2DA 4BTIB 1EZSC 2A2QH 1O3EA 1YPGH 1F5RA 2WPJS 2DUCA 3ODFA 3MNCA 1IOEA 1AKSB 1H4WA 2YNBA 4BAKB 5AFZH 1MU8B 2OBOA 2Y7ZA 3A83A 4FVDA 2Y5GA 1SGRE 4UONA 1GBKA 5J4QA 1GBMA 3P8FA 2GMTB 2BXTH 1MTVA 5AHGH 2A4RA 1O2OA 3F6UH 2Z9GA 1DWEH 1BITA 1EZQA 1TLDA 3VB7A 2JETB 2OQ5A 1T4VH 2Z9KA 5DP9A 1LVBA 1DE7H 1T31A 2D8WA 2EI6A 3W94A 4ABEA 3R0FA 3TJVA 2VGCC 1C1SA 1C2FA 3UY9A 1LDTT 4SGBE 3RU4T 4CRBA 1C5ZB 1CE5A 1D4PB 1SGFA 2C8WB 1GMCF 1ANCA 4FUCA 4KKDA 1V2VT 1C1NA 3TNSA 2BDAA 2Z94A 1O2KA 1ZHPA 3VB3A 2WPKS 5EW1H 1FUJA 2ZZUH 3FVFB 1DM4B 5FX5A 2FO9A 1P3CA 5GPIB 1LHCH 1NFWA 3E3TA 1GCTC 2WV4A 1TWXB 1G3CA 4CR5A 1N6XA 4CHAB 2PKSB 4X8SH 2WPMS 1W11U 4WH8A 4Y0ZE 5DP7A 3U1JB 1MD7A 4AFUA 1LPZB 1CHGA 1UHBA 3OSYA 3OYPA 4AGJA 2GKVE 2P8OC 2W3IA 1Y3XA 3UREA 1G2LA 1Q31A 3ZZ9A 1HPGA 1EPTB 4WY3A 3A7WA 2QN5T 3DD2H 3PROA 5T3HA 1HAZB 1S85A 5E2PA 1A2CH 2FESH 1WTGH 3M5OA 4M7GA 3LGTA 2W7SA 1K2I1 4UE7H 3RU4D 1S6FA 1NRSH 3SI4H 1V3XA 1YLDA 1O36A 3BTWE 2Y6TA 1PPGE 3GCHB 1SLVB 3RXUA 2ANMH 3VB4A 1AWFH 1DXWA 1C1RA 4INHA 1GI9B 3GCTF 2ZA5A 1UVTH 1GJ4H 2VINA 2SNWA 1BT7A 3W95A 2AFQB 2QCYA 3LONA 1JIMA
chains in the Genus database with same CATH superfamily
1OHHD 2XBWA 3VB5A 3ZVCA 1JIRA 5H4IB 2R0LA 4FUHA 1H8HD 1TPSA 2C3SA 2FMJA 2PKSC 3GDVA 3L6PA 4CHAC 1VKYA 2A7CA 1EOJA 4GCHF 3RMNH 2Q6DA 3QDZB 4YM9A 2KCAA 3T28A 4XD7D 4MTBA 1OWHA 1KXFA 1S84A 2Z3DA 4WH6A 4Y8ZA 1EP6A 5A0AE 1WQSA 2HNTF 3I77A 3M61U 1EPTC 4YOIA 1O3IA 3S0NA 1O0DH 1O2GH 1ZSJA 1Z8JB 1QBNA 4X1NU 1CVWH 2P59A 1DSUA 4ZHMU 1EKBB 1EAUA 1O3MA 1PQ5A 1P09A 1GI4A 2PUQH 4YT7H 1DICA 1SVPA 5FX6A 2FIRH 5C1YA 1O3FA 3BTKE 1H8ED 4I31A 3GDUA 1KYNA 3MU0A 1H8IH 1G32B 1D3QB 3LH3A 1LPKB 1FN8A 1BJVA 1Y5BT 1JXPA 3UOPA 4TWYA 1LQEA 1XUFA 1H9HE 3DHKH 3D49H 1C2HA 1YPHE 2P3TB 3F1SB 2B7DH 2GZ9A 1TONA 1JOUB 2NWNA 1GWAA 8LPRA 3OE7D 2J94A 1KDQB 1FY4A 4IC5A 1IQMA 1QGFA 1GBHA 5EOKA 4Z1MD 4U30A 3PMAB 3SI3H 4ABIA 1QQUA 4J1YA 1SGTA 1UK3A 1O5DH 1BIOA 1C5MD 2BD5A 1MTUA 4X1RU 4DG4A 3SOSA 1YGCH 1A61H 3TJNA 5HM9A 1OWEA 1EP5A 2IOTA 3OTJE 2QXHA 3MU5A 1MKWK 1BCUH 1JWTA 3MO9A 1K1OA 2WUBA 3PLBA 3SN8A 4JMYA 1O3LA 3SHCH 2Z9LA 2O8MA 1ZGIA 4Y79A 2BY6X 1GI0A 1C5XB 3LT3A 1AY6H 1TGBA 2QE7D 5F8XA 4DIIH 1SQRA 4ABHA 1SHYA 5F6MA 1XKBC 1EOLA 1ETSH 2PFEA 4X8TH 2ZDMA 1O31A 2QXJA 3A8BA 3P70B 1T7CA 4E06H 1KXDA 2Y7XA 1O2UA 2OC1A 2Q6GA 2BM2A 1TPPA 5EIYA 4Q7XA 4F48B 1NRNH 3EE7A 5I46H 2BX3A 1VCWA 3SNEA 2FOFA 1G3BA 2IPHA 3UNRA 2R9PA 3GICB 3Q77A 4QT8C 3FO8D 1JRTA 1FAXA 2OLGA 1ZOMA 4A92A 1OYTH 2J4IA 4FUGA 3A80A 2QA9E 2J2UA 2SNVA 3N7DA 4GHTA 1ZR0A 2GCHF 1O5AB 1JMOH 2J92A 3GYLB 1XUHA 2BY9X 2B0FA 1EX3A 1Z6JH 1EFRD 2TRMA 3P95A 4IMQA 3MNBA 4YZUA 3RXSA 3M37A 2A5IA 3TU7H 2GZ7A 1OYQA 1LTOA 1ZLRA 5DPAA 2IN2A 3NXPA 1GBBA 1C5TA 3ZVAA 1TIOA 4TSFD 1BUIA 1V6DA 2PKAA 2M2AA 3TIUA 2DE9A 4WJG2 3F9EA 4DVAU 3T26A 2XBYA 2ZQ2A 1IAUA 2BMGB 3KF2A 2UUFB 1D3DB 1F0SA 1P3EA 4A5TS 1UK2A 4OS2A 3U28C 3EGKH 1OWDA 1NRRH 4MNVA 4ZKNU 1MBMA 1GDQA 5FHTA 2ZP0H 5EQSA 2P16A 1O3JA 2QF3A 4Y6DA 2ZTYA 1GBJA 1SHHB 2ZTZA 4NG9H 3TJOA 2ODPA 2H1UA 2XBXA 2ZU1A 5TCCA 2LP6A 1RFNA 2QY0B 1EJMA 1LVMA 1TMBH 4JYUH 1UTNA 1DS2E 3PV5A 2KFWA 3U8RH 1WV7H 2V35A 2QAAA 3RXTA 1CSOE 2PTCE 3UQVA 4F49A 3OEED 4JCNA 1BOQA 2F9UA 1O2HA 2KZ4A 3RXCA 