3EA7A

Crystal structure of sars-cov main protease triple mutant sti/a in space group p21
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Crystal structure of SARS-CoV Mpro mutant
rcsb
source organism Sars coronavirus
total genus 80
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ea7A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea7A02
4A1XA 1P9UA 3E91A 3PV4A 2XC4A 1O3JA 1QL9A 2BD9A 1GGDB 5BPEA 3SU3A 2BMGB 2W26A 3P70B 5LGOA 5DK1A 3ZV8A 5JBCS 1GHAG 4NG9H 1QA7A 1ZMLA 2BB4A 5EQRA 5T3HA 5C1UA 4YOIA 5SGAE 2PHBA 1DWCH 2PFEA 1V2QT 1YPHC 1YF4A 3ATLA 1EXFA 1K1NA 1DANH 3F9HA 1RTLA 2BD7A 1H9LB 3FVFB 4X2WA 1LVBA 1ZPCA 2GTBA 4SGAE 1MZDA 3RMLH 5HGGA 1H8DH 5T6FA 4Z0KA 2VNTA 1NRRH 2EEKA 4B74A 2D8WA 2BVRH 3I77A 1TX8A 4BOHA 1DE7H 1GHWH 4DIHH 1VCPA 1WAYB 4B1TA 1J17T 3SUFA 1BTPA 1Z8RA 2A31A 4WWYA 5L2ZH 2FI4E 5DPAA 4I8KA 1T32A 1BRCE 3UOUA 1YPHE 4D9RA 1UHBA 2STAE 3ZZ9A 2J95A 1XMNB 1TABE 5HM2A 1TAWA 3MH6A 1LKAA 1CQQA 1MZAA 1TMBH 1C4V2 1NTPA 1QHRB 3T62A 2WPIS 1HV7A 2P95A 4X1NU 2QIQA 1TNJA 3G01A 1BMNH 1DXWA 1G36A 1HJAB 1NC6A 2BY5X 2FODA 2PTCE 3ZZCA 1GBIA 2CGAA 3KEEA 1KDQB 3EA9A 5E2OA 1YC0A 3TJUA 2FDAA 1LHFH 4MNWA 1HAGE 1O32A 4BAHB 5J4QA 2PUQH 1LCYA 4ABJA 2ODYB 2YNBA 3JZ1B 5FCKA 1O2NA 1S5SA 4NGAH 1O34A 2OC7A 2ALVA 3V12A 5HYOA 3A86A 1UCYK 3VB7A 3KHVA 3A88A 4X2YA 1FMGA 1HUTH 2BY8X 1FXYA 3PB1E 5DP8A 1ZZZA 4MPXA 1PFXC 1HAPH 3UWIA 4Y11E 1GCTC 2VIVA 3GY2A 3ZZ4A 1PQ8A 4AB8A 3RMOH 3ATIA 2OC1A 1O3PB 4H6TA 2FOGA 5DP5A 2ODPA 2RA0A 2JETC 1MAXA 3Q77A 4U01A 4TYDA 4Y8XA 1C5NH 1T8MA 1SPJA 1F0RA 3C1KA 4GCHG 2PGBB 1MCVA 4FUIA 3R3GB 4ISOA 1P8VC 1V2UT 1ZHPA 2P16A 1O2KA 1O2VA 2ZDKA 3ZZ7A 1BRUP 1C1VH 1MTNB 2OQ5A 3ZZDA 1PYTD 2FESH 2ZECA 2BD5A 2ESTE 3MMGA 1SC8U 3SW2B 2OLGA 3CS7A 4UFEH 4X2VA 3M3VA 3ZZ8A 1QJ1B 2ZHEH 1C5OH 1TRYA 7KMEH 3SQHE 3MFJA 1S83A 1IQFA 1NESE 3RM2H 1JWTA 1EAXA 2PTNA 3RXAA 1GHXH 1SGEE 4K3JA 1FIZA 1VITG 5DGJA 2A2QH 3E90B 4ZKOU 2GDEH 1UTJA 2UUYA 2AGEX 1HAYB 1UVSH 2VIPA 4LXBH 1SOTA 3NXPA 2ZHDA 3LJOA 1J8AA 2G81E 1L4DA 1AFQC 1FUJA 1AFEH 3MNCA 3RXIA 4BXWA 4MLFB 4UD9H 1P09A 5BRRE 4Y76A 2QXHA 3BTGE 1BRAA 1YM0A 4CRGA 3OSYA 2XW9A 3A7ZA 3CS0A 2SNVA 2ZDVH 2R9PA 1ZRBA 2VIOA 1OPHB 4YTAA 1KIGH 1TGCA 1FPHH 4BAKB 1O30A 1TONA 4I8GA 2ZU2A 3LH1A 1RTKA 2HOBA 1INCA 1ELTA 1SGRE 1O5DH 4RN6A 3RXLA 1AB9B 4ZXYH 1P57B 3EE0B 1W12U 3BTDE 3KNXA 3M3SA 3RXGA 1A5GH 1AVGH 4KELA 3U8TH 4DG4A 4DT7B 4PROA 5EODA 2H1UA 2ODQA 2A32A 1AKSA 1SQOA 1EKBB 4E06H 3TVJB 3A7VA 5JBAS 1K1LA 1MMJN 2G55A 4RKJB 3KF2A 1QL8A 2ZP0H 5TCAA 1C5TA 3PYHA 1QRWA 3LPRA 2BLWA 5A8XA 2PKSC 1S6HA 1D9IA 3IG6B 7GCHF 2O8MA 1IQHA 3AW0A 2D1JA 1IQGA 1QB9A 1UTPA 3PWBA 4NFEA 3RXTA 3HK3B 1HAZB 4JZDH 4VGCC 2ZNKH 2P3FH 3GY3A 2ZGBH 3PWCA 1SHHB 3LGVA 3HGPA 1GJCB 2BDBA 1GI3A 5GWZA 3KQBA 5EXLA 2PLXA 4CHAC 1SBWA 3LGTA 1NPMA 1Z7KA 5L30H 1QBOA 2SGPE 3O8CA 3S7HB 1Y59T 5EQQA 3ATKA 4AYVB 3RDZA 5FAHA 5LPRA 1DT2A 2A1DB 2WUCA 1IQLA 2PSXA 1O35A 1P2NA 2ZDMA 2VH0A 1D3QB 1FY3A 5HXFA 1JIMA 5CHAC 1KLJH 2J92A 2ZEBA 2ILNA 2GX4A 2GZ7A 1ZMJA 1GG6C 2XWAA 2BYAX 4JZEH 2WPMS 1A2CH 1O5BB 2FOHA 1NRQH 2TPIZ 2GV7A 1P10A 1WYKA 4DIIH 1W11U 2SGFE 4DGJA 3DT0H 1AVWA 5JBTA 1O3BA 1QBNA 1FN6A 2B7DH 3P8FA 1SLWB 1A7SA 3ZZ3A 1HXEH 2Y5GA 4B75A 2QA9E 2H5CA 5EU8A 1GHBG 2SNWA 4AGKA 3UQVA 1LKBA 2ZFQH 3OYPA 1YPLH 3TJNA 5JPMH 3JZ2B 3RXVA 1DLEA 1MKWK 2FLRH 5A0CA 4WXIA 1FV9A 1OXGA 2ANWA 2Y81A 3MU8A 2AEIH 3SBKA 1SR5C 1VJ9U 1C2LA 1O33A 1YPGH 1W7GH 1O5CB 3C27B 5ESTE 3KIDU 2CN0H 3BTTE 1T8LA 1VCWA 4U30A 3SN8A 2K1QA 3UNRA 3B23B 1HNEE 3HGNA 2RCEA 1V6DA 2ASUB 4FUEA 2XBVA 1HJ9A 2H9HA 2V6NA 3BG8A 1QA0A 4MVNA 4FXGH 2YNAA 1EB2A 2BVSH 2ZTYA 4MTBA 1K1MA 1EJMA 1Z6JH 3UR6A 2XBXA 2BD3A 5AFZH 4BNRA 4F49A 1FQ3A 2LNCA 5DP6A 1HIAB 3D65E 1KLIH 1J15A 1GBJA 4NWLA 3H7OA 1T8NA 1P2IA 3T26A 1Y5UT 2ULLA 1U6QA 1H8IH 1QFKH 1F7ZA 3UNSA 5FBEA 2JETB 3GY8A 1W8BH 1Z8IB 1F0TA 1WSSH 2V0BA 1BITA 3SJIA 1Q3XA 3FZZA 1W10U 1V2MT 3E0NB 2VVUA 7ESTE 3BTKE 3P8GA 4YO9A 2ZGCA 3RXOA 4K8YA 4E7RG 1C2JA 2NU3E 1BMLA 1EPTC 2QAAA 3T28A 5E8EH 1HFDA 3ZVDA 2ZU1A 5AFYH 1GI6A 1BHXF 1GI7B 1MH0A 1P2KA 1GCDA 1DPOA 3FP6E 4HI3A 2GZ8A 1XKBC 2G8TA 2GDDA 3A80A 1F0UA 1WCZA 7GCHG 1RRKA 1DSTA 4JK6A 6LPRA 1RJXB 1O2ZA 1O5FH 1A4WH 2B9LA 1ACBE 4ZKRU 4QT8C 1KLTA 1KXBA 3NK8A 4A6LA 1CA0C 4ZROA 1ZOMA 1O3NA 3UNQA 4AN7A 3E16B 1CO7E 1PPZA 3LONA 1B0FA 4O3TA 2AH4X 3ZVFA 4IMZA 1CHGA 4KP0A 1HBTH 4D7GA 3OX7U 5FPYA 1AY6H 2HNTC 2A4QA 3MOCA 1Q2WA 5G4BA 3OU0A 1V2ST 2A5AA 4NZQA 1ABIH 1DOJA 1BA8B 1JXPA 3QWCH 1FDPA 1TMTH 1AWFH 2VH6A 1CBWB 1LPGB 1ZJKA 9ESTA 4GUXA 1V2OT 3M5OA 3ZZ5A 3MNSA 4ISIH 1SLUB 5F8ZA 3PM3A 1EAWA 1T8OA 4XDEA 2I6SA 5JB9S 3BSQA 3KN2A 1BHXB 5A8ZA 1OWKA 1T4VH 1JRTA 2R2MB 5L2YH 1N8OB 4LOYH 1TB6H 2QXIA 1AZ8A 3LC5A 3SGBE 4E7NA 3S9BA 3KQCA 3SUEA 1HCGA 2BTCE 1SB1H 2FOMB 1EP5A 3R0FA 1ELAA 1F0SA 1N1LA 2BY7X 2F9NA 1Z71A 3EA8A 2CF8H 1CT2E 3V13A 4DW2U 1K2I1 1BBRH 4INLA 1GL0E 2FTLE 3QO6A 1ETTH 1VCQA 2TGDA 1OWEA 3TK9A 1SQTA 2Q6DA 1P06A 2J4IA 5CE1A 1AB9C 4OS6A 3W95A 4UFGH 1P2QA 1OX1A 4GSOA 1GBTA 1UVTH 3V0XA 1MU8B 1RFNA 1XX9A 1WOFA 1O2OA 2BLQA 4F4OC 