2FI3E

Crystal structure of a bpti variant (cys14->ser, cys38->ser) in complex with trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Functional and structural roles of the Cys14-Cys38 disulfide of bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
source organism Bos taurus
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi3E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi3E02
1TMTH 3A8CA 1BJVA 1DS2E 2BX3A 2ZQ2A 4D8NA 3E90B 1BIOA 1MKXH 1ELAA 2P94A 1MQ6A 1C5WB 1OP0A 1NFUA 1MUEB 1EUFA 2HPPH 3L3TA 1L4ZA 2UWPA 2PFEA 1HAHH 1AUTC 1PPCE 1FAKH 2A45B 2TGAA 1T32A 4YOGA 4H4FA 5A8XA 1OOKB 3BEIB 1OX1A 1C9TA 1LVOA 2ZHQH 3LU9B 1QURH 5FPSA 4AORA 5GIBA 4DT7B 1VITF 2ZGCA 1F5RA 3MNXA 3O8CA 4J2YB 3RXFA 1O2ZA 5F6MA 1BHXF 1F7ZA 5DGJA 1FY5A 1Z8GA 1DLKB 2ZCHP 1EB2A 5GDSH 3O8RA 2HALA 1T4VH 1U6QA 4O97A 1G3DA 2B8OH 2XBYA 5CMXH 1C5UA 1UHBB 1ZTLA 3P8NA 5T6FA 1C1TA 1O5BB 5HMAA 3HGNA 5JPMH 1QFKH 2WV4A 3V7TA 1HB0B 1O33A 2ANWA 3BG4B 2ZDMA 2O8MA 1MCTA 1C5ZB 3K9XB 1WUNH 4K69A 1INCA 3FZDA 3BG8A 1G2LA 2A0QB 2ZFSA 2BDGA 3VB5A 2QCYA 4RKJB 4GUXA 3BTFE 1J14A 1W10U 3ZVGA 4FU9A 3VXFH 2BDCA 3ATWA 4GCHG 1RIWC 1DANH 4CH8B 1IQKA 1CQQA 2ZU5A 3ZZAA 1BUIA 3CS7A 2BD4A 3RXKA 1QJ1B 1MBMA 1E0FD 4UD9H 2AERH 3T26A 1PPBH 3UNQA 1ID5H 1YLDA 5T6DA 1GHWH 1Y5UT 2QV1A 2Z3DA 2WPLS 4U01A 3W95A 2PSXA 3M5NA 1C2EA 2Y81A 1GJBB 1AQ7A 1HGTH 2G00A 4Y7BA 2R3YA 3IITA 1L4DA 4GAWA 4BANB 1P9UA 1C2GA 1H9LB 4KTCA 2FS9A 4KELA 4CHAC 3HKIB 3I29A 1CBWC 1P57B 2P8OB 3M35A 3TK6A 2H9TH 5GCHF 1C1RA 5C1XA 3GY3A 3BSQA 1QNJA 1AD8H 2STBE 3PTNA 4BAMB 2BDBA 3SHCH 4XFQA 1HAPH 5F03A 3T29A 1WCZA 1BA8B 2I6SA 2Z9KA 4Y8XA 8KME2 1J15A 3UNSA 2PWXA 2V3OH 2BYAX 3BTME 3A81A 5JBCS 1QJ6B 2G51A 1TMBH 4LZ1H 1QQUA 1GI8B 1AFEH 3MU8A 1A5GH 1FJSA 2V3HH 4Y71A 2O8LA 2FTMA 1HRTH 4OS4A 5A2MH 3DHKH 5CHAC 4AB8A 3GYMA 3MH7A 5EPNA 5LGOA 3HK3B 1XXDA 4XBCA 1JWTA 2VIVA 2EI8A 4DOQA 2BD2A 3KHVA 1TGCA 2THFB 3SU5A 3RU4T 1DITH 1OS8A 1T8OA 1UTKA 2CGAA 1ACBE 4ISNA 4ABDA 3UTUH 2BY8X 1BRCE 1ABJH 1C5MD 2WPIS 3A8DA 1ZPBA 2H1UA 2PUQH 3QLPH 5TCAA 1LKBA 3RXEA 5ESTE 1FV9A 2Q6FA 2ZWLH 3QUMP 5JB9S 4I31A 2HOBA 2ZHEH 1GG6C 1GJ4H 3M5OA 1K22H 1P02A 3ZZ5A 1B0FA 2FWWA 4GSOA 2H5DA 3NCLA 1EATA 3BV9B 4I32A 2AIQA 2FX6A 1DWEH 2UWOA 2VB0A 1TE0A 5FXLA 1BCUH 3OY5U 1GHYH 1W7XH 2PHBA 4AZ2B 6GCHF 1F0TA 1GJ9B 1K1JA 1AN1E 4AFZA 1O2LA 1O31A 1TRNA 3EDXB 3GY2A 1LQEA 3PLBA 2ZG0H 1W14U 1C1NA 1RIWB 7GCHG 1SGCA 2Y82A 1FONA 1EAIA 1FIZA 6ESTA 3KL6A 1GI9B 2CF8H 2ZI2H 4JZEH 4ABIA 1D4PB 3T25A 4Q7ZA 3P6ZB 3JZ2B 2GVFA 3QDZB 3FANA 1PQ8A 3CP7A 3A82A 1NY22 3SBKA 1SBWA 3TK9A 1EJNA 1T8MA 2OBQA 1TX6A 2TIOA 2FDAA 2GCTC 2FI5E 4JCNA 3BTKE 4CREA 1D6WA 4Q2KA 3SI4H 1A0LA 2FZZA 2C8XB 5GCHG 1ARCA 1CE5A 4R8TB 3ZVCA 4DJZB 1CBWB 4NFFA 3P8FA 3C1KA 3SJ8A 3QGJA 1WTGH 2R9PA 4UFGH 1TA2A 4ZXXH 1BMMH 2OC0A 1Z6JH 4MPXA 5LPRA 5L30H 4X2XA 1C1SA 1V2QT 4KGAA 4DW2U 3ZZ4A 4INLA 3UWIA 4GPGA 2VIOA 1MBQA 2C93B 1RRKA 2DE8A 1SOZA 1EASA 4ESTE 3FAOA 4X1PU 3SUGA 5GJ4B 1LMWB 1C1VH 3PMBB 1XUGA 2P16A 3RXQA 2PKAB 3F6UH 1PPGE 3RXDA 3TH2H 3MNCA 5DJ7A 3ATIA 2W7SA 2A31A 3RM2H 1S84A 1C2DA 3U9AH 1OP2A 5LPFA 4NCYA 1BMLA 2GZ7A 3BF6H 4TWYA 1Q3XA 4FUBA 3T62A 1PPEE 3ZZ8A 2A1DB 4LK4A 1P09A 4TPYA 1SHHB 4BAHB 1K28D 1XM1A 2BQ7B 3GDUA 3M7UA 2HRVA 8ESTE 1GMCG 3QZRA 4FUHA 4F4OC 1YPLH 1SGFA 4CH2B 4J1YA 1FLEE 1BRBE 5GWZA 3SGAE 1SR5C 1G36A 5DP9A 1GG6B 2ZA5A 3KCGH 2ZHDA 1XMNB 1O3KA 1NRSH 3A7ZA 4Y10E 1H9HE 2NU3E 4TWWA 4Y11E 3RXVA 1EKBB 1ZLRA 1GBIA 5EU8A 5J4SA 4IN1A 1C1QA 3K6ZA 4X8UH 1IHTH 5C5NA 1EX3A 4B2AA 5TCCA 1MAXA 2PV9B 3SNDA 2RA0A 3E16B 2OCVB 2QA9E 1BB0B 3SNCA 1HPGA 3TPIZ 2NU1E 1ANDA 1WU1A 4AFSA 1Q2WA 1OXGA 5AHGH 3MO9A 3SUDA 4KKDA 1P2OA 3M3SA 4KTSA 1TNJA 4B73A 4BXWA 1FIWA 3MH5A 1NTPA 4CBOA 3TJNA 4YM9A 1ZGVA 1DM4B 4FUEA 3DFJA 4WVPE 1TFXA 1C4V2 1D3PB 2A7JA 1P2JA 3NUMA 2C8ZB 4ABHA 1GBHA 2FEQH 3SQEE 3MH4A 1HDTH 1C4U2 2Q1JA 1EAUA 3QX5H 5A0BA 1AE8H 1GL1A 5F8XA 2GCTB 3MHWU 1GJCB 1P2MA 2FO9A 4X0WU 5LPEA 1F92A 1O3NA 1EZXC 1A46H 1MMJN 2FESH 2J38A 4K1TA 3ENSB 1T7CA 1EP6A 1S81A 5EQQA 1AZZA 5DP8A 1MAYA 2ZHWH 5EXMA 2ZPRA 3WY8A 1AKSA 1QL9A 2F91A 3A7TA 1NRPH 3TIUA 5H4IB 4MVNA 1OWJA 1KDQA 3DA9B 1GGDC 1W7GH 2ZTZA 1VCQA 1SGFG 5E2PA 3TVJB 2Y5GA 2C4FH 2BD3A 2I6QA 2ASUB 1HIAB 1FZZA 1BRUP 2TGTA 2QN5T 3IG6B 4FUGA 3KGPA 2XWAA 1G3EA 3ELAH 4X6OA 4O03A 2BDIA 2HLCA 3SW2B 3RXJA 2BY9X 1W0YH 1Y59T 1GMDF 1O32A 2F9PA 2BY5X 3W94A 3RXAA 1K1LA 2JH6D 4DGJA 2OUAA 1YC0A 2GP9B 2VWMA 3M7TA 4NZLA 2HGTH 2XBXA 2UWLA 5AF9H 1B0EA 1ZHMA 4ABGA 2BX4A 1EOLA 2ZU1A 1Z1JA 1DY9A 1GI0A 1ETTH 2VJ1A 4JYVH 4X2VA 3RXPA 2Y80A 5EQSA 1O5CB 1DDJA 3E0PB 3M3TA 1PFXC 1N8OC 3A80A 3D23A 4I8KA 3ESTA 1GMHF 1SGRE 1W12U 1YM0A 1GCTC 3LGYA 1A3BH 1EAWA 1ELDE 1AUJA 3NPSA 4NG9H 3FP8E 3KQBA 2NU4E 1DPOA 2VVUA 3RMMH 4ASHA 1G32B 2J4IA 1G2MA 1PPFE 4GHQA 1TNHA 4IMQA 1G37A 2FOAA 2BY6X 4Y8YA 3P92A 4DG4A 1XVMA 3M37A 3A83A 3BIUH 1BTXA 3LPRA 4ZHAA 1TQ7B 1YLCA 4WH6A 5C1UA 3HGPA 2G81E 3TU7H 4Q80A 1SPJA 5FBIA 2NU0E 1CA0B 1SGIB 3Q76A 1IQLA 1O5AB 3RMNH 3RXUA 1GJ7B 1DWCH 1V2JT 1VJAU 2A32A 2FOHA 3TITA 3ATKA 5K7RA 1ELTA 