3EA7A

Crystal structure of sars-cov main protease triple mutant sti/a in space group p21
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
305
structure length
305
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQCSGVTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Crystal structure of SARS-CoV Mpro mutant
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 80
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ea7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea7A02
3GDUA 4JCNA 3MOCA 3SV7A 4ABHA 3ZZ4A 2BD5A 1DPOA 5ETXA 1F0RA 1ZGVA 1L4ZA 3OU0A 1YC0A 3LGIA 1P06A 4FU9A 3ZZBA 1G3EA 1ZSLA 3AW1A 3KQEA 2BVSH 3RMLH 4A1TA 3NK8A 2QN5T 4ZXYH 1THPB 1GI0A 2OBQA 3S0NA 1S0RA 1FJSA 2CV3A 1BTYA 2BDYA 3LJOA 2GX4A 4YOJA 4KELA 4BTUB 1FPHH 1QQUA 3M7QA 3R3GB 1Y3UA 3HGNA 4DOQA 2WPMS 2ZO3H 4X0WU 2UWPA 1WAYB 3RUOA 5J4SA 3B23B 4WWYA 3OX7U 5C5OA 1O31A 3TNTA 1SGDE 3FFGA 1YLCA 3QN7A 1N1LA 1SGEE 1KYNA 3Q00A 1QL9A 1HAHH 1SGIB 3PMHB 3UR6A 1MD8A 4VGCC 2BDBA 1KDQA 2WUBA 3LGVA 2FOGA 4HFPB 3JZ2B 1EKBB 3E0PB 1GBAA 1W0ZU 1FUJA 5TCCA 1O3HA 3SU3A 4IN2A 4X1QU 5IDKA 2QXGA 2VIPA 3TJNA 1MBMA 1A0LA 1HJ9A 3H7OA 1QJ1B 2AH4X 1UHBB 2GCTC 2Z9KA 1AWFH 3OYPA 1K2I1 2TGAA 3P70B 5F8TA 3E91A 4Y7AA 3CP7A 2ZHDA 2OXSA 1SLUB 3LGWA 2ZECA 1NRSH 3EYDA 3ZV8A 3RMMH 1XUGA 5FCKA 3M36A 1WQSA 1C2HA 3BTEE 4CH8B 1W7XH 4NCYA 2FLBH 1ABJH 2P3FH 2ZQ1A 2DUCA 4DURA 4X6OA 1LPKB 3S7KB 2BMGB 3E8LA 2AMQA 4LXBH 3TGIE 1DANH 2ZDAH 4ZHMU 2JKHA 1P11E 1AN1E 1FMGA 4D76A 1K21H 1F5RA 1JXPA 2FOMB 3UWJH 3MNSA 3UREA 4AB8A 3KQDA 3UQVA 4ABBA 4MPVA 1ARCA 3P8NA 4GLYA 4X1NU 1TRYA 1DVAH 1SGFA 1QL8A 2PGBB 1G2LA 2PSXA 8LPRA 1QBOA 1RJXB 1A1RA 2CHAC 2CXVA 8GCHF 3SUEA 2SGDE 3ZV9A 4ABAA 4X6MA 5FBEA 1CHOG 3RXMA 2VINA 1MBQA 1SHHB 3O8RA 1J16A 3EE0B 1BMMH 2P95A 1FQ3A 3ATLA 1JRSA 3BIVH 1TBQH 1P03A 3QDZB 4INHA 7KMEH 4K5ZA 1O3CA 1FIZA 1TNGA 2A32A 4ABFA 2SNVA 3MYWA 1WCZA 1BMLA 1MCTA 3PWCA 2O8LA 2GCHF 4NSVA 2ZFPH 4YESB 1L1NA 3ZZAA 1SGCA 3Q77A 2OCVB 3T2NA 1Y5BT 1DUEA 1N6XA 1T8NA 2PSYA 2Z6BD 3PROA 1C1SA 1C1OA 1C1NA 2ZCKP 2A4GA 1KXAA 1W0YH 3RU4T 2XTTB 3NUMA 1O5FH 1V2WT 3E90B 2ZCLP 1QGFA 1NO9H 1QL7A 2THFB 4GUXA 4I33A 4BNRA 1G36A 2ZWLH 2O8TA 4CREA 1TOCB 2BLVA 4IC6A 1MTUA 2W5EA 1ELGA 2Y7XA 3UFAA 1OWKA 1SBWA 1H9HE 1XKAC 2HPQH 1MUEB 4B71A 4X1RU 1VR1H 4NIXA 2Z3CA 1RFNA 1O36A 2ODPA 2Z9JA 1EZSC 3UOUA 1MD7A 4Q7YA 6CHAB 4JZEH 1BJUA 1Z8GA 2QXJA 3SHAH 1OKXA 3OY5U 4IS5A 3ZZCA 1OOKB 3RLWH 4ZUHA 2BZ6H 2Z3EA 1O2XA 4IMQA 5DO4H 5K7RA 1OS8A 5B6OA 4U32A 4NZQA 2BVXH 1SQAA 1YYY1 1B7XB 1TPPA 2ZDVH 4WMEA 3ZVEA 2FWWA 1XM1A 1QA7A 1ACBE 3PLPA 4NIVA 1AD8H 4I31A 1CGIE 1CA8B 1GI9B 1MZAA 1QB1A 2ESTE 2NU3E 2A4QA 4NWKA 1DICA 1PPHE 2FDAA 3STIA 4E7NA 5ESTE 3S9AA 5I25A 1DWBH 1SVPA 1OXGA 1EAIA 1G2MA 3ATKA 4ZKRU 5T3HA 4FUIA 2FXRA 1ELCA 1XUHA 1DY9A 6GCHF 3T28A 2BOKA 1SLXB 1FAXA 3QTVH 5DK1A 1CGJE 4ISNA 1ESBA 1S81A 3NXPA 4H42U 1J15A 1LHCH 4WH6A 3VB6A 3SO3A 3UPEA 2HNTF 2BLWA 2FS8A 1V2NT 2H5DA 2F83A 3S9BA 4ABIA 4CR9A 5GWZA 1CU1A 1GI7B 4H6TA 2EC9H 2PUQH 2G8TA 1C5QA 4ISLA 1TLDA 3GCNA 1E0FD 3TIUA 2NWNA 3DFLA 5EPNA 4IMZA 2F91A 2ANWA 3SV8A 4UFGH 3TK5A 2G81E 3EA8A 3KHVA 3D65E 3TITA 1C5PA 1RS0A 2W3KA 3UOPA 3EA9A 3F9GA 3QGNB 5DP7A 1THRH 3UNSA 3RU4D 1EZQA 3DT0H 1CT2E 2Z3DA 3LC3A 1P10A 2V35A 1FLEE 3A7ZA 1CBWB 3RP2A 1A5GH 2AGEX 1SFIA 1O2HA 3V7TA 5AHGH 3TGKE 5HM9A 1QB9A 1P9UA 2VIVA 5IYTA 1ELFA 1QFKH 2BD2A 3GY8A 5ESBA 3SNEA 2FP7B 4UFDH 4MLFB 2A7JA 2OTVA 1HFDA 4O03A 3ZZ7A 4KTCA 2H2ZA 2A5IA 1A61H 5TCAA 2XBVA 1FNIA 1Z6EA 3SJ9A 1XX9A 3ODFA 3B9FH 1AVWA 4K1EA 1C1TA 3MH5A 1Y8TA 4DIIH 4HZHA 1SGPE 2ZZUH 1O3IA 3HKIB 3AVZA 1TONA 2OC1A 4CHAB 5HMAA 4I32A 4M7GA 1Y3WA 3I29A 4A1VA 1A0JA 3EGKH 1SGTA 1UMAH 4NIWA 2OP9A 2ZDNA 4FVBA 1GPZA 6CHAC 6ESTA 1FPCH 4SGAE 1C5RA 1V6DA 2FTMA 2P59A 1HJAB 2FZZA 3VEQB 4Y8ZA 1EPTB 1TQ0B 4HGCA 2QC2A 1NY22 5FAHA 3LH3A 2BLOA 4JYUH 5FPSA 1EUFA 3RC5A 2GV6A 4E05H 4ZHAA 2G52A 1OX1A 1HGTH 1QY6A 3AASA 2PWXA 2Z9GA 1LDTT 3Q3XA 1O2VA 1C1PA 1W2KH 1C5ZB 1BTZA 1QJ7B 1IAUA 3GCTF 1TE0A 1KXBA 1SPJA 1GI4A 5DP3A 1VCPA 2ZDLA 3A7XA 1KLJH 1LVOA 2W26A 1FDPA 4BANB 4INKA 4JYTA 2F9BH 1EQ9A 2VWOA 4YT7H 2GCHG 1OP2A 4NG9H 1E37B 1WV7H 1FZZA 3C1KA 2FI4E 2YNBA 1GL1A 4F4OC 4CRDA 3ENSB 1H9LB 2VU8E 1DM4B 3GY2A 4CRCA 3ZYDA 3N7OA 2PGQB 4UFFH 1GHAF 1BQYA 2SGQE 3QZRA 4KGAA 2PV9B 1ZYOA 3ELAH 3ITIA 4WF8A 1Y5AT 5TJXA 2Q6DA 1LKAA 2SFAA 5DP5A 1T7CA 5K0HA 4J1YA 3GDSA 1ETSH 3ZVBA 3PWBA 2H5CA 3KF2A 4A7IB 1AVXA 2XC5A 3IITA 2ALVA 2PUXB 2OD3B 1PPEE 3SJKA 1YCPK 1PJPA 1ZSKA 3BTME 2R3YA 3SQEE 4CRFA 3BEUA 4DCDA 4FUBA 2OBOA 3BTDE 4K1TA 2UUJB 5C20A 2GZ7A 3DUXH 4FXGH 2CMYA 1HPGA 1D9IA 1Y59T 3ZVGA 1C2MA 1CBWC 2ZGCA 3RMOH 4MPUA 2FOFA 3O8DA 1BMNH 4ISHH 1YCPH 2PKSB 7LPRA 2A7HA 1NRPH 4MNVA 3RXFA 1AI8H 4JYVH 1VCQA 5E0JA 2VH6A 3O8BA 2SGPE 5FHTA 4OS6A 4OS7A 1A0HB 1T8OA 1O3OA 1HAYB 1XVMA 1O3AA 5HGGA 1BTXA 4OS5A 2OUAA 1FY5A 2QY0B 2Y82A 1TNJA 1EASA 1V2KT 2H1UA 1C9PA 4BXWA 5FPTA 4B1TA 3VB3A 3PB1E 2FPZA 1CVWH 1SB1H 4AFZA 3D62A 1GMCG 1XUJA 3P17H 3V12A 1NRQH 1UVOA 4Q80A 2Z9LA 1XMNB 1V2PT 3VXFH 4K8BA 4ZMAH 3M3SA 2FX6A 3RM0H 3MNBA 