1C5QA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule keywords PROTEIN (TRYPSIN)
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5qA02
1HGTH 1TMUH 3K6YA 5DP8A 1QBOA 1V2KT 2BX4A 3KIDU 2ZCHP 3M3VA 2BD5A 1GG6B 1VCPA 1O37A 1O2OA 2R9PA 3PROA 2VJ1A 1C2MA 1EXFA 2ZPQA 3LOXA 1H8IH 5JBTA 4IMZA 5LPRA 2BDBA 3ZZ4A 4CRGA 1G2MA 4K2YA 1ZTKA 3DT0H 3LJOA 4X2XA 1EQ9A 1V2NT 1W7GH 3KQEA 2FOAA 2A7JA 5EOKA 1V3XA 4FUHA 3TH2H 4JK5A 1K28D 2D2DA 3JZ1B 5T6GA 5J4SA 3BF6H 1E37B 2GV6A 1BBRE 2C8WB 1XKBC 1PPGE 2LPRA 3ATMA 4I7YH 3K65B 4NCYA 1THSH 1AVGH 4E05H 3H7OA 1KY9A 3TH4H 2P95A 1OWHA 1W12U 3QK1A 1B0FA 1HJ9A 2BLQA 1QURH 3U69H 1C2IA 2G51A 2Z9IA 1GI8B 2PGBB 2A1DB 2ANMH 2W5EA 2WPLS 2CJIA 3RMOH 3RXOA 2TRMA 2Y80A 2CV3A 2PSYA 2ZDVH 3BV9B 1JBUH 3U98H 1HAHH 3SHAH 1VCWA 1S0QA 2NU1E 4DIHH 1UHBA 3RC5A 3MNXA 1RTFB 1ZYOA 1GVLA 3K9XB 3RLWH 1O3DA 2CGAA 5T6FA 3F1SB 1JMOH 1YPHE 4KGAA 2O8TA 3T2NA 1X7AC 2ZGJA 4MPUA 5IDKA 1L2EA 2FESH 2EA3A 1UTNA 3SI3H 1XUIA 2GMTB 3MHWU 7GCHG 1SLUB 1RRKA 2AERH 3Q00A 3SI4H 2GT8A 2GCHF 2WV4A 2BDHA 1QB6A 3SUDA 1YLCA 1NPMA 1O3AA 3SUEA 4O03A 2W7SA 1GHZA 1ZPCA 2BDYA 1RTKA 3RXFA 1C1NA 1Y5BT 1O2VA 1OSSA 1FLEE 2A5KA 1O2XA 3B9FH 4YLQH 2VIPA 2WPKS 1HB0B 2AGGX 1SL3A 1A5IA 2ILNA 1Y5AT 3L33A 3D23A 6GCHG 1K1IA 1QL7A 1ZHPA 3SBKA 1S6HA 1DSTA 2Z9JA 2ZQ2A 4X6NA 4BANB 1A61H 3A7XA 1HIAA 4ABEA 1C5MD 1V2LT 1TWXB 1O32A 1JIMA 2G8TA 2M5TA 4CHAB 1ZMNA 3SNDA 4AG1A 3M35A 3HK3B 3P70B 1O30A 4X1QU 1ELFA 1D3TB 2ZCKP 1O5CB 3ZZ9A 2ALVA 3BTKE 3SJKA 3FP8E 3IG6B 1TNLA 2FOBA 1GI2A 1GJ4H 1GWAA 4HZHA 2ZG0H 4LOYH 1YCPM 3OY5U 3C1KA 4CR9A 4Y10E 4X8SH 2GD4B 3F9GA 1GCDA 4ISNA 2AMQA 2HLCA 1K1LA 1GJBB 2FTMA 4JMYA 3TK5A 1F0SA 2GMTC 4AN7A 3PYHA 3I78A 2UUFB 1EAIA 2Y5GA 1NRQH 1V2PT 3Q77A 1MUEB 3MYWA 1WUNH 3P8OA 3M37A 2ZTYA 1Q3XA 3SV2H 2I6SA 2A4GA 1CA0B 2G00A 1WQVH 3RP2A 3I77A 3RUOA 1V2RT 1AU8A 2CHAC 4WMEA 2ZECA 1DXWA 4AORA 3SUFA 4Q7ZA 4WXIA 1AZ8A 1LVOA 1SGFG 1IOEA 1GI3A 4VGCC 3RU4T 4A1XA 1ANEA 4GPGA 1UCYK 2Y81A 1VITF 3MNSA 1PJPA 1QY6A 3SN8A 2R0LA 2PKSB 1C5NH 4ZKNU 3UWJH 1QQ4A 4WMFA 1OP8A 3LGYA 3S9AA 1AD8H 1EPTA 2ODYB 3URCA 1GHBG 1TPPA 2FYQA 4H6TA 2EI8A 4IN1A 5DP5A 1QHRB 5C20A 1LKBA 1KXBA 1OWEA 2H5DA 1LKAA 3ATLA 4FUJA 1D6RA 3UIRA 4WJG2 1FV9A 2Q6DA 1H9HE 1DT2A 1OXGA 2ZHQH 1GHAF 1H1BA 1PPFE 3EA7A 3RXCA 6LPRA 2ZGCA 1IQFA 2BZ6H 1O3FA 1VCQA 3ZZBA 5EQSA 1O5AB 5C1UA 4AZ2B 2ASUB 1TFXA 1Y5UT 1HRTH 2IOTA 4ZKRU 3SNBA 1O35A 5EGMA 2FEQH 3VXFH 5E2OA 2K1QA 3UWIA 1P0SH 4MNYA 5T6DA 2HPQH 2JETB 1TGNA 4JYVH 1WTHD 3LGWA 1ABJH 3E1XB 3KQBA 3O8CA 4HI3A 2HALA 2BHGA 5TJXA 2VIVA 4ZKSU 5HM9A 4FU8A 3A7WA 2XCFA 3GISB 1SQTA 3QDZB 1E0FD 4ISIH 4I31A 3FZDA 1K1PA 3ZV9A 1NESE 1EOJA 2FI5E 4DOQA 1TLDA 4NA8A 6GCHF 1L1JA 3K6ZA 5F8ZA 3SU5A 2A0QB 3TITA 1E38B 1W2KH 3TJUA 1O2PA 4YZUA 5DP6A 3SHCH 6CHAB 1DDJA 2ZQ1A 1BMMH 3GY2A 2PKSC 4D8NA 5E2PA 3LJJA 1O2LA 2NU4E 1AY6H 3E90B 3RXUA 4UEHH 1LVMA 1GI5A 2P8OB 1V2UT 1C5PA 1NC6A 1DUAA 2XXLA 1GI7B 1S5SA 4IC6A 3MH4A 1GBDA 1KIGH 1SLXB 4INHA 3E8LA 2VVUA 5C1XA 3UOPA 1EZUC 5LPFA 1DANH 3IITA 3QZQA 4MNXA 1ZTJA 1FNIA 1EP5A 2WYGA 2XW9A 2FI3E 3CS0A 2QN5T 2NU3E 1C5YB 1O3OA 2Y82A 5BPEA 2VIDA 3SJ9A 4A1TA 4YT6H 4J1YA 3T27A 4QT8C 1CQQA 4FUGA 1THPB 4AB8A 3RMLH 1SC8U 2ZDAH 1GDUA 2FTLE 2BLWA 2HPPH 1QBVH 4ABDA 3ZVDA 4O3TA 1FDPA 1KXDA 2ZA5A 1ANDA 1ZSJA 1CT4E 4AGJA 1KXFA 2ULLA 2HGTH 2VH0A 2J9NA 2GX4A 2J92A 3OSYA 5A09A 1QRXA 3TK9A 2AEIH 3WY8A 4NIXA 2YNBA 4GAWA 1O2YA 1DFPA 1HJAB 2GZ9A 2Z9GA 6CHAC 1CT0E 1P9SA 2QIQA 2H1UA 5K7RA 3PLPA 1GCTB 1UK4A 3GICB 1LHEH 1NFYA 2A7HA 1KYNA 2ODQA 2KAIA 1FPHH 1SGNE 4O3UA 1BT7A 1ELAA 3MO9A 2C90B 3N7OA 3F68H 1NTPA 3Q3YA 1ELVA 4I8JA 2FM2A 3QGJA 1C1MA 2SGPE 1MKWK 4NIVA 3KEEA 1MKWH 1N6XA 1P10A 1V2ST 5E0JA 1BCUH 5GXPA 1ESTA 2R2WU 5T3HA 2ZI2H 4Y8ZA 5JBCS 1NFXA 4HFPB 1SFIA 4NZQA 8GCHG 3P92A 1TA2A 1FAXA 7KMEH 2O8LA 1RFNA 3PO1B 4KP0A 3UQOA 5DPAA 1GJ9B 1ARCA 1ZJDA 1O3GA 3ZZAA 4MLFB 3LPRA 5EW2H 4ZHLU 2D8WA 1SQOA 1C5UA 3LT3A 5DK1A 3BEIB 2ZGHA 5GJ4B 1GPZA 1TA6A 4A7IB 1G3BA 3NUMA 2OC8A 2BY5X 1MD7A 3A87A 3A8BA 1JXPA 1NRSH 3AVZA 5LGOA 3SQEE 1AFQB 3A7VA 2ZHWH 2H5CA 4FUBA 3QZRA 4DCDA 1O2IA 1UVOA 1HPGA 1OS8A 1FJSA 2UWPA 5DGJA 5K0HA 3D49H 1C1SA 3LKWA 3GCTF 1GBAA 1L1GA 5FAHA 4B2CA 1LPGB 1NFUA 5L2YH 4X2VA 1IQIA 1FONA 1ELDE 2ZDMA 3BTWE 1ANCA 1N1LA 1GI1A 3KN2A 3TGIE 1ZGIA 4GVUA 4YM9A 3UPEA 1SVPA 2B8OH 2Z3DA 3ATKA 1KDQB 1DWDH 2F9PA 2J2UA 2WINI 2AIQA 1MBMA 1EPTC 3P8FA 5JYIA 2J4IA 1WTGH 3SU2A 4NZLA 1C1PA 1Q31A 1TOMH 4X1RU 4I8KA 5JPMH 2P59A 3ODFA 5GWZA 3D62A 1TQ0B 4Y71A 3KQDA 3O8RA 1A1RA 5FX6A 2OD3B 1DSUA 2GP9B 3E6PH 1GJ6A 3NXPA 1J9CH 4XFQA 3SU3A 3S9CA 5C1YA 1RIWB 2G4TA 5AFYH 2XTTB 1O0DH 2DUCA 3PTBA 2FOFA 1T8NA 3RM2H 2PW8H 2AFQB 3CP7A 1SHYA 3TU7H 4NSVA 2VGCC 2UUJB 1G36A 3PM3A 3I29A 3BIUH 1A46H 1DLEA 1W14U 1GDNA 4A1VA 3TK6A 1TGCA 1ELBA 2VVCA 2W3KA 1K1OA 1VITH 4U2WA 3ZYDA 1CHGA 3NZIA 1OKXA 2EEKA 1LHGH 2GV7A 2QV1A 3ELAH 3RXVA 2ZTZA 5JBBS 1KLJH 2ZGBH 2ZZUH 3MNCA 3OY6U 4NWLA 2GCHG 1Z71A 1ZPBA 2WPIS 2ZU1A 3PMBB 1CO7E 2HVXA 1TX8A 1OP2A 1U6QA 1H4WA 1W10U 1GGDB 1ZJKA 4K1EA 