3EA7A

Crystal structure of sars-cov main protease triple mutant sti/a in space group p21
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Crystal structure of SARS-CoV Mpro mutant
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 80
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ea7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea7A02
1WTGH 2TGAA 1IQIA 5CHAB 1GBLA 4INLA 1ARCA 2XW9A 1UK3A 5DO4H 2VJ1A 1NO9H 2C8YB 3A86A 3PTNA 1E0FD 1FAKH 1OWDA 2LPRA 3SHAH 1CE5A 1TALA 4NSVA 4X2WA 1HAZB 1BRUP 4ABGA 1O35A 1DUAA 1MAXA 1W14U 1EASA 1C5MD 1C2IA 4FU9A 3TH2H 3UWJH 5E0GA 4BAHB 2CF8H 2ODPA 2G81E 3QO6A 1CGHA 1C4U2 2WYGA 1H8IH 1YPHE 2ZTZA 5EQRA 3ATIA 1FY4A 4O3TA 1ELCA 2CGAA 2RCEA 1TWXB 4O97A 3LIWA 1P2OA 1NROH 1S5SA 1ABJH 1C5LH 2AFQB 3DT0H 4IMQA 1NFYA 3SNEA 4B74A 1BBRE 1MD7A 2PKAB 3P17H 1CHOF 1QQUA 1Z8GA 5ETXA 2GCTC 2Z9KA 4MPWA 5E2PA 2PKSB 1TBRH 4AFQA 4WH8A 1Q2WA 2FODA 1SQOA 1AD8H 2CF9H 1TPAE 1NRNH 4KTSA 2V3OH 3M37A 1KDQB 1O2IA 1EJAA 1MD8A 4ISIH 1GBBA 2BD2A 2A5KA 3RC6A 1CBWB 2ZU1A 4ABJA 3RXQA 1O2KA 4K1EA 2YNAA 3UPEA 3BEIB 3PLKA 3Q76A 1OWIA 2SGDE 3LDXH 3QGNB 1AE5A 2Z3CA 3K2UA 1HV7A 2FO9A 2BDIA 2F3CE 3QDZB 2BY5X 1EX3A 1Z8JB 1ZHPA 2XNIA 1V2WT 3VB5A 1D6RA 1THPB 3PO1B 1QCPA 1Y5AT 1NESE 3VGCC 1T31A 3KHVA 1VITH 5E2OA 3SW2B 1AVGH 1ZYOA 2AMDA 4QT8C 1SFIA 2Y82A 3FFGA 4FVDA 2FEQH 4WJG2 2Z3EA 1SGNE 1P03A 2ZG0H 4CHAB 6LPRA 1C1SA 3U98H 1GBTA 2ZDKA 1O2TA 3TLOA 2VIDA 4ABIA 1J15A 1HAPH 4Y7AA 5JBCS 3GCHC 1BTXA 2FWWA 1TNHA 4CRFA 4I8LA 3PWCA 1CA8B 1E34B 4E05H 1MKWH 1GCTB 3T26A 1V2LT 3MU1A 4K3JA 3M5OA 3ZZCA 2ZFTA 1O32A 1S6HA 4Y79A 2R2MB 1PFXC 2H9TH 4AFUA 1AUTC 1BMAA 2BQ6B 1ZJDA 3AASA 1D9IA 3SN8A 1BOQA 3TJUA 1QBNA 1GJDB 3LONA 5H4IB 2BOHB 6GCHG 3URCA 4H42U 1QRWA 2H5DA 4WMFA 2FOHA 2GT7A 4IC6A 1VITF 3TK9A 1C2GA 1H4WA 4UDWH 1AQ7A 4FUHA 4KTUA 1GBAA 4GHTA 1EZSC 3DA9B 1D6WA 1UTMA 4ISHH 4J1YA 3P95A 2CMYA 3HK6B 3B23B 1MKXH 5C5NA 1DVAH 1FY5A 1Y3XA 4TY6A 1EKBB 1NRSH 1NRQH 2SGEE 1ETRH 2BD8A 1AVXA 2PV9B 1HAIH 2FYRA 1HFDA 3H7TA 1V2MT 3LJJA 3R0FA 1UTPA 2A1DB 1EP5A 2WPLS 1UTLM 4Y7BA 2P16A 1DITH 1O3NA 4RN6A 3M7UA 1DPOA 3SV8A 1IQHA 4WMDA 4ABEA 1BJVA 1BRAA 2QAAA 1M9UA 2ZCLP 1HXEH 2A0QB 2FESH 5EGMA 4YZUA 4JZ1A 2OUAA 3DD2H 4YT7H 1BZXE 2W7UA 5DGJA 1W13U 4NFFA 4VGCC 1L1NA 4AX9H 1C5ZB 1JIMA 1IOEA 5C20A 2BLQA 1V2PT 3FZZA 1SFQB 4D8NA 4A1VA 3M7QA 2Y7ZA 2HGTH 1MU8B 1MZAA 5L2ZH 1GJCB 2BQ7B 1MQ6A 4KGAA 1P04A 2ZU2A 1J14A 2ZIQH 4B71A 1C2JA 1IHTH 1HYLA 1OWJA 2GCHG 4GSOA 1GMDG 1LPKB 4K8BA 3MNCA 1AZZA 4K5ZA 1QA0A 3RXEA 4ZROA 4IW4E 2FXRA 3TU7H 2UUKB 1FV9A 4ZKOU 1CQQA 1O5EH 3E0NB 2BVSH 4YOGA 1C1OA 2CV3A 4B73A 1XKBC 1GI4A 3PROA 3QX5H 1AFEH 1KY9A 1GJ7B 3U1JB 3NKKA 4IBLH 1O2RA 2BVRH 1C1QA 1QTFA 5T6GA 1V3XA 5C3NA 1UHBA 2ZHEH 1GBJA 4X8SH 1QRZA 3MO3A 3GY4A 3VB7A 1EAXA 1QR3E 1CT4E 4DIIH 3QZQA 1BDAA 1C2LA 1N8OC 8LPRA 3SJIA 4X2YA 1HJ8A 1Q31A 3WY8A 3P6ZB 2Z9IA 1CO7E 2ZU3A 1HJAC 5EXMA 5ABWA 3MHWU 1UTNA 2AIQA 2WINI 4Y11E 2A45B 1K1IA 2FX6A 1N1LA 3E0PB 1FI8A 1A0JA 1EZUC 3LH3A 4HI3A 4YLQH 2Q1JA 2RDLA 1OX1A 3F9FA 1YP9A 1O5AB 2R2WU 1RIWB 3MH4A 1VGCC 2O8WA 2BY9X 4CRCA 1TE0A 1O3MA 2ZHWH 2F9UA 1NU9A 4BANB 4IC5A 1C1WH 2P8OC 3M3TA 4WVPE 4D7GA 1QB9A 2QXHA 1TYNA 2VGCB 3BG4B 4AFZA 3LPRA 1SB1H 2PHBA 3P92A 4X1SU 2AERH 1O2ZA 1YGCH 2A31A 3L6PA 1GJ4H 5LPEA 1RS0A 2QC2A 2FYQA 2ZGCA 5JBTA 3MU4A 1TQ0B 3ZYEA 1O38A 4WH6A 5TCCA 2TIOA 4HZHA 5EODA 2H1UA 3EA8A 4R8TB 5JYIA 3PMHB 8GCHG 3ZZ9A 3L33A 2VIQA 3GY6A 1RTFB 1PYTD 5T6FA 3V13A 3DFLA 3KF2A 1GG6B 1VITG 1Q3XA 1GVLA 5FX6A 4BNRA 1PPGE 4SGBE 1C2HA 3HATH 3M3SA 3QWCH 1QFKH 1AZ8A 4AORA 3MMGA 2ZO3H 1K21H 1IQKA 1SOTA 1T8OA 3QZRA 3W95A 1UO6A 2ZPRA 4WXIA 4XBBA 1W7XH 1K1NA 1GI5A 1LTOA 4A1XA 4GCHF 3ZZ6A 1PQ7A 3ZZ7A 2ANMH 1F2SE 1NM6A 4BTTB 2B8OH 2PUQH 5FAHA 1GDNA 2P93A 4B2BA 4X8TH 1LQEA 3RXGA 2VIOA 1ZMNA 2OBOA 1MTUA 3UUZA 1N6XA 2ZFQH 1ZRKA 4F49A 3ATWA 2WPJS 1SQAA 1XUFA 1DDJA 2V35A 3BTGE 1UVSH 5JB8S 1F7ZA 2Z3DA 2BDGA 1EZQA 2GV7A 3SGAE 2VVVA 4FVBA 1MTNB 1C2KA 3SJ8A 3BTDE 2ZU4A 2PTCE 4LOYH 2FI3E 3ZZBA 2A4RA 1TQ7B 3H7OA 1K1JA 3VB6A 1T8MA 1HJ9A 1WTHD 1DANH 1P09A 1P3EA 4XFQA 4YOIA 3U9AH 1HBTH 1W0YH 2ODQA 2B7DH 1HIAA 1LHGH 1UTQA 3EA9A 4DG4A 2XC5A 5F03A 2ESTE 5T3HA 2NU4E 4JZEH 2GCTB 3B9FH 1A5IA 3E3TA 2SGAA 3V3MA 3SGBE 4UONA 1FAXA 1BHXF 1A4WH 3SNCA 1LDTT 4CR5A 1S85A 5FX5A 1CA0B 1F92A 5FCRA 1TMBH 2CXVA 3MH7A 1DWCH 4ISLA 1A5HA 1E35B 2KAIB 2R0KA 3NWUA 2BDBA 1BTUA 5TCAA 2GMTB 3RMNH 1F0SA 3RXLA 2WYJA 4O3UA 3A80A 1O5DH 2GD4B 2ZGXH 2OD3B 1K2I1 1JBUH 2A4OA 4ESTE 5AVDA 4MDSA 4K1SA 2UWPA 1PPCE 4GHQA 2J2UA 4OS6A 1UTOA 2BXUH 2PR3A 1GJ8B 5EQSA 1A0LA 1DSTA 2RG3A 3S7HB 1T7CA 2GTBA 1DY8A 1SGTA 1TPOA 5HMAA 2HNTC 2Z94A 4TY7A 1UVTH 3SUDA 1SGIB 1RRKA 3SUFA 3I77A 1UCYH 5GWZA 2WPMS 5DP3A 1Z71A 2R0LA 3P8OA 1Y5BT 1ETSH 3GCHB 1TNGA 1QJ7B 3M5MA 2G5VA 2GVFA 3VXEH 2EEKA 3LJOA 1S0RA 2OC0A 3M35A 3M36A 1GHVH 3UQOA 5EXNA 4I32A 2A7CA 1IHSH 1FONA 1J9CH 4DW2U 1HAGE 1TPSA 1SGEE 1XUHA 5FCKA 2BY8X 5DP6A 1EATA 4TWWA 3RM0H 1MQ5A 1EAUA 1LKAA 5SGAE 1DXWA 2EC9H 2UWOA 1EAIA 2O8TA 4K69A 1GBKA 3VXFH 3A83A 4JCNA 2GZ9A 