3KNXA 2CF9H 4OS7A 1MTNB 1UMAH 1K1IA 2ZECA 1VJ9U 4DOQA 3HK6B 1GHZA 1AVGH 1VITF 2NU3E 2ODYB 2VU8E 4BXSA 2R3YA 1T32A 1TA2A 2A7HA 4ISOA 3A81A 5GDSH 4O3UA 1BHXF 4NA9H 3TVJB 4ABGA 3LDXH 1SGNE 1D3TB 3SNDA 1GBCA 2GGVB 8ESTE 2OC8A 1SGDE 1TE0A 3VFEA 5JDUB 5AF9H 1ABIH 1FI8A 1XKAC 2A4QA 1GVKB 1SOZA 4R8TB 3VXFH 3AK5A 4IS5A 3VXEH 2P94A 1LMWB 2PP6A 3O8CA 4ISHH 1O38A 3FN8A 1QL7A 4WMDA 1C5NH 1P02A 4K1TA 2ZKSA 1TNJA 3URCA 1G36A 4SGAE 3EA7A 2FLRH 2WV5A 6GCHG 2TGAA 2ODQA 2QYIA 4B74A 1BMFD 3RXPA 1O2VA 4YO9A 3VB6A 1FN6A 1EXFA 1W0YH 2K8IA 1S0QA 2O9QA 3KIDU 1P2QA 5CHAB 4AX9H 2HVXA 4AZ2B 2OBQA 3RC5A 3A82A 2ZFFH 1ANDA 1TRNA 4D7FA 1DUEA 4ISLA 4Q7ZA 2ZFPH 2XW9A 1F7ZA 1DDJA 5C67A 3GCOA 3PMJA 2ZWLH 1Y3UA 1O5GH 3TK5A 5HGGA 2BD2A 2FXRA 1MTNC 2ZFQH 2ZFSA 1BTUA 5FBIA 1GPZA 3SV2H 1H8DH 2XC5A 1C5SA 1NC6A 2JH5D 1P2NA 1FIWA 1T8OA 3EA9A 3UFAA 4D9RA 1EUFA 2LPRA 1HCGA 3HKJB 4MNYA 4BAQB 1BRBE 2GVFA 4XOJA 1KIGH 1V2LT 3A7YA 3PTNA 2PUXB 4UFGH 1A5GH 3GY4A 3KL6A 4J2YB 3PLKA 2J5UA 3PM3A 1YP9A 1W13U 4GSOA 4WXIA 3PRDA 2A1DB 4ACAA 2K0QA 1KSNA 4I8HA 4TPYA 1GMDF 2G52A 2XOKD 1YPLH 1GMHF 2JH0D 3A8AA 1C1WH 2O8TA 4ISNA 1ETRH 3UTUH 1A3EH 3PTBA 3A86A 4VGCB 1ZYOA 1IQLA 3OTPA 3JZ1B 1XXFA 2XWAA 4MG3A 3CP7A 2WSSD 3E8LA 4P00A 3MWIU 1SFIA 1UTKA 5C0UA 2BQWB 1HJ8A 2B5TB 2H6MA 1IQNA 4Z0KA 2ILNA 4K60A 4NCYA 5CHAC 1GG6C 1Y3VA 5T1VA 2YMSB 1ESAA 3R3GB 1FQ3A 1TX8A 3SW2B 3SYJA 3Q00A 1AKSA 2W5EA 2OK5A 1BJUA 1BTHH 2CMYA 1GJ9B 3BEFB 4Y10E 1SC8U 4I7YH 5SGAE 3SV6A 5E2OA 2UWLA 2HVYB 2EC9H 1P2MA 2ZC9H 5CE1A 1BA8B 3PWBA 4XDEA 5FBEA 4ACBA 4X2YA 1B5GH 2FOGA 4NIXA 1VGCB 2C8ZB 2KCPA 3EA8A 4X2VA 1RIWB 1PPZA 3P8OA 1RJXB 4Z6AH 2FI3E 1MU6B 1AVXA 1LCYA 1GBEA 1RS0A 4F4OC 1F5LA 1YCPH 5JPMH 1O2TA 1B7XB 5AFYH 2HRVA 1DVAH 4XBCA 3ZVDA 1QFKH 1YYY1 3F2HA 2UWOA 1TNIA 1C1MA 3DSGA 5DGJA 3ZZ4A 5EGMA 4K1SA 2R3UA 2F9VA 5C94A 3RMMH 1HV7A 1UJ1A 1ARCA 1SGYE 1ZJKA 1FXYA 1GL0E 1MQ5A 1SGEE 1T8LA 1N1LA 1P2IA 2FPZA 2YMSC 3BTHE 3MH5A 2AS9A 1GDNA 1O2NA 2ZDLA 1ZTLA 3QGNB 3Q3XA 1ZGVA 3TGKE 1S0RA 3TK6A 2BVSH 1OOKB 1K1LA 1QURH 1HBTH 1VITG 2QXIA 1EZUC 4A1VA 3UOUA 3TLOA 1HRTH 5C5OA 1EPTA 3ODDA 3UR6A 1BRUP 2ZO3H 3MO3A 1P12E 1V2PT 3MU1A 3QZQA 3V7TA 1INCA 2JH6D 1TBRH 1IQJA 1VGCC 2JKHA 1W8BH 1AVWA 2CXVA 3P8NA 1UVPA 1C9PA 1XM1A 1C2MA 1SGFG 4AOQA 2J97A 3UQOA 1VITH 1O30A 1QRZA 1WYKA 1DSTA 1UVOA 1WTHD 1Y8TA 2ZPSA 3SGAE 4YLUA 4DJZB 4YOGA 1WU1A 1C5UA 2J34A 2C8XB 2OINA 4MPXA 1BBRH 1PPCE 1HAVB 1THRH 1QCPA 4UD9H 2V3OH 2HWLB 2R0KA 4MPWA 5E0HA 1TNGA 1A1RA 1QRXA 2GV7A 1XVMA 1HDTH 2QF0A 3F9FA 1SGCA 3P92A 2BLVA 3VEQB 4I33A 1X7AC 1TNKA 1DWBH 4NA7A 3TH3H 4JYTA 2YOLA 2HPQH 3BV9B 4AFSA 4YLQH 1SGIB 1C4U2 1TB6H 3F2GA 3RXKA 3WWFA 1HJAB 2QF5A 1QZ8A 3ZZ7A 3ZYDA 1PYTD 2AIPA 3EE0B 4FXGH 2V7QD 3QWCH 4FVBA 4BAMB 2ZHEH 1S83A 4ZHLU 1YPHC 3M35A 1FAKH 1ELCA 1SLWB 1O3KA 2C4FH 5DP6A 5JB9S 5E8EH 4NA8A 5GJ4B 1F0TA 3A89A 1GBIA 1GL1A 1JRSA 2ZGXH 1Z1IA 2QF4A 4I8JA 4B71A 2ANWA 1RD3B 4INLA 4NSVA 5F8ZA 3RXAA 2QGRA 2GMTC 1WSSH 2F9NA 4MQAA 4DW2U 1SFQB 4K8YA 1SLXB 1ZHRA 1Z71A 3N7EA 1E38B 1NPMA 5CDFE 1GMDG 3MMGA 1YY3A 3IWMA 1CO7E 1GMHG 1OP8A 4ZXXH 1K1PA 2JETC 3O8DA 1SGQE 5JB8S 2AMDA 3BTTE 1S6LA 4GPGA 5C5NA 3H7TA 3B9FH 3QZRA 4AORA 3V12A 3GY7A 4OS1A 1NFYA 3ITIA 5E0GA 