1GDQA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdqA01
1A5HA 1PPZA 5T6FA 4O3UA 4KELA 2GZ9A 1LHFH 1OXGA 3Q3YA 1GI8B 1GHWH 5EPYA 2WYJA 1SR5C 1O5EH 5T3HA 1A5GH 1LPKB 4D7FA 3MOCA 1CT0E 2OD3B 1E38B 2G5NA 1NRRH 1QB9A 1OWDA 1TRMA 1NFYA 3BEUA 1DDJA 5AFYH 3A87A 2EI7A 3P8OA 1AZ8A 2ASUB 2AYWA 1AFQC 1KXEA 1RIWB 3QLPH 1X7AC 2SNVA 1ELBA 4NA7A 1CT2E 1GJ9B 1IAUA 2ZHEH 2ZHDA 2V3HH 3Q00A 1O35A 2A7HA 1UVUH 1CHOF 4GPGA 2H9EH 3V13A 1BRUP 1TAWA 3VB3A 1SLWB 1TPPA 1P09A 2P8OC 4Y7BA 1O3JA 5E2OA 1GJ8B 2CF9H 2WPJS 3M3TA 3M7QA 1VCWA 2C8YB 1DE7H 1OWEA 4FUBA 3ZZBA 2FDAA 3MNBA 1Z8RA 3NPSA 1FY4A 2R3YA 1TOMH 4TY7A 4DOQA 2B7DH 2XW9A 3LONA 1SHYA 3LPRA 2P59A 1GG6C 1TOCB 1GJ4H 2AERH 1P11E 4WH6A 1O2PA 1C5OH 1ZSKA 1GL0E 1HIAB 2FESH 2ZF0H 1EZUC 1KXCA 3BTFE 5TCAA 2V35A 1UO6A 1NY22 2ZHQH 1NRNH 4MQAA 3RXBA 1SGDE 2FM2A 3L3TA 3ZV9A 1EJAA 1GPZA 1FPCH 3RXVA 4IS5A 3PM3A 1ELAA 5C5OA 1C2HA 1K1IA 3GCTG 1LHCH 1JIRA 1NU7B 1NRQH 3ZZ8A 3MH7A 1DANH 4JZFH 1L0ZA 1P2QA 4FU8A 3E1XB 1L2EA 1YPMH 2PR3A 4MNWA 1H4WA 2WUBA 2FOGA 1LKAA 1YPLH 3SUDA 4DIIH 4NIVA 5GCHG 2TIOA 4K8YA 2H9HA 1HJAB 2P93A 1YPHE 1SOZA 1VCQA 5EQRA 3SU4A 1D4PB 1ZTJA 2H5DA 3SHAH 1O5GH 1G30B 1RTLA 3RXLA 1C5QA 3A86A 1P3CA 1IQHA 1UVSH 3GCHC 2P3UB 5EU8A 5DPAA 2A2QH 4CRBA 5DP5A 1MZDA 2WINI 1W11U 4Q7YA 2FZZA 4KGAA 5LPEA 2J95A 2JH5D 3SBKA 4XBBA 1QRWA 1S81A 1ZSLA 2H2ZA 3RMOH 1BTZA 1EASA 3BTQE 1AB9C 3LC3A 4WJG2 3SV8A 1O2RA 1T8NA 3I77A 3FZDA 2IPHA 2PGQB 3A81A 2F83A 2O8UA 1O3EA 1TBRH 1V2PT 1KSNA 1HV7A 1Z8GA 3T28A 1K22H 1VR1H 2WUCA 3ZZDA 2VH0A 1N1LA 1V2WT 4U2WA 4ASHA 1O3CA 2WPMS 1O3MA 3IITA 1K21H 4O03A 1MTVA 2ZWLH 1SGIB 4XBCA 1JXPA 1OYTH 4THNH 2BD5A 3OTJE 2NWNA 1P9SA 4TYDA 4X6MA 5FBEA 2DUCA 2DE9A 2GCHF 3O8RA 2O8MA 5DKMA 3S9BA 1AUJA 3UREA 1C5PA 6LPRA 3PMHB 1QBVH 1WBGB 2GVFA 2F9VA 1VITH 1DXWA 1THSH 3JZ2B 4AFZA 4M7GA 1FNIA 3SNEA 1TA2A 1MKXK 1O2YA 1H8IH 1SGCA 4E06H 2QXHA 7ESTE 4XOJA 2W5EA 3U98H 6GCHF 2AMQA 1RRKA 1W12U 2KAIA 1A3BH 5F8TA 1YLCA 3A88A 1P2IA 3MNSA 1Q3XA 1RXPA 1W8BH 5FPSA 3FP7E 3BG4C 2OC1A 2A4GA 1BTXA 1RFNA 5L30H 2EI6A 1NROH 2PKSB 3OSYA 5F8XA 4H4FA 3LGUA 3K9XB 1CE5A 3U8RH 2BXTH 2BY6X 1ELVA 1F0TA 1QBNA 4GUXA 4OGYA 1XUHA 3SI4H 1GDUA 3LGWA 1C1NA 2Y80A 5GPIB 1GBIA 8KME2 3ESTA 1B0FA 1O3GA 1ID5H 3TJUA 3PLBA 3VB4A 2XBXA 2FO9A 4YLUA 1O31A 1BMMH 1EKBB 2BDGA 1WOFA 2BY7X 5C1YA 3SUGA 1XUKA 4Z0KA 5C67A 1VGCC 1A2CH 4H6TA 1A3EH 2R2WU 4HTCH 1PPGE 3Q3KA 5I25A 2ZFRH 2G52A 3ZZ4A 5T6DA 3UOPA 1C5SA 3SOSA 2ZDKA 2ZPQA 3BIUH 4BAQB 1F0UA 1CGIE 2FS8A 2OBQA 1GJ7B 3RLWH 1L1JA 4JZEH 1ZYOA 3MU8A 3WY8A 1PYTC 1MTNB 1RGQA 1V2KT 2Z9LA 1DICA 3UUZA 3TJOA 1L1NA 2F9PA 3N7OA 4RN6A 3RXCA 5GJ4B 4ESTE 1QBOA 3EAJA 3A7YA 2Z3CA 2BDIA 1SVPA 1O2VA 1QQUA 2Y82A 1NESE 1LMWB 2JH0D 3UQVA 3LOXA 3ENSB 2TPIZ 1BJUA 1GHAF 3A84A 3F9GA 1NPMA 3SU3A 3SU2A 3S7KB 4LK4A 1O2MA 2Q6GA 1GVKB 2ZDVH 2ZHWH 3SN8A 1O2GH 1CA8B 2OQUA 1AHTH 3URCA 3V0XA 1ABIH 3B8JA 2ZPSA 3HK6B 4Q7ZA 3PROA 1G3CA 3A8CA 3TIUA 2THFB 1EAUA 1C1QA 2FOHA 4FUHA 5LPRA 4X6OA 3MO3A 1O2IA 2HPPH 5A8XA 4X2YA 1AIXH 4YOIA 1L4DA 1P2NA 1O5CB 5FAHA 2SGDE 1GBMA 1YGCH 3PWBA 3FFGA 4TPYA 2VNTA 1YYY1 1JWTA 4SGBE 1XUJA 1YPHC 2ZP0H 4Y8XA 2W7SA 2BY8X 2GP9B 3SJ9A 2ZEBA 4RSPA 4BAKB 1K28D 1TNIA 4ZHMU 3PMBB 2B5TB 2B9LA 4JYVH 1GGDB 2EI8A 1TQ7B 2BOKA 3SGAE 5IDKA 1Y59T 2SGEE 1V2VT 1YPGH 2LNCA 1LQEA 4BTIB 5TCCA 2PTCE 3TGJE 1A7SA 2A4QA 3SU1A 1EUFA 3DD2H 2CHAB 3BTDE 1S85A 1O2UA 1O34A 3VB5A 2C4FH 1A0JA 1HAOH 3ZZ6A 1WAYB 1SQOA 2TGAA 1SFQB 1QL8A 4X1NU 2XC5A 1YCPH 3MO9A 3AW1A 1GI0A 2BLVA 4ZHLU 5LPFA 1TFXA 2IOTA 1IQKA 1BRAA 3FVFB 3PMJA 1SGYE 1DWEH 2GTBA 2F91A 3BSQA 4D9RA 3PMAB 3AAVA 4K5ZA 2PTNA 2ODQA 4NSVA 4X8VH 4IC5A 2CMYA 4NA8A 4O3TA 4CBOA 3E0NB 1SLVB 3L33A 3ZVFA 1QR3E 8GCHF 4NFFA 1O32A 4U30A 4KTSA 4MPXA 4CR5A 3S9AA 4ABEA 1FY8E 4AYVB 2AGIX 1GHXH 2VINA 3BG4B 1AO5A 1K1LA 1JOUB 3C1KA 2VVVA 3AW0A 2D1JA 2CN0H 4CRCA 3P8NA 1VITG 1UMAH 1O3HA 1C5LH 1C1OA 1UHBA 4HI3A 1DS2E 4R8TB 1G2MA 1VJ9U 4H42U 3T5FH 4MPVA 3QZRA 1EAXA 1O3NA 2GZ7A 4WXIA 4ABHA 1RTFB 2G8TA 1GWAA 1GHBF 1SLUB 2ZFPH 1C1SA 5C1UA 1UCYH 4FUGA 3A82A 3MU4A 3SO3A 2ZDNA 2WPIS 4UEHH 3M5OA 5CHAC 1HBTH 2FX6A 2QY0B 3RXGA 5F6MA 1VGCB 1CQQA 1UTPA 4AFUA 1YPJH 3QTOH 2FOFA 4MG3A 2FS9A 5BRRE 2OUAA 1MQ5A 1K1OA 1ELTA 4FU9A 1BTWA 4UFGH 3KQEA 3LT3A 2CF8H 2FMJA 1BBRH 1HRTH 4I8HA 1QURH 2AMPA 1DITH 2XWAA 4NZLA 4UONA 1O2LA 3UY9A 2AS9A 1KLJH 1D3PB 1W7XH 3P6ZB 1T32A 3M35A 1TGBA 1P06A 1J14A 3S9CA 1YLDA 3BN9A 3KNXA 3QN7A 4MLFB 2A0QB 3EGKH 1H9LB 2BD8A 1TQ0B 4XE4A 3U1JB 2QV1A 1K1PA 1BTHH 1BTYA 3TNTA 1MZAA 1EP5A 3T29A 3LGTA 1C2KA 2PKAA 3EDXB 4UE7H 2G4TA 3OY6U 4DT7B 1OKXA 4HFPB 2GDEH 3M3SA 2P94A 3BEFB 3F9FA 3RXJA 3SI3H 1GBJA 2FI5E 2A4RA 5T6GA 1BITA 1GJBB 2A5IA 1THRH 3OX7U 3EA7A 1SOTA 3QGNB 1OPHB 1TNJA 2R0LA 3CP7A 1C5MD 1LKBA 2FI4E 1UVTH 4JMYA 3ZVEA 3DFLA 3BTEE 2C3SA 2BD2A 2P3TB 3ZZ9A 3UNSA 4ZROA 1SSXA 1JMOH 3D65E 1FV9A 1HAPH 1J8AA 1NRSH 4B76A 1S83A 3RU4T 5HXFA 3GY6A 1U6QA 1S5SA 1E34B 4Q2KA 4IN2A 2BX4A 1Q31A 2C8WB 1L4ZA 4GAWA 4H6SB 1FIZA 1BB0B 2W7UA 1ARCA 8ESTE 1ANCA 2GKVE 2ZU3A 