2DE8A 1TIOA 1UTKA 1ZTJA 5A8XA 1C1MA 4Y10E 4YLUA 1QNJA 2R3YA 2ZPSA 3ESTA 3RM2H 3M7TA 3SU2A 4HFPB 3MI4A 1K9OE 1TGNA 5C5OA 2GV6A 4K1TA 3VPKA 1YPGH 2TGDA 2ZZUH 1IQGA 4XE4A 3TH4H 1IQNA 2AIPA 1O5GH 1ZMLA 2BDHA 2CN0H 1OYTH 4B1TA 3T27A 1HAVA 2VNTA 3F9HA 5EW1H 1YM0A 1NRPH 2PW8H 2D2DA 1ELEE 4MPUA 2XBYA 4KELA 1C5TA 2NU1E 4WWYA 5E0JA 2PFEA 4Y8XA 1TBQH 4BOHA 3VEQB 3ZVDA 1AWFH 1UJ1A 2VIVA 1QY6A 1ELDE 4JZIA 2F83A 7ESTE 2D1JA 3A7WA 2QXIA 2O8LA 2V3HH 5ESBA 5EXLA 4NA7A 1GJ9B 1XXDA 3MOCA 3MYWA 4VGCB 4ABHA 3HKIB 1O3DA 5BPEA 3LC3A 1PJPA 3T28A 3ZVFA 3SQEE 5C2ZA 5JBAS 5C1XA 2ZFRH 3GCOA 2W26A 1CT0E 1SVPA 2ZPQA 3GDSA 1DM4B 4ZKRU 3VB4A 2BY7X 5T6DA 3Q3KA 1O3BA 3RU4T 1L2EA 1WSSH 1C5SA 1EOLA 2XRCA 2ZCHP 3A81A 4AB9A 5K7RA 4Q2KA 3RXVA 1GL0E 1TABE 3FP6E 3SQHE 4UD9H 1YYY1 2G4TA 2BD5A 4UFFH 3T25A 2F9NA 1W7GH 1FY1A 1T32A 3NXPA 4IN1A 2ZDNA 2ZFPH 1YBWA 5GJ4B 3BTTE 3TITA 4AGJA 4BTIB 4RSPA 2ANKH 8ESTE 1V2TT 1EPTC 4X1NU 4U2WA 1TNJA 3RXBA 1TLDA 3KEEA 5EOKA 3TNTA 4BAOB 1C5RA 1A46H 2GCHF 1ELTA 2H9HA 2DE9A 1GMDF 3Q3YA 4X6NA 1BQYA 1J17T 2HPPH 3SU1A 7GCHG 1S83A 2J9NA 1N8OB 2NU2E 1ETTH 3SGQE 1ELAA 1GBHA 1KTSB 3SNBA 1HJAB 3MU5A 1OYQA 3L3TA 2GZ7A 5GCHG 3U69H 1ZHMA 2VWNA 4NWKA 3PTBA 2XBWA 3OSYA 1O2NA 3E8LA 1CGIE 2XBXA 2AH4X 1O33A 4INKA 1YPHC 1O3PB 1ZTKA 3OY5U 3TGJE 4TYDA 2BDAA 4FUIA 3SU4A 1O5BB 2ZDMA 1U6QA 1O5CB 2PLXA 1DXPA 3EQ0H 1MTVA 1ESAA 1QBVH 1AKSB 1ZPBA 3A7TA 3D23A 3ZV8A 3SV9A 3ZZAA 2P8OB 4INHA 4LZ4B 1Y59T 3U1IB 2QGRA 2GZ8A 1J8AA 2JH6D 4X1RU 4X8VH 1P05A 1RJXB 1SQTA 2HNTF 2HWLB 1C5YB 3MO6A 2TRMA 4AOQA 1SGPE 2QIQA 2Z6BD 1HAHH 2VVCA 4Y76A 3ZZ4A 1O36A 1O3KA 2ZNKH 1BTHH 1UVOA 2ZU5A 5A0CA 2FTMA 4E7RG 2OLGA 2RA0A 1W2KH 4IS5A 5C1YA 1NFXA 2AMPA 1VCPA 3LH1A 3M5NA 2G51A 3O8CA 2BZAA 1DLEA 2OQUA 2JKHA 1QA7A 3QK1A 4AYVB 2ZI2H 1HLTH 2OQ5A 2IN2A 2ANWA 4D9RA 3MH5A 1YF4A 2F9BH 4NZQA 1GMHG 1GL1A 4ABAA 3SU5A 4GVUA 4CRDA 3EE0B 4ZXXH 5CMXH 1Y5UT 1O39A 3RUOA 2BD9A 5GPIB 1PPEE 3E91A 5DP7A 1DT2A 3GDVA 1KIGH 3A82A 1GBIA 2XWAA 3BIUH 8GCHF 1K28D 4GAWA 2WPIS 4I8KA 4FUFA 1C2DA 1O2SA 2XC4A 4Q7ZA 1O5FH 1HAYB 4DOQA 1O3FA 4YESB 1A7SA 5GXPA 1PQAA 3SZNA 3RXRA 4ABFA 3RDZA 4J2YB 1V2OT 1ELVA 5HYOA 4JYUH 1P2JA 3SV2H 3V7TA 3F6UH 4BAKB 2FI5E 1EQ9A 3K9XB 1B0EA 4JK6A 2PGQB 1TGTA 2VH6A 3RP2A 5A2MH 3BTFE 3SI3H 1YPMH 1SPJA 3GY2A 5E0HA 2R3UA 4ZHMU 2Y80A 4X2XA 5FPSA 1L4DA 1XUJA 1DE7H 3OTJE 1GI8B 4XOJA 1MKWK 1X7AC 1FY3A 1BJUA 4OGXA 4ABDA 5EG4A 1TX6A 1UVPA 3GCNA 1GHBG 1SLWB 1A5GH 1EPTA 2Z9LA 4K2YA 3P70B 2UWLA 1E36B 5HXFA 1QJ6B 4PROA 1P8VC 1GI9B 4NG9H 4K8YA 2J92A 3RXPA 4E7NA 4AFSA 3G01A 3K6ZA 3KQEA 1O2PA 3MH6A 1BTWA 2JETC 4D9QA 2FOAA 2XBVA 1LHFH 4MG3A 1XKAC 2JETB 2TBSA 1KXDA 3NZIA 1W3CA 2ZDLA 4B2CA 3U8OH 4DGJA 1NS3A 1W10U 2ZTYA 9LPRA 4XSKU 5DP8A 2W3KA 1OP2A 5JBBS 5F6MA 3FZDA 5TJXA 1ORFA 4MNVA 3Q3XA 4JMYA 1FN6A 1ZZZA 3SI4H 5AF9H 1XXFA 3EYDA 1GHAG 1BBRH 2FM2A 3D49H 1BIOA 4YO9A 3HK3B 1WYKA 1EB1H 1SC8U 2SGQE 1TB6H 1KXFA 1DOJA 2G00A 4I7YH 1ZOMA 3F9GA 3BV9B 4DY7B 1VJAU 4X2VA 2ALPA 1DX5M 1V2KT 2ZP0H 2XXLA 4ZKSU 2P3FH 3PB1E 1TNLA 2BTCE 1P01A 1AB9B 4FUGA 1O3EA 4AN7A 1SR5C 2VIPA 2PKSC 2QF3A 4NWLA 1N6YA 1OWHA 1P3CA 1O34A 2P3UB 4ZH8A 2HALA 2SGFE 1K1PA 4NIXA 3LGVA 1WCZA 1ZPCA 3P8GA 1SLUB 3UNRA 4ZMAH 1O3JA 3HPTB 1LHCH 1JOUB 1NPMA 5DP5A 1TA2A 2SNWA 2FOMB 4CH2B 3RXUA 1A2CH 1INCA 4I8HA 4AZ2B 1C1PA 1CBWC 2ZC9H 1LMWB 2LIZA 4GUXA 2BZ6H 3MO9A 3QLPH 1QL9A 1CHGA 1CSOE 1W0ZU 1P11E 2OC8A 5LH8A 5IDKA 3W94A 1D3TB 2OXSA 5FPTA 3ELAH 1OP0A 2F9PA 3I29A 3S69A 3GYLB 1V2ST 2P95A 2J34A 5IYTA 3ENSB 1GWAA 1AWHB 3RC4A 2FS9A 1XUKA 1O2QA 3SU6A 4MNXA 1O37A 1YPEH 4HGCA 1K1OA 3A84A 1TX7A 1B5GH 1W8BH 2WUCA 1BT7A 2A2XH 2NU3E 5AFZH 3SJKA 4FXGH 1TX8A 4OS1A 1CGJE 2FPZA 3M3VA 3FP7E 1TRNA 1HGTH 1ZSLA 1KXBA 3EGKH 1ZMJA 3BSQA 4KTCA 1GCTC 4A92A 2VINA 3ZZ8A 1ABIH 4E06H 3EBNA 2NWNA 1C5XB 1FQ3A 2VWMA 3TK5A 3RXHA 5A0BA 4MNWA 4A6LA 2K1QA 1F5RA 2VIWA 3LKWA 1LVOA 4UEHH 1FIWA 3TGKE 3NK8A 3Q77A 2OINA 3A85A 1QB6A 2SNVA 1GHZA 1C5WB 2C4FH 4LZ1H 3PLBA 1O2LA 1YCPK 4Y71A 1L4ZA 1TGSZ 1ZSKA 1PYTC 3TJVA 4UFEH 5DP4A 5K0HA 1KSNA 1C4Y2 1OP8A 1HNEE 3ZVAA 2BDCA 1BUIA 1DSUA 3RXAA 3MFJA 1DWDH 1P2NA 1QQ4A 1OWEA 4Q7YA 1THRH 1HAOH 1BMNH 2W5EA 3TK6A 3ZZDA 2ALVA 2VVUA 3BTME 1OPHB 3SV6A 5F8XA 2ZGHA 1WU1A 3SU3A 1A1RA 3KIDU 4Y0YE 3PWBA 1KLJH 3D65E 2C8ZB 7KMEH 1NU7B 5LPRA 2GKVE 5DKMA 1EOJA 2AGEX 1H9HE 3KQBA 2BLVA 1C9PA 1BITA 1IQLA 4SGAE 1SLVB 3RXDA 1GHWH 2QXGA 3M5LA 1TPPA 4FU7A 1BTYA 1UK4A 1C1UH 1PPZA 2VU8E 3K6YA 1OXGA 1GBMA 1HUTH 1EP6A 2J95A 5JDUB 3PV4A 2PKAA 3BN9A 3RXOA 4CRBA 4NA9H 3MNSA 2VWOA 3DHKH 4ISNA 7GCHF 1DFPA 1QB1A 1VR1H 3FAOA 1A0HB 1SHYA 2ZHQH 3UQVA 1QBOA 2ZGJA 1KDQA 1IQJA 4Y0ZE 1UHBB 1AI8H 3P8NA 4ZXYH 1XM1A 1C2MA 1CVWH 1O2VA 5GCHF 3VGCB 4AGKA 1O3IA 3BEFB 2CHAC 1P2QA 4K60A 2M5TA 4FUDA 1ZR0A 1T4VH 1UTJA 2D8WA 3R3GB 1XUIA 2JH5D 4CRAA 2G52A 1VCQA 3OYPA 2ZF0H 1AIXH 4JZDH 1RXPA 1YPLH 3GY8A 1C1VH 4R0IA 1H1BA 1QIXB 3RXFA 3RMMH 1T8NA 1RTLA 1SOZA 3SJOA 3SOSA 2VWLA 1P2KA 2A2QH 3KCGH 1AGJA 3BIVH 3SO3A 2VB0A 5FBIA 3KN2A 3LGWA 3UTUH 3ZVCA 2H2ZA 1C5QA 2FOEA 3D62A 1FJSA 1VCWA 2QYIA 3RXSA 1C1NA 