1GDQA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
b'IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdqA01
1SFIA 4UFDH 1QB1A 1UVSH 2NU0E 1CA0C 4R0IA 3MNSA 3HK3B 2BVXH 2PUQH 1ESBA 2K1QA 5JYIA 1C2LA 3GCHC 2PKAB 3QO6A 3AAUA 3EA7A 4A1TA 1VITF 1GJ8B 2OUAA 1T4UH 5F6MA 1HJAB 4GCHG 3LH3A 2TGPZ 2ZTXA 1O2RA 1Z6JH 4Y11E 2UUYA 1A3BH 1HIAA 3SGBE 3QN7A 1DFPA 1PPFE 4IN2A 3P70B 1ZMNA 4AB9A 2W3KA 5C20A 4D76A 4UFFH 3RXQA 4LXBH 1NRNH 1YGCH 2WUBA 1SBWA 1WQVH 5T6DA 1SGQE 1OYTH 5C3NA 3UFAA 5A2MH 1C5TA 2C8XB 1IQMA 3GYMA 4K2YA 4WY3A 2AMPA 4OS7A 2B9LA 2DE9A 4AORA 1KDQB 2FP7B 1CA8B 2XNIA 3EDXB 1SGEE 1BBRH 4UFEH 1UTMA 4MVNA 2CHAB 1GJDB 1O30A 3P17H 1GJ7B 4TPIZ 3ZZ9A 2WYGA 2Q6DA 1YPGH 2PGBB 3KN2A 4ZXYH 3SJOA 1P11E 1GPZA 4Y0ZE 1GI2A 2PR3A 1AWFH 1UTLM 2D8WA 4FUJA 3RC6A 1TFXA 1UK3A 3SV2H 1S6FA 1XMNB 3H7TA 2ANWA 3U8OH 2RA0A 1P03A 1IHSH 2STAE 5DJ7A 5H4IB 4I8KA 4K8BA 1S85A 1GI8B 3KGPA 2A0QB 3FVFB 3ZZ6A 5J4QA 1Y3WA 2STBE 1C4Y2 2ZIQH 1ESAA 4JZEH 2B7DH 2FO9A 4ZHMU 1O3LA 3K6ZA 1RFNA 1T4VH 1QBOA 3PMBB 4RKJB 1IQNA 3L33A 3A7WA 3U8RH 2ZC9H 4ZROA 1GMDF 4MNXA 4HGCA 1YPHC 3BTQE 3RXPA 1BTXA 1H1BA 1BTUA 2PHBA 2A1DB 1GMHG 3LGVA 1THSH 3LJOA 3O8BA 4RSPA 2NU2E 2ZG0H 3SNCA 1EUFA 1XVMA 1O2PA 1WU1A 3ZZ8A 5FHTA 3TPIZ 4BXSA 4XE4A 1HRTH 1XM1A 2BY9X 3F9EA 2UUKB 1N1LA 4XBBA 3SU6A 1SLXB 2PLXA 2H2ZA 1ANBA 1NESE 3SJKA 1EB1H 5DP5A 1EQ9A 1DLKB 1MBMA 4U32A 1BBRK 2PV9B 2F9NA 1G32B 5A0CA 1UCYH 4NIXA 1VJAU 1GGDC 1J14A 1DS2E 1SGYE 4NWLA 1UTNA 2NU4E 1P05A 3A87A 3MH5A 1TA2A 1LKBA 5LH8A 4MLFB 1A0LA 1FY4A 3TNTA 1UK4A 7LPRA 3ZZ7A 1VR1H 2CV3A 1ZPCA 3KQEA 5FX6A 3KQBA 2OBOA 3OY6U 1AZZA 2ZHFH 2Z9JA 3LC3A 4ISOA 2V3HH 1O2MA 1ZJKA 3KL6A 1O2UA 1RJXB 4BXWA 3GISB 1YC0A 1GL1A 1DXPA 1EPTB 2RCEA 1ZZZA 2VVCA 1TE0A 2G4TA 1SGTA 2NU1E 1PYTC 1GBDA 4A1XA 3M3SA 2BDCA 3M5MA 1F7ZA 1K1OA 2CN0H 2BOHB 1L4DA 1B5GH 2ZGXH 2ANMH 3O8DA 4WH8A 1GVLA 2PKSC 1O2TA 2B0FA 2AEIH 3MU5A 2R0KA 1O35A 4H42U 3QWCH 1GCTB 1QQUA 2ZU1A 4YM9A 2GKVE 1GBBA 1G9IE 1N8OC 1RTKA 1DWEH 1ETTH 3OYPA 5ESTE 1MZAA 1C2MA 5F03A 3A86A 2A5IA 1QL7A 2C93B 1MCTA 3P6ZB 2A4GA 2GZ7A 1MKWH 1C2JA 4NWKA 5C1UA 2J2UA 1UCYK 2H9TH 4A92A 1W2KH 2HALA 3MO6A 4TYDA 2D2DA 1HLTH 1SGPE 3SHAH 2FODA 3NUMA 4DIHH 3M36A 4FUFA 3EAJA 4AOQA 1H9LB 3TGJE 1O2KA 1MTUA 5AFZH 5HXFA 4CRGA 3TVJB 5A09A 1KIGH 4JK6A 3I77A 1UHBA 1HBTH 1GBAA 2F91A 2ZCHP 1TNLA 2GP9B 3VB5A 1AWHB 3ZVAA 2FOHA 4WMFA 4BAQB 1GBCA 3GY5A 3U98H 1MZDA 4D7GA 3Q77A 4O03A 3RXHA 3RUOA 3PLBA 3SU1A 1KXAA 5C67A 1KXDA 1RGQA 1AU8A 5JBBS 3W95A 2EI7A 1TX7A 3E91A 2FS8A 2XYAA 3TJNA 4X0WU 3HPTB 5FAHA 1A0JA 1TPSA 2SGQE 5FXLA 1TRYA 2ZCKP 3Q76A 3DFLA 1IQHA 4MQAA 1C5XB 2LNCA 1ZTJA 2VH6A 4AFQA 2QIQA 4WXIA 3SORA 3SNBA 4MPVA 1H8DH 1J15A 3SGQE 1MKWK 3GCTG 4H4FA 1TLDA 2ZDNA 2ZU4A 1G30B 1MQ5A 2FOGA 2Y6TA 1OKXA 1O5FH 1GI6A 1W3CA 3F68H 5ABWA 3ZVFA 1CHGA 2FLBH 2G00A 2V6NA 1QJ1B 2FI5E 5K7RA 3RXCA 5HM2A 5F8TA 4CRDA 1XUIA 2OQ5A 3JZ1B 3LKWA 1AKSA 3F9FA 3FP8E 2BQ6B 3A83A 1GHZA 3BTKE 2O8UA 1MUEB 3EE0B 1ZTKA 3BEFB 3HKIB 1YCPK 5DP3A 4JMYA 4K8YA 1ELFA 3P8OA 4Y7AA 3LGYA 1O5AB 2SGDE 4GLYA 3B9FH 1CT4E 1W0ZU 2FOBA 1BB0B 3QZRA 1O34A 1Q31A 5EU8A 2ZPQA 3HGPA 3PYHA 1ANDA 4DOQA 2GMTB 3D65E 5FBIA 1DITH 1EP5A 1O3CA 3A88A 4FUHA 5LPRA 2O8LA 1MTWA 2AGIX 1INCA 1AB9B 1MTSA 2XWBI 3MH7A 5GXPA 5DP9A 5LPEA 2XWAA 1G2LA 3ATMA 1KXCA 1P0SH 5DPAA 2ZFRH 3RMLH 1OP8A 1BHXB 2AMDA 3UTUH 3SI3H 1G3CA 5TCCA 1G3DA 3ZV8A 1RIWB 3IWMA 1T32A 1P57B 5DKMA 5JB9S 5EOKA 1LQEA 1O3NA 3ITIA 1AQ7A 1SGFA 1BUIA 3P8GA 3SNDA 3JZ2B 2O9QA 1ELTA 9ESTA 1MU8B 1BTPA 4DY7B 1LVBA 2J94A 2OINA 1O2XA 3UREA 1U6QA 1AFQC 1O3EA 4INLA 1YPJH 1HB0B 4H6SB 4JCNA 1CA0B 2WPLS 2WYJA 5FX5A 1EB2A 1O31A 5GPIB 1IQKA 2WPKS 1DWCH 4LZ1H 1EZUC 1S0QA 1S81A 2P95A 2YNAA 3EA9A 3A8DA 3GCHB 4F49A 4FUCA 4R8TB 3SNAA 3TLOA 1Y3VA 1PPCE 3ZVCA 2QAAA 1V2VT 1GBMA 2FLRH 1NTPA 1YLCA 1EP6A 1SGIB 1UTKA 1SG8B 3SJ9A 4FVBA 1Y3YA 3VB6A 5K0HA 1HIAB 1P01A 1CO7E 1S5SA 3SW2B 1FIWA 2J95A 1NO9H 4HFPB 2GV6A 3ZZ5A 2VWNA 3GY7A 5G4BA 3CS0A 4Y10E 1BRCE 4GCHF 3B8JA 1TBZH 2G81E 1P9SA 4ABIA 1HJ8A 2GDDA 2DE8A 1ZMJA 3GICB 1QIXB 1E34B 2LPRA 1C1OA 1OWDA 3MFJA 4Q7XA 4Y79A 3RM0H 1TB6H 1MU6B 4FUDA 3DUXH 1C1TA 1BQYA 1PPZA 2ZO3H 3BEIB 2A5KA 4ASHA 1BJVA 1BIOA 1GJ5H 1B0EA 1V2KT 1XUKA 2SFAA 3MTYA 2ZI2H 4XOJA 6LPRA 4Y6DA 5GJ4B 1ABJH 1SLUB 4FUBA 3O8RA 2ZPRA 2VVUA 2GCHG 1ZJDA 5E0JA 4BOHA 1S6HA 2XC5A 4KTCA 3KQDA 1Z7KA 3A8CA 2IPHA 3LIWA 4GVUA 4O9VA 4NA7A 3RXLA 3T27A 2ODYB 4NIVA 1O5CB 1P09A 1KLTA 3LGWA 4E7NA 2HGTH 2ZDAH 1VGCC 3PROA 1OXGA 1G36A 1FQ3A 3RXMA 3RC4A 2AYWA 2ZHQH 4ZKNU 1ZSLA 3SV8A 3A7VA 1PQ7A 3MI4A 3UNSA 4X1SU 3T28A 4AFZA 1LHGH 2A2QH 4YTAA 5ESBA 1S0RA 3PLKA 1Z8RA 3EYDA 3BTTE 3FP7E 1HDTH 1O2HA 4YT6H 5JBTA 2ZDKA 1SGDE 1KSNA 1C1VH 1CGIE 3ZZ3A 1ZPZA 3MMGA 1YCPM 4NIYA 2ZF0H 4CHAC 1TMTH 5L30H 4TY7A 5EPYA 2UUJB 1O2NA 2SGEE 3E8LA 3A82A 1KXBA 5EW1H 3BTEE 4A1VA 1XUGA 4U01A 1VITH 2FYQA 2FTMA 4AN7A 2PW8H 1GGDB 3VB3A 1RTFB 4SGBE 1UTJA 2Y5GA 3FANA 1BMLA 1FXYA 1HAZB 1IQEA 3ZVEA 3CP7A 3TK6A 2FMJA 4I32A 3DFJA 2C8YB 3AVZA 3ZVGA 1OPHB 3BF6H 3HGNA 1TONA 