4IS5A 4JZIA 1CHGA 1RD3B 1THSH 4Q7XA 1ZR0A 3KIDU 1P01A 5AFZH 4HI3A 4YO9A 4Z0KA 2PTNA 2Z9GA 2YOLA 2AMPA 1SHYA 3RU4E 5E8EH 2F9OA 4UONA 1THRH 2HWLB 4K1EA 1SB1H 2B9LA 3RXCA 1JOUB 1P0SH 4AB9A 3BN9A 1IQFA 1GHAF 4Y0YE 1S6FA 2ANYA 2H2ZA 3E6PH 2ZO3H 3T28A 1P2QA 1AIXH 1GCDA 2BD9A 1W8BH 3SV7A 2A5KA 3SN8A 4ZROA 4F49A 1A5HA 1NN6A 3KN2A 1CU1A 2P95A 1V2RT 4ABJA 3ZZBA 4AFQA 2VINA 4X6PA 1K1PA 3VB3A 1ZOMA 3SUEA 3EA7A 4IMZA 3S7HB 1PPZA 1NS3A 1FPCH 1AKSB 2ZGHA 4HFPB 1ZGIA 4TPIZ 1KDQB 1GI2A 1GWAA 1OSSA 4RKOB 2R2WU 4TY6A 5J4QA 1QBNA 5DPAA 3RUOA 3DUXH 3LGIA 3UQVA 1HJ9A 2GT7A 1XUHA 1G30B 3V0XA 2C3SA 1K1OA 1CHOF 1IQNA 1DY8A 3PWBA 2OQ5A 4MG3A 1MTUA 1AB9C 2HPQH 4MDSA 2FOGA 2XWBI 2XCNA 1NO9H 1ORFA 4QT8C 2ZFTA 1O2RA 3SUFA 3VFEA 1O3JA 3BTEE 1HYLA 1YBWA 1RJXB 1FDPA 1C1MA 1EPTA 1O3PB 2BLVA 4Y7AA 1N8OB 3QN7A 1JBUH 3MU5A 1WV7H 4LZ4B 1Y3XA 1TNGA 2G5NA 2OBOA 2BOHB 1V6DA 2WPMS 1O3FA 3TK5A 1O2PA 3U1JB 1GCTB 1B5GH 1LPKB 8GCHG 1W2KH 1V2WT 1NU9A 2BOKA 2AFQB 2VIDA 1A61H 5G4BA 4A1XA 1P11E 2V35A 1GI4A 1D9IA 4INKA 1UTOA 1DT2A 2SGEE 2B0FA 1CO7E 4K3JA 1HAVA 2WV5A 3V13A 3GY4A 1C2LA 5B6OA 2A4RA 1SQAA 4MNVA 1GI3A 2VU8E 4NIVA 4BTUB 2P3FH 1UTJA 1SG8B 2OTVA 2GDDA 1Y3VA 4SGBE 3STIA 3DD2H 3H7TA 1O5EH 3FZZA 4X2YA 1ZHPA 3SHAH 3LC3A 4CRGA 1E35B 1C2FA 1BBRK 4H6TA 4ZMAH 3CS0A 4UFEH 3NWUA 4NZQA 1LDTT 3K65B 5BPEA 3PLPA 1JRSA 4ZHLU 2VH6A 4I7YH 3GY6A 1X7AC 2XNIA 4DIHH 3RLWH 3MWIU 4A92A 1O2IA 4X8VH 4NIXA 2FI4E 2GCHF 2A5AA 4AGJA 4D9RA 1SLUB 3RXGA 4ZKNU 1SGDE 1C1PA 1OPHB 5FX5A 1V2TT 3BTQE 2LPRA 1A2CH 1H4WA 3U69H 1XUIA 4ZAEA 1SGYE 1ZPZA 2FOEA 3SNEA 2WINI 2GZ9A 1GPZA 4FUDA 4X1SU 1CGJE 3M36A 5DK1A 3D65E 1O39A 4UEHH 1GHZA 1Z7KA 3SGQE 1C2JA 3HPTB 4CRAA 2FI3E 2YNBA 3V3MA 1N6XA 3A7VA 4D76A 1CT2E 3TGKE 1FI8A 1LHFH 1C5VA 1LHGH 2F3CE 5EXNA 1HUTH 1LPZB 1DVAH 2A7CA 3Q00A 1GBTA 1S83A 4A6LA 3HKJB 4X6MA 2BZAA 1L1GA 1AWHB 1C2HA 2W3KA 3LJOA 3I77A 3JZ1B 4GHTA 1VITG 4MNWA 2Y5HA 1LQDB 2P3UB 3UWJH 3SORA 1HXFH 4U2WA 2QY0B 3LGWA 1TRMA 2HNTF 4OS5A 1AB9B 1K21H 1MTSA 1VJ9U 2H9HA 2ALPA 2G4UA 5ABWA 1GDUA 4X6NA 2WYGA 1NFWA 1O3MA 1SC8U 2FTLE 1H1BA 1QA0A 1YPKH 3D49H 3PM3A 3TNTA 1JRTA 1HCGA 4AG1A 4YT6H 1QBVH 1DE7H 3QWCH 1Y8TA 2BD8A 1OWHA 2ZFPH 3KF2A 1QIXB 1BZXE 2ZDNA 3ZVBA 2SGFE 3TJOA 3SNBA 1A1RA 1GJ8B 2TGPZ 2OC1A 3G01A 2ZDVH 3EA9A 2D8WA 1BMNH 1Z8JB 4OS6A 1GJ6A 2OXSA 5FCRA 4AN7A 2QXJA 2ODYB 3LONA 2AS9A 4AFUA 1IQIA 3NZIA 1NRRH 1YCPK 1C2KA 1K1MA 5EODA 1C5OH 2CXVA 2ZFRH 4E05H 2FP7B 4ISHH 1W3CA 1VGCC 1MTVA 2Z6BD 2Y5FA 1TPPA 1BHXB 2EI7A 3M5LA 2ANMH 3MU4A 1KXAA 1NRQH 4ISIH 1A5IA 1KIGH 2DUCA 2G55A 1EXFA 2TPIZ 5EGMA 3RXOA 1DX5M 1NM6A 3SJIA 4MQAA 2BLWA 3KQDA 2SNVA 1C5QA 3MOCA 2R0KA 3MFJA 3SV9A 2QIQA 3AW0A 3GCTF 1QTFA 2OINA 2FOBA 1HAYB 1SQOA 1L2EA 2ILNA 3A7XA 4AYVB 1H8IH 3F9FA 3A88A 3KQEA 2ZFQH 5A0CA 1IQMA 4I8HA 1SLXB 4WWYA 5E0HA 1XUFA 1O0DH 1O2QA 2FM2A 1O5FH 5JB8S 3V12A 3UPEA 2ZKSA 3LC5A 4X8TH 4K8BA 2IN2A 2FS8A 1MU8B 5DP3A 4JYTA 3GY8A 1UTPA 3UOUA 1AVGH 3SU2A 3MU1A 2Z7FE 2BDAA 4OS1A 1HV7A 3S0NA 3R0FA 1QJ7B 2RDLA 1ELEE 3SV2H 1TBRH 1A4WH 1C5NH 1NFYA 4YOIA 2VH0A 2XXLA 3S9CA 1V2LT 1J16A 1SLWB 2H5CA 1FXYA 1P06A 2PLXA 3Q3KA 2ZDKA 3VB7A 1TNKA 2NU2E 1XXFA 1PQ5A 5DP7A 2GMTC 5A09A 1KYNA 3RLYH 5AFYH 4OGYA 1HFDA 3FP6E 2GV7A 1O2NA 4JZDH 1JMOH 1RTLA 1O2XA 1HAZB 1KSNA 1Y5AT 4FUJA 3F68H 3RXIA 3RXTA 4IGDA 2IJOB 2ZZUH 3IWMA 5JDUB 1XKBC 1BTHH 2G8TA 1XX9A 3PROA 2JH5D 1L1NA 4ZHMU 4AGKA 5FX6A 1HXEH 1K2I1 1P9SA 3BTDE 1AFQC 2F83A 3UIRA 5JBTA 1M9UA 1V3XA 1VZQH 1SFIA 5A0AE 1MQ5A 1RFNA 2F9BH 1BBRE 1SMFE 4ZUHA 1SGNE 2CJIA 6GCHG 1O3IA 1K1IA 4THNH 1O2YA 4CR9A 1PYTC 4AG2A 3OY6U 2Z3EA 1E38B 1ELBA 2OD3B 1TX7A 2FLRH 1P2IA 2H6MA 1TPSA 2SGDE 3U1IB 1SFQB 2UUYA 5I25A 3QGNB 4OGXA 1UTNA 4IC6A 2ZC9H 1VGCB 4X1NU 1Y3YA 2AH4X 2QXIA 1ELGA 1BITA 1MH0A 1KLJH 4H42U 5C20A 4LXBH 1SLVB 3FFGA 3OX7U 3LGTA 1CA0C 1P12E 5A8YA 2BQ6B 1ETSH 4RSPA 1DFPA 1BOQA 1MKWK 5C2ZA 1TLDA 3ZYDA 4U30A 1TALA 2V0BA 3P8GA 1NZQH 1JXPA 1UTMA 2J95A 2KAIA 2JETC 3FVFB 1S0RA 4K1SA 4UDWH 1TGNA 1T8LA 3GY7A 1UTQA 2G52A 1WYKA 3RMLH 2GX4A 1DSTA 3UREA 1TOMH 1N6YA 1D3QB 1FN6A 2K1QA 4X8SH 3TLOA 1GBDA 1O2GH 2STAE 2CHAC 3GY5A 1YGCH 1O2HA 5BRRE 4XDEA 2GGVB 2GZ8A 3UR6A 3T2NA 2XCFA 1G3CA 4UFDH 1ZRBA 4BOHA 1UVSH 5FBEA 4IW4E 1BBRH 1Z1IA 4E7RG 4OS2A 1G9IE 4I8JA 4JYUH 1QL8A 1HAOH 1FN8A 4ZH8A 3MU0A 1O3OA 1ZTJA 2J9NA 4GVUA 1E34B 3STJA 3M5MA 3UUZA 1YPHC 5AVDA 2XBVA 3RU4D 3OSYA 4Y8ZA 1WQSA 4MPUA 3PYHA 4FU7A 3BTGE 2GMTB 4UFFH 4BAOB 1FUJA 3SGBE 2ZQ1A 1GI6A 3ZYEA 3Q3XA 1GI7B 1TMUH 4Y79A 1O2WA 2SFAA 5F8ZA 4MLFB 2UUJB 3SZNA 1O38A 1BTPA 1P03A 1O3BA 3PMAB 1E37B 1E36B 2D2DA 5TJXA 1B7XB 3EGKH 1NESE 3TGJE 3T5FH 1WBGB 4E7NA 1S85A 3TH3H 1Z8RA 1MZAA 2R0LA 1Z8IB 1C5YB 2Z9LA 3RXRA 4B2CA 4E06H 1A7SA 1EZSC 1AFQB 4Z6AH 3VEQB 3QZQA 3GDVA 1JIMA 2GV6A 1KXBA 3E1XB 3MI4A 4GLYA 1O5DH 5DO4H 1GDQA 1CT0E 4A1VA 5FHTA 1UVTH 3S9AA 3O8DA 1DOJA 1GBEA 1GHVH 2ZTYA 2F9NA 1NROH 1TQ0B 2BZ6H 2A4OA 1DWDH 1QBOA 1FAXA 5L2YH 3N7OA 2W3IA 4B75A 1AY6H 2EI6A 3A8AA 1Z6EA 1O2KA 1EZUC 3GCHC 5EW1H 1SGPE 1UVPA 2SGPE 4D7FA 1XUKA 3GCNA 1ZHRA 1O3CA 3ZVFA 3ITIA 2P3TB 5EPYA 