2XC0A 1JRSA 1ZSJA 5EPNA 1GDQA 2G55A 4FUEA 3PYHA 3KQCA 3A8AA 4NFEA 4WF8A 2A32A 2ZKSA 1AO5A 1FDPA 3DFJA 3TNSA 1THSH 1JMOH 4XBDA 2OTVA 1TFXA 4BXSA 2FOGA 1OWKA 3FP8E 2P94A 1GJ5H 4X6MA 2WPKS 2LNCA 1T4UH 1SI5H 2QA9E 1GBFA 4NIVA 1TRMA 1RIWC 2Q6FA 2ULLA 2XWBI 2UUJB 3UWIA 2QV1A 1EAWA 1NN6A 4U30A 3OY6U 1B0FA 3GY5A 1GMHF 3EAJA 1GHXH 1K22H 1QGFA 2B5TB 2Z9GA 4MTBA 1J16A 4MLFB 1F0TA 2VGCC 2H9EH 3B8JA 4BXWA 1WBGB 4B76A 1UCYK 1MAYA 3CS7A 3GISB 4UFDH 2WUBA 5A8ZA 1ZRBA 1G32B 1LQDB 3SNAA 3DUXH 1PPHE 3E16B 3ZV9A 1NC6A 4I31A 1WOFA 2THFB 2J38A 2QN5T 4OGYA 6CHAC 1O2OA 1JXPA 3TGIE 3UR9A 3GICB 1FY8E 1H9LB 1JIRA 2EI6A 2O9QA 2W7SA 3K65B 4Y8ZA 1BRCE 1ZTLA 1S6FA 3PLPA 3UY9A 1OS8A 1H9IE 1PQ8A 1C2FA 4NIWA 3VFEA 2Y5GA 4IGDA 1K1MA 1V2NT 1FIZA 3F68H 4CREA 1YLDA 3MWIU 1BRBE 3AW1A 3KNXA 4I8GA 1BHXB 2HLCA 2PUXB 3SBKA 2AYWA 4LXBH 1AU8A 2FZZA 1BTPA 1BMMH 4MVNA 1G36A 3S7KB 2RA3A 3EA7A 4AYYB 2PSXA 2FOBA 4H6SB 1KYNA 1GHBF 1HRTH 5B6OA 1LVYA 2DUCA 2J94A 2HOBA 4MQAA 2C3SA 1WV7H 1TNKA 4NSYA 5F8TA 7LPRA 2XCFA 1O2YA 3ATKA 1TMUH 4OS5A 1V2VT 1F5LA 4JYTA 2K7XA 1HIAB 4CH8B 2WV5A 1A3BH 1GI1A 2P59A 4IMZA 3OU0A 3QUMP 2FDAA 1GGDC 5DJ7A 1UK2A 1LPGB 1GI7B 2EI7A 1C9TA 3Q00A 1MTNC 3PM3A 2A7HA 4Y6DA 1MTWA 3HKJB 4TPYA 1GJAB 1GDUA 1CT2E 2G5NA 4D76A 2IPHA 4X1QU 2Z9JA 5JB9S 3GCTG 2WPHS 1GVZA 3EDXB 1G3CA 4X0WU 1FMGA 1YKTA 1GHAF 1S84A 1E37B 1ACBE 1QL8A 3F1SB 1DUEA 2Y81A 2PTNA 5GIBA 3SORA 3VB3A 3STJA 3A7VA 2CJIA 3MU0A 1VGCB 1CA0C 4BAMB 5DP9A 4AG1A 2BD4A 2GGVB 1OSSA 5HM9A 1TOMH 1F0UA 4FUBA 4D7FA 1HXFH 1XUGA 4YT6H 1AY6H 2GMTC 1NZQH 3RLYH 3ITIA 3IG6B 1GI2A 1BMLA 2ZHDA 1L0ZA 4O9VA 1UVUH 2A4GA 2Q6GA 1FPCH 3MU8A 1SL3A 3UNSA 2BQWB 3FVFB 1GCDA 5F8ZA 5LPFA 1AFQC 1YC0A 3UOUA 1G2LA 3S9BA 2YOLA 1NRRH 3O8BA 4H4FA 1QJ1B 4Q7XA 1Z6JH 5EQQA 3SJ9A 2FP7B 2ZFSA 1PPBH 4YOJA 2Q6DA 4YTAA 2AMQA 1A3EH 3BTKE 3UOPA 3KQDA 3RXKA 2GP9B 2ASUB 2VH0A 2O8MA 4KP0A 1VJ9U 3AW0A 1Z8IB 4ZAEA 1FUJA 1A61H 3MTYA 1C5PA 1QRXA 1V2JT 3RXTA 4NCYA 5HGGA 1Z1JA 1H8DH 2ILNA 4CR9A 3ZZ5A 3A89A 4UE7H 2V6NA 2F9VA 1IAUA 4ASHA 4B75A 5L6NH 3BF6H 1YPJH 1HB0B 2A5IA 1ZGVA 3LOXA 1TGBA 1HAVB 1ANDA 1SHHB 1OOKB 3T5FH 2GT8A 1GJ6A 3LGUA 6ESTA 1KTTB 2PGBB 1EUFA 1BTZA 3T62A 1AN1E 4ZKNU 1HAXB 3RU4E 3RU4D 1RTKA 1K1LA 4MPVA 3P8FA 4FUJA 1SBWA 4WXVA 1IQFA 3IWMA 1XMNB 1Z1IA 1P0SH 3BEUA 3LGTA 2BD7A 4O03A 5J4SA 1SGQE 1ZJKA 3BG8A 1ARBA 3JZ1B 1G3EA 4ISOA 1WQVH 3T29A 1EB2A 1OKXA 4ABBA 3ODDA 3CP7A 5DG6A 2EI8A 2YNBA 1G3DA 2AEIH 2HVXA 3QN7A 3O8DA 1MBQA 5CHAC 1F0RA 2FOFA 1IQMA 2OC7A 1NFUA 1C5NH 1AE8H 2W3IA 1ZLRA 1D3QB 1TRYA 1LVMA 1TONA 2C93B 5I25A 3RXMA 1ESTA 2G8TA 2FTLE 3UNQA 1EZXC 1HDTH 1MKXK 5E8EH 1Z8RA 1AVWA 1LCYA 4CBNA 2PWXA 1Z6EA 2QXJA 3QTVH 4LK4A 4B2AA 1EJMA 1WUNH 1CHOG 1PPFE 1YCPM 3A7ZA 1QURH 2KAIA 1AUJA 1DWEH 3A8BA 3SNDA 5HM2A 2CHAB 3MNXA 4XDEA 1QL7A 3ZVBA 1AHTH 1V2QT 2OBQA 1FLEE 2V0BA 1PQ5A 5AHGH 1P9UA 1G2MA 1KLTA 1O2MA 1CU1A 2FIRH 1S82A 1TA6A 2UUYA 2ZHFH 5LGOA 1FN8A 4JZFH 3UR6A 1O3OA 1Y3YA 2SFAA 3QGJA 2Z7FE 3BTWE 1BCUH 3V12A 1SGFA 2QF0A 3STIA 1TMTH 2XCNA 5EU8A 1LO6A 2FI4E 3A88A 1MUEB 4GLYA 2HRVA 5FXLA 2QY0B 1KXEA 1GI6A 1O3GA 1JWTA 1GMCF 2BVXH 1UCYE 3S0NA 4DJZB 1SLXB 4DURA 1SGCA 1HCGA 2ZCKP 3PMAB 1O2WA 3LC5A 2A4QA 2ZA5A 3UFAA 3C1KA 4Y8YA 2Y5FA 4RKJB 4GPGA 1TOCB 1GJBB 2P3TB 1G30B 1GBCA 2BB4A 3RXIA 2ANYA 3CENA 4Q80A 1BBRK 4NGAH 5A8YA 1TNIA 3E6PH 3HGPA 1MTSA 1Z7KA 3I78A 4Z0KA 1W12U 2I6QA 2FLRH 3OX7U 3U8RH 1XX9A 1O3CA 3LGYA 5A09A 3PO1C 1P02A 2BY6X 1GVKB 1GPZA 1S0QA 2C90B 3ODFA 1Y3WA 3SUGA 1JRTA 1RD3B 2A5AA 1MCTA 3H5CB 1YCPH 1ZHRA 3AAVA 2TGTA 1MH0A 2WV4A 3N7OA 4CHAC 1SGDE 2BM2A 1XVOA 2BOKA 2H6MA 6CHAB 1DICA 1DWBH 3SHCH 1ID5H 4X1PU 5PTPA 1WQSA 1G3BA 3KGPA 2ZEBA 4X6OA 5FBEA 4NIYA 3T2NA 1SSXA 2STBE 3RMLH 2R9PA 5JPMH 1XVMA 2XTTB 2A7JA 1KLIH 9ESTA 4U01A 1E38B 2XYAA 4AB8A 4I8JA 1KXCA 1P12E 3TIUA 2ZDVH 1G37A 3GOVB 1MBMA 1ZGIA 2O8UA 2BHGA 1LKBA 5L2YH 5I46H 3BTEE 3V0XA 1YLCA 4YM9A 2IJOB 4BTUB 1TBZH 4UFGH 3F9EA 1D3DB 1AMHA 4DIHH 1ESBA 5C67A 2BYAX 2Y6TA 1MMJN 1ZPZA 2ZGBH 1B7XB 3HGNA 3NCLA 2FMJA 2OP9A 2QCYA 1P10A 5C1UA 1NFWA 3GY3A 3SU0A 4WY3A 2F9OA 2AGGX 3MNBA 2STAE 1O3AA 1C5VA 1P2IA 2BLOA 1C1TA 1V6DA 2GDEH 3A7YA 1EPTB 1FZZA 1GGDB 2PSYA 2OCVB 2GX4A 3RMOH 1V2UT 1SMFE 1S81A 5FHTA 4M7GA 4Z6AH 4IN2A 2F91A 3TJOA 3E1XB 3LU9B 3SV7A 1SGYE 1FXYA 2AGIX 4KKDA 1C5OH 2HNTE 2J4IA 3C27B 2FS8A 3M61U 3PMJA 3GYMA 1FNIA 3AVZA 1O2UA 1C1RA 1ELGA 1O2JA 1O30A 1RFNA 1WAYB 2BMGB 4DCDA 2BX3A 1C4V2 3GDUA 3UIRA 4MNYA 1TAWA 1GI0A 2ODYB 2I6SA 3LGIA 2IOTA 3CS0A 4ZHLU 3ATMA 4OS7A 4X6PA 1Y3UA 5FPYA 5J4QA 5GDSH 3URDA 2FX4A 3NPSA 2EA3A 3A7XA 4U32A 1DY9A 1D3PB 4DVAU 3BTHE 4HTCH 3GCTF 1MCVA 2D26C 2BDYA 1NY22 5AFYH 3TJNA 3A87A 3S9CA 1O2GH 1ANCA 3SUEA 3NUMA 1ELBA 1Y8TA 4A7IB 1GMCG 5G4BA 3TPIZ 1BB0B 1DLKB 3KL6A 4OS2A 4I33A 2JH0D 2ZQ2A 1AFQB 1P06A 1AKSA 2ZECA 2AS9A 3LT3A 1IQEA 1SGRE 1W11U 5DPAA 3A8CA 4NZLA 2Y5HA 2BLWA 2BD3A 1DS2E 3RXJA 3ATLA 1V2RT 2BXTH 1G9IE 2SGPE 1ELFA 4DT7B 3QTOH 4F4OC 2C8WB 4NA8A 1YPKH 2H5CA 2ZDAH 3JZ2B 1O31A 3S9AA 2Y7XA 2ZWLH 4A5TS 3A8DA 4RKOB 4JYVH 1SGFG 3RXCA 1SG8B 3ZZ3A 1TGCA 1AB9C 3FANA 2ZQ1A 1QHRB 1ANBA 1BA8B 2G4UA 1HPGA 5ESTE 1LVBA 1EXFA 2B0FA 1Y3VA 1GI3A 4CRGA 2FLBH 1LHEH 4XBCA 3TVJB 4MPXA 1O3HA 2GDDA 3TH3H 1O2HA 1L1JA 2NU0E 4X8UH 4AG2A 3RC5A 1C2EA 1FPHH 2OC1A 4ZHAA 1O0DH 4FUCA 3BG4C 3AAUA 1LHDH 5BRRE 5CE1A 1GHYH 2ZFFH 4TWYA 3BTQE 2ZTXA 2FOCA 4ZUHA 1KXAA 1P9SA 1D4PB 3O8RA 2UUFB 3E90B 1C5UA 1NTPA 1EJNA 1O2XA 1GBDA 1UMAH 1MZDA 1L1GA 3ZVGA 3ZYDA 5EPYA 3GY7A 1F5KU 1O3LA 2B9LA 5L30H 2BX4A 3RLWH 4GCHG 4FU8A 1RGQA 1T8LA 4H6TA 3UREA 4A1TA 3PMBB 4JK5A 1P2MA 1VZQH 3U8TH 4CBOA 3ZVEA 1LPZB 1P57B 4OS4A 4TPIZ 5DK1A 4BAQB 1GG6C 2TPIZ 3IITA 6GCHF 1NT1A 8KME2 4WMEA 1GBEA 2HPQH 4THNH 1ANEA 2TGPZ 5EW2H 5A0AE 1MU6B 2C8XB