5DP5A 1BTYA 2STAE 4YOJA 3EQ0H 4CH8B 2EA3A 1MZDA 1O39A 2H5CA 2FLBH 3EAJA 2A32A 2A4GA 1O2IA 3MH4A 1HAXB 2HPPH 3SHAH 1FPCH 3MTYA 2HALA 1OWKA 2OUAA 3AVZA 2A5KA 2ZFRH 2RDEA 2BY5X 4IN2A 4Y8YA 4HGCA 2G00A 3G01A 1TYNA 2G4UA 3VG8A 2FOBA 2VNTA 3LGVA 3ZV9A 3S7HB 2HNTE 3OEHD 3RXGA 2RG3A 1CBWB 1GBDA 1VJAU 1QA0A 2D1JA 2GTBA 3BTME 4UFFH 1LHDH 1C2IA 1GGDB 3M36A 3ZZ3A 1UTQA 1B0FA 2ZPQA 1ZPBA 3A87A 1UCYH 1EJNA 4X6MA 1YLNA 1TQ7B 3A84A 3F9GA 4XE4A 1D9IA 1KLTA 1TNHA 2ZU4A 3OY6U 3BG4B 1IQGA 2CF8H 2XTTB 1KLJH 2F9PA 5G4BA 1V2TT 3PV2A 1AN1E 1OP0A 3ATLA 3RXRA 1E35B 2XC4A 2LELA 4NSYA 3O8RA 2GJGA 5HM2A 2BQ6B 1EB2A 2UUYA 3HATH 3RC6A 6GCHF 4ISIH 2SGAA 1Z6EA 1QY6A 1EQ9A 3ZV8A 1NZQH 4Q2KA 2FX6A 1GI7B 1TRMA 3GCHC 1TBQH 2FS8A 1C4V2 3SU3A 3CENA 2R2MB 1G37A 1QIXB 1TX6A 3SU0A 5GWZA 1O2SA 2YMSD 1GHVH 3BEUA 1G30B 5T6DA 2Q6FA 2ZGJA 2G51A 1ZSKA 4JZEH 1TMUH 4Q63A 1P0SH 2M5TA 4XRNA 3D62A 5K7RA 4KTUA 3ZZCA 1O5EH 2VIWA 1W12U 4LK4A 3T27A 2WYJA 1SQAA 1MMJN 2G5NA 2Z7FE 4AYYB 2OCVB 2F9OA 2FYRA 1NBMD 1VR1H 2NU0E 2ZFTA 3UR9A 3ATWA 4WMFA 2ANYA 1GGDC 3ZVEA 1PQ8A 1Y5AT 4BAOB 1C5OH 1THSH 3BG8A 1TGCA 3FP6E 3DT0H 4XBBA 3L33A 3O8BA 3ZYEA 3E90B 4UFDH 1DPOA 6CHAB 3ZZDA 3RDZA 2ZDKA 2PTNA 5EJ1A 2BD3A 1LPGB 2EQNA 3MH7A 1F0RA 3RC4A 1HFDA 3AW1A 5J4SA 4K2YA 1ELTA 1XXDA 2VBCA 1RXPA 5TCAA 1DT2A 1NO9H 3KQCA 3RXMA 1FMGA 4CREA 1FX0B 1FY1A 3GISB 3F2FA 3LC3A 1K28D 4NGAH 1YWUA 1C1QA 3TH4H 2O8WA 1UTOA 2Z6BD 2CV3A 4A1XA 2ZDVH 4X6PA 1XX9A 1C5YB 2IPQX 1HB0B 2THFB 2WPHS 1CT2E 3M5NA 4X6NA 3ZVBA 4AG2A 1JBUH 1Z8IB 3ELAH 2VWMA 1AHTH 1QJ7B 1G3DA 3Q3YA 1V2KT 1W14U 2WZQA 1FDPA 2I6QA 1B0EA 1GJBB 1TAWA 3NRLA 4IC6A 5F03A 1NY22 1J14A 2OQUA 2SGFE 3E16B 4AGKA 3OAAD 2BX4A 1ACBE 2RFKC 1HAGE 1KXAA 3RP2A 3EDXB 4BAHB 3HKIB 1TX7A 2L74A 3TNTA 1HXFH 3FZZA 2ZI2H 4NZLA 5DJ7A 5ESTE 1YC0A 4ZKSU 3SQHE 5DP8A 1C4Y2 2ZNKH 2ZCLP 1UVSH 3ATKA 3RM0H 1GI2A 3RXDA 2EEKA 4DGJA 1W0JD 2Q1JA 3LJOA 1H1BA 4FU9A 3BTDE 2OTVA 3RXQA 3KQEA 3U8OH 1UTPA 4ZH8A 1T8NA 2ZG0H 1F5KU 2A4OA 4Y8XA 1WAYB 2VB0A 1V2QT 1HJ9A 4H6TA 1DY8A 1THPB 1O3BA 3LU9B 4B75A 3SNCA 1AB9B 2NU4E 2AGGX 1BBRE 1E34B 3U69H 3GY8A 4BANB 1AFQB 2BDBA 2HOBA 1DY9A 1A5HA 1LHEH 4FUDA 3S9AA 4ZAEA 4OS4A 1J15A 2FZZA 1OWJA 5L2YH 4NWKA 5F53A 2W3KA 1C1UH 2CGAA 1IQKA 1PPHE 2Z9JA 4RKOB 1DX5M 2OD3B 3H7OA 3TPIZ 1D3PB 1L2EA 1UTLM 1DITH 4B2AA 1P2JA 2VWLA 1A0LA 1PPBH 1LHFH 5BPEA 5DG6A 3S7KB 2AHME 1L1NA 3N99A 5EW2H 2A7JA 1IHSH 3RXLA 1A7SA 2XC0A 1O2JA 5HKKD 1SB1H 1V2NT 4A7IB 4AC9A 1H9LB 7LPRA 1M9UA 5EODA 3QUMP 3V3MA 1AD8H 1V2UT 2BB4A 1BTXA 1Z7KA 3BEIB 2TGTA 1GHBG 1FIZA 2ZTXA 3SJOA 1MCVA 4AN7A 1ZMJA 3K2UA 5A0BA 2I6SA 5LH8A 4NZQA 4FUBA 1QL9A 3TK9A 1CHOG 5C1UA 2GDDA 4CRFA 1CT0E 1L1GA 3SV9A 2ZEBA 1AB9C 3B23B 4O03A 5EPYA 4KGAA 4R0IA 4GAWA 4X2WA 2BXUH 3C27B 1COWD 1T8MA 5A2MH 1TMTH 3OX7U 3A88A 2NU1E 1MZAA 1AZ8A 1WDIA 5C2ZA 1AFQC 4NIVA 2B8OH 2F3CE 4Y71A 1IHTH 1P9UA 2EI7A 1AUJA 1O3DA 2V6NA 5EQRA 1TPOA 1PQ7A 3A7XA 1C2LA 5DKMA 4AFZA 2PW8H 1TNLA 1GVZA 2PR3A 1NFXA 1O37A 2ANKH 1LO6A 2BY8X 3OY5U 1C5WB 1O3CA 4JZDH 4HFPB 2ZHWH 2ZF0H 1V2WT 1FLEE 2QXGA 1TGSZ 7ESTE 1MTWA 1W2KH 3E1XB 3M3VA 2AIQA 1GI8B 3KQDA 1D6RA 3HK3B 2FODA 2SGEE 1AWHB 2TGPZ 3DSPA 2BY7X 1Q2WA 1GI6A 1UTJA 3LKWA 1E37B 4THNH 2FWWA 5K0HA 1NU7B 