2QXGA 1C1TA 1GBHA 1G2LA 1UK2A 1OOKB 4AB9A 3SHCH 4NG9H 1S6FA 2H6MA 2QA9E 1UJ1A 1WTHD 1T31A 3VGCB 1G37A 2FP7B 5A8ZA 3DA9B 4I8KA 1AY6H 4KKDA 2Y7ZA 5FX5A 2F9BH 4ABIA 1P9UA 2KAIB 1Q2WA 2ZI2H 3BF6H 3BTTE 1O2HA 2P3FH 1AVGH 5A0BA 2SFAA 4YZUA 2ZTYA 4LOYH 2H1UA 3V7TA 1WCZA 4IMQA 1NU9A 2Z9GA 1EQ9A 2ZQ2A 2HNTF 4GSOA 3QUMP 5FPYA 3VFEA 1O2TA 1EJNA 3QTVH 1BHXF 4OS6A 1MAXA 4Y7AA 1D6WA 4A1TA 7LPRA 5HM9A 4X0WU 4X8UH 3A8DA 3RXDA 4A5TS 1PPBH 3HPTB 1FY1A 1TMTH 3RDZA 2BDYA 1TMUH 4RKJB 5LGOA 2VH6A 1DWCH 1ZGIA 1MBQA 1OP8A 3QWCH 1XVMA 1GVLA 1AFEH 2Y5GA 2VIWA 4Y79A 4AG2A 3PLKA 1Z6JH 4YLQH 3M5NA 5FCKA 2B8OH 1JBUH 5C20A 1MQ6A 2A32A 3L6PA 1GI1A 1O3PB 7GCHF 4Y10E 1WTGH 5G4BA 1PQ7A 4XFQA 3T25A 4K1SA 2XXLA 1DVAH 1WYKA 3CS7A 5AHGH 1FY3A 2BVSH 1ZPZA 3CS0A 2ZTZA 1CGJE 1BA8B 1LVYA 1SGTA 3SUFA 4CREA 4CBNA 2ODPA 1HAIH 1O5AB 3KEEA 1Y8TA 2D2DA 2UWLA 4MTBA 2GMTB 2HOBA 3K6ZA 3V12A 2YOLA 1NM6A 2ZGCA 3K6YA 1SB1H 3UOUA 1LHGH 3SU0A 2ZZUH 1V2LT 1ANEA 1LCYA 3T62A 5CHAB 1T8LA 2W26A 2V3OH 4WWYA 3ZZ5A 3PLPA 3BTGE 3SNCA 3UWIA 2BTCE 1SGFG 3RXSA 3R0FA 4ABJA 5B6OA 1LVOA 3LIWA 3BTME 1NZQH 4F49A 1K2I1 1UCYE 2BQ7B 1N8OC 1Z7KA 2SGFE 3RM2H 1BRBE 1L1GA 1C1PA 4PROA 1FAKH 4JK6A 1SFIA 1HJ9A 2O8WA 2ZFQH 4NIYA 1P0SH 3F68H 3RC4A 4FUEA 2CXVA 3GY2A 1MUEB 3UFAA 2OQ5A 2FOEA 1BBRE 1KYNA 1GMHF 2J92A 2G51A 4BOHA 3GCNA 4AOQA 4CHAC 2EA3A 1GI7B 3NCLA 2Y5FA 4CH8B 1HAZB 3KQCA 3IWMA 3GDUA 1CO7E 2Z9KA 4DGJA 4JYTA 1GCTC 1DM4B 3A80A 3PO1C 1YCPK 1O2NA 1TWXB 3U8OH 3R3GB 5F03A 1YPEH 1O3KA 1LTOA 2PHBA 5E0GA 1BTUA 2BD7A 5ESTE 3RUOA 1GBCA 1WU1A 4KP0A 3KF2A 1T7CA 2HLCA 3TNSA 3HGPA 1SMFE 4ZMAH 5ABWA 2BXUH 4HZHA 5A0CA 3S0NA 2XBVA 1O2QA 1P2OA 4MPWA 1ZR0A 4BANB 4JK5A 2RCEA 1C2LA 1C5XB 1ZHMA 3TITA 3ZV8A 1QRXA 1ORFA 2IJOB 1SGEE 1QRZA 1V2TT 4YESB 1EP6A 1SGFA 5EGMA 4Q7XA 1IHTH 2BM2A 2HNTE 2F9OA 4Y11E 3T2NA 1K9OE 1V2NT 3SNBA 4NIWA 1IOEA 2ZDMA 2HPQH 4SGAE 1KXBA 3U8TH 2FTMA 4IBLH 1UCYK 2BYAX 5HYOA 1CHOG 3BEIB 4AX9H 1MD7A 2BVRH 3F6UH 1GVZA 1O3FA 4GCHF 3RU4E 1MH0A 1NS3A 1SGNE 1VJAU 3A89A 3A7TA 2RG3A 2ILNA 2VIVA 1TIOA 1TNGA 1GMCF 2D26C 4YOGA 2IN2A 6ESTA 2HGTH 7KMEH 1JRTA 1P3EA 2QXJA 1TALA 4INLA 4AN7A 1BBRK 5EXMA 2R0KA 3A8AA 2ALPA 1S0RA 1ELGA 2FIRH 1RS0A 1BUIA 1C2EA 3EA8A 2DE8A 1CBWC 1AFQB 3PTBA 1OS8A 1ZTKA 1GBAA 2CJIA 3E3TA 1TLDA 1GBDA 5GDSH 3TK9A 4B74A 2J2UA 1O3IA 2B0FA 2SGPE 1WUNH 4AGJA 1CHGA 1S0QA 1UHBB 3D23A 2BDHA 1DY8A 3UR9A 1O37A 4WF8A 1A5IA 4BXSA 2P8OB 1ZRBA 1P03A 1B0EA 1HXEH 3GY8A 3DFJA 3VXFH 1A1RA 1FMGA 3M5LA 2OTVA 3M36A 1C5UA 1YM0A 1BZXE 1GL1A 2BLQA 3TH2H 1P2KA 3B9FH 3SUEA 4JYUH 3STIA 1UK4A 2VWOA 1GG6B 2TGPZ 2WPHS 3A7WA 1MU8B 3KIDU 1Y3VA 1GJDB 2XYAA 4UFFH 1KDQA 4D7GA 1LPZB 1ABJH 1E35B 1AU8A 5DP8A 1XXDA 3P17H 2G81E 4FUDA 2G5VA 1ETSH 5C5NA 4X2VA 1HCGA 3ODDA 1TX7A 1MCVA 5I46H 1O30A 1K1JA 2QIQA 2R3UA 4JZ1A 1QIXB 1GI5A 1DOJA 2FWWA 4B2AA 1GHYH 3G01A 2I6QA 4LXBH 3W95A 2PKAB 1GHVH 4BNRA 4X1RU 3U69H 4OS1A 1PFXC 4DY7B 5F8ZA 3A8BA 2FOAA 1ZSJA 4ABGA 8LPRA 1Y3UA 1MTSA 2Y5HA 5E0JA 1IQGA 4I33A 5JB9S 1O2SA 1V2ST 1WQSA 4WMFA 3UQOA 2J94A 4NZQA 4D8NA 4WXVA 1A0HB 5E8EH 4GHQA 2C8XB 3P8FA 4IN1A 1D3DB 1XUGA 4I32A 1TGSZ 2GGVB 1KY9A 5EQSA 1O2OA 3U1IB 2ZGHA 1V3XA 1XX9A 3S69A 1ACBE 1GDQA 4X8SH 2ZU5A 1GCDA 1SC8U 3GCHB 4TWYA 4CHAB 3SORA 3E90B 2QXIA 1TMBH 1PQ8A 2BDAA 4AFQA 3SV9A 3A85A 1GCTB 2A2XH 4Y76A 3EQ0H 2FI3E 1D6RA 1GJ6A 1OYQA 3NK8A 4TPIZ 3LH3A 5EW1H 2EC9H 4I7YH 1S84A 2OINA 5K0HA 3BIVH 1QL9A 4QT8C 1YP9A 2PFEA 4WY3A 1J9CH 2AH4X 5FHTA 3KCGH 2ZCHP 4B73A 2ULLA 4B2CA 2Z94A 1AB9B 3RXTA 2PLXA 1NTPA 4B71A 2OP9A 5PTPA 2GCHG 1NFXA 1E0FD 1JRSA 1MCTA 4X1QU 4X6NA 1IQNA 2UWPA 2RA3A 1JIMA 5JBBS 4I8JA 1YKTA 1P2JA 1GMCG 5EXLA 4A1VA 1IQMA 1GJ5H 2HWLB 2VIOA 3ITIA 3F9EA 2I6SA 2VWNA 2QC2A 4X8TH 6GCHG 2FYRA 1HNEE 2BHGA 1ESAA 4K1TA 3VB6A 1ZHPA 1KLIH 2BOHB 1F5LA 5C2ZA 4OS2A 3ATWA 5SGAE 4Z6AH 2EEKA 1S82A 4FUCA 2O8TA 2TGDA 2Z3EA 1PQ5A 1G36A 1AVWA 5FX6A 1KXFA 1O39A 1MTWA 1ESTA 2V6NA 3EYDA 3NKKA 1HDTH 3QDZB 1EATA 4ISOA 4R0IA 2R2MB 3RMMH 1AQ7A 1VCPA 1RIWC 1C1WH 3LGVA 2W3KA 2HNTC 5DO4H 1XM1A 1CBWB 1DWBH 3DHKH 1BCUH 1AVXA 1TGCA 2FYQA 2AIQA 1OWJA 2XC0A 3ZZAA 4OS5A 2OXSA 1GI2A 2F3CE 2GZ8A 2UUJB 3H7OA 2Z3DA 3ATIA 1DWDH 1HAHH 3LJOA 1J17T 2J38A 2STAE 1QA0A 3E6PH 1MKWK 1HAYB 1QCPA 1XVOA 4NA9H 1SHHB 5AVDA 1DLEA 5L2YH 3MU1A 1HLTH 1DUAA 4YM9A 4YT7H 3ZZCA 1BT7A 1HAXB 2ZQ1A 2XRCA 4TY6A 2H9TH 4XDEA 5JPMH 1IQJA 2GD4B 3Q77A 4ZKRU 4NCYA 1NT1A 2CV3A 2FEQH 4AORA 2FXRA 2JETC 1P10A 2AFQB 3TGIE 2ZU1A 3ZVBA 3KL6A 4LZ4B 3ZVCA 4Y71A 3QZQA 1SI5H 1NFWA 2AGEX 3M61U 1O3LA 1TX8A 1MMJN 4ZKSU 3PV4A 2VVUA 1DFPA 1XUFA 2ZGJA 4I8GA 1MTUA 1MAYA 5DGJA 3SQHE 4ABFA 1GHAG 1IQEA 3F9HA 2PWXA 1XKAC 1HAVA 2ZGBH 2Q6DA 2JKHA 5FXLA 5EG4A 3RXAA 2PW8H 3MMGA 2PUXB 5HMAA 3FAOA 3M5MA 2Y81A 4E7RG 1HB0B 2BX3A 4KTCA 3GDSA 5HGGA 5GXPA 1OSSA 3E16B 1HFDA 3BTWE 5EXNA 3M37A 4DCDA 2AMDA 1UTOA 1FIWA 1GHZA 4I8LA 3STJA 3OYPA 1UTKA 2AEIH 2P16A 2Z9JA 1LQDB 3MH4A 1SGQE 2ODYB 1AMHA 1ZMLA 1BMAA 2OC0A 3GOVB 1XKBC 3GY4A 1DXPA 3VEQB 3A7XA 3I78A 3LGYA 5DG6A 1SG8B 2OC8A 1EZQA 2ZIQH 1A4WH 1SQTA 