chains in the Genus database with same CATH superfamily
1WTGH 2TGAA 2JJ1D 1IQIA 1H8ED 5CHAB 1GBLA 4INLA 1ARCA 2XW9A 1UK3A 5DO4H 2VJ1A 1NO9H 2C8YB 3A86A 3PTNA 1E0FD 1FAKH 1OWDA 2LPRA 2YMSB 3SHAH 1CE5A 1TALA 4NSVA 4X2WA 1HAZB 1BRUP 4ABGA 1O35A 1DUAA 1MAXA 1W14U 1EASA 3ZIAD 1C5MD 1C2IA 4FU9A 3TH2H 3UWJH 5E0GA 4BAHB 2CF8H 2ODPA 2G81E 3QO6A 1CGHA 1C4U2 2WYGA 1H8IH 1YPHE 2ZTZA 5EQRA 3ATIA 1FY4A 4O3TA 1ELCA 2CGAA 2RCEA 1TWXB 4O97A 3LIWA 5HIYA 1P2OA 1NROH 1S5SA 1ABJH 4RT0A 1C5LH 2AFQB 3DT0H 4IMQA 2J97A 1NFYA 3SNEA 4B74A 1BBRE 1WXRA 1MD7A 2PKAB 3P17H 1CHOF 1QQUA 1Z8GA 5ETXA 3KQ5A 2GCTC 2Z9KA 4MPWA 5E2PA 2PKSB 1TBRH 4AFQA 4Z1MD 4WH8A 3U28C 1Q2WA 2FODA 1SQOA 1AD8H 2CF9H 1TPAE 1NRNH 4KTSA 2V3OH 3M37A 1KDQB 1O2IA 1EJAA 3NRLA 1MD8A 4ISIH 1GBBA 2BD2A 2A5KA 3RC6A 1CBWB 2ZU1A 4ABJA 3RXQA 1O2KA 4K1EA 2YNAA 3UPEA 3WWFA 3BEIB 2K0QA 3PLKA 3Q76A 1OWIA 2SGDE 3LDXH 3QGNB 1AE5A 2Z3CA 3K2UA 1HV7A 2FO9A 2BDIA 2K8IA 2F3CE 3QDZB 2BY5X 1EX3A 1Z8JB 1ZHPA 2XNIA 1V2WT 3VB5A 1D6RA 1THPB 2L74A 3PO1B 1QCPA 1Y5AT 1NESE 3VGCC 1T31A 3KHVA 1VITH 5E2OA 3SW2B 1AVGH 1ZYOA 2AMDA 4QT8C 1SFIA 2Y82A 3FFGA 4FVDA 2FEQH 4WJG2 2Z3EA 1SGNE 1P03A 2ZG0H 4CHAB 6LPRA 1C1SA 3U98H 1GBTA 2ZDKA 1O2TA 3TLOA 2VIDA 4ABIA 1J15A 1HAPH 4Y7AA 5JBCS 3GCHC 1BTXA 2FWWA 1TNHA 4CRFA 4I8LA 3PWCA 4HG6A 5C94A 1CA8B 1E34B 4E05H 1MKWH 1GCTB 3T26A 1V2LT 3MU1A 4K3JA 3M5OA 3ZZCA 2ZFTA 1O32A 1S6HA 4Y79A 2R2MB 1PFXC 2H9TH 4AFUA 1AUTC 4RT1A 1BMAA 2BQ6B 1ZJDA 3AASA 1D9IA 3SN8A 1BOQA 3TJUA 1QBNA 1GJDB 3F0OA 3LONA 5H4IB 2BOHB 6GCHG 3URCA 4H42U 1QRWA 2H5DA 4WMFA 2FOHA 5KGOA 2GT7A 4IC6A 1VITF 3TK9A 1C2GA 1H4WA 4UDWH 1AQ7A 4FUHA 4KTUA 1GBAA 4GHTA 1EZSC 3DA9B 4ASUD 1D6WA 1UTMA 4ISHH 4J1YA 3P95A 2CMYA 3HK6B 3B23B 5C0UA 1MKXH 5C5NA 1DVAH 1FY5A 1Y3XA 4TY6A 1EKBB 1NRSH 1NRQH 2SGEE 1ETRH 2BD8A 2YMSD 1AVXA 2PV9B 3EE7A 1HAIH 2FYRA 1HFDA 3H7TA 1V2MT 3LJJA 3R0FA 1UTPA 2A1DB 1EP5A 2WPLS 1UTLM 5IK2D 4Y7BA 2P16A 1DITH 1O3NA 4RN6A 3M7UA 1DPOA 3SV8A 1IQHA 2J5UA 4WMDA 4ABEA 1BJVA 1BRAA 2QAAA 1M9UA 2ZCLP 1HXEH 2A0QB 2FESH 1OHHD 1YY3A 5EGMA 4YZUA 4JZ1A 2OUAA 3DD2H 4YT7H 1BZXE 2W7UA 5DGJA 1W13U 4NFFA 4VGCC 1E1QD 1L1NA 1C5ZB 4AX9H 1JIMA 1IOEA 5C20A 2BLQA 1V2PT 3FZZA 1SFQB 4D8NA 4A1VA 3M7QA 3SYJA 2Y7ZA 2HGTH 1MU8B 1MZAA 5L2ZH 1GJCB 2BQ7B 1MQ6A 4KGAA 1P04A 2ZU2A 1J14A 2ZIQH 5F53A 1C2JA 1IHTH 1HYLA 1OWJA 4B71A 2GCHG 3W1EA 4GSOA 1GMDG 5DN6D 1LPKB 4K8BA 3MNCA 1AZZA 4K5ZA 1QA0A 3RXEA 4ZROA 4IW4E 2FXRA 3TU7H 2UUKB 1FV9A 4ZKOU 1CQQA 1O5EH 3E0NB 2BVSH 4YOGA 1W0JD 1C1OA 2CV3A 4B73A 1XKBC 1GI4A 3PROA 3QX5H 1AFEH 1KY9A 1GJ7B 3U1JB 3NKKA 4IBLH 1O2RA 2BVRH 1C1QA 1QTFA 5T6GA 1V3XA 5C3NA 1UHBA 2ZHEH 1GBJA 4X8SH 1QRZA 3MO3A 3GY4A 3VB7A 1EAXA 2IJD1 1QR3E 1CT4E 1SKYE 4DIIH 3QZQA 1BDAA 1C2LA 1N8OC 8LPRA 3OEED 3SJIA 4X2YA 1HJ8A 1Q31A 3WY8A 3P6ZB 2Z9IA 1CO7E 2ZU3A 1HJAC 5EXMA 5ABWA 3MHWU 1UTNA 2AIQA 2WINI 4Y11E 2A45B 1K1IA 2FX6A 1N1LA 3E0PB 1FI8A 1A0JA 1EZUC 3LH3A 4HI3A 4YLQH 2Q1JA 2RDLA 1OX1A 3F9FA 5GNDA 1YP9A 1O5AB 2R2WU 1RIWB 3MH4A 1VGCC 2O8WA 2BY9X 3N99A 4CRCA 1TE0A 1O3MA 2ZHWH 2F9UA 1NU9A 4BANB 4IC5A 1C1WH 2P8OC 3M3TA 2VBCA 4WVPE 4D7GA 1QB9A 2QXHA 1TYNA 2VGCB 3BG4B 4AFZA 3LPRA 1SB1H 2PHBA 3P92A 4X1SU 2AERH 1O2ZA 1YGCH 2A31A 3L6PA 1GJ4H 5LPEA 1RS0A 2QC2A 2FYQA 2ZGCA 5JBTA 3MU4A 1TQ0B 3ZYEA 1O38A 4WH6A 5TCCA 2TIOA 4HZHA 5EODA 2H1UA 3EA8A 4R8TB 5JYIA 3PMHB 8GCHG 3ZZ9A 3L33A 4YXWD 2VIQA 3GY6A 1RTFB 1PYTD 5T6FA 3V13A 3DFLA 3KF2A 1GG6B 2J98B 1VITG 3FO8D 1Q3XA 1GVLA 5FX6A 4BNRA 1PPGE 4SGBE 1C2HA 3HATH 3M3SA 3QWCH 1QFKH 2LELA 1AZ8A 4AORA 3MMGA 2ZO3H 1K21H 1IQKA 1SOTA 1T8OA 3QZRA 3W95A 1UO6A 2ZPRA 4WXIA 4XBBA 1W7XH 1K1NA 1GI5A 1LTOA 4A1XA 2JDID 4GCHF 3ZZ6A 1PQ7A 3ZZ7A 2ANMH 1F2SE 1NM6A 2WV9A 4BTTB 2B8OH 2PUQH 5FAHA 1GDNA 2P93A 4B2BA 4X8TH 1LQEA 3RXGA 2VIOA 1ZMNA 2OBOA 1MTUA 4RI0A 3UUZA 1N6XA 2ZFQH 1ZRKA 4F49A 3ATWA 2WPJS 1SQAA 1XUFA 1DDJA 2V35A 3BTGE 1UVSH 2M2AA 5JB8S 1F7ZA 2Z3DA 2BDGA 1EZQA 2GV7A 3SGAE 2VVVA 4FVBA 1MTNB 1C2KA 3SJ8A 3BTDE 2ZU4A 2PTCE 4LOYH 2FI3E 3ZZBA 2A4RA 1TQ7B 3H7OA 1K1JA 3VB6A 1T8MA 1HJ9A 1WTHD 1DANH 1P09A 1P3EA 4XFQA 4YOIA 3U9AH 1HBTH 1W0YH 2ODQA 2B7DH 1HIAA 1LHGH 1UTQA 3EA9A 5KEDA 4DG4A 2XC5A 5F03A 3AK5A 2ESTE 5T3HA 2NU4E 4JZEH 4OM9A 2GCTB 3B9FH 1A5IA 3E3TA 2SGAA 3V3MA 3SGBE 4UONA 1FAXA 1BHXF 1A4WH 3SNCA 1LDTT 4CR5A 1S85A 5FX5A 5B6LA 1CA0B 1F92A 5FCRA 1TMBH 2CXVA 3MH7A 1DWCH 4ISLA 1A5HA 1E35B 