1YCPK 2ZU5A 2XBVA 5T6FA 1SI5H 4TYDA 5LPEA 4I8GA 1DANH 2KAIA 1HAOH 4E7NA 1MBQA 1UCYE 3T25A 1GI1A 1O2YA 3SORA 3ZZ6A 4HG6A 1O3AA 4FOUC 3M7QA 1W10U 1BMMH 1O2ZA 1C5RA 1GJDB 3SQEE 5JBTA 1E79D 1P2KA 4Q4LA 1LKBA 1S82A 4IBLH 4O97A 2G5VA 1WQVH 2G8TA 3HGNA 5CHBA 1GDUA 3MH6A 7GCHF 4CBNA 4IN1A 3A8DA 1YPEH 4DCDA 3K9XB 4MPVA 2BOKA 4AYVB 1UW7A 2VIOA 3UB0A 2P3FH 4CRDA 1O2PA 1AU8A 1LVOA 4Y11E 2J95A 4DIHH 1QBOA 1KTTB 1C5LH 4TPIZ 4HTCH 1N6YA 1KXBA 1P05A 3T5FH 3STJA 5FPTA 1O35A 2IJOB 3SJ8A 3SV8A 5T6GA 1OP2A 4OGYA 4CR9A 3SJ9A 1C1VH 4LXBH 2XNDD 1N8OB 3ZZAA 4O9VA 4X8VH 2BQ7B 2C90B 1HAVA 1UTMA 3URDA 1O2LA 3E6PH 3RXEA 1HYLA 1LQDB 4CRCA 1XUKA 2WYGA 1L1JA 1AQ7A 3PLPA 1ZPZA 1TGTA 1YPKH 1KXEA 3SNBA 1FY5A 1HIAB 1WOFA 3RXHA 3AW0A 1A5IA 1C2JA 4VGCC 1SR5C 3Q76A 1KLIH 3LGIA 4YESB 1W7GH 1GJCB 4K69A 1SMFE 1W0KD 4B2BA 1BMNH 8GCHG 2W6ID 2ZU3A 3QX5H 3LJJA 1BDAA 1P04A 9LPRA 1K1MA 2BDGA 2W6JD 2FTMA 1BBRK 1V2OT 1O3GA 1QB1A 4ABDA 3S9BA 3P6ZB 1XUJA 5HYOA 4FUFA 1SKYE 2GV6A 1ZJDA 2Z3CA 4BXWA 4OGXA 3Q3KA 2GT7A 3K65B 1QQ4A 4A1TA 3DFJA 2H9TH 1VZQH 1AE5A 1DOJA 3LGYA 2BZ6H 4RN6A 6ESTA 3JZ2B 5E0JA 5C20A 2AERH 3M3SA 3RMOH 2GP9B 4A6LA 2ASUB 2VIDA 5LGOA 1VCQA 2AGIX 3LOXA 3FP8E 2HNTC 1OPHB 3QN7A 3SUDA 1RIWC 3DUXH 1NS3A 4X6OA 2BZAA 4CH2B 4BOHA 3UPEA 2F83A 1KMHB 2FP7B 1MH0A 1GCTB 4F55A 1SQTA 1BTZA 3M5MA 1CA8B 3I78A 1AGJA 1BMLA 3RLYH 1V2MT 1ELEE 1Y5UT 3GY5A 2Y5HA 1C5QA 1YPJH 4E05H 2JIZD 2UUJB 1DLKB 2P8OB 3IITA 3UUZA 2BDCA 1HXEH 1Y3WA 3ZZBA 5PTPA 3RU4E 3TGIE 5HXFA 1ZTKA 5IDKA 1GHYH 4TY6A 2BLWA 3KN2A 3A7ZA 3BIUH 4U32A 5IYTA 2VWOA 2P3UB 1BTPA 1QL8A 2KCOA 4KP0A 1BTWA 4IMZA 1TBZH 1F2SE 4ZROA 3SGBE 1NROH 1EJAA 1HLTH 4MNXA 3KQ5A 5F8TA 1FZZA 4Q7YA 4GVUA 1OWIA 5EG4A 4MNWA 1MKXH 1YPMH 2AH4X 2ZDNA 1ELGA 4NFFA 2ZPRA 2G55A 4FU8A 1A0JA 1BQYA 4BTUB 1O5BB 1HAIH 4WF8A 4CRAA 2B9LA 2HGTH 4B6FA 1QJ1B 4FUIA 1S5SA 2CHAB 1J9CH 2F91A 2Y80A 4X8UH 2J38A 1W0ZU 4FETA 4OS5A 1DUAA 2FOEA 4MDSA 2F9BH 3T29A 2BVXH 4ABJA 4D7GA 3TH2H 2GDEH 2WUCA 4GHQA 1OSSA 4BNRA 1NRQH 1Z1JA 1EAWA 4HZHA 4ZMAH 1A0HB 1CGIE 1ELAA 2FOCA 4LZ1H 1UCYK 3CS7A 3U1IB 1YCPM 4JZFH 3ZVGA 3SBKA 4X0WU 1DXPA 1V2RT 4I32A 2DE8A 5LPFA 3VPKA 2FI5E 2A2XH 3SUGA 1SGPE 4D9QA 1FV9A 1KDQA 2CN0H 1BMAA 1TABE 5L30H 4OS6A 4RI0A 4H6SB 2BDYA 2BD8A 4RKJB 2XNIA 4ZCNA 7GCHG 1RTLA 3BN9A 3A85A 1S6HA 1HJAC 3BTEE 2GT8A 2UUKB 1BB0B 2FYQA 2NU2E 4I86A 2JDID 4Y0YE 3QLPH 5FCRA 3FANA 1WUNH 4K3JA 4DT7B 3E91A 2PLXA 3M7UA 3KYFA 1D6WA 3PO1B 4NWLA 3E0NB 4IGDA 4Y76A 1NTPA 3OFND 1BHXB 1QRWA 2KR7A 1P2OA 3MHWU 4X1SU 2VWNA 2CHAC 3ESTA 2XCFA 1HUTH 1MAYA 2EI8A 2ULLA 3UNQA 3SNAA 2OXSA 2BHGA 4NFEA 5EXNA 1TRYA 1O2WA 2A45B 3GY6A 4IW4E 1GVLA 1YBWA 2RA0A 1ELDE 5FAHA 2HLCA 1AIXH 2J9NA 1KTSB 2WPIS 1ZZZA 3ENSB 3P8GA 2GX4A 1NN6A 1C2GA 2SGPE 1NM6A 3NCLA 5CMXH 3A7TA 2VIPA 3EYDA 4Y7AA 4YT6H 1ZRKA 1CQQA 3U9AH 2BLQA 3UNSA 4NIYA 1PFXC 1SSXA 3GS9A 2BDHA 2VH6A 3RXJA 1BRAA 1GJ5H 4ZHAA 2J98B 2H5DA 3FZDA 3ZVFA 4JK6A 2P95A 3KHVA 2A31A 3GY3A 1HAPH 2ZGCA 2ESTE 1GBFA 2VVCA 1GHBF 3V13A 4TWWA 3LIWA 8KME2 5I25A 5GCHG 1UHBB 1Q3XA 3GCNA 5KGOA 1CHOF 1GJ6A 1O2QA 1C5PA 3QGJA 3AASA 5DSFA 1Z8GA 2XWBI 1C2KA 1C5VA 3UIRA 3N7OA 1ZMNA 1QA7A 4ZXYH 2ZHQH 1TGNA 2WHXA 1FPHH 3WY8A 5A8ZA 5C3NA 1QR3E 3IG6B 3UWIA 