1YPKH 2ZGXH 2A1DB 3GCTF 1DY9A 2W3IA 4O9VA 1W14U 4MVNA 1WSSH 2SGQE 2Z9IA 2CGAA 1EAWA 3P92A 1F5RA 1ZMJA 1PJPA 3RXFA 2VWLA 2A31A 4Y8ZA 3MI4A 3UTUH 4UFDH 3OY5U 5H4IB 5EQQA 3FANA 4GLYA 3QO6A 1TBZH 1SLXB 1A0LA 4X2XA 1ZGVA 1TNKA 2BQ6B 5GCHF 5GWZA 1HYLA 1P2MA 1O3AA 5AFZH 3GYLB 3VPKA 5JDUB 2ZU4A 3RXMA 2VU8E 1O2KA 5JBTA 5JYIA 3EE0B 4U01A 4F4OC 3SZNA 4B75A 4DG4A 3PB1E 4VGCC 1GBKA 4K60A 5A8YA 4OGXA 3S7HB 2BMGB 2PGBB 1P8VC 1TPSA 2BZ6H 1PQAA 1C2IA 2WV5A 1F5KU 3MH5A 1LHDH 1W3CA 1B7XB 2Y7XA 1FN6A 1H1BA 1TX6A 2PSXA 2R9PA 5JBAS 3RXEA 3H7TA 3O8CA 4DIHH 1W7GH 3B23B 4AG1A 4CH2B 4LZ1H 4B1TA 1GBFA 1A61H 1ZPCA 8GCHG 1SL3A 1O33A 1GMDF 1HGTH 1TPAE 3NWUA 5A2MH 4FU7A 4A6LA 1GBEA 2BDBA 4E05H 1FUJA 2VGCC 4JZIA 1UVOA 2ALVA 1CSOE 1QJ6B 1QJ7B 4YO9A 3RXIA 1BRCE 3RXQA 2C93B 3E0PB 4K1EA 5A09A 3HGNA 1OX1A 5HM2A 1K1MA 1Y5AT 1NFUA 1XUIA 1ETTH 3DT0H 3UNQA 1GI4A 1F0RA 1PPFE 1TBQH 3GCOA 1LHEH 3TH4H 1GHBG 2XCFA 2ESTE 1FXYA 1LO6A 5DP7A 1F2SE 3KN2A 3BTKE 3E8LA 2XCNA 1BHXB 4AGKA 5J4SA 2Q6FA 1C1RA 1O2XA 1EPTA 1KDQB 4ABBA 2BD9A 1ZJDA 1EAIA 1TNHA 2PKSC 2VIPA 3RXHA 3MHWU 4MNXA 4ZH8A 2FLBH 1PYTD 1BTPA 4NFEA 4BTTB 3I29A 1M9UA 1SBWA 2ZU2A 1SGRE 2QCYA 4K3JA 1ESBA 1MU6B 1C4Y2 2XBWA 1CVWH 3GYMA 1GI3A 5ETXA 3H5CB 5EPNA 3SU5A 3BTHE 2QYIA 3UR6A 2Z7FE 5A0AE 1W13U 3DUXH 3ATMA 2VB0A 1J16A 1QB1A 1TGTA 2A7CA 2JETB 1G9IE 4ZAEA 3NZIA 1D3TB 3RMNH 3LC5A 3GDVA 5JB8S 4RKOB 4AYYB 1ZLRA 4OS7A 1T4UH 5EW2H 1AE5A 3VXEH 5L6NH 1DSTA 2UUYA 3ZYEA 1C5YB 4GVUA 3SV2H 3KHVA 3ZZ7A 1GI9B 2Z6BD 1MTNC 4TWWA 4DJZB 2BLOA 4INHA 4E7NA 1H9HE 2NU1E 1O36A 1BJVA 1WQVH 1O5FH 3AASA 4WH8A 4BAHB 3Q76A 3K65B 4HGCA 1N6YA 1C9TA 3RXPA 1ELCA 1MKWH 3NXPA 3RC6A 1ZRKA 1ZJKA 5L2ZH 1QQ4A 3W94A 2BVXH 4BAOB 1ZMNA 1UK3A 4O97A 2NU4E 1GBLA 3GY3A 1LVMA 4KTUA 1DLKB 2XC4A 2ZDLA 3RXRA 2H5CA 1C9PA 2VWMA 1C2FA 2C90B 1SPJA 5CMXH 3A7ZA 3T27A 4XBDA 5DP4A 4ISHH 5DP6A 3HKIB 1E36B 1C2DA 3P8GA 4X1PU 1AZZA 3AVZA 1C5WB 1PPEE 1GJCB 1LDTT 1QGFA 2BY9X 1O3DA 3PWCA 2G4UA 3MNCA 4FUIA 3LH1A 1FY5A 3LKWA 3A7VA 2OLGA 3RXUA 4FUFA 1ZZZA 1AKSA 2QAAA 2NU0E 1QL7A 3MU0A 1QJ1B 2C8ZB 3BG8A 4X6PA 1C5VA 2UUFB 1GMDG 1BQYA 4AB8A 4MPUA 1ETRH 1FZZA 1FQ3A 1V2UT 1F92A 4MNVA 4CR9A 1C2JA 1GGDC 4VGCB 3RXKA 3TU7H 2UUKB 2BY5X 1YBWA 3ZYDA 2PUQH 3KQDA 1WV7H 4DW2U 1AUTC 1TYNA 3RU4D 2WV4A 1A46H 1EPTC 4IGDA 4IMZA 2OBOA 1IQIA 3UWJH 2CHAC 1O2ZA 2ZFFH 1P05A 4B2BA 7GCHG 2SNWA 2A4OA 3BV9B 2VGCB 5EODA 4ZKOU 4X2WA 5C1XA 1ELDE 3MFJA 1FPHH 3FP6E 1KIGH 1C2MA 1HAGE 2ANKH 3P95A 3D62A 4BAMB 1ZOMA 4UD9H 3M3VA 1LPGB 2XTTB 1E37B 4BTUB 2FODA 3SJIA 2ZHFH 1GDNA 2ZKSA 1IQFA 6CHAC 1AWFH 1TRNA 1W2KH 3ELAH 1C5TA 2ZCLP 3ATLA 9LPRA 1QFKH 3O8BA 1IHSH 2WPKS 1TA6A 1HXFH 3ZZ3A 1MBMA 3U9AH 4A1XA 1QNJA 1RJXB 3TVJB 1P57B 1EXFA 1OP0A 4U32A 2ZNKH 2ZTXA 3LU9B 3NUMA 2ANMH 2FX4A 1BOQA 2PSYA 1NN6A 1QY6A 1S6HA 2RA0A 4CRDA 3TH3H 1OWKA 2GCTC 3TJNA 1HAVB 2A5AA 4ISNA 4WMEA 1C4V2 3RC5A 2O9QA 3LDXH 4IC6A 2VJ1A 1Y3XA 3TK5A 1G3DA 3IG6B 3ZVAA 4BXWA 4NIXA 1NRPH 2WPLS 2ANYA 3F1SB 1FDPA 3D49H 3UNRA 3TGKE 2J9NA 5DP3A 2HVXA 1QTFA 3A83A 1Z8JB 2BZAA 4FVBA 1TNLA 1GMHG 2GDDA 1C5NH 3QK1A 1VITF 1GJAB 1EB1H 3UPEA 2UWOA 2AIPA 2WYGA 1HIAA 1QHRB 4A92A 2JH6D 1FONA 1AE8H 1N8OB 4J2YB 3SW2B 2SGAA 4ZUHA 3MYWA 1YC0A 4YOJA 2ZPRA 1YF4A 2BB4A 1G3BA 4FUJA 1KXDA 1C5ZB 1O5DH 4ABDA 1LVBA 1V2JT 2GT7A 4FVDA 5BPEA 1GBBA 2A45B 2ZC9H 2OC7A 2Q1JA 3TPIZ 3SV7A 1PPCE 3ODFA 1CA0C 4JCNA 2FOCA 4GHTA 1DX5M 5K7RA 3PO1B 1W10U 3HATH 3EA9A 2P95A 1O3BA 2ZG0H 1EOLA 1T8MA 2F9NA 2GV7A 3SGBE 3JZ1B 4MNYA 4X1SU 2FLRH 4Y8YA 1TB6H 1ANBA 1RD3B 1ELEE 1W0YH 2XBYA 1P01A 2OCVB 5DK1A 1ARBA 1BIOA 1FLEE 4CRAA 1Y3WA 1GI6A 1Y5UT 3SGQE 2GV6A 3QX5H 1F7ZA 4GCHG 3RLYH 1DT2A 3K2UA 1Z1JA 4WMDA 2A7JA 4K69A 4UDWH 4IW4E 3TLOA 5IYTA 1UVPA 2J4IA 2VVCA 5FPTA 4NWKA 2ZECA 4D76A 4CRFA 3O8DA 3MTYA 3GICB 1T4VH 3TJVA 1SQAA 1C5RA 2HRVA 2BLWA 4FXGH 1H9IE 2VIDA 1SGPE 1ZTLA 2STBE 4ISLA 3GY7A 1FAXA 5FBIA 1C2GA 3PYHA 3RMLH 1H8DH 3VGCC 1EOJA 5GIBA 1TONA 2F9UA 2FOBA 4INKA 4NSYA 3SV6A 3CENA 3SNDA 2ZCKP 3MNXA 1Y3YA 1ANDA 1MD8A 1FJSA 2ZFSA 3KGPA 4YTAA 3GY5A 3OU0A 4AFSA 5E0HA 4NGAH 3RM0H 3C27B 1AD8H 3FP8E 1EPTB 5JBCS 4Y0YE 1QB6A 5DJ7A 1DSUA 3P70B 3TK6A 2D8WA 3MH6A 1C4U2 1CU1A 3RP2A 2ZFTA 3V3MA 3M7UA 5C3NA 4Q80A 4ZXYH 1HJ8A 2G55A 1K1NA 1KLTA 4ZKNU 3SJOA 1CT4E 1D3QB 1W0ZU 3ATKA 1V2QT 1NC6A 1TABE 2ANWA 1TRYA 3QGJA 5E2PA 3PTNA 4K2YA 2NU2E 2BD4A 1BDAA 1IQLA 5TJXA 2TGTA 2XNIA 4DVAU 6CHAB 2GT8A 1UTNA 9ESTA 3UIRA 1D9IA 1BMLA 1THPB 1O2WA 3MU5A 2NU3E 1YCPM 1EZSC 1F0SA 1N6XA 1O3OA 1RTKA 4Y0ZE 5FCRA 4K8BA 1OP2A 4ISIH 3VB7A 2FTLE 1FN8A 2QF0A 1XXFA 3KQBA 1ZHRA 2GMTC 1T8OA 2QN5T 1UTQA 3URDA 1O38A 1C1MA 2BD3A 2GCTB 3T26A 1P04A 2QGRA 1ZPBA 2ZA5A 1AGJA 1OWHA 1TPOA 1GBTA 4JZDH 1EB2A 3MWIU 4MDSA 4WVPE 3SU6A 1AI8H 1DUEA 3LJJA 3ZVDA 2RDLA 2LPRA 1J15A 1PPHE 1XMNB 1Z8IB 1P02A 2FOMB 1TE0A 4ZHAA 1OWIA 1DPOA 1Z1IA 1MKXH 2VIQA 2V0BA 1NO9H 1ELFA 4ZXXH 2YNAA 4I31A 1AWHB 2BDCA 1VZQH 2ZO3H 1G32B 1O0DH 2K1QA 1C1VH 1Y5BT 2YNBA 3RXOA 1V2OT 1P12E 3E91A 4NWLA 1UTMA 4CRGA 1HJAC 1Z71A 3SQEE 3MO6A 4OS4A 1KTSB 2AGGX 1KXAA 2FPZA 2ZDAH 1BMNH 4AZ2B 2BQWB 1FI8A 1Z6EA 1UTLM 5J4QA 4Y6DA 4ABAA 3FZZA 3Q3XA 1AKSB 1CA0B 1G3EA 3ZVGA 1C1UH 3HK3B 1HPGA 2PV9B 4D9QA 1UTJA 1EZXC 2A5KA 4A7IB 3SJ8A 2Y6TA 3SNAA 1INCA 3HKJB 2QF3A 1O2JA 1V6DA 1O5BB 1QA7A 3AAUA 3GISB 5LH8A 1AN1E 2TBSA 1EX3A 2HALA 5AF9H 1V2RT 2G00A 2O8LA 1EJMA 2GX4A 3SJKA 2M5TA 1KTTB 5DP9A 5ESBA 2XWBI 4DURA 2TRMA 1HUTH 1TGNA 1B5GH 1V2MT 1CGHA 3M7TA 4YT6H 5EOKA 4XSKU 5CE1A 4J1YA 4UFEH 3LGIA 2J34A