3W95A 4X1PU 1CBWB 1GBHA 5TCAA 1O2QA 1YPJH 3VGCB 4B73A 4FU7A 4TPYA 4Y0YE 1C5OH 2OC0A 4AYYB 1NU7B 3MH5A 3EAJA 1UVPA 2D26C 1P3EA 2WYJA 2ZEBA 1N6YA 1QGFA 2QXIA 1D6WA 1FQ3A 1TOCB 1SLVB 2XBWA 4TWYA 4CRAA 2WPMS 5A8XA 3ZZ6A 3DA9B 3RDZA 1Z1IA 2P3FH 5EQQA 2EI6A 4THNH 1JOUB 3MH7A 1UTQA 3GY8A 1QJ1B 3U8RH 3A88A 3FANA 4NIWA 3R3GB 1O2JA 1IQMA 1O2ZA 3A82A 3T26A 3UNQA 3DFLA 2VINA 3MO6A 2TGPZ 1NZQH 2J38A 1GHWH 2Q1JA 2W7UA 3MTYA 1EB2A 2DE9A 1Y3VA 5CE1A 1YYY1 1FPCH 5FCKA 2W26A 2RA0A 2GCTC 1AUTC 1CU1A 1BZXE 1B7XB 2ZFSA 4Z0KA 3P8NA 2ZFTA 2YOLA 3M7QA 3MOCA 3R0FA 1TMTH 4JZ1A 5G4BA 2A2QH 1JRTA 2STAE 4JCNA 1WAYB 3VGCC 3E91A 2TBSA 1AKSB 5F8TA 3B23B 4ISLA 3RXAA 1F5LA 1HLTH 1LHDH 1PPEE 4PROA 2OP9A 3RC4A 1SGTA 2G5VA 4YOJA 3A89A 4Y76A 4BTUB 1VITG 2AMPA 1MD8A 2WPJS 1C2FA 2ZC9H 3UTUH 3QWCH 1C2KA 3KQCA 3STJA 3TVJB 3BG4B 3CS7A 4BAOB 2P93A 3GYMA 1O3NA 1CSOE 1AGJA 1LCYA 1MKXK 5FBIA 1V2TT 1YPMH 2TPIZ 2UUYA 1JRSA 3GCHC 4AFZA 1Y59T 1GJ8B 4A5TS 2QXGA 2HNTC 4Y7BA 2JH6D 3ZVGA 3GDVA 1TX7A 2BD4A 1KTTB 1RS0A 2Y7XA 1GBIA 3SU0A 1GHAG 3TJNA 3GY3A 1GG6C 4XBDA 2SNVA 1GJ7B 1BTWA 1C2GA 1BTPA 3M61U 3LC5A 1RTLA 1A3EH 5E0HA 1O3EA 1HAXB 2C8XB 3QUMP 2FX4A 1TGSZ 1W8BH 4OS2A 1MH0A 5I25A 1SLWB 7ESTE 3PMHB 1O5GH 3T62A 3W94A 1JWTA 2VIOA 1YM0A 3BEFB 1S82A 2O8UA 3BN9A 1GMDG 1G3EA 1DY9A 3O8BA 5C2ZA 1CE5A 2A4RA 2PKAB 2PV9B 1TPSA 1BMNH 2A7CA 2ZU5A 1ZRKA 3L6PA 1P2IA 4B74A 4FUFA 1O34A 2BX3A 2Z9KA 1MTSA 4JZEH 1LHCH 1F5RA 1PYTC 1IQJA 1VR1H 3TPIZ 2VWNA 1XM1A 4H4FA 2G4UA 2OCVB 1AVWA 1ZRBA 1YC0A 1ZLRA 1NO9H 1QJ6B 1SGEE 1C2EA 1D3QB 1UVTH 4WF8A 3GOVB 3T25A 2FLRH 5HYOA 1ESBA 1BRBE 1FN6A 4AGKA 2C93B 4RKJB 4OS6A 1C1OA 1ZZZA 3MH6A 1DITH 2SGAA 1F92A 2OC7A 5LPEA 1HAZB 1UTMA 4ZROA 1F0RA 3AASA 1S83A 2BD2A 2SGFE 2F9OA 1T4UH 1OWKA 3L3TA 2ALPA 2R3YA 1MCTA 1GBEA 3LC3A 4WMDA 1UCYE 4DJZB 2VH6A 1DICA 5FPTA 4AX9H 4DG4A 1C9PA 1EZQA 5JB8S 1ZOMA 1UTOA 4Y79A 2BB4A 1BJUA 1PPCE 3M5OA 4NFFA 1GI9B 5F6MA 1GMHG 1GBJA 1L0ZA 1ESAA 2F9NA 5A2MH 1O3MA 3LIWA 4HGCA 1BRUP 3KGPA 2ZU2A 1HAVA 1DVAH 1GMCF 1XVMA 3VXEH 3SNAA 2XYAA 2ZPRA 1N8OB 1T31A 1VGCB 1SOZA 1MU6B 1K1NA 2ZNKH 1V2OT 1Z8RA 3TNSA 3TJOA 3P95A 2HNTF 3GY6A 3S69A 1G2LA 1Z8GA 1XUGA 1PQAA 3TNTA 4I8HA 5FBEA 4OGXA 5DP9A 3MU8A 1LO6A 3UY9A 1UCYH 1C2JA 4BAQB 1C5LH 1Y3XA 3E0NB 1TBRH 1FN8A 4F49A 1CHOG 1VJ9U 2UWLA 1HXFH 4CHAC 3HKIB 1BMAA 3FAOA 3A7YA 1O5FH 3VFEA 1YKTA 2RA3A 5AHGH 1UVSH 3AW0A 2VU8E 2PUXB 2ZDLA 1BOQA 3OU0A 4ZHMU 4OGYA 1ABIH 2XC5A 2BVSH 2RCEA 3LGTA 3UQVA 2HWLB 2BDGA 1XUKA 2BXUH 4LZ1H 4Y8YA 2AGEX 3KHVA 2XBXA 3VEQB 1FY4A 2OBOA 1GL1A 1TBQH 1QQUA 2ZDKA 1IAUA 1G32B 3AAUA 1L4ZA 1O3LA 2C8YB 1K1JA 1GMDF 2ODPA 1O2TA 4CBNA 5A8YA 3KNXA 1AUJA 1O2WA 3RXEA 1TQ7B 1XVOA 2IJOB 2WV5A 1TONA 3PLBA 3U9AH 1C5ZB 3T5FH 1CA0C 1UHBB 1C4Y2 4Q7XA 1IHSH 4ABFA 1BHXB 2ZWLH 4J2YB 3A81A 4U32A 1DWBH 1FIWA 3ITIA 4NSYA 4WH8A 3TH3H 2GGVB 1MTUA 5IYTA 1TYNA 5EU8A 3PMAB 3QTOH 1GJAB 1MAXA 3NWUA 1LQEA 1GVKB 1K22H 1O2UA 1Y3YA 1H9LB 1C5QA 1A5GH 2HOBA 1KDQA 3UR6A 4MPWA 1O2SA 3SUGA 2F9UA 1ZPZA 2BY9X 3F9HA 1SG8B 2O8WA 3GCTG 4OS7A 1A0HB 3TJVA 1P06A 2QXJA 2ZTXA 3GCNA 2ZFRH 1V2WT 1NU9A 3ZV8A 1O3BA 1LQDB 2BVRH 5A0CA 1YPHC 1SGQE 4ISOA 2C8ZB 1BRCE 2B5TB 3G01A 3U1IB 3H7TA 1UK3A 3P6ZB 5F8XA 4YLUA 1GVZA 4ISHH 3GCOA 1HAIH 4K60A 1IQEA 1UTJA 3P8GA 1LMWB 4MVNA 2CF8H 1DPOA 3DUXH 4UONA 2G5NA 5ABWA 4OS4A 4ZHAA 1W3CA 3F9EA 1GMHF 2BDCA 3GDUA 3RXTA 1HIAB 3T28A 2JETC 2FWWA 2Z6BD 2GTBA 1ZMJA 4O97A 3S9BA 2BQWB 3ODDA 4DIIH 4WXVA 4XBBA 1QIXB 2ZHFH 1TNIA 1KLTA 4WH6A 4FXGH 2ZFPH 5FHTA 1SGRE 4ABHA 3SJ8A 1J8AA 4NA7A 6ESTA 1G3CA 1AE8H 1P11E 4BOHA 2A5AA 3FFGA 3BEUA 1PQ7A 1HUTH 1HAYB 3M3TA 1G30B 4E7RG 1P2OA 2AH4X 2XBYA 1PPBH 3C27B 4INLA 1ARBA 4IC5A 1CHOF 1J14A 1FY3A 4OS1A 1EX3A 4AYVB 1F7ZA 1P01A 2FPZA 2P8OC 2PWXA 1NROH 4MG3A 2UUKB 4UFGH 4X0WU 3MI4A 1M9UA 1MTNB 4XBCA 3P17H 1AB9B 1NN6A 3NKKA 3SV9A 3A7TA 3VB4A 1BB0B 3HK6B 1IQHA 4WVPE 4UFFH 2Q6GA 1F5KU 2GDEH 1YCPK 5FCRA 1QA0A 4E7NA 1Z8JB 4H42U 1DUEA 4KELA 5C67A 2FIRH 1XXFA 2ZCLP 4Y0ZE 3ZVFA 4NG9H 1PPZA 1D9IA 2EI7A 4DT7B 5ESTE 1ZHMA 2OINA 2FI4E 4JZIA 2SGDE 2OTVA 2XC4A 4IS5A 1RJXB 2QXHA 1V2QT 4MPXA 1YPEH 3DD2H 4XE4A 5EPYA 3PB1E 1XXDA 1TPAE 2J95A 4K69A 3M5LA 2RG3A 2JH0D 1W11U 2TGTA 4CH2B 2V6NA 4LK4A 2Y5FA 1BJVA 1GJDB 4FVDA 2SFAA 1HJAC 1P9UA 1DXPA 1ELTA 1FUJA 1K21H 2WUBA 1WSSH 1MCVA 1YPGH 5TCCA 2VIWA 4IGDA 1NRRH 3BTDE 1MAYA 2J34A 1AKSA 1C5SA 2Y6TA 1C1TA 1GCTC 3PMJA 4K1SA 1RGQA 1P09A 1S81A 2CXVA 2HNTE 4I33A 3TLOA 5HM2A 2G52A 3LGUA 4TPIZ 4O9VA 3A7ZA 3RU4E 1TALA 5EQRA 4NIYA 3A80A 1DWCH 2OQ5A 2V0BA 4WWYA 2FZZA 4MTBA 3PWCA 1BQYA 4AB9A 1BTXA 2QC2A 1P02A 4DVAU 1ZGVA 4GCHG 1JIRA 4IW4E 4FUCA 2A2XH 2SGEE 2CF9H 1HYLA 4Q2KA 2FS8A 2FOMB 3MO3A 1TX6A 1Q2WA 1TRNA 2QYIA 4UFDH 2A32A 2FYRA 1C2HA 1UTPA 2ZP0H 3MU0A 4Z6AH 3PO1C 1C2LA 2P94A 1YPKH 4YO9A 1BDAA 4ZKOU 1VJAU 1XX9A 4JZFH 1LTOA 8KME2 3QGNB 1WV7H 3K2UA 1HJ8A 2ZHEH 3M7UA 1TBZH 3SNEA 2BMGB 3BTEE 2BDIA 5A0AE 1AFQC 2VB0A 5CHAB 3MWIU 4IMQA 2V3HH 2J94A 3NK8A 3UR9A 1P2JA 4SGBE 3SU6A 3GY7A 2PLXA 1NFWA 1OWIA 1E35B 3SQHE 1C1VH 2HRVA 2VIQA 