1C5QA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5qA02
1D3TB 2WINI 4ASHA 4JZ1A 4FVBA 5FPTA 4I32A 1S0RA 2C8WB 1E36B 3A83A 1LVOA 3M5MA 2GCHG 3DHKH 3WY8A 1AN1E 1O3OA 2ZKSA 4Y7BA 1HAIH 2BTCE 3KNXA 3V7TA 4IW4E 1QNJA 2WPHS 2QC2A 1P01A 5GCHG 1EZUC 3U9AH 2GCTB 2ZCLP 1TGSZ 3T62A 1GBJA 4DG4A 1SGTA 3UR9A 3SV9A 3MTYA 3NK8A 5A0AE 2ZP0H 1O2LA 3KQCA 3LT3A 1T8LA 2ODPA 1EP5A 1TOMH 3B9FH 1FY1A 2A2QH 2NU3E 1AE8H 1QBVH 4X2YA 3O8RA 1MD8A 3QDZB 4AX9H 1C5LH 5LPRA 3ESTA 3ODDA 3PWCA 1AIXH 1P9SA 2ULLA 2Z3DA 5FCRA 1HXFH 1Y3VA 2Z3EA 4WXVA 3A80A 1GBIA 3TJUA 1DUAA 1C1QA 4HI3A 4XFQA 1SGPE 8GCHF 1P57B 2HGTH 4ABBA 1BMMH 1DFPA 4FUGA 1CA8B 3A81A 4U30A 5GJ4B 4K8BA 1FJSA 2AIPA 7GCHF 4HTCH 2FI3E 1GDNA 3CENA 2BDHA 3LKWA 3RXJA 4D9RA 2O8MA 3UREA 4MTBA 3MFJA 1O2GH 2BD9A 2PKSB 1BBRK 1GJBB 2XYAA 5EOKA 3SI4H 3A7WA 4DOQA 3VEQB 1VCWA 4IN2A 4R8TB 1BBRH 2UUKB 1YCPK 2G55A 1VJ9U 5F6MA 1EB1H 2VIVA 3RLWH 4WMFA 1AWHB 3TGJE 1A3BH 1YCPH 3EA9A 2PW8H 1ZMJA 2J94A 1Z8RA 2FPZA 1CSOE 1EAXA 4BTIB 1SFIA 3MH5A 1C5UA 1K21H 1YPHE 4XE4A 1KXEA 3OU0A 3W95A 1A1RA 1BIOA 5JYIA 1ELCA 3M3TA 1A46H 4Q7YA 1GBLA 2P94A 4QT8C 3SGQE 1DS2E 3S0NA 3A88A 1L0ZA 1W10U 1WYKA 3W94A 4J1YA 5FBIA 4JZEH 1TMBH 1YPEH 4ZXXH 1F2SE 1C5YB 1THRH 3A7ZA 3LC3A 2BY5X 2BDBA 1WU1A 4K2YA 2DE9A 2OQ5A 2P3FH 4TYDA 3L33A 2A5IA 3E0PB 4IMZA 2ZTZA 2TGPZ 1OXGA 2J95A 3PV4A 1Y5AT 3ELAH 3V3MA 3SNBA 3CS7A 1NFYA 1GDQA 3RMMH 3ITIA 1OYTH 1BTYA 2QXJA 1O2KA 1CGHA 2ZO3H 2G5VA 5FHTA 1TE0A 1MZAA 1GVKB 4ISIH 2XC0A 1GL1A 5T6FA 3K2UA 1CVWH 2BQ7B 5JBAS 1DLKB 1DY8A 5F8ZA 1AGJA 1BRUP 1G32B 3B8JA 1C2JA 2BVRH 2H6MA 1HUTH 1NPMA 1GCTC 1DOJA 3UWJH 2HOBA 1BRAA 1UJ1A 3UQVA 2AGIX 1SMFE 2Z7FE 1P9UA 4MQAA 4FUFA 1PYTC 2JETC 1GMHG 2VWLA 1S84A 5AF9H 5L2YH 2H1UA 2ZU4A 1ORFA 1ELEE 3SUDA 3ATWA 1GI6A 2R0LA 1C2LA 1HAOH 1IQEA 1HJAC 1ARBA 4THNH 2ZGXH 3D23A 3BTQE 1GI5A 1ACBE 3LJJA 1GJ5H 2TGDA 1JIRA 1C9TA 1G9IE 5DG6A 1HB0B 1JRSA 2XW9A 2PR3A 1MQ5A 3A8DA 5TCCA 1A0JA 1IQMA 1W11U 3GY2A 1BTHH 1MU8B 1UCYK 4RSPA 1O34A 3BG4C 3RXGA 1F5LA 4K1EA 5DO4H 1T7CA 2VB0A 1GBBA 3SHCH 1UCYH 2PFEA 1QHRB 4XBBA 2IJOB 2ZGBH 1AZ8A 4FUHA 2GTBA 1F5RA 2ZFRH 2F9VA 3SV7A 4I8JA 1S6FA 5HGGA 1UK3A 3FVFB 4OGXA 4X2XA 3ZZCA 