chains in the Genus database with same CATH superfamily
1A5HA 4Q63A 1PPZA 5T6FA 4O3UA 4KELA 2GZ9A 1LHFH 1OXGA 3Q3YA 1GI8B 1GHWH 5EPYA 2WYJA 1SR5C 2HLDD 1O5EH 4F48B 5T3HA 1A5GH 1LPKB 4D7FA 3MOCA 1CT0E 2OD3B 1E38B 2G5NA 1NRRH 1QB9A 1OWDA 1TRMA 1NFYA 3BEUA 1DDJA 5AFYH 3A87A 2EI7A 3P8OA 1AZ8A 2ASUB 2AYWA 1AFQC 3DSPA 1KXEA 1RIWB 2IPQX 1X7AC 3QLPH 2SNVA 1ELBA 4NA7A 1CT2E 1GJ9B 1IAUA 2ZHEH 2M2AA 2V3HH 2ZHDA 3Q00A 1O35A 2A7HA 1UVUH 1CHOF 4GPGA 2H9EH 3V13A 1BRUP 1TAWA 3VB3A 1SLWB 1TPPA 1P09A 2P8OC 4Y7BA 1O3JA 5E2OA 1GJ8B 2CF9H 2WPJS 3M3TA 3M7QA 1VCWA 2C8YB 1DE7H 1OWEA 4FUBA 3ZZBA 2FDAA 3MNBA 1Z8RA 3NPSA 1FY4A 2R3YA 1TOMH 4TY7A 4DOQA 2B7DH 2XW9A 3LONA 1SHYA 3LPRA 2P59A 1GG6C 1TOCB 1GJ4H 2AERH 1P11E 4WH6A 1SQRA 1O2PA 1C5OH 1ZSKA 1GL0E 1HIAB 2FESH 2ZF0H 1EZUC 1KXCA 3BTFE 5TCAA 2V35A 1UO6A 1NY22 3FOAA 4ZCNA 2ZHQH 1NRNH 4MQAA 3RXBA 1SGDE 2FM2A 3L3TA 3ZV9A 1EJAA 1GPZA 1FPCH 3RXVA 4IS5A 3PM3A 1ELAA 5EJLA 5C5OA 1C2HA 1K1IA 3GCTG 1LHCH 1JIRA 1NU7B 3OAAD 1NRQH 3ZZ8A 2YMSD 3MH7A 1DANH 4JZFH 1L0ZA 1P2QA 1QZ8A 3OEHD 4FU8A 3E1XB 1L2EA 1YPMH 2PR3A 4MNWA 1H4WA 3ZIAD 2WUBA 2FOGA 1LKAA 1YPLH 3SUDA 4DIIH 2LP6A 2XNDD 4ACBA 4NIVA 5GCHG 2TIOA 4K8YA 2H9HA 1HJAB 2P93A 1YPHE 1SOZA 1VCQA 5EQRA 3SU4A 1D4PB 1ZTJA 2H5DA 3SHAH 1O5GH 1G30B 1RTLA 3RXLA 1C5QA 3A86A 1P3CA 1IQHA 1UVSH 3GCHC 2P3UB 5EU8A 5CHBA 5DPAA 2A2QH 4CRBA 5DP5A 1MZDA 2WINI 1W11U 4Q7YA 2FZZA 4KGAA 5LPEA 2J95A 2JH5D 3SBKA 4XBBA 1QRWA 1S81A 1ZSLA 2H2ZA 3RMOH 1BTZA 1EASA 3BTQE 1AB9C 3LC3A 4WJG2 3SV8A 1O2RA 1T8NA 3I77A 3FZDA 2IPHA 2PGQB 3A81A 2F83A 2O8UA 1O3EA 1TBRH 2WV9A 1V2PT 1KSNA 1HV7A 1Z8GA 3T28A 1K22H 5CDFE 1VR1H 2WUCA 3ZZDA 2VH0A 1N1LA 1V2WT 4U2WA 4ASHA 1O3CA 2WPMS 1O3MA 3IITA 1K21H 4O03A 1MTVA 2ZWLH 1SGIB 4XBCA 1JXPA 1OYTH 4THNH 2BD5A 3OTJE 2NWNA 1P9SA 4TYDA 4X6MA 2L6OA 2DUCA 5FBEA 2DE9A 2K0QA 2GCHF 3O8RA 2O8MA 5DKMA 3S9BA 3OFND 1AUJA 3UREA 1C5PA 3OEED 6LPRA 3PMHB 1QBVH 1WBGB 2GVFA 2F9VA 2GJGA 1VITH 1DXWA 3VG8A 1THSH 3JZ2B 4AFZA 4M7GA 1FNIA 3SNEA 1TA2A 1MKXK 1O2YA 1H8IH 1SGCA 4E06H 2QXHA 7ESTE 4XOJA 2W5EA 3U98H 6GCHF 2AMQA 1RRKA 1W12U 3W1EA 2KAIA 1A3BH 5F8TA 1YLCA 3A88A 1P2IA 4F55A 3MNSA 1Q3XA 1RXPA 1W8BH 5FPSA 3FP7E 3BG4C 2OC1A 2A4GA 1BTXA 1RFNA 5L30H 2EI6A 1NROH 2PKSB 3OSYA 5F8XA 4H4FA 3LGUA 3K9XB 1CE5A 3U8RH 4XD7D 2BXTH 3SZEA 2BY6X 1ELVA 1F0TA 1QBNA 4GUXA 4OGYA 1XUHA 3SI4H 1GDUA 3LGWA 1C1NA 2Y80A 5GPIB 1GBIA 8KME2 3ESTA 1B0FA 1O3GA 1ID5H 3TJUA 3PLBA 3VB4A 2XBXA 2FO9A 5KECA 4YLUA 1O31A 1BMMH 1FX0B 1EKBB 2BDGA 1WOFA 2BY7X 5C1YA 3SUGA 1XUKA 4Z0KA 5C67A 1VGCC 1A2CH 4H6TA 1A3EH 2R2WU 4HTCH 1PPGE 3Q3KA 5I25A 2ZFRH 2G52A 3ZZ4A 5T6DA 3UOPA 1C5SA 2F4LA 3SOSA 2ZDKA 2ZPQA 3BIUH 3F2FA 4BAQB 1F0UA 1CGIE 2FS8A 2OBQA 1GJ7B 3RLWH 1L1JA 4JZEH 1ZYOA 3MU8A 3WY8A 1PYTC 1MTNB 1RGQA 2EQNA 1V2KT 2Z9LA 1DICA 3UUZA 3TJOA 1L1NA 5C0TA 2F9PA 3N7OA 4RN6A 3RXCA 5GJ4B 4ESTE 1QBOA 5EIYA 3EAJA 3A7YA 2Z3CA 2BDIA 4M9FA 1SVPA 1O2VA 1QQUA 2Y82A 1NESE 1LMWB 2JH0D 3UQVA 3LOXA 3ENSB 2TPIZ 1BJUA 1GHAF 3A84A 3F9GA 1NPMA 3SU3A 3SU2A 3WW7A 3S7KB 4LK4A 1O2MA 2Q6GA 1GVKB 2ZDVH 2ZHWH 3SN8A 1O2GH 1CA8B 2OQUA 1AHTH 3URCA 3V0XA 1ABIH 2J98A 2ZPSA 3B8JA 3HK6B 4Q7ZA 3PROA 1G3CA 3A8CA 3TIUA 2THFB 1EAUA 1C1QA 2FOHA 4FUHA 4RT0A 5LPRA 4X6OA 3MO3A 2L74A 1O2IA 2HPPH 5A8XA 4X2YA 1AIXH 4YOIA 3DSGA 1L4DA 1P2NA 1O5CB 2YMSC 5FAHA 2SGDE 1GBMA 1YGCH 3PWBA 3FFGA 4TPYA 2VNTA 1YYY1 1JWTA 4SGBE 1XUJA 1YPHC 2ZP0H 4Y8XA 2W7SA 2BY8X 2GP9B 3SJ9A 2ZEBA 4RSPA 4BAKB 1K28D 1TNIA 4ZHMU 3PMBB 2B5TB 2B9LA 4JYVH 1GGDB 2EI8A 1TQ7B 2BOKA 3SGAE 5IDKA 1Y59T 2SGEE 1V2VT 1YPGH 2LNCA 1LQEA 4BTIB 5TCCA 2PTCE 3TGJE 1A7SA 2A4QA 3SU1A 1EUFA 3DD2H 2CHAB 3BTDE 1S85A 1O2UA 1O34A 3VB5A 2C4FH 1A0JA 1HAOH 3ZZ6A 1WAYB 1SQOA 2TGAA 1SFQB 2F43B 1QL8A 4X1NU 2XC5A 1YCPH 3MO9A 3AW1A 1GI0A 2BLVA 4ZHLU 1EFRD 5LPFA 1TFXA 2IOTA 1IQKA 1BRAA 3FVFB 3PMJA 1SGYE 2RFKC 1DWEH 2GTBA 2F91A 3BSQA 4D9RA 3PMAB 3AAVA 4K5ZA 2PTNA 2ODQA 4NSVA 4X8VH 5EJZA 4IC5A 2CMYA 4NA8A 4O3TA 4CBOA 5DN6D 3E0NB 1SLVB 3L33A 3ZVFA 1QR3E 8GCHF 4NFFA 1O32A 4U30A 4KTSA 4MPXA 4CR5A 3S9AA 4ABEA 1FY8E 4AYVB 2AGIX 1GHXH 2VINA 3BG4B 1AO5A 1K1LA 1JOUB 3C1KA 2VVVA 3AW0A 2D1JA 2CN0H 4CRCA 3P8NA 1VITG 1UMAH 1O3HA 1C5LH 1C1OA 1UHBA 4HI3A 1DS2E 4R8TB 4DT4A 1G2MA 1VJ9U 4H42U 3T5FH 4MPVA 3QZRA 1EAXA 1O3NA 2GZ7A 4WXIA 4ABHA 1RTFB 2G8TA 1GWAA 1GHBF 1SLUB 2ZFPH 1C1SA 5HIZA 5C1UA 1UCYH 4FUGA 3A82A 3MU4A 3SO3A 2ZDNA 2WPIS 4UEHH 3M5OA 5CHAC 1HBTH 2FX6A 2QY0B 3RXGA 5F6MA 1VGCB 1CQQA 1UTPA 4AFUA 1YPJH 3QTOH 2FOFA 4MG3A 2FS9A 5BRRE 2OUAA 1MQ5A 3H09A 1K1OA 1ELTA 4FU9A 1BTWA 1S6LA 3KQEA 