3S7KB 2NWNA 3SJ9A 1QRZA 2EA3A 1AE5A 5T6GA 5GXPA 4ABAA 3GDSA 2BLOA 2BD7A 2FXRA 1AHTH 1GVKB 1Y3UA 3B8JA 1K9OE 4TY7A 2FYRA 1SGQE 3U8OH 1O2TA 1P05A 1VCPA 3E3TA 1FY1A 1Z71A 1TA6A 3MNBA 1GBBA 3RP2A 1SVPA 1AZ8A 2WPJS 2ZNKH 2JETB 1SSXA 3BTTE 1CVWH 6LPRA 3F9GA 1GDNA 8LPRA 1NT1A 3ZZ7A 3LH1A 4XOJA 1YCPH 1TAWA 1VITH 1ZJKA 4GCHF 1C1OA 1O3LA 4NGAH 3PMHB 3PTBA 2A2QH 1D6RA 2P59A 4HGCA 4NIWA 2CHAB 1TBQH 2KAIB 1ANCA 1F0SA 2XW9A 3RXBA 3EAJA 4KTUA 5JBBS 3SJKA 2VIPA 3VXEH 3EE0B 3VGCB 5T3HA 3LIWA 3R3GB 1IQEA 3NKKA 2VVVA 4IBLH 1QRWA 1SGTA 1UK2A 1UO6A 2J2UA 4NIYA 2OLGA 1GMDG 2SNWA 1EB1H 4FVDA 4WY3A 3SU4A 1ZYOA 1DXPA 2ZTXA 1ANBA 2AMQA 3ZZ6A 3PO1C 1IHSH 1C5PA 1DUAA 3P95A 1L0ZA 1CA8B 1LHCH 4VGCB 3ODDA 2ZCKP 1C5RA 1OWKA 2QC2A 3K6YA 1ZPCA 2TBSA 1GJ5H 2A2XH 1ELVA 1BJUA 3KNXA 4WH8A 1GL0E 4NA9H 5F8TA 1CGHA 2M5TA 1GMHG 2ZDAH 1LPGB 1IQHA 3U8RH 3PMJA 3ZV9A 5E0GA 1PYTD 1SGEE 4ZKRU 2SGQE 3U98H 5HM9A 5HYOA 3NK8A 1ZMNA 2OC8A 1GVLA 1YP9A 4B1TA 4CRBA 4ABFA 3ATMA 3MTYA 4RN6A 1EPTC 1QA7A 3BEUA 1SL3A 4NSVA 2VVCA 4YLQH 3U8TH 1O2UA 3GCHB 2UUKB 3HATH 1P2KA 3O8BA 1TNLA 4JMYA 5CE1A 3AASA 3FP7E 2GTBA 4X2WA 1DUEA 4INHA 3RXHA 2GDEH 2BB4A 3SQHE 5FPTA 4B74A 2FYQA 1LO6A 1QCPA 2A7HA 3M61U 3SJOA 4B76A 3UNRA 3ZZ3A 2G5VA 1O2MA 1H9IE 2G4TA 2W26A 1HAIH 4MNXA 1EJMA 1ELCA 1NU7B 1OWEA 2LNCA 2ZGBH 2XYAA 3A7WA 1TGSZ 1HJAC 1W0ZU 3A84A 4KP0A 4ISOA 1GBCA 2PTCE 2TGDA 1KLTA 2XBWA 1TYNA 2PGQB 5C67A 3TH4H 3S69A 1EQ9A 5DP6A 3A85A 1KTSB 2BDHA 1TPOA 1HBTH 5I46H 1VCWA 4B2BA 4CRDA 1YCPM 1TONA 3H5CB 3SV6A 1YPMH 3GICB 1C5TA 1DWBH 1GHAG 4CBNA 7GCHF 4ZKOU 2VWLA 1PQAA 2A4QA 1LCYA 3M7QA 2AYWA 2Z9IA 4YT7H 4A7IB 1YKTA 1FMGA 5EXLA 1KXEA 3RC4A 3F9EA 1YPEH 4BTIB 2IOTA 4NA8A 1OWIA 1J8AA 1TNIA 1OYQA 1ZRKA 1MCVA 2CV3A 4TYDA 4WJG2 2VWNA 5FAHA 1L1JA 1MKWH 3A8BA 4MPVA 1D3TB 4X1RU 2AMDA 5PTPA 3F1SB 4DCDA 5SGAE 1LTOA 1SI5H 1QGFA 3SO3A 4Y6DA 1O3EA 1GBKA 4YOJA 3ZZ9A 1RGQA 1F5LA 2FOFA 1EJAA 1WAYB 3PO1B 2AGIX 3PWCA 1GHBF 1FY8E 1TX8A 4WXVA 1CHOG 4MNYA 5EOKA 3AAUA 3DT0H 1OYTH 4AX9H 4HZHA 3RC6A 1O2JA 1V2UT 1TABE 2PKAA 2RCEA 4NA7A 4BAQB 4PROA 3BIVH 2CMYA 1EAXA 3TGIE 1UVOA 1IOEA 2ODQA 1P8VC 4CRFA 2H9EH 3RXMA 1WQVH 1MTWA 2Z94A 2XC4A 2FPZA 3LJJA 2BQWB 2J34A 4DURA 3VB4A 1ELFA 4JK5A 1GI5A 4CR5A 4WMFA 4Q7YA 1FQ3A 3OU0A 2ZPQA 6CHAC 3SV8A 2Z9JA 3MNSA 3LDXH 1EPTB 2FMJA 2ALVA 1TIOA 1UTLM 2R3UA 4DVAU 1TRYA 1P2NA 4MPWA 1BTUA 2VGCC 3EQ0H 1TOCB 1FY3A 1ZJDA 1BQYA 1AO5A 1AU8A 1A0HB 4ISLA 7LPRA 1RTKA 3VB6A 1GMCF 2HNTC 1MU6B 5HM2A 1WSSH 2ANKH 1CGIE 4U32A 1T31A 1GBFA 7ESTE 4JZFH 3B9FH 3S9BA 4SGAE 3D62A 1O37A 2O8TA 2F9UA 1HAVB 1UCYK 1OP8A 1UK3A 1KLIH 5JYIA 4MTBA 4NWLA 4WMDA 1UMAH 1HJAB 3BTWE 3RC5A 2IPHA 1O30A 1RXPA 4A5TS 1YPHE 2ZU4A 1TWXB 5LH8A 2GCHG 1K1NA 3SI3H 4XBBA 3SU1A 1TGTA 3NXPA 5EW2H 1W11U 2TRMA 1YF4A 2R2MB 2SGAA 1A0JA 1O35A 1BTZA 2QXHA 1LVBA 4AYYB 2A5IA 1QQ4A 2QF3A 1F0RA 2C90B 1DSUA 1V2OT 1LHEH 4K2YA 4Y0ZE 1ZSJA 1C9PA 3UFAA 1BTYA 1RS0A 4UE7H 3TJUA 1J9CH 2PKSC 3L6PA 1V2PT 1EZQA 5E0JA 2AGEX 3UY9A 4BTTB 3ZVAA 3A87A 4CRCA 2O8UA 4B71A 1O2VA 1ESBA 3KEEA 4M7GA 1OWDA 3GISB 1MKXK 4DIIH 1HJ8A 1G3BA 1AGJA 1UJ1A 4CHAB 2EC9H 1S5SA 1GHBG 3AAVA 4FUCA 3CENA 1EP5A 3LT3A 2ZGJA 5HXFA 4FUFA 2BHGA 5JBAS 3SU0A 1KXFA 1IQJA 1GI1A 2A4GA 1HIAA 2BVXH 4X1QU 2WUCA 9ESTA 2GD4B 1KY9A 1Y5BT 2PGBB 1F0UA 4YTAA 1O34A 2QF0A 3GCOA 1BRAA 4XE4A 4FVBA 2VNTA 3B23B 2O8WA 2Z3CA 7KMEH 1WTHD 2FOCA 3QK1A 2OC7A 3P8OA 5CHAB 1IAUA 3LGUA 1BT7A 1HNEE 4BXSA 2ZPSA 3MYWA 3LGVA 1TPAE 2BDYA 1QY6A 1V2VT 2PUXB 2BXTH 1GBMA 4K8YA 2AIPA 1MTNC 1WOFA 2Q6DA 2J94A 3K2UA 3PLKA 3ZVDA 5HGGA 6CHAB 3L33A 2VIWA 4YZUA 4BNRA 2VIQA 3MO6A 1TBZH 1O3AA 5DP4A 3A7YA 1A3EH 1ZMJA 4O3UA 1QRXA 5C5OA 3Q3YA 1AVXA 1V2ST 2AGGX 2VGCB 3HK6B 3AVZA 1NRNH 3LH3A 3UOPA 1PPHE 4JK6A 1T8NA 3SU3A 4BAKB 3ODFA 2JKHA 1C5XB 4A1TA 5L6NH 2BY7X 2RG3A 2ZECA 3ZZDA 5DP5A 1HLTH 4FU8A 1NPMA 2B5TB 2WUBA 5K0HA 2ESTE 9LPRA 1ZTKA 2Y6TA 4NFEA 3SU6A 1S82A 1ZSLA 1NFXA 3A86A 3MO3A 5DG6A 3UQOA 3OYPA 1HAGE 4XSKU 3DFLA 3GCTG 5L2ZH 2XC0A 1XKAC 2ZCLP 3GYLB 2CF9H 1QB6A 3GOVB 3SOSA 1FY4A 1S6HA 1CT4E 1W13U 5IYTA 3P17H 1O36A 3E0NB 2QGRA 2OP9A 4AOQA 2QYIA 1YYY1 2C8WB 1FNIA 3QTVH 3RDZA 2BVSH 2D26C 1C1WH 5EG4A 4ABBA 3RXLA 1THPB 3T27A 1C4Y2 1UK4A 1PQ7A 2PKSB 2WPHS 1GVZA 5ETXA 3BEFB 2WYJA 1Q31A 5E2OA 4YESB 3VGCC 1P3EA 3PV4A 3F9HA 1KTTB 1LVMA 1F2SE 2ZIQH 4WF8A 4FXGH 1UVUH 1YPGH 3VPKA 5A8ZA 3MMGA 1QL7A 1ZZZA 3LKWA 1AVWA 2YNAA 5ESBA 2PSYA 2UUFB 3KQCA 3EA8A 1S0QA 2ZHFH 2W5EA 2QAAA 2B7DH 5DKMA 2V6NA 1QR3E 1O3DA 4YLUA 3MH6A 3TJVA 1CSOE 1O5GH 2FX4A 4DY7B 1O3GA 3E8LA 3ZZCA 1MZDA 4VGCC 2JH0D 2EEKA 2VWOA 4H6SB 1V2KT 3P70B 1H8DH 4NWKA 2F9VA 3A89A 1T4UH 2ZFFH 3M3VA 3SNAA 2ZEBA 1P10A 3ZVEA 4O9VA 4Y76A 1D3DB 1GBJA 1GBLA 1UCYE 2PW8H 2RA3A 1F5KU 1MTNB 3ZV8A 4HTCH 4WXIA 1EOJA 2ULLA 3UR9A 3RXSA 3EYDA 2GKVE 1C2IA 1MD7A 1ETRH 4JZ1A 4OS7A 3QO6A 3URDA 1QHRB 4R0IA 3H7OA 1GBAA 1NC6A 2BXUH 1ESAA 1FPHH 1P04A 2DE9A 3QTOH 4IN2A 4NSYA 4ZKSU 2WPKS 1BDAA 1UHBA 4K60A 3ATLA 4I33A 2Y7XA 3URCA 2FIRH 5C1YA 2BTCE 2ZU3A 3TNSA 3AW1A 1O3HA 1XUJA 2Q6GA 1SOTA 1AI8H 1ZSKA 1XVOA 2Y7ZA 2P93A 5EQRA 3BG4C 2BD5A 8GCHF 1DXWA 1MD8A 3OTJE 1AWFH 3LOXA 2ZGXH 1J17T 2QXGA 4WMEA 1DLEA 1JIRA 3RM0H 1YPJH 3BTHE 3Q77A 1LHDH 1RTFB 2OQUA 2ZF0H 1ZMLA 1TB6H 4I8LA 1KXCA 1PJPA 4ZXYH 3E91A 3I78A 1C5SA 4FUIA 5FCKA 1DICA 2BLQA 1N1LA 2J92A 3RMOH 2FOMB 5GPIB 1OKXA 1C2MA 1GHXH 4D7GA 4LOYH 2CN0H 2FLBH 1BTWA 1O2OA 1BMAA 2AEIH 4ABEA 4K5ZA 1GJAB 2D1JA 4XBDA 2PR3A 1UCYH 1C5LH 1ANEA 2XTTB 1HAXB 1LKAA 1V2NT 2BMGB 2ZU2A 1QB9A 2O9QA 5IDKA 1ABIH 3PB1E 1IQGA 2FODA 2ODPA 2XC5A 1VR1H 4IC5A 1TGBA 2XRCA 4I8GA 4O3TA 5FPYA 1SQTA 1V2MT 2W7UA 1AMHA 1KXDA 3C27B 1Y3WA 2ZDLA 5C3NA 2BVRH 2P8OC 1ARBA 2BM2A 1O2SA 2C8YB 1LVYA 4D9QA 1GGDB 2ZP0H 1GJDB 1C1UH 2GT8A 1ESTA 1QB1A 2HVXA 2HNTE 1P3CA