2KAIB 2R0KA 3NWUA 2BDBA 1BTUA 5TCAA 2GMTB 3RMNH 1F0SA 3RXLA 2WYJA 4O3UA 1NBMD 3A80A 4FETA 1O5DH 2GD4B 2QF5A 2ZGXH 2OD3B 1K2I1 1JBUH 2A4OA 4ESTE 5AVDA 4MDSA 4K1SA 2UWPA 2JJ2D 1PPCE 4GHQA 2J2UA 4OS6A 1UTOA 2BXUH 2PR3A 1GJ8B 5EQSA 1A0LA 1DSTA 2RG3A 3S7HB 1T7CA 2GTBA 1DY8A 1SGTA 1TPOA 3DSPA 5HMAA 2HNTC 2Z94A 4TY7A 1UVTH 3SUDA 5HKKD 1SGIB 1RRKA 3SUFA 3I77A 1UCYH 5GWZA 2WPMS 5DP3A 1Z71A 2R0LA 3P8OA 1Y5BT 1ETSH 3GCHB 1TNGA 1QJ7B 3M5MA 1YLNA 2G5VA 2GVFA 3VXEH 2QE7D 2EEKA 3LJOA 1S0RA 2OC0A 3M35A 3M36A 1GHVH 3UQOA 5EXNA 4I32A 2A7CA 1IHSH 1FONA 1J9CH 1VKYA 4DW2U 1HAGE 1TPSA 1SGEE 1XUHA 5FCKA 2BY8X 2KCYA 5DP6A 1EATA 4TWWA 3RM0H 1MQ5A 1EAUA 1LKAA 5SGAE 1DXWA 2EC9H 2UWOA 1EAIA 2O8TA 4K69A 1GBKA 3VXFH 3A83A 4JCNA 2GZ9A 2DE8A 2HLDD 1TIOA 1UTKA 1ZTJA 5A8XA 1C1MA 4Y10E 4YLUA 1QNJA 2R3YA 2ZPSA 3ESTA 3RM2H 3M7TA 3SU2A 4HFPB 3MI4A 1K9OE 1TGNA 5C5OA 2GV6A 4K1TA 3VPKA 2WPDD 1YPGH 2TGDA 2ZZUH 1IQGA 4XE4A 3TH4H 1IQNA 2AIPA 1O5GH 1ZMLA 2BDHA 2CN0H 1OYTH 4B1TA 3T27A 1HAVA 2VNTA 3F9HA 5EW1H 1YM0A 1NRPH 2PW8H 2D2DA 1ELEE 4MPUA 2XBYA 4KELA 1C5TA 2NU1E 4WWYA 5E0JA 2PFEA 4Y8XA 1TBQH 4BOHA 3VEQB 3ZVDA 1AWFH 1UJ1A 2VIVA 1QY6A 1ELDE 4JZIA 3DSGA 4I86A 2F83A 7ESTE 2D1JA 3A7WA 2QXIA 2O8LA 2V3HH 2OK5A 5ESBA 5EXLA 4NA7A 1GJ9B 1XXDA 3MOCA 3MYWA 4VGCB 4ABHA 3HKIB 1O3DA 5BPEA 3LC3A 1PJPA 3T28A 3ZVFA 3SQEE 5C2ZA 5JBAS 5C1XA 2ZFRH 3GCOA 2W26A 1CT0E 1SVPA 2ZPQA 3GDSA 1DM4B 4ZKRU 3VB4A 1E79D 2BY7X 5T6DA 3Q3KA 1O3BA 3RU4T 1L2EA 1WSSH 1C5SA 1EOLA 2XRCA 2ZCHP 3A81A 4AB9A 5K7RA 4Q2KA 3RXVA 1GL0E 1TABE 3FP6E 3SQHE 4UD9H 1YYY1 3WW7A 2G4TA 2BD5A 4UFFH 3T25A 2F9NA 2EQNA 1W7GH 1FY1A 1YWUA 1T32A 3NXPA 4IN1A 2ZDNA 2ZFPH 1YBWA 5GJ4B 3BTTE 3UB0A 3TITA 4AGJA 4BTIB 4RSPA 2ANKH 8ESTE 1V2TT 1EPTC 4X1NU 4U2WA 1TNJA 3RXBA 1TLDA 3KEEA 5EOKA 3TNTA 4BAOB 1C5RA 1A46H 2GCHF 1ELTA 2H9HA 1MABB 2DE9A 1GMDF 3Q3YA 4X6NA 1BQYA 1J17T 2HPPH 3SU1A 7GCHG 3N7EA 1S83A 2J9NA 1N8OB 2NU2E 5HIZA 1ETTH 3SGQE 1ELAA 1GBHA 1KTSB 3SNBA 1HJAB 3MU5A 1OYQA 3L3TA 2GZ7A 5GCHG 3U69H 1ZHMA 2VWNA 4NWKA 3PTBA 2XBWA 3OSYA 1O2NA 3E8LA 1CGIE 2XBXA 2AH4X 1O33A 4INKA 1YPHC 1O3PB 1ZTKA 3OY5U 3TGJE 4TYDA 2BDAA 4FUIA 3SU4A 1O5BB 2ZDMA 1U6QA 1O5CB 2PLXA 1DXPA 3EQ0H 1MTVA 1ESAA 1QBVH 1AKSB 1ZPBA 3A7TA 3D23A 3ZV8A 3KYGA 3SV9A 3ZZAA 2P8OB 4INHA 4LZ4B 1Y59T 3U1IB 2QGRA 2GZ8A 1J8AA 2JH6D 4X1RU 4X8VH 1P05A 1RJXB 1SQTA 2HNTF 2HWLB 1C5YB 3MO6A 2TRMA 4AOQA 1SGPE 2QIQA 2Z6BD 1HAHH 2VVCA 4Y76A 3ZZ4A 1O36A 1O3KA 2ZNKH 1BTHH 1UVOA 2ZU5A 5A0CA 2FTMA 1W0KD 4E7RG 2OLGA 2RA0A 1W2KH 4IS5A 5C1YA 1NFXA 2AMPA 1VCPA 3LH1A 3M5NA 2G51A 3O8CA 2BZAA 1DLEA 2OQUA 2JKHA 1QA7A 3QK1A 4AYVB 2ZI2H 1HLTH 2OQ5A 2IN2A 2ANWA 4D9RA 3MH5A 1YF4A 2F9BH 4NZQA 1GMHG 1GL1A 4ABAA 3SU5A 4GVUA 4CRDA 3EE0B 4ZXXH 5CMXH 1Y5UT 1O39A 2KCPA 2BD9A 4M9FA 3RUOA 5GPIB 1PPEE 3E91A 5DP7A 1DT2A 3GDVA 1KIGH 3A82A 1GBIA 2XWAA 3BIUH 8GCHF 1K28D 4GAWA 2WPIS 4I8KA 2WHXA 4FUFA 1C2DA 1O2SA 2XC4A 4Q7ZA 1O5FH 1HAYB 4DOQA 1O3FA 4YESB 1A7SA 3PV5A 5GXPA 1PQAA 3SZNA 3RXRA 4ABFA 3RDZA 4J2YB 1V2OT 1ELVA 5HYOA 4JYUH 1P2JA 3SV2H 1BMFD 3V7TA 3F6UH 4BAKB 2FI5E 1EQ9A 3K9XB 1B0EA 4JK6A 2PGQB 1TGTA 2VH6A 3RP2A 5A2MH 3BTFE 3SI3H 1YPMH 1SPJA 3GY2A 3PRDA 5E0HA 2R3UA 4ZHMU 2Y80A 4B6EA 4X2XA 5FPSA 1L4DA 1XUJA 3OEHD 1DE7H 3OTJE 1GI8B 4XOJA 1MKWK 1X7AC 4F48B 1FY3A 1BJUA 4OGXA 4ABDA 5EG4A 1TX6A 1UVPA 3GCNA 1GHBG 1SLWB 1A5GH 1EPTA 2Z9LA 4K2YA 3P70B 2UWLA 1E36B 5HXFA 1QJ6B 4PROA 1P8VC 1GI9B 1UW7A 4NG9H 4K8YA 2J92A 3RXPA 4E7NA 4AFSA 3G01A 3K6ZA 3KQEA 1O2PA 3MH6A 1BTWA 2JETC 4D9QA 2FOAA 2XBVA 1LHFH 4MG3A 1XKAC 2RDEA 2JETB 2TBSA 1KXDA 3NZIA 1W3CA 2ZDLA 4B2CA 3U8OH 4DGJA 2YMSC 1NS3A 1W10U 2ZTYA 9LPRA 4XSKU 5DP8A 2W3KA 1OP2A 5JBBS 5F6MA 3FZDA 5TJXA 1ORFA 4MNVA 3Q3XA 4JMYA 1FN6A 1ZZZA 3SI4H 5AF9H 1SQRA 1XXFA 3EYDA 1GHAG 1BBRH 2FM2A 3D49H 1BIOA 4YO9A 4FOUC 3HK3B 1WYKA 1EB1H 2L6OA 1SC8U 2SGQE 1TB6H 1KXFA 1DOJA 2G00A 4I7YH 1ZOMA 3F9GA 3BV9B 4DY7B 1VJAU 4X2VA 2ALPA 1DX5M 1V2KT 5CHBA 2ZP0H 2XXLA 4ZKSU 2P3FH 3PB1E 1TNLA 1COWD 2BTCE 1P01A 1AB9B 4FUGA 1O3EA 4AN7A 1SR5C 2VIPA 4Q4LA 2PKSC 2QF3A 4NWLA 1N6YA 1OWHA 1P3CA 1O34A 2P3UB 4ZH8A 2HALA 2SGFE 1K1PA 4NIXA 3LGVA 1WCZA 1ZPCA 3P8GA 1SLUB 3UNRA 4ZMAH 1O3JA 3HPTB 1LHCH 1JOUB 1NPMA 5DP5A 1TA2A 2SNWA 2FOMB 4CH2B 3RXUA 1A2CH 1INCA 4I8HA 4AZ2B 1C1PA 1CBWC 2ZC9H 1LMWB 2LIZA 4GUXA 2BZ6H 3MO9A 3QLPH 1QL9A 1CHGA 1CSOE 1W0ZU 1P11E 2OC8A 5EJZA 5LH8A 5IDKA 3W94A 1D3TB 2OXSA 5FPTA 3ELAH 1OP0A 2F9PA 3I29A 3MQKC 3S69A 3GYLB 1V2ST 2P95A 2J34A 3OFND 5IYTA 3ENSB 1GWAA 1AWHB 3F2HA 3RC4A 2FS9A 1XUKA 1O2QA 3SU6A 4MNXA 1O37A 1YPEH 4HGCA 1K1OA 3A84A 1TX7A 1B5GH 2LP6A 1W8BH 2WUCA 1BT7A 2A2XH 2NU3E 5AFZH 3SJKA 4FXGH 1TX8A 4OS1A 1CGJE 2FPZA 3M3VA 3GS9A 3FP7E 1TRNA 1HGTH 1ZSLA 4ZCNA 1KXBA 3EGKH 1ZMJA 3BSQA 1K0HA 4KTCA 1GCTC 4A92A 2VINA 3ZZ8A 1ABIH 4E06H 3EBNA 2NWNA 1C5XB 1FQ3A 2VWMA 3TK5A 3RXHA 5A0BA 4MNWA 4A6LA 2K1QA 1F5RA 2VIWA 3LKWA 1LVOA 4UEHH 1FIWA 3TGKE 3NK8A 3Q77A 2OINA 2WZQA 4DT4A 3A85A 1QB6A 2SNVA 1GHZA 1C5WB 2C4FH 4LZ1H 3PLBA 1O2LA 1YCPK 4Y71A 1L4ZA 1TGSZ 1ZSKA 1PYTC 3TJVA 4UFEH 5DP4A 5K0HA 