1TBQH 1CSOE 2QN5T 1P12E 4DW2U 1C2HA 1P2IA 4JZFH 1Z6EA 1CGJE 4JZDH 1IQFA 2BLVA 4O3TA 3LH1A 1PPBH 4F4OC 1RRKA 2GD4B 2OC7A 1HGTH 3MU8A 3UQOA 1GDNA 1V2PT 3VFEA 3D49H 1O5GH 4IGDA 3RMOH 2BD7A 1EASA 5JDUB 2ZGBH 1DT2A 3DT0H 4YOIA 1C1MA 2PKSB 4MPXA 1MD8A 1ZTLA 4I8HA 1C2EA 2BQ7B 2G5NA 1BMAA 2QF3A 1O3MA 4BAKB 3GCOA 2P8OB 4X2XA 1N8OB 3AAVA 1NY22 1ZHMA 3ZZ4A 4E05H 3W94A 1BOQA 4KKDA 4I31A 4FU7A 4NSYA 4X6MA 1W7GH 2JETB 2O8TA 2ZWLH 1SVPA 3NK8A 1O3JA 1B7XB 3RMNH 3T25A 2BDIA 1C2GA 2XC4A 2C4FH 4D8NA 1O3OA 3U69H 2SGFE 3NCLA 2VIWA 4H6TA 4O3UA 2ZA5A 2O8MA 2Z3CA 3RXGA 1C5RA 4NFFA 1NROH 2BLQA 3PV4A 2BDHA 4J2YB 4K1EA 1GBLA 2ZHWH 1CQQA 3RXUA 1UHBB 4GUXA 1OS8A 2QGRA 3VXFH 1YYY1 1XUHA 3T29A 3PB1E 3F9HA 1XXDA 3FFGA 2VB0A 4Y8XA 4FU9A 1ZGVA 1A0HB 1D3DB 3U8TH 1G37A 2O8WA 3KEEA 3HKJB 3BG8A 3QGNB 4B2CA 1O2WA 1QJ6B 1EJNA 1TOCB 4X2WA 1W11U 2V3OH 3E0PB 1UMAH 4RKOB 4DURA 2JH5D 2KAIA 5DP7A 4IBLH 4UDWH 2ZPSA 3MU0A 5DP8A 2W7UA 3RXVA 2Y5HA 4ISLA 1CT2E 3GYLB 2BDYA 1C1UH 1EZQA 1SGNE 2SGPE 1GHBF 1TAWA 2AGGX 1C5SA 3STJA 1JRTA 4GSOA 1LKAA 1NFXA 2A4RA 1YBWA 2ZGHA 1VCWA 2Y5FA 1T8LA 1ARBA 1TGSZ 4ZH8A 1IQJA 2H9HA 1SGFG 1GHWH 3HK6B 1EZXC 4AG2A 5GCHG 5IYTA 1QFKH 1TGCA 1DANH 1LVYA 2Z9KA 2BVSH 2H5DA 1AO5A 2WUCA 3S9BA 2CGAA 4NCYA 1P2NA 3F6UH 3BTHE 2W26A 1GJCB 2QC2A 1AKSB 4JZIA 1A1RA 4Q7YA 4XBCA 5C2ZA 1F5RA 1BJUA 1JRSA 2WV5A 3NZIA 3SBKA 5T3HA 2IOTA 1GVKB 1DE7H 1W14U 4I8JA 4X6PA 1ZHPA 4ABHA 4B2BA 3M5OA 1O2ZA 2BQWB 5FCRA 1KY9A 1WV7H 1IQGA 3ZZBA 2F9VA 1PPEE 4MNVA 2OC1A 1SOTA 1JXPA 5GWZA 2OTVA 3M5NA 2VIPA 5E2PA 1FY3A 1GHAG 1P10A 3F9GA 2BY8X 1AZ8A 3ELAH 3SUEA 1TRNA 2QXGA 1ELVA 2VINA 5C5NA 4D7FA 5JB8S 1H8IH 1JIMA 1Z1IA 1NFWA 4ISNA 2XBXA 2HPPH 3ATLA 1O3PB 3MOCA 1ZSJA 1O2QA 4AG1A 1MQ6A 1WQSA 3VGCC 3T2NA 1LCYA 1HPGA 4X1PU 3BG4C 4IMQA 4D9QA 1KLJH 1C5OH 2RA3A 4GHQA 2JH0D 1O38A 1SQOA 3RP2A 2VIVA 1GDUA 2GT7A 4WJG2 3K9XB 1S84A 4K3JA 4ZMAH 2UUFB 1EKBB 1O2JA 3RXTA 1A5IA 2ZU3A 5HMAA 2Q6GA 5EGMA 3S9CA 1BRBE 4UD9H 1QBNA 4SGAE 5CHAC 3RXFA 1D6WA 1H9HE 5DGJA 1F92A 1SPJA 1YPEH 3ZZCA 3LONA 1QB9A 4Z6AH 1C5LH 1O2VA 3D23A 5E0HA 4X8TH 2ZECA 1V2UT 5EQQA 2F3CE 2HNTE 3U1IB 1MAYA 2FOFA 4IW4E 1KTSB 5EW2H 4CR5A 1PJPA 5EXNA 4DG4A 3PM3A 1ZLRA 2ULLA 2I6SA 1O0DH 4YLUA 4FVDA 3LC5A 3VEQB 1FN8A 1P04A 2SNWA 1UO6A 3ZZDA 1S82A 1FY1A 2THFB 2FTLE 4CRAA 1P2OA 1Y3UA 2FX6A 3UQVA 1AI8H 4OGYA 5LGOA 3LGTA 3TIUA 1NRQH 4BTUB 1YCPH 2PFEA 2BLOA 3GY2A 2FOCA 2ZFFH 2J9NA 2QXHA 4IC5A 1VZQH 3SI4H 5GIBA 4B71A 1K1MA 1NRSH 4HI3A 5SGAE 3BV9B 1ZRBA 3VXEH 1DXWA 1ID5H 3RXJA 1NZQH 3M3TA 3FZDA 1HAXB 3PLPA 3TNSA 4VGCB 1DSUA 5JBCS 1QRWA 1HUTH 2FXRA 3UWJH 2WPJS 2Z9GA 2GT8A 2CHAC 3A7YA 4ABJA 1O2OA 1LPKB 4ISIH 1EZSC 1K1PA 4K1SA 6GCHG 1D3TB 1O2LA 2ZKSA 1P2QA 4WF8A 4MPUA 3NPSA 8ESTE 1SOZA 2EC9H 3BIVH 1J9CH 3F1SB 2Y80A 3LDXH 1LHEH 1QNJA 4B73A 1AIXH 2H9EH 3UPEA 3SN8A 5HYOA 4K69A 2VIDA 2R3UA 3TU7H 4CR9A 2EI6A 2GCHF 3L3TA 1DICA 2A31A 1OWIA 2F9UA 4JYUH 3RLWH 1CHOG 3SJIA 4WH6A 2R2WU 4WXVA 3FZZA 2ZU5A 1V2NT 2JKHA 5DP6A 1FIZA 5FPTA 2BMGB 2QY0B 1MTNB 4CRFA 1TIOA 2FYRA 1Z8IB 1TOMH 2HLCA 3RM2H 1PFXC 1EX3A 2ZGCA 3H5CB 6CHAC 1JBUH 2FOEA 3SOSA 1DWDH 2Y81A 1KXFA 4MTBA 2OC8A 2AIQA 3P95A 4Y8YA 2AH4X 1A3EH 1QA7A 3TITA 2WPMS 2IN2A 2OLGA 4IMZA 1NRPH 4B76A 3RXBA 3ZYEA 1ANEA 1FV9A 2QXIA 1C1WH 3E16B 1HXEH 2FX4A 4TWYA 1QHRB 3UNRA 5DK1A 3QTOH 2J38A 5I46H 4ZKOU 1C2KA 1GWAA 4E7RG 1GBJA 2M5TA 4CBOA 2GCTC 1YPMH 2BXUH 1E38B 2VGCC 1SLVB 3TH4H 2XBWA 5AHGH 4AFSA 1B0FA 2G4UA 1HFDA 1KTTB 4FUEA 2ODQA 1NM6A 1SR5C 1THPB 1C1PA 1AMHA 5F8XA 3MH6A 1GBKA 1PQAA 1LHDH 1TNKA 3OY5U 3Q3KA 1MAXA 2F83A 4KTUA 1PPHE 3T62A 1PPGE 3UR6A 3QGJA 2C8WB 1FY8E 1O5DH 3A85A 2UWOA 3Q00A 5FPSA 2R3YA 3RU4D 2BD9A 2BM2A 1Y5UT 1G2MA 1OWJA 2TRMA 3TJOA 5AFYH 2ZNKH 1H4WA 3GDVA 2UWPA 5B6OA 1O3KA 3GY3A 4NZLA 5AF9H 1MMJN 3RXDA 2AFQB 3SUFA 1QRZA 2GTBA 2AS9A 1ORFA 4DJZB 1ESTA 4YOGA 1CVWH 1J8AA 2W5EA 1TPOA 1GMCG 5PTPA 2F9BH 2HOBA 1GDQA 1QRXA 3ZYDA 1F2SE 1HAOH 1Q2WA 1ELCA 3S0NA 5JBAS 3RXIA 2QF0A 2ZDVH 4PROA 3V13A 3BTFE 2XC0A 4X1NU 1AGJA 3GY8A 1GI9B 2Z6BD 1L0ZA 3GY4A 4K1TA 3OTJE 5GDSH 5C5OA 1HXFH 1D3QB 7GCHG 1C4V2 4FUIA 1O5EH 2PWXA 2A4QA 1NN6A 1HAYB 2ANYA 3O8CA 1LPZB 4TPYA 1TWXB 4YO9A 4AZ2B 3KNXA 2W7SA 3MU1A 2PSYA 4MG3A 3L6PA 2QYIA 1F0UA 1GI3A 4CH2B 2Q6FA 4AX9H 1V2ST 1IQIA 2KAIB 1AY6H 1AN1E 1CU1A 2BLWA 4FUGA 1T8NA 1ELAA 4DGJA 1L2EA 3KIDU 1BBRE 1G3BA 1K1NA 1Z8GA 4ZHAA 3RDZA 2GX4A 1QY6A 3SUGA 1F5KU 1IHTH 3ZZAA 3RXAA 4KTSA 1FN6A 5EG4A 4MNWA 2HNTF 4B2AA 8GCHG 2FDAA 1FPCH 1ELEE 5C1XA 5CMXH 2FI3E 1T8OA 1GI0A 5BPEA 1QL8A 3VB7A 1K21H 1P2JA 1CGHA 3SV9A 3PMJA 2G5VA 1QJ7B 5IDKA 2BD5A 1NU7B 4Q80A 2H6MA 1Y8TA 1FLEE 2FZZA 3BTDE 4JK5A 1FMGA 4FU8A 1N6YA 3E3TA 2A2XH 3S69A 1SGCA 1BITA 2BYAX 1GCDA 1P8VC 1AUTC 2ZCLP 1K1LA 1JIRA 2NU3E 1O3BA 1A5GH 5GCHF 1OYQA 5ETXA 1QCPA 3BTWE 3E90B 4ZKSU 2VWMA 1ZSKA 1GMHF 1P3CA 3K65B 1EOLA 2ESTE 4K5ZA 1Z71A 2HVXA 1XX9A 1HAGE 2ZGJA 4X6NA 1UTQA 3AW1A 1JWTA 4OS6A 1L4ZA 2ALVA 1WYKA 3EQ0H 1OP0A 1CT0E 3UOUA 1DY9A 3MNXA 1TMBH 1WOFA 1BTWA 1BMNH 2GV7A 2I6QA 3MNCA 4ABAA 2Y7XA 3MWIU 1HAPH 