2BY6X 1W11U 4CHAC 4AGJA 1UJ1A 2D26C 3A87A 1K1JA 3NZIA 3OSYA 3RU4E 4AOQA 9ESTA 3STJA 3FZDA 2ZC9H 1P2NA 1OYQA 2GGVB 1V2LT 3W95A 1EJAA 1VITH 1GJ9B 4K69A 6GCHG 1GJBB 2P93A 1UCYH 1HJAC 2GDDA 2GZ9A 1C5LH 3U69H 2F9OA 1W10U 1TRNA 1RD3B 1Z8IB 1LPGB 1EPTC 1NFUA 5C1YA 4BAQB 1S0QA 2OLGA 1D3DB 1PPBH 1T8LA 1TIOA 1GVKB 2ZU4A 4D9RA 4J2YB 1V2QT 1XXDA 1O30A 2H9HA 1KDQB 1SQTA 3NWUA 1AB9B 1OP8A 1GBIA 1DLEA 3HKJB 4X2XA 1BRAA 4DW2U 1HNEE 1GBMA 4NIYA 1QRWA 5E2OA 2G4UA 2CF8H 5T6GA 3QGJA 4X1PU 1MAXA 4NA9H 2BHGA 1AO5A 3S7HB 2J94A 4SGBE 1ABIH 1GI8B 4YT6H 1F92A 5C2ZA 1CHGA 2ZFSA 2R3UA 1O3BA 4ABDA 1Q2WA 4WVPE 1V2TT 4Y0YE 3LT3A 1N8OB 1BZXE 1QRXA 4WY3A 1EXFA 1SLVB 1ZHMA 2NU2E 1HAZB 5A2MH 1CE5A 4AFUA 3KNXA 2R2WU 1GHYH 5EQSA 5FX5A 1K1OA 5JDUB 1WTHD 1LVBA 4FVDA 3PV4A 5EQRA 2IN2A 2ANMH 5LGOA 2EI6A 3RXDA 1FY4A 1HJ8A 2FOCA 1G3CA 2C90B 3IWMA 1W7GH 1GMDF 1P3CA 1TMTH 4MDSA 4U30A 2XYAA 3E1XB 1GJAB 2R0KA 1BT7A 2Z94A 2J9NA 1C9TA 5GCHF 1SOZA 2ZU2A 4B2BA 3MU8A 1JRTA 1IQJA 3TJUA 1V2ST 2PKSC 1IQKA 2BDCA 7GCHF 3SZNA 2ZDKA 3MH7A 1RGQA 2FYRA 5DKMA 3W94A 4FUHA 1ZPCA 3GY7A 1A7SA 4UE7H 5G4BA 1C2KA 2B0FA 3BF6H 4JZDH 1YP9A 3SU1A 3K65B 1GI2A 1V2VT 2ZDMA 2A45B 2CGAA 1OWJA 2P3UB 3M5OA 4R8TB 1EZXC 2LNCA 3HK6B 3UY9A 5JB8S 3FZZA 1SG8B 4NZLA 5HM2A 3SV2H 1V2UT 1QRZA 1IOEA 4AFSA 1C5XB 4FUFA 4YM9A 2IPHA 3GCTG 2ZU3A 2ZEBA 1JMOH 2ULLA 1TOMH 2R2MB 4Q7XA 1G3BA 1NU9A 3VGCB 1ANCA 2F9PA 1O3MA 3MNXA 2H9EH 3V13A 3A80A 4FU7A 3A88A 3M5NA 3PLKA 4RN6A 3TLOA 2OC0A 3PM3A 5AF9H 1CA0B 1BJVA 3F68H 4A6LA 3DHKH 1GHAG 1HAPH 3RM2H 1DWDH 3CS0A 1OSSA 1EOLA 3SBKA 4AYVB 2J4IA 1AQ7A 1TX7A 1LKBA 3PO1B 3UR9A 4NA7A 2VIWA 2WPHS 2TRMA 1AB9C 1KSNA 1HIAA 4NSYA 2B7DH 1ARBA 4UFEH 1IQMA 4ASHA 4Q2KA 1D4PB 1TAWA 3BTWE 3MH4A 1J8AA 4THNH 4K8YA 1PYTC 3FANA 4FUCA 3F9FA 1DXPA 1MU6B 1QA0A 5A8ZA 2VH0A 2ANYA 1MU8B 3BV9B 4AN7A 3EA7A 2RA3A 1VJAU 1S82A 1GVZA 3T25A 4K2YA 1YCPM 3FP8E 3M7TA 4XBBA 4X2VA 1FAKH 4K1SA 2ZGXH 3C27B 1RIWB 4AG1A 2VB0A 5A0CA 1KLIH 1C2IA 5DJ7A 1N8OC 1ELAA 4D9QA 1BIOA 3GDVA 3MHWU 2FO9A 3RXOA 2ZFTA 2HVXA 3NPSA 3ATWA 5PTPA 3KN2A 3IG6B 4X8SH 1SMFE 4HTCH 4I8JA 5E0GA 1GBHA 1F0TA 2WPIS 1BBRE 1OWIA 3QZQA 1O2QA 1GI3A 5A8YA 3Q76A 3SOSA 2QV1A 1PFXC 1INCA 4GAWA 3MO3A 1DE7H 5DP6A 1THSH 1O2IA 2WV5A 2ZFRH 1VITF 2AEIH 3KQBA 2GTBA 2SGAA 3SV6A 1P2QA 1G37A 3A7WA 4AZ2B 2G5VA 3RXSA 1IQFA 3RXPA 3BSQA 4XSKU 2F3CE 4JK6A 4WXIA 1NESE 2UWOA 1NROH 3U1JB 3PTBA 5FPYA 3GY5A 3TGJE 1KTSB 3T29A 1GHZA 1JBUH 3E6PH 3K6ZA 4FUJA 3RXUA 4GHQA 3SJIA 4BXSA 2PKAB 2J38A 2WUCA 1AFQB 2Y7ZA 3SNAA 1D3QB 1D3PB 3RXAA 1GMCF 1UTNA 4BAMB 2QCYA 2GVFA 2W7SA 1SC8U 1ETRH 1K9OE 3VGCC 4CRGA 2OC7A 1GBDA 1HV7A 3RMNH 3P8GA 1DXWA 2Q6GA 1DX5M 3ZVAA 4ISOA 1ORFA 1LQDB 1OWDA 2QXHA 3BN9A 4XDEA 2GZ8A 1MZDA 1ANBA 4FUEA 1GVLA 1AFEH 1CA0C 1LQEA 4DT7B 5L30H 1SL3A 1EJMA 5E8EH 1A2CH 3TNSA 1DWEH 1E35B 5EW1H 1GL0E 2GMTB 2Y5FA 4ZKSU 1AHTH 1TALA 2A2QH 1XKBC 1Y3VA 1DSTA 3FP7E 3MFJA 3CENA 2QA9E 2O8UA 3PO1C 1YLDA 2AMDA 4Y0ZE 3A83A 2AYWA 1YPMH 3UNQA 1UVSH 4RKOB 3T62A 1D3TB 1PPZA 1T31A 4Z0KA 1TGSZ 2D1JA 2VVCA 3TPIZ 4BTIB 5BPEA 4BOHA 4XFQA 2ZU5A 1UTKA 1UVTH 1YKTA 1UK2A 1QCPA 1GMDG 4YLUA 1CGHA 5HYOA 4MNXA 3A89A 5GCHG 2QF0A 3RXGA 3MU5A 1MKWK 1TNLA 2LPRA 7GCHG 2WPKS 2PKAA 3U8OH 3EAJA 1L2EA 3UIRA 3ODDA 5DP8A 1RIWC 4NA8A 2BD3A 1RTLA 1O2KA 4IGDA 1C1VH 1XUKA 2ALPA 2FEQH 1E36B 3SU4A 1GJ4H 2XC4A 3BEFB 1Q31A 2V6NA 1ELBA 1MKWH 2PTCE 1C1UH 3KL6A 1CT4E 1H4WA 4DG4A 3TK6A 1D6WA 4B73A 2D8WA 3TH3H 2HNTC 1HXEH 1AGJA 4TWWA 1P2IA 2D2DA 5JYIA 1ZOMA 1O2NA 1ZR0A 1UTQA 3Q3YA 1SQOA 5LH8A 2DE9A 1V2RT 3P92A 2H6MA 1TGNA 2PLXA 1GHVH 4OGYA 1IQEA 6LPRA 2BY9X 1TNIA 1BB0B 3LGYA 1YPEH 1K22H 4NGAH 1SLWB 1P09A 1A3EH 3LONA 4H6SB 3GCHB 5A09A 1ELTA 1B0FA 3RDZA 2GD4B 1F0UA 2TGPZ 5EXNA 2SNWA 1Z1IA 1TX8A 2C4FH 5F8ZA 2FMJA 8ESTE 1LPZB 1O2UA 1SGFG 1HAGE 1O3JA 3M35A 1ID5H 4X8UH 2FI3E 1BRBE 3SJOA 1C4U2 1GCTB 1F0SA 3S69A 2V3HH 1AFQC 1BMAA 2ASUB 2XRCA 4MQAA 2FODA 2ZP0H 3SU0A 1O2WA 1TA6A 5FXLA 3FAOA 4CR5A 2I6QA 2QYIA 3VPKA 1UTMA 4OGXA 2FOBA 1LMWB 3Q3KA 4E06H 2I6SA 4IW4E 1NFYA 2G51A 1T32A 2Y81A 3QLPH 1O2GH 5JBAS 2QIQA 3BIUH 1O2YA 1HYLA 1MKXK 1TABE 1P04A 4IBLH 1QJ6B 5T6FA 4AYYB 3ATIA 4FUDA 2ZNKH 3T27A 3FP6E 2ANKH 3LGTA 4KTSA 2H9TH 1A5IA 1V2OT 3SUDA 1PQAA 2YOLA 3QUMP 3RXHA 3RXBA 4A5TS 2GMTC 1BA8B 1YBWA 3MI4A 1TBZH 1C5TA 3EDXB 3LPRA 2P8OB 3A86A 3KIDU 5AFYH 2WINI 1Z6JH 2J95A 3BEIB 3V3MA 1MKXH 4LZ1H 3BTFE 1AZZA 3SGBE 4B76A 1O3FA 1DLKB 2QAAA 1JWTA 2ZHEH 1Z8JB 5C3NA 4GCHF 3VFEA 3LU9B 4TY7A 2XBWA 1P9SA 1HCGA 5EXMA 2ZHFH 2XCFA 3ZZ3A 2RA0A 1O5BB 1ELEE 2XNIA 2K7XA 4Y79A 1YPLH 4B74A 1GBTA 1ESTA 1VITG 5E2PA 4I7YH 2Z7FE 5F6MA 3SV9A 3BTQE 5JB9S 2TBSA 2AERH 2BD7A 2ZQ2A 4DJZB 2BY5X 1V3XA 3G01A 1NU7B 1SR5C 3MU0A 4BAKB 2B8OH 4FUGA 1PPCE 1GJ8B 1LHEH 1O34A 1ZSJA 3GY3A 4B75A 2ZG0H 3T5FH 1E38B 5C5NA 1UTJA 3EQ0H 3GISB 4TPIZ 1C1WH 1P2MA 1TFXA 1DFPA 5CMXH 3OTJE 1P2OA 1S85A 1GHXH 4I8LA 4JZ1A 1ANDA 4LK4A 2BX4A 2V3OH 2ZIQH 3LC5A 4Z6AH 1GCDA 1VZQH 1Q3XA 1YGCH 2BDAA 2R0LA 1EX3A 1HAOH 7ESTE 1LVMA 1TNHA 3A7TA 1QQ4A 4ABGA 2J2UA 3LIWA 3RXLA 1P02A 1BCUH 2EI7A 3RXKA 1PQ8A 1BUIA 2W7UA 1C5NH 