4K3JA 1GBEA 4WH6A 3MU1A 4AN7A 1LHGH 3VGCC 4J2YB 2UWPA 1AQ7A 2ZGCA 4IC6A 3I77A 3HATH 2FS8A 3RC5A 6CHAC 4TWWA 3RXFA 2VH6A 2ANWA 4JMYA 1GHAG 3ZYEA 3LC5A 2PSXA 3EGKH 3TNSA 1UVOA 1TPPA 1AVWA 2J9NA 3F9GA 2OBOA 1OWJA 1PPHE 2ODQA 2ZPSA 4XBCA 4Y76A 1QY6A 1Z1JA 2AYWA 2QN5T 1YPMH 2Q6GA 1HNEE 3BSQA 4WF8A 2EI7A 2HWLB 4GUXA 1FN8A 4Q2KA 2XBXA 1HXEH 2GKVE 4K1TA 4AZ2B 1L1JA 1C5VA 2FI5E 1RFNA 3SU5A 1DITH 1J8AA 4ZHMU 1SSXA 1B7XB 2OCVB 1C1PA 1HJ9A 2AH4X 2ZFSA 1PPCE 1LVBA 1SPJA 1JMOH 2NU4E 2A7CA 1C5NH 3UOUA 4NWLA 4ABEA 5BRRE 5FX6A 4H4FA 1LPGB 2OP9A 2PHBA 3A7YA 3RXSA 2O8UA 1YPKH 1TALA 1TBRH 2W7UA 4KTUA 1HV7A 5TCAA 1KLIH 2Y82A 3AW1A 1HIAB 4IN1A 3KGPA 2HNTC 2FOCA 1SGFA 3KL6A 1C9PA 1JOUB 3QGNB 2OTVA 3LGUA 4NIXA 1TIOA 1OS8A 5EODA 1TWXB 2VIOA 2Y5HA 1T32A 1O30A 2BYAX 1O31A 3SJIA 2D2DA 2G4UA 3NPSA 2BY7X 3DT0H 1ZSKA 1BHXB 3A8BA 1Z8JB 3BG4B 5ABWA 1GBDA 1YKTA 3GYLB 1F0UA 2TGAA 1C4V2 2GX4A 3MNBA 5F8TA 1O3PB 3SU0A 1ELTA 1SL3A 1KIGH 1QRWA 4Y71A 2FESH 3EAJA 2BMGB 3GCNA 5EW1H 3GY5A 2A5KA 4B2BA 1DX5M 2W5EA 5HM9A 3A8AA 1ELFA 3A85A 3GY7A 3ZV9A 1GJCB 1Z6JH 2AMDA 3FZDA 1FY8E 4NG9H 3HKIB 3RXTA 4YM9A 1SGEE 2BXUH 1MU6B 3T26A 2SGFE 3M36A 1V2JT 1YP9A 1D9IA 4WMDA 1FXYA 2VGCC 1JWTA 4KTCA 9LPRA 2ZA5A 2VINA 3H5CB 4JYTA 2ZHFH 2FOFA 1HAHH 1TQ7B 2TRMA 1NFUA 2QGRA 2HPPH 3PYHA 4ZH8A 3SO3A 3GYMA 1V3XA 3SUGA 1C5SA 1OWEA 1TRNA 4YO9A 1BJVA 1O2TA 1ZMNA 1HAPH 2FTMA 1SQAA 4GAWA 3E3TA 1C1UH 1O2ZA 3P8NA 5DPAA 3Q3XA 2OC7A 1V2TT 5EXMA 5A8XA 1YC0A 5C1UA 3RXBA 2HLCA 1UHBB 4FU8A 1FN6A 2PSYA 1GJAB 2QF3A 4O97A 2XC5A 1V2NT 2O8TA 5A2MH 3UFAA 2R0KA 1A61H 1O2JA 3ZZ4A 1ZTKA 3EYDA 1GI9B 2Z9LA 1C1VH 4FUBA 4UFDH 1LPKB 4LZ4B 4ZAEA 2BDCA 3BTTE 3CP7A 3P8OA 2IPHA 1P03A 4CHAC 1D3DB 3A84A 1BMAA 8GCHG 3PLPA 4X8TH 3H7TA 1P2MA 2RDLA 3F68H 2OQUA 1UVPA 1TPSA 3KCGH 4SGBE 1VCQA 2ZDNA 7GCHG 2ZCKP 3O8BA 3F9HA 3BTFE 4ABHA 1ZPCA 2WV5A 3GCTF 2J4IA 1ELAA 1AU8A 2BQ6B 2AIQA 4KKDA 4X6OA 4NFFA 5ESTE 2BX3A 2VWOA 2D8WA 4CR9A 2ZU2A 5LGOA 1N6XA 1OX1A 1CU1A 2Z9GA 3BEFB 4ABFA 2CN0H 2XTTB 5K7RA 3UWIA 1DVAH 2IN2A 1H9IE 1CO7E 3QN7A 2FYRA 4A1XA 1E37B 2P59A 5F03A 3TH2H 1GJ8B 1KLTA 1HRTH 1VGCC 4Y7AA 2WPIS 2UUJB 1AWFH 1FV9A 2QXGA 3M7UA 1QIXB 3M7TA 1WQSA 1Y5BT 