1DPOA 1UCYE 4NA8A 3SHCH 4GAWA 4OS4A 1A2CH 4AGJA 1K9OE 1O36A 5A8YA 3TGKE 4UFGH 1YM0A 1P06A 2ASUB 2GMTC 3BTME 1GHAF 1UVPA 1QGFA 2FOAA 3GOVB 2XCFA 1PQ5A 3VGCB 1FPHH 1WBGB 1Y59T 1LHFH 1VCQA 3TH2H 3URCA 1GBTA 1YPHE 4X1QU 4B1TA 2GDEH 2ZFQH 2GGVB 2A7CA 1TNJA 3C1KA 1TNIA 3AW0A 3SUDA 2VH0A 7ESTE 1O33A 1OWEA 1MBQA 2WPHS 1OWHA 4JYVH 4XSKU 1K22H 2ZQ2A 2ZFPH 4MPWA 3QUMP 4NZQA 3H7OA 3TK5A 1GJBB 2BHGA 2V0BA 2FEQH 2VNTA 2ZHDA 1ARCA 4JZ1A 2Y82A 1GJ4H 1C2IA 4IS5A 2EA3A 1T31A 1MCVA 4X8VH 3UIRA 1F5LA 4AYYB 2ZEBA 3PWBA 4KELA 1UTPA 1TA6A 1L1NA 2XRCA 1CE5A 1V2MT 3SGAE 2BDAA 1TABE 3U9AH 1QL9A 4B75A 1HAHH 3IITA 4NSVA 2Z7FE 2ZHEH 1EJMA 1O3IA 2XCNA 3EA8A 1SB1H 1BDAA 1UJ1A 2FWWA 1P9UA 3TH3H 2ANKH 1ACBE 1A46H 3M7TA 3V0XA 1LDTT 1W8BH 3B23B 4U2WA 1LQDB 4YZUA 2EEKA 4X1RU 4Y7BA 4J1YA 1IQLA 1NC6A 1XUFA 1YP9A 2C90B 3ZVDA 1TNHA 1G3EA 1AHTH 4UE7H 1ELGA 1N6XA 1O2GH 2HRVA 4HZHA 4MNYA 3LGUA 1W10U 1RTLA 1WTGH 3RLYH 2BZ6H 3V7TA 1QA0A 1X7AC 1RXPA 2JH6D 3QLPH 1GI1A 1AVXA 1DM4B 1UVTH 2XBYA 4Y76A 4ZUHA 2OBQA 4LOYH 2OCVB 3GDUA 4Q7ZA 1V2LT 3QZQA 4DT7B 1GHYH 5F8ZA 3QTVH 2A5AA 3I29A 3GCNA 1EAXA 1OX1A 2B8OH 1MKXH 4K60A 1Y5AT 3SZNA 1P2KA 3STIA 3PWCA 3SV7A 1K2I1 1HNEE 2YOLA 2ZQ1A 1LHCH 1SI5H 2BY7X 1FAKH 1SQAA 5DP4A 6GCHF 4AB8A 1BHXF 1V2JT 1LMWB 1TPPA 5BRRE 2QA9E 3Q3XA 2VWLA 1TQ0B 3GDSA 2OQUA 3RXSA 3MO9A 3PO1C 2P3TB 4NFEA 3GCTF 1HCGA 2BD2A 1QTFA 4Y71A 1XXFA 1JMOH 1NT1A 2ZZUH 4WMDA 1GBHA 2OP9A 1W0YH 2FPZA 2Z3EA 3KHVA 2BTCE 1O3AA 1W7XH 4I8LA 4BNRA 6CHAB 1O3GA 1ETSH 2SGAA 1C9PA 3RXEA 1CHOF 2CF8H 1K1JA 3OSYA 2PTNA 4Y0YE 1UVUH 3BN9A 1LVMA 1EAIA 2CMYA 4OS1A 1A4WH 1PQ8A 3ESTA 4I33A 3S7HB 1F0TA 1EATA 3A81A 3AASA 3G01A 2OXSA 2D1JA 4BTTB 3SU3A 5L2ZH 4YESB 8LPRA 1AFEH 4CRBA 2CF9H 1O37A 1XKBC 3RU4T 3T5FH 5EQSA 4HTCH 2GCTB 4TY6A 2VGCB 1RS0A 1TRMA 2NWNA 1EXFA 1TALA 5E0GA 5EXMA 5HM9A 2AMQA 1MKXK 2WV4A 3N7OA 1WUNH 1NS3A 1MH0A 1LTOA 2FS9A 2OD3B 5L6NH 4Z0KA 4WWYA 1DUAA 4NIWA 1CBWC 2BOKA 4NG9H 1KYNA 1Z8JB 3A89A 3A8AA 1K1IA 1GJ6A 2BD3A 2A7HA 1GG6C 2Z9LA 2Q1JA 1HAVA 1SHHB 3LGIA 1AFQB 3LJJA 2ZTZA 4DVAU 2Z94A 3QDZB 1VITG 2BY5X 4WMEA 1L1JA 1QR3E 1SHYA 1V2TT 3URDA 1QB6A 4BAHB 3S7KB 3SO3A 4ESTE 1HYLA 3K6YA 3R0FA 3DA9B 2PUXB 2A45B 2ZFTA 3RMMH 1DLEA 2P16A 1J17T 3Q3YA 5L2YH 4NA9H 2P8OC 3QX5H 2HWLB 1C9TA 3IG6B 2PKAA 1P02A 1AE8H 1HJAC 5A0BA 2JETC 3A84A 1M9UA 2FI4E 2AIPA 2A32A 1SLWB 1YKTA 2BVRH 2DUCA 1P2MA 1TQ7B 2XW9A 1IAUA 1UVOA 1GMCF 2TGAA 2SNVA 1ZRKA 2PTCE 4DIIH 1C1QA 1ZMLA 3SNEA 1TGBA 3CENA 2Z3DA 1XKAC 2TGTA 1NPMA 3UY9A 4YOJA 4LZ4B 2HPQH 1V2RT 1EOJA 4IC6A 4KGAA 1SFQB 2FIRH 3GY6A 4ZXXH 5EODA 5E8EH 1DDJA 5EQRA 2BX4A 4FXGH 4XFQA 3LT3A 1ETRH 7GCHF 3KQCA 3SJ8A 2FOMB 5LPFA 1OP2A 4DCDA 3E1XB 1MTVA 1YLDA 3K2UA 1OSSA 1FJSA 3SU5A 5FCKA 1KDQA 1ZGIA 3V12A 4A7IB 5T6GA 1GHBG 3VB4A 4YLQH 4E06H 3ZV9A 1A5HA 1C1SA 3KF2A 4RN6A 3M5LA 3LOXA 1C5ZB 4ABDA 4X2VA 1UK2A 2P3UB 6ESTA 1BTYA 5T6FA 1Z1JA 1GMDG 2YNBA 1GJ9B 1DSTA 1ZPBA 1GBFA 1VGCB 1BT7A 1DY8A 1NFYA 1ZHRA 1O2SA 1C5UA 4U30A 2AGEX 5DG6A 2A7JA 3T26A 2P3FH 2C8ZB 8GCHF 2AERH 2G51A 1C5PA 1TPAE 2G52A 2R0LA 3PMHB 4X6OA 3U1JB 1P3EA 4WVPE 4BAMB 1GI7B 2RDLA 1WAYB 2P94A 3SU2A 1ELBA 2BY6X 1ZOMA 3MO3A 2WPIS 2PGQB 3UOPA 5EPNA 1WCZA 1YPLH 2IJOB 3V3MA 3UWIA 4CHAB 1IOEA 2F9OA 2GZ9A 1D6RA 1L1GA 4X8UH 1FY5A 1THRH 3FP6E 1GI5A 2D26C 1QURH 5A8XA 3A7XA 2R9PA 1VCPA 1HJ9A 3MNBA 2ZDMA 4BTIB 2P93A 1EAWA 1LO6A 1C2FA 1XVOA 2BXTH 3SU0A 1GVZA 1FUJA 3UR9A 1AD8H 2HNTC 3MYWA 2J92A 1KLIH 3LPRA 3M7UA 5A8ZA 4GPGA 3LU9B 1NRRH 1FDPA 5C1YA 2B5TB 2Z9IA 3SQHE 2VVVA 1HAIH 2BX3A 3RXKA 1EPTC 3BIUH 3OX7U 1TGNA 1GBIA 8KME2 3E6PH 1TNGA 1EPTA 5TJXA 2P59A 4X2YA 3RXOA 1GBEA 3C27B 3PMAB 1FNIA 1F0RA 1NU9A 1OOKB 3ATKA 4M7GA 3M7QA 2XTTB 5HGGA 1BMMH 1FONA 1O39A 4TWWA 2W3IA 1O3DA 1O3HA 3WY8A 1NFUA 4CBNA 4ZAEA 4OS2A 4X8SH 2XBVA 3KCGH 1DWBH 1AVWA 1S83A 2ODPA 2CXVA 1V6DA 3M3VA 1MD7A 2VJ1A 4ABGA 1YF4A 4MDSA 1SL3A 3FAOA 1AE5A 1GCTC 2TIOA 4INHA 2OC0A 3S9AA 1DX5M 1O2YA 1K28D 1DUEA 4ISHH 1ABIH 1C1NA 3VPKA 3MH4A 3BEUA 4XDEA 1TGTA 2EI8A 3M35A 1C5VA 1JOUB 4UEHH 5FPYA 1C4U2 1FAXA 2BDBA 1O3FA 1EAUA 1GHVH 2FESH 1C5QA 2ZFSA 3PTNA 3NXPA 3A8BA 4OGXA 3M37A 1V2WT 1UTOA 1LPGB 2A4OA 2BDGA 4IN1A 1AUJA 2BZAA 1H9IE 4BANB 1SMFE 1O2IA 4NGAH 4THNH 1V2QT 4QT8C 4CH8B 2ILNA 1C5WB 3NWUA 4ZKRU 3CS7A 2GZ8A 3A7TA 1T7CA 1F0SA 1BA8B 3UNQA 3RU4E 4Y8ZA 2FM2A 1Q3XA 1T8MA 5E2OA 3RC5A 1OWKA 7KMEH 4AYVB 1C5NH 4JYTA 4D9RA 3I78A 1A7SA 3A7ZA 1LVOA 3ATWA 1TYNA 3P8FA 3SU4A 1BRAA 4ABFA 1VJ9U 4B74A 2PSXA 1W12U 2Y7ZA 4O97A 1W13U 1WTHD 4VGCC 1A61H 3PTBA 1C5YB 5CE1A 5A0AE 3BTGE 1D3PB 5TCAA 1D4PB 1C1RA 3R3GB 2F9PA 2GVFA 3QK1A 3NKKA 1V3XA 3ODFA 4OS5A 4BAOB 2VU8E 4CRCA 9LPRA 2VWOA 4I7YH 5J4SA 3ODDA 4ZHLU 4AFUA 1BTHH 4Q2KA 3TJUA 3TK9A 3TGIE 1O5BB 1GHXH 4INKA 3PO1B 1SGRE 1TBRH 1BCUH 1AVGH 1KXEA 4GHTA 3EGKH 2VIOA 1GL0E 2VIQA 3ENSB 3RXRA 1BTZA 1QQ4A 1E35B 5DO4H 2ZP0H 3A80A 4UONA 5FBEA 1MTNC 2BD4A 3P92A 3MHWU 1HV7A 4LK4A 1ZYOA 3SQEE 1QBVH 2TGDA 1ELDE 4KP0A 1DOJA 3DD2H 1O32A 4A5TS 2H5CA 1ANCA 1TMUH 2ZU2A 1D9IA 1J16A 3M61U 2C3SA 1E36B 2ZTYA 1C2DA 4ABEA 1SSXA 4YT7H 3ZVBA 1BZXE 1FZZA 5I25A 1E0FD 4I8GA 4CREA 2J4IA 1TX8A 2J34A 3DHKH 4XBDA 3SV6A 2WINI 4ABBA 3OU0A 2QXJA 4AGKA 2BD8A 1GI4A 3BG4B 2XXLA 1SQTA 3TJVA 2TBSA 1GJAB 1BRUP 2QV1A 2TPIZ 1AB9C 1YPKH 3MU4A 4A6LA 1E37B 2BB4A 3ATIA 2H1UA 2ZDLA 3HATH 3P8NA 5JPMH 2RG3A 2UWLA 1CBWB 1XUJA 3E0NB 1RD3B 2G8TA 1HAVB 1PYTD 1ZR0A 2QCYA 2G55A 1RIWC 2V35A 1GG6B 1Y3XA 1C5MD 2ALPA 2R2MB 1SC8U 3BSQA 3UUZA 1DVAH 1EJAA 2CJIA 3D62A 1FI8A 5CHAB 1TX6A 1Y5BT 1V2OT 1WSSH 5AVDA 5EXLA