2F9UA 3GICB 1GBEA 2PHBA 1LHDH 5DG6A 4KP0A 2BM2A 3GCHC 1L4DA 1ELVA 3QX5H 1NFWA 2WPLS 3M7UA 1O3GA 3TH4H 1AWHB 3M37A 1C5OH 1SGYE 2FM2A 1GJ5H 1AMHA 1HRTH 1TBRH 3PMJA 4RKJB 1KXDA 5I46H 2FOHA 1GMHG 4D7GA 1LHGH 1EJNA 1GDQA 1GCTC 2PR3A 4LZ4B 1O2LA 1TGTA 3L33A 1SHYA 2FESH 5E0HA 1P01A 2XWBI 4CBOA 2SGFE 1OWEA 4MG3A 4Y6DA 1C5SA 3UTUH 4A92A 5C1UA 2G00A 1W13U 1EOJA 1F7ZA 3MTYA 1AY6H 2HGTH 4F49A 5LPFA 2ZGBH 1YM0A 1ZMNA 1N6YA 1W3CA 2A4RA 1MCVA 1O2SA 1OWHA 8KME2 1C1RA 1A3BH 4X8TH 3PTNA 1T8MA 2WPJS 1DUAA 3K6YA 4ZHLU 1ZZZA 1P2KA 1W12U 2SGEE 1FXYA 1WU1A 2AIQA 3ZYEA 1UCYE 3AAUA 4GHTA 1O38A 1YF4A 1BRUP 1WTGH 2EA3A 4ZAEA 4DIHH 1EAWA 2P8OC 1AE8H 1O5DH 2BYAX 5GIBA 3ZZ6A 4WXVA 4MNYA 2O8WA 3VXEH 2FIRH 4HI3A 4BAHB 2TGTA 3PYHA 1D6RA 4XE4A 4B2CA 4YOIA 4ZKNU 1L1JA 1O5CB 1JIRA 1HAVA 4NFFA 1C4Y2 1QBVH 2GDEH 2G55A 2FI5E 4IN1A 1GG6B 2ZF0H 1FV9A 2VIQA 2C93B 3RC4A 4ZROA 1NT1A 2FLRH 2HALA 2AMPA 2FYQA 1KIGH 5CE1A 1ZJKA 4JZFH 4R0IA 4ABJA 4D8NA 1ZGIA 1GDUA 2JETB 1HIAB 1AVGH 1O5GH 4OS2A 2AS9A 4H4FA 1S6HA 1FN8A 3HGPA 5EG4A 1DSUA 3TJOA 2F9NA 2VJ1A 1JOUB 1ZMJA 2GT8A 1O2PA 1DOJA 1C5WB 1FIWA 1H1BA 2KAIB 1SGNE 1S6FA 2ZPSA 2BDIA 4I8GA 2VVVA 1C5MD 4I8HA 2HNTE 5L2YH 2IOTA 4GVUA 2QF3A 2ZPQA 3U8RH 3GCOA 3ZZ8A 2PW8H 3SGAE 1F2SE 5FBIA 1HDTH 4CH2B 2CF9H 4D7FA 3K9XB 4DY7B 2DE8A 2HWLB 2J34A 3MWIU 1EP6A 1JIMA 4AGKA 2A7CA 2TIOA 3P8OA 1ZTJA 4NFEA 2ODQA 5GPIB 1GGDB 2Y6TA 1A46H 3B8JA 4OS1A 2C8YB 3D23A 1O2JA 1C2JA 1ZJDA 1ANEA 1PQ7A 1BOQA 4O9VA 1J9CH 2Y5GA 3MU4A 1NZQH 2Y5HA 1NFXA 3ZZ5A 2JH6D 4GSOA 1BTWA 4AORA 1CO7E 4MVNA 1G9IE 1C4V2 2BLQA 1O3EA 3TK9A 2BD8A 3VB5A 2OC8A 5ABWA 1O3LA 3M5LA 4IC5A 5BRRE 2ZHWH 1TPOA 4GCHG 4UEHH 3V0XA 1MQ5A 3L3TA 1BBRK 1F5LA 1T4VH 3BTKE 1VGCB 1HLTH 2HRVA 4LOYH 2ZCHP 1O33A 1DT2A 1ZRKA 4MTBA 1TNKA 2CJIA 2O8MA 2VVUA 5HXFA 3M5MA 2BY7X 2ZTYA 1B0EA 1RTFB 4KTUA 2KAIA 4Y71A 4I8KA 1UO6A 2GP9B 3UWIA 3MU1A 1OP0A 5DGJA 3SNBA 1P3EA 1BBRH 1P05A 1ZMLA 1G30B 1B5GH 3GY6A 4UONA 1BRCE 3SORA 1W14U 3KGPA 3VB7A 1FY3A 1GJ7B 1GHWH 3KCGH 4PROA 2BOHB 1TX6A 1QR3E 3P8FA 1XUFA 1WQVH 2B5TB 1HXFH 4XBCA 1C2GA 1UHBA 3LOXA 5GDSH 3GOVB 3BG4B 3ZVDA 4WMDA 3TU7H 3U8TH 1O2ZA 1K1NA 1GG6C 5H4IB 1O0DH 2R9PA 1GJ6A 1SGQE 2A2XH 3L6PA 1GWAA 3SHCH 1UVPA 2VIDA 1TB6H 5JPMH 2XCNA 4INLA 1YPHC 2JETC 2ZFQH 2FX4A 3SNCA 1YPJH 2ODYB 1O2OA 4X6PA 1C1QA 1CQQA 2ZGJA 1TMUH 1OPHB 1SI5H 1K1LA 2AGIX 1XUIA 1DITH 3H7TA 5A0BA 5C1XA 1MTNB 1QBNA 2B9LA 1O3DA 1TMBH 2VWNA 1IHTH 1MMJN 2IJOB 1AZ8A 2TPIZ 1IQIA 4CRBA 1WBGB 3KEEA 3VB4A 1KTTB 3TJVA 2AFQB 1PYTD 2YNAA 3NCLA 5SGAE 3WY8A 1K1IA 5FX6A 1O2RA 1TGCA 4X2YA 2P16A 1HAIH 1TWXB 3LJJA 3RXIA 2ZA5A 1TPAE 3SI4H 1EB1H 3S9CA 3A7VA 1FI8A 1K1MA 2BDHA 4ZXXH 1QNJA 2ZTZA 4ABEA 2RDLA 1GGDC 1HBTH 1O3PB 2XBXA 1GJCB 2PFEA 1ZTKA 2C8WB 2ZFFH 1YPGH 1VJ9U 1A5HA 1NM6A 2BXTH 2C8ZB 4CRAA 3DD2H 2UUYA 2XC0A 2AIPA 3E3TA 2GT7A 3TVJB 1OYTH 4Y8YA 1DY8A 1GI6A 2BVRH 3LKWA 1P57B 1GMHF 2WV4A 2ZU1A 3SUGA 5EW2H 4AB9A 1RXPA 3NKKA 5CHAB 3U9AH 3DA9B 3AAVA 5GXPA 2BY8X 3HPTB 3HK3B 2VNTA 1WSSH 1O2TA 2HOBA 1Y3XA 2ZTXA 1MTSA 3MO9A 1VGCC 3R0FA 4MNWA 3SUFA 1P2JA 5AFZH 1H8IH 1NRNH 2V0BA 1GHBF 3RXJA 2ZHQH 2W3IA 1ESAA 4U01A 2BXUH 3CS7A 3QO6A 4AX9H 1BHXB 4YO9A 2Y80A 2XXLA 4X6NA 2J92A 1WOFA 2K1QA 3RXTA 3UUZA 1A4WH 3A8AA 4YOGA 2QGRA 3U98H 3RXEA 1AE5A 2HPPH 1HUTH 2FTLE 1ZRBA 2BQ7B 5EQQA 1EAUA 1S84A 4O3TA 2XBYA 1F5KU 1GI1A 3F1SB 4RSPA 3E0NB 1U6QA 2JH0D 2BD9A 2P94A 4YZUA 1KXEA 1C2FA 1HB0B 1LHFH 4ISIH 1KXFA 4A1XA 1SGRE 1GBBA 3QTOH 1BTHH 3BG4C 4YLQH 1NS3A 1PQ5A 1TGBA 4CBNA 3SU2A 1ZHPA 3BTTE 3P6ZB 1QIXB 2OQ5A 1MTWA 1P0SH 3GYMA 3MO6A 2EI8A 1UTPA 1BTPA 1K1PA 2BQ6B 3A81A 1Z7KA 3ZZ9A 3RXCA 3RXVA 1SSXA 4OS4A 3K2UA 1NN6A 1ZPZA 3I78A 1O5AB 2XWAA 3FVFB 2NU4E 1RRKA 3A7YA 5AVDA 1J14A 4K60A 3H5CB 1MTNC 1S83A 1ZPBA 3A8DA 1LCYA 2PTNA 3TH2H 1BITA 2BZAA 3ESTA 1J17T 3BG8A 3A8CA 2BX3A 4NWLA 5EXLA 2GKVE 1AKSB 2VIOA 4WJG2 1BHXF 2QXIA 2WYGA 2BB4A 3SN8A 3HATH 2BD4A 3E16B 1AUJA 2HLCA 1KY9A 1TA2A 4WMFA 1GBLA 1ZTLA 5DP9A 2Z9IA 3MMGA 2P3TB 3RXQA 1X7AC 1Y5UT 1WYKA 4WH8A 5DP4A 4DGJA 1AU8A 2ZI2H 8GCHG 4K3JA 2VGCB 3M3TA 1XVOA 3UNRA 3O8CA 1TYNA 1UTLM 5L6NH 3ZVCA 4ZH8A 4JZIA 4U2WA 4O97A 1LO6A 1GI5A 2AGGX 5C67A 2GV7A 4TPYA 1ETTH 1V2JT 1IQLA 2BTCE 3SI3H 3RLYH 1KLTA 1O37A 5F8XA 1NTPA 1UK3A 1Z8RA 2A4OA 4O3UA 1TQ7B 1EATA 3PMAB 1NC6A 1L0ZA 1C2LA 2M5TA 2F9VA 2WYJA 1C5YB 1G3DA 1Z71A 5A0AE 3U1IB 2STAE 1QHRB 5CHAC 1WUNH 5F03A 4Y8XA 3RXRA 3BTGE 4BAOB 5JBTA 2UUKB 2EEKA 1DWCH 5J4QA 1K28D 4Q7ZA 3QK1A 1Z1JA 1UTOA 1O3KA 1P12E 1IQNA 1C2DA 5JBBS 3SJ8A 1QTFA 1GBKA 1RTKA 2LIZA 2UUFB 2C8XB 1NRRH 3T26A 1KXCA 4TWYA 1BDAA 1UVUH 4YTAA 1SOTA 1EAXA 4E7RG 4FU8A 4X1SU 3KQCA 1CHOF 4UDWH 4ZKOU 3F6UH 5EU8A 3LGUA 3GY4A 4TY6A 2TGDA 1P8VC 3QWCH 1W8BH 2NU0E 1C1MA 4XOJA 1IQGA 1AKSA 3AW0A 4Y76A 1O32A 1EP5A 2NU1E 1L1GA 3A82A 1AIXH 2G4TA 2UWLA 1O2MA 4XBDA 1MH0A 1UK4A 4BTTB 1EPTA 1TRMA 1MAYA 3F9HA 3DFJA 3D49H 2FOAA 2A5AA 1E34B 2A31A 3EBNA 2ZGHA 2JH5D 2G5NA 1FONA 4VGCB 2VWMA 1LVYA 3MH6A 4DVAU 1XXFA 1EZUC 4JMYA 4Y11E 1DS2E 1O5EH 1IQHA 1H9IE 4X2WA 1YPHE 4B2AA 4JK5A 2CN0H 1QB6A 1IHSH 3A84A 3LH1A 5GJ4B 2A5KA 3I77A 