3LT3A 4UFGH 2CF8H 2FMJA 1BBRH 1HRTH 4I8HA 1QURH 2AMPA 1DITH 2XWAA 5EJ1A 4NZLA 4UONA 1O2LA 3UY9A 2AS9A 1KLJH 1D3PB 1W7XH 3P6ZB 1T32A 3M35A 1TGBA 1P06A 1J14A 3S9CA 1YLDA 3BN9A 3DCLA 3KNXA 3QN7A 4MLFB 2A0QB 3EGKH 1H9LB 1NBMD 2BD8A 1TQ0B 4XE4A 3U1JB 2QV1A 1K1PA 1BTHH 1BTYA 3TNTA 1MZAA 1EP5A 3T29A 3LGTA 1C2KA 2PKAA 3EDXB 4UE7H 2G4TA 3OY6U 4DT7B 1OKXA 4HFPB 2GDEH 3M3SA 2P94A 3F0PA 3BEFB 3F9FA 3RXJA 3SI3H 1GBJA 2FI5E 2A4RA 5T6GA 1BITA 1GJBB 2A5IA 1THRH 3OX7U 3EA7A 1SOTA 3QGNB 1OPHB 1TNJA 2R0LA 3CP7A 1C5MD 1LKBA 2FI4E 1UVTH 4JMYA 3ZVEA 3DFLA 3BTEE 2C3SA 2BD2A 2P3TB 3ZZ9A 3UNSA 4ZROA 1SSXA 1JMOH 3D65E 1FV9A 1HAPH 1J8AA 1NRSH 4B76A 1S83A 3RU4T 5HXFA 3GY6A 5IK2D 1U6QA 1S5SA 1E34B 4Q2KA 4IN2A 2BX4A 1Q31A 2C8WB 1L4ZA 4GAWA 4H6SB 1FIZA 1BB0B 2W7UA 1ARCA 8ESTE 3N99A 1ANCA 2GKVE 2ZU3A 2QXGA 1C1TA 1GBHA 1G2LA 1UK2A 1OOKB 4AB9A 3SHCH 4NG9H 1S6FA 2H6MA 2QA9E 1UJ1A 1WTHD 1T31A 3VGCB 3U28C 1G37A 2PP6A 2FP7B 5A8ZA 3DA9B 4I8KA 1AY6H 4KKDA 2Y7ZA 5FX5A 2F9BH 4ABIA 1P9UA 2KAIB 1Q2WA 2ZI2H 3BF6H 3BTTE 1O2HA 2P3FH 1AVGH 5A0BA 2SFAA 4YZUA 2ZTYA 4LOYH 2H1UA 3V7TA 1WCZA 2KZ4A 4IMQA 3AK5A 1NU9A 2Z9GA 1EQ9A 2ZQ2A 2HNTF 2WPDD 3QUMP 4GSOA 5FPYA 3VFEA 1O2TA 1EJNA 3QTVH 1BHXF 4OS6A 1MAXA 4Y7AA 1D6WA 4A1TA 7LPRA 5HM9A 4X0WU 4X8UH 3A8DA 1BMFD 3RXDA 4A5TS 1PPBH 3HPTB 1FY1A 1TMTH 3RDZA 2BDYA 1TMUH 4RKJB 5LGOA 2VH6A 1DWCH 1ZGIA 1MBQA 1OP8A 3QWCH 4HG6A 1XVMA 1GVLA 1AFEH 2Y5GA 2VIWA 4Y79A 4AG2A 3PLKA 1Z6JH 4YLQH 3M5NA 5FCKA 2B8OH 1JBUH 5C20A 1MQ6A 2A32A 3L6PA 1GI1A 1O3PB 7GCHF 4Y10E 1WTGH 5G4BA 1PQ7A 4XFQA 3T25A 4K1SA 2XXLA 1DVAH 1WYKA 3CS7A 5AHGH 1FY3A 2BVSH 1ZPZA 3CS0A 2ZTZA 1CGJE 1BA8B 1LVYA 1SGTA 3SUFA 4CREA 2JJ2D 2QF5A 4CBNA 2ODPA 1HAIH 1O5AB 3KEEA 1Y8TA 2D2DA 2UWLA 4MTBA 2GMTB 2HOBA 3K6ZA 3V12A 2YOLA 3WWBA 1NM6A 2ZGCA 3K6YA 1SB1H 3UOUA 1LHGH 3SU0A 2ZZUH 1V2LT 1ANEA 1LCYA 3T62A 5CHAB 1T8LA 2W26A 2V3OH 4WWYA 3ZZ5A 3PLPA 3BTGE 3SNCA 3UWIA 2BTCE 1SGFG 3RXSA 3R0FA 4ABJA 5B6OA 1LVOA 3LIWA 3BTME 1NZQH 4F49A 1K2I1 1UCYE 2BQ7B 1N8OC 1Z7KA 2SGFE 3RM2H 1BRBE 1L1GA 3KYFA 4P00A 1C1PA 4PROA 1FAKH 4JK6A 1SFIA 1HJ9A 2O8WA 2ZFQH 4NIYA 1P0SH 2J98B 3F68H 3RC4A 4FUEA 2CXVA 3GY2A 1MUEB 3UFAA 2OQ5A 2FOEA 1BBRE 1KYNA 1GMHF 2J92A 2G51A 4BOHA 3GCNA 4AOQA 5B6LA 4CHAC 2EA3A 1GI7B 3NCLA 2Y5FA 4CH8B 1HAZB 3KQCA 3IWMA 3GDUA 1CO7E 2Z9KA 4DGJA 4JYTA 1GCTC 1DM4B 3A80A 3PO1C 1YCPK 1O2NA 1TWXB 3U8OH 3R3GB 5F03A 1YPEH 1O3KA 1LTOA 2PHBA 3PRDA 5E0GA 1BTUA 2BD7A 5ESTE 2OK5A 3RUOA 1GBCA 1WU1A 4KP0A 3KF2A 1T7CA 2HLCA 3TNSA 3HGPA 1SMFE 4ZMAH 4AC9A 5ABWA 2BXUH 4HZHA 5A0CA 3S0NA 2XOKD 2XBVA 1O2QA 1P2OA 1W0JD 4MPWA 1ZR0A 4BANB 4JK5A 2RCEA 1C2LA 1C5XB 1ZHMA 3TITA 3ZV8A 1QRXA 1ORFA 2IJOB 1SGEE 1QRZA 1V2TT 4YESB 1EP6A 3UAIC 1SGFA 5EGMA 4Q7XA 1IHTH 2BM2A 2HNTE 2F9OA 4Y11E 3T2NA 1K9OE 1V2NT 1MABB 3SNBA 4NIWA 1IOEA 2ZDMA 2HPQH 4SGAE 1KXBA 3U8TH 2FTMA 4IBLH 1UCYK 2BYAX 5HYOA 2W6ID 1CHOG 3BEIB 4AX9H 1MD7A 3SYJA 2BVRH 3F6UH 1GVZA 1O3FA 4GCHF 3RU4E 1MH0A 1NS3A 1SGNE 1VJAU 3A89A 3A7TA 2RG3A 2ILNA 2VIVA 1TIOA 1TNGA 1GMCF 2D26C 4YOGA 2IN2A 6ESTA 2HGTH 7KMEH 1JRTA 1P3EA 3OTPA 2QXJA 1TALA 4INLA 2KM0A 4AN7A 1BBRK 5EXMA 2R0KA 3A8AA 2ALPA 1S0RA 1ELGA 2FIRH 1RS0A 1BUIA 1C2EA 3EA8A 2DE8A 1CBWC 1AFQB 3PRBA 3PTBA 1OS8A 1ZTKA 1GBAA 2CJIA 3E3TA 1TLDA 1GBDA 5GDSH 3TK9A 4B74A 2J2UA 1O3IA 2B0FA 2SGPE 1WUNH 4AGJA 1CHGA 1S0QA 1UHBB 3D23A 2BDHA 5F53A 1DY8A 3UR9A 3MQKC 4FOUC 1O37A 4WF8A 1A5IA 4BXSA 2P8OB 1ZRBA 1P03A 4Z1MD 1B0EA 1HXEH 3GY8A 3DFJA 3VXFH 3KQ5A 1A1RA 5HIYA 1FMGA 3M5LA 2OTVA 3M36A 1C5UA 1YM0A 1BZXE 1GL1A 2BLQA 3TH2H 1P2KA 3B9FH 3SUEA 4JYUH 3STIA 1UK4A 2VWOA 1GG6B 2TGPZ 2WPHS 3A7WA 1MU8B 3KIDU 1Y3VA 1GJDB 2XYAA 4UFFH 1KDQA 4D7GA 1LPZB 1ABJH 1E35B 1AU8A 5DP8A 1XXDA 3P17H 2G81E 4FUDA 2G5VA 1ETSH 5C5NA 4X2VA 1HCGA 3ODDA 1TX7A 3PV2A 1MCVA 5I46H 1O30A 1K1JA 2QIQA 2R3UA 4JZ1A 1QIXB 1GI5A 1DOJA 2FWWA 4B2AA 1GHYH 3G01A 2I6QA 4TT3D 4LXBH 3W95A 2PKAB 1GHVH 4BNRA 4X1RU 4FETA 3U69H 4OS1A 1PFXC 4DY7B 5F8ZA 3A8BA 2FOAA 1ZSJA 4ABGA 8LPRA 1Y3UA 1MTSA 2Y5HA 5E0JA 1IQGA 4I33A 5JB9S 1O2SA 1V2ST 1WQSA 4WMFA 3UQOA 2J94A 4NZQA 4D8NA 4WXVA 1A0HB 5E8EH 4GHQA 2C8XB 3P8FA 4IN1A 1D3DB 1XUGA 4I32A 1TGSZ 2GGVB 1KY9A 5EQSA 1O2OA 3U1IB 2ZGHA 1V3XA 1XX9A 3S69A 1ACBE 1GDQA 4X8SH 2ZU5A 1GCDA 1SC8U 3GCHB 4TWYA 4CHAB 3SORA 3E90B 2QXIA 1TMBH 1PQ8A 2BDAA 4AFQA 3SV9A 3A85A 1GCTB 2A2XH 3CNRA 3EQ0H 4Y76A 2FI3E 1D6RA 1GJ6A 1OYQA 3NK8A 4TPIZ 3LH3A 5EW1H 2EC9H 4I7YH 1S84A 2OINA 5K0HA 3BIVH 1QL9A 4QT8C 1YP9A 2PFEA 4WY3A 1J9CH 2AH4X 5FHTA 3KCGH 2ZCHP 4B73A 2ULLA 4B2CA 2Z94A 1AB9B 3RXTA 2PLXA 1NTPA 4B71A 2OP9A 5PTPA 2GCHG 1NFXA 1E0FD 1JRSA 1MCTA 4X1QU 4X6NA 1IQNA 2UWPA 2RA3A 1JIMA 5JBBS 3PV5A 4I8JA 1YKTA 1P2JA 1GMCG 5EXLA 4A1VA 1IQMA 1GJ5H 2HWLB 2VIOA 3ITIA 3F9EA 2I6SA 2VWNA 2QC2A 4X8TH 6GCHG 2FYRA 3UB0A 1HNEE 2BHGA 1ESAA 4K1TA 3VB6A 1ZHPA 1KLIH 2BOHB 1F5LA 5C2ZA 4OS2A 3ATWA 5SGAE 4Z6AH 2EEKA 1S82A 4FUCA 2O8TA 2TGDA 3KYGA 2Z3EA 1PQ5A 1G36A 1AVWA 5FX6A 1KXFA 1O39A 1MTWA 1ESTA 2V6NA 3EYDA 3NKKA 1HDTH 3QDZB 1EATA 4ISOA 4R0IA 