chains in the Genus database with same CATH superfamily
1TMTH 3A8CA 1BJVA 1DS2E 2BX3A 2ZQ2A 4D8NA 3E90B 1BIOA 1MKXH 1ELAA 2P94A 1MQ6A 2LP6A 2XOKD 1C5WB 1OP0A 1NFUA 1MUEB 1EUFA 2HPPH 3L3TA 1L4ZA 2UWPA 2PFEA 1HAHH 1AUTC 1PPCE 1FAKH 2A45B 2TGAA 1T32A 4YOGA 4H4FA 5A8XA 1OOKB 3BEIB 1OX1A 1C9TA 1LVOA 2ZHQH 3LU9B 1SQRA 1QURH 5FPSA 4AORA 5GIBA 4DT7B 1VITF 2ZGCA 1F5RA 3MNXA 3O8CA 4J2YB 3RXFA 1O2ZA 5F6MA 1BHXF 1F7ZA 5DGJA 1FY5A 1Z8GA 1DLKB 2ZCHP 1EB2A 5GDSH 3O8RA 2HALA 3FN8A 1T4VH 1U6QA 4O97A 1G3DA 2B8OH 2XBYA 3F2GA 5CDFE 5CMXH 1C5UA 1UHBB 1ZTLA 3P8NA 5T6FA 1H8ED 1C1TA 1O5BB 5HMAA 3HGNA 5JPMH 1QFKH 2WV4A 3V7TA 1HB0B 1O33A 2ANWA 3BG4B 2ZDMA 2O8MA 1MCTA 1E1RD 1C5ZB 3K9XB 1WUNH 4K69A 1INCA 3FZDA 3BG8A 1G2LA 2A0QB 2ZFSA 2BDGA 3VB5A 2QCYA 4TSFD 4RKJB 4GUXA 1K0HA 3BTFE 1J14A 1W10U 3ZVGA 4B6EA 4FU9A 3VXFH 2BDCA 3ATWA 4GCHG 1RIWC 1DANH 4CH8B 1IQKA 1CQQA 2ZU5A 1QZ8A 3ZZAA 1BUIA 3CS7A 2BD4A 3RXKA 1QJ1B 1MBMA 1E0FD 4UD9H 2AERH 3T26A 1PPBH 3UNQA 1ID5H 1YLDA 5T6DA 1GHWH 1Y5UT 2QV1A 2Z3DA 2WPLS 4U01A 3W95A 2PSXA 3M5NA 4Q4LA 1C2EA 2Y81A 1GJBB 1AQ7A 1HGTH 2G00A 4Y7BA 2R3YA 3IITA 1L4DA 4GAWA 4BANB 1P9UA 1C2GA 1H9LB 2JIZD 4KTCA 2FS9A 4KELA 4CHAC 3HKIB 3I29A 1CBWC 1P57B 2P8OB 3M35A 3TK6A 2H9TH 5GCHF 1C1RA 5C1XA 3GY3A 3BSQA 1QNJA 1AD8H 2STBE 3PTNA 4BAMB 2BDBA 3SHCH 4XFQA 1HAPH 5F03A 3T29A 1WCZA 1BA8B 2I6SA 3PV5A 2Z9KA 4Y8XA 8KME2 1J15A 3UNSA 2PWXA 2V3OH 2BYAX 3BTME 3A81A 5JBCS 1QJ6B 2G51A 1TMBH 2QE7D 4LZ1H 1QQUA 1GI8B 1AFEH 3MU8A 1A5GH 1FJSA 2V3HH 4Y71A 2O8LA 2FTMA 1HRTH 4OS4A 5A2MH 3DHKH 5CHAC 4AB8A 3GYMA 3MH7A 5EPNA 5LGOA 3HK3B 1XXDA 4XBCA 1JWTA 2VIVA 2K8IA 2EI8A 4DOQA 2BD2A 3KHVA 1TGCA 2THFB 3SU5A 3RU4T 1DITH 1OS8A 1T8OA 1UTKA 3DSOA 2CGAA 1ACBE 4ISNA 4ABDA 3UTUH 2BY8X 1BRCE 1ABJH 1C5MD 2WPIS 3A8DA 1ZPBA 2H1UA 2PUQH 3QLPH 5TCAA 1LKBA 3RXEA 5ESTE 1FV9A 2Q6FA 5EJZA 2ZWLH 3QUMP 5JB9S 2M2AA 4I31A 2HOBA 2ZHEH 1GG6C 1GJ4H 3M5OA 1K22H 1P02A 3ZZ5A 1B0FA 2FWWA 4GSOA 2H5DA 3NCLA 1EATA 3BV9B 4I32A 2AIQA 2FX6A 1DWEH 2UWOA 2VB0A 1TE0A 5FXLA 1BCUH 3OY5U 1GHYH 1W7XH 2PHBA 2VBCA 4AZ2B 6GCHF 1F0TA 1GJ9B 1K1JA 1AN1E 4AFZA 1O2LA 1O31A 1TRNA 3EDXB 3GY2A 1LQEA 3PLBA 5F53A 2ZG0H 1W14U 1C1NA 1RIWB 7GCHG 1SGCA 2Y82A 1FONA 1EAIA 1FIZA 1YLNA 6ESTA 3KL6A 1GI9B 2CF8H 2ZI2H 3OTPA 4JZEH 4ABIA 1D4PB 3T25A 4Q7ZA 3OEED 3P6ZB 3JZ2B 2GVFA 3QDZB 3FANA 1PQ8A 3CP7A 3A82A 1NY22 3SBKA 1SBWA 3TK9A 1EJNA 1T8MA 2OBQA 1TX6A 2TIOA 2FDAA 2GCTC 2FI5E 4JCNA 3BTKE 4CREA 1D6WA 4Q2KA 3SI4H 1A0LA 2FZZA 2C8XB 5GCHG 1ARCA 1CE5A 4TT3D 4R8TB 3ZVCA 4DJZB 4F55A 1CBWB 4NFFA 3P8FA 3C1KA 3SJ8A 3QGJA 1WTGH 2R9PA 4UFGH 1TA2A 4ZXXH 1BMMH 2OC0A 4P00A 1Z6JH 4MPXA 5LPRA 5L30H 4X2XA 1C1SA 1V2QT 4KGAA 4DW2U 3ZZ4A 4INLA 3UWIA 4GPGA 2VIOA 1MBQA 2C93B 1RRKA 2DE8A 1SOZA 1EASA 4ESTE 3FAOA 4X1PU 3FKSD 2XNDD 3SUGA 5GJ4B 1LMWB 1C1VH 3PMBB 1XUGA 2P16A 3RXQA 2PKAB 3F6UH 1PPGE 3DSPA 3RXDA 3TH2H 2J98B 3MNCA 5DJ7A 3ATIA 2W7SA 2A31A 3RM2H 1S84A 1C2DA 3U9AH 1OP2A 5LPFA 4NCYA 1BMLA 2GZ7A 3BF6H 4TWYA 1Q3XA 4FUBA 3T62A 1PPEE 3ZZ8A 2A1DB 4LK4A 1P09A 4TPYA 2KZ4A 1SHHB 4BAHB 1K28D 1XM1A 2BQ7B 3GDUA 3M7UA 2HRVA 8ESTE 3DCLA 1GMCG 3QZRA 4FUHA 4F4OC 1YPLH 1SGFA 4CH2B 4J1YA 1FLEE 1BRBE 5GWZA 3SGAE 1SR5C 1G36A 5DP9A 1GG6B 2ZA5A 3KCGH 2ZHDA 1XMNB 1O3KA 1NRSH 3A7ZA 4Y10E 1H9HE 2NU3E 4TWWA 4Y11E 3RXVA 1EKBB 1ZLRA 3CNRA 1GBIA 5EU8A 2IPQX 5J4SA 4IN1A 1C1QA 3K6ZA 4X8UH 1IHTH 3PRDA 1EX3A 4B2AA 5C5NA 5TCCA 1MAXA 2PV9B 4AC9A 3SNDA 2RA0A 3E16B 2OCVB 2QA9E 1BB0B 3SNCA 1HPGA 3TPIZ 2NU1E 1ANDA 1WU1A 4AFSA 1Q2WA 2HVYB 1OXGA 5AHGH 3MO9A 3SUDA 4KKDA 1P2OA 3M3SA 4KTSA 1TNJA 4B73A 4BXWA 1FIWA 3MH5A 1NTPA 4CBOA 3TJNA 4YM9A 1ZGVA 1DM4B 4FUEA 3DFJA 4WVPE 1TFXA 1C4V2 1NBME 1D3PB 2A7JA 1P2JA 3NUMA 2C8ZB 4ABHA 1GBHA 2FEQH 3SQEE 2K0QA 3MH4A 1HDTH 1C4U2 2Q1JA 1EAUA 3QX5H 5A0BA 1AE8H 1GL1A 5F8XA 2GCTB 3MHWU 1GJCB 1P2MA 2FO9A 4X0WU 5LPEA 1F92A 1O3NA 1EZXC 1A46H 1MMJN 2FESH 2J38A 4K1TA 3ENSB 1T7CA 1EP6A 1S81A 5EQQA 1AZZA 5DP8A 1MAYA 2ZHWH 5EXMA 2ZPRA 3WY8A 1AKSA 1QL9A 2F91A 3A7TA 1NRPH 3TIUA 5H4IB 4MVNA 1OWJA 1KDQA 3DA9B 1GGDC 1W7GH 2ZTZA 1VCQA 1SGFG 5E2PA 3TVJB 2Y5GA 2C4FH 2BD3A 2I6QA 2ASUB 1HIAB 1FZZA 1BRUP 2TGTA 2QN5T 3IG6B 4FUGA 3KYGA 3KGPA 2XWAA 1G3EA 3ELAH 4X6OA 4O03A 2BDIA 2HLCA 2RDEA 3SW2B 3RXJA 2BY9X 1W0YH 1Y59T 1GMDF 1O32A 2F9PA 2BY5X 3H09A 3W94A 3RXAA 1K1LA 2JH6D 4DGJA 2OUAA 1YC0A 2GP9B 2VWMA 3M7TA 4NZLA 2HGTH 2XBXA 