1K1MA 1C2HA 1LKBA 1UO6A 4U32A 2J38A 3QTVH 1ZGIA 2PWXA 3S9CA 4YESB 1VZQH 1NM6A 1P2OA 2FEQH 1DICA 2BD5A 5L6NH 5EXNA 1GBTA 1W7XH 2JH6D 3TGKE 4Y11E 3GCOA 4X2WA 1TX8A 2SFAA 4Y8XA 1FDPA 2RA3A 1TA2A 1TGNA 1MTNC 2SGEE 5C5OA 3LGWA 1C1MA 2GMTC 4BXWA 4K1SA 2PTNA 4TPIZ 3QX5H 1D6WA 5FBEA 3K9XB 4UEHH 2B8OH 1AFQB 3KHVA 2QXHA 1PQ5A 1WBGB 1OWKA 3IITA 3TNTA 1K1PA 4FUJA 1T31A 3T25A 2ZU1A 1KXCA 4JK5A 3TLOA 3NCLA 3UQOA 2XWAA 3I29A 3M7QA 2VIDA 3P92A 1O2NA 3NWUA 1BBRE 3A8CA 3TJVA 1EXFA 2ZNKH 1Y8TA 2WUBA 1BQYA 4MNWA 5J4QA 1DXWA 1CBWC 2G5NA 1GG6C 2ZG0H 1O37A 1SR5C 1L4DA 1NU9A 3GY6A 4CHAB 4E06H 1J16A 1UK2A 3NZIA 1BT7A 4UFEH 2ZDAH 4ZXYH 1P09A 1W7GH 3RM2H 1C1OA 2OLGA 1E34B 2H9TH 1IQLA 1ZTJA 4MLFB 2SGDE 3F9FA 1HGTH 4CH8B 2I6QA 1FZZA 3OY5U 1TMTH 4RKOB 2FO9A 2ZGHA 3KQDA 1Q3XA 1SGRE 4K69A 1SGYE 5T6GA 2FDAA 1GI3A 5CHAC 3V13A 1C1RA 1BJUA 1P02A 1O2HA 3OX7U 1ZSJA 1GPZA 1LVMA 3PLBA 1Z8GA 4GCHF 1V2RT 1A5IA 4X6PA 2WPLS 3SNDA 1ZHRA 2ZZUH 1C5MD 2GV7A 2O8LA 3MNCA 1E35B 3SN8A 1GBCA 1NY22 1SGQE 3BF6H 4JYVH 1IQFA 1NZQH 1HAGE 1K22H 2I6SA 2AEIH 4B71A 5FCKA 3RXPA 1C5QA 3BN9A 2A45B 1RRKA 1G3CA 1MD7A 4DGJA 2R9PA 3RXLA 1SVPA 3A7XA 1KXAA 1PPGE 1UTNA 3ZZ8A 1QA7A 2QYIA 3RXCA 4GSOA 1GI7B 4DJZB 1EP6A 1ABIH 2OD3B 3F1SB 4H6TA 1MTNB 1T8NA 1HCGA 3ZVFA 4B76A 1O3HA 3O8CA 1GMDF 4NIVA 3MWIU 1H1BA 1H9HE 1RGQA 1RTLA 3IG6B 2OUAA 4OS4A 1K1IA 2XBVA 5J4SA 5E2PA 2VVUA 1J17T 1TNKA 5IYTA 3VXEH 2ANKH 4FUIA 4AFZA 2BD7A 2LPRA 2F83A 3PMBB 4LK4A 4ISHH 4FU9A 3K65B 2P8OC 4IS5A 3LH1A 4A92A 1XUKA 1FY5A 1C5RA 3SUEA 2K1QA 2PGQB 1GG6B 4X6MA 3RXOA 3OSYA 3P17H 1UMAH 3B23B 4BTTB 4X1NU 1HAVA 2ASUB 3H7OA 3RDZA 2BZAA 3ZZ5A 1C1NA 1UTPA 2ZDMA 1CHGA 5DP4A 3SGAE 1GMCF 2Y81A 1MZDA 4WY3A 4BAKB 1DWDH 1DWEH 1C1TA 4DIIH 1ZSLA 3BEIB 3GY3A 1O2MA 3SHAH 3UTUH 1KDQB 1O3KA 1UCYE 1EAWA 5HMAA 2Q6FA 2J34A 2D1JA 2Y5FA 1Y3UA 1YBWA 3HPTB 1P8VC 2BZ6H 5A8ZA 1H8DH 3UNRA 3HGPA 1BTZA 1TOCB 2J2UA 4X1QU 2WPJS 1BDAA 1PJPA 3P8FA 5F8XA 3NKKA 2SGPE 4JCNA 4BXSA 5AVDA 2A5AA 1GGDC 1SGIB 1C2IA 4DIHH 3TH4H 3GDSA 2VJ1A 3U98H 1K1NA 1O3CA 1ZZZA 3BIVH 2QY0B 1DT2A 3E0NB 4UFGH 2NU2E 1V2KT 1C2MA 2FWWA 1CHOF 2A4RA 1O2XA 1BRBE 2Z9IA 5HXFA 1MAXA 1TGTA 3QLPH 3RXVA 6GCHF 1ZHPA 2KAIB 