2R2MB 3RMMH 1AQ7A 1VCPA 4YXWD 1RIWC 1C1WH 3LGVA 2W3KA 2HNTC 5DO4H 1XM1A 1CBWB 1DWBH 3DHKH 5GNDA 1BCUH 4TSFD 1AVXA 1TGCA 2FYQA 2AIQA 1OWJA 2XC0A 3ZZAA 4OS5A 2OXSA 1GI2A 2F3CE 5KEDA 2GZ8A 2UUJB 3H7OA 2Z3DA 3ATIA 1DWDH 1HAHH 3LJOA 1J17T 2J38A 1E1RD 2STAE 1QA0A 3E6PH 1MKWK 1HAYB 1QCPA 1XVOA 4NA9H 1SHHB 5AVDA 1DLEA 5L2YH 3MU1A 1HLTH 1DUAA 4YM9A 4YT7H 3N7DA 3ZZCA 1BT7A 1HAXB 2ZQ1A 2XRCA 4TY6A 2H9TH 4XDEA 5JPMH 1IQJA 2GD4B 3Q77A 4ZKRU 4NCYA 1NT1A 2CV3A 2FEQH 4AORA 2FXRA 2JETC 1E79D 1P10A 2AFQB 3TGIE 2ZU1A 3ZVBA 3KL6A 4LZ4B 3ZVCA 4Y71A 2JDID 3QZQA 1SI5H 1NFWA 2AGEX 3M61U 1O3LA 1TX8A 1MMJN 4ZKSU 3PV4A 2VVUA 1DFPA 1XUFA 2ZGJA 4I8GA 1MTUA 1MAYA 5DGJA 3SQHE 4ABFA 1GHAG 1IQEA 3F9HA 2PWXA 1XKAC 1HAVA 1YLNA 2ZGBH 2Q6DA 2JKHA 5FXLA 5EG4A 3RXAA 2PW8H 3MMGA 2PUXB 5HMAA 3FAOA 3M5MA 2Y81A 4E7RG 1HB0B 2BX3A 4KTCA 3GDSA 5HGGA 5GXPA 1OSSA 3E16B 1HFDA 3BTWE 5EXNA 3M37A 4DCDA 2AMDA 1UTOA 1FIWA 1GHZA 4I8LA 3STJA 3OYPA 1UTKA 2WSSD 2AEIH 2P16A 2Z9JA 1LQDB 3MH4A 1NBME 1SGQE 2ODYB 1AMHA 1ZMLA 1BMAA 2OC0A 3GOVB 1XKBC 3GY4A 1DXPA 3EE7A 3VEQB 3A7XA 4B6EA 3I78A 3LGYA 5DG6A 1SG8B 2OC8A 1EZQA 2ZIQH 1A4WH 1SQTA 1YPKH 2ZGXH 2A1DB 3GCTF 1DY9A 2W3IA 4O9VA 1W14U 4MVNA 1WSSH 2SGQE 4I86A 2Z9IA 2CGAA 1EAWA 3P92A 1F5RA 1ZMJA 1PJPA 3RXFA 4B6FA 2VWLA 2A31A 4Y8ZA 3MI4A 3UTUH 4UFDH 3OY5U 5H4IB 5EQQA 3FANA 4GLYA 3QO6A 1TBZH 1SLXB 1A0LA 4X2XA 1ZGVA 1TNKA 2BQ6B 5GCHF 5GWZA 1HYLA 1P2MA 1O3AA 5AFZH 3GYLB 2YMSB 3VPKA 5JDUB 2ZU4A 3RXMA 2VU8E 1O2KA 5JBTA 5JYIA 3EE0B 4U01A 4F4OC 3SZNA 4B75A 4DG4A 3PB1E 4VGCC 1GBKA 4K60A 5A8YA 4OGXA 3S7HB 2BMGB 2PGBB 1P8VC 1TPSA 2BZ6H 1PQAA 1C2IA 2WV5A 1F5KU 3MH5A 1LHDH 1W3CA 1B7XB 2Y7XA 1FN6A 1H1BA 1TX6A 2PSXA 2R9PA 5JBAS 3RXEA 3H7TA 3O8CA 4DIHH 1W7GH 3B23B 4AG1A 4CH2B 4LZ1H 2KCAA 1GBFA 1A61H 1ZPCA 4B1TA 8GCHG 1SL3A 1O33A 1GMDF 1HGTH 1TPAE 3F2HA 3NWUA 5A2MH 1K0HA 4FU7A 4ASUD 2CK3D 1GBEA 4A6LA 2V3MA 2BDBA 4E05H 1FUJA 2VGCC 4JZIA 1UVOA 5DSFA 2ALVA 1CSOE 1QJ6B 1QJ7B 4YO9A 3RXIA 1BRCE 3RXQA 1WXRA 2C93B 2K8IA 3E0PB 4K1EA 5A09A 3HGNA 1OX1A 5HM2A 1K1MA 1Y5AT 1NFUA 1XUIA 1ETTH 4XRNA 3DT0H 3UNQA 1GI4A 1F0RA 1PPFE 1TBQH 3GCOA 1LHEH 3TH4H 1GHBG 2XCFA 2ESTE 1FXYA 1LO6A 5DP7A 1F2SE 3KN2A 3BTKE 3E8LA 2XCNA 1BHXB 4AGKA 5J4SA 2Q6FA 1C1RA 1O2XA 1EPTA 1KDQB 4ABBA 2BD9A 1ZJDA 1EAIA 1TNHA 2PKSC 1YWUA 2VIPA 3RXHA 3MHWU 4MNXA 4ZH8A 2FLBH 1PYTD 1BTPA 4NFEA 4BTTB 3I29A 1M9UA 1SBWA 2ZU2A 1SGRE 2QCYA 4K3JA 1ESBA 1MU6B 2KR7A 1C4Y2 2XBWA 1CVWH 3GYMA 1GI3A 5ETXA 3H5CB 5EPNA 3SU5A 3WWFA 3BTHE 2QYIA 3UR6A 2Z7FE 5A0AE 1W13U 3DUXH 3ATMA 2VB0A 3FN8A 1J16A 1QB1A 1TGTA 2A7CA 2JETB 1G9IE 4ZAEA 3NZIA 1D3TB 3RMNH 3LC5A 3GDVA 5JB8S 4RKOB 4AYYB 1ZLRA 2VBCA 4OS7A 2JIZD 1T4UH 5EW2H 1AE5A 3VXEH 5L6NH 1DSTA 2UUYA 3ZYEA 1C5YB 2IJD1 4GVUA 3SV2H 3KHVA 3ZZ7A 1GI9B 2Z6BD 1MTNC 4TWWA 4DJZB 2BLOA 4INHA 4E7NA 1H9HE 1O36A 1BJVA 1WQVH 2NU1E 1O5FH 3AASA 4WH8A 4BAHB 3Q76A 3K65B 4HGCA 2KCOA 1N6YA 1C9TA 3F2GA 3RXPA 1ELCA 1MKWH 3NXPA 4Q4LA 3RC6A 1ZRKA 1ZJKA 5L2ZH 1QQ4A 3W94A 2BVXH 4BAOB 1ZMNA 1UK3A 4O97A 2NU4E 1GBLA 3GY3A 1LVMA 4KTUA 1DLKB 2XC4A 2ZDLA 3RXRA 2H5CA 4P02A 1C9PA 2VWMA 1C2FA 2C90B 1SPJA 5CMXH 3A7ZA 3T27A 4XBDA 5DP4A 4ISHH 5DP6A 3HKIB 1E36B 1C2DA 3P8GA 4X1PU 1AZZA 3AVZA 1C5WB 1PPEE 1GJCB 1LDTT 1QGFA 2BY9X 1O3DA 3PWCA 2G4UA 3MNCA 4FUIA 2HVYB 2J5UA 3LH1A 1FY5A 3LKWA 3A7VA 2OLGA 3RXUA 4FUFA 1ZZZA 1AKSA 2QAAA 2NU0E 1QL7A 3MU0A 1QJ1B 2C8ZB 3BG8A 4X6PA 1C5VA 2EY4C 2UUFB 1GMDG 1BQYA 4AB8A 4MPUA 1ETRH 1FZZA 1FQ3A 1V2UT 1F92A 4MNVA 4CR9A 1C2JA 1GGDC 4VGCB 3RXKA 3TU7H 2UUKB 2BY5X 1YBWA 3ZYDA 2PUQH 3KQDA 1WV7H 4DW2U 1AUTC 1TYNA 3RU4D 2WV4A 1H8ED 1A46H 1EPTC 4IGDA 4IMZA 2OBOA 2AHME 1IQIA 5KGOA 3UWJH 2CHAC 1O2ZA 2ZFFH 1P05A 4B2BA 7GCHG 2SNWA 2A4OA 3BV9B 2VGCB 5EODA 4ZKOU 4X2WA 5C1XA 1ELDE 3MFJA 1FPHH 3FP6E 1KIGH 1C2MA 1HAGE 2ANKH 3P95A 3D62A 4BAMB 1ZOMA 4UD9H 3M3VA 1LPGB 2XTTB 1E37B 4BTUB 2FODA 3SJIA 2ZHFH 1GDNA 2ZKSA 1IQFA 6CHAC 1AWFH 1TRNA 1SKYE 1W2KH 3ELAH 5C94A 1C5TA 2ZCLP 3ATLA 9LPRA 1QFKH 3O8BA 1IHSH 2WPKS 1TA6A 1HXFH 3ZZ3A 4ACAA 1MBMA 3U9AH 4A1XA 1QNJA 1RJXB 3TVJB 1P57B 1EXFA 1OP0A 4U32A 2ZNKH 2ZTXA 3LU9B 3NUMA 2ANMH 2FX4A 1BOQA 2PSYA 1NN6A 1QY6A 1S6HA 2RA0A 4CRDA 3TH3H 1OWKA 2GCTC 3TJNA 1HAVB 2A5AA 4ISNA 4WMEA 1C4V2 3RC5A 2O9QA 3LDXH 4IC6A 2VJ1A 1Y3XA 3TK5A 1G3DA 3IG6B 3ZVAA 4BXWA 4NIXA 1NRPH 2WPLS 2ANYA 2W6JD 3F1SB 1FDPA 3D49H 3UNRA 3TGKE 2J9NA 5DP3A 3OE7D 2HVXA 1QTFA 3A83A 1Z8JB 2BZAA 4FVBA 1TNLA 1GMHG 2GDDA 1C5NH 3QK1A 1VITF 1GJAB 1EB1H 3UPEA 2UWOA 2AIPA 2LELA 1WDIA 2WYGA 1HIAA 1QHRB 4A92A 2JH6D 1FONA 1AE8H 1N8OB 3F3BA 4J2YB 3SW2B 2SGAA 4ZUHA 3MYWA 1YC0A 4YOJA 2ZPRA 1YF4A 2BB4A 1G3BA 4FUJA 1KXDA 2WHXA 1C5ZB 2V7QD 1O5DH 4ABDA 1LVBA 1V2JT 2GT7A 4FVDA 5BPEA 1GBBA 2A45B 2ZC9H 2OC7A 2Q1JA 3TPIZ 3SV7A 1PPCE 3ODFA 1CA0C 4JCNA 2FOCA 4GHTA 1DX5M 5K7RA 3FO8D 3PO1B 3NRLA 1W10U 3HATH 3EA9A 2P95A 1O3BA 2ZG0H 1EOLA 1T8MA 2F9NA 2GV7A 3SGBE 3JZ1B 4MNYA 4X1SU 2FLRH 4Y8YA 1TB6H 1ANBA 1RD3B 1ELEE 1W0YH 2XBYA 1P01A 2OCVB 2WZQA 5DK1A 1ARBA 5FL7D 1BIOA 1FLEE 4CRAA 1Y3WA 