1TQ7B 2QC2A 1FPCH 1TALA 2OC8A 4Q80A 1BJVA 2OCVB 3A8BA 1A3EH 2FXRA 5C20A 3ODDA 3E6PH 1HAVA 1YLDA 4AFQA 1TGBA 3FFGA 1GBMA 1C5UA 3GCNA 1N6XA 4HTCH 1TIOA 4CHAB 3A8AA 1SG8B 1ZJDA 2Q1JA 1C2FA 3MI4A 1ZTJA 4Q7ZA 4AFZA 5C3NA 1OWDA 1TRNA 2QV1A 1GBLA 2AMQA 3QLPH 1O3GA 3SJOA 1DY9A 4AYYB 4TY6A 1UCYE 5E2PA 4OGYA 1C5ZB 1S0QA 2FOCA 4ABBA 3L6PA 5CHAB 4MQAA 3U8OH 1GG6B 1QRZA 4TPIZ 2C4FH 3GOVB 1L0ZA 4J1YA 1S82A 4KGAA 1BTHH 4IN2A 1XVOA 4DVAU 5EGMA 4K1TA 3TIUA 3I29A 3KCGH 4X8UH 3MTYA 1D4PB 1P03A 5GJ4B 1PPHE 5T6GA 2ZC9H 4ZXXH 2BX3A 3SNAA 5L6NH 1UMAH 1TOMH 2A45B 2DE8A 2OTVA 2W5EA 1O31A 4I8LA 3UR9A 4AFUA 1H9HE 1BTUA 3RXBA 1TE0A 3AVZA 3F6UH 4JMYA 1A3BH 1SGQE 2F9BH 1K1IA 4YESB 3TJOA 3SO3A 4ABDA 2P3TB 1KXAA 1UHBB 4X8TH 1OP0A 1PPGE 1PYTC 5GPIB 4CRFA 1IQNA 1IQMA 4DOQA 3NKKA 1W7XH 1TWXB 1W14U 2JH0D 4Y0YE 2QCYA 3PLPA 1SGDE 1ZYOA 4X0WU 2Q6GA 1D6RA 3HK6B 1EAUA 1YCPH 2STBE 1SFQB 4NIYA 1P02A 1MCTA 1WTHD 1NS3A 1XM1A 2QGRA 1GJ8B 5A8YA 1SLXB 1LO6A 4Z6AH 2ZFPH 3DFLA 1XUFA 2BD4A 2ANMH 1BBRK 1DFPA 4FUDA 2A5KA 2VVCA 1AZZA 1Y3VA 4Q7YA 1EP6A 4A1TA 4XBDA 3RMMH 1DY8A 3AW1A 3ENSB 2Z3CA 3KGPA 1KXFA 1MTVA 4R8TB 1BMMH 3VXFH 3UPEA 1GI5A 3T29A 1O2SA 2HNTF 1ZTKA 1IHSH 1DXPA 2OP9A 1NRPH 1UTMA 3A83A 3RC6A 1O2MA 3BIVH 2AGIX 1ZPBA 2RA3A 3SV9A 2XRCA 2G5VA 1G3CA 4FUFA 1TNGA 4OS1A 3RLYH 3GCHB 2Y80A 3GCOA 3M5LA 3B9FH 1O38A 1TQ0B 2TBSA 1EPTB 2ZWLH 3URCA 1ETRH 2J94A 1ANBA 4I8JA 3RXFA 2I6QA 2IPHA 4MNVA 1AE8H 2FMJA 1DX5M 1UTLM 3GDVA 2CHAB 2Z9GA 5HM9A 2NU2E 1F5LA 1GHBF 2FS8A 3HPTB 1NO9H 1SGNE 1O2XA 1P05A 1SHYA 2GGVB 2R3YA 3M37A 2XTTB 1CA0B 5FHTA 2F9PA 2BY9X 3KQDA 1FY8E 2FOEA 3TGJE 1OP8A 1TMUH 4ZAEA 2ZGJA 1GJBB 2ZFSA 4NZLA 3ZVCA 1ANCA 1L1JA 2BLVA 4FU7A 3ATMA 1GHZA 2ZU4A 1G3EA 2PGQB 1V2TT 2WINI 3MH4A 1KTTB 2O9QA 1HAOH 1BOQA 1MKXK 4X6PA 1RXPA 2A4OA 1ETSH 2Z9JA 3BG4B 1S6FA 1SL3A 3GDSA 3STIA 4B2CA 4K2YA 1SGYE 1KXCA 4JCNA 1E38B 3M7QA 1T31A 1HAXB 1DSUA 1KY9A 1V2LT 2ZPSA 1K1JA 1MU6B 3GY4A 1CE5A 2SGDE 3M7TA 2AYWA 1AU8A 1F5KU 1ZR0A 1PPFE 3ZZBA 1RS0A 3P8OA 3WY8A 1DICA 1MKWH 4AX9H 2OBQA 1YPEH 7LPRA 2BDYA 1EX3A 3E3TA 3EQ0H 4FUHA 5EXNA 3UREA 4AG2A 1GI2A 2QYIA 4LZ4B 1C5LH 3M7UA 2QF0A 1UJ1A 1FY1A 1KSNA 1JMOH 2V3HH 1HJ8A 2TRMA 1CBWC 2DE9A 2ZA5A 3AAVA 3QZRA 4LZ1H 3SZNA 4B2AA 2QY0B 1GMCF 5EXMA 2GD4B 2C8ZB 1UO6A 3A81A 3PMJA 4DURA 3PO1B 1YCPK 1RIWB 3F1SB 1N8OC 2OBOA 4H4FA 1VR1H 3A82A 2TIOA 2A7JA 3BTWE 2D2DA 1AKSB 1V2KT 3ZVGA 4ESTE 2FZZA 1CGJE 4JZ1A 1ELCA 4DCDA 4MNYA 1K21H 2ANKH 4CRDA 1GBKA 1THSH 2R0KA 1EAIA 3UQOA 5JB8S 1FY4A 4WXVA 4ABFA 2J38A 3ZVAA 2ZDNA 3TK5A 3UY9A 3VEQB 2PKAA 5B6OA 1A61H 4NIXA 1MTUA 3A7XA 1C1TA 1MTSA 1C5MD 2FI3E 1W3CA 2CF9H 1NM6A 1AHTH 2ZF0H 5DP4A 4OS4A 1A5IA 2P59A 4ABAA 1DLKB 3MH7A 2HVXA 3ATWA 1AUTC 2Y5HA 1XUIA 2VJ1A 4OGXA 1Z6EA 2PR3A 3SV6A 1BDAA 4D8NA 1LHGH 1T7CA 3DFJA 1JBUH 4DJZB 1TRMA 1PQAA 1QCPA 1TOCB 4H42U 2UUKB 5FPSA 2QXJA 2HWLB 3NWUA 2XYAA 1G3BA 3V3MA 3TH2H 1KTSB 2CJIA 2UWLA 5LH8A 3F9GA 2A0QB 1K9OE 3SGAE 3IWMA 3FZDA 2FP7B 1ELGA 4AB9A 2WPJS 3LT3A 2ZQ1A 2OD3B 1A46H 4YT6H 4NFFA 4MPWA 4Q2KA 1O3AA 1HLTH 3SOSA 2PV9B 1O39A 4NSVA 4ABIA 5ESBA 1QRXA 3RU4D 1QGFA 3A84A 1CA8B 2P8OC 3S0NA 1Y3YA 4K1SA 1W0YH 1WV7H 2ZFFH 2VIWA 2O8TA 1NU7B 3MU1A 2AGGX 3S9CA 4J2YB 1GBCA 2FPZA 1VGCB 3RXQA 4AGJA 1V2VT 2FX6A 3H7TA 1LHCH 3U69H 1NU9A 1EZSC 1FN8A 1XUJA 4IS5A 3ZVBA 4DY7B 5TCCA 2GCHF 3PMAB 2LPRA 1NFXA 1FNIA 4X6OA 1V2WT 4B2BA 1HB0B 3S69A 1O3EA 2WV4A 1AUJA 4ZMAH 1Y3XA 3M3TA 1M9UA 1P2MA 2Y5FA 2B0FA 4X8SH 1MBQA 3LC3A 4K5ZA 5E0JA 1WQSA 1MAYA 5DP7A 1K28D 3TNTA 4MG3A 1YPKH 3QUMP 4Y7AA 1TNKA 1C4Y2 3SHAH 9LPRA 1H1BA 4JZFH 1EJNA 1TNIA 3TU7H 3SNCA 1DITH 1C1RA 1W13U 1EQ9A 1ELVA 1D3PB 6GCHF 4XFQA 3ZYDA 1CT0E 5F8XA 1C1WH 2F9UA 3DA9B 3BF6H 1KYNA 1S0RA 2GVFA 3KL6A 1IOEA 5EW1H 2THFB 1X7AC 1QBVH 1NFWA 3K6YA 1VITH 4CBNA 1BQYA 1ZMNA 2Y6TA 4WH6A 1GMCG 4O97A 3ESTA 2JH5D 2YOLA 2FM2A 1GVZA 2GCTC 1TX7A 3RM0H 1BZXE 1Y8TA 1SGTA 1YGCH 2WPHS 3RXJA 5ABWA 3S9AA 1ZSJA 3OTJE 5TJXA 1ELDE 1C4U2 1THPB 3T27A 3N7OA 3RXCA 1ZRKA 1L4ZA 2BDAA 3K2UA 4GHQA 3SI3H 1LMWB 1C5XB 3F9FA 2TGPZ 3SQEE 4JYUH 2H5DA 1UVUH 3SJKA 3LIWA 1ESAA 3O8RA 4WMFA 2VWOA 4CREA 4I7YH 2HRVA 3GISB 2UUJB 2FI5E 3VB3A 3QDZB 2EI7A 3GCHC 1P3EA 4X1QU 3TNSA 1MTWA 2P3UB 4K69A 1DM4B 1OP2A 1HXFH 2BD8A 4KTUA 3ITIA 2F9OA 1C2GA 1Y3UA 3GCTF 1P12E 1EJAA 1O2QA 1UK2A 4B76A 3SU1A 2CHAC 1ELBA 2WYGA 1MUEB 2XC5A 2HPQH 4AG1A 4YM9A 2KAIB 1C9TA 4MPUA 3SI4H 4BAOB 5FCRA 3SU4A 3MYWA 2A4RA 4WVPE 1QJ7B 2WYJA 2ZHQH 1NN6A 4FU8A 3QGNB 2SFAA 1ZSLA 1BRBE 2FLBH 4D76A 5GIBA 5GXPA 4U32A 1C5RA 2ZHFH 5FXLA 3VB4A 1LPZB 4GAWA 2FO9A 8GCHF 1GI8B 1O3HA 1WUNH 4YLQH 1XUGA 1UK3A 3BG4C 1Z1JA 2C8YB 1SMFE 3BTQE 1CSOE 1GVKB 5T6DA 1F2SE 3LKWA 3RXMA 2BVXH 1G2MA 1Z8GA 1QIXB 2ZTZA 1E35B 3U9AH 1GJ5H 3M35A 5C5OA 1QJ6B 1SGCA 5C5NA 1ID5H 3M5MA 4FUJA 5A09A 4BAMB 2BLOA 2BQWB 3DHKH 1P01A 2PSYA 1D6WA 3SU5A 1FAKH 1OOKB 1SQAA 3A89A 6CHAC 5FPTA 2EC9H 1Y5AT 1P3CA 2G52A 1AGJA 2VINA 3KQEA 2PWXA 3PMBB 3PO1C 1RIWC 5K7RA 1AE5A 1AO5A 4UFDH 2GCHG 1O3CA 5IDKA 1JRSA 5ETXA 8LPRA 2UWOA 4WF8A 5A0BA 1ZSKA 3MO3A 4Y8YA 1UTQA 2FEQH 3SU6A 3Q00A 