1YPKH 1C5UA 2GCTB 1HAVB 1MTVA 3P95A 3ATMA 1GBCA 1NPMA 2ZKSA 5L2ZH 3RC6A 5EPYA 1GBJA 3BTHE 1GJDB 1C5VA 4KKDA 3SQHE 1EB2A 2XW9A 4AG2A 3URDA 2ILNA 2C3SA 3PLBA 3ZZDA 4MPXA 5DPAA 1BTUA 5EOKA 1UCYK 1SFQB 4QT8C 9LPRA 1O39A 1GDNA 1TPSA 4GPGA 1Y3YA 2BDGA 1FN6A 3UQOA 1FY1A 1GBFA 3MNCA 4UD9H 1FY8E 3ZVFA 1O3NA 2VWLA 1H8DH 1AUTC 2BQWB 5T6DA 3A85A 1MQ6A 4MPWA 2FS9A 1ELDE 2A0QB 3SGQE 1O35A 5FCRA 1VCWA 1M9UA 1PPGE 2Q1JA 1HAXB 1PPFE 3F9EA 2OINA 1ZLRA 1C2EA 5EODA 3SU5A 2O9QA 2STBE 5JBCS 2CHAB 5EGMA 1GHBG 3OY6U 5LPRA 3SW2B 2OQUA 2VGCC 2ZPRA 3URCA 1S5SA 4Y7BA 2A1DB 2RCEA 2Q6FA 5A8XA 1V2MT 1CSOE 1LTOA 3M3VA 3LDXH 1G32B 2FOEA 1T4UH 1ZHRA 1DDJA 3JZ1B 3A8BA 1CT0E 4Y10E 2RG3A 1QURH 3SU6A 5LPEA 3GYLB 3PMBB 4ESTE 3M61U 4AFQA 4X8VH 4TYDA 3SNDA
chains in the Genus database with same CATH superfamily
3GDUA 4JCNA 3MOCA 3SV7A 4ABHA 3ZZ4A 2BD5A 1DPOA 5ETXA 1F0RA 1ZGVA 3AK5A 1L4ZA 3OU0A 1YC0A 3LGIA 1P06A 4FU9A 3ZZBA 1G3EA 1ZSLA 3FOAA 3AW1A 3KQEA 2BVSH 3RMLH 3GS9A 4A1TA 3UAIC 3NK8A 2QN5T 4ZXYH 1THPB 1GI0A 2OBQA 3S0NA 1S0RA 1FJSA 2CV3A 1BTYA 2BDYA 3LJOA 2GX4A 4YOJA 4KELA 4BTUB 1FPHH 1QQUA 3M7QA 3R3GB 1Y3UA 3HGNA 4DOQA 2WPMS 2ZO3H 4X0WU 2UWPA 1WAYB 3RUOA 5J4SA 3B23B 4WWYA 3OX7U 5C5OA 1O31A 2M2AA 3TNTA 1SGDE 3FFGA 4RI0A 1E1RD 1YLCA 2L74A 3QN7A 1N1LA 1SGEE 1KYNA 3Q00A 4ZCNA 1QL9A 1HAHH 1SGIB 3PMHB 3UR6A 1MD8A 4VGCC 2BDBA 1KDQA 2WUBA 3LGVA 2FOGA 4HFPB 3JZ2B 1EKBB 3E0PB 1GBAA 1W0ZU 1FUJA 5TCCA 1O3HA 3SU3A 4IN2A 4X1QU 5IDKA 2QXGA 2VIPA 1YLNA 1MBMA 3TJNA 1A0LA 1HJ9A 3H7OA 1QJ1B 2AH4X 1UHBB 2GCTC 2Z9KA 1WDIA 1AWFH 4M9FA 3OYPA 1K2I1 2TGAA 3P70B 5F8TA 3E91A 4Y7AA 3CP7A 2ZHDA 2OXSA 1SLUB 3LGWA 2ZECA 1NRSH 3EYDA 3ZV8A 3RMMH 1XUGA 5FCKA 3M36A 1WQSA 1C2HA 3BTEE 4CH8B 1W7XH 4NCYA 2FLBH 1ABJH 4RT0A 2P3FH 2ZQ1A 2DUCA 4DURA 4X6OA 1LPKB 3S7KB 2BMGB 3E8LA 2AMQA 4LXBH 3TGIE 1DANH 2ZDAH 4ZHMU 2JKHA 1P11E 1AN1E 2YMSD 1FMGA 4D76A 1K21H 1F5RA 1JXPA 2FOMB 3UWJH 3MNSA 3UREA 4AB8A 3KQDA 3UQVA 4ABBA 4MPVA 1ARCA 3P8NA 4GLYA 4X1NU 1TRYA 1DVAH 1SGFA 1QL8A 2PGBB 1G2LA 2PSXA 8LPRA 1QBOA 1RJXB 1A1RA 2CHAC 2CXVA 2F4LA 8GCHF 3SUEA 2SGDE 3ZV9A 4ABAA 4X6MA 5FBEA 2V7QD 1CHOG 3RXMA 2VINA 1MBQA 1SHHB 3O8RA 1J16A 3EE0B 1BMMH 2P95A 1FQ3A 2HLDD 3ATLA 1JRSA 4I86A 3BIVH 1TBQH 1P03A 3QDZB 2KX4A 4INHA 7KMEH 4K5ZA 1O3CA 1FIZA 1TNGA 2A32A 4ABFA 2SNVA 3MYWA 1WCZA 1BMLA 1MCTA 3PWCA 2O8LA 4Q4LA 2GCHF 3KYFA 4NSVA 2ZFPH 4YESB 1L1NA 3ZZAA 1SGCA 3Q77A 2OCVB 3T2NA 1Y5BT 2EQNA 1DUEA 1N6XA 1T8NA 2PSYA 2Z6BD 3PROA 1C1SA 1C1OA 1C1NA 2ZCKP 2A4GA 1KXAA 1W0YH 3RU4T 2XTTB 3NUMA 1O5FH 1V2WT 3E90B 2ZCLP 1QGFA 1NO9H 1QL7A 2THFB 4GUXA 4I33A 4BNRA 1G36A 2ZWLH 2O8TA 4CREA 1TOCB 2BLVA 2KCOA 5KECA 4IC6A 1MTUA 2W5EA 1ELGA 2Y7XA 3UFAA 1OWKA 1SBWA 1H9HE 1XKAC 2HPQH 1MUEB 5DN6D 4B71A 4X1RU 1VR1H 4NIXA 2Z3CA 1RFNA 1O36A 2ODPA 2Z9JA 1EZSC 3UOUA 1MD7A 4Q7YA 6CHAB 4JZEH 1BJUA 1Z8GA 2QXJA 3SHAH 1OKXA 3OY5U 4IS5A 3ZZCA 1OOKB 3RLWH 4ZUHA 2BZ6H 2Z3EA 1O2XA 4IMQA 5DO4H 5K7RA 1OS8A 5B6OA 4YXWD 4U32A 4NZQA 2BVXH 1QZ8A 1SQAA 1YYY1 1B7XB 1TPPA 2ZDVH 4WMEA 3ZVEA 5C0UA 2FWWA 1XM1A 1QA7A 1ACBE 3PLPA 4NIVA 1AD8H 4I31A 1CGIE 1CA8B 1GI9B 1MZAA 1QB1A 1WXRA 2ESTE 2NU3E 2A4QA 4NWKA 1DICA 1PPHE 2FDAA 3STIA 4E7NA 5ESTE 3S9AA 5I25A 1DWBH 1SVPA 1OXGA 1EAIA 1G2MA 3ATKA 4ZKRU 5T3HA 4FUIA 2FXRA 1ELCA 1XUHA 1DY9A 6GCHF 3T28A 2BOKA 1SLXB 1FAXA 3QTVH 5DK1A 1CGJE 4ISNA 1ESBA 1S81A 3NXPA 4H42U 1J15A 1LHCH 4WH6A 3VB6A 3SO3A 3UPEA 2HNTF 2BLWA 2FS8A 1V2NT 2H5DA 2F83A 3S9BA 4ABIA 4CR9A 5GWZA 1CU1A 1GI7B 4H6TA 2EC9H 2PUQH 2G8TA 1C5QA 4ISLA 1TLDA 3GCNA 1E0FD 3TIUA 2NWNA 3DFLA 5EPNA 4IMZA 2F91A 2ANWA 3SV8A 4UFGH 3TK5A 2G81E 3EA8A 3KHVA 3D65E 3TITA 1C5PA 1RS0A 2W3KA 3UOPA 3EA9A 4F55A 3F9GA 3QGNB 5DP7A 1THRH 3UNSA 3RU4D 2JJ2D 1EZQA 3DT0H 1CT2E 2Z3DA 3LC3A 1P10A 2V35A 1FLEE 3A7ZA 1CBWB 3RP2A 5CDFE 1A5GH 2AGEX 1SFIA 1O2HA 3V7TA 5AHGH 3TGKE 4P02A 5HM9A 1QB9A 1P9UA 2VIVA 5IYTA 1ELFA 1QFKH 2BD2A 3GY8A 5ESBA 3SNEA 2FP7B 4UFDH 4MLFB 3CNRA 2A7JA 2OTVA 1HFDA 4O03A 3ZZ7A 4KTCA 1W0KD 2H2ZA 2A5IA 1A61H 5TCAA 3SZEA 2XBVA 1FNIA 1Z6EA 3SJ9A 1XX9A 3ODFA 3B9FH 1AVWA 4K1EA 1C1TA 3MH5A 1Y8TA 4DIIH 4HZHA 1SGPE 3SYJA 2ZZUH 1O3IA 2QF5A 3HKIB 3AVZA 1TONA 2OC1A 4CHAB 5HMAA 4I32A 4M7GA 1Y3WA 3I29A 4A1VA 1A0JA 3EGKH 1SGTA 1UMAH 3DSGA 4NIWA 2OP9A 2ZDNA 4FVBA 1GPZA 6CHAC 6ESTA 1FPCH 2XNDD 4SGAE 2KCAA 1C5RA 1V6DA 2FTMA 2P59A 1HJAB 2FZZA 3VEQB 4Y8ZA 1EPTB 1TQ0B 4HGCA 2QC2A 1NY22 5FAHA 3LH3A 2BLOA 4JYUH 5FPSA 1EUFA 3RC5A 2GV6A 4E05H 4ZHAA 2G52A 1OX1A 1HGTH 1QY6A 3AASA 2PWXA 2Z9GA 1LDTT 3Q3XA 1O2VA 1C1PA 1W2KH 1C5ZB 2J98A 1BTZA 1QJ7B 1IAUA 3GCTF 1TE0A 1KXBA 1SPJA 1GI4A 5DP3A 1VCPA 2ZDLA 3A7XA 1KLJH 1LVOA 2W26A 1FDPA 4BANB 4INKA 4JYTA 2F9BH 1EQ9A 2VWOA 4YT7H 2GCHG 1OP2A 4NG9H 1E37B 1WV7H 1FZZA 3C1KA 2FI4E 2YNBA 3PV5A 1GL1A 4F4OC 4CRDA 3ENSB 1H9LB 2VU8E 1DM4B 3GY2A 4CRCA 3ZYDA 5IK2D 3N7OA 2PGQB 4UFFH 1GHAF 1BQYA 2SGQE 3QZRA 4KGAA 2PV9B 1ZYOA 3ELAH 5DSFA 3ITIA 4WF8A 1Y5AT 2VBCA 5TJXA 2Q6DA 1LKAA 2SFAA 5DP5A 1T7CA 5K0HA 4J1YA 3GDSA 1ETSH 3ZVBA 3PWBA 2H5CA 3W1EA 3KF2A 4A7IB 1AVXA 2XC5A 3IITA 2ALVA 2PUXB 2OD3B 1PPEE 3SJKA 