1KSNA 1C4Y2 1OP8A 1HNEE 3ZVAA 2BDCA 1BUIA 1DSUA 3RXAA 3MFJA 1DWDH 1P2NA 1QQ4A 1OWEA 4Q7YA 5C17A 1THRH 1HAOH 1BMNH 2W5EA 3TK6A 3ZZDA 2ALVA 2VVUA 3BTME 1OPHB 3SV6A 5F8XA 2ZGHA 1WU1A 3SU3A 1A1RA 3KIDU 4Y0YE 3PWBA 1KLJH 3D65E 2C8ZB 7KMEH 1NU7B 5LPRA 2GKVE 5DKMA 1EOJA 2AGEX 1H9HE 3KQBA 2BLVA 1C9PA 2F4LA 1BITA 1IQLA 2AHME 4SGAE 1SLVB 3RXDA 1GHWH 2QXGA 1S6LA 3M5LA 1TPPA 4FU7A 1BTYA 1UK4A 1C1UH 1PPZA 2VU8E 3K6YA 1WDIA 1OXGA 1GBMA 1HUTH 1EP6A 2J95A 5JDUB 3PV4A 2PKAA 3BN9A 3RXOA 1NBME 4CRBA 4NA9H 3MNSA 2VWOA 3DHKH 4ISNA 7GCHF 1DFPA 1QB1A 1VR1H 3FAOA 1A0HB 1SHYA 2ZHQH 3UQVA 1QBOA 2ZGJA 1KDQA 1IQJA 4Y0ZE 1UHBB 1AI8H 2V3MA 3P8NA 4ZXYH 1XM1A 1C2MA 1CVWH 1O2VA 5GCHF 3VGCB 4AGKA 1O3IA 3BEFB 2CHAC 1P2QA 4K60A 2M5TA 4FUDA 1ZR0A 1T4VH 1UTJA 2D8WA 3R3GB 1XUIA 2JH5D 4CRAA 2G52A 2V7QD 1VCQA 3OYPA 2ZF0H 1AIXH 4JZDH 1RXPA 1YPLH 3GY8A 1C1VH 4R0IA 1H1BA 1QIXB 3RXFA 2JIZD 3RMMH 1T8NA 1RTLA 1SOZA 3SJOA 3SOSA 2VWLA 1P2KA 2A2QH 3KCGH 1AGJA 3BIVH 3SO3A 2VB0A 5FBIA 3KN2A 3LGWA 3UTUH 3ZVCA 2H2ZA 1C5QA 2FOEA 3D62A 1FJSA 1VCWA 2QYIA 3RXSA 1C1NA 2XC0A 1JRSA 1ZSJA 5EPNA 4P02A 1GDQA 2G55A 4FUEA 3PYHA 3KQCA 3A8AA 4NFEA 4WF8A 2A32A 2ZKSA 1AO5A 2KR7A 3KYFA 1FDPA 3DFJA 3TNSA 1THSH 1JMOH 4XBDA 2OTVA 1TFXA 4BXSA 2FOGA 1OWKA 3FP8E 2P94A 1GJ5H 4X6MA 2WPKS 2LNCA 1T4UH 1SI5H 2QA9E 1GBFA 4NIVA 1TRMA 1RIWC 2Q6FA 2ULLA 2XWBI 2UUJB 3UWIA 2QV1A 1E1RD 1EAWA 1NN6A 4AC9A 4U30A 3OY6U 1B0FA 3GY5A 1GMHF 3EAJA 1GHXH 1K22H 1QGFA 2B5TB 2Z9GA 2XOKD 4MTBA 1J16A 4MLFB 1F0TA 2VGCC 2H9EH 3B8JA 4BXWA 1WBGB 4B76A 1UCYK 1MAYA 3CS7A 3GISB 4UFDH 2WUBA 3UAIC 1ZRBA 1G32B 1LQDB 5A8ZA 3SNAA 3DUXH 1PPHE 3E16B 3ZV9A 1NC6A 4I31A 1WOFA 3DCLA 2THFB 2J38A 2QN5T 4OGYA 6CHAC 1O2OA 1JXPA 3TGIE 3UR9A 3GICB 1FY8E 1H9LB 1JIRA 2EI6A 2O9QA 2W7SA 3K65B 4Y8ZA 1BRCE 1ZTLA 1S6FA 3OAAD 3PLPA 3UY9A 1OS8A 1H9IE 2KZ4A 3DSOA 1PQ8A 1C2FA 4NIWA 3VFEA 2Y5GA 4IGDA 1K1MA 1V2NT 1FIZA 3F68H 4CREA 1YLDA 3MWIU 1BRBE 3AW1A 3KNXA 4I8GA 1BHXB 2HLCA 2PUXB 3SBKA 2AYWA 4LXBH 1AU8A 2FZZA 3H09A 1BTPA 4TSFD 1BMMH 4MVNA 1G36A 3S7KB 2RA3A 3EA7A 4AYYB 2PSXA 2FOBA 4H6SB 1KYNA 1GHBF 1HRTH 5B6OA 1LVYA 2KFWA 2DUCA 2J94A 2HOBA 4MQAA 2C3SA 1WV7H 1TNKA 4NSYA 5F8TA 7LPRA 2XCFA 1O2YA 3ATKA 1TMUH 4OS5A 1V2VT 1F5LA 4JYTA 2K7XA 3OE7D 1HIAB 4CH8B 2WV5A 1A3BH 1GI1A 2P59A 4IMZA 2KM0A 3OU0A 3QUMP 2FDAA 2W6ID 1GGDC 5DJ7A 1UK2A 1LPGB 1GI7B 2EI7A 1C9TA 3Q00A 1MTNC 3PM3A 2A7HA 4Y6DA 1MTWA 3HKJB 4TPYA 3CNRA 1GJAB 1GDUA 2W6JD 1CT2E 2G5NA 4D76A 5FL7D 2IPHA 4X1QU 4ACBA 2Z9JA 5JB9S 2XNDD 3GCTG 2WPHS 1GVZA 3EDXB 1G3CA 2KCAA 4X0WU 1FMGA 1YKTA 1GHAF 1S84A 1E37B 1ACBE 1QL8A 3F1SB 2IPQX 1DUEA 4B6FA 2Y81A 2PTNA 5GIBA 2RFKC 3SORA 3VB3A 3STJA 3A7VA 2CJIA 3MU0A 1VGCB 1CA0C 4BAMB 5DP9A 4AG1A 2BD4A 2GGVB 1OSSA 5HM9A 1TOMH 1F0UA 4FUBA 4ACAA 4D7FA 1HXFH 1XUGA 4YT6H 1AY6H 2WSSD 2GMTC 1NZQH 3RLYH 3ITIA 3IG6B 1GI2A 1BMLA 2ZHDA 1L0ZA 4O9VA 1UVUH 2A4GA 2Q6GA 1FPCH 3MU8A 1SL3A 3UNSA 2BQWB 3FVFB 1GCDA 5F8ZA 5LPFA 1AFQC 1YC0A 3UOUA 1G2LA 3S9BA 2YOLA 1NRRH 3O8BA 4H4FA 1QJ1B 4Q7XA 1Z6JH 5EQQA 3SJ9A 2FP7B 2ZFSA 1PPBH 4YOJA 2Q6DA 4YTAA 2AMQA 1A3EH 3BTKE 3UOPA 3KQDA 3RXKA 2GP9B 2ASUB 2VH0A 2O8MA 4KP0A 1VJ9U 3AW0A 1Z8IB 2EY4C 4ZAEA 1FUJA 1A61H 2QF4A 3MTYA 2J98A 1C5PA 1QRXA 1V2JT 3RXTA 4NCYA 5HGGA 1Z1JA 1H8DH 2ILNA 4CR9A 3VG8A 3ZZ5A 3A89A 4UE7H 2V6NA 2F9VA 1IAUA 4ASHA 4B75A 5L6NH 3BF6H 1YPJH 1HB0B 2A5IA 1ZGVA 3LOXA 1TGBA 1HAVB 1ANDA 1QZ8A 1SHHB 3FKSD 1OOKB 3T5FH 5T1VA 2GT8A 1GJ6A 3LGUA 3FN8A 6ESTA 1KTTB 2PGBB 1EUFA 1BTZA 3T62A 1AN1E 4ZKNU 1HAXB 3RU4E 3RU4D 1RTKA 1K1LA 4MPVA 3P8FA 4FUJA 5EJ1A 1SBWA 4WXVA 1IQFA 3IWMA 1XMNB 1Z1IA 1P0SH 3BEUA 3LGTA 2BD7A 4O03A 5J4SA 3F3BA 1SGQE 1ZJKA 3BG8A 1ARBA 3JZ1B 1G3EA 4ISOA 1WQVH 3T29A 1EB2A 1OKXA 4ABBA 3ODDA 3CP7A 5DG6A 2EI8A 2F43B 2YNBA 1G3DA 2AEIH 2HVXA 3QN7A 3O8DA 1MBQA 5CHAC 1F0RA 2FOFA 1IQMA 2OC7A 1NFUA 1C5NH 1AE8H 2W3IA 1ZLRA 1D3QB 1TRYA 3F0PA 1LVMA 1TONA 2C93B 5I25A 3RXMA 1ESTA 2G8TA 2FTLE 3UNQA 1EZXC 1HDTH 1MKXK 5E8EH 1Z8RA 1AVWA 1LCYA 4CBNA 2PWXA 1Z6EA 2QXJA 3QTVH 4LK4A 4B2AA 1EJMA 1WUNH 1CHOG 1PPFE 2PP6A 1YCPM 3A7ZA 1QURH 2KAIA 1AUJA 1DWEH 3A8BA 3SNDA 5HM2A 2CHAB 3MNXA 3WWBA 4XDEA 1QL7A 3ZVBA 1AHTH 1V2QT 2OBQA 1FLEE 2V0BA 1PQ5A 5AHGH 1P9UA 1G2MA 1KLTA 1O2MA 1CU1A 2FIRH 1S82A 1TA6A 2UUYA 2ZHFH 5LGOA 1FN8A 4JZFH 3UR6A 1O3OA 4XD7D 1Y3YA 2SFAA 3QGJA 2Z7FE 3BTWE 1BCUH 3V12A 1SGFA 2QF0A 3PV2A 3STIA 1TMTH 2XCNA 5KECA 5EU8A 1LO6A 2FI4E 3A88A 1MUEB 4GLYA 2HRVA 5FXLA 2QY0B 1KXEA 1GI6A 1O3GA 1JWTA 1GMCF 2BVXH 1UCYE 3S0NA 4DJZB 1SLXB 4DURA 1SGCA 1HCGA 2ZCKP 3PMAB 1O2WA 5EIYA 3LC5A 2A4QA 2ZA5A 3UFAA 3C1KA 4Y8YA 2Y5FA 4RKJB 4GPGA 1TOCB 1GJBB 2P3TB 1G30B 1GBCA 4Q63A 2BB4A 3RXIA 2ANYA 3CENA 4Q80A 1BBRK 3F2GA 4NGAH 5A8YA 1TNIA 3E6PH 3HGPA 1MTSA 1Z7KA 3I78A 4Z0KA 1W12U 2I6QA 2FLRH 3OX7U 3U8RH 1XX9A 4F55A 1O3CA 3LGYA 5A09A 3PO1C 1P02A 2BY6X 1GVKB 1GPZA 1S0QA 2C90B 3ODFA 3FOAA 1Y3WA 3SUGA 1JRTA 1RD3B 2A5AA 1MCTA 3H5CB 1YCPH 1ZHRA 3AAVA 2TGTA 1MH0A 3F2FA 2WV4A 3N7OA 4CHAC 1EFRD 1SGDE 2BM2A 1XVOA 2BOKA 2H6MA 6CHAB 1DICA 1DWBH 3SHCH 1ID5H 4X1PU 5PTPA 1WQSA 