2C3SA 1TIOA 1MBQA 3VB5A 2FOCA 2GDDA 1LPZB 3MNBA 1AHTH 2F83A 3NPSA 3VB7A 4DURA 2C4FH 2ZPSA 3RMNH 5JB9S 1TGBA 3FZZA 1AN1E 2A5IA 3LGVA 4D7FA 1OP0A 1Y3WA 1YGCH 5EXNA 4BAMB 1WQSA 1O39A 1V2VT 4I8LA 1P2QA 1L1NA 2F9VA 3BG8A 3BTQE 1J15A 1O36A 1NS3A 4Y8XA 3QTVH 3OX7U 2W3IA 5DJ7A 2FOGA 3FP7E 2BLOA 1UTKA 4Y11E 2XWBI 2H9HA 2PR3A 4H6SB 1CVWH 1RIWC 2R2MB 5EXMA 1DOJA 2ZDNA 4BAHB 1HBTH 2OXSA 1PQ5A 2XNIA 1SGCA 3HGPA 2ANWA 1L4DA 3ZYEA 2UWOA 1GHXH 1O2NA 4D9RA 1MQ5A 1QCPA 4YTAA 4Q7YA 1OYQA 4YOGA 1NRPH 1C5VA 3MMGA 1Z6EA 4MNVA 3E16B 3UFAA 1C1RA 4XSKU 1TMBH 4D7GA 4ABGA 1GJCB 1SR5C 2BD7A 2TGDA 4NFEA 3ENSB 1EATA 1ID5H 1EZXC 1AE5A 2ZU4A 1NRNH 1W0ZU 1T8LA 1UMAH 4WY3A 1DS2E 4FVBA 3FVFB 5GCHG 2F91A 3QO6A 1QB9A 1TB6H 1SPJA 2BTCE 4UE7H 2R3UA 4X1NU 2PTNA 1AMHA 1ANBA 3ZZDA 1GMCG 3HPTB 4B2BA 1GGDC 1EJAA 3M7TA 1IQGA 4CRBA 1SQAA 3ZZCA 1CBWC 4B75A 1C4U2 4D76A 3S7HB 1OWJA 4LXBH 5FX5A 1O5BB 1J16A 3O8DA 2H2ZA 4BTIB 5PTPA 1RXPA 4GCHF 1OYTH 3HKJB 4NA9H 2F9BH 5AFZH 4Y6DA 1C5TA 4UD9H 1T7CA 1O3HA 1XUHA 2BOKA 1YLDA 2Z7FE 2AGIX 4E06H 1C1WH 1HAPH 3MFJA 4FUEA 5SGAE 1FMGA 4I32A 1IQLA 1K1MA 2G81E 3SZNA 1BRAA 2BY6X 2BD8A 4ABIA 4BAKB 1MKXH 1PFXC 1H8DH 1UJ1A 4AG2A 4RN6A 4IN2A 8ESTE 3SU4A 3RXDA 4YOIA 1EJMA 3A8DA 1DLKB 3A84A 1PQ8A 1HXEH 3RXJA 1SB1H 3EQ0H 5C5OA 1MZDA 3VPKA 1K9OE 1O2GH 1ELCA 1XMNB 4IBLH 3LH3A 5A8ZA 3UREA 3EA8A 4K5ZA 2FDAA 3RXRA 4MPVA 3PWBA 5EPNA 1C5RA 2PGQB 2FODA 4CH8B 1BBRK 1WOFA 2XWAA 1K2I1 1BBRH 1KXCA 5AF9H 5FPSA 1NM6A 4ABJA 2BQ6B 3ZZ5A 3RXKA 3SV6A 1W7XH 1UO6A 1AWFH 1O5DH 1TRYA 1GBCA 5B6OA 3ESTA 1LVBA 3IWMA 1HCGA 2ANKH 4AFUA 3MU4A 5ETXA 4Y7AA 4B2AA 1ETRH 2JH5D 1QRZA 1ORFA 3EDXB 4X8VH 4BNRA 4INKA 4RKOB 1AQ7A 4CREA 1GBLA 3ATIA 1G3DA 4R0IA 4B71A 5HMAA 3RXQA 1P3CA 4CBOA 3STIA 4YESB 1GL0E 3V7TA 3BG4C 4AOQA 2CHAB 3GY4A 1GDQA 1WYKA 4VGCB 3KCGH 1J17T 1QNJA 1MMJN 1O2MA 1DE7H 3OTJE 1H9IE 4KTSA 2BDAA 5C5NA 4TY7A 1BIOA 1O38A 1ACBE 4XDEA 5C3NA 2ZO3H 2PHBA 5L6NH 1FZZA 1QBNA 4KTUA 1IQNA 1WBGB 2SGQE 1AWHB 1PPHE 1AO5A 3RXGA 3EA9A 4R8TB 3UUZA 5L30H 1HAGE 3A83A 3UNSA 1P03A 3SW2B 2ZFFH 3GDSA 2BD3A 5GCHF 4AFQA 2QF3A 2OBQA 1FIZA 3SJOA 3ZVEA 3ZVAA 5JBAS 3S0NA 3GYLB 1CT2E 1A7SA 5DO4H 1E34B 1O3CA 2O9QA 3HGNA 5FXLA 4BXWA 1C5WB 3SORA 4A92A 1Z8IB 1G9IE 1UTLM 1EZSC 2ZHDA 1ZHRA 1P8VC 4DY7B 1AZZA 1QRWA 4JYUH 4FUIA 3SGQE 3V13A 7LPRA 1C2DA 1O3KA 2PFEA 2ANYA 5EXLA 4X1SU 2AS9A 3EGKH 3URDA 4ABBA 1ETSH 3TIUA 4B76A 1AFEH 3MU5A 1ZSKA 4UDWH 3E3TA 2VVVA 4Q80A 2AMDA 2FMJA 1W0YH 1Y3UA 2A45B 3SV7A 1CA8B 1A4WH 3VB3A 2BLVA 1ZSLA 2Z9LA 3F9FA 3JZ2B 3GY5A 4KTCA 1SGPE 1A5HA 3CENA 3SV8A 3Q76A 1OX1A 1OPHB 2WUCA 2XC0A 2AIPA 1TPOA 2BD9A 1QA7A 5H4IB 1T4VH 4TY6A 1GJ5H 4K1TA 4HTCH 1YPLH 3M5MA 1GHYH 2G55A 1XUFA 3AW1A 2ZU3A 1GBBA 3H5CB 4ZH8A 3SJIA 2OLGA 1HAOH 3AAVA 2H6MA 9LPRA 1GBTA 4GSOA 1EJNA 1N8OC 1INCA 1VGCC 3BIVH 1BTZA 4U30A 5EW1H 3KF2A 1FAKH 2QF0A 2FO9A 1A0LA 1KSNA 1QR3E 2B7DH 1RD3B 7GCHF 4GUXA 1Z1JA 3RXHA 3B8JA 1G37A 4ZUHA 2VWLA 1XKAC 4KKDA 1GHVH 5E8EH 2QGRA 1TNHA 1BTYA 2BVXH 1XUJA 1VZQH 2Z3EA 3QX5H 4A6LA 1YF4A 3Q3XA 3RXSA 5EG4A 1BTUA 1P2MA 4OS5A 3A8CA 1IHTH 1O2RA 4ZXXH 5EODA 3RM0H 1DY8A 2BY7X 3ATWA 1NT1A 1QL8A 1MZAA 1Z6JH 1TABE 3V0XA 2PUQH 4X6PA 1A3BH 2IPHA 1C9TA 3U8TH 2QCYA 3FP6E 4FUDA 1MTVA 2XRCA 2EC9H 2Q6FA 4K8BA 2XBVA 3ZZ7A 2VWOA 1QL9A 5A0BA 4JK6A 4MNWA 1P05A 1TRMA 5GPIB 1S6FA 1THRH 4X6OA 3LH1A 2XCNA 2BZAA 2OC1A 5LH8A 2BM2A 1GI0A 4BTTB 3MU1A 4DGJA 1CGHA 5ESBA 1V2MT 1KXEA 3DHKH 3EE0B 5J4QA 1P12E 4GHQA 1TNKA 1LVYA 4YT7H 1TGTA 2CN0H 1FY8E 3OYPA 3ZZ8A 2Y7ZA 1WU1A 1BUIA 3U1JB 2BQ7B 1W13U 1MU8B 1FY5A 4RSPA 2D1JA 3M36A 1EKBB 3LONA 3BTHE 3SOSA 2Y5HA 4X8TH 1LHFH 1ZTLA 2WPHS 1O2KA 1LPKB 1SHHB 2ZF0H 1HAVB 1QTFA 2GZ7A 1SGIB 2NWNA 4TYDA 1GI4A 1E36B 3RXBA 1DM4B 5HGGA 4CRCA 1GHBF 1GBFA 3DFJA 1YCPH 1BITA 1KLIH 1QFKH 2OUAA 4SGAE 3SNCA 2FS9A 4ABAA 5DP3A 5GDSH 3S7KB 4U01A 1KTSB 4K3JA 2F3CE 2FXRA 1SOTA 1YBWA 1AI8H 4ZMAH 4ZAEA 1SBWA 3BTTE 4X6MA 3V12A 1O3PB 5E0GA 4D9QA 1MTWA 2OQUA 2ZGXH 1D3DB 2FP7B 1LDTT 1O33A 2P3TB 1EPTB 2RDLA 1CGJE 3F6UH 3LGIA 9ESTA 3ZVBA 3PTNA 1F0TA 1UVUH 3V3MA 2BY8X 5FPYA 2H9EH 3PV4A 1SMFE 1HV7A 3LDXH 4FU9A 3RXLA 1D3PB 2GT7A 5DKMA 2BXTH 1EAUA 1FI8A 3RXPA 2B9LA 3RXIA 1T8OA 3PLKA 2CMYA 1EAWA 4F4OC 3KL6A 1IQKA 2VNTA 1A0JA 2VGCB 3M5NA 1EUFA 3A86A 2FLBH 1BMLA 2A31A 5DP7A 2O8MA 1ZMLA 2JKHA 1MTNC 2FX6A 1S84A 1SSXA 1AB9C 1V2JT 3E0PB 1GI6A 4ESTE 1S85A 4X2WA 4MDSA 1BHXF 2Z3CA 4JZDH 1YP9A 1B5GH 3RC6A 1Y8TA 4NWKA 1BA8B 1AIXH 1ELEE 1T32A 2V35A 1C1UH 3RMMH 1C4V2 1AVXA 1Z7KA 2AYWA 4X8UH 1NY22 1MQ6A 2FOHA 3T29A 1FY1A 4X2YA 4BXSA 1C1QA 2R0KA 4LZ4B 1EASA 1TE0A 1O31A 4CRFA 2ZIQH 1F2SE 2LNCA 2FOEA 3UOUA 2GVFA 1O3IA 2ZKSA 2GZ8A 1HDTH 2Z94A 5AVDA 1F0UA 1O2HA 5I46H 3QN7A 5F03A 2GKVE 2QA9E 4GHTA 2P16A 3VB6A 1OWDA 3U8OH 4MQAA 2PKAA 5L2ZH 2I6QA 1QJ7B 1SGDE 1O3JA 1OOKB 4JYTA 1EAXA 1S0RA 4UFEH 1TNJA 3EYDA 1QB1A 3SGAE 2A4OA 2ZFQH 5DG6A 1UK2A 5DP4A 4ZXYH 1EB1H 1ELGA 4K8YA 2STBE 1TNGA 1B0EA 2TGAA 4DW2U 1DX5M 1A2CH 1P57B 2H9TH 3BTME 3A8AA 1SI5H 5BRRE 3QLPH 4I8GA 3LU9B 1HFDA 3HATH 3NCLA 3TGJE 4CRDA 2BOHB 5JDUB 1P2NA 2B0FA 2ESTE 1HNEE 3BTFE 3RU4D 1WCZA 1C5XB 2NU0E 3SO3A 8LPRA 1ETTH 2QAAA 3Q3KA 2IN2A 2V3OH 2VWMA 2DE8A 2GCTB 5GIBA 5CMXH 2QY0B 4NGAH 1GBKA 1CGIE 3BTGE 3RXMA 1V6DA 3ZVCA 3ZZ3A 4CR5A 1DWEH 1P04A 4TWWA 2PSXA 3SU1A 2THFB 2YNAA 2A4QA 1T8MA 3BSQA 2P3UB 4B1TA 5HXFA 3D65E 1P2KA 1SFQB 3M3SA 4AFSA 1BTHH 1PYTD 1GBMA 3RLYH 2KAIB 2BYAX 2TIOA 1SGYE 1SGFA 2SNWA 1EOLA 1TAWA 2NU2E 4M7GA 3UNRA 4GLYA 3TGKE 1KXAA 8GCHF 1EP6A 4ASHA 5CHAC 3SGBE 1ZR0A 3GCHB 1FXYA 4XOJA 2PTCE 1D4PB 1O5EH 3A85A