1YCPK 1PJPA 1ZSKA 3BTME 2R3YA 3SQEE 4CRFA 3BEUA 4DCDA 4FUBA 2OBOA 3BTDE 4K1TA 2UUJB 4F48B 5C20A 2OK5A 2GZ7A 3DUXH 4FXGH 2CMYA 1HPGA 1D9IA 1Y59T 3ZVGA 1C2MA 1CBWC 2ZGCA 3RMOH 4MPUA 2FOFA 3O8DA 1BMNH 4ISHH 1YCPH 2PKSB 7LPRA 2A7HA 1NRPH 4MNVA 3RXFA 1AI8H 4JYVH 1VCQA 5E0JA 2VH6A 3O8BA 2SGPE 5FHTA 4OS6A 4OS7A 1A0HB 1T8OA 1O3OA 1HAYB 1XVMA 1O3AA 5HGGA 1BTXA 4OS5A 2OUAA 4OM9A 1FY5A 2QY0B 2Y82A 1TNJA 1EASA 1V2KT 2H1UA 3N7EA 1C9PA 4BXWA 5FPTA 4B1TA 3VB3A 3PB1E 2FPZA 1CVWH 1SB1H 2JIZD 4AFZA 3D62A 1GMCG 1XUJA 3P17H 3V12A 1NRQH 1UVOA 4Q80A 2Z9LA 1XMNB 1V2PT 1E79D 3VXFH 4K8BA 4ZMAH 3M3SA 2FX6A 3RM0H 3MNBA 2BY6X 1W11U 4CHAC 4AGJA 1UJ1A 2D26C 3A87A 1K1JA 3NZIA 3OSYA 3RU4E 4AOQA 9ESTA 3STJA 3FZDA 2ZC9H 1P2NA 1OYQA 2GGVB 1V2LT 3W95A 1EJAA 1VITH 1GJ9B 4K69A 6GCHG 1GJBB 2P93A 1UCYH 1HJAC 2GDDA 2GZ9A 1C5LH 3U69H 2F9OA 1W10U 1TRNA 1RD3B 1Z8IB 1LPGB 1EPTC 1NFUA 5C1YA 4BAQB 1S0QA 1K0HA 2OLGA 1D3DB 1PPBH 1T8LA 1TIOA 1GVKB 2ZU4A 4D9RA 4J2YB 1V2QT 1XXDA 1O30A 2H9HA 1KDQB 3DSOA 1SQTA 3NWUA 1AB9B 1OP8A 1GBIA 2V3MA 1DLEA 3HKJB 4X2XA 1BRAA 4DW2U 1HNEE 1GBMA 2XOKD 4NIYA 1QRWA 5E2OA 2G4UA 2CF8H 5T6GA 3QGJA 4X1PU 3N7DA 1MAXA 4NA9H 2BHGA 1AO5A 3S7HB 2J94A 4SGBE 1ABIH 1GI8B 3OAAD 1F92A 4YT6H 5C2ZA 1CHGA 2ZFSA 2R3UA 1O3BA 4ABDA 2K0QA 1Q2WA 4ACAA 4WVPE 3PRBA 1V2TT 4Y0YE 3LT3A 1N8OB 1BZXE 1QRXA 4WY3A 1EXFA 1SLVB 1ZHMA 2NU2E 1HAZB 5A2MH 1CE5A 4AFUA 3KNXA 2R2WU 1GHYH 5EQSA 5FX5A 1K1OA 5JDUB 1WTHD 1LVBA 4FVDA 1FX0B 3PV4A 5EQRA 2IN2A 5C0TA 2ANMH 5LGOA 2EI6A 2KCPA 3RXDA 1FY4A 1HJ8A 2FOCA 1G3CA 2C90B 3IWMA 1W7GH 1GMDF 1P3CA 1TMTH 4MDSA 4U30A 2XYAA 3E1XB 2KM0A 1GJAB 2R0KA 1BT7A 2Z94A 2J9NA 1C9TA 5GCHF 1SOZA 2ZU2A 4B2BA 3DCLA 3MU8A 1JRTA 1IQJA 3TJUA 1V2ST 2PKSC 1IQKA 2BDCA 7GCHF 3SZNA 2ZDKA 3MH7A 1RGQA 2FYRA 5DKMA 3W94A 4FUHA 1ZPCA 3GY7A 1A7SA 4UE7H 5G4BA 1C2KA 2B0FA 3BF6H 4JZDH 1YP9A 3SU1A 3K65B 1GI2A 1V2VT 2ZDMA 2A45B 2CGAA 1OWJA 2P3UB 3M5OA 4R8TB 1EZXC 2LNCA 3HK6B 3UY9A 5JB8S 3FZZA 1SG8B 4NZLA 5HM2A 3SV2H 1V2UT 1QRZA 1IOEA 4AFSA 4XD7D 1C5XB 4FUFA 4YM9A 2IPHA 3GCTG 2ZU3A 2ZEBA 1JMOH 2ULLA 1TOMH 2R2MB 4Q7XA 1G3BA 1NU9A 3VGCB 2WV9A 1ANCA 2F9PA 1O3MA 3MNXA 2H9EH 3V13A 3A80A 5HIZA 4FU7A 3A88A 3M5NA 3PLKA 4RN6A 3TLOA 2OC0A 3PM3A 5AF9H 1CA0B 1BJVA 3F68H 3ZIAD 4A6LA 3DHKH 1GHAG 1HAPH 3RM2H 1DWDH 3CS0A 1OSSA 1EOLA 2QE7D 3SBKA 4AYVB 2J4IA 1AQ7A 1TX7A 1LKBA 1EFRD 3PO1B 5C17A 3UR9A 4NA7A 2VIWA 2WPHS 2TRMA 4B6FA 1AB9C 1KSNA 1HIAA 4NSYA 2B7DH 1ARBA 4UFEH 1IQMA 4ASHA 4Q2KA 1D4PB 1TAWA 3BTWE 3MH4A 1J8AA 4THNH 4K8YA 1PYTC 3FANA 4FUCA 3F9FA 2J97A 1DXPA 1MU6B 1QA0A 5A8ZA 2VH0A 2ANYA 1MU8B 3BV9B 4AN7A 3EA7A 2RA3A 1VJAU 1S82A 1GVZA 3T25A 4K2YA 1YCPM 3FP8E 3M7TA 4XBBA 4X2VA 1FAKH 4K1SA 2ZGXH 3C27B 1RIWB 4AG1A 2VB0A 5A0CA 1KLIH 1C2IA 5DJ7A 1N8OC 1ELAA 4D9QA 1BIOA 3GDVA 3MHWU 2FO9A 3RXOA 2ZFTA 2HVXA 3NPSA 3ATWA 5PTPA 3KN2A 3IG6B 4X8SH 1SMFE 4HTCH 4I8JA 5E0GA 1GBHA 1F0TA 2WPIS 1BBRE 1OWIA 3QZQA 1O2QA 1GI3A 5A8YA 3Q76A 3SOSA 2QV1A 1PFXC 2WHXA 1INCA 1NBME 3MO3A 4GAWA 1DE7H 5DP6A 1THSH 1O2IA 2WV5A 2ZFRH 1VITF 2AEIH 3KQBA 2GTBA 2SGAA 3SV6A 1P2QA 1G37A 3A7WA 4AZ2B 2G5VA 3RXSA 1IQFA 3RXPA 3BSQA 4XSKU 2F3CE 4JK6A 4WXIA 1NESE 2UWOA 1NROH 3U1JB 3PTBA 5FPYA 5EJ1A 3GY5A 3TGJE 1KTSB 3T29A 1GHZA 1JBUH 3E6PH 3K6ZA 4FUJA 3RXUA 4GHQA 3SJIA 4BXSA 2PKAB 4ASUD 2J38A 2WUCA 1AFQB 2Y7ZA 3SNAA 1D3QB 1D3PB 3RXAA 1GMCF 1UTNA 4BAMB 2QCYA 2GVFA 2W7SA 1SC8U 1ETRH 1K9OE 3VGCC 4CRGA 2OC7A 1GBDA 1HV7A 3RMNH 3P8GA 1DXWA 2Q6GA 1DX5M 3ZVAA 4ISOA 1ORFA 1LQDB 1OWDA 2QXHA 3BN9A 4XDEA 3H09A 2GZ8A 1MZDA 1ANBA 4FUEA 1GVLA 1AFEH 1CA0C 1LQEA 4DT7B 5L30H 2W6JD 1SL3A 1EJMA 5E8EH 1A2CH 3TNSA 1DWEH 1E35B 5EW1H 1GL0E 2GMTB 2Y5FA 4ZKSU 1AHTH 1TALA 2A2QH 1XKBC 1Y3VA 5EIYA 1DSTA 3FP7E 3MFJA 3CENA 2QA9E 2O8UA 3PO1C 1YLDA 2AMDA 4Y0ZE 3A83A 2AYWA 1YPMH 3UNQA 1UVSH 4RKOB 3T62A 1D3TB 1PPZA 3F2GA 1T31A 4Z0KA 1TGSZ 2D1JA 2VVCA 3TPIZ 4BTIB 5BPEA 4BOHA 4XFQA 2ZU5A 1UTKA 1UVTH 1YKTA 1UK2A 1QCPA 1GMDG 4YLUA 1CGHA 5HYOA 2GJGA 4MNXA 3A89A 5GCHG 2QF0A 2J98B 3RXGA 3MU5A 1MKWK 1TNLA 2LPRA 7GCHG 2WPKS 2PKAA 3U8OH 3EAJA 1L2EA 3UIRA 3ODDA 5DP8A 1RIWC 4NA8A 2BD3A 1RTLA 1O2KA 4IGDA 1C1VH 1XUKA 4XRNA 2ALPA 2FEQH 1E36B 3SU4A 1GJ4H 2XC4A 3BEFB 1Q31A 2QF4A 2V6NA 1ELBA 3VG8A 1MKWH 2PTCE 1C1UH 3KL6A 1CT4E 1H4WA 4DG4A 3TK6A 1D6WA 4B73A 2D8WA 3TH3H 2HNTC 1HXEH 2RDEA 1AGJA 4TWWA 1P2IA 2D2DA 5JYIA 2AHME 1ZOMA 1O2NA 1ZR0A 1UTQA 3Q3YA 1SQOA 3NRLA 5LH8A 2DE9A 1V2RT 3P92A 2H6MA 1TGNA 3F2FA 2PLXA 1GHVH 4OGYA 4HG6A 1IQEA 6LPRA 2CK3D 2BY9X 1TNIA 1BB0B 3LGYA 1YPEH 1K22H 4NGAH 1SLWB 1P09A 1A3EH 3LONA 4H6SB 3GCHB 5A09A 1ELTA 1B0FA 3RDZA 2GD4B 1F0UA 2TGPZ 5EXNA 2SNWA 1Z1IA 1TX8A 2C4FH 5F8ZA 2FMJA 8ESTE 1LPZB 1O2UA 1SGFG 1HAGE 1O3JA 3M35A 1ID5H 4X8UH 2FI3E 1BRBE 3SJOA 1C4U2 1GCTB 1F0SA 3S69A 2V3HH 1AFQC 1BMAA 2ASUB 2XRCA 4MQAA 2FODA 1BMFD 2ZP0H 3SU0A 1O2WA 1TA6A 3MQKC 5FXLA 3FAOA 4CR5A 2I6QA 2QYIA 3VPKA 1UTMA 4OGXA 2FOBA 1LMWB 3Q3KA 4E06H 2I6SA 4IW4E 1NFYA 2G51A 1T32A 2Y81A 3QLPH 1O2GH 5JBAS 2QIQA 3BIUH 1O2YA 1HYLA 1MKXK 1TABE 1P04A 3N99A 1QJ6B 4IBLH 5T6FA 4AYYB 3ATIA 3OTPA 4FUDA 2ZNKH 