2UWLA 5AF9H 1B0EA 1ZHMA 4ABGA 2BX4A 1EOLA 2ZU1A 1Z1JA 1DY9A 1GI0A 1ETTH 2VJ1A 4JYVH 4X2VA 3RXPA 2Y80A 5EQSA 1O5CB 1DDJA 3E0PB 3M3TA 1PFXC 1N8OC 3A80A 3D23A 4I8KA 2WV9A 3ESTA 1GMHF 1SGRE 1W12U 1YM0A 1GCTC 3LGYA 1A3BH 1EAWA 1ELDE 1AUJA 3NPSA 4NG9H 3FP8E 3KQBA 2NU4E 1DPOA 2VVUA 3RMMH 4ASHA 1G32B 2J4IA 1G2MA 1PPFE 3WWFA 4GHQA 1TNHA 4IMQA 1G37A 2FOAA 2BY6X 4Y8YA 3P92A 4DG4A 1XVMA 3M37A 3A83A 3BIUH 1BTXA 3LPRA 4ZHAA 1TQ7B 1YLCA 5HKKD 4WH6A 5C1UA 3HGPA 2G81E 3UAIC 3TU7H 4Q80A 1SPJA 5FBIA 2NU0E 1CA0B 1SGIB 3Q76A 1IQLA 1O5AB 3RMNH 3RXUA 1GJ7B 1FX0B 1DWCH 1V2JT 1VJAU 2A32A 2FOHA 3TITA 3ATKA 5K7RA 1ELTA 5EJ1A 4IS5A 4JZIA 1CHGA 1RD3B 1THSH 4Q7XA 1ZR0A 3KIDU 1P01A 5AFZH 4HI3A 4YO9A 4Z0KA 1WXRA 2PTNA 2Z9GA 2YOLA 2AMPA 1SHYA 3RU4E 2KFWA 5E8EH 2F9OA 4UONA 1THRH 2HWLB 4K1EA 1SB1H 2B9LA 3RXCA 1JOUB 1P0SH 4AB9A 3BN9A 1IQFA 1GHAF 4Y0YE 1S6FA 2ANYA 2H2ZA 3E6PH 2EQNA 2ZO3H 1P2QA 1AIXH 1GCDA 2BD9A 3T28A 1W8BH 3SV7A 2A5KA 3SN8A 4ZROA 4F49A 1A5HA 1NN6A 3KN2A 1CU1A 2P95A 1V2RT 4ABJA 3ZZBA 4AFQA 2VINA 4X6PA 1K1PA 3VB3A 1ZOMA 1SKYE 3SUEA 3EA7A 4IMZA 3S7HB 1PPZA 1NS3A 1FPCH 1AKSB 2ZGHA 5T1VA 4HFPB 1ZGIA 4TPIZ 1KDQB 1GI2A 1GWAA 1OSSA 4RKOB 2R2WU 5C0UA 4TY6A 5J4QA 1QBNA 5EIYA 5DPAA 5GNDA 3RUOA 3DUXH 3LGIA 3UQVA 4B6FA 1HJ9A 2GT7A 1XUHA 1G30B 3V0XA 2C3SA 1K1OA 1CHOF 1IQNA 1DY8A 3PWBA 2OQ5A 4MG3A 1MTUA 1AB9C 2HPQH 4MDSA 2FOGA 2XWBI 2XCNA 1NO9H 1ORFA 4QT8C 2ZFTA 1O2RA 3SUFA 3VFEA 1O3JA 3BTEE 1HYLA 1YBWA 1RJXB 1FDPA 1C1MA 1EPTA 1O3PB 2BLVA 4Y7AA 1N8OB 3QN7A 1JBUH 3MU5A 1WV7H 4LZ4B 1Y3XA 1TNGA 2G5NA 2OBOA 2BOHB 1V6DA 2WPMS 1O3FA 3TK5A 1O2PA 3U1JB 2WZQA 1GCTB 1B5GH 1LPKB 8GCHG 1W2KH 1V2WT 1NU9A 2BOKA 2AFQB 1YY3A 2VIDA 3KYFA 3OEHD 1A61H 5G4BA 4A1XA 1P11E 2V35A 1GI4A 1D9IA 4INKA 1UTOA 1DT2A 2SGEE 3W1EA 2B0FA 1CO7E 4K3JA 1HAVA 2WV5A 3V13A 3GY4A 1C2LA 5B6OA 2A4RA 1SQAA 4MNVA 1GI3A 2VU8E 4NIVA 4BTUB 2P3FH 1UTJA 1SG8B 2OTVA 2RFKC 1WDIA 2GDDA 1Y3VA 4SGBE 3STIA 2J97A 3DD2H 3H7TA 1O5EH 3FZZA 4X2YA 1ZHPA 3SHAH 3LC3A 4CRGA 1E35B 1C2FA 1BBRK 4H6TA 4ZMAH 3CS0A 4UFEH 3NWUA 4I86A 4NZQA 1LDTT 3K65B 5BPEA 3PLPA 2JJ1D 1JRSA 4ZHLU 2VH6A 4I7YH 3GY6A 1X7AC 2XNIA 4DIHH 3RLWH 3MWIU 4A92A 1O2IA 4X8VH 4NIXA 2FI4E 2GCHF 3OFND 2A5AA 4AGJA 4D9RA 1SLUB 3RXGA 4ZKNU 1SGDE 1C1PA 1OPHB 5FX5A 1V2TT 3BTQE 2LPRA 1E1QD 1A2CH 1H4WA 3U69H 1XUIA 4ZAEA 1SGYE 1ZPZA 2FOEA 3SNEA 2WINI 2GZ9A 1GPZA 4FUDA 4X1SU 1CGJE 3M36A 5DK1A 3D65E 1O39A 4UEHH 1GHZA 1Z7KA 3SGQE 1C2JA 3HPTB 4CRAA 2FI3E 2YNBA 3V3MA 1N6XA 5HIYA 3A7VA 4D76A 1YWUA 1CT2E 3TGKE 1FI8A 1LHFH 1C5VA 1LHGH 2F3CE 5EXNA 1HUTH 1LPZB 1DVAH 2A7CA 3Q00A 1GBTA 1S83A 4A6LA 3HKJB 4X6MA 2BZAA 5KECA 3DSGA 1L1GA 1AWHB 1C2HA 2W3KA 3LJOA 3FOAA 3I77A 3JZ1B 4GHTA 3AK5A 1VITG 4MNWA 2Y5HA 1LQDB 2P3UB 3UWJH 3SORA 1HXFH 4U2WA 2QY0B 3LGWA 4FETA 1TRMA 2HNTF 4OS5A 1AB9B 1K21H 1MTSA 1VJ9U 2H9HA 2ALPA 2G4UA 4RT1A 5ABWA 1GDUA 4X6NA 2WYGA 1NFWA 1O3MA 1SC8U 2FTLE 1H1BA 1QA0A 1YPKH 3D49H 3PM3A 3TNTA 1JRTA 1HCGA 4AG1A 4YT6H 1QBVH 1DE7H 3QWCH 1Y8TA 2BD8A 1OWHA 2ZFPH 3KF2A 1QIXB 1BZXE 2F43B 2ZDNA 3ZVBA 2SGFE 3TJOA 3SNBA 1A1RA 1GJ8B 2TGPZ 2KR7A 2OC1A 3G01A 2ZDVH 3EA9A 2D8WA 1BMNH 1Z8JB 4OS6A 1GJ6A 2OXSA 5FCRA 4AN7A 3MQKC 2QXJA 2AHME 2ODYB 1OHHD 3LONA 2AS9A 4AFUA 1IQIA 3NZIA 1NRRH 1YCPK 1C2KA 1K1MA 5EODA 1C5OH 2CXVA 2ZFRH 4E05H 2FP7B 4ISHH 1W3CA 1VGCC 1MTVA 2Z6BD 2Y5FA 1TPPA 1BHXB 2EI7A 3M5LA 2ANMH 3MU4A 1KXAA 1NRQH 4ISIH 1A5IA 1KIGH 2DUCA 2G55A 1EXFA 2TPIZ 5EGMA 3RXOA 1DX5M 1NM6A 3SJIA 4MQAA 2BLWA 3KQDA 2SNVA 1C5QA 3MOCA 2R0KA 1BMFD 3MFJA 3SV9A 2QIQA 3AW0A 3GCTF 1QTFA 2OINA 2FOBA 1HAYB 1SQOA 1L2EA 2ILNA 3A7XA 4AYVB 1H8IH 3F9FA 3A88A 3KQEA 2ZFQH 5A0CA 1IQMA 4I8HA 1SLXB 4WWYA 5E0HA 1XUFA 1O0DH 1O2QA 2FM2A 1W0KD 1O5FH 5JB8S 4XD7D 3V12A 3UPEA 2ZKSA 3LC5A 4X8TH 4K8BA 2IN2A 2FS8A 1MU8B 5DP3A 1NBMD 4JYTA 3GY8A 1UTPA 3UOUA 1AVGH 3SU2A 3MU1A 2Z7FE 2BDAA 4OS1A 1HV7A 3S0NA 3R0FA 1QJ7B 2IJD1 1ELEE 2RDLA 3SV2H 1TBRH 1A4WH 1C5NH 1NFYA 4YOIA 2VH0A 2XXLA 3S9CA 1V2LT 1J16A 1SLWB 3EE7A 2LELA 2H5CA 1FXYA 1P06A 2PLXA 3Q3KA 2ZDKA 3VB7A 1TNKA 2NU2E 1XXFA 1PQ5A 5DP7A 2GMTC 4P02A 5A09A 1KYNA 3RLYH 5AFYH 4OGYA 1HFDA 3WWBA 3FP6E 2WSSD 2GV7A 3SYJA 1O2NA 4JZDH 1JMOH 1RTLA 1O2XA 1HAZB 1KSNA 1Y5AT 4FUJA 3F68H 3RXIA 3RXTA 4IGDA 2IJOB 2ZZUH 3IWMA 5JDUB 1XKBC 1BTHH 2G8TA 1XX9A 3PROA 2JH5D 1L1NA 4ZHMU 4AGKA 5FX6A 1HXEH 1K2I1 1P9SA 3BTDE 1AFQC 2F83A 3UIRA 5JBTA 1M9UA 1V3XA 1VZQH 1SFIA 5A0AE 1MQ5A 1RFNA 2F9BH 1BBRE 1SMFE 4ZUHA 1SGNE 2CJIA 6GCHG 1O3IA 1K1IA 4THNH 1O2YA 4CR9A 1PYTC 4AG2A 5DSFA 3N7EA 3OY6U 2Z3EA 1E38B 1ELBA 2OD3B 1TX7A 2FLRH 1P2IA 2H6MA 1TPSA 2SGDE 3U1IB 1SFQB 2UUYA 5I25A 3QGNB 4OGXA 1UTNA 4IC6A 2ZC9H 1EFRD 1VGCB 4X1NU 3PRBA 1Y3YA 2AH4X 2QXIA 1ELGA 1BITA 1MH0A 3KQ5A 1KLJH 4H42U 5C20A 4LXBH 1SLVB 3FFGA 3OX7U 3LGTA 1CA0C 1P12E 5A8YA 2BQ6B 1ETSH 4RSPA 1DFPA 1BOQA 1MKWK 5C2ZA 1TLDA 3ZYDA 4U30A 1TALA 2V0BA 3P8GA 1NZQH 1JXPA 1UTMA 2J95A 2KAIA 2JETC 3FVFB 1S0RA 4K1SA 4UDWH 1TGNA 1T8LA 3GY7A 1UTQA 2G52A 1WYKA 3RMLH 2GX4A 1DSTA 3UREA 1TOMH 1N6YA 1D3QB 1FN6A 2K1QA 4X8SH 3TLOA 1GBDA 1O2GH 2STAE 2CHAC 3GY5A 