3SU2A 1GHXH 4X2XA 2ZGHA 5EU8A 3PO1C 2STBE 2A5AA 4YTAA 2GCTB 1J17T 1J16A 1CBWC 4OM9A 1K0HA 1MD8A 1SPJA 3MU8A 3RXBA 3ATIA 4UEHH 3NWUA 3FAOA 1SL3A 3RXIA 2W7UA 3I29A 1WBGB 3SUEA 2PWXA 1XMNB 1TQ0B 3BTFE 3LGUA 3LC5A 2Y5FA 3RXFA 2SGQE 2A0QB 1ARBA 4Q80A 4ESTE 3MI4A 2QC2A 1AI8H 3BG4C 4RSPA 5L2ZH 1PJPA 2GZ8A 2K1QA 1CU1A 5ETXA 2D2DA 5A8YA 4K1EA 1LVYA 1G3EA 3NKKA 1HAHH 1XVOA 2VIVA 4JYVH 1IQHA 4WMEA 3GDSA 1P57B 3NK8A 5JBAS 4Y7BA 1VCPA 4RT1A 1ELBA 1ESBA 1L4DA 4JK5A 2AEIH 1F0UA 1QBVH 1NESE 1MABB 2G4TA 3LH1A 3PRBA 1AMHA 2AYWA 1K1NA 9ESTA 2ZHFH 1C1OA 3MYWA 1K1JA 1BZXE 3D23A 5DO4H 2BOHB 1GMCG 2GCTC 1NFUA 1RGQA 3PYHA 2PSYA 1DWDH 1ID5H 3ATMA 2FDAA 2FX4A 3F9HA 1QTFA 3CNRA 2LNCA 3U98H 1ESTA 3MNSA 2RA3A 3C1KA 2L6OA 1SLUB 2C8YB 3PB1E 1QB6A 2QV1A 4PROA 3DA9B 2ALPA 3PMHB 4P02A 6LPRA 1MKWH 2BTCE 4LOYH 4O3TA 3SUFA 3F3BA 3RMLH 3M7TA 4H4FA 4K5ZA 3BIVH 4I8LA 4WWYA 5EXLA 4ABFA 1UO6A 1O33A 1MTSA 6CHAC 2BLOA 2QIQA 4AB9A 1O2MA 5FL7D 4WVPE 1P8VC 1ZSLA 2ZGBH 4B1TA 1FNIA 2IJD1 2Y81A 3K6ZA 1KY9A 2OC0A 5FPSA 2Z9IA 2V0BA 3HPTB 2W26A 8GCHF 1ETTH 2GD4B 1TALA 2ZHDA 1AUTC 4KTSA 4DY7B 4B2CA 4X1PU 2AMPA 2FEQH 3RXVA 1K21H 1OS8A 2CJIA 2TPIZ 1IQFA 1XUGA 2BD9A 1P06A 1IQIA 1QJ6B 4M9FA 3KQBA 2VJ1A 3SGQE 1O3PB 1MQ6A 1P9SA 5JBCS 5HMAA 3ZZ5A 1RTKA 3NPSA 4DURA 2AMQA 1DWCH 5KEDA 1ANEA 3VGCB 2D26C 5C0TA 1GHAF 4ZUHA 1F92A 2O8UA 1G9IE 2ZU2A 4RT0A 1GCDA 3GCTG 1RRKA 3AAVA 3GYMA 1PPEE 2FTLE 2ALVA 4ASUD 2V3HH 2G81E 2OC7A 1P01A 1P10A 5BRRE 3BF6H 1CT4E 1O5CB 1GI5A 3LPRA 2FM2A 1E1QD 1U6QA 1GI3A 3GOVB 3F0OA 1GJ8B 1H9IE 1E0FD 1O34A 4GCHG 1CGJE 4AB8A 4BTTB 2O8LA 2H9HA 4GUXA 3A7VA 5FXLA 2TGDA 1NT1A 5DP3A 1A46H 3F68H 2RCEA 2OP9A 2XXLA 2V3MA 3KGPA 1NU9A 5B6OA 1L4ZA 1MCTA 3FP7E 1V2ST 5DK1A 1GJAB 2ZDAH 3SU4A 1O3OA 2YNAA 5L6NH 3MQKC 2KCYA 2FI4E 2PKAB 4UDWH 3FKSD 2ZQ1A 3RXOA 4ZKOU 2UWPA 4GLYA 1UK4A 2SFAA 4CRGA 4AFQA 1OX1A 1PPFE 3RLWH 2FOHA 4INKA 1NRPH 4KELA 1BRCE 2PGBB 5EJZA 1ANBA 3MNXA 2P93A 3AAUA 3SU6A 3DFLA 1P03A 5JYIA 3GY2A 1ZHMA 1QHRB 3W1EA 2XYAA 1ZPCA 1CGHA 1GG6B 3S69A 1PYTC 2BD7A 3SO3A 3VGCC 4E7RG 3BTGE 5C1XA 4LZ4B 2BYAX 3QK1A 3H5CB 3FOAA 2WPDD 1YLCA 4X1QU 3E0PB 3SZNA 3V0XA 2VIQA 3BTQE 4FUJA 4KTCA 2C93B 1FONA 1HIAA 1QNJA 1C2EA 5IK2D 1FY3A 3RM2H 3SJIA 1GHWH 1O2RA 2FS9A 3F0PA 2Z3EA 1A4WH 4DT4A 4I8KA 4U2WA 1HAYB 1C9TA 1GJ7B 3QO6A 4XFQA 4U01A 5FPYA 1AE8H 3D65E 1O3HA 1UVUH 1K22H 2WPLS 1ZMLA 2VVUA 5EJLA 2XCNA 3WWBA 1QB9A 3KCGH 2ZIQH 3MOCA 2AGEX 1HNEE 2TBSA 1O2XA 2VVVA 1TFXA 5LPRA 4FUEA 1SG8B 3B8JA 3A8CA 2PV9B 1EZXC 4MPUA 4ABBA 5KECA 2ZCHP 4K8BA 5GNDA 1AZZA 2BDIA 1ELFA 2WINI 1KXCA 3BSQA 7KMEH 5A0CA 4TY7A 1FJSA 2FOMB 3CS0A 1EAXA 1HGTH 3QTVH 1TPAE 2XRCA 3PV4A 4UFEH 2H2ZA 1LKAA 2VH0A 1GBAA 3SU1A 5EXMA 1W3CA 5ESBA 3PWCA 1YF4A 1W7XH 1C1PA 2BD4A 3U8TH 3SU5A 3LGWA 4TT3D 3P17H 1Y59T 2PHBA 2ZCKP 2GCHG 1PQAA 1MUEB 1EB1H 1Y3YA 2SGDE 1CA0B 5TJXA 2FOAA 4HI3A 1TOCB 3T62A 5FCKA 3TITA 1WXRA 1V2JT 5HIZA 1EAIA 4NIWA 3ZZ8A 4D76A 3KYGA 4MVNA 1L0ZA 1OKXA 3S9CA 1YKTA 1GBLA 5GIBA 3T2NA 4B73A 5DP4A 3TGJE 4B76A 5GXPA 4ASHA 1J8AA 4JZ1A 3SJKA 1IQEA 1O32A 1LHGH 3FFGA 3WW7A 1O5FH 1SBWA 1Z8RA 3M3TA 4XSKU 3L3TA 1AO5A 2PSXA 5A8XA 3NUMA 3RUOA 1ZRBA 2JJ1D 1SQOA 1E36B 5HIYA 1O3NA 1ELVA 3H09A 4ZKRU 1TA6A 2Y82A 4ABAA 