1GI6A 1Y5UT 3SGQE 2GV6A 3QX5H 1F7ZA 4GCHG 3RLYH 1DT2A 1OHHD 3K2UA 1Z1JA 4WMDA 2A7JA 4K69A 4UDWH 4IW4E 3TLOA 5IYTA 1UVPA 2J4IA 2VVCA 5FPTA 4NWKA 2ZECA 4D76A 4CRFA 3O8DA 1W0KD 3MTYA 3GICB 1T4VH 3TJVA 5C0UA 1SQAA 1C5RA 2HRVA 1KMHB 2BLWA 1H9IE 2VIDA 4FXGH 1SGPE 1ZTLA 2STBE 4ISLA 3GY7A 1FAXA 3F0OA 5FBIA 1C2GA 3PYHA 3RMLH 1H8DH 4RT1A 3VGCC 1EOJA 5GIBA 1TONA 2F9UA 2FOBA 4INKA 4NSYA 3SV6A 3CENA 3SNDA 2ZCKP 3MNXA 1Y3YA 3FKSD 1ANDA 1MD8A 1FJSA 2ZFSA 3KGPA 4YTAA 3GY5A 3OU0A 4AFSA 5E0HA 4NGAH 3RM0H 3C27B 1AD8H 3FP8E 1EPTB 5JBCS 4Y0YE 1QB6A 5DJ7A 1DSUA 3P70B 3TK6A 2D8WA 3MH6A 1C4U2 1CU1A 3RP2A 2ZFTA 3V3MA 3M7UA 5C3NA 4Q80A 4ZXYH 1HJ8A 2G55A 1K1NA 1KLTA 4ZKNU 3SJOA 1CT4E 1D3QB 2QF4A 1W0ZU 1E1QD 3ATKA 1V2QT 1NC6A 1TABE 2ANWA 1TRYA 3QGJA 5E2PA 3PTNA 4K2YA 2NU2E 2KCYA 2BD4A 1BDAA 1IQLA 5TJXA 2TGTA 2XNIA 4DVAU 6CHAB 2GT8A 1UTNA 9ESTA 3UIRA 1D9IA 3DSOA 1BMLA 3N7EA 1THPB 1VKYA 1O2WA 3MU5A 2NU3E 1YCPM 1EZSC 1YY3A 1F0SA 1N6XA 1O3OA 1RTKA 4Y0ZE 5FCRA 4K8BA 1OP2A 4ISIH 3VB7A 2FTLE 1FN8A 4OM9A 2QF0A 1XXFA 3KQBA 1ZHRA 2GMTC 1T8OA 2QN5T 1UTQA 4RI0A 3URDA 1O38A 1C1MA 2BD3A 2GCTB 3T26A 1P04A 2QGRA 1ZPBA 2ZA5A 1AGJA 1OWHA 1TPOA 1GBTA 4JZDH 1EB2A 3MWIU 4MDSA 4WVPE 3SU6A 1AI8H 1DUEA 3LJJA 3ZVDA 2RDLA 2LPRA 1J15A 1PPHE 1XMNB 1Z8IB 1P02A 2FOMB 1TE0A 2KX4A 4ZHAA 1OWIA 1DPOA 1Z1IA 1MKXH 2KFWA 2VIQA 2V0BA 1NO9H 1ELFA 4ZXXH 2YNAA 4I31A 1AWHB 2BDCA 1VZQH 2ZO3H 1G32B 1O0DH 2K1QA 1C1VH 1Y5BT 2KCPA 2YNBA 1V2OT 3RXOA 1P12E 2RDEA 1UW7A 2J97A 3E91A 1COWD 4NWLA 1UTMA 4CRGA 1HJAC 1Z71A 3SQEE 3MO6A 4OS4A 1KTSB 2AGGX 1KXAA 2FPZA 2ZDAH 1BMNH 4AZ2B 2BQWB 1FI8A 5HKKD 2JJ1D 3GS9A 1Z6EA 1UTLM 2QE7D 5J4QA 4Y6DA 4ABAA 3FZZA 3Q3XA 1AKSB 1CA0B 1G3EA 3ZVGA 1C1UH 3HK3B 1HPGA 5T1VA 2PV9B 4D9QA 1UTJA 1EZXC 2A5KA 4A7IB 3SJ8A 2Y6TA 3SNAA 1INCA 3HKJB 2QF3A 1O2JA 1V6DA 1O5BB 1QA7A 3AAUA 3GISB 5LH8A 1AN1E 2TBSA 1EX3A 2HALA 5AF9H 1V2RT 2G00A 2O8LA 1EJMA 2GX4A 3SJKA 2M5TA 1KTTB 5DP9A 5ESBA 2XWBI 4DURA 2TRMA 1HUTH 1TGNA 1B5GH 5C17A 1V2MT 1CGHA 3M7TA 4YT6H 5EOKA 4XSKU 5CE1A 4J1YA 4UFEH 3LGIA 1H8HD 2J34A
chains in the Genus database with same CATH topology
1A5HA 1PPZA 5T6FA 4O3UA 4KELA 2GZ9A 1LHFH 1OXGA 3Q3YA 1GI8B 1GHWH 5EPYA 2WYJA 1SR5C 1O5EH 5T3HA 1A5GH 1LPKB 4D7FA 3MOCA 1CT0E 2OD3B 1E38B 2G5NA 1NRRH 1QB9A 1OWDA 1TRMA 1NFYA 3BEUA 1DDJA 5AFYH 3A87A 2EI7A 3P8OA 1AZ8A 2ASUB 2AYWA 1AFQC 1KXEA 1RIWB 3QLPH 1X7AC 2SNVA 1ELBA 4NA7A 1CT2E 1GJ9B 1IAUA 2ZHEH 2ZHDA 2V3HH 3Q00A 1O35A 2A7HA 1UVUH 1CHOF 4GPGA 2H9EH 3V13A 1BRUP 1TAWA 3VB3A 1SLWB 1TPPA 1P09A 2P8OC 4Y7BA 1O3JA 5E2OA 1GJ8B 2CF9H 2WPJS 3M3TA 3M7QA 1VCWA 2C8YB 1DE7H 1OWEA 4FUBA 3ZZBA 2FDAA 3MNBA 1Z8RA 3NPSA 1FY4A 2R3YA 1TOMH 4TY7A 4DOQA 2B7DH 2XW9A 3LONA 1SHYA 3LPRA 2P59A 1GG6C 1TOCB 1GJ4H 2AERH 1P11E 4WH6A 1O2PA 1C5OH 1ZSKA 1GL0E 1HIAB 2FESH 2ZF0H 1EZUC 1KXCA 3BTFE 5TCAA 2V35A 1UO6A 1NY22 2ZHQH 1NRNH 4MQAA 3RXBA 1SGDE 2FM2A 3L3TA 3ZV9A 1EJAA 1GPZA 1FPCH 3RXVA 4IS5A 3PM3A 1ELAA 5C5OA 1C2HA 1K1IA 3GCTG 1LHCH 1JIRA 1NU7B 1NRQH 3ZZ8A 3MH7A 1DANH 4JZFH 1L0ZA 1P2QA 4FU8A 3E1XB 1L2EA 1YPMH 2PR3A 4MNWA 1H4WA 2WUBA 2FOGA 1LKAA 1YPLH 3SUDA 4DIIH 4NIVA 5GCHG 2TIOA 4K8YA 2H9HA 1HJAB 2P93A 1YPHE 1SOZA 1VCQA 5EQRA 3SU4A 1D4PB 1ZTJA 2H5DA 3SHAH 1O5GH 1G30B 1RTLA 3RXLA 1C5QA 3A86A 1P3CA 1IQHA 1UVSH 3GCHC 2P3UB 5EU8A 5DPAA 2A2QH 4CRBA 5DP5A 1MZDA 2WINI 1W11U 4Q7YA 2FZZA 4KGAA 5LPEA 2J95A 2JH5D 3SBKA 4XBBA 1QRWA 1S81A 1ZSLA 2H2ZA 3RMOH 1BTZA 1EASA 3BTQE 1AB9C 3LC3A 4WJG2 3SV8A 1O2RA 1T8NA 3I77A 3FZDA 2IPHA 2PGQB 3A81A 2F83A 2O8UA 1O3EA 1TBRH 1V2PT 1KSNA 1HV7A 1Z8GA 3T28A 1K22H 1VR1H 2WUCA 3ZZDA 2VH0A 1N1LA 1V2WT 4U2WA 4ASHA 1O3CA 2WPMS 1O3MA 3IITA 1K21H 4O03A 1MTVA 2ZWLH 1SGIB 4XBCA 1JXPA 1OYTH 4THNH 2BD5A 3OTJE 2NWNA 1P9SA 4TYDA 4X6MA 5FBEA 2DUCA 2DE9A 2GCHF 3O8RA 2O8MA 5DKMA 3S9BA 1AUJA 3UREA 1C5PA 6LPRA 3PMHB 1QBVH 1WBGB 2GVFA 2F9VA 1VITH 1DXWA 1THSH 3JZ2B 4AFZA 4M7GA 1FNIA 3SNEA 1TA2A 1MKXK 1O2YA 1H8IH 1SGCA 4E06H 2QXHA 7ESTE 4XOJA 2W5EA 3U98H 6GCHF 2AMQA 1RRKA 1W12U 2KAIA 1A3BH 5F8TA 1YLCA 3A88A 1P2IA 3MNSA 1Q3XA 1RXPA 1W8BH 5FPSA 3FP7E 3BG4C 2OC1A 2A4GA 1BTXA 1RFNA 5L30H 2EI6A 1NROH 2PKSB 3OSYA 5F8XA 4H4FA 3LGUA 3K9XB 1CE5A 3U8RH 2BXTH 2BY6X 1ELVA 1F0TA 1QBNA 4GUXA 4OGYA 1XUHA 3SI4H 1GDUA 3LGWA 1C1NA 2Y80A 5GPIB 1GBIA 8KME2 3ESTA 1B0FA 1O3GA 1ID5H 3TJUA 3PLBA 3VB4A 2XBXA 2FO9A 4YLUA 1O31A 1BMMH 1EKBB 2BDGA 1WOFA 2BY7X 5C1YA 3SUGA 1XUKA 4Z0KA 5C67A 1VGCC 1A2CH 4H6TA 1A3EH 2R2WU 4HTCH 1PPGE 3Q3KA 5I25A 2ZFRH 2G52A 3ZZ4A 5T6DA 3UOPA 1C5SA 3SOSA 2ZDKA 2ZPQA 3BIUH 4BAQB 1F0UA 1CGIE 2FS8A 2OBQA 1GJ7B 3RLWH 1L1JA 4JZEH 1ZYOA 3MU8A 3WY8A 1PYTC 1MTNB 1RGQA 1V2KT 2Z9LA 1DICA 3UUZA 3TJOA 1L1NA 2F9PA 3N7OA 4RN6A 3RXCA 5GJ4B 4ESTE 1QBOA 3EAJA 3A7YA 2Z3CA 2BDIA 1SVPA 1O2VA 1QQUA 2Y82A 1NESE 1LMWB 2JH0D 3UQVA 3LOXA 3ENSB 2TPIZ 1BJUA 1GHAF 3A84A 3F9GA 1NPMA 3SU3A 3SU2A 3S7KB 4LK4A 1O2MA 2Q6GA 1GVKB 2ZDVH 2ZHWH 3SN8A 1O2GH 1CA8B 2OQUA 1AHTH 3URCA 3V0XA 1ABIH 3B8JA 2ZPSA 3HK6B 4Q7ZA 3PROA 1G3CA 3A8CA 3TIUA 2THFB 1EAUA 1C1QA 