1YGCH 1O2HA 5BRRE 4XDEA 2GGVB 2GZ8A 3UR6A 3T2NA 2XCFA 1G3CA 4UFDH 1ZRBA 4BOHA 1UVSH 5FBEA 4IW4E 1BBRH 1Z1IA 4E7RG 1MABB 4OS2A 1G9IE 4I8JA 4JYUH 1QL8A 1HAOH 1FN8A 4ZH8A 3MU0A 1O3OA 1ZTJA 2J9NA 4GVUA 1E34B 3STJA 3M5MA 3UUZA 5C94A 1KMHB 1YPHC 5AVDA 2XBVA 3RU4D 3OSYA 4Y8ZA 1WQSA 4MPUA 3PYHA 4FU7A 3BTGE 2GMTB 4UFFH 4BAOB 1FUJA 3SGBE 2ZQ1A 1GI6A 3ZYEA 3Q3XA 1GI7B 1TMUH 4Y79A 1O2WA 2SFAA 5F8ZA 4MLFB 2UUJB 3SZNA 1O38A 1BTPA 2JJ2D 1P03A 1O3BA 3PMAB 1E37B 1E36B 2D2DA 5TJXA 1B7XB 3EGKH 1NESE 3TGJE 3T5FH 1WBGB 4E7NA 1S85A 3TH3H 1Z8RA 1MZAA 2R0LA 1Z8IB 1C5YB 2Z9LA 3RXRA 4B2CA 4E06H 1A7SA 1EZSC 1AFQB 4Z6AH 3VEQB 3QZQA 3GDVA 1JIMA 2GV6A 2KCYA 1KXBA 3E1XB 3MI4A 4GLYA 1O5DH 5DO4H 1GDQA 1CT0E 4A1VA 5FHTA 1UVTH 3S9AA 3O8DA 1DOJA 1GBEA 1GHVH 2ZTYA 2F9NA 1NROH 1TQ0B 2BZ6H 2A4OA 1DWDH 1QBOA 1FAXA 5L2YH 3N7OA 2W3IA 2QF5A 4B75A 1AY6H 2EI6A 3A8AA 1Z6EA 1O2KA 1EZUC 3GCHC 5EW1H 1SGPE 1UVPA 2SGPE 4D7FA 1XUKA 3GCNA 1ZHRA 1O3CA 3ZVFA 3ITIA 2P3TB 5EPYA 3S7KB 2NWNA 4M9FA 3SJ9A 1QRZA 2EA3A 1AE5A 5T6GA 5GXPA 4ABAA 3GDSA 2BLOA 2BD7A 2FXRA 1AHTH 1GVKB 1Y3UA 3B8JA 3NRLA 2W6ID 1K9OE 4TY7A 2FYRA 1SGQE 3U8OH 1O2TA 1P05A 1VCPA 3E3TA 1FY1A 1Z71A 1TA6A 3MNBA 1GBBA 3RP2A 1SVPA 1AZ8A 2WPJS 2ZNKH 2JETB 1SSXA 3BTTE 1CVWH 6LPRA 3F9GA 1GDNA 8LPRA 1NT1A 2YMSC 3ZZ7A 3LH1A 4XOJA 1YCPH 1TAWA 1VITH 1ZJKA 4GCHF 1C1OA 1O3LA 4NGAH 4ACBA 3PMHB 3PTBA 2A2QH 1D6RA 2P59A 4HGCA 4NIWA 2CHAB 1TBQH 2KAIB 1ANCA 1F0SA 2XW9A 3RXBA 3EAJA 4KTUA 5JBBS 3SJKA 2VIPA 1UW7A 3VXEH 3EE0B 3VGCB 5T3HA 3LIWA 3R3GB 1IQEA 3NKKA 2VVVA 4IBLH 1QRWA 1SGTA 1UK2A 1UO6A 2J2UA 4NIYA 2OLGA 1GMDG 2SNWA 1EB1H 4FVDA 4WY3A 3SU4A 3SZEA 1ZYOA 1DXPA 2ZTXA 1ANBA 5FL7D 2AMQA 3ZZ6A 3PO1C 1IHSH 1C5PA 1DUAA 3P95A 1L0ZA 1CA8B 1LHCH 4VGCB 2J5UA 3ODDA 2ZCKP 1C5RA 1OWKA 2QC2A 3K6YA 1ZPCA 2CK3D 2TBSA 1GJ5H 2A2XH 1ELVA 1BJUA 3KNXA 4WH8A 1GL0E 4NA9H 5F8TA 1CGHA 2M5TA 1GMHG 2ZDAH 2L6OA 1LPGB 1IQHA 3U8RH 3PMJA 3ZV9A 5E0GA 1PYTD 1SGEE 4ZKRU 2JDID 2SGQE 3U98H 5HM9A 5HYOA 3NK8A 1ZMNA 2OC8A 1GVLA 1YP9A 4B1TA 4CRBA 4ABFA 3ATMA 2W6JD 3MTYA 4RN6A 1EPTC 1QA7A 3BEUA 1SL3A 4NSVA 2VVCA 4YLQH 3U8TH 1O2UA 3GCHB 2UUKB 3HATH 1P2KA 3O8BA 1TNLA 4JMYA 5CE1A 1COWD 3AASA 3FP7E 2HLDD 2GTBA 4X2WA 1W0JD 1DUEA 4INHA 3RXHA 2GDEH 2BB4A 3SQHE 5FPTA 4B74A 2FYQA 1LO6A 1QCPA 2A7HA 3M61U 3SJOA 3ZIAD 4B76A 3UNRA 2PP6A 3F0OA 3N99A 3ZZ3A 2G5VA 2V7QD 2KCOA 1O2MA 1H9IE 2G4TA 2W26A 1HAIH 4MNXA 1EJMA 1ELCA 1NU7B 1OWEA 2LNCA 2ZGBH 2XYAA 3A7WA 1TGSZ 1HJAC 1W0ZU 3A84A 4KP0A 4ISOA 1GBCA 2PTCE 2TGDA 1KLTA 1VKYA 2XBWA 1TYNA 2PGQB 5C67A 3TH4H 3S69A 1EQ9A 5DP6A 3A85A 1KTSB 2BDHA 1TPOA 1HBTH 5I46H 1VCWA 2YMSB 4B2BA 2V3MA 4CRDA 1YCPM 1TONA 3H5CB 3SV6A 1YPMH 3GICB 1C5TA 1DWBH 1GHAG 4CBNA 4ZCNA 7GCHF 4ZKOU 2VWLA 1PQAA 2A4QA 1LCYA 3M7QA 2AYWA 2Z9IA 4YT7H 4A7IB 1YKTA 1FMGA 5EXLA 1KXEA 3RC4A 3F9EA 1YPEH 4BTIB 2IOTA 4ACAA 4NA8A 1OWIA 1J8AA 1TNIA 1OYQA 1ZRKA 1MCVA 2CV3A 4TYDA 4WJG2 2VWNA 5FAHA 1L1JA 1MKWH 3A8BA 4MPVA 1D3TB 4X1RU 2AMDA 5PTPA 3F1SB 3WW7A 4DCDA 5SGAE 1LTOA 1SI5H 1QGFA 3SO3A 4Y6DA 1O3EA 1GBKA 4YOJA 3ZZ9A 1RGQA 1F5LA 2FOFA 1EJAA 1WAYB 3PO1B 2AGIX 3PWCA 1GHBF 1FY8E 1TX8A 4WXVA 1CHOG 4MNYA 3F0PA 5EOKA 3AAUA 3DT0H 1OYTH 4AX9H 4HZHA 3RC6A 3VG8A 1O2JA 1V2UT 1TABE 2PKAA 2RCEA 4NA7A 4BAQB 4PROA 3BIVH 2CMYA 2J98A 1EAXA 2F4LA 3TGIE 1UVOA 1IOEA 2ODQA 1P8VC 4CRFA 2H9EH 3RXMA 1WQVH 1MTWA 2Z94A 2XC4A 2FPZA 3LJJA 2BQWB 5IK2D 2J34A 4DURA 3VB4A 1ELFA 4JK5A 1GI5A 4CR5A 4WMFA 5CHBA 4Q7YA 1FQ3A 3OU0A 2ZPQA 3UB0A 6CHAC 3SV8A 2Z9JA 3MNSA 3LDXH 1EPTB 2FMJA 2ALVA 1TIOA 1UTLM 2R3UA 4DVAU 1TRYA 1P2NA 4MPWA 1BTUA 2VGCC 3EQ0H 1TOCB 1FY3A 1ZJDA 1BQYA 1AO5A 1AU8A 1A0HB 4ISLA 7LPRA 1RTKA 3VB6A 1GMCF 2HNTC 1MU6B 5HM2A 1WSSH 2ANKH 1CGIE 4U32A 1T31A 1GBFA 7ESTE 4JZFH 3B9FH 3S9BA 2GJGA 4SGAE 3D62A 1O37A 2O8TA 2F9UA 1HAVB 1UCYK 1OP8A 1UK3A 1KLIH 5JYIA 4MTBA 4NWLA 4WMDA 1UMAH 1HJAB 3BTWE 2KCAA 3RC5A 2IPHA 1O30A 2YMSD 1RXPA 4A5TS 1YPHE 2ZU4A 1TWXB 5LH8A 1H8HD 2GCHG 4YXWD 1K1NA 3SI3H 4XBBA 3SU1A 1TGTA 3NXPA 5EW2H 1W11U 2TRMA 1YF4A 2R2MB 2SGAA 1A0JA 1O35A 1BTZA 2QXHA 1LVBA 4AYYB 2A5IA 1QQ4A 2QF3A 1F0RA 2C90B 1DSUA 1V2OT 1LHEH 4K2YA 4Y0ZE 1ZSJA 1C9PA 3UFAA 1BTYA 1RS0A 4UE7H 3TJUA 1J9CH 2PKSC 3L6PA 1V2PT 1EZQA 5E0JA 2AGEX 3UY9A 4BTTB 3ZVAA 3A87A 5HIZA 4CRCA 2O8UA 3U28C 4OM9A 1O2VA 4B71A 4HG6A 5C0TA 1ESBA 3KEEA 4M7GA 1OWDA 3GISB 1MKXK 4DIIH 1HJ8A 1G3BA 1AGJA 1UJ1A 1S6LA 4CHAB 2EC9H 1S5SA 1GHBG 3AAVA 4FUCA 3CENA 1EP5A 3LT3A 2ZGJA 5HXFA 4FUFA 2BHGA 5JBAS 3SU0A 1KXFA 1IQJA 1GI1A 2A4GA 1HIAA 2BVXH 4X1QU 2WUCA 9ESTA 2GD4B 1KY9A 1Y5BT 2PGBB 1F0UA 4YTAA 1O34A 2QF0A 3GCOA 1BRAA 2WPDD 4XE4A 4FVBA 2VNTA 3B23B 2O8WA 2Z3CA 7KMEH 1WTHD 2FOCA 3QK1A 2OC7A 3P8OA 3F2FA 5CHAB 1IAUA 3LGUA 1BT7A 1HNEE 4BXSA 2ZPSA 3MYWA 3LGVA 1TPAE 2BDYA 1QY6A 1V2VT 2PUXB 2BXTH 1GBMA 4K8YA 2AIPA 1MTNC 1WOFA 2Q6DA 2J94A 3K2UA 3PLKA 3ZVDA 5HGGA 6CHAB 3L33A 2VIWA 4YZUA 4BNRA 2VIQA 3MO6A 5B6LA 1TBZH 1O3AA 3PV2A 5DP4A 3A7YA 1A3EH 1ZMJA 2EY4C 4O3UA 1QRXA 5C5OA 3Q3YA 1AVXA 1V2ST 2AGGX 2VGCB 3HK6B 3AVZA 1NRNH 3LH3A 3UOPA 1PPHE 4JK6A 1T8NA 3SU3A 2QF4A 