chains in the Genus database with same CATH superfamily
1HGTH 3SZEA 1TMUH 3K6YA 5DP8A 1QBOA 1V2KT 2BX4A 3KIDU 2ZCHP 3M3VA 2BD5A 1GG6B 1NBME 1VCPA 1O37A 1O2OA 2R9PA 3PROA 2VJ1A 1C2MA 1EXFA 2ZPQA 3LOXA 1H8IH 5JBTA 4IMZA 5LPRA 2BDBA 3ZZ4A 4CRGA 1G2MA 4K2YA 1ZTKA 3DT0H 2KZ4A 3LJOA 4X2XA 1EQ9A 1V2NT 1W7GH 3KQEA 2FOAA 2A7JA 5EOKA 1V3XA 4FUHA 3TH2H 1YY3A 4JK5A 1K28D 2D2DA 3JZ1B 5T6GA 5J4SA 1VKYA 3BF6H 1E37B 2GV6A 1BBRE 2C8WB 1XKBC 1PPGE 2JJ1D 2LPRA 3ATMA 4I7YH 3K65B 4NCYA 1THSH 1AVGH 4E05H 3H7OA 1KY9A 3TH4H 2P95A 1OWHA 1W12U 3QK1A 1B0FA 4F48B 3SYJA 1HJ9A 2BLQA 1QURH 3U69H 1C2IA 2G51A 2Z9IA 1GI8B 2PGBB 2A1DB 2ANMH 2W5EA 2WPLS 2CJIA 3RMOH 3FOAA 3RXOA 2TRMA 2Y80A 2CV3A 2PSYA 2ZDVH 3BV9B 1JBUH 3U98H 1HAHH 3SHAH 1VCWA 3DSPA 1S0QA 2NU1E 4DIHH 1UHBA 3RC5A 3MNXA 1RTFB 1ZYOA 1GVLA 2J98A 3K9XB 3RLWH 1O3DA 2CGAA 5T6FA 3F1SB 1JMOH 1YPHE 4KGAA 2O8TA 3T2NA 5EJZA 1NBMD 1X7AC 2ZGJA 4MPUA 5IDKA 2XNDD 1L2EA 2FESH 2KCYA 4Q4LA 2EA3A 1UTNA 3SI3H 1XUIA 2GMTB 3MHWU 7GCHG 1SLUB 1RRKA 2AERH 3Q00A 3SI4H 2GT8A 2GCHF 2WV4A 2BDHA 1QB6A 3SUDA 1YLCA 1NPMA 3KYFA 1O3AA 3SUEA 4O03A 2W7SA 1GHZA 1ZPCA 2BDYA 1RTKA 3RXFA 1C1NA 1Y5BT 1O2VA 1OSSA 1FLEE 2A5KA 1O2XA 3B9FH 4YLQH 2VIPA 2WPKS 1HB0B 2AGGX 1SL3A 1A5IA 2ILNA 1Y5AT 3L33A 3D23A 6GCHG 1K1IA 1QL7A 1ZHPA 3SBKA 1S6HA 1DSTA 2Z9JA 2ZQ2A 4X6NA 4BANB 1A61H 3A7XA 1HIAA 4ABEA 1C5MD 1V2LT 4TSFD 1TWXB 1O32A 1JIMA 2G8TA 2M5TA 4CHAB 5CDFE 1ZMNA 3SNDA 4AG1A 4B6FA 3M35A 3HK3B 3P70B 1O30A 4X1QU 1ELFA 1D3TB 2ZCKP 3OTPA 1O5CB 3ZZ9A 4YXWD 2ALVA 3BTKE 3SJKA 3FP8E 3IG6B 1TNLA 2FOBA 1GI2A 1GJ4H 1GWAA 4RI0A 4HZHA 2ZG0H 4LOYH 1YCPM 3OY5U 3C1KA 4CR9A 4Y10E 4X8SH 2GD4B 3F9GA 1GCDA 4ISNA 2AMQA 2HLCA 1K1LA 1GJBB 2FTMA 4JMYA 3TK5A 1F0SA 2GMTC 5B6LA 4AN7A 3PYHA 3I78A 2UUFB 1EAIA 2Y5GA 1NRQH 1V2PT 3Q77A 1MUEB 3MYWA 1WUNH 3F2HA 3P8OA 3M37A 2ZTYA 1Q3XA 3SV2H 2I6SA 2A4GA 1CA0B 2G00A 1WQVH 3RP2A 3I77A 3RUOA 1V2RT 1AU8A 2CHAC 4WMEA 2ZECA 1DXWA 4AORA 3SUFA 4Q7ZA 4WXIA 1AZ8A 1LVOA 1SGFG 1IOEA 1GI3A 2K0QA 4VGCC 3RU4T 4A1XA 1ANEA 4GPGA 1UCYK 2Y81A 1VITF 3MNSA 1PJPA 1QY6A 3SN8A 2R0LA 2PKSB 1C5NH 4ZKNU 3UWJH 1QQ4A 4WMFA 1OP8A 3LGYA 3S9AA 1AD8H 1EPTA 4Z1MD 2ODYB 3URCA 1GHBG 1TPPA 1E1QD 2FYQA 4H6TA 2EI8A 4IN1A 5DP5A 1QHRB 3DSGA 1LKBA 1KXBA 1OWEA 2H5DA 5C20A 1LKAA 3ATLA 4FUJA 1WXRA 1D6RA 3UIRA 4WJG2 1FV9A 2Q6DA 1H9HE 1DT2A 1OXGA 2ZHQH 1GHAF 1H1BA 1PPFE 3EA7A 3RXCA 6LPRA 2ZGCA 1IQFA 2BZ6H 1O3FA 1VCQA 2KFWA 3ZZBA 5EQSA 1O5AB 5C1UA 2EQNA 4AZ2B 2ASUB 1TFXA 1Y5UT 1HRTH 2IOTA 4ZKRU 3SNBA 1O35A 5EGMA 2FEQH 3VXFH 5E2OA 2K1QA 3UWIA 1P0SH 4MNYA 5T6DA 1SKYE 2HPQH 2JETB 1TGNA 4JYVH 1WTHD 3LGWA 1ABJH 3E1XB 3KQBA 3O8CA 4HI3A 2HALA 2BHGA 5TJXA 2VIVA 4ZKSU 5HM9A 4FU8A 3A7WA 2XCFA 3GISB 1SQTA 3QDZB 1E0FD 4ISIH 4I31A 3FZDA 1K1PA 3ZV9A 1NESE 4RT0A 1EOJA 2FI5E 4DOQA 1TLDA 4NA8A 6GCHF 1L1JA 3K6ZA 5F8ZA 3SU5A 5HKKD 2A0QB 3TITA 1E38B 1W2KH 3TJUA 1O2PA 4YZUA 5DP6A 3SHCH 6CHAB 1DDJA 2ZQ1A 1BMMH 3GY2A 2PKSC 4D8NA 1MABB 5E2PA 3LJJA 1O2LA 2NU4E 1AY6H 3E90B 3RXUA 4UEHH 3F2GA 1LVMA 1GI5A 2P8OB 1V2UT 1C5PA 1NC6A 1DUAA 2XXLA 1GI7B 1S5SA 4IC6A 3MH4A 1GBDA 1KIGH 1SLXB 4INHA 3E8LA 2VVUA 5C1XA 3UOPA 1EZUC 5LPFA 1DANH 3IITA 2KCAA 3QZQA 4MNXA 1ZTJA 1FNIA 1EP5A 2WYGA 2XW9A 5DN6D 2FI3E 3CS0A 2QN5T 2NU3E 1C5YB 1O3OA 2Y82A 5BPEA 2VIDA 3SJ9A 4A1TA 5C0UA 4YT6H 4J1YA 3T27A 4QT8C 1CQQA 2HVYB 4FUGA 1THPB 4AB8A 2KCOA 3RMLH 1SC8U 2ZDAH 1GDUA 2FTLE 2BLWA 2HPPH 1QBVH 5F53A 1SQRA 4ABDA 3ZVDA 4O3TA 1FDPA 1KXDA 2ZA5A 1ANDA 1ZSJA 1CT4E 4AGJA 1KXFA 2EY4C 2ULLA 2HGTH 2VH0A 2J9NA 2GX4A 2J92A 3OSYA 5A09A 1QRXA 3TK9A 2AEIH 5GNDA 3WY8A 4NIXA 2W6ID 2YNBA 4GAWA 1O2YA 1DFPA 1HJAB 2GZ9A 2Z9GA 6CHAC 1CT0E 1P9SA 2QIQA 2H1UA 5K7RA 3PLPA 1GCTB 1UK4A 3GICB 1LHEH 1NFYA 2A7HA 1KYNA 2ODQA 2KAIA 4ZCNA 1FPHH 1SGNE 4O3UA 1BT7A 1ELAA 3MO9A 2C90B 3N7OA 1H8HD 3F68H 1NTPA 3FN8A 3Q3YA 1ELVA 4I8JA 2FM2A 3QGJA 1C1MA 2SGPE 1MKWK 4NIVA 5KGOA 3KEEA 1MKWH 1N6XA 1P10A 1V2ST 5E0JA 1BCUH 5GXPA 2J97A 1ESTA 2R2WU 5T3HA 2ZI2H 4Y8ZA 2XOKD 5JBCS 1NFXA 4HFPB 1SFIA 4NZQA 1OHHD 8GCHG 3P92A 1TA2A 1FAXA 7KMEH 2O8LA 1RFNA 3PO1B 4KP0A 3UQOA 5DPAA 1GJ9B 1ARCA 1ZJDA 1O3GA 3ZZAA 4MLFB 3LPRA 5EW2H 2OK5A 4ZHLU 2D8WA 1SQOA 1C5UA 2CK3D 3LT3A 3BEIB 2ZGHA 5DK1A 5GJ4B 1GPZA 1TA6A 4A7IB 1G3BA 3NUMA 2OC8A 2BY5X 1MD7A 3A87A 3A8BA 1JXPA 1NRSH 3AVZA 5LGOA 3SQEE 1AFQB 1FX0B 3A7VA 5EJLA 2ZHWH 2H5CA 4FUBA 3QZRA 4DCDA 1O2IA 1UVOA 1HPGA 1OS8A 1FJSA 2UWPA 5DGJA 5K0HA 3D49H 1C1SA 3LKWA 3GCTF 1GBAA 1L1GA 5FAHA 4B2CA 1LPGB 1NFUA 5L2YH 4X2VA 1IQIA 1FONA 1K0HA 1ELDE 