5GCHF 1EATA 3NZIA 1OXGA 3UWJH 2H9EH 4WXVA 1FY8E 1K9OE 1E1RD 2PGQB 3QTOH 2BVRH 2VGCB 3K6YA 1C1TA 2TIOA 3MFJA 1SOTA 1XUIA 1S81A 3KEEA 1ORFA 1EASA 3DCLA 5ABWA 4AG1A 5JBBS 1TOMH 4JZIA 4XBDA 3SV7A 4D8NA 4H42U 1G2MA 1AFEH 3MO6A 5EQQA 1GHAG 3MU4A 1RTFB 1MKXK 1ABJH 1GBTA 2R2WU 4FU7A 1YM0A 3M5LA 3STIA 4YXWD 1DLEA 1ZTJA 5EPNA 5AVDA 2KAIB 1A3BH 3TJUA 2CK3D 1DFPA 1WCZA 1MAXA 1T4UH 5A09A 3PMBB 1CA0C 3HGPA 1N8OC 2RDLA 4MLFB 4CBOA 3OU0A 1P11E 1C2DA 4BTIB 1EZSC 2A2QH 1O3EA 1YPGH 1F5RA 2WPJS 2DUCA 3ODFA 3MNCA 1IOEA 5C17A 1AKSB 1H4WA 2YNBA 4BAKB 5AFZH 1MU8B 2OBOA 2Y7ZA 3A83A 4FVDA 2Y5GA 1SGRE 4UONA 1GBKA 5J4QA 1GBMA 3P8FA 2GMTB 2BXTH 1MTVA 5AHGH 2A4RA 1O2OA 3F6UH 2Z9GA 1DWEH 2EY4C 1BITA 1EZQA 1TLDA 3VB7A 2JETB 2OQ5A 1T4VH 2Z9KA 5DP9A 1LVBA 1DE7H 1T31A 2D8WA 2EI6A 3W94A 4ABEA 3R0FA 3TJVA 2VGCC 1C1SA 1C2FA 3UY9A 1LDTT 4SGBE 3RU4T 4CRBA 1C5ZB 5B6LA 1CE5A 1D4PB 1SGFA 2F43B 2C8WB 1GMCF 1ANCA 4FUCA 4KKDA 1V2VT 1C1NA 3TNSA 2BDAA 2Z94A 1O2KA 1ZHPA 5DN6D 3VB3A 2WPKS 5EW1H 1FUJA 2ZZUH 3FVFB 1DM4B 5FX5A 2FO9A 1P3CA 5GPIB 2J98A 1LHCH 1NFWA 3E3TA 1GCTC 2WV4A 1TWXB 2KX4A 1G3CA 4CR5A 1N6XA 4CHAB 2PKSB 4X8SH 2WPMS 1W11U 4WH8A 4Y0ZE 5DP7A 3U1JB 1MD7A 4AFUA 1LPZB 1CHGA 1UHBA 3OSYA 3OYPA 4AGJA 2GKVE 3ZIAD 2P8OC 2WV9A 2W3IA 1Y3XA 3UAIC 3UREA 1G2LA 1Q31A 3ZZ9A 1HPGA 1EPTB 4WY3A 3A7WA 2QN5T 3DD2H 3PROA 5T3HA 1HAZB 1S85A 5E2PA 2F4LA 1A2CH 2FESH 1WTGH 3M5OA 4M7GA 3LGTA 2W7SA 1K2I1 4UE7H 3RU4D 1S6FA 1NRSH 3SI4H 1V3XA 1YLDA 3DSOA 1O36A 3BTWE 2JJ2D 2Y6TA 1PPGE 3GCHB 1SLVB 3RXUA 2HLDD 2ANMH 3VB4A 1AWFH 1DXWA 1C1RA 4INHA 1GI9B 1NBME 3GCTF 2ZA5A 1UVTH 1GJ4H 4B6EA 2VINA 2SNWA 2KM0A 1BT7A 3W95A 2AFQB 3SZEA 2QCYA 3LONA 1JIMA
chains in the Genus database with same CATH topology
2XBWA 3VB5A 3ZVCA 1JIRA 5H4IB 2R0LA 4FUHA 2C3SA 1TPSA 2FMJA 3GDVA 2PKSC 3L6PA 4CHAC 2A7CA 1EOJA 4GCHF 3RMNH 2Q6DA 3QDZB 4YM9A 3T28A 4MTBA 1OWHA 1KXFA 1S84A 2Z3DA 4WH6A 4Y8ZA 1EP6A 5A0AE 1WQSA 2HNTF 3I77A 3M61U 1EPTC 4YOIA 1O3IA 3S0NA 1O0DH 1O2GH 1ZSJA 1Z8JB 1QBNA 4X1NU 1CVWH 2P59A 1DSUA 4ZHMU 1EKBB 1EAUA 1O3MA 1PQ5A 1P09A 1GI4A 2PUQH 4YT7H 1DICA 1SVPA 5FX6A 2FIRH 5C1YA 1O3FA 3BTKE 4I31A 3GDUA 1KYNA 3MU0A 1H8IH 1G32B 1D3QB 3LH3A 1LPKB 1FN8A 1BJVA 1Y5BT 1JXPA 3UOPA 4TWYA 1LQEA 1XUFA 1H9HE 3DHKH 3D49H 1C2HA 1YPHE 2P3TB 3F1SB 2B7DH 2GZ9A 1TONA 1JOUB 2NWNA 1GWAA 8LPRA 2J94A 1KDQB 1FY4A 4IC5A 1IQMA 1QGFA 1GBHA 5EOKA 4U30A 3PMAB 3SI3H 4ABIA 1QQUA 4J1YA 1SGTA 1UK3A 1O5DH 1BIOA 1C5MD 2BD5A 1MTUA 4X1RU 4DG4A 3SOSA 1YGCH 1A61H 3TJNA 5HM9A 1OWEA 1EP5A 2IOTA 3OTJE 2QXHA 3MU5A 1MKWK 1BCUH 1JWTA 3MO9A 1K1OA 2WUBA 3PLBA 3SN8A 4JMYA 1O3LA 3SHCH 2Z9LA 2O8MA 1ZGIA 4Y79A 2BY6X 1GI0A 1C5XB 3LT3A 1AY6H 1TGBA 5F8XA 4DIIH 4ABHA 1SHYA 5F6MA 1XKBC 1EOLA 1ETSH 2PFEA 4X8TH 2ZDMA 1O31A 2QXJA 3A8BA 3P70B 1T7CA 4E06H 1KXDA 2Y7XA 1O2UA 2OC1A 2Q6GA 2BM2A 1TPPA 4Q7XA 1NRNH 5I46H 2BX3A 1VCWA 3SNEA 2FOFA 1G3BA 2IPHA 3UNRA 2R9PA 3GICB 3Q77A 4QT8C 1JRTA 1FAXA 2OLGA 1ZOMA 4A92A 1OYTH 2J4IA 4FUGA 3A80A 2QA9E 2J2UA 2SNVA 4GHTA 1ZR0A 2GCHF 1O5AB 1JMOH 2J92A 3GYLB 1XUHA 2BY9X 2B0FA 1EX3A 1Z6JH 2TRMA 3P95A 4IMQA 3MNBA 4YZUA 3RXSA 3M37A 2A5IA 3TU7H 2GZ7A 1OYQA 1LTOA 1ZLRA 5DPAA 2IN2A 3NXPA 1GBBA 1C5TA 3ZVAA 1TIOA 1BUIA 1V6DA 