3ODFA 2JKHA 4BAKB 1C5XB 4A1TA 4DT4A 5L6NH 2BY7X 2RG3A 2ZECA 5KGOA 3ZZDA 5DP5A 1HLTH 4FU8A 1NPMA 2B5TB 2WUBA 5K0HA 2ESTE 9LPRA 1ZTKA 2Y6TA 4NFEA 3SU6A 1S82A 1ZSLA 1NFXA 3A86A 3MO3A 5DG6A 5C17A 3UQOA 3OYPA 1HAGE 4XSKU 3DFLA 3GCTG 5L2ZH 2XC0A 1XKAC 2ZCLP 3GYLB 2CF9H 1QB6A 3GOVB 3SOSA 1FY4A 3F3BA 1S6HA 1CT4E 1W13U 5IYTA 3P17H 1O36A 3E0NB 2QGRA 2OP9A 4AOQA 2QYIA 5EJLA 1YYY1 2C8WB 1FNIA 3QTVH 3RDZA 2BVSH 2D26C 1C1WH 5EG4A 4ABBA 3RXLA 1THPB 3T27A 1C4Y2 1UK4A 1PQ7A 2PKSB 2WPHS 1GVZA 3OAAD 5ETXA 3BEFB 2WYJA 1Q31A 5E2OA 2WHXA 4YESB 3VGCC 1P3EA 3PV4A 3F9HA 5KEDA 1KTTB 1LVMA 1F2SE 2ZIQH 4WF8A 4FXGH 1UVUH 1YPGH 3VPKA 5A8ZA 3MMGA 1QL7A 1ZZZA 3LKWA 1AVWA 2YNAA 4Z1MD 5ESBA 2PSYA 2UUFB 3KQCA 3EA8A 1S0QA 2ZHFH 4RT0A 2W5EA 2QAAA 2B7DH 5DKMA 2V6NA 1QR3E 1O3DA 4YLUA 3MH6A 3TJVA 1CSOE 1O5GH 2FX4A 4DY7B 4F48B 1O3GA 3E8LA 3ZZCA 1MZDA 4VGCC 2JH0D 2EEKA 2VWOA 4H6SB 1V2KT 3P70B 1H8DH 4NWKA 2F9VA 3A89A 1T4UH 2ZFFH 3M3VA 3SNAA 2ZEBA 1P10A 3ZVEA 4O9VA 3FO8D 4Y76A 1D3DB 1GBJA 1GBLA 1UCYE 2PW8H 2RA3A 1F5KU 1MTNB 2L74A 3ZV8A 4HTCH 4WXIA 1EOJA 2ULLA 3UR9A 3RXSA 3EYDA 2GKVE 1C2IA 1MD7A 1ETRH 4JZ1A 4OS7A 4FOUC 3QO6A 3URDA 1QHRB 4R0IA 3H7OA 1GBAA 1NC6A 2KM0A 2BXUH 1ESAA 1FPHH 1P04A 2DE9A 3QTOH 4IN2A 4NSYA 4ZKSU 2WPKS 1BDAA 1UHBA 4K60A 3ATLA 4I33A 2Y7XA 4XRNA 3URCA 2FIRH 5C1YA 2BTCE 2KCPA 2ZU3A 3TNSA 3AW1A 1O3HA 1XUJA 2Q6GA 1SOTA 1AI8H 1ZSKA 1XVOA 2KX4A 2Y7ZA 2P93A 5EQRA 3BG4C 2BD5A 8GCHF 1DXWA 1MD8A 3OTJE 1AWFH 3LOXA 2ZGXH 1E79D 1J17T 2QXGA 4WMEA 1DLEA 1JIRA 3RM0H 1YPJH 3BTHE 3Q77A 1LHDH 1RTFB 2OQUA 2ZF0H 1ZMLA 1TB6H 4I8LA 1KXCA 1PJPA 4ZXYH 3E91A 3I78A 1C5SA 4FUIA 5FCKA 1DICA 2BLQA 3GS9A 1N1LA 2J92A 3RMOH 2FOMB 5GPIB 1OKXA 1C2MA 1GHXH 4D7GA 4LOYH 2CN0H 2FLBH 1BTWA 1O2OA 1BMAA 2AEIH 4ABEA 4K5ZA 1GJAB 2D1JA 4XBDA 2PR3A 4RI0A 1UCYH 1C5LH 1ANEA 2XTTB 1HAXB 1LKAA 1V2NT 2BMGB 2ZU2A 1QB9A 2O9QA 5IDKA 1ABIH 3PB1E 1IQGA 2FODA 2ODPA 2XC5A 1VR1H 4Q63A 4IC5A 1TGBA 2XRCA 4I8GA 4O3TA 5FPYA 1SQTA 1V2MT 2W7UA 1AMHA 1KXDA 3C27B 1Y3WA 3OE7D 2ZDLA 5C3NA 2BVRH 2P8OC 1ARBA 2BM2A 1O2SA 3F2HA 2C8YB 3N7DA 1LVYA 4D9QA 1GGDB 2ZP0H 5DN6D 1GJDB 2OK5A 4ASUD 1C1UH 2GT8A 1ESTA 1QB1A 2HVXA 2HNTE 1P3CA
chains in the Genus database with same CATH topology
1TMTH 3A8CA 1BJVA 1DS2E 2BX3A 2ZQ2A 4D8NA 3E90B 1BIOA 1MKXH 1ELAA 2P94A 1MQ6A 1C5WB 1OP0A 1NFUA 1MUEB 1EUFA 2HPPH 3L3TA 1L4ZA 2UWPA 2PFEA 1HAHH 1AUTC 1PPCE 1FAKH 2A45B 2TGAA 1T32A 4YOGA 4H4FA 5A8XA 1OOKB 3BEIB 1OX1A 1C9TA 1LVOA 2ZHQH 3LU9B 1QURH 5FPSA 4AORA 5GIBA 4DT7B 1VITF 2ZGCA 1F5RA 3MNXA 3O8CA 4J2YB 3RXFA 1O2ZA 5F6MA 1BHXF 1F7ZA 5DGJA 1FY5A 1Z8GA 1DLKB 2ZCHP 1EB2A 5GDSH 3O8RA 2HALA 1T4VH 1U6QA 4O97A 1G3DA 2B8OH 2XBYA 5CMXH 1C5UA 1UHBB 1ZTLA 3P8NA 5T6FA 1C1TA 1O5BB 5HMAA 3HGNA 5JPMH 1QFKH 2WV4A 3V7TA 1HB0B 1O33A 2ANWA 3BG4B 2ZDMA 2O8MA 1MCTA 1C5ZB 3K9XB 1WUNH 4K69A 1INCA 3FZDA 3BG8A 1G2LA 2A0QB 2ZFSA 2BDGA 3VB5A 2QCYA 4RKJB 4GUXA 3BTFE 1J14A 1W10U 3ZVGA 4FU9A 3VXFH 2BDCA 3ATWA 4GCHG 1RIWC 1DANH 4CH8B 1IQKA 1CQQA 2ZU5A 3ZZAA 1BUIA 3CS7A 2BD4A 3RXKA 1QJ1B 1MBMA 1E0FD 4UD9H 2AERH 3T26A 1PPBH 3UNQA 1ID5H 1YLDA 5T6DA 1GHWH 1Y5UT 2QV1A 2Z3DA 2WPLS 4U01A 3W95A 2PSXA 3M5NA 1C2EA 2Y81A 1GJBB 1AQ7A 1HGTH 2G00A 4Y7BA 2R3YA 3IITA 1L4DA 4GAWA 4BANB 1P9UA 1C2GA 1H9LB 4KTCA 2FS9A 4KELA 4CHAC 3HKIB 3I29A 1CBWC 1P57B 2P8OB 3M35A 3TK6A 2H9TH 5GCHF 1C1RA 5C1XA 3GY3A 3BSQA 1QNJA 1AD8H 2STBE 3PTNA 4BAMB 2BDBA 3SHCH 4XFQA 1HAPH 5F03A 3T29A 1WCZA 1BA8B 2I6SA 2Z9KA 4Y8XA 8KME2 1J15A 3UNSA 2PWXA 2V3OH 2BYAX 3BTME 3A81A 5JBCS 1QJ6B 2G51A 1TMBH 4LZ1H 1QQUA 1GI8B 1AFEH 3MU8A 1A5GH 1FJSA 2V3HH 4Y71A 2O8LA 2FTMA 1HRTH 4OS4A 5A2MH 3DHKH 5CHAC 4AB8A 3GYMA 3MH7A 5EPNA 5LGOA 3HK3B 1XXDA 4XBCA 1JWTA 2VIVA 2EI8A 4DOQA 2BD2A 3KHVA 1TGCA 2THFB 3SU5A 3RU4T 1DITH 1OS8A 1T8OA 1UTKA 2CGAA 1ACBE 4ISNA 4ABDA 3UTUH 2BY8X 1BRCE 1ABJH 1C5MD 2WPIS 3A8DA 1ZPBA 2H1UA 2PUQH 3QLPH 5TCAA 1LKBA 3RXEA 5ESTE 1FV9A 2Q6FA 2ZWLH 3QUMP 5JB9S 4I31A 2HOBA 2ZHEH 1GG6C 1GJ4H 3M5OA 1K22H 1P02A 3ZZ5A 1B0FA 2FWWA 4GSOA 2H5DA 3NCLA 1EATA 3BV9B 4I32A 2AIQA 2FX6A 1DWEH 2UWOA 2VB0A 1TE0A 5FXLA 1BCUH 3OY5U 1GHYH 1W7XH 2PHBA 4AZ2B 6GCHF 1F0TA 1GJ9B 1K1JA 1AN1E 4AFZA 1O2LA 1O31A 1TRNA 3EDXB 3GY2A 1LQEA 3PLBA 2ZG0H 1W14U 1C1NA 1RIWB 7GCHG 1SGCA 2Y82A 1FONA 1EAIA 1FIZA 6ESTA 3KL6A 1GI9B 2CF8H 2ZI2H 4JZEH 4ABIA 1D4PB 3T25A 4Q7ZA 3P6ZB 3JZ2B 2GVFA 3QDZB 3FANA 1PQ8A 3CP7A 3A82A 1NY22 3SBKA 1SBWA 3TK9A 1EJNA 1T8MA 2OBQA 1TX6A 2TIOA 2FDAA 2GCTC 2FI5E 4JCNA 3BTKE 4CREA 1D6WA 4Q2KA 3SI4H 1A0LA 2FZZA 2C8XB 5GCHG 1ARCA 1CE5A 4R8TB 3ZVCA 4DJZB 1CBWB 4NFFA 3P8FA 3C1KA 3SJ8A 3QGJA 1WTGH 2R9PA 4UFGH 1TA2A 4ZXXH 1BMMH 2OC0A 1Z6JH 4MPXA 5LPRA 5L30H 4X2XA 1C1SA 1V2QT 4KGAA 4DW2U 3ZZ4A 4INLA 3UWIA 4GPGA 2VIOA 1MBQA 2C93B 1RRKA 2DE8A 1SOZA 1EASA 4ESTE 3FAOA 4X1PU 3SUGA 5GJ4B 1LMWB 1C1VH 3PMBB 1XUGA 2P16A 3RXQA 2PKAB 3F6UH 1PPGE 3RXDA 3TH2H 3MNCA 5DJ7A 3ATIA 2W7SA 2A31A 3RM2H 1S84A 1C2DA 3U9AH 1OP2A 5LPFA 4NCYA 1BMLA 2GZ7A 3BF6H 4TWYA 1Q3XA 4FUBA 3T62A 1PPEE 3ZZ8A 2A1DB 4LK4A 1P09A 4TPYA 1SHHB 4BAHB 1K28D 1XM1A 2BQ7B 3GDUA 