1G3BA 3KGPA 2ZEBA 4X6OA 5FBEA 4NIYA 3T2NA 1SSXA 2STBE 3RMLH 2R9PA 5JPMH 1XVMA 2XTTB 2A7JA 1KLIH 9ESTA 4U01A 1E38B 2XYAA 2CK3D 4AB8A 4I8JA 1KXCA 1P12E 3TIUA 2ZDVH 1G37A 3GOVB 1MBMA 1ZGIA 2O8UA 2BHGA 1LKBA 5L2YH 5I46H 3BTEE 3V0XA 1YLCA 4YM9A 2IJOB 4BTUB 1TBZH 4UFGH 3F9EA 1D3DB 1AMHA 4DIHH 1ESBA 5C67A 2BYAX 2Y6TA 1MMJN 1ZPZA 2ZGBH 1B7XB 3HGNA 3NCLA 2FMJA 2OP9A 2QCYA 1P10A 5C1UA 1NFWA 3GY3A 3SU0A 4WY3A 2F9OA 2AGGX 5DSFA 3MNBA 2STAE 1O3AA 1C5VA 1P2IA 2BLOA 1C1TA 1V6DA 2GDEH 3A7YA 4P00A 1EPTB 1FZZA 1GGDB 2PSYA 2OCVB 2GX4A 3RMOH 1V2UT 1H8HD 1SMFE 1S81A 5FHTA 4M7GA 4Z6AH 4IN2A 2F91A 3TJOA 3E1XB 3N7DA 3LU9B 3SV7A 1SGYE 1FXYA 2AGIX 4KKDA 1C5OH 2HNTE 2J4IA 3C27B 2FS8A 3M61U 3PMJA 3GYMA 1FNIA 3AVZA 1O2UA 1C1RA 1ELGA 1O2JA 1O30A 1RFNA 1WAYB 2BMGB 4DCDA 2BX3A 1C4V2 3GDUA 3UIRA 4MNYA 4XRNA 1TAWA 1GI0A 2ODYB 1KMHB 2I6SA 3LGIA 2IOTA 3CS0A 4ZHLU 3ATMA 5EJLA 2HVYB 4OS7A 4X6PA 3SZEA 1Y3UA 5FPYA 5J4QA 5GDSH 3URDA 2FX4A 5C0TA 3NPSA 2EA3A 3A7XA 4U32A 1DY9A 1D3PB 4DVAU 3BTHE 4HTCH 3GCTF 1MCVA 2D26C 2BDYA 1NY22 5AFYH 3TJNA 3A87A 3S9CA 1O2GH 1ANCA 3SUEA 3NUMA 1ELBA 1Y8TA 4A7IB 1GMCG 5G4BA 3TPIZ 2GJGA 1BB0B 1DLKB 3KL6A 4OS2A 4I33A 2JH0D 2ZQ2A 1AFQB 1P06A 1AKSA 2ZECA 3OTPA 2AS9A 3LT3A 1IQEA 1SGRE 1W11U 5DPAA 3A8CA 4NZLA 2Y5HA 2BLWA 2BD3A 1DS2E 3RXJA 3ATLA 1V2RT 2BXTH 1G9IE 2SGPE 1ELFA 4DT7B 3QTOH 2KCOA 4F4OC 2C8WB 4NA8A 1YPKH 2H5CA 2ZDAH 3JZ2B 1O31A 3S9AA 2Y7XA 2ZWLH 4A5TS 3A8DA 4RKOB 4JYVH 1SGFG 3RXCA 1SG8B 3ZZ3A 1TGCA 1AB9C 3FANA 2ZQ1A 1QHRB 1ANBA 1BA8B 2G4UA 1HPGA 5ESTE 1LVBA 1EXFA 2B0FA 1Y3VA 1GI3A 4CRGA 2FLBH 1LHEH 4XBCA 3TVJB 4MPXA 1O3HA 2GDDA 3TH3H 1O2HA 1L1JA 2NU0E 4X8UH 4AG2A 3RC5A 1C2EA 1FPHH 2OC1A 5CDFE 4TT3D 4ZHAA 1O0DH 4FUCA 3BG4C 3AAUA 1LHDH 5BRRE 5CE1A 1GHYH 2ZFFH 4TWYA 3BTQE 2ZTXA 2FOCA 4ZUHA 1KXAA 1P9SA 1D4PB 1FX0B 3O8RA 2UUFB 3E90B 1C5UA 1NTPA 1EJNA 1O2XA 1GBDA 1UMAH 1MZDA 1L1GA 3ZVGA 3ZYDA 5EPYA 3GY7A 1F5KU 1O3LA 2B9LA 5L30H 2BX4A 3RLWH 4GCHG 3PRBA 4FU8A 1RGQA 1T8LA 4H6TA 2KX4A 3UREA 4A1TA 3PMBB 4JK5A 1P2MA 1VZQH 3U8TH 4CBOA 3ZVEA 1LPZB 1P57B 4OS4A 4TPIZ 5DK1A 4BAQB 1GG6C 2TPIZ 3IITA 6GCHF 1NT1A 8KME2 4WMEA 1GBEA 2HPQH 4THNH 1ANEA 2TGPZ 5EW2H 5A0AE 1MU6B 2C8XB
chains in the Genus database with same CATH topology
1WTGH 2TGAA 1IQIA 5CHAB 1GBLA 4INLA 1ARCA 2XW9A 1UK3A 5DO4H 2VJ1A 1NO9H 2C8YB 3A86A 3PTNA 1E0FD 1FAKH 1OWDA 2LPRA 3SHAH 1CE5A 1TALA 4NSVA 4X2WA 1HAZB 1BRUP 4ABGA 1O35A 1DUAA 1MAXA 1W14U 1EASA 1C5MD 1C2IA 4FU9A 3TH2H 3UWJH 5E0GA 4BAHB 2CF8H 2ODPA 2G81E 3QO6A 1CGHA 1C4U2 2WYGA 1H8IH 1YPHE 2ZTZA 5EQRA 3ATIA 1FY4A 4O3TA 1ELCA 2CGAA 2RCEA 1TWXB 4O97A 3LIWA 1P2OA 1NROH 1S5SA 1ABJH 1C5LH 2AFQB 3DT0H 4IMQA 1NFYA 3SNEA 4B74A 1BBRE 1MD7A 2PKAB 3P17H 1CHOF 1QQUA 1Z8GA 5ETXA 2GCTC 2Z9KA 4MPWA 5E2PA 2PKSB 1TBRH 4AFQA 4WH8A 1Q2WA 2FODA 1SQOA 1AD8H 2CF9H 1TPAE 1NRNH 4KTSA 2V3OH 3M37A 1KDQB 1O2IA 1EJAA 1MD8A 4ISIH 1GBBA 2BD2A 2A5KA 3RC6A 1CBWB 2ZU1A 4ABJA 3RXQA 1O2KA 4K1EA 2YNAA 3UPEA 3BEIB 3PLKA 3Q76A 1OWIA 2SGDE 3LDXH 3QGNB 1AE5A 2Z3CA 3K2UA 1HV7A 2FO9A 2BDIA 2F3CE 3QDZB 2BY5X 1EX3A 1Z8JB 1ZHPA 2XNIA 1V2WT 3VB5A 1D6RA 1THPB 3PO1B 1QCPA 1Y5AT 1NESE 3VGCC 1T31A 3KHVA 1VITH 5E2OA 3SW2B 1AVGH 1ZYOA 2AMDA 4QT8C 1SFIA 2Y82A 3FFGA 4FVDA 2FEQH 4WJG2 2Z3EA 1SGNE 1P03A 2ZG0H 4CHAB 6LPRA 1C1SA 3U98H 1GBTA 2ZDKA 1O2TA 3TLOA 2VIDA 4ABIA 1J15A 1HAPH 4Y7AA 5JBCS 3GCHC 1BTXA 2FWWA 1TNHA 4CRFA 4I8LA 3PWCA 1CA8B 1E34B 4E05H 1MKWH 1GCTB 3T26A 1V2LT 3MU1A 4K3JA 3M5OA 3ZZCA 2ZFTA 1O32A 1S6HA 4Y79A 2R2MB 1PFXC 2H9TH 4AFUA 1AUTC 1BMAA 2BQ6B 1ZJDA 3AASA 1D9IA 3SN8A 1BOQA 3TJUA 1QBNA 1GJDB 3LONA 5H4IB 2BOHB 6GCHG 3URCA 4H42U 1QRWA 2H5DA 4WMFA 2FOHA 2GT7A 4IC6A 1VITF 3TK9A 1C2GA 1H4WA 4UDWH 1AQ7A 4FUHA 4KTUA 1GBAA 4GHTA 1EZSC 3DA9B 1D6WA 1UTMA 4ISHH 4J1YA 3P95A 2CMYA 3HK6B 3B23B 1MKXH 5C5NA 1DVAH 1FY5A 1Y3XA 4TY6A 1EKBB 1NRSH 1NRQH 2SGEE 1ETRH 2BD8A 1AVXA 2PV9B 1HAIH 2FYRA 1HFDA 3H7TA 1V2MT 3LJJA 3R0FA 1UTPA 2A1DB 1EP5A 2WPLS 1UTLM 4Y7BA 2P16A 1DITH 1O3NA 4RN6A 3M7UA 1DPOA 3SV8A 1IQHA 4WMDA 4ABEA 1BJVA 1BRAA 2QAAA 1M9UA 2ZCLP 1HXEH 2A0QB 2FESH 5EGMA 4YZUA 4JZ1A 2OUAA 3DD2H 4YT7H 1BZXE 2W7UA 5DGJA 1W13U 4NFFA 4VGCC 1L1NA 4AX9H 1C5ZB 1JIMA 1IOEA 5C20A 2BLQA 1V2PT 3FZZA 1SFQB 4D8NA 4A1VA 3M7QA 2Y7ZA 2HGTH 1MU8B 1MZAA 5L2ZH 1GJCB 2BQ7B 1MQ6A 4KGAA 1P04A 2ZU2A 1J14A 2ZIQH 4B71A 1C2JA 1IHTH 1HYLA 1OWJA 2GCHG 4GSOA 1GMDG 1LPKB 4K8BA 3MNCA 1AZZA 4K5ZA 1QA0A 3RXEA 4ZROA 4IW4E 2FXRA 3TU7H 2UUKB 1FV9A 4ZKOU 1CQQA 1O5EH 3E0NB 2BVSH 4YOGA 1C1OA 2CV3A 4B73A 1XKBC 1GI4A 3PROA 3QX5H 1AFEH 1KY9A 1GJ7B 3U1JB 3NKKA 4IBLH 1O2RA 2BVRH 1C1QA 1QTFA 5T6GA 1V3XA 5C3NA 1UHBA 2ZHEH 1GBJA 4X8SH 1QRZA 3MO3A 3GY4A 3VB7A 1EAXA 1QR3E 1CT4E 4DIIH 3QZQA 1BDAA 1C2LA 1N8OC 8LPRA 3SJIA 4X2YA 1HJ8A 1Q31A 3WY8A 3P6ZB 2Z9IA 1CO7E 2ZU3A 1HJAC 5EXMA 5ABWA 3MHWU 1UTNA 2AIQA 2WINI 4Y11E 2A45B 1K1IA 2FX6A 1N1LA 3E0PB 1FI8A 1A0JA 1EZUC 3LH3A 4HI3A 4YLQH 2Q1JA 2RDLA 1OX1A 3F9FA 1YP9A 1O5AB 2R2WU 1RIWB 3MH4A 1VGCC 2O8WA 2BY9X 4CRCA 1TE0A 1O3MA 2ZHWH 2F9UA 1NU9A 4BANB 4IC5A 1C1WH 2P8OC 3M3TA 4WVPE 