chains in the Genus database with same CATH superfamily
1SFIA 4UFDH 1QB1A 1UVSH 2NU0E 1CA0C 4R0IA 4ZCNA 3MNSA 3HK3B 2BVXH 2PUQH 1ESBA 2K1QA 5JYIA 1C2LA 2OK5A 3GCHC 2PKAB 3QO6A 3AAUA 3EA7A 4A1TA 1VITF 1GJ8B 2OUAA 1T4UH 5F6MA 1HJAB 4GCHG 3LH3A 2TGPZ 2ZTXA 1O2RA 1Z6JH 4Y11E 2UUYA 1A3BH 1HIAA 3SGBE 3QN7A 1DFPA 1PPFE 4IN2A 5C0TA 3P70B 3PRBA 1ZMNA 4AB9A 2W3KA 5C20A 4D76A 4UFFH 3RXQA 4LXBH 1NRNH 1YGCH 2WUBA 1SBWA 1WQVH 5T6DA 1SGQE 1OYTH 5C3NA 3UFAA 5A2MH 1C5TA 2C8XB 1IQMA 3GYMA 4K2YA 1NBMD 4WY3A 2AMPA 4OS7A 2B9LA 2DE9A 2V3MA 4AORA 1KDQB 2FP7B 1CA8B 2WZQA 2XNIA 1SGEE 1BBRH 3EDXB 1UTMA 4UFEH 4Q4LA 4MVNA 2CHAB 1GJDB 1O30A 3P17H 1GJ7B 4TPIZ 3ZZ9A 2WYGA 2Q6DA 1YPGH 2PGBB 3KN2A 4ZXYH 3SJOA 1P11E 1GPZA 4Y0ZE 1GI2A 2PR3A 1AWFH 1UTLM 4ACBA 2D8WA 4FUJA 3RC6A 1TFXA 1UK3A 3SV2H 1S6FA 1XMNB 3H7TA 2ANWA 3U8OH 2RA0A 1P03A 3U28C 1IHSH 3F0OA 2STAE 5DJ7A 5H4IB 4I8KA 4K8BA 1S85A 1GI8B 3KGPA 2A0QB 3FVFB 3ZZ6A 5J4QA 1Y3WA 1H8HD 2STBE 1C4Y2 2ZIQH 1ESAA 4JZEH 2B7DH 2FO9A 4ZHMU 1O3LA 3K6ZA 1RFNA 1T4VH 1QBOA 3PMBB 4RKJB 1IQNA 3L33A 3A7WA 3U8RH 2ZC9H 4ZROA 1GMDF 4MNXA 4HGCA 1YPHC 3BTQE 3RXPA 1BTXA 1H1BA 1BTUA 2PHBA 2A1DB 1GMHG 3LGVA 1THSH 3LJOA 3O8BA 4RSPA 2NU2E 2ZG0H 3EE7A 3SNCA 1EUFA 1XVMA 1O2PA 1WU1A 3ZZ8A 3PV2A 5FHTA 3TPIZ 4BXSA 4XE4A 1HRTH 1XM1A 2BY9X 3F9EA 2UUKB 1N1LA 4XBBA 3SU6A 1SLXB 2PLXA 2H2ZA 1ANBA 1NESE 3SJKA 1EB1H 5DP5A 1EQ9A 1DLKB 1MBMA 4U32A 1BBRK 2PV9B 3DSOA 2F9NA 1G32B 5A0CA 1UCYH 4NIXA 1FX0B 1VJAU 1GGDC 1J14A 1DS2E 1SGYE 3DSPA 4NWLA 1UTNA 2NU4E 1P05A 3A87A 3MH5A 1TA2A 1LKBA 5LH8A 4MLFB 1A0LA 1FY4A 3TNTA 1WDIA 1UK4A 7LPRA 3ZZ7A 1VR1H 2CV3A 1ZPCA 3KQEA 5FX6A 4DT4A 3KQBA 2OBOA 3OY6U 1AZZA 2ZHFH 2Z9JA 3LC3A 4ISOA 2V3HH 1O2MA 1ZJKA 3KL6A 1O2UA 1RJXB 2JIZD 4BXWA 4XRNA 3GISB 1YC0A 1GL1A 1DXPA 1EPTB 2KX4A 2RCEA 1ZZZA 2VVCA 1TE0A 2G4TA 1SGTA 1SQRA 2NU1E 1PYTC 3TLOA 3WWBA 1GBDA 4A1XA 3M3SA 2BDCA 3M5MA 1F7ZA 1K1OA 2CN0H 2BOHB 1L4DA 1B5GH 2ZGXH 2ANMH 3O8DA 4WH8A 1WXRA 1GVLA 2PKSC 1O2TA 2B0FA 2AEIH 3MU5A 2R0KA 1O35A 3OFND 4H42U 3QWCH 1GCTB 1QQUA 2ZU1A 4YM9A 2GKVE 1GBBA 1G9IE 1N8OC 1RTKA 3W1EA 1DWEH 1ETTH 3OYPA 3PV5A 1MZAA 5ESTE 1C2MA 2K0QA 5F03A 3A86A 2A5IA 1QL7A 2C93B 1MCTA 3P6ZB 2A4GA 2GZ7A 1MKWH 1C2JA 4NWKA 5C1UA 2J2UA 1UCYK 2H9TH 4A92A 1W2KH 2HALA 3MO6A 4TYDA 2D2DA 1HLTH 1S6LA 3FKSD 1SGPE 3SHAH 2FODA 3NUMA 4DIHH 3M36A 4FUFA 3EAJA 4AOQA 1H9LB 3TGJE 1O2KA 4RT1A 1MTUA 2RDEA 5AFZH 5HXFA 4CRGA 3TVJB 5A09A 1KIGH 4JK6A 3I77A 5CHBA 1UHBA 1HBTH 1GBAA 2F91A 2ZCHP 1TNLA 2EY4C 2GP9B 3VB5A 1AWHB 3ZVAA 2FOHA 4WMFA 4BAQB 1GBCA 3GY5A 3U98H 1MZDA 4D7GA 3Q77A 4O03A 3RXHA 3RUOA 3PLBA 3SU1A 1KXAA 5C67A 1KXDA 1RGQA 1AU8A 5JBBS 3W95A 2EI7A 1TX7A 3E91A 2FS8A 2XYAA 3TJNA 4X0WU 3HPTB 5FAHA 1A0JA 1TPSA 2SGQE 5FXLA 1TRYA 2ZCKP 3Q76A 4FOUC 3DFLA 1IQHA 4MQAA 1C5XB 2LNCA 1ZTJA 2VH6A 4AFQA 2QIQA 4WXIA 3SORA 3SNBA 4MPVA 3N7DA 1H8DH 1J15A 3SGQE 1MKWK 3GCTG 4H4FA 1TLDA 2ZDNA 2ZU4A 1G30B 1E79D 1MQ5A 2FOGA 2Y6TA 1OKXA 1O5FH 1GI6A 1W3CA 3F68H 5ABWA 3ZVFA 1CHGA 2FLBH 2G00A 2V6NA 1QJ1B 2FI5E 5K7RA 3RXCA 5HM2A 5F8TA 4CRDA 1XUIA 2OQ5A 3JZ1B 3LKWA 1AKSA 3F9FA 3FP8E 2BQ6B 3A83A 1GHZA 3BTKE 2O8UA 1MUEB 3EE0B 1ZTKA 3BEFB 3HKIB 1YCPK 5DP3A 4JMYA 4TSFD 4K8YA 1ELFA 3P8OA 4Y7AA 3LGYA 1O5AB 2SGDE 4GLYA 4B6FA 3B9FH 1CT4E 1W0ZU 2FOBA 1BB0B 2F43B 3QZRA 1O34A 1Q31A 5EU8A 2ZPQA 3HGPA 3PYHA 1ANDA 4DOQA 2GMTB 3D65E 5FBIA 1DITH 1EP5A 1O3CA 3A88A 4FUHA 5LPRA 5GNDA 2O8LA 5EJZA 1MTWA 2AGIX 1INCA 1AB9B 1MTSA 2XWBI 3MH7A 5GXPA 5DP9A 5LPEA 5CDFE 2XWAA 1G2LA 3ATMA 1KXCA 1P0SH 5DPAA 2ZFRH 3RMLH 1OP8A 1BHXB 2AMDA 3UTUH 3SI3H 1G3CA 5TCCA 1G3DA 3ZV8A 1RIWB 3IWMA 1T32A 1P57B 5DKMA 5JB9S 1MABB 5EOKA 1LQEA 1O3NA 2K8IA 3ITIA 1AQ7A 1SGFA 1BUIA 3P8GA 3SNDA 3KYFA 3JZ2B 2O9QA 1ELTA 9ESTA 1MU8B 1BTPA 4DY7B 1LVBA 2J94A 1O2XA 2OINA 3UREA 1U6QA 1AFQC 1O3EA 4INLA 1YPJH 1HB0B 2LP6A 4H6SB 4JCNA 1CA0B 2WPLS 2WYJA 5FX5A 1EB2A 1O31A 5GPIB 1IQKA 2WPKS 1DWCH 4LZ1H 2JDID 1EZUC 1S0QA 1S81A 2P95A 2YNAA 3EA9A 3A8DA 3GCHB 4F49A 2F4LA 4FUCA 4R8TB 3SNAA 1Y3VA 1PPCE 3ZVCA 2QAAA 1V2VT 1GBMA 2FLRH 1NTPA 1YLCA 1EP6A 1SGIB 1UTKA 1SG8B 3SJ9A 4FVBA 1Y3YA 3VB6A 3VG8A 5K0HA 1HIAB 1P01A 1CO7E 1S5SA 2WHXA 3SW2B 1FIWA 2J95A 1NO9H 4HFPB 5C94A 2GV6A 3ZZ5A 2VWNA 3GY7A 5G4BA 3CS0A 4Y10E 1BRCE 4GCHF 3B8JA 1TBZH 2G81E 1P9SA 4ABIA 1HJ8A 2GDDA 2DE8A 1ZMJA 3GICB 1QIXB 1E34B 2LPRA 4M9FA 1C1OA 1OWDA 3MFJA 4Q7XA 4Y79A 3RM0H 1TB6H 1MU6B 4FUDA 3DUXH 1C1TA 1BQYA 1PPZA 2ZO3H 3BEIB 2A5KA 4ASHA 1BJVA 1BIOA 5IK2D 1GJ5H 1B0EA 1V2KT 1XUKA 2SFAA 3MTYA 2ZI2H 4XOJA 6LPRA 4Y6DA 