3M7UA 2HRVA 8ESTE 1GMCG 3QZRA 4FUHA 4F4OC 1YPLH 1SGFA 4CH2B 4J1YA 1FLEE 1BRBE 5GWZA 3SGAE 1SR5C 1G36A 5DP9A 1GG6B 2ZA5A 3KCGH 2ZHDA 1XMNB 1O3KA 1NRSH 3A7ZA 4Y10E 1H9HE 2NU3E 4TWWA 4Y11E 3RXVA 1EKBB 1ZLRA 1GBIA 5EU8A 5J4SA 4IN1A 1C1QA 3K6ZA 4X8UH 1IHTH 5C5NA 1EX3A 4B2AA 5TCCA 1MAXA 2PV9B 3SNDA 2RA0A 3E16B 2OCVB 2QA9E 1BB0B 3SNCA 1HPGA 3TPIZ 2NU1E 1ANDA 1WU1A 4AFSA 1Q2WA 1OXGA 5AHGH 3MO9A 3SUDA 4KKDA 1P2OA 3M3SA 4KTSA 1TNJA 4B73A 4BXWA 1FIWA 3MH5A 1NTPA 4CBOA 3TJNA 4YM9A 1ZGVA 1DM4B 4FUEA 3DFJA 4WVPE 1TFXA 1C4V2 1D3PB 2A7JA 1P2JA 3NUMA 2C8ZB 4ABHA 1GBHA 2FEQH 3SQEE 3MH4A 1HDTH 1C4U2 2Q1JA 1EAUA 3QX5H 5A0BA 1AE8H 1GL1A 5F8XA 2GCTB 3MHWU 1GJCB 1P2MA 2FO9A 4X0WU 5LPEA 1F92A 1O3NA 1EZXC 1A46H 1MMJN 2FESH 2J38A 4K1TA 3ENSB 1T7CA 1EP6A 1S81A 5EQQA 1AZZA 5DP8A 1MAYA 2ZHWH 5EXMA 2ZPRA 3WY8A 1AKSA 1QL9A 2F91A 3A7TA 1NRPH 3TIUA 5H4IB 4MVNA 1OWJA 1KDQA 3DA9B 1GGDC 1W7GH 2ZTZA 1VCQA 1SGFG 5E2PA 3TVJB 2Y5GA 2C4FH 2BD3A 2I6QA 2ASUB 1HIAB 1FZZA 1BRUP 2TGTA 2QN5T 3IG6B 4FUGA 3KGPA 2XWAA 1G3EA 3ELAH 4X6OA 4O03A 2BDIA 2HLCA 3SW2B 3RXJA 2BY9X 1W0YH 1Y59T 1GMDF 1O32A 2F9PA 2BY5X 3W94A 3RXAA 1K1LA 2JH6D 4DGJA 2OUAA 1YC0A 2GP9B 2VWMA 3M7TA 4NZLA 2HGTH 2XBXA 2UWLA 5AF9H 1B0EA 1ZHMA 4ABGA 2BX4A 1EOLA 2ZU1A 1Z1JA 1DY9A 1GI0A 1ETTH 2VJ1A 4JYVH 4X2VA 3RXPA 2Y80A 5EQSA 1O5CB 1DDJA 3E0PB 3M3TA 1PFXC 1N8OC 3A80A 3D23A 4I8KA 3ESTA 1GMHF 1SGRE 1W12U 1YM0A 1GCTC 3LGYA 1A3BH 1EAWA 1ELDE 1AUJA 3NPSA 4NG9H 3FP8E 3KQBA 2NU4E 1DPOA 2VVUA 3RMMH 4ASHA 1G32B 2J4IA 1G2MA 1PPFE 4GHQA 1TNHA 4IMQA 1G37A 2FOAA 2BY6X 4Y8YA 3P92A 4DG4A 1XVMA 3M37A 3A83A 3BIUH 1BTXA 3LPRA 4ZHAA 1TQ7B 1YLCA 4WH6A 5C1UA 3HGPA 2G81E 3TU7H 4Q80A 1SPJA 5FBIA 2NU0E 1CA0B 1SGIB 3Q76A 1IQLA 1O5AB 3RMNH 3RXUA 1GJ7B 1DWCH 1V2JT 1VJAU 2A32A 2FOHA 3TITA 3ATKA 5K7RA 1ELTA 4IS5A 4JZIA 1CHGA 1RD3B 1THSH 4Q7XA 1ZR0A 3KIDU 1P01A 5AFZH 4HI3A 4YO9A 4Z0KA 2PTNA 2Z9GA 2YOLA 2AMPA 1SHYA 3RU4E 5E8EH 2F9OA 4UONA 1THRH 2HWLB 4K1EA 1SB1H 2B9LA 3RXCA 1JOUB 1P0SH 4AB9A 3BN9A 1IQFA 1GHAF 4Y0YE 1S6FA 2ANYA 2H2ZA 3E6PH 2ZO3H 3T28A 1P2QA 1AIXH 1GCDA 2BD9A 1W8BH 3SV7A 2A5KA 3SN8A 4ZROA 4F49A 1A5HA 1NN6A 3KN2A 1CU1A 2P95A 1V2RT 4ABJA 3ZZBA 4AFQA 2VINA 4X6PA 1K1PA 3VB3A 1ZOMA 3SUEA 3EA7A 4IMZA 3S7HB 1PPZA 1NS3A 1FPCH 1AKSB 2ZGHA 4HFPB 1ZGIA 4TPIZ 1KDQB 1GI2A 1GWAA 1OSSA 4RKOB 2R2WU 4TY6A 5J4QA 1QBNA 5DPAA 3RUOA 3DUXH 3LGIA 3UQVA 1HJ9A 2GT7A 1XUHA 1G30B 3V0XA 2C3SA 1K1OA 1CHOF 1IQNA 1DY8A 3PWBA 2OQ5A 4MG3A 1MTUA 1AB9C 2HPQH 4MDSA 2FOGA 2XWBI 2XCNA 1NO9H 1ORFA 4QT8C 2ZFTA 1O2RA 3SUFA 3VFEA 1O3JA 3BTEE 1HYLA 1YBWA 1RJXB 1FDPA 1C1MA 1EPTA 1O3PB 2BLVA 4Y7AA 1N8OB 3QN7A 1JBUH 3MU5A 1WV7H 4LZ4B 1Y3XA 1TNGA 2G5NA 2OBOA 2BOHB 1V6DA 2WPMS 1O3FA 3TK5A 1O2PA 3U1JB 1GCTB 1B5GH 1LPKB 8GCHG 1W2KH 1V2WT 1NU9A 2BOKA 2AFQB 2VIDA 1A61H 5G4BA 4A1XA 1P11E 2V35A 1GI4A 1D9IA 4INKA 1UTOA 1DT2A 2SGEE 2B0FA 1CO7E 4K3JA 1HAVA 2WV5A 3V13A 3GY4A 1C2LA 5B6OA 2A4RA 1SQAA 4MNVA 1GI3A 2VU8E 4NIVA 4BTUB 2P3FH 1UTJA 1SG8B 2OTVA 2GDDA 1Y3VA 4SGBE 3STIA 3DD2H 3H7TA 1O5EH 3FZZA 4X2YA 1ZHPA 3SHAH 3LC3A 4CRGA 1E35B 1C2FA 1BBRK 4H6TA 4ZMAH 3CS0A 4UFEH 3NWUA 4NZQA 1LDTT 3K65B 5BPEA 3PLPA 1JRSA 4ZHLU 2VH6A 4I7YH 3GY6A 1X7AC 2XNIA 4DIHH 3RLWH 3MWIU 4A92A 1O2IA 4X8VH 4NIXA 2FI4E 2GCHF 2A5AA 4AGJA 4D9RA 1SLUB 3RXGA 4ZKNU 1SGDE 1C1PA 1OPHB 5FX5A 1V2TT 3BTQE 2LPRA 1A2CH 1H4WA 3U69H 1XUIA 4ZAEA 1SGYE 1ZPZA 2FOEA 3SNEA 2WINI 2GZ9A 1GPZA 4FUDA 4X1SU 1CGJE 3M36A 5DK1A 3D65E 1O39A 4UEHH 1GHZA 1Z7KA 3SGQE 1C2JA 3HPTB 4CRAA 2FI3E 2YNBA 3V3MA 1N6XA 3A7VA 4D76A 1CT2E 3TGKE 1FI8A 1LHFH 1C5VA 1LHGH 2F3CE 5EXNA 1HUTH 1LPZB 1DVAH 2A7CA 3Q00A 1GBTA 1S83A 4A6LA 3HKJB 4X6MA 2BZAA 1L1GA 1AWHB 1C2HA 2W3KA 3LJOA 3I77A 3JZ1B 4GHTA 1VITG 4MNWA 2Y5HA 1LQDB 2P3UB 3UWJH 3SORA 1HXFH 4U2WA 2QY0B 3LGWA 1TRMA 2HNTF 4OS5A 1AB9B 1K21H 1MTSA 1VJ9U 2H9HA 2ALPA 2G4UA 5ABWA 1GDUA 4X6NA 2WYGA 1NFWA 1O3MA 1SC8U 2FTLE 1H1BA 1QA0A 1YPKH 3D49H 3PM3A 3TNTA 1JRTA 1HCGA 4AG1A 4YT6H 1QBVH 1DE7H 3QWCH 1Y8TA 2BD8A 1OWHA 2ZFPH 3KF2A 1QIXB 1BZXE 2ZDNA 3ZVBA 2SGFE 3TJOA 3SNBA 1A1RA 1GJ8B 2TGPZ 2OC1A 3G01A 2ZDVH 3EA9A 2D8WA 1BMNH 1Z8JB 4OS6A 1GJ6A 2OXSA 5FCRA 4AN7A 2QXJA 2ODYB 3LONA 2AS9A 4AFUA 1IQIA 3NZIA 1NRRH 1YCPK 1C2KA 1K1MA 5EODA 1C5OH 2CXVA 2ZFRH 4E05H 2FP7B 4ISHH 1W3CA 1VGCC 1MTVA 2Z6BD 2Y5FA 1TPPA 1BHXB 2EI7A 3M5LA 2ANMH 3MU4A 1KXAA 1NRQH 4ISIH 1A5IA 1KIGH 2DUCA 2G55A 1EXFA 2TPIZ 5EGMA 3RXOA 1DX5M 1NM6A 3SJIA 4MQAA 2BLWA 3KQDA 2SNVA 1C5QA 3MOCA 2R0KA 3MFJA 3SV9A 2QIQA 3AW0A 3GCTF 1QTFA 2OINA 2FOBA 1HAYB 1SQOA 1L2EA 2ILNA 3A7XA 4AYVB 1H8IH 3F9FA 3A88A 3KQEA 2ZFQH 5A0CA 1IQMA 4I8HA 1SLXB 4WWYA 5E0HA 1XUFA 1O0DH 1O2QA 2FM2A 1O5FH 5JB8S 3V12A 3UPEA 2ZKSA 3LC5A 4X8TH 4K8BA 2IN2A 2FS8A 1MU8B 5DP3A 4JYTA 3GY8A 1UTPA 3UOUA 1AVGH 3SU2A 3MU1A 2Z7FE 2BDAA 4OS1A 1HV7A 3S0NA 3R0FA 1QJ7B 2RDLA 1ELEE 3SV2H 1TBRH 1A4WH 1C5NH 1NFYA 4YOIA 2VH0A 2XXLA 3S9CA 1V2LT 1J16A 1SLWB 2H5CA 1FXYA 1P06A 2PLXA 3Q3KA 2ZDKA 3VB7A 1TNKA 2NU2E 1XXFA 1PQ5A 5DP7A 2GMTC 5A09A 1KYNA 3RLYH 5AFYH 4OGYA 1HFDA 3FP6E 2GV7A 1O2NA 4JZDH 1JMOH 1RTLA