2PKAA 3TIUA 2DE9A 4WJG2 3F9EA 4DVAU 3T26A 2XBYA 2ZQ2A 1IAUA 2BMGB 3KF2A 2UUFB 1D3DB 1F0SA 1P3EA 4A5TS 1UK2A 4OS2A 3EGKH 1OWDA 1NRRH 4MNVA 4ZKNU 1MBMA 1GDQA 5FHTA 2ZP0H 5EQSA 2P16A 1O3JA 2QF3A 4Y6DA 2ZTYA 1GBJA 1SHHB 2ZTZA 4NG9H 3TJOA 2ODPA 2H1UA 2XBXA 2ZU1A 5TCCA 1RFNA 2QY0B 1EJMA 1LVMA 1TMBH 4JYUH 1UTNA 1DS2E 3U8RH 1WV7H 2V35A 2QAAA 3RXTA 1CSOE 2PTCE 3UQVA 4F49A 4JCNA 1BOQA 2F9UA 1O2HA 3RXCA 3KNXA 2CF9H 4OS7A 1MTNB 1UMAH 1K1IA 2ZECA 1VJ9U 4DOQA 3HK6B 1GHZA 1AVGH 1VITF 2NU3E 2ODYB 2VU8E 4BXSA 2R3YA 1T32A 1TA2A 2A7HA 4ISOA 3A81A 5GDSH 4O3UA 1BHXF 4NA9H 3TVJB 4ABGA 3LDXH 1SGNE 1D3TB 3SNDA 1GBCA 2GGVB 8ESTE 2OC8A 1SGDE 1TE0A 3VFEA 5JDUB 5AF9H 1ABIH 1FI8A 1XKAC 2A4QA 1GVKB 1SOZA 4R8TB 3VXFH 4IS5A 3VXEH 2P94A 1LMWB 3O8CA 4ISHH 1O38A 1QL7A 4WMDA 1C5NH 1P02A 4K1TA 2ZKSA 1TNJA 3URCA 1G36A 4SGAE 3EA7A 2FLRH 2WV5A 6GCHG 2TGAA 2ODQA 2QYIA 4B74A 3RXPA 1O2VA 4YO9A 3VB6A 1FN6A 1EXFA 1W0YH 1S0QA 2O9QA 3KIDU 1P2QA 5CHAB 4AX9H 2HVXA 4AZ2B 2OBQA 3RC5A 3A82A 2ZFFH 1ANDA 1TRNA 4D7FA 1DUEA 4ISLA 4Q7ZA 2ZFPH 2XW9A 1F7ZA 1DDJA 5C67A 3GCOA 3PMJA 2ZWLH 1Y3UA 1O5GH 3TK5A 5HGGA 2BD2A 2FXRA 1MTNC 2ZFQH 2ZFSA 1BTUA 5FBIA 1GPZA 3SV2H 1H8DH 2XC5A 1C5SA 1NC6A 2JH5D 1P2NA 1FIWA 1T8OA 3EA9A 3UFAA 4D9RA 1EUFA 2LPRA 1HCGA 3HKJB 4MNYA 4BAQB 1BRBE 2GVFA 4XOJA 1KIGH 1V2LT 3A7YA 3PTNA 2PUXB 4UFGH 1A5GH 3GY4A 3KL6A 4J2YB 3PLKA 3PM3A 1YP9A 1W13U 4GSOA 4WXIA 2A1DB 1KSNA 4I8HA 4TPYA 1GMDF 2G52A 1YPLH 1GMHF 2JH0D 3A8AA 1C1WH 2O8TA 4ISNA 1ETRH 3UTUH 1A3EH 3PTBA 3A86A 4VGCB 1ZYOA 1IQLA 3JZ1B 1XXFA 2XWAA 4MG3A 3CP7A 3E8LA 3MWIU 1SFIA 1UTKA 2BQWB 1HJ8A 2B5TB 2H6MA 1IQNA 4Z0KA 2ILNA 4K60A 4NCYA 5CHAC 1GG6C 1Y3VA 1ESAA 3R3GB 1FQ3A 1TX8A 3SW2B 3Q00A 1AKSA 2W5EA 1BJUA 1BTHH 2CMYA 1GJ9B 3BEFB 4Y10E 1SC8U 4I7YH 5SGAE 3SV6A 5E2OA 2UWLA 2EC9H 1P2MA 2ZC9H 5CE1A 1BA8B 3PWBA 4XDEA 5FBEA 4X2YA 1B5GH 2FOGA 4NIXA 1VGCB 2C8ZB 3EA8A 4X2VA 1RIWB 1PPZA 3P8OA 1RJXB 4Z6AH 2FI3E 1MU6B 1AVXA 1LCYA 1GBEA 1RS0A 4F4OC 1F5LA 1YCPH 5JPMH 1O2TA 1B7XB 5AFYH 2HRVA 1DVAH 4XBCA 3ZVDA 1QFKH 1YYY1 2UWOA 1TNIA 1C1MA 5DGJA 3ZZ4A 5EGMA 4K1SA 2R3UA 2F9VA 3RMMH 1HV7A 1UJ1A 1ARCA 1SGYE 1ZJKA 1FXYA 1GL0E 1MQ5A 1SGEE 1T8LA 1N1LA 1P2IA 2FPZA 3BTHE 3MH5A 2AS9A 1GDNA 1O2NA 2ZDLA 1ZTLA 3QGNB 3Q3XA 1ZGVA 3TGKE 1S0RA 3TK6A 2BVSH 1OOKB 1K1LA 1QURH 1HBTH 1VITG 2QXIA 1EZUC 4A1VA 3UOUA 3TLOA 1HRTH 5C5OA 1EPTA 3ODDA 3UR6A 1BRUP 2ZO3H 3MO3A 1P12E 1V2PT 3MU1A 3QZQA 3V7TA 1INCA 2JH6D 1TBRH 1IQJA 1VGCC 2JKHA 1W8BH 1AVWA 2CXVA 3P8NA 1UVPA 1C9PA 1XM1A 1C2MA 1SGFG 4AOQA 3UQOA 1VITH 1O30A 1QRZA 1WYKA 1DSTA 1UVOA 1WTHD 1Y8TA 2ZPSA 3SGAE 4YLUA 4DJZB 4YOGA 1WU1A 1C5UA 2J34A 2C8XB 2OINA 4MPXA 1BBRH 1PPCE 1HAVB 1THRH 1QCPA 4UD9H 2V3OH 2HWLB 2R0KA 4MPWA 5E0HA 1TNGA 1A1RA 1QRXA 2GV7A 1XVMA 1HDTH 2QF0A 3F9FA 1SGCA 3P92A 2BLVA 3VEQB 4I33A 1X7AC 1TNKA 1DWBH 4NA7A 3TH3H 4JYTA 2YOLA 2HPQH 3BV9B 4AFSA 4YLQH 1SGIB 1C4U2 1TB6H 3RXKA 1HJAB 3ZZ7A 3ZYDA 1PYTD 2AIPA 3EE0B 4FXGH 3QWCH 4FVBA 4BAMB 2ZHEH 1S83A 4ZHLU 1YPHC 3M35A 1FAKH 1ELCA 1SLWB 1O3KA 2C4FH 5DP6A 5JB9S 5E8EH 4NA8A 5GJ4B 1F0TA 3A89A 1GBIA 1GL1A 1JRSA 2ZGXH 1Z1IA 4I8JA 4B71A 2ANWA 1RD3B 4INLA 4NSVA 5F8ZA 3RXAA 2QGRA 2GMTC 1WSSH 2F9NA 4MQAA 4DW2U 1SFQB 4K8YA 1SLXB 