1P2NA 4ZROA 3PTBA 4CH2B 4ISOA 2BDAA 3VFEA 1ESAA 1ELBA 1HIAA 4GHQA 3KEEA 3AVZA 4NIYA 1RIWC 1C5PA 1CQQA 2BD3A 3SOSA 1O5GH 1GJDB 2AMQA 1EATA 2ZQ2A 4X6NA 2J92A 3BTGE 1GDUA 1O5CB 2ZHQH 3UOPA 2EEKA 1V2ST 3HGNA 5C67A 1ARCA 2P93A 2PGBB 3FP7E 4VGCC 4BAMB 8ESTE 1PFXC 1LMWB 2R2MB 5DP8A 1W3CA 3PO1C 4YOGA 4O3UA 3FAOA 2OBQA 2R2WU 2SNWA 3S69A 1SGFG 3Q77A 3MU5A 1QURH 2ODYB 1O33A 5JPMH 3M37A 1U6QA 1AFEH 1C4U2 3SQEE 3GOVB 2OINA 1HDTH 1WTGH 4WJG2 1V6DA 1TRYA 1OPHB 2GZ9A 1F92A 1RTFB 3GDUA 5B6OA 3VB4A 2AFQB 1FY4A 1L4ZA 2ANYA 1V2LT 2B9LA 2WPKS 3S9BA 1ID5H 1P2JA 1V2WT 3SU4A 1XM1A 3V0XA 4MPVA 5LPFA 1VITF 3NXPA 1ELGA 3U8TH 1O39A 1O5AB 1TQ0B 2VVVA 5I25A 4FUCA 2W3KA 3SJKA 1PQ8A 3A7VA 1D4PB 1WOFA 1C4Y2 3UR6A 3DA9B 1K1LA 1Y59T 3RMLH 2AGGX 1BHXF 4ISNA 4I8GA 5JBBS 1UHBA 4O3TA 3IWMA 2STBE 1HAVB 3T29A 3GCTG 4WWYA 1P06A 1P04A 1AUJA 4JK6A 4CRFA 2GV6A 1NRPH 4U2WA 2V35A 5K0HA 1J15A 4KP0A 3ZVBA 1GI2A 5FAHA 3D65E 1J9CH 1XUIA 2FX6A 3VB3A 2FP7B 1SQOA 4INKA 3GISB 3TITA 2PUQH 2V6NA 1QRXA 1B0FA 1BMLA 1D3QB 4MDSA 3TU7H 4B74A 3ZZ6A 2OC8A 1GCTB 3M5OA 2BHGA 4YLUA 1IQJA 3LGYA 2HVXA 1AUTC 5HYOA 3TIUA 5ETXA 1PPEE 5EXLA 1OP0A 1AD8H 2ZHDA 1XMNB 4JZDH 1NRQH 1Y3WA 3P95A 3SNAA 2RA0A 2ZPQA 3A87A 2JETB 3RXKA 3SV6A 2ZCHP 1TX7A 2A7JA 2OXSA 3U69H 1P0SH 1C5XB 2F9NA 3E6PH 1UTMA 3PO1B 5EQRA 3TK9A 1ANDA 1MTSA 4ZKNU 1AI8H 4CRGA 1SOZA 1SGNE 2GGVB 1HJAB 5FXLA 3UPEA 2H5CA 5EQSA 3QK1A 1EZQA 2XXLA 3ODFA 1WAYB 1NFWA 1KXDA 2BY6X 1XVOA 4E7RG 5DP9A 1XX9A 1P11E 3QGJA 1SBWA 3LJOA 4KGAA 3ZZ3A 4ZKOU 5C20A 1LDTT 5PTPA 1O3FA 3U8RH 3MNXA 4YOIA 4DW2U 1OWDA 3OYPA 1PPFE 4AG2A 3A89A 1MBQA 2GP9B 4U01A 4BOHA 2Y80A 3E8LA 4ZUHA 1GJ6A 2HNTF 3DFLA 1LQEA 4LOYH 5A8YA 1K2I1 3SBKA 1DANH 4ABGA 5C1XA 1A0HB 3PMJA 2ZTYA 2EI8A 3E90B 4Y6DA 2ZFFH 4DY7B 2WV4A 3EQ0H 3SI3H 2CMYA 2SGAA 2ZC9H 3D62A 1V2MT 1P05A 4YT6H 1AVGH 1TABE 4IBLH 3S7KB 4AFUA 3VGCB 1IQNA 3PTNA 1G36A 1SGCA 1V2OT 1Z7KA 6CHAB 1O3JA 1FIZA 4B73A 4MPXA 4D9QA 3RP2A 4CBOA 1G30B 3GY4A 3BG8A 2ANMH 3LGTA 1G3DA 4GCHG 1DSUA 5JBTA 1XUFA 1LKAA 1PQ7A 4CBNA 4XSKU 4CRAA 2A32A 1A2CH 1O3EA 1AY6H 1W13U 3ATIA 3KQEA 4I8KA 5IDKA 2A31A 4MNXA 4OS5A 1TGCA 1S85A 3LH3A 4MNYA 1BB0B 1S82A 1VJAU 1Z1IA 2JKHA 1FNIA 