2FOHA 4FUHA 5LPRA 4X6OA 3MO3A 1O2IA 2HPPH 5A8XA 4X2YA 1AIXH 4YOIA 1L4DA 1P2NA 1O5CB 5FAHA 2SGDE 1GBMA 1YGCH 3PWBA 3FFGA 4TPYA 2VNTA 1YYY1 1JWTA 4SGBE 1XUJA 1YPHC 2ZP0H 4Y8XA 2W7SA 2BY8X 2GP9B 3SJ9A 2ZEBA 4RSPA 4BAKB 1K28D 1TNIA 4ZHMU 3PMBB 2B5TB 2B9LA 4JYVH 1GGDB 2EI8A 1TQ7B 2BOKA 3SGAE 5IDKA 1Y59T 2SGEE 1V2VT 1YPGH 2LNCA 1LQEA 4BTIB 5TCCA 2PTCE 3TGJE 1A7SA 2A4QA 3SU1A 1EUFA 3DD2H 2CHAB 3BTDE 1S85A 1O2UA 1O34A 3VB5A 2C4FH 1A0JA 1HAOH 3ZZ6A 1WAYB 1SQOA 2TGAA 1SFQB 1QL8A 4X1NU 2XC5A 1YCPH 3MO9A 3AW1A 1GI0A 2BLVA 4ZHLU 5LPFA 1TFXA 2IOTA 1IQKA 1BRAA 3FVFB 3PMJA 1SGYE 1DWEH 2GTBA 2F91A 3BSQA 4D9RA 3PMAB 3AAVA 4K5ZA 2PTNA 2ODQA 4NSVA 4X8VH 4IC5A 2CMYA 4NA8A 4O3TA 4CBOA 3E0NB 1SLVB 3L33A 3ZVFA 1QR3E 8GCHF 4NFFA 1O32A 4U30A 4KTSA 4MPXA 4CR5A 3S9AA 4ABEA 1FY8E 4AYVB 2AGIX 1GHXH 2VINA 3BG4B 1AO5A 1K1LA 1JOUB 3C1KA 2VVVA 3AW0A 2D1JA 2CN0H 4CRCA 3P8NA 1VITG 1UMAH 1O3HA 1C5LH 1C1OA 1UHBA 4HI3A 1DS2E 4R8TB 1G2MA 1VJ9U 4H42U 3T5FH 4MPVA 3QZRA 1EAXA 1O3NA 2GZ7A 4WXIA 4ABHA 1RTFB 2G8TA 1GWAA 1GHBF 1SLUB 2ZFPH 1C1SA 5C1UA 1UCYH 4FUGA 3A82A 3MU4A 3SO3A 2ZDNA 2WPIS 4UEHH 3M5OA 5CHAC 1HBTH 2FX6A 2QY0B 3RXGA 5F6MA 1VGCB 1CQQA 1UTPA 4AFUA 1YPJH 3QTOH 2FOFA 4MG3A 2FS9A 5BRRE 2OUAA 1MQ5A 1K1OA 1ELTA 4FU9A 1BTWA 4UFGH 3KQEA 3LT3A 2CF8H 2FMJA 1BBRH 1HRTH 4I8HA 1QURH 2AMPA 1DITH 2XWAA 4NZLA 4UONA 1O2LA 3UY9A 2AS9A 1KLJH 1D3PB 1W7XH 3P6ZB 1T32A 3M35A 1TGBA 1P06A 1J14A 3S9CA 1YLDA 3BN9A 3KNXA 3QN7A 4MLFB 2A0QB 3EGKH 1H9LB 2BD8A 1TQ0B 4XE4A 3U1JB 2QV1A 1K1PA 1BTHH 1BTYA 3TNTA 1MZAA 1EP5A 3T29A 3LGTA 1C2KA 2PKAA 3EDXB 4UE7H 2G4TA 3OY6U 4DT7B 1OKXA 4HFPB 2GDEH 3M3SA 2P94A 3BEFB 3F9FA 3RXJA 3SI3H 1GBJA 2FI5E 2A4RA 5T6GA 1BITA 1GJBB 2A5IA 1THRH 3OX7U 3EA7A 1SOTA 3QGNB 1OPHB 1TNJA 2R0LA 3CP7A 1C5MD 1LKBA 2FI4E 1UVTH 4JMYA 3ZVEA 3DFLA 3BTEE 2C3SA 2BD2A 2P3TB 3ZZ9A 3UNSA 4ZROA 1SSXA 1JMOH 3D65E 1FV9A 1HAPH 1J8AA 1NRSH 4B76A 1S83A 3RU4T 5HXFA 3GY6A 1U6QA 1S5SA 1E34B 4Q2KA 4IN2A 2BX4A 1Q31A 2C8WB 1L4ZA 4GAWA 4H6SB 1FIZA 1BB0B 2W7UA 1ARCA 8ESTE 1ANCA 2GKVE 2ZU3A 2QXGA 1C1TA 1GBHA 1G2LA 1UK2A 1OOKB 4AB9A 3SHCH 4NG9H 1S6FA 2H6MA 2QA9E 1UJ1A 1WTHD 1T31A 3VGCB 1G37A 2FP7B 5A8ZA 3DA9B 4I8KA 1AY6H 4KKDA 2Y7ZA 5FX5A 2F9BH 4ABIA 1P9UA 2KAIB 1Q2WA 2ZI2H 3BF6H 3BTTE 1O2HA 2P3FH 1AVGH 5A0BA 2SFAA 4YZUA 2ZTYA 4LOYH 2H1UA 3V7TA 1WCZA 4IMQA 1NU9A 2Z9GA 1EQ9A 2ZQ2A 2HNTF 4GSOA 3QUMP 5FPYA 3VFEA 1O2TA 1EJNA 3QTVH 1BHXF 4OS6A 1MAXA 4Y7AA 1D6WA 4A1TA 7LPRA 5HM9A 4X0WU 4X8UH 3A8DA 3RXDA 4A5TS 1PPBH 3HPTB 1FY1A 1TMTH 3RDZA 2BDYA 1TMUH 4RKJB 5LGOA 2VH6A 1DWCH 1ZGIA 1MBQA 1OP8A 3QWCH 1XVMA 1GVLA 1AFEH 2Y5GA 2VIWA 4Y79A 4AG2A 3PLKA 1Z6JH 4YLQH 3M5NA 5FCKA 2B8OH 1JBUH 5C20A 1MQ6A 2A32A 3L6PA 1GI1A 1O3PB 7GCHF 4Y10E 1WTGH 5G4BA 1PQ7A 4XFQA 3T25A 4K1SA 2XXLA 1DVAH 1WYKA 3CS7A 5AHGH 1FY3A 2BVSH 1ZPZA 3CS0A 2ZTZA 1CGJE 1BA8B 1LVYA 1SGTA 3SUFA 4CREA 4CBNA 2ODPA 1HAIH 1O5AB 3KEEA 1Y8TA 2D2DA 2UWLA 4MTBA 2GMTB 2HOBA 3K6ZA 3V12A 2YOLA 1NM6A 2ZGCA 3K6YA 1SB1H 3UOUA 1LHGH 3SU0A 2ZZUH 1V2LT 1ANEA 1LCYA 3T62A 5CHAB 1T8LA 2W26A 2V3OH 4WWYA 3ZZ5A 3PLPA 3BTGE 3SNCA 3UWIA 2BTCE 1SGFG 3RXSA 3R0FA 4ABJA 5B6OA 1LVOA 3LIWA 3BTME 1NZQH 4F49A 1K2I1 1UCYE 2BQ7B 1N8OC 1Z7KA 2SGFE 3RM2H 1BRBE 1L1GA 1C1PA 4PROA 1FAKH 4JK6A 1SFIA 1HJ9A 2O8WA 2ZFQH 4NIYA 1P0SH 3F68H 3RC4A 4FUEA 2CXVA 3GY2A 1MUEB 3UFAA 2OQ5A 2FOEA 1BBRE 1KYNA 1GMHF 2J92A 2G51A 4BOHA 3GCNA 4AOQA 4CHAC 2EA3A 1GI7B 3NCLA 2Y5FA 4CH8B 1HAZB 3KQCA 3IWMA 3GDUA 1CO7E 2Z9KA 4DGJA 4JYTA 1GCTC 1DM4B 3A80A 3PO1C 1YCPK 1O2NA 1TWXB 3U8OH 3R3GB 5F03A 1YPEH 1O3KA 1LTOA 2PHBA 5E0GA 1BTUA 2BD7A 5ESTE 3RUOA 1GBCA 1WU1A 4KP0A 3KF2A 1T7CA 2HLCA 3TNSA 3HGPA 1SMFE 4ZMAH 5ABWA 2BXUH 4HZHA 5A0CA 3S0NA 2XBVA 1O2QA 1P2OA 4MPWA 1ZR0A 4BANB 4JK5A 2RCEA 1C2LA 1C5XB 1ZHMA 3TITA 3ZV8A 1QRXA 1ORFA 2IJOB 1SGEE 1QRZA 1V2TT 4YESB 1EP6A 1SGFA 5EGMA 4Q7XA 1IHTH 2BM2A 2HNTE 2F9OA 4Y11E 3T2NA 1K9OE 1V2NT 3SNBA 4NIWA 1IOEA 2ZDMA 2HPQH 4SGAE 1KXBA 3U8TH 2FTMA 4IBLH 1UCYK 2BYAX 5HYOA 1CHOG 3BEIB 4AX9H 1MD7A 2BVRH 3F6UH 1GVZA 1O3FA 4GCHF 3RU4E 1MH0A 1NS3A 1SGNE 1VJAU 3A89A 3A7TA 2RG3A 2ILNA 2VIVA 1TIOA 1TNGA 1GMCF 2D26C 4YOGA 2IN2A 6ESTA 2HGTH 7KMEH 1JRTA 1P3EA 2QXJA 1TALA 4INLA 4AN7A 1BBRK 5EXMA 2R0KA 3A8AA 2ALPA 1S0RA 1ELGA 2FIRH 1RS0A 1BUIA 1C2EA 3EA8A 2DE8A 1CBWC 1AFQB 3PTBA 1OS8A 1ZTKA 1GBAA 2CJIA 3E3TA 1TLDA 1GBDA 5GDSH 3TK9A 4B74A 2J2UA 1O3IA 2B0FA 2SGPE 1WUNH 4AGJA 1CHGA 1S0QA 1UHBB 3D23A 2BDHA 1DY8A 3UR9A 1O37A 4WF8A 1A5IA 4BXSA 2P8OB 1ZRBA 1P03A 1B0EA 1HXEH 3GY8A 3DFJA 3VXFH 1A1RA 1FMGA 3M5LA 2OTVA 3M36A 1C5UA 1YM0A 1BZXE 1GL1A 2BLQA 3TH2H 1P2KA 3B9FH 3SUEA 4JYUH 3STIA 1UK4A 2VWOA 1GG6B 2TGPZ 2WPHS 3A7WA 1MU8B 3KIDU 1Y3VA 1GJDB 2XYAA 4UFFH 1KDQA 4D7GA 1LPZB 1ABJH 1E35B 1AU8A 5DP8A 1XXDA 3P17H 2G81E 4FUDA 2G5VA 1ETSH 5C5NA 4X2VA 1HCGA 3ODDA 1TX7A 1MCVA 5I46H 1O30A 1K1JA 2QIQA 2R3UA 4JZ1A 1QIXB 1GI5A 1DOJA 2FWWA 4B2AA 1GHYH 3G01A 2I6QA 4LXBH 3W95A 2PKAB 1GHVH 4BNRA 4X1RU 3U69H 4OS1A 1PFXC 4DY7B 5F8ZA 3A8BA 2FOAA 1ZSJA 4ABGA 8LPRA 1Y3UA