4D7GA 1QB9A 2QXHA 1TYNA 2VGCB 3BG4B 4AFZA 3LPRA 1SB1H 2PHBA 3P92A 4X1SU 2AERH 1O2ZA 1YGCH 2A31A 3L6PA 1GJ4H 5LPEA 1RS0A 2QC2A 2FYQA 2ZGCA 5JBTA 3MU4A 1TQ0B 3ZYEA 1O38A 4WH6A 5TCCA 2TIOA 4HZHA 5EODA 2H1UA 3EA8A 4R8TB 5JYIA 3PMHB 8GCHG 3ZZ9A 3L33A 2VIQA 3GY6A 1RTFB 1PYTD 5T6FA 3V13A 3DFLA 3KF2A 1GG6B 1VITG 1Q3XA 1GVLA 5FX6A 4BNRA 1PPGE 4SGBE 1C2HA 3HATH 3M3SA 3QWCH 1QFKH 1AZ8A 4AORA 3MMGA 2ZO3H 1K21H 1IQKA 1SOTA 1T8OA 3QZRA 3W95A 1UO6A 2ZPRA 4WXIA 4XBBA 1W7XH 1K1NA 1GI5A 1LTOA 4A1XA 4GCHF 3ZZ6A 1PQ7A 3ZZ7A 2ANMH 1F2SE 1NM6A 4BTTB 2B8OH 2PUQH 5FAHA 1GDNA 2P93A 4B2BA 4X8TH 1LQEA 3RXGA 2VIOA 1ZMNA 2OBOA 1MTUA 3UUZA 1N6XA 2ZFQH 1ZRKA 4F49A 3ATWA 2WPJS 1SQAA 1XUFA 1DDJA 2V35A 3BTGE 1UVSH 5JB8S 1F7ZA 2Z3DA 2BDGA 1EZQA 2GV7A 3SGAE 2VVVA 4FVBA 1MTNB 1C2KA 3SJ8A 3BTDE 2ZU4A 2PTCE 4LOYH 2FI3E 3ZZBA 2A4RA 1TQ7B 3H7OA 1K1JA 3VB6A 1T8MA 1HJ9A 1WTHD 1DANH 1P09A 1P3EA 4XFQA 4YOIA 3U9AH 1HBTH 1W0YH 2ODQA 2B7DH 1HIAA 1LHGH 1UTQA 3EA9A 4DG4A 2XC5A 5F03A 2ESTE 5T3HA 2NU4E 4JZEH 2GCTB 3B9FH 1A5IA 3E3TA 2SGAA 3V3MA 3SGBE 4UONA 1FAXA 1BHXF 1A4WH 3SNCA 1LDTT 4CR5A 1S85A 5FX5A 1CA0B 1F92A 5FCRA 1TMBH 2CXVA 3MH7A 1DWCH 4ISLA 1A5HA 1E35B 2KAIB 2R0KA 3NWUA 2BDBA 1BTUA 5TCAA 2GMTB 3RMNH 1F0SA 3RXLA 2WYJA 4O3UA 3A80A 1O5DH 2GD4B 2ZGXH 2OD3B 1K2I1 1JBUH 2A4OA 4ESTE 5AVDA 4MDSA 4K1SA 2UWPA 1PPCE 4GHQA 2J2UA 4OS6A 1UTOA 2BXUH 2PR3A 1GJ8B 5EQSA 1A0LA 1DSTA 2RG3A 3S7HB 1T7CA 2GTBA 1DY8A 1SGTA 1TPOA 5HMAA 2HNTC 2Z94A 4TY7A 1UVTH 3SUDA 1SGIB 1RRKA 3SUFA 3I77A 1UCYH 5GWZA 2WPMS 5DP3A 1Z71A 2R0LA 3P8OA 1Y5BT 1ETSH 3GCHB 1TNGA 1QJ7B 3M5MA 2G5VA 2GVFA 3VXEH 2EEKA 3LJOA 1S0RA 2OC0A 3M35A 3M36A 1GHVH 3UQOA 5EXNA 4I32A 2A7CA 1IHSH 1FONA 1J9CH 4DW2U 1HAGE 1TPSA 1SGEE 1XUHA 5FCKA 2BY8X 5DP6A 1EATA 4TWWA 3RM0H 1MQ5A 1EAUA 1LKAA 5SGAE 1DXWA 2EC9H 2UWOA 1EAIA 2O8TA 4K69A 1GBKA 3VXFH 3A83A 4JCNA 2GZ9A 2DE8A 1TIOA 1UTKA 1ZTJA 5A8XA 1C1MA 4Y10E 4YLUA 1QNJA 2R3YA 2ZPSA 3ESTA 3RM2H 3M7TA 3SU2A 4HFPB 3MI4A 1K9OE 1TGNA 5C5OA 2GV6A 4K1TA 3VPKA 1YPGH 2TGDA 2ZZUH 1IQGA 4XE4A 3TH4H 1IQNA 2AIPA 1O5GH 1ZMLA 2BDHA 2CN0H 1OYTH 4B1TA 3T27A 1HAVA 2VNTA 3F9HA 5EW1H 1YM0A 1NRPH 2PW8H 2D2DA 1ELEE 4MPUA 2XBYA 4KELA 1C5TA 2NU1E 4WWYA 5E0JA 2PFEA 4Y8XA 1TBQH 4BOHA 3VEQB 3ZVDA 1AWFH 1UJ1A 2VIVA 1QY6A 1ELDE 4JZIA 2F83A 7ESTE 2D1JA 3A7WA 2QXIA 2O8LA 2V3HH 5ESBA 5EXLA 4NA7A 1GJ9B 1XXDA 3MOCA 3MYWA 4VGCB 4ABHA 3HKIB 1O3DA 5BPEA 3LC3A 1PJPA 3T28A 3ZVFA 3SQEE 5C2ZA 5JBAS 5C1XA 2ZFRH 3GCOA 2W26A 1CT0E 1SVPA 2ZPQA 3GDSA 1DM4B 4ZKRU 3VB4A 2BY7X 5T6DA 3Q3KA 1O3BA 3RU4T 1L2EA 1WSSH 1C5SA 1EOLA 2XRCA 2ZCHP 3A81A 4AB9A 5K7RA 4Q2KA 3RXVA 1GL0E 1TABE 3FP6E 3SQHE 4UD9H 1YYY1 2G4TA 2BD5A 4UFFH 3T25A 2F9NA 1W7GH 1FY1A 1T32A 3NXPA 4IN1A 2ZDNA 2ZFPH 1YBWA 5GJ4B 3BTTE 3TITA 4AGJA 4BTIB 4RSPA 2ANKH 8ESTE 1V2TT 1EPTC 4X1NU 4U2WA 1TNJA 3RXBA 1TLDA 3KEEA 5EOKA 3TNTA 4BAOB 1C5RA 1A46H 2GCHF 1ELTA 2H9HA 2DE9A 1GMDF 3Q3YA 4X6NA 1BQYA 1J17T 2HPPH 3SU1A 7GCHG 1S83A 2J9NA 1N8OB 2NU2E 1ETTH 3SGQE 1ELAA 1GBHA 1KTSB 3SNBA 1HJAB 3MU5A 1OYQA 3L3TA 2GZ7A 5GCHG 3U69H 1ZHMA 2VWNA 4NWKA 3PTBA 2XBWA 3OSYA 1O2NA 3E8LA 1CGIE 2XBXA 2AH4X 1O33A 4INKA 1YPHC 1O3PB 1ZTKA 3OY5U 3TGJE 4TYDA 2BDAA 4FUIA 3SU4A 1O5BB 2ZDMA 1U6QA 1O5CB 2PLXA 1DXPA 3EQ0H 1MTVA 1ESAA 1QBVH 1AKSB 1ZPBA 3A7TA 3D23A 3ZV8A 3SV9A 3ZZAA 2P8OB 4INHA 4LZ4B 1Y59T 3U1IB 2QGRA 2GZ8A 1J8AA 2JH6D 4X1RU 4X8VH 1P05A 1RJXB 1SQTA 2HNTF 2HWLB 1C5YB 3MO6A 2TRMA 4AOQA 1SGPE 2QIQA 2Z6BD 1HAHH 2VVCA 4Y76A 3ZZ4A 1O36A 1O3KA 2ZNKH 1BTHH 1UVOA 2ZU5A 5A0CA 2FTMA 4E7RG 2OLGA 2RA0A 1W2KH 4IS5A 5C1YA 1NFXA 2AMPA 1VCPA 3LH1A 3M5NA 2G51A 3O8CA 2BZAA 1DLEA 2OQUA 2JKHA 1QA7A 3QK1A 4AYVB 2ZI2H 1HLTH 2OQ5A 2IN2A 2ANWA 4D9RA 3MH5A 1YF4A 2F9BH 4NZQA 1GMHG 1GL1A 4ABAA 3SU5A 4GVUA 4CRDA 3EE0B 4ZXXH 5CMXH 1Y5UT 1O39A 3RUOA 2BD9A 5GPIB 1PPEE 3E91A 5DP7A 1DT2A 3GDVA 1KIGH 3A82A 1GBIA 2XWAA 3BIUH 8GCHF 1K28D 4GAWA 2WPIS 4I8KA 4FUFA 1C2DA 1O2SA 2XC4A 4Q7ZA 1O5FH 1HAYB 4DOQA 1O3FA 4YESB 1A7SA 5GXPA 1PQAA 3SZNA 3RXRA 4ABFA 3RDZA 4J2YB 1V2OT 1ELVA 5HYOA 4JYUH 1P2JA 3SV2H 3V7TA 3F6UH 4BAKB 2FI5E 1EQ9A 3K9XB 1B0EA 4JK6A 2PGQB 1TGTA 2VH6A 3RP2A 5A2MH 3BTFE 3SI3H 1YPMH 1SPJA 3GY2A 5E0HA 2R3UA 4ZHMU 2Y80A 4X2XA 5FPSA 1L4DA 1XUJA 1DE7H 3OTJE 1GI8B 4XOJA 1MKWK 1X7AC 1FY3A 1BJUA 4OGXA 4ABDA 5EG4A 1TX6A 1UVPA 3GCNA 1GHBG 1SLWB 1A5GH 1EPTA 2Z9LA 4K2YA 3P70B 2UWLA 1E36B 5HXFA 1QJ6B 4PROA 1P8VC 1GI9B 4NG9H 4K8YA 2J92A 3RXPA 4E7NA 4AFSA 3G01A 3K6ZA 3KQEA 1O2PA 3MH6A 1BTWA 2JETC 4D9QA 2FOAA 2XBVA 1LHFH 4MG3A 1XKAC 2JETB 2TBSA 1KXDA 3NZIA 1W3CA 2ZDLA 4B2CA 3U8OH 4DGJA 1NS3A 1W10U 2ZTYA 9LPRA 4XSKU 5DP8A 2W3KA 1OP2A 5JBBS 5F6MA 3FZDA 5TJXA 1ORFA 4MNVA 3Q3XA 4JMYA 1FN6A 1ZZZA 3SI4H 5AF9H 1XXFA 3EYDA 1GHAG 1BBRH 2FM2A 3D49H 1BIOA 4YO9A 3HK3B 1WYKA 1EB1H 1SC8U 2SGQE 1TB6H 1KXFA 1DOJA 2G00A 4I7YH 1ZOMA 3F9GA 3BV9B 4DY7B 1VJAU 4X2VA 2ALPA 1DX5M 1V2KT 2ZP0H 2XXLA 4ZKSU 2P3FH 3PB1E 1TNLA 2BTCE 1P01A 1AB9B 4FUGA 1O3EA 4AN7A 1SR5C 2VIPA 2PKSC 2QF3A 4NWLA 1N6YA 1OWHA 1P3CA 1O34A 2P3UB 4ZH8A 2HALA 2SGFE 1K1PA 4NIXA 3LGVA 1WCZA