4B2AA 1ZOMA 1FUJA 1QBOA 1SLXB 2C3SA 4WVPE 3TJNA 2A4OA 3SV8A 3PROA 4JZIA 1DWBH 3RU4E 2WUCA 4A7IB 1W2KH 1QB9A 1MCTA 1RTKA 3AAVA 3MH6A 2PLXA 3RXIA 1SFQB 2THFB 1XVMA 5EGMA 2UUYA 2GZ7A 2FOHA 5HM2A 4FUEA 4A6LA 1GMDG 1LQDB 1WV7H 1QQ4A 2TBSA 3CS0A 1O3NA 1F0SA 2GDDA 1CA0C 4KELA 3ZZDA 2CXVA 2QXIA 5FPSA 1DE7H 2XC4A 2P16A 2ALVA 2FOGA 4LZ1H 1EKBB 1SLVB 2FM2A 1V2UT 5JB8S 1N1LA 5C1YA 1C2EA 2ZDLA 5CMXH 2PKAA 4KTSA 4MPWA 1FIWA 1EPTC 2ZI2H 2M5TA 4AGKA 3RXAA 3STJA 3SUFA 1CGJE 2SGQE 2YOLA 3LU9B 3ZYDA 1ANBA 1FAKH 1RD3B 3MU0A 1TNHA 5FPYA 4IC5A 2XCFA 2FOMB 2H5DA 6LPRA 1N6YA 3SU1A 4RKJB 4JZFH 2ZFQH 2HNTE 2ZEBA 4NIWA 3ZVAA 3BEUA 1VITH 1YYY1 1EASA 2B5TB 5A0BA 5E0GA 1GMCG 2XCNA 1GHVH 1K28D 3VPKA 6ESTA 3ZZ9A 5A09A 2Q1JA 1SLWB 3RLYH 3BTDE 5DP5A 3ZV8A 1LTOA 1IQIA 3GCHC 4B1TA 3TK5A 1N8OC 1ZR0A 4NGAH 1BTPA 4K5ZA 2VWNA 1P10A 2GCTC 3TK6A 1H9LB 5EG4A 2VGCB 2G51A 1C5OH 4ZKSU 3QZQA 2FLBH 1MTWA 5JB9S 4INHA 3OY6U 1A4WH 2H9HA 2VIPA 3SJ8A 1G2LA 3UNQA 1A0LA 1O2SA 1PQAA 1SI5H 4AB8A 3FP6E 1H4WA 2Y7ZA 3JZ2B 1XUGA 3F9EA 1C5WB 1ZRKA 5GIBA 1O5FH 1UTJA 2AMPA 1KXFA 1VR1H 2Y5GA 1UVTH 4YOJA 3E1XB 1O2WA 1NRSH 2FOEA 1GVLA 5CE1A 1C5ZB 4HZHA 5C5NA 3ATMA 1KDQA 1NROH 2ZECA 1O5DH 4BNRA 2CF9H 1WQVH 1FPCH 3SV2H 2BM2A 3P70B 1PYTD 1KTTB 3RXHA 1CHOG 3SU2A 3SNCA 2PUXB 6GCHG 3MYWA 2BXTH 1FAXA 4NWKA 2LNCA 1INCA 4D76A 4NZQA 3UUZA 1XKBC 1Z8IB 4A5TS 1MCVA 1YPHC 3LGIA 4X1PU 1T4VH 3FFGA 3PLKA 2FOAA 1NS3A 1O2PA 1YPLH 2ALPA 5DKMA 2O8WA 1ANEA 3ENSB 1G37A 1QL9A 4DURA 2AS9A 3RXRA 4AFSA 5DP6A 1SOTA 4Q7XA 3KF2A 1YCPM 4BAOB 4AGJA 3QTOH 2BLVA 2XRCA 2ZQ1A 2BDYA 3SJOA 3ZVGA 1KY9A 2KAIA 4NA8A 4OS2A 3EDXB 3GY8A 2ESTE 2BVXH 1TNJA 1AE5A 1YGCH 4Z6AH 1A5HA 1DPOA 4R0IA 3T28A 2NU1E 5H4IB 1O3MA 1DWCH 1SC8U 4UFFH 3DFJA 3QUMP 1SLUB 1JIMA 1O0DH 1VGCB 4Q80A 2ZHWH 4MPUA 1Z6EA 1JXPA 1XXDA 4I8HA 3ZZAA 2ZTXA 4AYVB 1GCDA 4YLQH 4Y0YE 5GPIB 3MH4A 1DSTA 1C1WH 2VIWA 3A86A 1TNLA 1TBQH 2ZDVH 1ZTLA 2EA3A 3DD2H 3K6YA 4FVDA 2AGEX 3GCHB 1N8OB 1VITG 1UTKA 1EAIA 1G3BA 1ZMLA 3R3GB 1LVYA 2F9UA 1M9UA 1EJMA 2PKAB 1QL8A 4AORA 1AKSB 3RU4D 1ZRBA 4TY6A 3MH7A 1CE5A 4FUDA 4CRCA 2ZWLH 3A82A 1TPOA 2F9OA 2XBYA 4ABIA 4IGDA 2GZ8A 4JYUH 4HFPB 3NUMA 2RCEA 3HKJB 2GMTB 