2ZDMA 3BTWE 1ANCA 1N1LA 1GI1A 3KN2A 3TGIE 2WPDD 1ZGIA 4GVUA 3WWFA 4YM9A 3UPEA 1SVPA 2B8OH 2Z3DA 3ATKA 1KDQB 1DWDH 2F9PA 2J2UA 2WINI 2AIQA 1MBMA 1EPTC 3P8FA 5JYIA 5IK2D 2J4IA 2YMSD 2WZQA 1WTGH 3SU2A 4NZLA 1C1PA 1Q31A 1TOMH 4X1RU 4I8KA 5JPMH 4RT1A 2P59A 3ODFA 5GWZA 3D62A 1TQ0B 4Y71A 3KQDA 3O8RA 1A1RA 5FX6A 2OD3B 1DSUA 2GP9B 3E6PH 1GJ6A 3NXPA 1J9CH 4XFQA 3SU3A 3S9CA 5C1YA 1RIWB 2G4TA 5AFYH 2XTTB 1O0DH 2DUCA 3PTBA 2FOFA 1T8NA 3RM2H 2PW8H 3MQKC 2AFQB 3CP7A 1SHYA 3TU7H 4NSVA 2VGCC 2UUJB 1G36A 3PM3A 3I29A 3BIUH 1A46H 1DLEA 1W14U 1GDNA 4A1VA 3TK6A 1TGCA 1ELBA 2VVCA 2W3KA 1K1OA 1VITH 4U2WA 3ZYDA 1CHGA 3NZIA 1OKXA 2EEKA 1LHGH 2GV7A 2QV1A 3ELAH 3RXVA 2ZTZA 5JBBS 2KM0A 1KLJH 2ZGBH 2ZZUH 3MNCA 3OY6U 4NWLA 2GCHG 1Z71A 1ZPBA 4Q63A 2WPIS 2ZU1A 3PMBB 1CO7E 2HVXA 1TX8A 1OP2A 1U6QA 1H4WA 1W10U 1GGDB 2YMSB 1ZJKA 4K1EA 3W95A 5EIYA 4X1PU 1CBWB 1GBHA 5TCAA 1O2QA 1YPJH 3VGCB 4B73A 4FU7A 3AK5A 4TPYA 4Y0YE 1C5OH 2OC0A 4AYYB 1NU7B 3MH5A 3EAJA 3EE7A 1UVPA 2D26C 1P3EA 2QF5A 2WYJA 2ZEBA 1N6YA 1QGFA 2QXIA 1D6WA 1FQ3A 1TOCB 1SLVB 2XBWA 4TWYA 4CRAA 2WPMS 5A8XA 3ZZ6A 3DA9B 3RDZA 1Z1IA 2P3FH 5EQQA 2EI6A 4THNH 1JOUB 3MH7A 1UTQA 3GY8A 5HIYA 1QJ1B 3U8RH 3A88A 3FANA 4NIWA 3R3GB 1O2JA 5DSFA 1IQMA 1O2ZA 3PRDA 3A82A 3T26A 3UNQA 3DFLA 2VINA 3MO6A 2TGPZ 1NZQH 2J38A 1BMFD 1GHWH 2Q1JA 2W7UA 3MTYA 1EB2A 2DE9A 1Y3VA 5CE1A 1YYY1 1FPCH 5FCKA 2W26A 2RA0A 2GCTC 2GJGA 1AUTC 1CU1A 1BZXE 1B7XB 2ZFSA 4Z0KA 3P8NA 2ZFTA 2YOLA 3M7QA 3MOCA 3R0FA 1TMTH 4JZ1A 5G4BA 2A2QH 1JRTA 2STAE 4JCNA 1WAYB 3VGCC 3E91A 2TBSA 1AKSB 5F8TA 3B23B 4ISLA 3RXAA 1F5LA 1HLTH 1LHDH 1PPEE 4PROA 2OP9A 3RC4A 1SGTA 2G5VA 3DSOA 4YOJA 3A89A 4Y76A 4BTUB 1VITG 2AMPA 1MD8A 2WPJS 1C2FA 2ZC9H 3UTUH 3QWCH 1C2KA 3KQCA 3STJA 5C0TA 3TVJB 3BG4B 3CS7A 4BAOB 2P93A 3GYMA 1O3NA 1CSOE 1AGJA 1LCYA 1MKXK 5FBIA 1V2TT 1YPMH 2TPIZ 2UUYA 1JRSA 3GCHC 4AFZA 1Y59T 1GJ8B 4A5TS 2QXGA 2HNTC 4Y7BA 2JH6D 3ZVGA 3GDVA 1TX7A 2BD4A 1KTTB 1RS0A 2Y7XA 1GBIA 3SU0A 1GHAG 3TJNA 3GY3A 1GG6C 4XBDA 2SNVA 1GJ7B 1BTWA 1C2GA 1BTPA 3M61U 3LC5A 1RTLA 1A3EH 5E0HA 1O3EA 1HAXB 2C8XB 3QUMP 2FX4A 1TGSZ 1W8BH 4OS2A 1MH0A 5I25A 1SLWB 7ESTE 3PMHB 1O5GH 3T62A 3W94A 1JWTA 2VIOA 1YM0A 3BEFB 1S82A 2O8UA 3PV2A 3BN9A 1GMDG 1G3EA 1DY9A 3O8BA 5C2ZA 1CE5A 2A4RA 2PKAB 2PV9B 1TPSA 1BMNH 2A7CA 2ZU5A 1ZRKA 3L6PA 3N7EA 1P2IA 4B74A 4FETA 4FUFA 1O34A 2BX3A 2Z9KA 1MTSA 4JZEH 1LHCH 1F5RA 1PYTC 1IQJA 1VR1H 3TPIZ 2VWNA 1XM1A 4H4FA 2G4UA 2OCVB 1AVWA 1ZRBA 1YC0A 1ZLRA 1NO9H 1QJ6B 1SGEE 1C2EA 1D3QB 1UVTH 4WF8A 2QE7D 3GOVB 3T25A 2FLRH 5HYOA 1ESBA 1BRBE 1FN6A 4AGKA 2C93B 4RKJB 4OS6A 1C1OA 1ZZZA 3MH6A 1DITH 2SGAA 1F92A 2OC7A 3F3BA 1HAZB 5LPEA 1QZ8A 1UTMA 4ZROA 1F0RA 3AASA 1S83A 2BD2A 2SGFE 2F9OA 1T4UH 3N99A 1OWKA 3L3TA 2ALPA 2R3YA 1MCTA 1GBEA 3LC3A 4WMDA 3VG8A 1UCYE 4DJZB 2VH6A 1DICA 5FPTA 4AX9H 4DG4A 1C9PA 1EZQA 5JB8S 1ZOMA 1UTOA 4Y79A 2BB4A 1BJUA 1PPCE 3M5OA 4NFFA 1GI9B 5F6MA 1GMHG 1GBJA 1L0ZA 1ESAA 2F9NA 5A2MH 1O3MA 3LIWA 4HGCA 1BRUP 3KGPA 2ZU2A 1HAVA 1DVAH 1GMCF 1XVMA 3VXEH 3SNAA 2XYAA 2ZPRA 1N8OB 1T31A 1VGCB 1SOZA 1MU6B 1K1NA 2ZNKH 1V2OT 1Z8RA 3TNSA 2W6JD 3TJOA 4HG6A 3P95A 2HNTF 3GY6A 3S69A 1G2LA 1Z8GA 1XUGA 1PQAA 3TNTA 4I8HA 5FBEA 4OGXA 5DP9A 3MU8A 2JIZD 1LO6A 3UY9A 1UCYH 1C2JA 4BAQB 1C5LH 1Y3XA 3E0NB 1TBRH 1FN8A 4F49A 1CHOG 1VJ9U 2UWLA 1HXFH 4CHAC 3HKIB 1BMAA 3FAOA 3A7YA 1O5FH 3VFEA 1YKTA 2RA3A 5AHGH 1UVSH 3AW0A 2VU8E 3WWBA 2PUXB 2ZDLA 1BOQA 3OU0A 2VBCA 3PV5A 4ZHMU 4OGYA 1ABIH 2XC5A 2BVSH 2RCEA 3LGTA 3UQVA 2HWLB 2BDGA 1XUKA 2BXUH 4LZ1H 4Y8YA 2AGEX 3KHVA 2XBXA 3VEQB 1FY4A 2OBOA 1GL1A 1TBQH 1QQUA 2ZDKA 1IAUA 1G32B 3AAUA 1L4ZA 1O3LA 2C8YB 1K1JA 1GMDF 2ODPA 1O2TA 4CBNA 5A8YA 3KNXA 1AUJA 1O2WA 3RXEA 1TQ7B 1XVOA 2IJOB 2WV5A 3GS9A 1TONA 3PLBA 3U9AH 1C5ZB 3T5FH 1CA0C 1UHBB 1C4Y2 4Q7XA 1IHSH 4ABFA 1BHXB 2ZWLH 4J2YB 3A81A 4P02A 4U32A 1DWBH 1FIWA 1YWUA 3ITIA 2J98B 4NSYA 4WH8A 3TH3H 2GGVB 1MTUA 5IYTA 1TYNA 5EU8A 3PMAB 3QTOH 1GJAB 1MAXA 3NWUA 3FO8D 1LQEA 1GVKB 1K22H 1O2UA 1Y3YA 1H9LB 1C5QA 1A5GH 2HOBA 1KDQA 3UR6A 4MPWA 1O2SA 3SUGA 2F9UA 1ZPZA 2BY9X 3F9HA 1SG8B 2O8WA 3GCTG 4OS7A 1A0HB 3TJVA 1P06A 2QXJA 2ZTXA 3GCNA 2ZFRH 1V2WT 1NU9A 3ZV8A 2L74A 1O3BA 1LQDB 2BVRH 5A0CA 1YPHC 1SGQE 2LP6A 2C8ZB 4ISOA 1BRCE 2B5TB 3G01A 3U1IB 3H7TA 1UK3A 3P6ZB 5F8XA 4YLUA 1GVZA 4ISHH 3GCOA 1HAIH 4K60A 1IQEA 1UTJA 3P8GA 1LMWB 4MVNA 2CF8H 1DPOA 3DUXH 4UONA 2G5NA 5ABWA 4OS4A 4ZHAA 1W3CA 3F9EA 1GMHF 2BDCA 3GDUA 3RXTA 1HIAB 3T28A 2JETC 2FWWA 2Z6BD 2GTBA 1ZMJA 4O97A 3S9BA 2BQWB 3ODDA 4DIIH 4WXVA 4XBBA 1QIXB 2ZHFH 1TNIA 1KLTA 4WH6A 4FXGH 2ZFPH 5FHTA 3PRBA 1SGRE 4ABHA 3SJ8A 1J8AA 4NA7A 6ESTA 1G3CA 1AE8H 1P11E 4BOHA 2A5AA 3FFGA 3BEUA 3N7DA 1PQ7A 1HUTH 1HAYB 3M3TA 1G30B 4E7RG 1P2OA 2AH4X 2XBYA 1PPBH 4DT4A 3C27B 4INLA 1ARBA 4IC5A 1CHOF 1J14A 1FY3A 4OS1A 1EX3A 4AYVB 1F7ZA 1P01A 2FPZA 2P8OC 2PWXA 1NROH 4MG3A 2F43B 2UUKB 4UFGH 4X0WU 3MI4A 1M9UA 1MTNB 4XBCA 3P17H 1AB9B 1NN6A 3NKKA 3SV9A 3A7TA 3VB4A 1BB0B 3HK6B 1IQHA 4WVPE 4UFFH 2Q6GA 1F5KU 2GDEH 1YCPK 5FCRA 1QA0A 4E7NA 1Z8JB 4H42U 1DUEA 4KELA 5C67A 