4CRBA 1GI0A 2VIDA 4X1PU 1DWEH 3A8DA 2R0LA 3BEIB 3LJJA 1GJ9B 3QGJA 1HAVB 1SGFG 2AFQB 1SVPA 2A2XH 4XSKU 1O2PA 1P2OA 2A7HA 3CP7A 1V2RT 1UK4A 5DP3A 4CR9A 1BBRE 6GCHG 1G30B 2P94A 2HPPH 1WTGH 3H5CB 1O5GH 3VXEH 3U1IB 3HKJB 3ZYEA 2UWPA 5FX6A 2ALPA 1TGSZ 1GBFA 2W7UA 4R0IA 1GWAA 1O2RA 4JZIA 3HKIB 1GMHF 2FTMA 2ZFRH 2Z94A 2AMPA 2IN2A 2LIZA 2J9NA 1YBWA 1K1OA 1FIWA 2AIQA 3RUOA 1D3DB 1EUFA 2WV5A 3LH3A 5J4SA 1GBHA 2ZHWH 3FANA 2Z9IA 1UTNA 1V2PT 4A92A 1IQKA 2K7XA 2F3CE 2ZTXA 2FOAA 5DKMA 1SSXA 1NRNH 4IGDA 3ZZAA 1P9SA 4TWWA 1S84A 1BMAA 2G5NA 4BANB 2P8OB 2XNIA 1J9CH 2BDGA 2BD2A 4NIVA 4FU9A 4BXSA 4NCYA 5I25A 3A87A 1MKXH 3TH3H 2XXLA 1C1UH 4IC5A 3RXHA 1WQVH 2NU0E 3ODFA 4BTIB 1TX6A 5AHGH 3F68H 1B5GH 3P95A 1PPBH 2XWBI 3EGKH 4X1SU 1BT7A 1AMHA 3GCTG 4GVUA 1HPGA 4ZHMU 2ZKSA 1JIRA 3T25A 4K8BA 3T5FH 1ANDA 3RXRA 4IC6A 4YZUA 3MHWU 3TPIZ 1E34B 1FAXA 1VGCC 3ZV9A 1ZHMA 1C2HA 2XCFA 2C90B 1IAUA 1C5WB 3GY7A 1GBDA 4O3UA 1EZXC 4ZKSU 5EOKA 4BTTB 2CV3A 2ZDAH 3SUGA 3SV7A 2GP9B 1UTKA 1O2WA 3FP7E 1MBMA 1GJ6A 3SNBA 4HFPB 1LVMA 1TA2A 3BTFE 1QR3E 1OSSA 1GI4A 1B0EA 1FZZA 4IMQA 8KME2 2W7SA 1HGTH 1V2JT 1EOLA 5C1XA 8GCHG 1HYLA 1GJ7B 1MQ5A 2ZFTA 4ABGA 1RD3B 3QX5H 2PW8H 4ZKNU 2H9EH 3LU9B 5A2MH 1HAHH 2H6MA 2Z6BD 3K65B 2JH6D 1AD8H 3LDXH 2ZU3A 3GDUA 5IYTA 4ZHLU 1C2DA 3MNBA 4Y7BA 1QTFA 3URDA 1A1RA 3UTUH 1K22H 2VVVA 2VU8E 4Q7XA 5LPFA 2BX4A 1AI8H 2GCTB 1O2TA 1GHYH 4K60A 2W3IA 4TY7A 3RU4T 1FLEE 2BOHB 3ZVEA 2G00A 1TA6A 3I78A 1RTFB 3RC4A 1XXDA 4ASHA 5GCHF 3EBNA 4XBBA 3MH5A 1O2GH 1C1NA 1O3LA 1RGQA 4OS2A 4WJG2 4ZH8A 3EDXB 3NPSA 1GJDB 1S81A 1O5AB 4Y0ZE 2R2WU 2IOTA 1LTOA 3VB6A 1O5EH 1TGNA 3SNEA 5C1YA 3HATH 5AVDA 1YCPM 2GMTC 2BM2A 1NFYA 1O2LA 3GYMA 4YT7H 1O3FA 4O03A 1CVWH 1KDQA 1BCUH 4HGCA 3P17H 1AWHB 2ZDLA 1EZUC 1NROH 1PQ5A 1HRTH 2A7CA 1WBGB 3V7TA 1JOUB 2F83A 2VB0A 3A7WA 1AQ7A 5F8TA 1C2MA 2ZGXH 2BQ7B 2BXTH 2QXGA 4FUCA 3SJ9A 1OKXA 1MQ6A 1BUIA 1C5PA 1BTXA 3AASA 2EI6A 4Y6DA 1O3MA 2SGEE 2ZO3H 4SGBE 1P04A 5HMAA 4BAQB 5JYIA 2BHGA 3UOPA 2A4GA 1GMHG 2C8XB 1OYTH 4UDWH 4AZ2B 4D7FA 1EPTA 4B71A 2DUCA 1DS2E 2IJOB 1O0DH 1ARBA 4Y8ZA 2ZPRA 1TNLA 4CH8B 1ZPZA 3FP8E 1BTYA 1CU1A 5JBBS 1A0HB 1O3DA 5E0HA 3SV2H 1BB0B 2Y7ZA 2GT7A 4CRAA 2J34A 1F5RA 3QZQA 4FVBA 2ZCLP 1GMDF 4K1EA 5DO4H 1BTZA 1YPMH 3VFEA 1QURH 1TGTA 2AERH 1XXFA 2ZZUH 3RXPA 3PTNA 1SLVB 2B5TB 3NZIA 3LGWA 5E0GA 1TLDA 1ZGVA 3RXUA 4CRCA 4RKOB 1IQEA 5EW2H 5DG6A 4ABEA 3P8NA 1C2IA 3TJVA 6CHAB 2FYQA 3RLWH 3M36A 1XUKA 4X8VH 2Y7XA 1SI5H 4CBOA 4B73A 1J14A 3BIUH 3SGQE 1W0ZU 1NT1A 1P2JA 4HZHA 1L1NA 2VWMA 2BDIA 2VGCC 2ZGHA 5EG4A 1QB1A 3MU5A 4FUBA 1LHEH 3TLOA 1QNJA 2PKAB 4I8HA 3GY5A 3E1XB 4MDSA 1ELEE 3IITA 4IN1A 1IQJA 1TPAE 4GHTA 4WY3A 6ESTA 2PUXB 1TBQH 3EA7A 1C5YB 5C67A 2C3SA 3D49H 3RU4E 1S85A 1CHOF 2FS9A 2NU4E 5F6MA 1IQIA 3TH4H 3PLKA 1O36A 4D9QA 2FIRH 3FAOA 1G37A 1TPPA 1K1PA 3LOXA 3D23A 4AORA 2Z9LA 1LQEA 2VWNA 3D62A 3O8BA 4A5TS 4NSYA 1GDNA 3S7KB 4UEHH 2H9TH 1C5QA 5A0AE 1A0JA 1O2UA 2WPKS 3VGCB 4ISLA 1LPKB 4YOJA 3F9EA 1PPEE 4UE7H 5I46H 3OY5U 4CR5A 1GBAA 2AIPA 3GYLB 3Q3YA 1TNHA 4INKA 2BOKA 1TYNA 2O8WA 1C2EA 1O3IA 3QN7A 2BY6X 5GCHG 2Z3EA 1H4WA 4NWKA 2C8WB 1OYQA 3PROA 2HALA 5EPNA 4E05H 1G2LA 2QN5T 4MPVA 2ZU5A 3U8RH 2ZPQA 1VZQH 3SHCH 1XKAC 1EASA 2W3KA 2Z9KA 2D26C 2AMDA 1DDJA 5CMXH 4MNXA 3QK1A 3UIRA 2JKHA 2XCNA 3UWJH 3UUZA 1LDTT 3RMNH 3RXKA 2Z3DA 2ZCKP 1C1QA 1V3XA 3MNXA 3Q76A 5C2ZA 1NRSH 4XOJA 1EOJA 1AN1E 1OS8A 1SOZA 1YYY1 2CXVA 1EATA 4Y10E 2GV6A 2J2UA 1GGDC 4I31A 1TPOA 2WPLS 1GBEA 1ZLRA 3PMHB 2SGQE 1GHVH 1KXDA 1XUHA 2SGAA 1NFUA 3TITA 3BTME 1FONA 3MU4A 3L33A 5PTPA 1FY5A 2OC0A 2V35A 1GI1A 2OINA 5JDUB 1NY22 1O2JA 1Z1IA 1Q31A 2GT8A 1GDUA 1E36B 1TFXA 3SV8A 1O37A 2BZ6H 3SUDA 5DJ7A 1C5SA 1BJUA 1SGIB 3BTEE 1A5HA 1UVOA 3MO9A 3RXDA 4ZHAA 1AIXH 5K0HA 1QB6A 4NA9H 4WH8A 3QTOH 3GY6A 1YLCA 3DD2H 5AF9H 1GMDG 4ISNA 1LQDB 4KTSA 3T2NA 2O8UA 1FI8A 4NA8A 4AFSA 1F92A 2TGTA 1PJPA 1MD7A 2ZCHP 3A7YA 1ORFA 2BDHA 1KXEA 1G9IE 2A5IA 2B8OH 1ESBA 1ZGIA 1HDTH 2FX4A 2G4TA 4NA7A 4U2WA 1XVMA 2OXSA 3OY6U 1TBZH 3NCLA 3SU2A 2ANYA 4CH2B 1L2EA 2NU1E 2HLCA 3PLBA 1GBBA 1GDQA 3E8LA 2HGTH 3STJA 2GMTB 4KTCA 1UTOA 2XBYA 4GLYA 4XBCA 1P0SH 1HJAC 8ESTE 3SJ8A 2VWLA 3L3TA 1W2KH 2BQ6B 2M5TA 2O8LA 2Z7FE 4ABHA 1O2HA 2QF3A 2OUAA 3P92A 2XC0A 2RDLA 1Z8JB 2F91A 3NUMA 1O2IA 1B7XB 1GCTB 1PPCE 2BXUH 3TGIE 3BEUA 1CT4E 1D3TB 1HIAA 5H4IB 2EA3A 1GJAB 3RC5A 1CHOG 4I33A 1EZQA 2R3UA 2BZAA 3RXSA 1OWHA 4M7GA 1GHAF 3B8JA 4BTUB 3BTHE 2EI8A 2NWNA 2ZI2H 3A85A 1ELFA 1HAIH 2P93A 2ZQ2A 2ZG0H 1GVLA 1GPZA 3RP2A 4INHA 4THNH 1ZHRA 1C2KA 4O9VA 4IBLH 3MU0A 2FOBA 1IHTH 4JYTA 1L1GA 3MWIU 1SGFA 1G32B 1GJ4H 3SU0A 5EPYA 1NZQH 4H6SB 1O3KA 2FOFA 1J16A 1A0LA 1PQ7A 2ZIQH 1SGPE 1BTWA 1MTNC 3MO6A 2Y82A 2CMYA 1UVPA 3AAUA 4GPGA 1QY6A 3PTBA 1C1OA 5F03A 2KAIA 3SNDA 1E37B 3DUXH 4OS5A 1YKTA 3A8CA 1O2YA 4YLUA 1LVOA 1DVAH 2GZ9A 2OQUA 5DP9A 2AS9A 1AFQB 4X6MA 2RG3A 2H2ZA 3VPKA 2Q6FA 2VGCB 2F9VA 1CGIE 2TGAA 1ABJH 3P6ZB 4IW4E 3VB5A 3QTVH 2UUFB 2VIQA 4UFFH 3EYDA 1C1SA 3ZZ6A 1BIOA 1N6YA 3K9XB 2FWWA 3ELAH 4X6NA 3BV9B 1TPSA 3LGIA 4XE4A 4Y79A 1ANEA 3BEFB 3LGUA 1THRH 2V3OH 2FYRA 3K6ZA 3TGKE 4NIWA 2HNTE 4JYVH 1YPJH 4JK5A 1CGHA 5GDSH 3W94A 3TK6A 5FBIA 3E0PB 1AVXA 4KKDA 2WUBA 1GL1A 1V2NT 4OS7A 5FX5A 1G3DA 1OWIA 1TBRH 3A7TA 3BN9A 4AOQA 4A7IB 1OWJA 1C1PA 3O8DA 2GKVE 4Y71A 4WMEA 4GCHF 2PKSB 1GI9B 2G4UA 3CENA 1UCYH 4RSPA 1YP9A 3M5NA 1ZTLA 3RXEA 3VGCC 1P11E 3EAJA 4ISHH 1ESTA 3U98H 4TWYA 1DUEA 1Y5BT 1MD8A 4VGCB 4X2XA 3SORA 1ARCA 1EB1H 2BDCA 1E0FD 1LHDH 1LVYA 3Q3KA 1H9IE 1C9PA 3GICB 4TPYA 1C5VA 1QQ4A 1QQUA 2XBWA 1DWBH 4WMDA 4A1VA 4UONA 3M61U 5EQSA 3LGYA 4LK4A 4ZUHA 1T4UH 1VJAU 5LPEA 1SFIA 2C93B 3U1JB 1WU1A 4X1RU 1VITF 1DUAA 1Y3WA 1C1MA 4FUGA 1O3OA 2G51A 4FVDA 1DWDH 4YOGA 4I32A 3UFAA 1FJSA 1QL7A 3Q3XA