1O3LA 1P3CA 2NWNA 1MBMA 1GI4A 1Q31A 1LO6A 5C2ZA 1O2VA 2BDGA 1OOKB 3PMHB 1O3BA 3RC6A 1ZJKA 1HYLA 4SGAE 2BLWA 1SG8B 1GBHA 4Y10E 3V12A 3L3TA 2ZGJA 1QR3E 2JH0D 5EPYA 4TPYA 5AFZH 2YNBA 1W0ZU 2QA9E 3EA8A 1AO5A 2C4FH 3SQHE 5C3NA 1QJ6B 1O2IA 5AHGH 1E38B 1CT4E 1ETSH 2GVFA 1G2MA 2G52A 1NRRH 1CBWB 2BD4A 1CGIE 1UVSH 4DCDA 1NO9H 1T8OA 1IQKA 1JRTA 1DLEA 1O35A 2QF0A 2B0FA 3Q3KA 1FONA 1O3DA 3LGVA 1QB6A 1F0TA 1RXPA 1ANCA 1EZXC 1Z71A 3TVJB 1WTHD 1GL0E 3Q3YA 5A0CA 3RXUA 2VWMA 1NESE 1MKXK 1KYNA 3K6ZA 1HAYB 3MI4A 5CHAB 3AASA 3AAUA 1IOEA 4CR5A 1MKXH 2B7DH 2BQWB 5JBCS 4CRDA 1XUHA 2A7HA 1HAXB 5TJXA 3ZZBA 1TNIA 4K60A 2UUFB 1F5KU 2FYQA 4BAHB 1OP2A 4GLYA 1BUIA 2Y7XA 1K9OE 3R0FA 3F6UH 2H2ZA 2W3IA 2GT7A 2ZF0H 3MO9A 1IAUA 1SB1H 1ABJH 1EUFA 2A0QB 3TPIZ 2R3UA 3D49H 1IQGA 5E2OA 2OC1A 3E16B 3MO6A 3TJOA 3M3SA 2BX4A 3URDA 5G4BA 1GVZA 1G3EA 1PPZA 1P2QA 1O5EH 3L6PA 1GHBF 1ETRH 1QA0A 3LONA 4WH8A 1YPGH 1KXBA 1B5GH 2YNAA 1AMHA 1AVXA 3U8OH 1KSNA 3RMNH 2FLRH 2TIOA 2F9PA 4HGCA 1S0QA 3T2NA 2FI4E 3RXQA 1QJ1B 1C2FA 3SJ9A 4E05H 2STAE 3ZVCA 5L30H 1YPJH 4NA9H 1ELVA 3A7TA 1XXFA 3C27B 1YLCA 1EAUA 3P6ZB 4YTAA 4INLA 2A1DB 4XDEA 3FANA 1THSH 2ZIQH 1GHWH 1TLDA 4ZHLU 3KQBA 2BY9X 3ZVEA 1TMUH 1QRZA 1XKAC 2D26C 2FX4A 1MTVA 3VB5A 2P8OB 2FZZA 4CRBA 2G4TA 4YZUA 2OC0A 3BTKE 1Q2WA 3RXMA 1LHDH 1SHHB 1GJ4H 4BTUB 2C8XB 2ZU5A 1ZLRA 2Z3CA 1O2YA 1XUJA 4X1RU 3UY9A 1GHYH 2DE8A 3BTEE 4DT7B 3TGIE 1ZJDA 1O36A 2QCYA 7LPRA 1LHCH 2A2XH 2GCHF 1KTSB 1C5TA 4ESTE 1EJNA 1NN6A 2G8TA 5EW2H 1ESBA 3LOXA 1GHZA 5JDUB 2P95A 4K8YA 4I8LA 1WUNH 1TAWA 5GCHF 2F91A 4B75A 5T6DA 3PB1E 3FZZA 1AZZA 4TWYA 4ZKRU 1K1OA 1SQTA 2SNVA 1SGDE 5DJ7A 3OTJE 1D3PB 1OYQA 1GWAA 2BOHB 4H6SB 1EOJA 1WCZA 1A5GH 4Y8ZA 2IOTA 1BMNH 2A4QA 3JZ1B 5L2ZH 4AFQA 4Z0KA 1L2EA 3RU4T 4X2VA 3U1JB 2ZU3A 5EQQA 2W26A 2XWBI 1GGDB 1QCPA 1GI8B 1OKXA 2TPIZ 3MO3A 4OGYA 4PROA 4NCYA 4DVAU 4E7NA 1L1NA 3U1IB 1JBUH 4Y0ZE 2CHAC 2VU8E 5T3HA 1S6HA 2ZHEH 1BTWA 2Y6TA 1NRNH 4BANB 1H8IH 1BRCE 2F9BH 4B2CA 2CF8H 1HLTH 4ABJA 1UTQA 1ESTA 1RIWB 3BIUH 1QL7A 2FOBA 1O2UA 4XBDA 1NC6A 5E0JA 3P8GA 1HAZB 4X8UH 2Q6DA 1DY9A 1TB6H 2QV1A 1HFDA 1FI8A 1L1GA 4Y79A 1EZSC 3UNSA 4VGCB 1O5BB 1W8BH 4X0WU 3MU8A 3SNEA 1C1SA 