2FIRH 1XXFA 2ZCLP 4Y0ZE 3ZVFA 4NG9H 1PPZA 5CHBA 1D9IA 2EI7A 4XRNA 4DT7B 5ESTE 1ZHMA 2OINA 2FI4E 4JZIA 2SGDE 2OTVA 2XC4A 4IS5A 1RJXB 2QXHA 1V2QT 4MPXA 1YPEH 3DD2H 4XE4A 5EPYA 3PB1E 1XXDA 1TPAE 2J95A 4K69A 3M5LA 2RG3A 2JH0D 1W11U 2TGTA 4CH2B 2V6NA 4LK4A 2Y5FA 1BJVA 1GJDB 4FVDA 2SFAA 1HJAC 1P9UA 1DXPA 1ELTA 1FUJA 1K21H 2WUBA 1WSSH 1MCVA 4ACBA 1YPGH 5TCCA 2VIWA 4IGDA 1NRRH 3BTDE 1MAYA 1S6LA 2J34A 1AKSA 1C5SA 2Y6TA 1C1TA 2KR7A 1GCTC 3PMJA 4K1SA 1RGQA 1P09A 1S81A 2CXVA 2HNTE 4I33A 3TLOA 5HM2A 2G52A 3LGUA 4TPIZ 4O9VA 3A7ZA 3RU4E 1TALA 5EQRA 4NIYA 3A80A 1DWCH 2OQ5A 2V0BA 4WWYA 2FZZA 4MTBA 3PWCA 1BQYA 4AB9A 1BTXA 2QC2A 1P02A 4DVAU 1ZGVA 4GCHG 1JIRA 4IW4E 4FUCA 2A2XH 2SGEE 3F0OA 2CF9H 1HYLA 4Q2KA 2FS8A 2FOMB 3MO3A 1TX6A 1Q2WA 1TRNA 2QYIA 3UB0A 4UFDH 2A32A 2FYRA 1C2HA 2WV9A 1UTPA 2ZP0H 3MU0A 4Z6AH 3OE7D 3PO1C 2KCPA 1C2LA 2P94A 1YPKH 4YO9A 1BDAA 4ZKOU 1VJAU 1XX9A 3OFND 4JZFH 1LTOA 8KME2 3QGNB 1WV7H 3K2UA 1HJ8A 2ZHEH 3M7UA 1TBZH 3SNEA 2BMGB 3BTEE 2BDIA 5A0AE 1AFQC 2VB0A 5CHAB 3MWIU 4IMQA 2V3HH 2J94A 3NK8A 3UR9A 1P2JA 4SGBE 3SU6A 3GY7A 2PLXA 1NFWA 1OWIA 4XD7D 1E35B 3SQHE 1C1VH 2HRVA 2VIQA 2C3SA 1TIOA 1MBQA 3VB5A 2FOCA 2GDDA 1LPZB 3MNBA 1AHTH 4F55A 2F83A 3NPSA 3VB7A 4DURA 2C4FH 3H09A 2ZPSA 3RMNH 5JB9S 1TGBA 3FZZA 1AN1E 2A5IA 3LGVA 4D7FA 1OP0A 1Y3WA 1YGCH 5EXNA 4BAMB 1WQSA 1O39A 1V2VT 1W0JD 4I8LA 4P00A 1P2QA 2F9VA 1YLNA 1L1NA 3BG8A 1J15A 1O36A 1NS3A 3BTQE 3QTVH 4Y8XA 3OX7U 2W3IA 3F2FA 5DJ7A 2FOGA 3FP7E 2BLOA 1UTKA 4Y11E 2XWBI 2H9HA 2PR3A 4H6SB 1CVWH 1RIWC 2R2MB 5EXMA 1DOJA 2ZDNA 4BAHB 1HBTH 3ZIAD 5C94A 2OXSA 1PQ5A 2XNIA 1SGCA 3HGPA 2ANWA 1L4DA 3ZYEA 2UWOA 1GHXH 1O2NA 4D9RA 1MQ5A 1QCPA 4YTAA 4Q7YA 1OYQA 4YOGA 1NRPH 1C5VA 3MMGA 2AHME 1Z6EA 4MNVA 3E16B 3UFAA 1C1RA 4XSKU 1TMBH 4D7GA 4ABGA 1GJCB 1SR5C 2BD7A 4M9FA 2TGDA 4NFEA 3ENSB 1EATA 1ID5H 1EZXC 1AE5A 3KYGA 2ZU4A 1NRNH 1W0ZU 1T8LA 1H8ED 1UMAH 4WY3A 1DS2E 5EJ1A 4FVBA 3FVFB 5GCHG 2F91A 3QO6A 1QB9A 1TB6H 1SPJA 2BTCE 4UE7H 2R3UA 4X1NU 2PTNA 1AMHA 1ANBA 3ZZDA 1GMCG 3HPTB 4B2BA 4OM9A 1GGDC 2YMSC 1EJAA 3M7TA 1IQGA 4CRBA 1SQAA 3ZZCA 1CBWC 4B75A 1C4U2 4D76A 3S7HB 1OWJA 4LXBH 5FX5A 1O5BB 1J16A 3O8DA 2H2ZA 1WDIA 4BTIB 5PTPA 4TT3D 1RXPA 4GCHF 3DCLA 1OYTH 3HKJB 4NA9H 2F9BH 5AFZH 4Y6DA 1C5TA 4UD9H 1T7CA 1O3HA 1XUHA 2BOKA 1E79D 1YLDA 2Z7FE 2AGIX 4E06H 1C1WH 1HAPH 3MFJA 4FUEA 5SGAE 1FMGA 2V3MA 4I32A 1IQLA 1K1MA 2G81E 3SZNA 1BRAA 2BY6X 2BD8A 4ABIA 4BAKB 1MKXH 1PFXC 1H8DH 1UJ1A 4AG2A 4RN6A 4IN2A 8ESTE 3SU4A 3RXDA 4YOIA 1EJMA 3A8DA 1DLKB 2F4LA 3A84A 1PQ8A 1HXEH 3RXJA 1SB1H 3EQ0H 5C5OA 1MZDA 3VPKA 1K9OE 1O2GH 1ELCA 1XMNB 4IBLH 3LH3A 5A8ZA 3UREA 3EA8A 2K8IA 5KEDA 4K5ZA 2FDAA 3RXRA 4MPVA 3PWBA 5EPNA 1C5RA 2PGQB 2FODA 4CH8B 1BBRK 2WSSD 1WOFA 2XWAA 1K2I1 1BBRH 1KXCA 5AF9H 5FPSA 1NM6A 4ABJA 2BQ6B 3ZZ5A 3RXKA 3SV6A 1W7XH 1UO6A 1AWFH 1O5DH 1TRYA 3OEED 1GBCA 5B6OA 3ESTA 1LVBA 3IWMA 1HCGA 1E1RD 2ANKH 3CNRA 3MU4A 5ETXA 4Y7AA 4AFUA 4B2AA 1ETRH 2JH5D 1QRZA 1ORFA 3EDXB 4X8VH 4BNRA 4INKA 4RKOB 1AQ7A 4CREA 1GBLA 3ATIA 1G3DA 4R0IA 4B71A 5HMAA 3RXQA 1P3CA 4CBOA 3STIA 4YESB 1GL0E 3V7TA 3BG4C 4ACAA 4AOQA 2CHAB 3GY4A 1GDQA 2RDEA 1WYKA 4VGCB 3KCGH 1J17T 1QNJA 5FL7D 4I86A 1MMJN 1O2MA 1DE7H 3OTJE 1H9IE 4KTSA 2BDAA 5C5NA 4TY7A 1BIOA 1O38A 1ACBE 4XDEA 5C3NA 2ZO3H 2JDID 2PHBA 1FZZA 5L6NH 1QBNA 4KTUA 1IQNA 1WBGB 2SGQE 1AWHB 1PPHE 1AO5A 3RXGA 3EA9A 4R8TB 3UUZA 5HIZA 5L30H 1HAGE 3A83A 3UNSA 1P03A 3SW2B 2ZFFH 3GDSA 2BD3A 5GCHF 4AFQA 2QF3A 2OBQA 5KECA 1FIZA 3SJOA 3ZVEA 3ZVAA 5JBAS 3S0NA 3GYLB 1CT2E 1A7SA 5DO4H 1E34B 1O3CA 2O9QA 3HGNA 3OAAD 5FXLA 4BXWA 1C5WB 3SORA 4A92A 1Z8IB 1G9IE 2HLDD 1UTLM 1EZSC 2ZHDA 1ZHRA 1P8VC 4DY7B 1AZZA 1QRWA 4JYUH 5C17A 4FUIA 3SGQE 3V13A 7LPRA 1C2DA 1O3KA 2PFEA 2ANYA 5EXLA 5T1VA 4X1SU 2AS9A 3EGKH 3URDA 4ABBA 1ETSH 3TIUA 4B76A 1AFEH 3MU5A 1ZSKA 4UDWH 3E3TA 2VVVA 4Q80A 2AMDA 2FMJA 4AC9A 1W0YH 1Y3UA 2A45B 3SV7A 1CA8B 1A4WH 3VB3A 2BLVA 1ZSLA 2Z9LA 3F9FA 3JZ2B 1KMHB 3GY5A 3U28C 4KTCA 1SGPE 1A5HA 3CENA 3SV8A 3Q76A 1OX1A 2IJD1 1OPHB 2WUCA 2XC0A 2AIPA 1TPOA 2BD9A 1QA7A 5H4IB 1T4VH 3F0PA 4TY6A 1GJ5H 4K1TA 4HTCH 1YPLH 3M5MA 1GHYH 2G55A 1XUFA 3AW1A 2ZU3A 1GBBA 3H5CB 4ZH8A 3SJIA 2OLGA 1HAOH 3FKSD 3AAVA 2H6MA 9LPRA 1GBTA 4GSOA 1EJNA 1N8OC 1INCA 1VGCC 3BIVH 1BTZA 4U30A 5EW1H 3KF2A 1FAKH 2QF0A 2FO9A 1A0LA 1KSNA 1QR3E 2B7DH 1RD3B 3OEHD 7GCHF 4GUXA 1Z1JA 3RXHA 3B8JA 1G37A 4ZUHA 2VWLA 1XKAC 4KKDA 1GHVH 5E8EH 2RFKC 2QGRA 1TNHA 1BTYA 2BVXH 1XUJA 1VZQH 2Z3EA 3QX5H 4A6LA 1YF4A 3Q3XA 3RXSA 5EG4A 1BTUA 1P2MA 4OS5A 2KX4A 3A8CA 1IHTH 1O2RA 4ZXXH 5EODA 3RM0H 1DY8A 2BY7X 3ATWA 1NT1A 1QL8A 1MZAA 1Z6JH 1TABE 3V0XA 2PUQH 4X6PA 1A3BH 2IPHA 1EFRD 1C9TA 3U8TH 2QCYA 3FP6E 4FUDA 1MTVA 2XRCA 2EC9H 2Q6FA 4K8BA 1W0KD 2XBVA 2M2AA 3ZZ7A 2VWOA 1QL9A 5A0BA 4JK6A 4MNWA 1P05A 1TRMA 5GPIB 1S6FA 1THRH 4X6OA 3LH1A 2XCNA 2BZAA 2OC1A 2L6OA 5LH8A 2BM2A 2JJ2D 1GI0A 4BTTB 3MU1A 1UW7A 4DGJA 1CGHA 5ESBA 1V2MT 1KXEA 3DHKH 3EE0B 5J4QA 1P12E 4GHQA 1TNKA 1LVYA 4YT7H 2WHXA 1TGTA 2CN0H 1FY8E 3OYPA 3ZZ8A 2Y7ZA 1WU1A 1BUIA 3U1JB 2BQ7B 