chains in the Genus database with same CATH superfamily
4A1XA 1P9UA 3E91A 2YMSD 3PV4A 2XC4A 1O3JA 1QL9A 2BD9A 1GGDB 5BPEA 3SU3A 2BMGB 2W26A 3P70B 5LGOA 5DK1A 3ZV8A 5JBCS 1GHAG 4NG9H 1QA7A 1ZMLA 2BB4A 5EQRA 5T3HA 5C1UA 2WSSD 4YOIA 5SGAE 2PHBA 1DWCH 2PFEA 1V2QT 1YPHC 1YF4A 3ATLA 3FN8A 1EXFA 1K1NA 1DANH 3F9HA 1RTLA 2BD7A 1H9LB 3FVFB 4X2WA 5HIYA 2V3MA 1LVBA 1ZPCA 2GTBA 4SGAE 1MZDA 3RMLH 5HGGA 1H8DH 5T6FA 4Z0KA 2VNTA 1NRRH 2EEKA 4B74A 2D8WA 2BVRH 3I77A 1TX8A 4BOHA 1DE7H 1FX0B 1GHWH 4DIHH 1VCPA 1WAYB 4B1TA 1J17T 3SUFA 1BTPA 1Z8RA 2A31A 4WWYA 5L2ZH 2FI4E 5DPAA 4I8KA 1T32A 1BRCE 3UOUA 1YPHE 4D9RA 1UHBA 2STAE 3ZZ9A 2J95A 1XMNB 1TABE 5HM2A 1TAWA 3MH6A 1LKAA 2KCOA 1CQQA 1MZAA 1TMBH 1C4V2 1NTPA 1QHRB 3T62A 2WPIS 1HV7A 2P95A 4X1NU 2QIQA 1YY3A 1TNJA 3G01A 1BMNH 1DXWA 1G36A 1HJAB 1NC6A 2BY5X 2FODA 2PTCE 2KCYA 3ZZCA 1GBIA 2CGAA 3KEEA 1KDQB 3EA9A 5E2OA 1YC0A 3TJUA 2FDAA 1LHFH 4MNWA 1HAGE 1O32A 4BAHB 5J4QA 2PUQH 1LCYA 4ABJA 2ODYB 2YNBA 3OEED 3JZ1B 5FCKA 1O2NA 1S5SA 4NGAH 1O34A 2OC7A 2ALVA 3V12A 5HYOA 3A86A 1UCYK 3VB7A 3KHVA 3A88A 4X2YA 1FMGA 1HUTH 2BY8X 1FXYA 3PB1E 5DP8A 1ZZZA 4MPXA 1PFXC 1HAPH 3UWIA 4Y11E 1GCTC 2VIVA 3GY2A 3ZZ4A 1PQ8A 4AB8A 3RMOH 3ATIA 2OC1A 1O3PB 4H6TA 2FOGA 5DP5A 2ODPA 2RA0A 2JETC 1MAXA 4RT1A 3Q77A 4U01A 4TYDA 4Y8XA 1C5NH 1COWD 1T8MA 1SPJA 1F0RA 3C1KA 4GCHG 2PGBB 1MCVA 4FUIA 3R3GB 4ISOA 1P8VC 1V2UT 1ZHPA 2P16A 1O2KA 1O2VA 2ZDKA 3ZZ7A 1BRUP 1C1VH 1MTNB 2OQ5A 3OEHD 3ZZDA 2QF4A 1PYTD 2FESH 2ZECA 2BD5A 2ESTE 3MMGA 1SC8U 3SW2B 2OLGA 3CS7A 4UFEH 4X2VA 3M3VA 3ZZ8A 1QJ1B 2ZHEH 4F55A 1C5OH 1TRYA 7KMEH 3SQHE 3MFJA 1S83A 1IQFA 1NESE 3DSGA 3RM2H 1JWTA 1EAXA 2PTNA 3RXAA 1GHXH 1SGEE 4K3JA 1FIZA 1VITG 5DGJA 2A2QH 3E90B 4ZKOU 2J97A 2GDEH 1UTJA 2UUYA 2AGEX 1HAYB 2YMSB 1UVSH 2VIPA 4LXBH 1SOTA 3NXPA 2ZHDA 3LJOA 2CK3D 1J8AA 2G81E 1L4DA 1AFQC 1FUJA 1AFEH 3MNCA 3RXIA 4BXWA 4MLFB 4UD9H 1P09A 5BRRE 4Y76A 2QXHA 3BTGE 1BRAA 1YM0A 4CRGA 2KCAA 3OSYA 2XW9A 3A7ZA 3CS0A 2SNVA 2ZDVH 2R9PA 1ZRBA 2VIOA 1OPHB 4AC9A 4YTAA 4B6EA 1KIGH 1TGCA 1FPHH 4BAKB 1O30A 1TONA 4I8GA 2ZU2A 3LH1A 1RTKA 2HOBA 1INCA 1ELTA 1SGRE 1O5DH 4RN6A 3RXLA 1AB9B 4ZXYH 1P57B 3EE0B 1W12U 3BTDE 3KNXA 3M3SA 3RXGA 1A5GH 1AVGH 4KELA 3U8TH 4DG4A 4DT7B 4PROA 5EODA 2H1UA 2ODQA 2A32A 1AKSA 1SQOA 1EKBB 4E06H 3TVJB 3A7VA 5JBAS 1K1LA 1MMJN 2G55A 4RKJB 3KF2A 5B6LA 1QL8A 5KEDA 2ZP0H 5TCAA 1C5TA 3PYHA 1QRWA 3LPRA 2BLWA 5A8XA 2PKSC 1S6HA 1D9IA 3IG6B 7GCHF 2O8MA 1IQHA 3AW0A 2D1JA 1IQGA 1QB9A 1UTPA 3PWBA 4NFEA 3RXTA 3HK3B 1HAZB 4JZDH 4VGCC 2ZNKH 2P3FH 3GY3A 2ZGBH 3PWCA 1SHHB 5CDFE 3LGVA 3HGPA 1GJCB 2BDBA 4RI0A 1GI3A 2VBCA 5GWZA 3KQBA 5EXLA 2PLXA 4CHAC 1SBWA 3LGTA 1NPMA 1Z7KA 5L30H 1QBOA 2SGPE 3O8CA 3S7HB 1Y59T 5EQQA 3ATKA 4AYVB 3RDZA 5FAHA 5LPRA 1DT2A 2A1DB 2WUCA 1IQLA 2PSXA 1O35A 1P2NA 2ZDMA 2VH0A 1D3QB 1FY3A 5HXFA 1JIMA 5CHAC 1KLJH 2J92A 2ZEBA 2ILNA 2GX4A 2GZ7A 1ZMJA 1GG6C 2XWAA 2BYAX 4JZEH 2WPMS 1A2CH 1O5BB 2FOHA 1NRQH 2TPIZ 2GV7A 1P10A 1WYKA 4DIIH 1W11U 2SGFE 4DGJA 3DT0H 1AVWA 5JBTA 1O3BA 1QBNA 1FN6A 2B7DH 3P8FA 1SLWB 1A7SA 3ZZ3A 1HXEH 2Y5GA 4B75A 2QA9E 2H5CA 5EU8A 1GHBG 2SNWA 4AGKA 3UQVA 5C17A 1LKBA 2ZFQH 3OYPA 1YPLH 3TJNA 5JPMH 3JZ2B 3RXVA 4TT3D 1DLEA 1MKWK 2FLRH 5A0CA 4WXIA 1FV9A 1OXGA 2ANWA 2Y81A 3MU8A 2AEIH 2OK5A 3SBKA 1SR5C 1VJ9U 1C2LA 1O33A 1YPGH 1W7GH 1O5CB 3C27B 5ESTE 3KIDU 1W0KD 2CN0H 3BTTE 1T8LA 1VCWA 4U30A 3SN8A 2K1QA 3FOAA 3UNRA 3B23B 3N99A 1MABB 1HNEE 3HGNA 2RCEA 1V6DA 3F0OA 2ASUB 4FUEA 2XBVA 1HJ9A 2H9HA 2V6NA 3BG8A 1KMHB 1QA0A 4MVNA 4B6FA 4FXGH 2YNAA 1EB2A 2BVSH 2ZTYA 4MTBA 1K1MA 3OFND 1EJMA 1Z6JH 3UR6A 2XBXA 2BD3A 5AFZH 4BNRA 4F49A 2M2AA 1FQ3A 2LNCA 5DP6A 1HIAB 3D65E 1KLIH 1J15A 1GBJA 4NWLA 3H7OA 1T8NA 1P2IA 3T26A 1Y5UT 2ULLA 3W1EA 1U6QA 1H8IH 1QFKH 1F7ZA 3UNSA 5FBEA 2L6OA 2JETB 3GY8A 1W8BH 1Z8IB 1F0TA 1WSSH 2V0BA 1BITA 3SJIA 1Q3XA 1E1QD 3FZZA 1W10U 1V2MT 3E0NB 2VVUA 7ESTE 3BTKE 3P8GA 4YO9A 2ZGCA 3RXOA 3WWBA 4K8YA 4E7RG 1C2JA 2NU3E 1BMLA 1EPTC 2QAAA 3T28A 5E8EH 1HFDA 3ZVDA 2ZU1A 5AFYH 1GI6A 1BHXF 1GI7B 1MH0A 1P2KA 1GCDA 1DPOA 3FP6E 4HI3A 2GZ8A 1XKBC 2G8TA 2GDDA 3A80A 1F0UA 1WCZA 7GCHG 1RRKA 1DSTA 4JK6A 6LPRA 1RJXB 1O2ZA 1O5FH 1A4WH 2B9LA 3PRDA 1ACBE 4ZKRU 4QT8C 1KLTA 1KXBA 3NK8A 4A6LA 1CA0C 4ZROA 1ZOMA 1O3NA 3UNQA 4AN7A 3E16B 1CO7E 1PPZA 3LONA 1B0FA 4O3TA 4P00A 2AH4X 3OE7D 3ZVFA 4IMZA 1CHGA 4KP0A 1HBTH 4D7GA 3OX7U 5FPYA 1AY6H 1K0HA 2HNTC 2A4QA 3MOCA 