5GJ4B 1ABJH 1SLUB 2W6JD 4FUBA 3O8RA 2ZPRA 2VVUA 2GCHG 1ZJDA 5E0JA 4BOHA 1S6HA 3H09A 2XC5A 4KTCA 3KQDA 1Z7KA 3A8CA 2IPHA 3LIWA 4GVUA 4O9VA 4NA7A 3RXLA 3T27A 4FETA 2ODYB 4NIVA 1O5CB 1P09A 1KLTA 3LGWA 4E7NA 2HGTH 2ZDAH 1VGCC 3PROA 1OXGA 1G36A 1FQ3A 3RXMA 3RC4A 2AYWA 2ZHQH 4ZKNU 1ZSLA 3SV8A 3A7VA 1PQ7A 3MI4A 3UNSA 4X1SU 3T28A 4AFZA 1W0KD 1LHGH 2A2QH 4YTAA 5ESBA 3UB0A 1S0RA 3PLKA 1Z8RA 3EYDA 3BTTE 3FP7E 1HDTH 1O2HA 4YT6H 5JBTA 2ZDKA 1SGDE 1KSNA 1C1VH 5HIZA 1CGIE 3ZZ3A 1ZPZA 3MMGA 1YCPM 4NIYA 2ZF0H 4CHAC 1TMTH 5L30H 4TY7A 5EPYA 2UUJB 1O2NA 2SGEE 3E8LA 3A82A 5EJLA 1KXBA 3OTPA 5EW1H 3BTEE 4A1VA 1XUGA 4U01A 1VITH 2FYQA 2FTMA 4AN7A 2PW8H 1GGDB 3KQ5A 3VB3A 1RTFB 4SGBE 1UTJA 2Y5GA 3FANA 1BMLA 1FXYA 1HAZB 1IQEA 3ZVEA 3CP7A 3TK6A 2FMJA 4I32A 3DFJA 2C8YB 3AVZA 2HVYB 3ZVGA 1OPHB 3BF6H 3HGNA 1TONA 1TBQH 1CSOE 2QN5T 1P12E 4DW2U 1C2HA 1P2IA 4JZFH 1Z6EA 1CGJE 4JZDH 1IQFA 2BLVA 4O3TA 3LH1A 1PPBH 4F4OC 1RRKA 2GD4B 2OC7A 1HGTH 3MU8A 3UQOA 1GDNA 1YWUA 1V2PT 2L6OA 3VFEA 3D49H 1O5GH 4IGDA 3RMOH 2BD7A 1EASA 5JDUB 2ZGBH 1DT2A 3DT0H 4YOIA 5EJ1A 1C1MA 2PKSB 4MPXA 1MD8A 1ZTLA 4I8HA 1C2EA 2BQ7B 2G5NA 1BMAA 2QF3A 1O3MA 1QZ8A 4BAKB 3GCOA 2P8OB 4X2XA 1N8OB 3AAVA 1NY22 1ZHMA 3ZZ4A 4E05H 3W94A 1BOQA 4KKDA 4I31A 4FU7A 4NSYA 4X6MA 1W7GH 2JETB 2O8TA 2ZWLH 1SVPA 3NK8A 1O3JA 1B7XB 3RMNH 3T25A 2BDIA 1C2GA 2XC4A 2C4FH 4D8NA 1O3OA 3U69H 2XNDD 2SGFE 3NCLA 2VIWA 4H6TA 4O3UA 2ZA5A 2O8MA 2Z3CA 3RXGA 1C5RA 3KYGA 1NROH 4NFFA 2BLQA 4XD7D 2YMSB 3PV4A 2BDHA 4J2YB 4K1EA 1GBLA 2ZHWH 1CQQA 3RXUA 1UHBB 4GUXA 1OS8A 2QGRA 3VXFH 1YYY1 3AK5A 1XUHA 3T29A 3PB1E 3F9HA 1XXDA 3FFGA 2VB0A 4Y8XA 3F0PA 4FU9A 1ZGVA 1A0HB 1D3DB 3U8TH 1G37A 2O8WA 3KEEA 3HKJB 3BG8A 3QGNB 4B2CA 1O2WA 1QJ6B 1EJNA 1TOCB 3F2GA 1W11U 2V3OH 3E0PB 4X2WA 1UMAH 4RKOB 4DURA 2JH5D 2KAIA 2WSSD 5DP7A 4IBLH 4UDWH 2ZPSA 3MU0A 5DP8A 2W7UA 3RXVA 2Y5HA 4ISLA 1CT2E 3GYLB 2BDYA 5F53A 1C1UH 1EZQA 1SGNE 2SGPE 1GHBF 1TAWA 2AGGX 1C5SA 3STJA 1JRTA 4GSOA 1LKAA 1NFXA 2A4RA 1YBWA 2ZGHA 1VCWA 2Y5FA 1T8LA 1ARBA 1TGSZ 4ZH8A 1IQJA 2H9HA 1SGFG 1GHWH 3HK6B 1EZXC 4AG2A 5GCHG 2JJ2D 2LELA 5IYTA 1QFKH 1TGCA 1DANH 1LVYA 2Z9KA 2BVSH 2H5DA 2KCYA 1AO5A 2WUCA 3S9BA 2CGAA 4NCYA 1P2NA 3F6UH 3BTHE 2W26A 1GJCB 2QC2A 1AKSB 4JZIA 1A1RA 4Q7YA 4XBCA 5C2ZA 1F5RA 1BJUA 1JRSA 2WV5A 3NZIA 3SBKA 5T3HA 2IOTA 1GVKB 1DE7H 1W14U 4I8JA 4X6PA 1ZHPA 2IPQX 4ABHA 4B2BA 3M5OA 1O2ZA 2BQWB 5FCRA 2QF5A 1KY9A 1WV7H 1IQGA 3ZZBA 2F9VA 1PPEE 4MNVA 2OC1A 1SOTA 1JXPA 5GWZA 2OTVA 3M5NA 1H8ED 2VIPA 5E2PA 1FY3A 1GHAG 1P10A 2J5UA 3F9GA 2BY8X 1AZ8A 3ELAH 3F2FA 3SUEA 1TRNA 2QXGA 1ELVA 2VINA 5C5NA 4D7FA 5JB8S 1H8IH 1JIMA 1Z1IA 1NFWA 4ISNA 2XBXA 2HPPH 3ATLA 1O3PB 3MOCA 1ZSJA 1O2QA 4AG1A 1MQ6A 1WQSA 3VGCC 3T2NA 1LCYA 1HPGA 4X1PU 3BG4C 4IMQA 4D9QA 1KLJH 1C5OH 2RA3A 4GHQA 2JH0D 1O38A 1SQOA 3RP2A 2VIVA 1GDUA 2GT7A 4WJG2 3K9XB 1S84A 4K3JA 4ZMAH 2UUFB 1EKBB 1O2JA 3RXTA 1A5IA 2ZU3A 5HMAA 2Q6GA 5EGMA 3S9CA 1BRBE 4UD9H 1QBNA 4SGAE 5CHAC 3RXFA 1D6WA 1H9HE 5DGJA 1F92A 1SPJA 1YPEH 3ZZCA 3LONA 1QB9A 4Z6AH 1C5LH 1O2VA 3D23A 5E0HA 4X8TH 2ZECA 1V2UT 5EQQA 2F3CE 2HNTE 2M2AA 1MAYA 2FOFA 3U1IB 4IW4E 1KTSB 5EW2H 4CR5A 1PJPA 5EXNA 4DG4A 3PM3A 1ZLRA 2ULLA 2I6SA 1O0DH 4YLUA 4FVDA 3LC5A 3VEQB 1FN8A 1P04A 2SNWA 1UO6A 1YY3A 3ZZDA 1S82A 2AHME 1FY1A 2THFB 2FTLE 4P02A 4CRAA 1P2OA 1Y3UA 2FX6A 3UQVA 1AI8H 4OGYA 5LGOA 3OAAD 3LGTA 3TIUA 1NRQH 4BTUB 1YCPH 2PFEA 2BLOA 3GY2A 2FOCA 2ZFFH 2J9NA 2QXHA 4IC5A 1VZQH 3SI4H 5GIBA 4B71A 1K1MA 1NRSH 4HI3A 5SGAE 3BV9B 3F2HA 1ZRBA 3VXEH 1DXWA 1ID5H 3RXJA 1NZQH 3M3TA 3FZDA 1HAXB 3PLPA 3DCLA 3TNSA 4VGCB 1DSUA 5JBCS 1QRWA 1HUTH 2JJ1D 2FXRA 3UWJH 2WPJS 2Z9GA 2GT8A 2CHAC 3A7YA 4ABJA 1O2OA 1LPKB 4ISIH 1EZSC 1K1PA 4K1SA 6GCHG 1D3TB 1O2LA 2ZKSA 1P2QA 2KFWA 2XOKD 4WF8A 4AC9A 4MPUA 3NPSA 8ESTE 1SOZA 2EC9H 3BIVH 2EQNA 1J9CH 3F1SB 2Y80A 3LDXH 1LHEH 1QNJA 4B73A 1AIXH 2H9EH 2KZ4A 3UPEA 3SN8A 5HYOA 4K69A 2VIDA 2R3UA 3WW7A 3TU7H 4CR9A 2EI6A 2GCHF 3L3TA 1DICA 2A31A 1OWIA 2F9UA 4JYUH 3RLWH 2PP6A 1CHOG 3SJIA 4WH6A 2R2WU 4WXVA 1K0HA 3FZZA 2ZU5A 1V2NT 2JKHA 5DP6A 1FIZA 5FPTA 2BMGB 2QY0B 1MTNB 2J97A 4CRFA 1TIOA 2FYRA 1Z8IB 1TOMH 2HLCA 3RM2H 1PFXC 1EX3A 2ZGCA 3H5CB 6CHAC 1JBUH 2FOEA 3SOSA 1DWDH 2Y81A 1KXFA 4MTBA 2OC8A 2AIQA 3P95A 4Y8YA 2AH4X 1A3EH 1QA7A 3TITA 2WPMS 2IN2A 2OLGA 4IMZA 1NRPH 4B76A 3RXBA 3ZYEA 1ANEA 1FV9A 2QXIA 1C1WH 3E16B 1HXEH 2FX4A 4TWYA 1QHRB 3UNRA 5DK1A 3QTOH 2J38A 4OM9A 5I46H 4ZKOU 1C2KA 1GWAA 4E7RG 1GBJA 2M5TA 2QE7D 4CBOA 2GCTC 1KMHB 1YPMH 1E38B 2BXUH 1SLVB 2VGCC 3TH4H 2XBWA 5AHGH 4AFSA 1B0FA 2G4UA 1HFDA 1KTTB 4FUEA 2ODQA 1NM6A 1SR5C 1THPB 2L74A 1C1PA 1AMHA 5F8XA 3MH6A 1GBKA 1PQAA 1LHDH 1TNKA 3OY5U 3Q3KA 2KR7A 1MAXA 2F83A 4KTUA 1PPHE 3T62A 1PPGE 3UR6A 3QGJA 2C8WB 1FY8E 1O5DH 3A85A 2UWOA 3Q00A 5FPSA 2R3YA 3UAIC 3RU4D 2BD9A 2BM2A 4ASUD 1Y5UT 1G2MA 1OWJA 2TRMA 3TJOA 3SYJA 5DSFA 5AFYH 2ZNKH 1H4WA 3GDVA 2UWPA 5B6OA 1O3KA 3GY3A 2RFKC 4NZLA 5AF9H 1MMJN 3RXDA 2AFQB 3SUFA 1QRZA 2GTBA 2VBCA 2AS9A 1ORFA 4DJZB 1ESTA 4YOGA 1CVWH 1J8AA 2W5EA 1TPOA 1GMCG 5PTPA 2F9BH 