1W13U 1MU8B 2V7QD 1FY5A 4RSPA 2D1JA 3KQ5A 3M36A 1EKBB 3LONA 3BTHE 3SOSA 2Y5HA 4X8TH 1LHFH 1ZTLA 2WPHS 1O2KA 1LPKB 1SHHB 2ZF0H 1HAVB 1QTFA 2GZ7A 1SGIB 2NWNA 4TYDA 1GI4A 1E36B 3RXBA 1DM4B 5HGGA 4CRCA 1GHBF 1GBFA 3DFJA 1YCPH 1BITA 1KLIH 1QFKH 2OUAA 4SGAE 3SNCA 2FS9A 4ABAA 5DP3A 5GDSH 3S7KB 4U01A 1KTSB 4K3JA 2F3CE 2FXRA 1SOTA 1YBWA 1AI8H 4ZMAH 4ZAEA 1SBWA 3BTTE 4X6MA 3V12A 1O3PB 5E0GA 4D9QA 1MTWA 2OQUA 2ZGXH 1D3DB 2FP7B 1LDTT 1O33A 2P3TB 1EPTB 2RDLA 1CGJE 3F6UH 3LGIA 9ESTA 3ZVBA 3PTNA 1F0TA 1UVUH 3V3MA 2BY8X 5FPYA 2H9EH 3PV4A 1SMFE 1HV7A 3LDXH 4FU9A 3RXLA 1D3PB 2GT7A 5DKMA 2BXTH 1EAUA 1FI8A 3RXPA 2B9LA 3RXIA 1T8OA 3PLKA 2CMYA 1EAWA 4F4OC 3KL6A 1IQKA 2VNTA 4ASUD 1A0JA 2VGCB 3M5NA 1EUFA 3A86A 2FLBH 1BMLA 2A31A 5DP7A 1ZMLA 2O8MA 2JKHA 2J5UA 1MTNC 2FX6A 1S84A 1SSXA 1AB9C 1V2JT 3E0PB 1GI6A 2PP6A 4ESTE 1S85A 4X2WA 4MDSA 1BHXF 2Z3CA 4JZDH 1YP9A 1B5GH 3RC6A 1Y8TA 4NWKA 1BA8B 1AIXH 1ELEE 1T32A 2V35A 1C1UH 3RMMH 1C4V2 1AVXA 1Z7KA 2AYWA 2LELA 4X8UH 1NY22 1MQ6A 2FOHA 3T29A 1FY1A 4X2YA 4BXSA 1C1QA 2R0KA 4LZ4B 1EASA 1TE0A 1O31A 4CRFA 2ZIQH 1F2SE 2LNCA 2FOEA 3UOUA 2GVFA 1O3IA 2ZKSA 2GZ8A 1HDTH 2Z94A 5AVDA 1F0UA 1O2HA 5I46H 3QN7A 5F03A 2GKVE 2QA9E 4GHTA 2P16A 3VB6A 1OWDA 3U8OH 4MQAA 2PKAA 5L2ZH 2I6QA 1QJ7B 1SGDE 1O3JA 1OOKB 3WW7A 4JYTA 1EAXA 1S0RA 4UFEH 1TNJA 3EYDA 1QB1A 3SGAE 2A4OA 2ZFQH 5DG6A 1UK2A 5DP4A 4ZXYH 1EB1H 1ELGA 4K8YA 2STBE 1TNGA 1B0EA 2TGAA 4DW2U 1DX5M 1A2CH 1P57B 2H9TH 3BTME 3A8AA 1SI5H 5BRRE 3QLPH 4I8GA 3LU9B 1HFDA 3HATH 3NCLA 3TGJE 4CRDA 2BOHB 5JDUB 1P2NA 2B0FA 2ESTE 1HNEE 3BTFE 1COWD 3RU4D 1WCZA 1C5XB 2NU0E 3SO3A 8LPRA 3UAIC 1ETTH 2QAAA 3W1EA 3Q3KA 2IN2A 2V3OH 3NRLA 2VWMA 2DE8A 2GCTB 5GIBA 5CMXH 2QF4A 2QY0B 4NGAH 1GBKA 1CGIE 3BTGE 3RXMA 1V6DA 3ZVCA 3ZZ3A 4CR5A 1DWEH 1P04A 4TWWA 2PSXA 3SU1A 2THFB 2YNAA 2A4QA 1T8MA 4FOUC 3BSQA 2P3UB 4B1TA 5HXFA 3D65E 1P2KA 1SFQB 3M3SA 4AFSA 1BTHH 4B6EA 1PYTD 1GBMA 3RLYH 2IPQX 2BYAX 2KAIB 2TIOA 1SGYE 1SGFA 2SNWA 1EOLA 1TAWA 2NU2E 4M7GA 3UNRA 4GLYA 3TGKE 1KXAA 8GCHF 1EP6A 4ASHA 5CHAC 3SGBE 1ZR0A 3GCHB 1FXYA 4XOJA 2PTCE 1D4PB 1O5EH 3A85A
chains in the Genus database with same CATH topology
1HGTH 1TMUH 3K6YA 5DP8A 1QBOA 1V2KT 2BX4A 3KIDU 2ZCHP 3M3VA 2BD5A 1GG6B 1VCPA 1O37A 1O2OA 2R9PA 3PROA 2VJ1A 1C2MA 1EXFA 2ZPQA 3LOXA 1H8IH 5JBTA 4IMZA 5LPRA 2BDBA 3ZZ4A 4CRGA 1G2MA 4K2YA 1ZTKA 3DT0H 3LJOA 4X2XA 1EQ9A 1V2NT 1W7GH 3KQEA 2FOAA 2A7JA 5EOKA 1V3XA 4FUHA 3TH2H 4JK5A 1K28D 2D2DA 3JZ1B 5T6GA 5J4SA 3BF6H 1E37B 2GV6A 1BBRE 2C8WB 1XKBC 1PPGE 2LPRA 3ATMA 4I7YH 3K65B 4NCYA 1THSH 1AVGH 4E05H 3H7OA 1KY9A 3TH4H 2P95A 1OWHA 1W12U 3QK1A 1B0FA 1HJ9A 2BLQA 1QURH 3U69H 1C2IA 2G51A 2Z9IA 1GI8B 2PGBB 2A1DB 2ANMH 2W5EA 2WPLS 2CJIA 3RMOH 3RXOA 2TRMA 2Y80A 2CV3A 2PSYA 2ZDVH 3BV9B 1JBUH 3U98H 1HAHH 3SHAH 1VCWA 1S0QA 2NU1E 4DIHH 1UHBA 3RC5A 3MNXA 1RTFB 1ZYOA 1GVLA 3K9XB 3RLWH 1O3DA 2CGAA 5T6FA 3F1SB 1JMOH 1YPHE 4KGAA 2O8TA 3T2NA 1X7AC 2ZGJA 4MPUA 5IDKA 1L2EA 2FESH 2EA3A 1UTNA 3SI3H 1XUIA 2GMTB 3MHWU 7GCHG 1SLUB 1RRKA 2AERH 3Q00A 3SI4H 2GT8A 2GCHF 2WV4A 2BDHA 1QB6A 3SUDA 1YLCA 1NPMA 1O3AA 3SUEA 4O03A 2W7SA 1GHZA 1ZPCA 2BDYA 1RTKA 3RXFA 1C1NA 1Y5BT 1O2VA 1OSSA 1FLEE 2A5KA 1O2XA 3B9FH 4YLQH 2VIPA 2WPKS 1HB0B 2AGGX 1SL3A 1A5IA 2ILNA 1Y5AT 3L33A 3D23A 6GCHG 1K1IA 1QL7A 1ZHPA 3SBKA 1S6HA 1DSTA 2Z9JA 2ZQ2A 4X6NA 4BANB 1A61H 3A7XA 1HIAA 4ABEA 1C5MD 1V2LT 1TWXB 1O32A 1JIMA 2G8TA 2M5TA 4CHAB 1ZMNA 3SNDA 4AG1A 3M35A 3HK3B 3P70B 1O30A 4X1QU 1ELFA 1D3TB 2ZCKP 1O5CB 3ZZ9A 2ALVA 3BTKE 3SJKA 3FP8E 3IG6B 1TNLA 2FOBA 1GI2A 1GJ4H 1GWAA 4HZHA 2ZG0H 4LOYH 1YCPM 3OY5U 3C1KA 4CR9A 4Y10E 4X8SH 2GD4B 3F9GA 1GCDA 4ISNA 2AMQA 2HLCA 1K1LA 1GJBB 2FTMA 4JMYA 3TK5A 1F0SA 2GMTC 4AN7A 3PYHA 3I78A 2UUFB 1EAIA 2Y5GA 1NRQH 1V2PT 3Q77A 1MUEB 3MYWA 1WUNH 3P8OA 3M37A 2ZTYA 1Q3XA 3SV2H 2I6SA 2A4GA 1CA0B 2G00A 1WQVH 3RP2A 3I77A 3RUOA 1V2RT 1AU8A 2CHAC 4WMEA 2ZECA 1DXWA 4AORA 3SUFA 4Q7ZA 4WXIA 1AZ8A 1LVOA 1SGFG 1IOEA 1GI3A 4VGCC 3RU4T 4A1XA 1ANEA 4GPGA 1UCYK 2Y81A 1VITF 3MNSA 1PJPA 1QY6A 3SN8A 2R0LA 2PKSB 1C5NH 4ZKNU 3UWJH 1QQ4A 4WMFA 1OP8A 3LGYA 3S9AA 1AD8H 1EPTA 2ODYB 3URCA 1GHBG 1TPPA 2FYQA 4H6TA 2EI8A 4IN1A 5DP5A 1QHRB 5C20A 1LKBA 1KXBA 1OWEA 2H5DA 1LKAA 3ATLA 4FUJA 1D6RA 3UIRA 4WJG2 1FV9A 2Q6DA 1H9HE 1DT2A 1OXGA 2ZHQH 1GHAF 1H1BA 1PPFE 3EA7A 3RXCA 6LPRA 2ZGCA 1IQFA 2BZ6H 1O3FA 1VCQA 3ZZBA 5EQSA 1O5AB 5C1UA 4AZ2B 2ASUB 1TFXA 1Y5UT 1HRTH 2IOTA 4ZKRU 3SNBA 1O35A 5EGMA 2FEQH 3VXFH 5E2OA 2K1QA 3UWIA 1P0SH 4MNYA 5T6DA 2HPQH 2JETB 1TGNA 4JYVH 1WTHD 3LGWA 1ABJH 3E1XB 3KQBA 3O8CA 4HI3A 2HALA 2BHGA 5TJXA 2VIVA 4ZKSU 5HM9A 4FU8A 3A7WA 2XCFA 3GISB 1SQTA 3QDZB 1E0FD 4ISIH 4I31A 3FZDA 1K1PA 3ZV9A 1NESE 1EOJA 2FI5E 4DOQA 1TLDA 4NA8A 6GCHF 1L1JA 3K6ZA 5F8ZA 3SU5A 2A0QB 3TITA 1E38B 1W2KH 3TJUA 1O2PA 4YZUA 5DP6A 3SHCH 6CHAB 1DDJA 2ZQ1A 1BMMH 3GY2A 2PKSC 4D8NA 5E2PA 3LJJA 1O2LA 2NU4E 1AY6H 3E90B 3RXUA 4UEHH 1LVMA 1GI5A 2P8OB 1V2UT 1C5PA 1NC6A 1DUAA 2XXLA 1GI7B 1S5SA 4IC6A 3MH4A 1GBDA 1KIGH 1SLXB 4INHA 3E8LA 2VVUA 5C1XA 3UOPA 1EZUC 5LPFA 1DANH 