4FOUC 1Q2WA 5G4BA 3OU0A 1V2ST 2A5AA 4NZQA 1ABIH 1DOJA 1BA8B 1JXPA 3QWCH 1FDPA 1NBMD 1TMTH 1AWFH 2VH6A 1CBWB 1LPGB 1ZJKA 9ESTA 4GUXA 1V2OT 3M5OA 3ZZ5A 3MNSA 4ISIH 1SLUB 5F8ZA 3PM3A 3VG8A 1EAWA 1T8OA 4XDEA 2I6SA 5JB9S 3BSQA 3KN2A 1BHXB 5A8ZA 1OWKA 1T4VH 1JRTA 2R2MB 5L2YH 1N8OB 4LOYH 1TB6H 2QXIA 1AZ8A 3LC5A 3SGBE 4E7NA 3S9BA 3KQCA 3SUEA 1HCGA 2BTCE 1SB1H 2FOMB 1EP5A 3R0FA 1ELAA 1F0SA 1N1LA 2BY7X 1SQRA 1Z71A 2F9NA 3EA8A 2CF8H 1CT2E 3V13A 4DW2U 1K2I1 1BBRH 4INLA 1GL0E 3F2HA 2FTLE 3QO6A 1ETTH 1VCQA 2TGDA 2HLDD 1OWEA 3TK9A 1SQTA 2Q6DA 1P06A 2J4IA 5CE1A 1AB9C 4OS6A 3W95A 4UFGH 1P2QA 1OX1A 4GSOA 1GBTA 1UVTH 3V0XA 1MU8B 1RFNA 1XX9A 2WZQA 1WOFA 1O2OA 2WHXA 2BLQA 4F4OC 1TQ7B 2QC2A 1FPCH 1TALA 2OC8A 4Q80A 1BJVA 2OCVB 3A8BA 4I86A 1A3EH 2FXRA 5C20A 2EQNA 3ODDA 3E6PH 2K0QA 1H8HD 1HAVA 1YLDA 4AFQA 1TGBA 3FFGA 1GBMA 1C5UA 3GCNA 1N6XA 4HTCH 1TIOA 4CHAB 3A8AA 1SG8B 1ZJDA 2Q1JA 1C2FA 2QF5A 3MI4A 1ZTJA 3DSOA 3ZIAD 4Q7ZA 4AFZA 5C3NA 1OWDA 1TRNA 2QV1A 1GBLA 2AMQA 3QLPH 1O3GA 3SJOA 1DY9A 4AYYB 4TY6A 1UCYE 5E2PA 4OGYA 1C5ZB 1S0QA 2FOCA 4ABBA 3L6PA 5CHAB 4MQAA 1QZ8A 3U8OH 1GG6B 1QRZA 2J98A 4TPIZ 2C4FH 3GOVB 1L0ZA 4J1YA 1S82A 4KGAA 1BTHH 4IN2A 1XVOA 4DVAU 5EGMA 4K1TA 3TIUA 3I29A 3KCGH 4X8UH 3MTYA 1D4PB 1P03A 5GJ4B 1PPHE 5T6GA 2ZC9H 4ZXXH 5EIYA 2BX3A 3SNAA 5L6NH 1UMAH 1TOMH 2A45B 2DE8A 2OTVA 2W5EA 1O31A 4I8LA 3UR9A 4AFUA 1H9HE 1BTUA 3RXBA 1TE0A 3AVZA 3F6UH 4JMYA 1A3BH 1SGQE 2F9BH 1K1IA 4YESB 3TJOA 3SO3A 4ABDA 2P3TB 1KXAA 1UHBB 4X8TH 2V7QD 1OP0A 3EE7A 3CNRA 1PPGE 1PYTC 5GPIB 4CRFA 1IQNA 1IQMA 4DOQA 3NKKA 1W7XH 1TWXB 1W14U 2JH0D 4Y0YE 2QCYA 3PLPA 1SGDE 1SKYE 1ZYOA 4X0WU 2Q6GA 1D6RA 3HK6B 1EAUA 1YCPH 2STBE 1SFQB 4NIYA 1P02A 1MCTA 1WTHD 1NS3A 1XM1A 2QGRA 1GJ8B 5A8YA 1SLXB 1LO6A 4ACAA 4Z6AH 2ZFPH 3DFLA 1XUFA 2BD4A 2ANMH 2AHME 1BBRK 1DFPA 2F43B 4FUDA 2A5KA 2VVCA 1AZZA 1Y3VA 4Q7YA 1EP6A 4A1TA 4XBDA 3RMMH 1DY8A 3AW1A 3ENSB 3DCLA 2Z3CA 3KGPA 1KXFA 1MTVA 4R8TB 1BMMH 3VXFH 3UPEA 1GI5A 3T29A 1O2SA 2HNTF 4TSFD 5C0TA 1ZTKA 1IHSH 1DXPA 2OP9A 1NRPH 1UTMA 3A83A 3RC6A 1O2MA 3BIVH 2AGIX 1ZPBA 2RA3A 3SV9A 2XRCA 2G5VA 1G3CA 4FUFA 1TNGA 4OS1A 3RLYH 3GCHB 2Y80A 3GCOA 3M5LA 3B9FH 1O38A 1TQ0B 2TBSA 1EPTB 4ACBA 2ZWLH 3URCA 1ETRH 2J94A 1ANBA 4I8JA 3RXFA 2I6QA 2IPHA 4MNVA 1AE8H 2FMJA 1DX5M 5IK2D 1UTLM 3GDVA 2CHAB 2Z9GA 5HM9A 2NU2E 1F5LA 1GHBF 2FS8A 3HPTB 1NO9H 1SGNE 1O2XA 1P05A 1SHYA 2GGVB 2R3YA 3M37A 2XTTB 4DT4A 1CA0B 2JJ2D 5FHTA 2F9PA 2BY9X 3KQDA 1FY8E 2FOEA 3TGJE 4ZCNA 1OP8A 1TMUH 4ZAEA 2ZGJA 1GJBB 2ZFSA 4NZLA 3ZVCA 1ANCA 1L1JA 2BLVA 4FU7A 3ATMA 2JJ1D 1GHZA 2ZU4A 1G3EA 2PGQB 1V2TT 2WINI 3MH4A 1KTTB 3KYGA 2O9QA 1HAOH 1YWUA 1BOQA 1MKXK 4X6PA 1RXPA 2A4OA 5DSFA 1ETSH 2Z9JA 3BG4B 1S6FA 1SL3A 3GDSA 5T1VA 4Q63A 4K2YA 3STIA 4B2CA 1SGYE 1KXCA 4JCNA 1E38B 3M7QA 1T31A 1HAXB 1DSUA 1KY9A 1V2LT 2ZPSA 5DN6D 3F2GA 1K1JA 1MU6B 3GY4A 1CE5A 2SGDE 3M7TA 2AYWA 1AU8A 1F5KU 1ZR0A 1PPFE 3ZZBA 1RS0A 3P8OA 3WY8A 1DICA 1MKWH 4AX9H 2OBQA 1YPEH 7LPRA 2BDYA 1EX3A 3E3TA 3EQ0H 4FUHA 5EXNA 3UREA 4AG2A 1GI2A 2QYIA 4LZ4B 1C5LH 3M7UA 2QF0A 1UJ1A 1FY1A 1KSNA 1JMOH 2V3HH 3KYFA 1WXRA 1HJ8A 2TRMA 1CBWC 2DE9A 2ZA5A 3AAVA 3QZRA 4LZ1H 3SZNA 4B2AA 2QY0B 1GMCF 5EXMA 2GD4B 2C8ZB 1UO6A 3A81A 3PMJA 4DURA 3PO1B 1YCPK 1RIWB 3F1SB 1N8OC 2OBOA 4H4FA 1VR1H 3A82A 2TIOA 2A7JA 3BTWE 2D2DA 1AKSB 1V2KT 5EJLA 3ZVGA 4ESTE 2FZZA 1CGJE 4JZ1A 1ELCA 4DCDA 4MNYA 2W6JD 1K21H 2ANKH 4CRDA 1GBKA 1THSH 2R0KA 1EAIA 2F4LA 3UQOA 5JB8S 1FY4A 4WXVA 4ABFA 2J38A 3ZVAA 2ZDNA 3TK5A 3UY9A 1UW7A 3VEQB 2PKAA 5B6OA 1A61H 4NIXA 1MTUA 3A7XA 1C1TA 1MTSA 1C5MD 2FI3E 1W3CA 2CF9H 1NM6A 2KFWA 1AHTH 2ZF0H 5DP4A 4OS4A 1A5IA 2P59A 4ABAA 1DLKB 3MH7A 2HVXA 3ATWA 1AUTC 2Y5HA 1XUIA 2VJ1A 4OGXA 1Z6EA 2PR3A 3SV6A 1BDAA 4D8NA 1LHGH 1T7CA 3DFJA 1JBUH 4DJZB 1TRMA 1PQAA 1QCPA 1TOCB 4H42U 2UUKB 5FPSA 2QXJA 2HWLB 3NWUA 2XYAA 1G3BA 3V3MA 3TH2H 1KTSB 2CJIA 2UWLA 5LH8A 3F9GA 2A0QB 1K9OE 3SGAE 3IWMA 3FZDA 2FP7B 1ELGA 4AB9A 2WPJS 3LT3A 2ZQ1A 2OD3B 1A46H 4YT6H 4NFFA 4MPWA 4Q2KA 1O3AA 1HLTH 3SOSA 2PV9B 1O39A 4NSVA 4ABIA 5ESBA 1QRXA 3RU4D 1QGFA 3A84A 1CA8B 2P8OC 3S0NA 1Y3YA 4K1SA 1W0YH 1WV7H 3UAIC 2ZFFH 2VIWA 5F53A 2O8TA 1NU7B 3MU1A 2AGGX 3S9CA 4J2YB 1GBCA 2FPZA 1VGCB 3RXQA 4AGJA 1V2VT 2FX6A 3H7TA 1LHCH 3U69H 1NU9A 1EZSC 1FN8A 1XUJA 4IS5A 3ZVBA 4DY7B 5TCCA 2GCHF 3PMAB 2LPRA 1NFXA 1FNIA 4X6OA 1V2WT 4B2BA 5C94A 1HB0B 3S69A 1O3EA 2WV4A 1AUJA 4ZMAH 1Y3XA 3M3TA 1M9UA 1P2MA 2Y5FA 3F3BA 2B0FA 4X8SH 1MBQA 3LC3A 4K5ZA 5E0JA 1WQSA 1MAYA 1E1RD 5DP7A 1K28D 3TNTA 4MG3A 1YPKH 3QUMP 4Y7AA 1TNKA 1C4Y2 3SHAH 9LPRA 1H1BA 4JZFH 1EJNA 1TNIA 3GS9A 3TU7H 3SNCA 1DITH 1C1RA 1W13U 1EQ9A 1ELVA 1D3PB 6GCHF 4XFQA 3ZYDA 1CT0E 5F8XA 1C1WH 2F9UA 3DA9B 3BF6H 1KYNA 1S0RA 2GVFA 3KL6A 1IOEA 5EW1H 2THFB 1X7AC 1QBVH 1NFWA 3K6YA 1VITH 4CBNA 1BQYA 1ZMNA 2Y6TA 4WH6A 1GMCG 4O97A 3ESTA 2JH5D 2YOLA 2FM2A 1GVZA 2GCTC 1TX7A 3RM0H 1BZXE 1Y8TA 1SGTA 1YGCH 2WPHS 3RXJA 5ABWA 3S9AA 1ZSJA 3OTJE 5TJXA 1ELDE 1C4U2 1THPB 3T27A 3N7OA 3RXCA 1ZRKA 1L4ZA 2BDAA 1BMFD 3K2UA 4GHQA 3SI3H 1LMWB 1C5XB 3F9FA 2TGPZ 3SQEE 4JYUH 2H5DA 