2HOBA 1GDQA 1QRXA 3ZYDA 1F2SE 1HAOH 1Q2WA 1ELCA 3S0NA 5JBAS 3RXIA 2QF0A 1COWD 2ZDVH 4PROA 3V13A 3BTFE 2XC0A 4X1NU 1AGJA 3GY8A 1GI9B 2Z6BD 1L0ZA 3GY4A 4K1TA 3OTJE 5GDSH 5C5OA 1HXFH 1D3QB 7GCHG 1C4V2 4FUIA 1O5EH 2PWXA 2A4QA 1NN6A 1HAYB 2J98A 2ANYA 3O8CA 1LPZB 4TPYA 1TWXB 4YO9A 4AZ2B 3KNXA 2W7SA 3MU1A 2PSYA 4MG3A 3L6PA 2KCAA 2QYIA 1F0UA 1GI3A 4CH2B 2Q6FA 4AX9H 1V2ST 1IQIA 2KAIB 1AY6H 1AN1E 1CU1A 2BLWA 4FUGA 1T8NA 1ELAA 4DGJA 1L2EA 3KIDU 1BBRE 1OHHD 1G3BA 1K1NA 1Z8GA 4ZHAA 3RDZA 2GX4A 1QY6A 3SUGA 1F5KU 2QF4A 1IHTH 3ZZAA 3RXAA 4KTSA 1FN6A 5EG4A 4MNWA 2HNTF 4B2AA 8GCHG 2FDAA 1FPCH 1ELEE 5C1XA 5CMXH 2FI3E 1T8OA 1GI0A 5BPEA 1QL8A 3VB7A 3OEED 1K21H 1P2JA 3FOAA 1CGHA 3SV9A 3PMJA 2G5VA 1QJ7B 5IDKA 2BD5A 1NU7B 4Q80A 2H6MA 1Y8TA 1FLEE 2FZZA 3BTDE 5C17A 4JK5A 1FMGA 4FU8A 1N6YA 3E3TA 2A2XH 3S69A 1SGCA 1BITA 2BYAX 1GCDA 2HLDD 1P8VC 1AUTC 2ZCLP 5T1VA 1K1LA 1JIRA 2NU3E 1O3BA 1A5GH 5GCHF 1OYQA 3PRDA 1QCPA 5ETXA 3BTWE 3E90B 4ZKSU 2VWMA 1ZSKA 3SZEA 1GMHF 1P3CA 3K65B 1EOLA 2ESTE 4K5ZA 1Z71A 2HVXA 1XX9A 1HAGE 2ZGJA 4X6NA 4RI0A 1UTQA 3AW1A 1JWTA 4OS6A 1L4ZA 2ALVA 1WYKA 3EQ0H 1OP0A 1CT0E 3UOUA 1DY9A 3MNXA 1TMBH 1WOFA 1BTWA 5DN6D 1BMNH 2GV7A 2I6QA 3MNCA 2GJGA 4ABAA 2Y7XA 3MWIU 1HAPH 1DPOA 1UCYE 4NA8A 3SHCH 4GAWA 4OS4A 1A2CH 4AGJA 1K9OE 1O36A 5A8YA 3TGKE 4UFGH 1YM0A 1P06A 2ASUB 2GMTC 3BTME 1GHAF 1UVPA 1QGFA 2FOAA 3GOVB 2XCFA 1PQ5A 3VGCB 1FPHH 1WBGB 1Y59T 1LHFH 1VCQA 3TH2H 3URCA 1GBTA 1YPHE 4X1QU 4B1TA 2GDEH 2ZFQH 2GGVB 2A7CA 1TNJA 3C1KA 1TNIA 3AW0A 3SUDA 2VH0A 7ESTE 1O33A 1OWEA 1MBQA 2WPHS 1OWHA 4JYVH 4XSKU 1K22H 2ZQ2A 2ZFPH 4MPWA 3QUMP 4NZQA 3H7OA 3TK5A 1GJBB 2BHGA 2V0BA 2FEQH 2VNTA 2ZHDA 1ARCA 4JZ1A 2Y82A 1GJ4H 1C2IA 4IS5A 2EA3A 1T31A 1MCVA 4X8VH 3UIRA 1F5LA 4AYYB 2ZEBA 3PWBA 4KELA 1UTPA 1TA6A 1L1NA 3CNRA 2XRCA 1CE5A 1V2MT 3SGAE 2BDAA 1TABE 3U9AH 1QL9A 4B75A 1HAHH 4Q63A 3IITA 4NSVA 2Z7FE 2ZHEH 1EJMA 1O3IA 2XCNA 3EA8A 3ZIAD 1SB1H 1BDAA 1UJ1A 3WWFA 2FWWA 1P9UA 3TH3H 2ANKH 1ACBE 1A46H 4Z1MD 3M7TA 5B6LA 3V0XA 1LDTT 1W8BH 3B23B 4U2WA 1LQDB 4YZUA 2EEKA 4X1RU 4Y7BA 4J1YA 3N99A 1IQLA 1NC6A 1XUFA 1YP9A 2C90B 3ZVDA 1TNHA 1G3EA 2YMSD 1AHTH 4UE7H 1ELGA 1N6XA 1O2GH 2HRVA 4HZHA 4MNYA 3LGUA 1W10U 1RTLA 1WTGH 3RLYH 2BZ6H 3V7TA 1QA0A 1X7AC 1RXPA 2JH6D 3QLPH 1GI1A 1AVXA 1DM4B 1UVTH 2XBYA 4Y76A 4ZUHA 2OBQA 4LOYH 3MQKC 2OCVB 3GDUA 4Q7ZA 1V2LT 3QZQA 2V7QD 4DT7B 1GHYH 5F8ZA 3NRLA 3QTVH 2A5AA 3I29A 3GCNA 1EAXA 1OX1A 2B8OH 1MKXH 4K60A 1Y5AT 3SZNA 4ACAA 1P2KA 3F3BA 3STIA 3PWCA 3SV7A 1K2I1 1HNEE 2YOLA 2ZQ1A 3GS9A 1LHCH 1SI5H 4B6EA 2BY7X 1FAKH 1SQAA 5DP4A 6GCHF 4AB8A 1BHXF 1V2JT 1LMWB 1TPPA 5BRRE 2QA9E 3Q3XA 2VWLA 1TQ0B 3GDSA 2OQUA 3RXSA 3MO9A 3PO1C 2P3TB 4NFEA 3GCTF 1HCGA 2BD2A 1QTFA 4Y71A 1XXFA 1JMOH 1NT1A 2ZZUH 4WMDA 1GBHA 2OP9A 1W0YH 2FPZA 2Z3EA 3KHVA 2BTCE 1NBME 1O3AA 1W7XH 1UW7A 4I8LA 4BNRA 6CHAB 1O3GA 1ETSH 2SGAA 1C9PA 5EIYA 3RXEA 1CHOF 1E1RD 2CF8H 1K1JA 3OSYA 2PTNA 4Y0YE 1UVUH 3BN9A 1LVMA 1EAIA 2CMYA 4OS1A 1A4WH 1PQ8A 3ESTA 4I33A 3S7HB 1F0TA 1EATA 3A81A 3AASA 3G01A 2OXSA 2D1JA 4BTTB 1W0JD 3SU3A 5L2ZH 4YESB 8LPRA 1YLNA 1AFEH 4CRBA 2CF9H 1O37A 1XKBC 3RU4T 3T5FH 5EQSA 4HTCH 2GCTB 4TY6A 2VGCB 1RS0A 1TRMA 2NWNA 1EXFA 1TALA 5E0GA 5EXMA 5HM9A 2AMQA 4I86A 1MKXK 2WV4A 3N7OA 1WUNH 1NS3A 1MH0A 1LTOA 2FS9A 2OD3B 5L6NH 4Z0KA 4WWYA 1DUAA 4NIWA 1CBWC 2BOKA 4NG9H 1KYNA 1Z8JB 3A89A 3A8AA 1K1IA 1GJ6A 2BD3A 2A7HA 1GG6C 2Z9LA 2Q1JA 1HAVA 2WV9A 1SHHB 3LGIA 1AFQB 3LJJA 2ZTZA 2IJD1 2Z94A 4DVAU 3QDZB 1VITG 2BY5X 4WMEA 1L1JA 1QR3E 1SHYA 1V2TT 3URDA 1QB6A 4BAHB 3S7KB 3SO3A 4ESTE 1HYLA 2KM0A 3K6YA 3R0FA 3DA9B 1SKYE 2PUXB 2A45B 2ZFTA 3RMMH 5HIYA 1DLEA 2P16A 1J17T 3Q3YA 5L2YH 4NA9H 2P8OC 3QX5H 2HWLB 1C9TA 3IG6B 2PKAA 1P02A 1AE8H 1HJAC 5A0BA 2JETC 3A84A 1M9UA 2FI4E 2AIPA 2A32A 1SLWB 2KCPA 1YKTA 2BVRH 2DUCA 1P2MA 1TQ7B 2XW9A 1IAUA 1UVOA 1GMCF 5FL7D 2TGAA 2SNVA 1ZRKA 2PTCE 4DIIH 1C1QA 1ZMLA 3SNEA 1TGBA 3CENA 2J98B 1XKAC 2TGTA 2Z3DA 1NPMA 3UY9A 4YOJA 4LZ4B 2HPQH 1V2RT 1EOJA 4IC6A 4KGAA 1SFQB 2FIRH 3GY6A 4ZXXH 2YMSC 5EODA 5E8EH 1DDJA 5EQRA 2BX4A 4FXGH 4XFQA 3LT3A 1ETRH 7GCHF 3KQCA 2CK3D 3SJ8A 2FOMB 5LPFA 1OP2A 4DCDA 3E1XB 1MTVA 1YLDA 3K2UA 1OSSA 1FJSA 3SU5A 5FCKA 1KDQA 1ZGIA 3V12A 4A7IB 5T6GA 1GHBG 3VB4A 4YLQH 4E06H 3ZV9A 1A5HA 1C1SA 3KF2A 4RN6A 3M5LA 3LOXA 1C5ZB 4ABDA 4X2VA 1UK2A 2P3UB 6ESTA 1BTYA 5T6FA 1Z1JA 1GMDG 2YNBA 1GJ9B 2KCOA 1DSTA 1ZPBA 1GBFA 1VGCB 4HG6A 1BT7A 1DY8A 1NFYA 1ZHRA 1O2SA 1C5UA 4U30A 2AGEX 5DG6A 2A7JA 3T26A 3OEHD 2P3FH 2C8ZB 8GCHF 4TT3D 2AERH 2G51A 1C5PA 1TPAE 2G52A 2R0LA 3PMHB 4X6OA 3U1JB 1P3EA 4WVPE 4BAMB 1GI7B 2RDLA 1WAYB 2P94A 3SU2A 1ELBA 2BY6X 1ZOMA 3MO3A 2WPIS 2PGQB 3UOPA 5EPNA 1WCZA 1YPLH 2IJOB 3V3MA 3UWIA 4CHAB 1IOEA 2F9OA 2GZ9A 1D6RA 1L1GA 4X8UH 1FY5A 1BMFD 1THRH 3FP6E 1GI5A 2D26C 1QURH 5A8XA 3A7XA 2R9PA 1VCPA 1HJ9A 3MNBA 2ZDMA 4BTIB 2P93A 1EAWA 1LO6A 1C2FA 1XVOA 2BXTH 3SU0A 1GVZA 1FUJA 3UR9A 4YXWD 1AD8H 2HNTC 3MYWA 5KEDA 2J92A 1KLIH 3LPRA 3M7UA 5A8ZA 4GPGA 3LU9B 1NRRH 1FDPA 5C1YA 2B5TB 2Z9IA 3SQHE 2VVVA 1HAIH 2BX3A 3RXKA 4F55A 