3IITA 3QZQA 4MNXA 1ZTJA 1FNIA 1EP5A 2WYGA 2XW9A 2FI3E 3CS0A 2QN5T 2NU3E 1C5YB 1O3OA 2Y82A 5BPEA 2VIDA 3SJ9A 4A1TA 4YT6H 4J1YA 3T27A 4QT8C 1CQQA 4FUGA 1THPB 4AB8A 3RMLH 1SC8U 2ZDAH 1GDUA 2FTLE 2BLWA 2HPPH 1QBVH 4ABDA 3ZVDA 4O3TA 1FDPA 1KXDA 2ZA5A 1ANDA 1ZSJA 1CT4E 4AGJA 1KXFA 2ULLA 2HGTH 2VH0A 2J9NA 2GX4A 2J92A 3OSYA 5A09A 1QRXA 3TK9A 2AEIH 3WY8A 4NIXA 2YNBA 4GAWA 1O2YA 1DFPA 1HJAB 2GZ9A 2Z9GA 6CHAC 1CT0E 1P9SA 2QIQA 2H1UA 5K7RA 3PLPA 1GCTB 1UK4A 3GICB 1LHEH 1NFYA 2A7HA 1KYNA 2ODQA 2KAIA 1FPHH 1SGNE 4O3UA 1BT7A 1ELAA 3MO9A 2C90B 3N7OA 3F68H 1NTPA 3Q3YA 1ELVA 4I8JA 2FM2A 3QGJA 1C1MA 2SGPE 1MKWK 4NIVA 3KEEA 1MKWH 1N6XA 1P10A 1V2ST 5E0JA 1BCUH 5GXPA 1ESTA 2R2WU 5T3HA 2ZI2H 4Y8ZA 5JBCS 1NFXA 4HFPB 1SFIA 4NZQA 8GCHG 3P92A 1TA2A 1FAXA 7KMEH 2O8LA 1RFNA 3PO1B 4KP0A 3UQOA 5DPAA 1GJ9B 1ARCA 1ZJDA 1O3GA 3ZZAA 4MLFB 3LPRA 5EW2H 4ZHLU 2D8WA 1SQOA 1C5UA 3LT3A 5DK1A 3BEIB 2ZGHA 5GJ4B 1GPZA 1TA6A 4A7IB 1G3BA 3NUMA 2OC8A 2BY5X 1MD7A 3A87A 3A8BA 1JXPA 1NRSH 3AVZA 5LGOA 3SQEE 1AFQB 3A7VA 2ZHWH 2H5CA 4FUBA 3QZRA 4DCDA 1O2IA 1UVOA 1HPGA 1OS8A 1FJSA 2UWPA 5DGJA 5K0HA 3D49H 1C1SA 3LKWA 3GCTF 1GBAA 1L1GA 5FAHA 4B2CA 1LPGB 1NFUA 5L2YH 4X2VA 1IQIA 1FONA 1ELDE 2ZDMA 3BTWE 1ANCA 1N1LA 1GI1A 3KN2A 3TGIE 1ZGIA 4GVUA 4YM9A 3UPEA 1SVPA 2B8OH 2Z3DA 3ATKA 1KDQB 1DWDH 2F9PA 2J2UA 2WINI 2AIQA 1MBMA 1EPTC 3P8FA 5JYIA 2J4IA 1WTGH 3SU2A 4NZLA 1C1PA 1Q31A 1TOMH 4X1RU 4I8KA 5JPMH 2P59A 3ODFA 5GWZA 3D62A 1TQ0B 4Y71A 3KQDA 3O8RA 1A1RA 5FX6A 2OD3B 1DSUA 2GP9B 3E6PH 1GJ6A 3NXPA 1J9CH 4XFQA 3SU3A 3S9CA 5C1YA 1RIWB 2G4TA 5AFYH 2XTTB 1O0DH 2DUCA 3PTBA 2FOFA 1T8NA 3RM2H 2PW8H 2AFQB 3CP7A 1SHYA 3TU7H 4NSVA 2VGCC 2UUJB 1G36A 3PM3A 3I29A 3BIUH 1A46H 1DLEA 1W14U 1GDNA 4A1VA 3TK6A 1TGCA 1ELBA 2VVCA 2W3KA 1K1OA 1VITH 4U2WA 3ZYDA 1CHGA 3NZIA 1OKXA 2EEKA 1LHGH 2GV7A 2QV1A 3ELAH 3RXVA 2ZTZA 5JBBS 1KLJH 2ZGBH 2ZZUH 3MNCA 3OY6U 4NWLA 2GCHG 1Z71A 1ZPBA 2WPIS 2ZU1A 3PMBB 1CO7E 2HVXA 1TX8A 1OP2A 1U6QA 1H4WA 1W10U 1GGDB 1ZJKA 4K1EA 3W95A 4X1PU 1CBWB 1GBHA 5TCAA 1O2QA 1YPJH 3VGCB 4B73A 4FU7A 4TPYA 4Y0YE 1C5OH 2OC0A 4AYYB 1NU7B 3MH5A 3EAJA 1UVPA 2D26C 1P3EA 2WYJA 2ZEBA 1N6YA 1QGFA 2QXIA 1D6WA 1FQ3A 1TOCB 1SLVB 2XBWA 4TWYA 4CRAA 2WPMS 5A8XA 3ZZ6A 3DA9B 3RDZA 1Z1IA 2P3FH 5EQQA 2EI6A 4THNH 1JOUB 3MH7A 1UTQA 3GY8A 1QJ1B 3U8RH 3A88A 3FANA 4NIWA 3R3GB 1O2JA 1IQMA 1O2ZA 3A82A 3T26A 3UNQA 3DFLA 2VINA 3MO6A 2TGPZ 1NZQH 2J38A 1GHWH 2Q1JA 2W7UA 3MTYA 1EB2A 2DE9A 1Y3VA 5CE1A 1YYY1 1FPCH 5FCKA 2W26A 2RA0A 2GCTC 1AUTC 1CU1A 1BZXE 1B7XB 2ZFSA 4Z0KA 3P8NA 2ZFTA 2YOLA 3M7QA 3MOCA 3R0FA 1TMTH 4JZ1A 5G4BA 2A2QH 1JRTA 2STAE 4JCNA 1WAYB 3VGCC 3E91A 2TBSA 1AKSB 5F8TA 3B23B 4ISLA 3RXAA 1F5LA 1HLTH 1LHDH 1PPEE 4PROA 2OP9A 3RC4A 1SGTA 2G5VA 4YOJA 3A89A 4Y76A 4BTUB 1VITG 2AMPA 1MD8A 2WPJS 1C2FA 2ZC9H 3UTUH 3QWCH 1C2KA 3KQCA 3STJA 3TVJB 3BG4B 3CS7A 4BAOB 2P93A 3GYMA 1O3NA 1CSOE 1AGJA 1LCYA 1MKXK 5FBIA 1V2TT 1YPMH 2TPIZ 2UUYA 1JRSA 3GCHC 4AFZA 1Y59T 1GJ8B 4A5TS 2QXGA 2HNTC 4Y7BA 2JH6D 3ZVGA 3GDVA 1TX7A 2BD4A 1KTTB 1RS0A 2Y7XA 1GBIA 3SU0A 1GHAG 3TJNA 3GY3A 1GG6C 4XBDA 2SNVA 1GJ7B 1BTWA 1C2GA 1BTPA 3M61U 3LC5A 1RTLA 1A3EH 5E0HA 1O3EA 1HAXB 2C8XB 3QUMP 2FX4A 1TGSZ 1W8BH 4OS2A 1MH0A 5I25A 1SLWB 7ESTE 3PMHB 1O5GH 3T62A 3W94A 1JWTA 2VIOA 1YM0A 3BEFB 1S82A 2O8UA 3BN9A 1GMDG 1G3EA 1DY9A 3O8BA 5C2ZA 1CE5A 2A4RA 2PKAB 2PV9B 1TPSA 1BMNH 2A7CA 2ZU5A 1ZRKA 3L6PA 1P2IA 4B74A 4FUFA 1O34A 2BX3A 2Z9KA 1MTSA 4JZEH 1LHCH 1F5RA 1PYTC 1IQJA 1VR1H 3TPIZ 2VWNA 1XM1A 4H4FA 2G4UA 2OCVB 1AVWA 1ZRBA 1YC0A 1ZLRA 1NO9H 1QJ6B 1SGEE 1C2EA 1D3QB 1UVTH 4WF8A 3GOVB 3T25A 2FLRH 5HYOA 1ESBA 1BRBE 1FN6A 4AGKA 2C93B 4RKJB 4OS6A 1C1OA 1ZZZA 3MH6A 1DITH 2SGAA 1F92A 2OC7A 5LPEA 1HAZB 1UTMA 4ZROA 1F0RA 3AASA 1S83A 2BD2A 2SGFE 2F9OA 1T4UH 1OWKA 3L3TA 2ALPA 2R3YA 1MCTA 1GBEA 3LC3A 4WMDA 1UCYE 4DJZB 2VH6A 1DICA 5FPTA 4AX9H 4DG4A 1C9PA 1EZQA 5JB8S 1ZOMA 1UTOA 4Y79A 2BB4A 1BJUA 1PPCE 3M5OA 4NFFA 1GI9B 5F6MA 1GMHG 1GBJA 1L0ZA 1ESAA 2F9NA 5A2MH 1O3MA 3LIWA 4HGCA 1BRUP 3KGPA 2ZU2A 1HAVA 1DVAH 1GMCF 1XVMA 3VXEH 3SNAA 2XYAA 2ZPRA 1N8OB 1T31A 1VGCB 1SOZA 1MU6B 1K1NA 2ZNKH 1V2OT 1Z8RA 3TNSA 3TJOA 3P95A 2HNTF 3GY6A 3S69A 1G2LA 1Z8GA 1XUGA 1PQAA 3TNTA 4I8HA 5FBEA 4OGXA 5DP9A 3MU8A 1LO6A 3UY9A 1UCYH 1C2JA 4BAQB 1C5LH 1Y3XA 3E0NB 1TBRH 1FN8A 4F49A 1CHOG 1VJ9U 2UWLA 1HXFH 4CHAC 3HKIB 1BMAA 3FAOA 3A7YA 1O5FH 3VFEA 1YKTA 2RA3A 5AHGH 1UVSH 3AW0A 2VU8E 2PUXB 2ZDLA 1BOQA 3OU0A 4ZHMU 4OGYA 1ABIH 2XC5A 2BVSH 2RCEA 3LGTA 3UQVA 2HWLB 2BDGA 1XUKA 2BXUH 4LZ1H 4Y8YA 2AGEX 3KHVA 2XBXA 3VEQB 1FY4A 2OBOA 1GL1A 1TBQH 1QQUA 2ZDKA 1IAUA 1G32B 3AAUA 1L4ZA 1O3LA 2C8YB 1K1JA 1GMDF 2ODPA 1O2TA 4CBNA 5A8YA 3KNXA 1AUJA 1O2WA 3RXEA 1TQ7B 1XVOA 2IJOB 2WV5A 1TONA 3PLBA 3U9AH 1C5ZB 3T5FH 1CA0C 1UHBB 1C4Y2 4Q7XA 1IHSH 4ABFA 1BHXB 2ZWLH 4J2YB 3A81A 4U32A 1DWBH 1FIWA 3ITIA 4NSYA 4WH8A 3TH3H 2GGVB 1MTUA 5IYTA 1TYNA 5EU8A 3PMAB 3QTOH 1GJAB 1MAXA 3NWUA 1LQEA 1GVKB 1K22H 1O2UA 1Y3YA 1H9LB 1C5QA 1A5GH 2HOBA 1KDQA 3UR6A 4MPWA 1O2SA 3SUGA 2F9UA 1ZPZA 2BY9X 3F9HA 1SG8B 2O8WA