1UVUH 3SJKA 3LIWA 1NBME 1ESAA 3O8RA 4WMFA 2VWOA 4CREA 4I7YH 2HRVA 3GISB 2UUJB 2FI5E 2LELA 3VB3A 3QDZB 2EI7A 3GCHC 1P3EA 4X1QU 3TNSA 1MTWA 2P3UB 4K69A 1DM4B 1OP2A 1HXFH 2BD8A 4KTUA 3ITIA 2F9OA 1C2GA 1Y3UA 3GCTF 5EJ1A 1P12E 1EJAA 1O2QA 1UK2A 4B76A 3SU1A 2CHAC 1ELBA 2WYGA 1MUEB 2XC5A 2HPQH 4AG1A 4YM9A 2KAIB 1C9TA 4MPUA 3SI4H 4BAOB 5FCRA 3SU4A 3MYWA 2A4RA 4WVPE 1QJ7B 2WYJA 2ZHQH 1H8ED 1NN6A 4FU8A 3QGNB 2SFAA 1ZSLA 1BRBE 2FLBH 4D76A 5GIBA 5GXPA 4U32A 1C5RA 2ZHFH 5FXLA 3VB4A 1LPZB 4GAWA 2FO9A 8GCHF 1GI8B 1O3HA 1WUNH 4YLQH 1XUGA 1UK3A 3BG4C 1Z1JA 2C8YB 1SMFE 3BTQE 1CSOE 1GVKB 5T6DA 1F2SE 4Q4LA 3LKWA 3RXMA 2BVXH 1G2MA 1Z8GA 1QIXB 4YXWD 2ZTZA 1E35B 3AK5A 3PRBA 3U9AH 1GJ5H 3M35A 5C5OA 1QJ6B 1SGCA 5C5NA 1ID5H 3M5MA 2RFKC 4FUJA 3SZEA 5A09A 5HKKD 4BAMB 2BLOA 2BQWB 3DHKH 1P01A 2PSYA 1D6WA 3SU5A 1FAKH 1OOKB 1SQAA 3A89A 6CHAC 5FPTA 2EC9H 1Y5AT 1P3CA 2G52A 1AGJA 2VINA 3KQEA 2PWXA 3PMBB 3PO1C 2EY4C 1RIWC 4OM9A 5K7RA 1AE5A 1AO5A 4UFDH 2GCHG 1EFRD 1O3CA 5IDKA 1JRSA 5ETXA 8LPRA 2UWOA 4WF8A 5FL7D 5A0BA 1ZSKA 3MO3A 4Y8YA 1UTQA 2FEQH 3SU6A 3Q00A 4CRBA 1GI0A 2VIDA 4X1PU 1DWEH 3A8DA 2R0LA 3BEIB 3LJJA 1GJ9B 3QGJA 1HAVB 2QE7D 1SGFG 2AFQB 1SVPA 2A2XH 4XSKU 1O2PA 1P2OA 2A7HA 3CP7A 1V2RT 1UK4A 5DP3A 4CR9A 1BBRE 6GCHG 1G30B 2P94A 2HPPH 1WTGH 3H5CB 1O5GH 3VXEH 3U1IB 3HKJB 3ZYEA 2UWPA 5FX6A 2ALPA 1TGSZ 1GBFA 2W7UA 4R0IA 1GWAA 1O2RA 4JZIA 3HKIB 1GMHF 2FTMA 2ZFRH 2Z94A 2AMPA 2IN2A 2LIZA 2J9NA 1YBWA 1K1OA 1FIWA 2AIQA 3RUOA 1D3DB 1EUFA 2WV5A 3LH3A 2J98B 5J4SA 1GBHA 2ZHWH 3FANA 2Z9IA 1UTNA 1V2PT 4A92A 1IQKA 4F48B 2K7XA 2F3CE 2ZTXA 2FOAA 5DKMA 1SSXA 1NRNH 4IGDA 3ZZAA 1P9SA 4TWWA 1S84A 1BMAA 2G5NA 4BANB 2P8OB 2XNIA 1J9CH 2BDGA 2BD2A 4NIVA 4FU9A 3MQKC 4BXSA 4NCYA 5I25A 3A87A 1MKXH 4P02A 3TH3H 2XXLA 1C1UH 4IC5A 3RXHA 1WQVH 2NU0E 3ODFA 4BTIB 1TX6A 5AHGH 3F68H 1B5GH 3P95A 1PPBH 2XWBI 3EGKH 4X1SU 1BT7A 1AMHA 3GCTG 3FO8D 4GVUA 1E79D 1HPGA 2JDID 2ZKSA 4ZHMU 1JIRA 3T25A 4K8BA 3T5FH 1ANDA 3RXRA 4IC6A 4YZUA 3MHWU 3TPIZ 1E34B 1FAXA 1VGCC 3ZV9A 1ZHMA 1C2HA 2XCFA 2C90B 1IAUA 1C5WB 3GY7A 1GBDA 4O3UA 1EZXC 4ZKSU 5EOKA 4BTTB 2CV3A 2ZDAH 3SUGA 3SV7A 2GP9B 1UTKA 1O2WA 3FP7E 1MBMA 1GJ6A 3SNBA 4HFPB 1LVMA 1TA2A 3BTFE 1QR3E 1OSSA 1GI4A 1B0EA 1FZZA 4IMQA 2HVYB 4XD7D 8KME2 2W7SA 1HGTH 1V2JT 1EOLA 5C1XA 8GCHG 1HYLA 1GJ7B 1MQ5A 2ZFTA 4ABGA 1RD3B 3OAAD 3QX5H 2PW8H 4ZKNU 2H9EH 3LU9B 5A2MH 1HAHH 2H6MA 2Z6BD 2JIZD 3K65B 2JH6D 1AD8H 3LDXH 2ZU3A 3GDUA 5IYTA 4ZHLU 1C2DA 3H09A 3MNBA 3N7EA 3N7DA 4Y7BA 1QTFA 3URDA 1A1RA 3UTUH 1K22H 2VVVA 2VU8E 4Q7XA 5LPFA 2BX4A 1AI8H 2GCTB 1O2TA 1GHYH 4K60A 2W3IA 4TY7A 3RU4T 1FLEE 2BOHB 3ZVEA 2G00A 1TA6A 3I78A 1RTFB 3RC4A 1XXDA 4ASHA 5GCHF 3EBNA 4XBBA 3MH5A 1O2GH 1C1NA 1O3LA 1RGQA 4OS2A 4WJG2 4ZH8A 3EDXB 3NPSA 1GJDB 1S81A 1O5AB 4Y0ZE 2R2WU 2IOTA 1LTOA 3VB6A 1O5EH 1TGNA 3SNEA 5C1YA 3HATH 5AVDA 1YCPM 2K8IA 2GMTC 2GJGA 3WWFA 2BM2A 1NFYA 1O2LA 3GYMA 4YT7H 2WPDD 1O3FA 4O03A 1CVWH 1KDQA 1BCUH 4HGCA 3P17H 1AWHB 2ZDLA 1EZUC 1NROH 1PQ5A 1HRTH 2A7CA 1WBGB 3V7TA 1JOUB 2F83A 3F2FA 2VB0A 3A7WA 1AQ7A 5F8TA 1C2MA 2ZGXH 2BQ7B 2BXTH 2QXGA 4FUCA 3SJ9A 1OKXA 1MQ6A 1BUIA 1C5PA 1BTXA 3AASA 2EI6A 4Y6DA 1O3MA 2SGEE 2ZO3H 4SGBE 1P04A 5HMAA 4BAQB 5JYIA 2BHGA 3UOPA 2A4GA 1GMHG 2C8XB 1OYTH 4UDWH 4AZ2B 4D7FA 1EPTA 2IJD1 5KGOA 4B71A 2DUCA 1DS2E 2IJOB 1O0DH 1ARBA 4Y8ZA 2ZPRA 1TNLA 4CH8B 1ZPZA 3FP8E 1BTYA 1CU1A 5JBBS 1A0HB 1O3DA 5E0HA 3SV2H 1BB0B 2Y7ZA 2GT7A 4CRAA 2J34A 1F5RA 3QZQA 4FVBA 2ZCLP 1GMDF 4K1EA 5DO4H 1BTZA 1YPMH 3VFEA 1QURH 1TGTA 2AERH 1XXFA 2ZZUH 3RXPA 3PTNA 1SLVB 2B5TB 3NZIA 3LGWA 5E0GA 1TLDA 1ZGVA 3RXUA 4CRCA 3DSPA 4RKOB 1IQEA 5EW2H 5DG6A 4ABEA 3P8NA 1C2IA 3TJVA 6CHAB 2FYQA 3RLWH 4Z1MD 3M36A 1XUKA 4X8VH 2Y7XA 1SI5H 4CBOA 4B73A 1J14A 2KZ4A 3BIUH 3SGQE 1W0ZU 1NT1A 1P2JA 4HZHA 1L1NA 2VWMA 2KX4A 2BDIA 2VGCC 2ZGHA 5EG4A 1QB1A 3MU5A 4FUBA 1LHEH 3TLOA 1QNJA 2PKAB 4I8HA 3GY5A 3E1XB 4MDSA 1ELEE 3IITA 3PV2A 4IN1A 1IQJA 1TPAE 4FETA 4GHTA 4WY3A 6ESTA 2PUXB 1TBQH 3EA7A 1C5YB 5C67A 2C3SA 3D49H 3RU4E 1S85A 1CHOF 2FS9A 2NU4E 5F6MA 1IQIA 3TH4H 3PLKA 1O36A 4D9QA 2FIRH 3FAOA 3KQ5A 1G37A 1TPPA 2KM0A 1K1PA 3WW7A 3LOXA 3D23A 4AORA 2Z9LA 1LQEA 4RT0A 2VWNA 3D62A 3O8BA 4A5TS 4NSYA 1GDNA 3S7KB 4UEHH 2H9TH 1C5QA 5A0AE 1A0JA 1O2UA 2WPKS 2KR7A 3VGCB 4ISLA 1LPKB 4YOJA 3F9EA 1PPEE 4UE7H 5I46H 3OY5U 4CR5A 1GBAA 2AIPA 3GYLB 3Q3YA 1TNHA 4INKA 2BOKA 1TYNA 2O8WA 1C2EA 1O3IA 3QN7A 2BY6X 5EJZA 5GCHG 2Z3EA 1H4WA 4NWKA 2C8WB 1OYQA 3PROA 2HALA 5EPNA 4E05H 1G2LA 2QN5T 4MPVA 2ZU5A 5CHBA 3U8RH 2ZPQA 1VZQH 3SHCH 1XKAC 1EASA 2W3KA 2Z9KA 2D26C 2AMDA 1DDJA 5CMXH 4MNXA 3QK1A 3UIRA 2JKHA 2XCNA 3UWJH 3UUZA 1LDTT 3RMNH 3RXKA 2Z3DA 2ZCKP 1C1QA 1V3XA 3MNXA 3Q76A 5C2ZA 1NRSH 4XOJA 1EOJA 1AN1E 1OS8A 2KCPA 1SOZA 1YYY1 2CXVA 1EATA 4Y10E 2GV6A 2J5UA 2J2UA 1GGDC 2IPQX 1TPOA 2LP6A 2WPLS 4I31A 3NRLA 1GBEA 1ZLRA 3PMHB 2SGQE 1GHVH 1KXDA 1XUHA 2SGAA 1NFUA 3TITA 4M9FA 3BTME 1FONA 3MU4A 3L33A 1OHHD 5PTPA 1FY5A 2OC0A 2V35A 1GI1A 2OINA 5JDUB 1NY22 1O2JA 1Z1IA 1Q31A 2GT8A 1GDUA 1E36B 1TFXA 3SV8A 1O37A 2BZ6H 3SUDA 5DJ7A 1C5SA 1BJUA 1SGIB 