1EPTC 3BIUH 3OX7U 1TGNA 1GBIA 8KME2 3E6PH 1TNGA 1EPTA 5TJXA 2P59A 4X2YA 3RXOA 1GBEA 3C27B 3PMAB 1FNIA 1F0RA 1NU9A 1OOKB 3ATKA 4M7GA 3M7QA 2XTTB 5HGGA 5KECA 1BMMH 1FONA 1O39A 4TWWA 2W3IA 1O3DA 1O3HA 3WY8A 1NFUA 4CBNA 4ZAEA 4OS2A 4X8SH 2XBVA 3KCGH 1DWBH 1AVWA 1S83A 2ODPA 2CXVA 1V6DA 3M3VA 1MD7A 2VJ1A 4ABGA 1YF4A 4MDSA 1SL3A 3FAOA 1AE5A 1GCTC 2TIOA 4INHA 2OC0A 3S9AA 1DX5M 1O2YA 1K28D 1DUEA 4ISHH 1ABIH 1C1NA 3VPKA 3OE7D 3MH4A 3BEUA 4XDEA 1TGTA 2EI8A 3M35A 1C5VA 1JOUB 4UEHH 5FPYA 1C4U2 1FAXA 2BDBA 1O3FA 1EAUA 1GHVH 2FESH 1C5QA 2ZFSA 3PTNA 3NXPA 3A8BA 4OGXA 3M37A 1V2WT 1UTOA 1LPGB 2A4OA 2BDGA 4IN1A 1AUJA 2BZAA 5HKKD 1H9IE 4BANB 1SMFE 1O2IA 4NGAH 1E1QD 4THNH 1V2QT 4QT8C 4CH8B 2ILNA 1C5WB 3NWUA 4ZKRU 3CS7A 2GZ8A 5C0UA 3A7TA 1T7CA 1F0SA 2W6ID 1BA8B 3UNQA 3RU4E 3DSGA 4Y8ZA 2FM2A 1Q3XA 1T8MA 5E2OA 3RC5A 1OWKA 7KMEH 4AYVB 4F48B 1C5NH 4JYTA 4D9RA 3I78A 1A7SA 3A7ZA 1LVOA 3ATWA 1TYNA 3P8FA 3SU4A 1BRAA 4ABFA 1VJ9U 4B74A 2PSXA 1W12U 2Y7ZA 4O97A 1W13U 1WTHD 4VGCC 1A61H 3PTBA 1C5YB 5CE1A 5A0AE 3BTGE 1D3PB 5TCAA 1D4PB 1C1RA 3R3GB 2F9PA 2GVFA 3QK1A 3NKKA 1V3XA 3ODFA 4OS5A 4BAOB 2VU8E 4CRCA 9LPRA 2VWOA 4I7YH 5J4SA 3ODDA 4ZHLU 4AFUA 1BTHH 4Q2KA 3TJUA 1EFRD 3TK9A 3TGIE 1O5BB 1GHXH 4INKA 3FO8D 3PO1B 1SGRE 1TBRH 1BCUH 1AVGH 1KXEA 4GHTA 3EGKH 2VIOA 1GL0E 2VIQA 3ENSB 3RXRA 1BTZA 1QQ4A 1E35B 5DO4H 2ZP0H 3A80A 4UONA 5FBEA 1MTNC 2BD4A 3P92A 3MHWU 1HV7A 4LK4A 1ZYOA 3SQEE 1QBVH 2TGDA 1ELDE 4KP0A 1DOJA 3DD2H 1O32A 4A5TS 2H5CA 1ANCA 1TMUH 2ZU2A 1D9IA 4RT0A 1J16A 3M61U 2C3SA 1E36B 2ZTYA 1C2DA 4ABEA 1SSXA 2WPDD 4YT7H 3ZVBA 1BZXE 1FZZA 5I25A 1E0FD 4I8GA 4CREA 2J4IA 1TX8A 2J34A 3DHKH 4XBDA 3SV6A 2WINI 4ABBA 3OU0A 2QXJA 4AGKA 2BD8A 1GI4A 3BG4B 2XXLA 1SQTA 3TJVA 2TBSA 1GJAB 1BRUP 2QV1A 2TPIZ 1AB9C 1YPKH 3MU4A 4A6LA 1E37B 2BB4A 3ATIA 2H1UA 4P00A 2ZDLA 3HATH 3P8NA 5JPMH 2RG3A 2UWLA 1CBWB 1XUJA 3E0NB 3N7EA 1RD3B 2G8TA 1HAVB 1PYTD 1ZR0A 2QCYA 2G55A 1RIWC 5KGOA 2V35A 1GG6B 1Y3XA 1C5MD 2ALPA 2R2MB 1VKYA 1SC8U 3BSQA 3UUZA 1DVAH 1EJAA 2CJIA 3D62A 1FI8A 5CHAB 1TX6A 3FN8A 1Y5BT 1V2OT 1WSSH 5AVDA 5EXLA
chains in the Genus database with same CATH topology
1SFIA 4UFDH 1QB1A 1UVSH 2NU0E 1CA0C 4R0IA 3MNSA 3HK3B 2BVXH 2PUQH 1ESBA 2K1QA 5JYIA 1C2LA 3GCHC 2PKAB 3QO6A 3AAUA 3EA7A 4A1TA 1VITF 1GJ8B 2OUAA 1T4UH 5F6MA 1HJAB 4GCHG 3LH3A 2TGPZ 2ZTXA 1O2RA 1Z6JH 4Y11E 2UUYA 1A3BH 1HIAA 3SGBE 3QN7A 1DFPA 1PPFE 4IN2A 3P70B 1ZMNA 4AB9A 2W3KA 5C20A 4D76A 4UFFH 3RXQA 4LXBH 1NRNH 1YGCH 2WUBA 1SBWA 1WQVH 5T6DA 1SGQE 1OYTH 5C3NA 3UFAA 5A2MH 1C5TA 2C8XB 1IQMA 3GYMA 4K2YA 4WY3A 2AMPA 4OS7A 2B9LA 2DE9A 4AORA 1KDQB 2FP7B 1CA8B 2XNIA 3EDXB 1SGEE 1BBRH 4UFEH 1UTMA 4MVNA 2CHAB 1GJDB 1O30A 3P17H 1GJ7B 4TPIZ 3ZZ9A 2WYGA 2Q6DA 1YPGH 2PGBB 3KN2A 4ZXYH 3SJOA 1P11E 1GPZA 4Y0ZE 1GI2A 2PR3A 1AWFH 1UTLM 2D8WA 4FUJA 3RC6A 1TFXA 1UK3A 3SV2H 1S6FA 1XMNB 3H7TA 2ANWA 3U8OH 2RA0A 1P03A 1IHSH 2STAE 5DJ7A 5H4IB 4I8KA 4K8BA 1S85A 1GI8B 3KGPA 2A0QB 3FVFB 3ZZ6A 5J4QA 1Y3WA 2STBE 1C4Y2 2ZIQH 1ESAA 4JZEH 2B7DH 2FO9A 4ZHMU 1O3LA 3K6ZA 1RFNA 1T4VH 1QBOA 3PMBB 4RKJB 1IQNA 3L33A 3A7WA 3U8RH 2ZC9H 4ZROA 1GMDF 4MNXA 4HGCA 1YPHC 3BTQE 3RXPA 1BTXA 1H1BA 1BTUA 2PHBA 2A1DB 1GMHG 3LGVA 1THSH 3LJOA 3O8BA 4RSPA 2NU2E 2ZG0H 3SNCA 1EUFA 1XVMA 1O2PA 1WU1A 3ZZ8A 5FHTA 3TPIZ 4BXSA 4XE4A 1HRTH 1XM1A 2BY9X 3F9EA 2UUKB 1N1LA 4XBBA 3SU6A 1SLXB 2PLXA 2H2ZA 1ANBA 1NESE 3SJKA 1EB1H 5DP5A 1EQ9A 1DLKB 1MBMA 4U32A 1BBRK 2PV9B 2F9NA 1G32B 5A0CA 1UCYH 4NIXA 1VJAU 1GGDC 1J14A 1DS2E 1SGYE 4NWLA 1UTNA 2NU4E 1P05A 3A87A 3MH5A 1TA2A 1LKBA 5LH8A 4MLFB 1A0LA 1FY4A 3TNTA 1UK4A 7LPRA 3ZZ7A 1VR1H 2CV3A 1ZPCA 3KQEA 5FX6A 3KQBA 2OBOA 3OY6U 1AZZA 2ZHFH 2Z9JA 3LC3A 4ISOA 2V3HH 1O2MA 1ZJKA 3KL6A 1O2UA 1RJXB 4BXWA 3GISB 1YC0A 1GL1A 1DXPA 1EPTB 2RCEA 1ZZZA 2VVCA 1TE0A 2G4TA 1SGTA 2NU1E 1PYTC 1GBDA 4A1XA 3M3SA 2BDCA 3M5MA 1F7ZA 1K1OA 2CN0H 2BOHB 1L4DA 1B5GH 2ZGXH 2ANMH 3O8DA 4WH8A 1GVLA 2PKSC 1O2TA 2B0FA 2AEIH 3MU5A 2R0KA 1O35A 4H42U 3QWCH 1GCTB 1QQUA 2ZU1A 4YM9A 2GKVE 1GBBA 1G9IE 1N8OC 1RTKA 1DWEH 1ETTH 3OYPA 5ESTE 1MZAA 1C2MA 5F03A 3A86A 2A5IA 1QL7A 2C93B 1MCTA 3P6ZB 2A4GA 2GZ7A 1MKWH 1C2JA 4NWKA 5C1UA 2J2UA 1UCYK 2H9TH 4A92A 1W2KH 2HALA 3MO6A 4TYDA 2D2DA 1HLTH 1SGPE 3SHAH 2FODA 3NUMA 4DIHH 3M36A 4FUFA 3EAJA 4AOQA 1H9LB 3TGJE 1O2KA 1MTUA 5AFZH 5HXFA 4CRGA 3TVJB 5A09A 1KIGH 4JK6A 3I77A 1UHBA 1HBTH 1GBAA 2F91A 2ZCHP 1TNLA 2GP9B 3VB5A 1AWHB 3ZVAA 2FOHA 4WMFA 4BAQB 1GBCA 3GY5A 3U98H 1MZDA 4D7GA 3Q77A 4O03A 3RXHA 3RUOA 3PLBA 3SU1A 1KXAA 5C67A 1KXDA 1RGQA 1AU8A 5JBBS 3W95A 2EI7A 1TX7A 3E91A 2FS8A 2XYAA 3TJNA 4X0WU 3HPTB 5FAHA 1A0JA 1TPSA 2SGQE 5FXLA 1TRYA 2ZCKP 3Q76A 3DFLA 1IQHA 4MQAA 1C5XB 2LNCA 1ZTJA 2VH6A 4AFQA 2QIQA 4WXIA 3SORA 3SNBA 4MPVA 1H8DH 1J15A 3SGQE 1MKWK 3GCTG 4H4FA 1TLDA 2ZDNA 2ZU4A 1G30B 1MQ5A 2FOGA 2Y6TA 1OKXA 1O5FH 1GI6A 1W3CA 3F68H 5ABWA 3ZVFA 1CHGA 2FLBH 2G00A 2V6NA 1QJ1B 2FI5E 5K7RA 3RXCA 5HM2A 5F8TA 4CRDA 1XUIA 2OQ5A 3JZ1B 3LKWA 1AKSA 3F9FA 3FP8E 2BQ6B 3A83A 1GHZA 3BTKE 2O8UA 1MUEB 3EE0B 1ZTKA 3BEFB 3HKIB 1YCPK 5DP3A 