3T27A 3FP6E 2ANKH 3LGTA 4KTSA 2H9TH 1A5IA 1V2OT 3SUDA 1PQAA 2YOLA 3QUMP 3RXHA 3RXBA 4A5TS 2GMTC 1BA8B 1YBWA 3MI4A 1TBZH 1C5TA 2W6ID 3EDXB 3LPRA 2P8OB 3A86A 5FL7D 3KIDU 4ACBA 5AFYH 2WINI 1Z6JH 2J95A 3BEIB 3V3MA 1MKXH 4LZ1H 3BTFE 1AZZA 3SGBE 4B76A 1O3FA 2JDID 5HKKD 1DLKB 2QAAA 1JWTA 2ZHEH 1Z8JB 5C3NA 4GCHF 3VFEA 3LU9B 4TY7A 2XBWA 3UB0A 1P9SA 1HCGA 5EXMA 2ZHFH 2XCFA 3ZZ3A 2RA0A 1O5BB 1ELEE 2YMSB 2XNIA 2K7XA 4Y79A 1YPLH 4B74A 1GBTA 1ESTA 3FN8A 1VITG 5E2PA 4I7YH 2Z7FE 5F6MA 3SV9A 3BTQE 5JB9S 2TBSA 2AERH 2BD7A 2ZQ2A 3OFND 4DJZB 2BY5X 1V3XA 3G01A 3F0OA 1NU7B 1SR5C 3MU0A 4BAKB 2RFKC 2B8OH 4FUGA 1PPCE 1GJ8B 1LHEH 1O34A 1ZSJA 3GY3A 4B75A 2ZG0H 3T5FH 1E38B 5C5NA 1UTJA 3EQ0H 3GISB 4TPIZ 1C1WH 1P2MA 2EY4C 1TFXA 1DFPA 2LELA 5CMXH 4Z1MD 3OTJE 1P2OA 1S85A 1GHXH 4I8LA 4JZ1A 1ANDA 4LK4A 2BX4A 2V3OH 2ZIQH 3LC5A 4Z6AH 1GCDA 1VZQH 3PV2A 1Q3XA 1YGCH 2BDAA 2R0LA 1EX3A 1HAOH 7ESTE 1LVMA 1TNHA 3A7TA 1QQ4A 4ABGA 2J2UA 3LIWA 3RXLA 1P02A 1BCUH 2EI7A 3RXKA 1PQ8A 1BUIA 2W7UA 1C5NH 2F9UA 3GICB 1GBEA 2PHBA 1LHDH 5DG6A 4KP0A 2BM2A 3GCHC 1L4DA 1ELVA 3QX5H 1NFWA 2WPLS 3M7UA 1O3GA 3TH4H 1AWHB 3M37A 1C5OH 1SGYE 2FM2A 1GJ5H 1AMHA 1HRTH 1TBRH 3PMJA 4RKJB 1KXDA 5I46H 2FOHA 1GMHG 4D7GA 1LHGH 1EJNA 1GDQA 1GCTC 1H8ED 2PR3A 4LZ4B 1O2LA 1TGTA 2PP6A 1SHYA 3L33A 2FESH 5E0HA 1P01A 2XWBI 4CBOA 2SGFE 1OWEA 4MG3A 4Y6DA 1C5SA 3UTUH 4A92A 5C1UA 2G00A 1W13U 1EOJA 1F7ZA 3MTYA 1AY6H 2HGTH 4F49A 5LPFA 2ZGBH 1YM0A 1NBMD 1ZMNA 1N6YA 1W3CA 2A4RA 1MCVA 1O2SA 1OWHA 8KME2 1C1RA 1KMHB 1A3BH 4X8TH 3PTNA 1T8MA 2WPJS 1DUAA 3K6YA 4ZHLU 1ZZZA 1P2KA 1W12U 2SGEE 1SKYE 1FXYA 1WU1A 2KCYA 4P00A 2AIQA 3ZYEA 1UCYE 1UW7A 3AAUA 4GHTA 1O38A 1YF4A 1BRUP 1WTGH 2EA3A 4ZAEA 4DIHH 1EAWA 2P8OC 1AE8H 1O5DH 2BYAX 5GIBA 3ZZ6A 4WXVA 4MNYA 2O8WA 3VXEH 2FIRH 4HI3A 4BAHB 2TGTA 3PYHA 1D6RA 4XE4A 4B2CA 4YOIA 4ZKNU 1L1JA 1O5CB 1JIRA 1HAVA 4NFFA 1C4Y2 1QBVH 2GDEH 2G55A 2FI5E 4IN1A 1GG6B 2ZF0H 1FV9A 2IJD1 2VIQA 2C93B 3RC4A 1E1QD 4ZROA 1NT1A 2FLRH 2HALA 2AMPA 2FYQA 1KIGH 5CE1A 2YMSC 1ZJKA 4JZFH 4R0IA 4ABJA 4D8NA 1ZGIA 2J5UA 2L6OA 1GDUA 2JETB 1HIAB 1OHHD 1AVGH 1O5GH 4OS2A 2AS9A 4H4FA 1S6HA 1FN8A 3HGPA 5B6LA 5EG4A 1DSUA 3TJOA 2F9NA 2VJ1A 1JOUB 1ZMJA 2GT8A 1O2PA 1DOJA 1C5WB 1FIWA 1H1BA 2KAIB 1SGNE 1S6FA 5EJLA 2ZPSA 2BDIA 4I8GA 2VVVA 1C5MD 4I8HA 2HNTE 5L2YH 2IOTA 4GVUA 2QF3A 2ZPQA 3U8RH 3GCOA 3ZZ8A 2PW8H 1COWD 3SGAE 1F2SE 5FBIA 1HDTH 4CH2B 2CF9H 4D7FA 3K9XB 4DY7B 2DE8A 2HWLB 2J34A 3MWIU 1EP6A 1JIMA 4AGKA 2A7CA 2TIOA 3P8OA 1ZTJA 4NFEA 2ODQA 5GPIB 1GGDB 2Y6TA 1A46H 3B8JA 4OS1A 2C8YB 4DT4A 3OEHD 3D23A 1O2JA 1C2JA 1ZJDA 4FETA 1ANEA 1PQ7A 3WW7A 1BOQA 4O9VA 1J9CH 2Y5GA 3MU4A 1NZQH 2Y5HA 1NFXA 3ZZ5A 2JH6D 4GSOA 1BTWA 4AORA 1CO7E 4MVNA 1G9IE 1C4V2 2BLQA 1O3EA 2WPDD 2BD8A 3TK9A 3VB5A 2OC8A 5ABWA 5KGOA 1O3LA 3M5LA 4IC5A 5BRRE 2ZHWH 1TPOA 4GCHG 4UEHH 3V0XA 1MQ5A 3L3TA 1BBRK 5T1VA 1F5LA 1T4VH 3BTKE 1VGCB 1HLTH 2HRVA 4LOYH 2ZCHP 1O33A 1DT2A 1ZRKA 4MTBA 1TNKA 2CJIA 2O8MA 2VVUA 5HXFA 1VKYA 3M5MA 2BY7X 2ZTYA 1B0EA 1RTFB 4KTUA 2KAIA 4Y71A 4I8KA 1UO6A 2GP9B 3UWIA 3MU1A 1OP0A 5DGJA 3SNBA 3F0PA 1P3EA 1BBRH 1P05A 1ZMLA 1G30B 1B5GH 3GY6A 4B6EA 4UONA 1BRCE 3SORA 1W14U 3KGPA 3VB7A 1FY3A 1GJ7B 1GHWH 3KCGH 4PROA 2BOHB 1TX6A 1QR3E 3P8FA 1XUFA 1WQVH 2B5TB 1H8HD 1HXFH 4XBCA 1C2GA 1UHBA 3LOXA 5GDSH 3GOVB 3BG4B 3ZVDA 4WMDA 3WWFA 3TU7H 3U8TH 1O2ZA 1K1NA 1GG6C 5H4IB 1O0DH 2R9PA 1GJ6A 1SGQE 2A2XH 3L6PA 5GNDA 1GWAA 3SHCH 1UVPA 2VIDA 1TB6H 2IPQX 2LP6A 5JPMH 2XCNA 4INLA 1YPHC 2JETC 2ZFQH 2FX4A 3SNCA 1YPJH 2ODYB 1O2OA 4X6PA 1C1QA 1CQQA 2ZGJA 1TMUH 1OPHB 1SI5H 1K1LA 2AGIX 1XUIA 1DITH 3H7TA 5A0BA 5C1XA 1MTNB 1QBNA 2B9LA 4TSFD 1O3DA 1TMBH 2VWNA 1IHTH 1MMJN 2IJOB 1AZ8A 2TPIZ 1IQIA 4CRBA 1WBGB 3KEEA 3VB4A 1KTTB 3TJVA 2AFQB 1PYTD 2YNAA 3NCLA 5SGAE 3WY8A 1K1IA 5FX6A 1O2RA 1TGCA 1S6LA 4X2YA 2P16A 1HAIH 1TWXB 3LJJA 3RXIA 3OE7D 2ZA5A 1TPAE 3SI4H 1EB1H 3S9CA 3A7VA 1FI8A 1K1MA 2BDHA 4ZXXH 1QNJA 2ZTZA 4ABEA 2RDLA 1GGDC 3FKSD 1HBTH 1O3PB 2XBXA 1GJCB 2PFEA 1ZTKA 2C8WB 2ZFFH 1YPGH 1VJ9U 1A5HA 1NM6A 2BXTH 2KFWA 2C8ZB 4CRAA 3DD2H 2UUYA 2XC0A 2AIPA 3E3TA 2GT7A 3TVJB 1OYTH 4Y8YA 1DY8A 1GI6A 2BVRH 3LKWA 1P57B 1GMHF 2WV4A 2ZU1A 3SUGA 5EW2H 4AB9A 1RXPA 3NKKA 5CHAB 3U9AH 3DA9B 3AAVA 5GXPA 2BY8X 3HPTB 3HK3B 2VNTA 1WSSH 1O2TA 2HOBA 1Y3XA 2ZTXA 1MTSA 3MO9A 1VGCC 3R0FA 4Q63A 4MNWA 3SUFA 1P2JA 5AFZH 1H8IH 1NRNH 1W0JD 2V0BA 1GHBF 3RXJA 2ZHQH 2W3IA 1ESAA 4U01A 2BXUH 3CS7A 3QO6A 4AX9H 1BHXB 4YO9A 2Y80A 2XXLA 4X6NA 2J92A 1WOFA 2K1QA 3RXTA 3UUZA 1A4WH 3A8AA 4YOGA 2QGRA 3U98H 3RXEA 1AE5A 2HPPH 1HUTH 2FTLE 1ZRBA 2BQ7B 5EQQA 1EAUA 1S84A 4O3TA 2XBYA 1F5KU 1GI1A 3F1SB 4RSPA 3E0NB 1U6QA 2JH0D 2BD9A 3OEED 2P94A 4YZUA 1KXEA 1C2FA 1HB0B 1LHFH 4ISIH 1KXFA 3PRDA 5EJZA 4A1XA 1SGRE 1GBBA 3QTOH 1BTHH 3EE7A 3BG4C 4YLQH 1NS3A 1PQ5A 1TGBA 4CBNA 3SU2A 2F43B 1ZHPA 3BTTE 3P6ZB 1QIXB 2OQ5A 1MTWA 1P0SH 2WZQA 3GYMA 3MO6A 2EI8A 1UTPA 1BTPA 1K1PA 2BQ6B 3A81A 1Z7KA 3ZZ9A 3FO8D 3RXCA 3RXVA 1SSXA 4OS4A 3K2UA 1NN6A 1ZPZA 3I78A 1O5AB 2XWAA 3FVFB 2NU4E 1RRKA 2WSSD 3A7YA 5AVDA 1J14A 4K60A 4RT1A 3H5CB 1MTNC 1S83A 1ZPBA 3A8DA 