1ZHRA 1Z71A 1E38B 1NPMA 1GMDG 3MMGA 3IWMA 1CO7E 1GMHG 1OP8A 4ZXXH 1K1PA 2JETC 3O8DA 1SGQE 5JB8S 2AMDA 3BTTE 4GPGA 5C5NA 3H7TA 3B9FH 3QZRA 4AORA 3V12A 3GY7A 4OS1A 1NFYA 3ITIA 5E0GA 5DP5A 1BTYA 2STAE 4YOJA 3EQ0H 4CH8B 2EA3A 1MZDA 1O39A 2H5CA 2FLBH 3EAJA 2A32A 2A4GA 1O2IA 3MH4A 1HAXB 2HPPH 3SHAH 1FPCH 3MTYA 2HALA 1OWKA 2OUAA 3AVZA 2A5KA 2ZFRH 2BY5X 4IN2A 4Y8YA 4HGCA 2G00A 3G01A 1TYNA 2G4UA 2FOBA 2VNTA 3LGVA 3ZV9A 3S7HB 2HNTE 3RXGA 2RG3A 1CBWB 1GBDA 1VJAU 1QA0A 2D1JA 2GTBA 3BTME 4UFFH 1LHDH 1C2IA 1GGDB 3M36A 3ZZ3A 1UTQA 1B0FA 2ZPQA 1ZPBA 3A87A 1UCYH 1EJNA 4X6MA 1TQ7B 3A84A 3F9GA 4XE4A 1D9IA 1KLTA 1TNHA 2ZU4A 3OY6U 3BG4B 1IQGA 2CF8H 2XTTB 1KLJH 2F9PA 5G4BA 1V2TT 1AN1E 1OP0A 3ATLA 3RXRA 1E35B 2XC4A 4NSYA 3O8RA 5HM2A 2BQ6B 1EB2A 2UUYA 3HATH 3RC6A 6GCHF 4ISIH 2SGAA 1Z6EA 1QY6A 1EQ9A 3ZV8A 1NZQH 4Q2KA 2FX6A 1GI7B 1TRMA 3GCHC 1TBQH 2FS8A 1C4V2 3SU3A 3CENA 2R2MB 1G37A 1QIXB 1TX6A 3SU0A 5GWZA 1O2SA 1GHVH 3BEUA 1G30B 5T6DA 2Q6FA 2ZGJA 2G51A 1ZSKA 4JZEH 1TMUH 1P0SH 2M5TA 3D62A 5K7RA 4KTUA 3ZZCA 1O5EH 2VIWA 1W12U 4LK4A 3T27A 2WYJA 1SQAA 1MMJN 2G5NA 2Z7FE 4AYYB 2OCVB 2F9OA 2FYRA 1VR1H 2NU0E 2ZFTA 3UR9A 3ATWA 4WMFA 2ANYA 1GGDC 3ZVEA 1PQ8A 1Y5AT 4BAOB 1C5OH 1THSH 3BG8A 1TGCA 3FP6E 3DT0H 4XBBA 3L33A 3O8BA 3ZYEA 3E90B 4UFDH 1DPOA 6CHAB 3ZZDA 3RDZA 2ZDKA 2PTNA 2BD3A 1LPGB 3MH7A 1F0RA 3RC4A 1HFDA 3AW1A 5J4SA 4K2YA 1ELTA 1XXDA 1RXPA 5TCAA 1DT2A 1NO9H 3KQCA 3RXMA 1FMGA 4CREA 1FY1A 3GISB 3LC3A 1K28D 4NGAH 3TH4H 1C1QA 2O8WA 1UTOA 2Z6BD 2CV3A 4A1XA 2ZDVH 4X6PA 1XX9A 1C5YB 1HB0B 2THFB 2WPHS 1CT2E 3M5NA 4X6NA 3ZVBA 4AG2A 1JBUH 1Z8IB 3ELAH 2VWMA 1AHTH 1QJ7B 1G3DA 3Q3YA 1V2KT 1W14U 1FDPA 2I6QA 1B0EA 1GJBB 1TAWA 4IC6A 5F03A 1NY22 1J14A 2OQUA 2SGFE 3E16B 4AGKA 2BX4A 1ACBE 1HAGE 1KXAA 3RP2A 3EDXB 4BAHB 3HKIB 1TX7A 3TNTA 1HXFH 3FZZA 2ZI2H 4NZLA 5DJ7A 5ESTE 1YC0A 4ZKSU 3SQHE 5DP8A 1C4Y2 2ZNKH 2ZCLP 1UVSH 3ATKA 3RM0H 1GI2A 3RXDA 2EEKA 4DGJA 2Q1JA 3LJOA 1H1BA 4FU9A 3BTDE 2OTVA 3RXQA 3KQEA 3U8OH 1UTPA 4ZH8A 1T8NA 2ZG0H 1F5KU 2A4OA 4Y8XA 1WAYB 2VB0A 1V2QT 1HJ9A 4H6TA 1DY8A 1THPB 1O3BA 3LU9B 4B75A 3SNCA 1AB9B 2NU4E 2AGGX 1BBRE 1E34B 3U69H 3GY8A 4BANB 1AFQB 2BDBA 2HOBA 1DY9A 1A5HA 1LHEH 4FUDA 3S9AA 4ZAEA 4OS4A 1J15A 2FZZA 1OWJA 5L2YH 4NWKA 2W3KA 1C1UH 2CGAA 1IQKA 1PPHE 2Z9JA 4RKOB 1DX5M 2OD3B 3H7OA 3TPIZ 1D3PB 1L2EA 1UTLM 1DITH 4B2AA 1P2JA 2VWLA 1A0LA 1PPBH 1LHFH 5BPEA 5DG6A 3S7KB 5EW2H 1L1NA 2A7JA 1IHSH 3RXLA 1A7SA 2XC0A 1O2JA 1SB1H 1V2NT 4A7IB 1H9LB 7LPRA 1M9UA 5EODA 3QUMP 3V3MA 1AD8H 1V2UT 2BB4A 1BTXA 1Z7KA 3BEIB 2TGTA 1GHBG 1FIZA 2ZTXA 3SJOA 1MCVA 4AN7A 1ZMJA 3K2UA 5A0BA 2I6SA 5LH8A 4NZQA 4FUBA 1QL9A 3TK9A 1CHOG 5C1UA 2GDDA 4CRFA 1CT0E 1L1GA 3SV9A 2ZEBA 1AB9C 3B23B 4O03A 5EPYA 4KGAA 4R0IA 4GAWA 4X2WA 2BXUH 3C27B 5A2MH 1T8MA 1TMTH 3OX7U 3A88A 2NU1E 1MZAA 1AZ8A 5C2ZA 1AFQC 4NIVA 2B8OH 2F3CE 4Y71A 1IHTH 1P9UA 2EI7A 1AUJA 1O3DA 2V6NA 5EQRA 1TPOA 1PQ7A 3A7XA 1C2LA 5DKMA 4AFZA 2PW8H 1TNLA 1GVZA 2PR3A 1NFXA 1O37A 2ANKH 1LO6A 2BY8X 3OY5U 1C5WB 1O3CA 4JZDH 4HFPB 2ZHWH 2ZF0H 1V2WT 1FLEE 2QXGA 1TGSZ 7ESTE 1MTWA 1W2KH 3E1XB 3M3VA 2AIQA 1GI8B 3KQDA 1D6RA 3HK3B 2FODA 2SGEE 1AWHB 2TGPZ 2BY7X 1Q2WA 1GI6A 1UTJA 3LKWA 1E37B 4THNH 2FWWA 5K0HA 1NU7B 1YCPK 2ZU5A