4JMYA 4K8YA 1ELFA 3P8OA 4Y7AA 3LGYA 1O5AB 2SGDE 4GLYA 3B9FH 1CT4E 1W0ZU 2FOBA 1BB0B 3QZRA 1O34A 1Q31A 5EU8A 2ZPQA 3HGPA 3PYHA 1ANDA 4DOQA 2GMTB 3D65E 5FBIA 1DITH 1EP5A 1O3CA 3A88A 4FUHA 5LPRA 2O8LA 1MTWA 2AGIX 1INCA 1AB9B 1MTSA 2XWBI 3MH7A 5GXPA 5DP9A 5LPEA 2XWAA 1G2LA 3ATMA 1KXCA 1P0SH 5DPAA 2ZFRH 3RMLH 1OP8A 1BHXB 2AMDA 3UTUH 3SI3H 1G3CA 5TCCA 1G3DA 3ZV8A 1RIWB 3IWMA 1T32A 1P57B 5DKMA 5JB9S 5EOKA 1LQEA 1O3NA 3ITIA 1AQ7A 1SGFA 1BUIA 3P8GA 3SNDA 3JZ2B 2O9QA 1ELTA 9ESTA 1MU8B 1BTPA 4DY7B 1LVBA 2J94A 2OINA 1O2XA 3UREA 1U6QA 1AFQC 1O3EA 4INLA 1YPJH 1HB0B 4H6SB 4JCNA 1CA0B 2WPLS 2WYJA 5FX5A 1EB2A 1O31A 5GPIB 1IQKA 2WPKS 1DWCH 4LZ1H 1EZUC 1S0QA 1S81A 2P95A 2YNAA 3EA9A 3A8DA 3GCHB 4F49A 4FUCA 4R8TB 3SNAA 3TLOA 1Y3VA 1PPCE 3ZVCA 2QAAA 1V2VT 1GBMA 2FLRH 1NTPA 1YLCA 1EP6A 1SGIB 1UTKA 1SG8B 3SJ9A 4FVBA 1Y3YA 3VB6A 5K0HA 1HIAB 1P01A 1CO7E 1S5SA 3SW2B 1FIWA 2J95A 1NO9H 4HFPB 2GV6A 3ZZ5A 2VWNA 3GY7A 5G4BA 3CS0A 4Y10E 1BRCE 4GCHF 3B8JA 1TBZH 2G81E 1P9SA 4ABIA 1HJ8A 2GDDA 2DE8A 1ZMJA 3GICB 1QIXB 1E34B 2LPRA 1C1OA 1OWDA 3MFJA 4Q7XA 4Y79A 3RM0H 1TB6H 1MU6B 4FUDA 3DUXH 1C1TA 1BQYA 1PPZA 2ZO3H 3BEIB 2A5KA 4ASHA 1BJVA 1BIOA 1GJ5H 1B0EA 1V2KT 1XUKA 2SFAA 3MTYA 2ZI2H 4XOJA 6LPRA 4Y6DA 5GJ4B 1ABJH 1SLUB 4FUBA 3O8RA 2ZPRA 2VVUA 2GCHG 1ZJDA 5E0JA 4BOHA 1S6HA 2XC5A 4KTCA 3KQDA 1Z7KA 3A8CA 2IPHA 3LIWA 4GVUA 4O9VA 4NA7A 3RXLA 3T27A 2ODYB 4NIVA 1O5CB 1P09A 1KLTA 3LGWA 4E7NA 2HGTH 2ZDAH 1VGCC 3PROA 1OXGA 1G36A 1FQ3A 3RXMA 3RC4A 2AYWA 2ZHQH 4ZKNU 1ZSLA 3SV8A 3A7VA 1PQ7A 3MI4A 3UNSA 4X1SU 3T28A 4AFZA 1LHGH 2A2QH 4YTAA 5ESBA 1S0RA 3PLKA 1Z8RA 3EYDA 3BTTE 3FP7E 1HDTH 1O2HA 4YT6H 5JBTA 2ZDKA 1SGDE 1KSNA 1C1VH 1CGIE 3ZZ3A 1ZPZA 3MMGA 1YCPM 4NIYA 2ZF0H 4CHAC 1TMTH 5L30H 4TY7A 5EPYA 2UUJB 1O2NA 2SGEE 3E8LA 3A82A 1KXBA 5EW1H 3BTEE 4A1VA 1XUGA 4U01A 1VITH 2FYQA 2FTMA 4AN7A 2PW8H 1GGDB 3VB3A 1RTFB 4SGBE 1UTJA 2Y5GA 3FANA 1BMLA 1FXYA 1HAZB 1IQEA 3ZVEA 3CP7A 3TK6A 2FMJA 4I32A 3DFJA 2C8YB 3AVZA 3ZVGA 1OPHB 3BF6H 3HGNA 1TONA 1TBQH 1CSOE 2QN5T 1P12E 4DW2U 1C2HA 1P2IA 4JZFH 1Z6EA 1CGJE 4JZDH 1IQFA 2BLVA 4O3TA 3LH1A 1PPBH 4F4OC 1RRKA 2GD4B 2OC7A 1HGTH 3MU8A 3UQOA 1GDNA 1V2PT 3VFEA 3D49H 1O5GH 4IGDA 3RMOH 2BD7A 1EASA 5JDUB 2ZGBH 1DT2A 3DT0H 4YOIA 1C1MA 2PKSB 4MPXA 1MD8A 1ZTLA 4I8HA 1C2EA 2BQ7B 2G5NA 1BMAA 2QF3A 1O3MA 4BAKB 3GCOA 2P8OB 4X2XA 1N8OB 3AAVA 1NY22 1ZHMA 3ZZ4A 4E05H 3W94A 1BOQA 4KKDA 4I31A 4FU7A 4NSYA 4X6MA 1W7GH 2JETB 2O8TA 2ZWLH 1SVPA 3NK8A 1O3JA 1B7XB 3RMNH 3T25A 2BDIA 1C2GA 2XC4A 2C4FH 4D8NA 1O3OA 3U69H 2SGFE 3NCLA 2VIWA 4H6TA 4O3UA 2ZA5A 2O8MA 2Z3CA 3RXGA 1C5RA 4NFFA 1NROH 2BLQA 3PV4A 2BDHA 4J2YB 4K1EA 1GBLA 2ZHWH 1CQQA 3RXUA 1UHBB 4GUXA 1OS8A 2QGRA 3VXFH 1YYY1 1XUHA 3T29A 3PB1E 3F9HA 1XXDA 3FFGA 2VB0A 4Y8XA 4FU9A 1ZGVA 1A0HB 1D3DB 3U8TH 1G37A 2O8WA 3KEEA 3HKJB 3BG8A 3QGNB 4B2CA 1O2WA 1QJ6B 1EJNA 1TOCB 4X2WA 1W11U 2V3OH 3E0PB 1UMAH 4RKOB 4DURA 2JH5D 2KAIA 5DP7A 4IBLH 4UDWH 2ZPSA 3MU0A 5DP8A 2W7UA 3RXVA 2Y5HA 4ISLA 1CT2E 3GYLB 2BDYA 1C1UH 1EZQA 1SGNE 2SGPE 1GHBF 1TAWA 2AGGX 1C5SA 3STJA 1JRTA 4GSOA 1LKAA 1NFXA 2A4RA 1YBWA 2ZGHA 1VCWA 2Y5FA 1T8LA 1ARBA 1TGSZ 4ZH8A 1IQJA 2H9HA 1SGFG 1GHWH 3HK6B 1EZXC 4AG2A 5GCHG 5IYTA 1QFKH 1TGCA 1DANH 1LVYA 2Z9KA 2BVSH 2H5DA 1AO5A 2WUCA 3S9BA 2CGAA 4NCYA 1P2NA 3F6UH 3BTHE 2W26A 1GJCB 2QC2A 1AKSB 4JZIA 1A1RA 4Q7YA 4XBCA 5C2ZA 1F5RA 1BJUA 1JRSA 2WV5A 3NZIA 3SBKA 5T3HA 2IOTA 1GVKB 1DE7H 1W14U 4I8JA 4X6PA 1ZHPA 4ABHA 4B2BA 3M5OA 1O2ZA 2BQWB 5FCRA 1KY9A 1WV7H 1IQGA 3ZZBA 2F9VA 1PPEE 4MNVA 2OC1A 1SOTA 1JXPA 5GWZA 2OTVA 3M5NA 2VIPA 5E2PA 1FY3A 1GHAG 1P10A 3F9GA 2BY8X 1AZ8A 3ELAH 3SUEA 1TRNA 2QXGA 1ELVA 2VINA 5C5NA 4D7FA 5JB8S 1H8IH 1JIMA 1Z1IA 1NFWA 4ISNA 2XBXA 2HPPH 3ATLA 1O3PB 3MOCA 1ZSJA 1O2QA 4AG1A 1MQ6A 1WQSA 3VGCC 3T2NA 1LCYA 1HPGA 4X1PU 3BG4C 4IMQA 4D9QA 1KLJH 1C5OH 2RA3A 4GHQA 2JH0D 1O38A 1SQOA 3RP2A 2VIVA 1GDUA 2GT7A 4WJG2 3K9XB 1S84A 4K3JA 4ZMAH 2UUFB 1EKBB 1O2JA 3RXTA 1A5IA 2ZU3A 5HMAA 2Q6GA 5EGMA 3S9CA 1BRBE 4UD9H 1QBNA 4SGAE 5CHAC 3RXFA 1D6WA 1H9HE 5DGJA 1F92A 1SPJA 1YPEH 3ZZCA 3LONA 1QB9A 4Z6AH 1C5LH 1O2VA 3D23A 5E0HA 4X8TH 2ZECA 1V2UT 5EQQA 2F3CE 2HNTE 3U1IB 1MAYA 2FOFA 4IW4E 1KTSB 5EW2H 4CR5A 1PJPA 5EXNA 4DG4A 3PM3A 1ZLRA 2ULLA 2I6SA 1O0DH 4YLUA 4FVDA 3LC5A 3VEQB 1FN8A 1P04A 2SNWA 1UO6A 3ZZDA 1S82A 1FY1A 2THFB 2FTLE 4CRAA 1P2OA 1Y3UA 2FX6A 3UQVA 1AI8H 4OGYA 5LGOA 3LGTA 3TIUA 1NRQH 4BTUB 1YCPH 2PFEA 2BLOA 3GY2A 2FOCA 2ZFFH 2J9NA 2QXHA 4IC5A 1VZQH 3SI4H 5GIBA 4B71A 1K1MA 1NRSH 4HI3A 5SGAE 3BV9B 1ZRBA 3VXEH 1DXWA 1ID5H 3RXJA 1NZQH 3M3TA 3FZDA 1HAXB 3PLPA 3TNSA 4VGCB 1DSUA 5JBCS 1QRWA 1HUTH 2FXRA 3UWJH 2WPJS 2Z9GA 2GT8A 2CHAC 3A7YA 4ABJA 1O2OA 1LPKB 4ISIH 1EZSC 1K1PA 4K1SA 6GCHG 1D3TB 1O2LA 2ZKSA 1P2QA 4WF8A 4MPUA 3NPSA 8ESTE 1SOZA 2EC9H 3BIVH 1J9CH 3F1SB 2Y80A 3LDXH 1LHEH 1QNJA 4B73A 1AIXH 2H9EH 3UPEA 3SN8A 5HYOA 4K69A 2VIDA 2R3UA 3TU7H 4CR9A 2EI6A 2GCHF 3L3TA 1DICA 2A31A 1OWIA 2F9UA 4JYUH 3RLWH 1CHOG 3SJIA 4WH6A 2R2WU 4WXVA 3FZZA 2ZU5A 1V2NT 2JKHA 5DP6A 1FIZA 5FPTA 2BMGB 2QY0B