1LCYA 2PTNA 3TH2H 1BITA 3F2HA 2BZAA 3ESTA 1J17T 3BG8A 5C94A 3A8CA 2BX3A 4NWLA 5EXLA 2GKVE 1AKSB 2VIOA 4WJG2 1BHXF 2QXIA 2WYGA 2BB4A 3SN8A 3HATH 2BD4A 3E16B 1AUJA 2HLCA 1KY9A 1TA2A 4WMFA 1GBLA 1ZTLA 5DP9A 2Z9IA 3MMGA 2P3TB 3RXQA 1X7AC 1Y5UT 1WYKA 4WH8A 5DP4A 4DGJA 1AU8A 1MABB 2ZI2H 3KQ5A 4K3JA 8GCHG 2VGCB 3M3TA 1XVOA 3UNRA 3DSPA 3O8CA 1TYNA 1UTLM 5L6NH 3ZVCA 4ZH8A 4JZIA 4U2WA 4O97A 1LO6A 1GI5A 2AGGX 5C67A 2GV7A 4TPYA 1ETTH 1V2JT 1IQLA 2BTCE 3SI3H 3RLYH 1KLTA 1O37A 5F8XA 1NTPA 1UK3A 1Z8RA 2A4OA 4O3UA 1TQ7B 1EATA 3PMAB 1NC6A 1L0ZA 1C2LA 2M5TA 2F9VA 2WYJA 1C5YB 1G3DA 1Z71A 5A0AE 3U1IB 4TT3D 2STAE 1QHRB 5CHAC 4AC9A 1WUNH 5F03A 4Y8XA 3RXRA 3BTGE 1SQRA 4BAOB 5JBTA 2UUKB 2KZ4A 2EEKA 1DWCH 5J4QA 1K28D 4Q7ZA 3QK1A 1Z1JA 5KEDA 1UTOA 1O3KA 1P12E 1IQNA 1C2DA 5JBBS 3SJ8A 1QTFA 1GBKA 1RTKA 2LIZA 2UUFB 2C8XB 1NRRH 3T26A 1KXCA 4TWYA 1BDAA 1UVUH 4YTAA 1SOTA 1EAXA 4E7RG 4FU8A 4X1SU 3KQCA 1CHOF 4UDWH 4ZKOU 3F6UH 5EU8A 3LGUA 3GY4A 4TY6A 5F53A 2TGDA 1P8VC 3QWCH 1W8BH 2NU0E 1C1MA 1YY3A 4XOJA 3U28C 1IQGA 1AKSA 3AW0A 4Y76A 5HIYA 1O32A 1EP5A 2NU1E 1L1GA 3A82A 1AIXH 3KYGA 2G4TA 2UWLA 1O2MA 4XBDA 1MH0A 1UK4A 4BTTB 1EPTA 1TRMA 1MAYA 3F9HA 3DFJA 3D49H 2FOAA 2A5AA 1E34B 2A31A 4FOUC 3EBNA 2ZGHA 5CHBA 2JH5D 2G5NA 1FONA 4VGCB 2VWMA 1LVYA 3MH6A 4DVAU 1XXFA 1EZUC 4JMYA 4Y11E 1DS2E 1O5EH 1IQHA 1H9IE 4X2WA 1YPHE 4B2AA 4JK5A 2CN0H 1QB6A 1IHSH 3A84A 3LH1A 5GJ4B 2A5KA 3I77A 1YPKH 1C5UA 2GCTB 1HAVB 1MTVA 3P95A 3ATMA 1GBCA 1NPMA 2ZKSA 5L2ZH 3RC6A 5EPYA 1GBJA 3BTHE 1GJDB 1C5VA 4KKDA 3SQHE 1EB2A 2XW9A 2KR7A 4AG2A 3URDA 2ILNA 2C3SA 3PLBA 3ZZDA 4MPXA 5DPAA 1BTUA 5EOKA 1UCYK 1SFQB 4QT8C 9LPRA 1O39A 1GDNA 1TPSA 4GPGA 1Y3YA 2BDGA 1FN6A 3UQOA 1FY1A 1GBFA 3MNCA 4UD9H 1FY8E 3ZVFA 1O3NA 2VWLA 1H8DH 1AUTC 2BQWB 5T6DA 3A85A 1MQ6A 4MPWA 2FS9A 1ELDE 2A0QB 3SGQE 1O35A 5FCRA 2K8IA 1VCWA 1M9UA 1PPGE 2Q1JA 1HAXB 1PPFE 3F9EA 2OINA 1ZLRA 1C2EA 5EODA 3SU5A 2JJ1D 2O9QA 2STBE 5JBCS 2CHAB 5EGMA 1GHBG 3OY6U 5LPRA 3SW2B 2OQUA 2VGCC 2ZPRA 3URCA 1S5SA 4Y7BA 2A1DB 2RCEA 2Q6FA 3F3BA 5A8XA 1V2MT 1CSOE 1LTOA 3M3VA 3LDXH 1G32B 2FOEA 1T4UH 1ZHRA 1DDJA 3JZ1B 3A8BA 1CT0E 4Y10E 1YWUA 2RG3A 3WWBA 1QURH 3SU6A 5LPEA 3GYLB 3PMBB 4ESTE 3M61U 2HVYB 4AFQA 4X8VH 4TYDA 3SNDA
chains in the Genus database with same CATH topology
3GDUA 4JCNA 3MOCA 3SV7A 4ABHA 3ZZ4A 2BD5A 1DPOA 5ETXA 1F0RA 1ZGVA 1L4ZA 3OU0A 1YC0A 3LGIA 1P06A 4FU9A 3ZZBA 1G3EA 1ZSLA 3AW1A 3KQEA 2BVSH 3RMLH 4A1TA 3NK8A 2QN5T 4ZXYH 1THPB 1GI0A 2OBQA 3S0NA 1S0RA 1FJSA 2CV3A 1BTYA 2BDYA 3LJOA 2GX4A 4YOJA 4KELA 4BTUB 1FPHH 1QQUA 3M7QA 3R3GB 1Y3UA 3HGNA 4DOQA 2WPMS 2ZO3H 4X0WU 2UWPA 1WAYB 3RUOA 5J4SA 3B23B 4WWYA 3OX7U 5C5OA 1O31A 3TNTA 1SGDE 3FFGA 1YLCA 3QN7A 1N1LA 1SGEE 1KYNA 3Q00A 1QL9A 1HAHH 1SGIB 3PMHB 3UR6A 1MD8A 4VGCC 2BDBA 1KDQA 2WUBA 3LGVA 2FOGA 4HFPB 3JZ2B 1EKBB 3E0PB 1GBAA 1W0ZU 1FUJA 5TCCA 1O3HA 3SU3A 4IN2A 4X1QU 5IDKA 2QXGA 2VIPA 3TJNA 1MBMA 1A0LA 1HJ9A 3H7OA 1QJ1B 2AH4X 1UHBB 2GCTC 2Z9KA 1AWFH 3OYPA 1K2I1 2TGAA 3P70B 5F8TA 3E91A 4Y7AA 3CP7A 2ZHDA 2OXSA 1SLUB 3LGWA 2ZECA 1NRSH 3EYDA 3ZV8A 3RMMH 1XUGA 5FCKA 3M36A 1WQSA 1C2HA 3BTEE 4CH8B 1W7XH 4NCYA 2FLBH 1ABJH 2P3FH 2ZQ1A 2DUCA 4DURA 4X6OA 1LPKB 3S7KB 2BMGB 3E8LA 2AMQA 4LXBH 3TGIE 1DANH 2ZDAH 4ZHMU 2JKHA 1P11E 1AN1E 1FMGA 4D76A 1K21H 1F5RA 1JXPA 2FOMB 3UWJH 3MNSA 3UREA 4AB8A 3KQDA 3UQVA 4ABBA 4MPVA 1ARCA 3P8NA 4GLYA 4X1NU 1TRYA 1DVAH 1SGFA 1QL8A 2PGBB 1G2LA 2PSXA 8LPRA 1QBOA 1RJXB 1A1RA 2CHAC 2CXVA 8GCHF 3SUEA 2SGDE 3ZV9A 4ABAA 4X6MA 5FBEA 1CHOG 3RXMA 2VINA 1MBQA 1SHHB 3O8RA 1J16A 3EE0B 1BMMH 2P95A 1FQ3A 3ATLA 1JRSA 3BIVH 1TBQH 1P03A 3QDZB 4INHA 7KMEH 4K5ZA 1O3CA 1FIZA 1TNGA 2A32A 4ABFA 2SNVA 3MYWA 1WCZA 1BMLA 1MCTA 3PWCA 2O8LA 2GCHF 4NSVA 2ZFPH 4YESB 1L1NA 3ZZAA 1SGCA 3Q77A 2OCVB 3T2NA 1Y5BT 1DUEA 1N6XA 1T8NA 2PSYA 2Z6BD 3PROA 1C1SA 1C1OA 1C1NA 2ZCKP 2A4GA 1KXAA 1W0YH 3RU4T 2XTTB 3NUMA 1O5FH 1V2WT 3E90B 2ZCLP 1QGFA 1NO9H 1QL7A 2THFB 4GUXA 4I33A 4BNRA 1G36A 2ZWLH 2O8TA 4CREA 1TOCB 2BLVA 4IC6A 1MTUA 2W5EA 1ELGA 2Y7XA 3UFAA 1OWKA 1SBWA 1H9HE 1XKAC 2HPQH 1MUEB 4B71A 4X1RU 1VR1H 4NIXA 2Z3CA 1RFNA 1O36A 2ODPA 2Z9JA 1EZSC 3UOUA 1MD7A 4Q7YA 6CHAB 4JZEH 1BJUA 1Z8GA 2QXJA 3SHAH 1OKXA 3OY5U 4IS5A 3ZZCA 1OOKB 3RLWH 4ZUHA 2BZ6H 2Z3EA 1O2XA 4IMQA 5DO4H 5K7RA 1OS8A 5B6OA 4U32A 4NZQA 2BVXH 1SQAA 1YYY1 1B7XB 1TPPA 2ZDVH 4WMEA 3ZVEA 2FWWA 1XM1A 1QA7A 1ACBE 3PLPA 4NIVA 1AD8H 4I31A 1CGIE 1CA8B 1GI9B 1MZAA 1QB1A 2ESTE 2NU3E 2A4QA 4NWKA 1DICA 1PPHE 2FDAA 3STIA 4E7NA 5ESTE 3S9AA 5I25A 1DWBH 1SVPA 1OXGA 1EAIA 1G2MA 3ATKA 4ZKRU 5T3HA 4FUIA 2FXRA 1ELCA 1XUHA 1DY9A 6GCHF 3T28A 2BOKA 1SLXB 1FAXA 3QTVH 5DK1A 1CGJE 4ISNA 1ESBA 1S81A 3NXPA 4H42U 1J15A 1LHCH 4WH6A 3VB6A 3SO3A 3UPEA 2HNTF 2BLWA 2FS8A 1V2NT 2H5DA 2F83A 3S9BA 4ABIA 4CR9A 5GWZA 1CU1A 1GI7B 4H6TA 2EC9H 2PUQH 2G8TA 1C5QA 4ISLA 1TLDA 3GCNA 1E0FD 3TIUA 2NWNA 3DFLA 5EPNA 4IMZA 2F91A 2ANWA 3SV8A 4UFGH 3TK5A 2G81E 3EA8A 3KHVA 3D65E 3TITA 1C5PA 1RS0A 2W3KA 3UOPA 3EA9A 3F9GA 3QGNB 5DP7A 1THRH 3UNSA 3RU4D 1EZQA 3DT0H 1CT2E 2Z3DA 3LC3A 1P10A 2V35A 1FLEE 3A7ZA 1CBWB 3RP2A 1A5GH 