3EA7A 1S83A 4TY7A 3SZNA 1O2QA 1O2OA 3GDVA 1AHTH 2FMJA 4MG3A 3Q00A 1TGBA 3UIRA 2P3TB 2BVSH 4NZLA 5EU8A 4I31A 3VB6A 4AB9A 1C2KA 1MQ6A 2Z9KA 3RC4A 2HALA 4F49A 3LIWA 4FU7A 3FP8E 2TGTA 2UWOA 3MOCA 2GT8A 3M5NA 3MU4A 1X7AC 1RJXB 9ESTA 3KN2A 2P3UB 3QWCH 4X8VH 3RM0H 1EB2A 3Q76A 4AYYB 1NT1A 1TONA 3QZRA 1QFKH 3VB7A 1C2GA 1MMJN 1T4UH 4ABAA 2BOKA 3RUOA 1TRMA 1ZGVA 2BD8A 1A7SA 1BZXE 3C1KA 3S7HB 4MVNA 3PWBA 2ZFPH 1YF4A 2C8YB 1QB1A 3HK3B 3N7OA 3M61U 1LHEH 5ESBA 4I7YH 2UWLA 3O8DA 1P2KA 5DP7A 4OS1A 1MH0A 2ZPRA 1GJ7B 2QAAA 5FX5A 2GDEH 1OSSA 1ETTH 4GPGA 4NFEA 2PTCE 1EOLA 3SU6A 2CHAB 4XOJA 4CREA 4ABDA 4O03A 3G01A 1NU7B 2C8ZB 1YM0A 5I46H 3ATKA 4Q7ZA 1Y3XA 1GMHF 1OWHA 1W0YH 3SW2B 1MUEB 5SGAE 3MHWU 3BTHE 1O3AA 3DUXH 1HJ8A 1P2IA 3STIA 1VCPA 2AERH 5LPEA 2G81E 1IQHA 1QGFA 3T27A 2V3HH 1IHSH 1EPTA 1MTUA 5LH8A 1GBFA 2F3CE 1AB9C 5GXPA 1BTUA 1THPB 1O32A 1BA8B 2H9EH 4GVUA 2FODA 2O9QA 4NA7A 4D8NA 1ZHMA 1AFQC 4OS6A 1RS0A 1UTOA 1UTLM 1DXPA 1GI1A 3RXDA 4UE7H 3MMGA 3MNSA 1MKWK 1FMGA 2BY8X 1V2PT 3BTWE 1TX6A 4IMQA 2A4GA 1UK4A 1FPHH 2Z94A 1QJ7B 1MKWH 1Y3YA 4UD9H 1O3GA 1EJAA 2C90B 1NTPA 2DUCA 4X8SH 2FXRA 3QO6A 1SHYA 4UDWH 1P12E 1GBMA 4ISLA 4WMEA 1GBAA 3SU3A 1AKSA 1WSSH 5GDSH 2WPMS 2VNTA 4H42U 2ILNA 1T8MA 3TH3H 5DGJA 4D7FA 1LHFH 1F7ZA 2EC9H 2JH5D 1CT0E 2PV9B 5EPNA 2CJIA 3LDXH 2EI6A 3BTME 4RN6A 2ZFTA 4I33A 4M7GA 2HPQH 1FLEE 1GBKA 1GHXH 1J14A 8KME2 1GHAF 1HBTH 1NFXA 2BD2A 2WYJA 3RMOH 4A1VA 5AFYH 4O9VA 1EX3A 1YLDA 4ZMAH 1S81A 1KLJH 1ZPZA 2V0BA 1ZYOA 7ESTE 1LCYA 2R3YA 2Z9JA 1ZPBA 4FXGH 4AG1A 2FS9A 3LPRA 5DP3A 1GI0A 4A1TA 1TPAE 3M35A 3AW0A 5E8EH 4AOQA 5BPEA 3PMAB 3M3VA 4ZHAA 2WYGA 3VXFH 1ELDE 2VVCA 3PM3A 4D7GA 3URCA 1O38A 1O3IA 1QQUA 2BLOA 3KIDU 1Y5UT 1IHTH 2BDIA 3M5LA 1D6RA 5GWZA 2G00A 1MAYA 2FTLE 2CV3A 1QBNA 2W7SA 1V2VT 3SGBE 1GJ9B 1OWIA 4LXBH 1W14U 1AB9B 1GHBG 2V3OH 1V2QT 1TFXA 1HPGA 2VIQA 1F0RA 4BAQB 8LPRA 1LPZB 1UVUH 3I78A 1DDJA 4GHTA 4OS7A 1S5SA 1DM4B 2VH0A 2XBWA 1W12U 3SORA 4WXIA 1K1JA 1P3EA 3GICB 1CT2E 4NSVA 1BCUH 2XNIA 1A3EH 3E91A 4X1SU 2PKSC 5DK1A 4MNVA 5E0HA 1TA6A 1E0FD 3HK6B 4Y8YA 1TNGA 2QIQA 2BB4A 2ZDKA 1C2DA 1CA0B 1TBZH 2FIRH 7KMEH 2HRVA 1B0EA 1PPBH 1OP8A 2BLQA 1O2RA 4NSYA 1DUEA 3ZZ7A 2Z6BD 3RXEA 1EPTB 1BITA 2CGAA 1QTFA 1BOQA 1FQ3A 2GD4B 1FY3A 2RG3A 3BV9B 3ZVDA 1BTXA 3S9AA 4F4OC 4YT7H 1EQ9A 4UONA 3EE0B 3ATLA 1TYNA 3T5FH 2C93B 2NU0E