3BTEE 1A5HA 1UVOA 3MO9A 3RXDA 4ZHAA 1AIXH 5K0HA 1QB6A 4NA9H 4WH8A 3QTOH 3GY6A 1YLCA 3DD2H 5AF9H 1GMDG 4ISNA 5GNDA 1LQDB 4KTSA 2L74A 3T2NA 2O8UA 1FI8A 4NA8A 4AFSA 1F92A 2TGTA 1PJPA 1MD7A 2ZCHP 3U28C 3A7YA 1ORFA 2BDHA 1KXEA 1G9IE 2A5IA 2B8OH 1ESBA 1ZGIA 1HDTH 2FX4A 2G4TA 4NA7A 4U2WA 1XVMA 2OXSA 3OY6U 1TBZH 3NCLA 3SU2A 2ANYA 4CH2B 1L2EA 2NU1E 2HLCA 3PLBA 1GBBA 1GDQA 3E8LA 2HGTH 3STJA 2GMTB 4KTCA 1UTOA 2XBYA 4GLYA 4XBCA 1P0SH 1HJAC 8ESTE 1S6LA 3SJ8A 2VWLA 3L3TA 1W2KH 2BQ6B 2M5TA 2O8LA 2Z7FE 4ABHA 1O2HA 2QF3A 2OUAA 3P92A 2XC0A 2RDLA 1Z8JB 2F91A 3NUMA 1O2IA 1B7XB 1GCTB 1PPCE 2BXUH 3TGIE 3BEUA 1CT4E 1D3TB 1HIAA 5H4IB 2EA3A 1GJAB 3RC5A 1CHOG 4I33A 1EZQA 2R3UA 2BZAA 3RXSA 1OWHA 4M7GA 1GHAF 3B8JA 4BTUB 3BTHE 2EI8A 2NWNA 2ZI2H 3A85A 1ELFA 1HAIH 2P93A 2ZQ2A 2ZG0H 1GVLA 1GPZA 3RP2A 3PV5A 4INHA 4THNH 1ZHRA 1C2KA 4O9VA 4IBLH 3MU0A 2FOBA 1IHTH 4JYTA 1L1GA 3MWIU 1SGFA 1G32B 1GJ4H 3SU0A 5EPYA 1NZQH 4H6SB 1O3KA 2FOFA 1J16A 3UB0A 1A0LA 1PQ7A 2ZIQH 1SGPE 1BTWA 1MTNC 3MO6A 2Y82A 2CMYA 2PP6A 1UVPA 3AAUA 4GPGA 5C0UA 1QY6A 3PTBA 4XRNA 1C1OA 5F03A 2KAIA 3SNDA 1E37B 3DUXH 2W6ID 4OS5A 1YKTA 3A8CA 1O2YA 4YLUA 1LVOA 1DVAH 2GZ9A 2OQUA 5DP9A 2AS9A 1AFQB 4X6MA 2RG3A 2H2ZA 3VPKA 2Q6FA 2VGCB 2F9VA 1CGIE 2TGAA 1ABJH 3P6ZB 1VKYA 2YMSC 4IW4E 3VB5A 3QTVH 2UUFB 2VIQA 4UFFH 3EYDA 1C1SA 3ZZ6A 1BIOA 1N6YA 3K9XB 2FWWA 3ELAH 4X6NA 3BV9B 1TPSA 3LGIA 4XE4A 4Y79A 1ANEA 2WV9A 3BEFB 3LGUA 1THRH 2V3OH 2FYRA 3K6ZA 3TGKE 4NIWA 2HNTE 4JYVH 1YPJH 4JK5A 1CGHA 5GDSH 3W94A 3TK6A 5FBIA 3E0PB 1YLNA 1AVXA 4KKDA 2WUBA 3FKSD 1GL1A 1V2NT 2XOKD 4OS7A 5FX5A 1G3DA 1OWIA 1TBRH 3A7TA 3BN9A 3F0PA 4A7IB 4AOQA 4HG6A 1OWJA 1C1PA 3O8DA 2GKVE 4Y71A 4WMEA 4GCHF 2PKSB 1GI9B 3SYJA 2G4UA 5KECA 3CENA 5HIZA 1UCYH 4RSPA 1YP9A 3M5NA 1ZTLA 3RXEA 1WDIA 3VGCC 1P11E 3EAJA 4ISHH 1ESTA 3U98H 4TWYA 1DUEA 1Y5BT 1MD8A 1W0JD 4VGCB 4X2XA 3SORA 1ARCA 1EB1H 2BDCA 1E0FD 1LHDH 2XNDD 1LVYA 2RDEA 3Q3KA 1H9IE 1C9PA 3GICB 4TPYA 1C5VA 1QQ4A 1QQUA 2XBWA 1DWBH 4WMDA 4A1VA 4UONA 3M61U 5EQSA 3OTPA 3LGYA 4LK4A 4ZUHA 1T4UH 1VJAU 5LPEA 1SFIA 2C93B 3U1JB 1WU1A 4X1RU 1VITF 1DUAA 1Y3WA 1C1MA 4FUGA 1O3OA 2G51A 4FVDA 1DWDH 4ASUD 4YOGA 4I32A 3UFAA 1FJSA 1QL7A 3Q3XA
chains in the Genus database with same CATH topology
4A1XA 1P9UA 3E91A 3PV4A 2XC4A 1O3JA 1QL9A 2BD9A 1GGDB 5BPEA 3SU3A 2BMGB 2W26A 3P70B 5LGOA 5DK1A 3ZV8A 5JBCS 1GHAG 4NG9H 1QA7A 1ZMLA 2BB4A 5EQRA 5T3HA 5C1UA 4YOIA 5SGAE 2PHBA 1DWCH 2PFEA 1V2QT 1YPHC 1YF4A 3ATLA 1EXFA 1K1NA 1DANH 3F9HA 1RTLA 2BD7A 1H9LB 3FVFB 4X2WA 1LVBA 1ZPCA 2GTBA 4SGAE 1MZDA 3RMLH 5HGGA 1H8DH 5T6FA 4Z0KA 2VNTA 1NRRH 2EEKA 4B74A 2D8WA 2BVRH 3I77A 1TX8A 4BOHA 1DE7H 1GHWH 4DIHH 1VCPA 1WAYB 4B1TA 1J17T 3SUFA 1BTPA 1Z8RA 2A31A 4WWYA 5L2ZH 2FI4E 5DPAA 4I8KA 1T32A 1BRCE 3UOUA 1YPHE 4D9RA 1UHBA 2STAE 3ZZ9A 2J95A 1XMNB 1TABE 5HM2A 1TAWA 3MH6A 1LKAA 1CQQA 1MZAA 1TMBH 1C4V2 1NTPA 1QHRB 3T62A 2WPIS 1HV7A 2P95A 4X1NU 2QIQA 1TNJA 3G01A 1BMNH 1DXWA 1G36A 1HJAB 1NC6A 2BY5X 2FODA 2PTCE 3ZZCA 1GBIA 2CGAA 3KEEA 1KDQB 3EA9A 5E2OA 1YC0A 3TJUA 2FDAA 1LHFH 4MNWA 1HAGE 1O32A 4BAHB 5J4QA 2PUQH 1LCYA 4ABJA 2ODYB 2YNBA 3JZ1B 5FCKA 1O2NA 1S5SA 4NGAH 1O34A 2OC7A 2ALVA 3V12A 5HYOA 3A86A 1UCYK 3VB7A 3KHVA 3A88A 4X2YA 1FMGA 1HUTH 2BY8X 1FXYA 3PB1E 5DP8A 1ZZZA 4MPXA 1PFXC 1HAPH 3UWIA 4Y11E 1GCTC 2VIVA 3GY2A 3ZZ4A 1PQ8A 4AB8A 3RMOH 3ATIA 2OC1A 1O3PB 4H6TA 2FOGA 5DP5A 2ODPA 2RA0A 2JETC 1MAXA 3Q77A 4U01A 4TYDA 4Y8XA 1C5NH 1T8MA 1SPJA 1F0RA 3C1KA 4GCHG 2PGBB 1MCVA 4FUIA 3R3GB 4ISOA 1P8VC 1V2UT 1ZHPA 2P16A 1O2KA 1O2VA 2ZDKA 3ZZ7A 1BRUP 1C1VH 1MTNB 2OQ5A 3ZZDA 1PYTD 2FESH 2ZECA 2BD5A 2ESTE 3MMGA 1SC8U 3SW2B 2OLGA 3CS7A 4UFEH 4X2VA 3M3VA 3ZZ8A 1QJ1B 2ZHEH 1C5OH 1TRYA 7KMEH 3SQHE 3MFJA 1S83A 1IQFA 1NESE 3RM2H 1JWTA 1EAXA 2PTNA 3RXAA 1GHXH 1SGEE 4K3JA 1FIZA 1VITG 5DGJA 2A2QH 3E90B 4ZKOU 2GDEH 1UTJA 2UUYA 2AGEX 1HAYB 1UVSH 2VIPA 4LXBH 1SOTA 3NXPA 2ZHDA 3LJOA 1J8AA 2G81E 1L4DA 1AFQC 1FUJA 1AFEH 3MNCA 3RXIA 4BXWA 4MLFB 4UD9H 1P09A 5BRRE 4Y76A 2QXHA 3BTGE 1BRAA 1YM0A 4CRGA 3OSYA 2XW9A 3A7ZA 3CS0A 2SNVA 2ZDVH 2R9PA 1ZRBA 2VIOA 1OPHB 4YTAA 1KIGH 1TGCA 1FPHH 4BAKB 1O30A 1TONA 4I8GA 2ZU2A 3LH1A 1RTKA 2HOBA 1INCA 1ELTA 1SGRE 1O5DH 4RN6A 3RXLA 1AB9B 4ZXYH 1P57B 3EE0B 1W12U 3BTDE 3KNXA 3M3SA 3RXGA 1A5GH 1AVGH 4KELA 3U8TH 4DG4A 4DT7B 4PROA 5EODA 2H1UA 2ODQA 2A32A 1AKSA 1SQOA 1EKBB 4E06H 3TVJB 3A7VA 5JBAS 1K1LA 1MMJN 2G55A 4RKJB 3KF2A 1QL8A 2ZP0H 5TCAA 1C5TA 3PYHA 1QRWA 3LPRA 2BLWA 5A8XA 2PKSC 1S6HA 1D9IA 3IG6B 7GCHF 2O8MA 1IQHA 3AW0A 2D1JA 1IQGA 1QB9A 1UTPA 3PWBA 4NFEA 3RXTA 3HK3B 1HAZB 4JZDH 4VGCC 2ZNKH 2P3FH 3GY3A 2ZGBH 3PWCA 1SHHB 3LGVA 3HGPA 1GJCB 2BDBA 1GI3A 5GWZA 3KQBA 5EXLA 2PLXA 4CHAC 1SBWA 3LGTA 1NPMA 1Z7KA 5L30H 1QBOA 2SGPE 3O8CA 3S7HB 1Y59T 5EQQA 3ATKA 4AYVB 3RDZA 5FAHA 5LPRA 1DT2A 2A1DB 2WUCA 1IQLA 2PSXA 1O35A 1P2NA 2ZDMA 2VH0A 1D3QB 1FY3A 5HXFA 1JIMA 5CHAC 1KLJH 2J92A 2ZEBA 2ILNA 2GX4A 2GZ7A 1ZMJA 1GG6C 2XWAA 2BYAX 4JZEH 2WPMS 1A2CH 1O5BB 2FOHA 1NRQH 2TPIZ 2GV7A 1P10A 1WYKA 4DIIH 1W11U 2SGFE 4DGJA 3DT0H 1AVWA 5JBTA 1O3BA 1QBNA 1FN6A 