2AGEX 1SFIA 1O2HA 3V7TA 5AHGH 3TGKE 5HM9A 1QB9A 1P9UA 2VIVA 5IYTA 1ELFA 1QFKH 2BD2A 3GY8A 5ESBA 3SNEA 2FP7B 4UFDH 4MLFB 2A7JA 2OTVA 1HFDA 4O03A 3ZZ7A 4KTCA 2H2ZA 2A5IA 1A61H 5TCAA 2XBVA 1FNIA 1Z6EA 3SJ9A 1XX9A 3ODFA 3B9FH 1AVWA 4K1EA 1C1TA 3MH5A 1Y8TA 4DIIH 4HZHA 1SGPE 2ZZUH 1O3IA 3HKIB 3AVZA 1TONA 2OC1A 4CHAB 5HMAA 4I32A 4M7GA 1Y3WA 3I29A 4A1VA 1A0JA 3EGKH 1SGTA 1UMAH 4NIWA 2OP9A 2ZDNA 4FVBA 1GPZA 6CHAC 6ESTA 1FPCH 4SGAE 1C5RA 1V6DA 2FTMA 2P59A 1HJAB 2FZZA 3VEQB 4Y8ZA 1EPTB 1TQ0B 4HGCA 2QC2A 1NY22 5FAHA 3LH3A 2BLOA 4JYUH 5FPSA 1EUFA 3RC5A 2GV6A 4E05H 4ZHAA 2G52A 1OX1A 1HGTH 1QY6A 3AASA 2PWXA 2Z9GA 1LDTT 3Q3XA 1O2VA 1C1PA 1W2KH 1C5ZB 1BTZA 1QJ7B 1IAUA 3GCTF 1TE0A 1KXBA 1SPJA 1GI4A 5DP3A 1VCPA 2ZDLA 3A7XA 1KLJH 1LVOA 2W26A 1FDPA 4BANB 4INKA 4JYTA 2F9BH 1EQ9A 2VWOA 4YT7H 2GCHG 1OP2A 4NG9H 1E37B 1WV7H 1FZZA 3C1KA 2FI4E 2YNBA 1GL1A 4F4OC 4CRDA 3ENSB 1H9LB 2VU8E 1DM4B 3GY2A 4CRCA 3ZYDA 3N7OA 2PGQB 4UFFH 1GHAF 1BQYA 2SGQE 3QZRA 4KGAA 2PV9B 1ZYOA 3ELAH 3ITIA 4WF8A 1Y5AT 5TJXA 2Q6DA 1LKAA 2SFAA 5DP5A 1T7CA 5K0HA 4J1YA 3GDSA 1ETSH 3ZVBA 3PWBA 2H5CA 3KF2A 4A7IB 1AVXA 2XC5A 3IITA 2ALVA 2PUXB 2OD3B 1PPEE 3SJKA 1YCPK 1PJPA 1ZSKA 3BTME 2R3YA 3SQEE 4CRFA 3BEUA 4DCDA 4FUBA 2OBOA 3BTDE 4K1TA 2UUJB 5C20A 2GZ7A 3DUXH 4FXGH 2CMYA 1HPGA 1D9IA 1Y59T 3ZVGA 1C2MA 1CBWC 2ZGCA 3RMOH 4MPUA 2FOFA 3O8DA 1BMNH 4ISHH 1YCPH 2PKSB 7LPRA 2A7HA 1NRPH 4MNVA 3RXFA 1AI8H 4JYVH 1VCQA 5E0JA 2VH6A 3O8BA 2SGPE 5FHTA 4OS6A 4OS7A 1A0HB 1T8OA 1O3OA 1HAYB 1XVMA 1O3AA 5HGGA 1BTXA 4OS5A 2OUAA 1FY5A 2QY0B 2Y82A 1TNJA 1EASA 1V2KT 2H1UA 1C9PA 4BXWA 5FPTA 4B1TA 3VB3A 3PB1E 2FPZA 1CVWH 1SB1H 4AFZA 3D62A 1GMCG 1XUJA 3P17H 3V12A 1NRQH 1UVOA 4Q80A 2Z9LA 1XMNB 1V2PT 3VXFH 4K8BA 4ZMAH 3M3SA 2FX6A 3RM0H 3MNBA 2BY6X 1W11U 4CHAC 4AGJA 1UJ1A 2D26C 3A87A 1K1JA 3NZIA 3OSYA 3RU4E 4AOQA 9ESTA 3STJA 3FZDA 2ZC9H 1P2NA 1OYQA 2GGVB 1V2LT 3W95A 1EJAA 1VITH 1GJ9B 4K69A 6GCHG 1GJBB 2P93A 1UCYH 1HJAC 2GDDA 2GZ9A 1C5LH 3U69H 2F9OA 1W10U 1TRNA 1RD3B 1Z8IB 1LPGB 1EPTC 1NFUA 5C1YA 4BAQB 1S0QA 2OLGA 1D3DB 1PPBH 1T8LA 1TIOA 1GVKB 2ZU4A 4D9RA 4J2YB 1V2QT 1XXDA 1O30A 2H9HA 1KDQB 1SQTA 3NWUA 1AB9B 1OP8A 1GBIA 1DLEA 3HKJB 4X2XA 1BRAA 4DW2U 1HNEE 1GBMA 4NIYA 1QRWA 5E2OA 2G4UA 2CF8H 5T6GA 3QGJA 4X1PU 1MAXA 4NA9H 2BHGA 1AO5A 3S7HB 2J94A 4SGBE 1ABIH 1GI8B 4YT6H 1F92A 5C2ZA 1CHGA 2ZFSA 2R3UA 1O3BA 4ABDA 1Q2WA 4WVPE 1V2TT 4Y0YE 3LT3A 1N8OB 1BZXE 1QRXA 4WY3A 1EXFA 1SLVB 1ZHMA 2NU2E 1HAZB 5A2MH 1CE5A 4AFUA 3KNXA 2R2WU 1GHYH 5EQSA 5FX5A 1K1OA 5JDUB 1WTHD 1LVBA 4FVDA 3PV4A 5EQRA 2IN2A 2ANMH 5LGOA 2EI6A 3RXDA 1FY4A 1HJ8A 2FOCA 1G3CA 2C90B 3IWMA 1W7GH 1GMDF 1P3CA 1TMTH 4MDSA 4U30A 2XYAA 3E1XB 1GJAB 2R0KA 1BT7A 2Z94A 2J9NA 1C9TA 5GCHF 1SOZA 2ZU2A 4B2BA 3MU8A 1JRTA 1IQJA 3TJUA 1V2ST 2PKSC 1IQKA 2BDCA 7GCHF 3SZNA 2ZDKA 3MH7A 1RGQA 2FYRA 5DKMA 3W94A 4FUHA 1ZPCA 3GY7A 1A7SA 4UE7H 5G4BA 1C2KA 2B0FA 3BF6H 4JZDH 1YP9A 3SU1A 3K65B 1GI2A 1V2VT 2ZDMA 2A45B 2CGAA 1OWJA 2P3UB 3M5OA 4R8TB 1EZXC 2LNCA 3HK6B 3UY9A 5JB8S 3FZZA 1SG8B 4NZLA 5HM2A 3SV2H 1V2UT 1QRZA 1IOEA 4AFSA 1C5XB 4FUFA 4YM9A 2IPHA 3GCTG 2ZU3A 2ZEBA 1JMOH 2ULLA 1TOMH 2R2MB 4Q7XA 1G3BA 1NU9A 3VGCB 1ANCA 2F9PA 1O3MA 3MNXA 2H9EH 3V13A 3A80A 4FU7A 3A88A 3M5NA 3PLKA 4RN6A 3TLOA 2OC0A 3PM3A 5AF9H 1CA0B 1BJVA 3F68H 4A6LA 3DHKH 1GHAG 1HAPH 3RM2H 1DWDH 3CS0A 1OSSA 1EOLA 3SBKA 4AYVB 2J4IA 1AQ7A 1TX7A 1LKBA 3PO1B 3UR9A 4NA7A 2VIWA 2WPHS 2TRMA 1AB9C 1KSNA 1HIAA 4NSYA 2B7DH 1ARBA 4UFEH 1IQMA 4ASHA 4Q2KA 1D4PB 1TAWA 3BTWE 3MH4A 1J8AA 4THNH 4K8YA 1PYTC 3FANA 4FUCA 3F9FA 1DXPA 1MU6B 1QA0A 5A8ZA 2VH0A 2ANYA 1MU8B 3BV9B 4AN7A 3EA7A 2RA3A 1VJAU 1S82A 1GVZA 3T25A 4K2YA 1YCPM 3FP8E 3M7TA 4XBBA 4X2VA 1FAKH 4K1SA 2ZGXH 3C27B 1RIWB 4AG1A 2VB0A 5A0CA 1KLIH 1C2IA 5DJ7A 1N8OC 1ELAA 4D9QA 1BIOA 3GDVA 3MHWU 2FO9A 3RXOA 2ZFTA 2HVXA 3NPSA 3ATWA 5PTPA 3KN2A 3IG6B 4X8SH 1SMFE 4HTCH 4I8JA 5E0GA 1GBHA 1F0TA 2WPIS 1BBRE 1OWIA 3QZQA 1O2QA 1GI3A 5A8YA 3Q76A 3SOSA 2QV1A 1PFXC 1INCA 4GAWA 3MO3A 1DE7H 5DP6A 1THSH 1O2IA 2WV5A 2ZFRH 1VITF 2AEIH 3KQBA 2GTBA 2SGAA 3SV6A 1P2QA 1G37A 3A7WA 4AZ2B 2G5VA 3RXSA 1IQFA 3RXPA 3BSQA 4XSKU 2F3CE 4JK6A 4WXIA 1NESE 2UWOA 1NROH 3U1JB 3PTBA 5FPYA 3GY5A 3TGJE 1KTSB 3T29A 1GHZA 1JBUH 3E6PH 3K6ZA 4FUJA 3RXUA 4GHQA 3SJIA 4BXSA 2PKAB 2J38A 2WUCA 1AFQB 2Y7ZA 3SNAA 1D3QB 1D3PB 3RXAA 1GMCF 1UTNA 4BAMB 2QCYA 2GVFA 2W7SA 1SC8U 1ETRH 1K9OE 3VGCC 4CRGA 2OC7A 1GBDA 1HV7A 3RMNH 3P8GA 1DXWA 2Q6GA 1DX5M 3ZVAA 4ISOA 1ORFA 1LQDB 1OWDA 2QXHA 3BN9A 4XDEA 2GZ8A 1MZDA 1ANBA 4FUEA 1GVLA 1AFEH 1CA0C 1LQEA 4DT7B 5L30H 1SL3A 1EJMA 5E8EH 1A2CH 3TNSA 1DWEH 1E35B 5EW1H 1GL0E 2GMTB 2Y5FA 4ZKSU 1AHTH 1TALA 2A2QH 1XKBC 1Y3VA 1DSTA 3FP7E 3MFJA 3CENA 2QA9E 2O8UA 3PO1C 1YLDA 2AMDA 4Y0ZE 3A83A 2AYWA 1YPMH 3UNQA 1UVSH 4RKOB 3T62A 1D3TB 1PPZA 1T31A 4Z0KA 1TGSZ 2D1JA 2VVCA 3TPIZ 4BTIB 5BPEA 4BOHA 4XFQA 2ZU5A 1UTKA 1UVTH 1YKTA 1UK2A 1QCPA 1GMDG 4YLUA 1CGHA 5HYOA 4MNXA 3A89A 5GCHG 2QF0A 3RXGA 3MU5A 1MKWK 1TNLA 2LPRA 7GCHG 2WPKS 2PKAA 3U8OH 3EAJA 1L2EA 3UIRA 3ODDA 5DP8A 1RIWC 4NA8A 2BD3A 1RTLA 1O2KA 4IGDA 1C1VH 1XUKA 2ALPA