2B7DH 3P8FA 1SLWB 1A7SA 3ZZ3A 1HXEH 2Y5GA 4B75A 2QA9E 2H5CA 5EU8A 1GHBG 2SNWA 4AGKA 3UQVA 1LKBA 2ZFQH 3OYPA 1YPLH 3TJNA 5JPMH 3JZ2B 3RXVA 1DLEA 1MKWK 2FLRH 5A0CA 4WXIA 1FV9A 1OXGA 2ANWA 2Y81A 3MU8A 2AEIH 3SBKA 1SR5C 1VJ9U 1C2LA 1O33A 1YPGH 1W7GH 1O5CB 3C27B 5ESTE 3KIDU 2CN0H 3BTTE 1T8LA 1VCWA 4U30A 3SN8A 2K1QA 3UNRA 3B23B 1HNEE 3HGNA 2RCEA 1V6DA 2ASUB 4FUEA 2XBVA 1HJ9A 2H9HA 2V6NA 3BG8A 1QA0A 4MVNA 4FXGH 2YNAA 1EB2A 2BVSH 2ZTYA 4MTBA 1K1MA 1EJMA 1Z6JH 3UR6A 2XBXA 2BD3A 5AFZH 4BNRA 4F49A 1FQ3A 2LNCA 5DP6A 1HIAB 3D65E 1KLIH 1J15A 1GBJA 4NWLA 3H7OA 1T8NA 1P2IA 3T26A 1Y5UT 2ULLA 1U6QA 1H8IH 1QFKH 1F7ZA 3UNSA 5FBEA 2JETB 3GY8A 1W8BH 1Z8IB 1F0TA 1WSSH 2V0BA 1BITA 3SJIA 1Q3XA 3FZZA 1W10U 1V2MT 3E0NB 2VVUA 7ESTE 3BTKE 3P8GA 4YO9A 2ZGCA 3RXOA 4K8YA 4E7RG 1C2JA 2NU3E 1BMLA 1EPTC 2QAAA 3T28A 5E8EH 1HFDA 3ZVDA 2ZU1A 5AFYH 1GI6A 1BHXF 1GI7B 1MH0A 1P2KA 1GCDA 1DPOA 3FP6E 4HI3A 2GZ8A 1XKBC 2G8TA 2GDDA 3A80A 1F0UA 1WCZA 7GCHG 1RRKA 1DSTA 4JK6A 6LPRA 1RJXB 1O2ZA 1O5FH 1A4WH 2B9LA 1ACBE 4ZKRU 4QT8C 1KLTA 1KXBA 3NK8A 4A6LA 1CA0C 4ZROA 1ZOMA 1O3NA 3UNQA 4AN7A 3E16B 1CO7E 1PPZA 3LONA 1B0FA 4O3TA 2AH4X 3ZVFA 4IMZA 1CHGA 4KP0A 1HBTH 4D7GA 3OX7U 5FPYA 1AY6H 2HNTC 2A4QA 3MOCA 1Q2WA 5G4BA 3OU0A 1V2ST 2A5AA 4NZQA 1ABIH 1DOJA 1BA8B 1JXPA 3QWCH 1FDPA 1TMTH 1AWFH 2VH6A 1CBWB 1LPGB 1ZJKA 9ESTA 4GUXA 1V2OT 3M5OA 3ZZ5A 3MNSA 4ISIH 1SLUB 5F8ZA 3PM3A 1EAWA 1T8OA 4XDEA 2I6SA 5JB9S 3BSQA 3KN2A 1BHXB 5A8ZA 1OWKA 1T4VH 1JRTA 2R2MB 5L2YH 1N8OB 4LOYH 1TB6H 2QXIA 1AZ8A 3LC5A 3SGBE 4E7NA 3S9BA 3KQCA 3SUEA 1HCGA 2BTCE 1SB1H 2FOMB 1EP5A 3R0FA 1ELAA 1F0SA 1N1LA 2BY7X 2F9NA 1Z71A 3EA8A 2CF8H 1CT2E 3V13A 4DW2U 1K2I1 1BBRH 4INLA 1GL0E 2FTLE 3QO6A 1ETTH 1VCQA 2TGDA 1OWEA 3TK9A 1SQTA 2Q6DA 1P06A 2J4IA 5CE1A 1AB9C 4OS6A 3W95A 4UFGH 1P2QA 1OX1A 4GSOA 1GBTA 1UVTH 3V0XA 1MU8B 1RFNA 1XX9A 1WOFA 1O2OA 2BLQA 4F4OC 1TQ7B 2QC2A 1FPCH 1TALA 2OC8A 4Q80A 1BJVA 2OCVB 3A8BA 1A3EH 2FXRA 5C20A 3ODDA 3E6PH 1HAVA 1YLDA 4AFQA 1TGBA 3FFGA 1GBMA 1C5UA 3GCNA 1N6XA 4HTCH 1TIOA 4CHAB 3A8AA 1SG8B 1ZJDA 2Q1JA 1C2FA 3MI4A 1ZTJA 4Q7ZA 4AFZA 5C3NA 1OWDA 1TRNA 2QV1A 1GBLA 2AMQA 3QLPH 1O3GA 3SJOA 1DY9A 4AYYB 4TY6A 1UCYE 5E2PA 4OGYA 1C5ZB 1S0QA 2FOCA 4ABBA 3L6PA 5CHAB 4MQAA 3U8OH 1GG6B 1QRZA 4TPIZ 2C4FH 3GOVB 1L0ZA 4J1YA 1S82A 4KGAA 1BTHH 4IN2A 1XVOA 4DVAU 5EGMA 4K1TA 3TIUA 3I29A 3KCGH 4X8UH 3MTYA 1D4PB 1P03A 5GJ4B 1PPHE 5T6GA 2ZC9H 4ZXXH 2BX3A 3SNAA 5L6NH 1UMAH 1TOMH 2A45B 2DE8A 2OTVA 2W5EA 1O31A 4I8LA 3UR9A 4AFUA 1H9HE 1BTUA 3RXBA 1TE0A 3AVZA 3F6UH 4JMYA 1A3BH 1SGQE 2F9BH 1K1IA 4YESB 3TJOA 3SO3A 4ABDA 2P3TB 1KXAA 1UHBB 4X8TH 1OP0A 1PPGE 1PYTC 5GPIB 4CRFA 1IQNA 1IQMA 4DOQA 3NKKA 1W7XH 1TWXB 1W14U 2JH0D 4Y0YE 2QCYA 3PLPA 1SGDE 1ZYOA 4X0WU 2Q6GA 1D6RA 3HK6B 1EAUA 1YCPH 2STBE 1SFQB 4NIYA 1P02A 1MCTA 1WTHD 1NS3A 1XM1A 2QGRA 1GJ8B 5A8YA 1SLXB 1LO6A 4Z6AH 2ZFPH 3DFLA 1XUFA 2BD4A 2ANMH 1BBRK 1DFPA 4FUDA 2A5KA 2VVCA 1AZZA 1Y3VA 4Q7YA 1EP6A 4A1TA 4XBDA 3RMMH 1DY8A 3AW1A 3ENSB 2Z3CA 3KGPA 1KXFA 1MTVA 4R8TB 1BMMH 3VXFH 3UPEA 1GI5A 3T29A 1O2SA 2HNTF 1ZTKA 1IHSH 1DXPA 2OP9A 1NRPH 1UTMA 3A83A 3RC6A 1O2MA 3BIVH 2AGIX 1ZPBA 2RA3A 3SV9A 2XRCA 2G5VA 1G3CA 4FUFA 1TNGA 4OS1A 3RLYH 3GCHB 2Y80A 3GCOA 3M5LA 3B9FH 1O38A 1TQ0B 2TBSA 1EPTB 2ZWLH 3URCA 1ETRH 2J94A 1ANBA 4I8JA 3RXFA 2I6QA 2IPHA 4MNVA 1AE8H 2FMJA 1DX5M 1UTLM 3GDVA 2CHAB 2Z9GA 5HM9A 2NU2E 1F5LA 1GHBF 2FS8A 3HPTB 1NO9H 1SGNE 1O2XA 1P05A 1SHYA 2GGVB 2R3YA 3M37A 2XTTB 1CA0B 5FHTA 2F9PA 2BY9X 3KQDA 1FY8E 2FOEA 3TGJE 1OP8A 1TMUH 4ZAEA 2ZGJA 1GJBB 2ZFSA 4NZLA 3ZVCA 1ANCA 1L1JA 2BLVA 4FU7A 3ATMA 1GHZA 2ZU4A 1G3EA 2PGQB 1V2TT 2WINI 3MH4A 1KTTB 2O9QA 1HAOH 1BOQA 1MKXK 4X6PA 1RXPA 2A4OA 1ETSH 2Z9JA 3BG4B 1S6FA 1SL3A 3GDSA 3STIA 4B2CA 4K2YA 1SGYE 1KXCA 4JCNA 1E38B 3M7QA 1T31A 1HAXB 1DSUA 1KY9A 1V2LT 2ZPSA 1K1JA 1MU6B 3GY4A 1CE5A 2SGDE 3M7TA 2AYWA 1AU8A 1F5KU 1ZR0A 1PPFE 3ZZBA 1RS0A 3P8OA 3WY8A 1DICA 1MKWH 4AX9H 2OBQA 1YPEH 7LPRA 2BDYA 1EX3A 3E3TA 3EQ0H 4FUHA 5EXNA 3UREA 4AG2A 1GI2A 2QYIA 4LZ4B 1C5LH 3M7UA 2QF0A 1UJ1A 1FY1A 1KSNA 1JMOH 2V3HH 1HJ8A 2TRMA 1CBWC 2DE9A 2ZA5A 3AAVA 3QZRA 4LZ1H 3SZNA 4B2AA 2QY0B 1GMCF 5EXMA 2GD4B 2C8ZB 1UO6A 3A81A 3PMJA 4DURA 3PO1B 1YCPK 1RIWB 3F1SB 1N8OC 2OBOA 4H4FA 1VR1H 3A82A 2TIOA 2A7JA 3BTWE 2D2DA 1AKSB 1V2KT 3ZVGA 4ESTE 2FZZA 1CGJE 4JZ1A 1ELCA 4DCDA 4MNYA 1K21H 2ANKH 4CRDA 1GBKA 1THSH 2R0KA 1EAIA 3UQOA 5JB8S 1FY4A 4WXVA 4ABFA 2J38A 3ZVAA 2ZDNA 3TK5A 3UY9A 3VEQB 2PKAA 5B6OA 1A61H 4NIXA 1MTUA 3A7XA 1C1TA 1MTSA 1C5MD 2FI3E 1W3CA 2CF9H 1NM6A 1AHTH 2ZF0H 5DP4A 4OS4A 1A5IA 2P59A 4ABAA 1DLKB 3MH7A 2HVXA 3ATWA 1AUTC 2Y5HA 1XUIA 2VJ1A 4OGXA 1Z6EA 2PR3A 3SV6A 1BDAA 4D8NA 1LHGH 1T7CA 3DFJA 1JBUH 4DJZB 1TRMA 1PQAA 1QCPA 1TOCB 4H42U 2UUKB 5FPSA 2QXJA 2HWLB 3NWUA 2XYAA 1G3BA 3V3MA 3TH2H 1KTSB 2CJIA 2UWLA 5LH8A 3F9GA 2A0QB 1K9OE 3SGAE 3IWMA 3FZDA 2FP7B 1ELGA 4AB9A 2WPJS 3LT3A 2ZQ1A 2OD3B 1A46H 4YT6H 4NFFA 4MPWA 4Q2KA 1O3AA 1HLTH 3SOSA 2PV9B 1O39A 4NSVA 4ABIA 5ESBA 1QRXA 3RU4D 1QGFA 3A84A 1CA8B 2P8OC 3S0NA 1Y3YA 4K1SA 1W0YH 1WV7H 2ZFFH 2VIWA 2O8TA