chains in the Genus database with same CATH superfamily
1D3TB 2WINI 4ASHA 4JZ1A 4FVBA 5FPTA 4I32A 2KCYA 1S0RA 2C8WB 1E36B 3A83A 1LVOA 3M5MA 2GCHG 3DHKH 3WY8A 1AN1E 1O3OA 2ZKSA 2WHXA 4Y7BA 1HAIH 2BTCE 4RI0A 3KNXA 3V7TA 4IW4E 1QNJA 2WPHS 2QC2A 1P01A 5GCHG 1EZUC 3U9AH 2GCTB 2ZCLP 1TGSZ 3T62A 1GBJA 4DG4A 1SGTA 3UR9A 3SV9A 3MTYA 3NK8A 5A0AE 2ZP0H 1O2LA 3KQCA 3LT3A 1T8LA 2ODPA 1EP5A 1TOMH 1YWUA 3B9FH 1FY1A 2A2QH 3PV5A 2NU3E 1AE8H 1QBVH 4X2YA 3O8RA 1MD8A 3QDZB 4AX9H 1C5LH 5LPRA 3ESTA 3ODDA 3PWCA 1AIXH 1P9SA 2ULLA 2Z3DA 5FCRA 1HXFH 1Y3VA 2Z3EA 4WXVA 3A80A 1GBIA 3TJUA 1DUAA 2PP6A 1C1QA 4HI3A 4XFQA 1SGPE 2LELA 8GCHF 1P57B 2HGTH 4ABBA 1BMMH 1DFPA 4FUGA 1CA8B 3A81A 4U30A 5GJ4B 4K8BA 1FJSA 2AIPA 7GCHF 4HTCH 2FI3E 1GDNA 3CENA 2BDHA 3LKWA 3RXJA 4D9RA 2O8MA 3UREA 4MTBA 3MFJA 1O2GH 2BD9A 2PKSB 1BBRK 1GJBB 2XYAA 5EOKA 3SI4H 3A7WA 4DOQA 3OTPA 3VEQB 1VCWA 4IN2A 4R8TB 1BBRH 2UUKB 1YCPK 2G55A 1VJ9U 5F6MA 1EB1H 2VIVA 3RLWH 4WMFA 1AWHB 3TGJE 1A3BH 1YCPH 3EA9A 2PW8H 1ZMJA 2J94A 1Z8RA 2FPZA 1CSOE 1EAXA 4BTIB 1SFIA 3MH5A 1C5UA 1K21H 1YPHE 4XE4A 1KXEA 3OU0A 3W95A 1A1RA 1BIOA 5JYIA 1ELCA 3M3TA 1A46H 4Q7YA 1GBLA 2P94A 4QT8C 3SGQE 1DS2E 1VKYA 3S0NA 3A88A 1L0ZA 1W10U 1WYKA 3W94A 4J1YA 5FBIA 4JZEH 1TMBH 1YPEH 4ZXXH 1F2SE 1C5YB 1THRH 3A7ZA 3LC3A 2BY5X 2BDBA 1WU1A 4K2YA 1S6LA 2DE9A 2OQ5A 2P3FH 4TYDA 3L33A 2A5IA 3E0PB 4IMZA 2ZTZA 2TGPZ 1OXGA 2J95A 3PV4A 1Y5AT 3ELAH 3V3MA 3SNBA 3CS7A 1NFYA 1GDQA 3RMMH 3ITIA 1OYTH 1BTYA 2QXJA 4F55A 1O2KA 1CGHA 2ZO3H 2G5VA 5FHTA 1TE0A 1MZAA 1GVKB 4ISIH 2XC0A 1GL1A 5T6FA 3K2UA 1CVWH 2BQ7B 5JBAS 1DLKB 1DY8A 5F8ZA 3N7DA 1AGJA 1BRUP 1G32B 3B8JA 1C2JA 2BVRH 2H6MA 1HUTH 1NPMA 1GCTC 1DOJA 3UWJH 2HOBA 1BRAA 3DSPA 1UJ1A 3UQVA 2AGIX 1SMFE 2Z7FE 1P9UA 4MQAA 4FUFA 1PYTC 2JETC 1GMHG 2VWLA 1S84A 5AF9H 5L2YH 2H1UA 2ZU4A 1ORFA 1ELEE 3SUDA 3ATWA 1GI6A 2R0LA 1C2LA 3DCLA 1HAOH 1IQEA 1HJAC 1ARBA 4THNH 2ZGXH 3D23A 3BTQE 1GI5A 1ACBE 3LJJA 1GJ5H 2TGDA 1JIRA 1C9TA 1G9IE 5DG6A 1HB0B 1JRSA 2XW9A 2J98A 2PR3A 1MQ5A 4AC9A 3OEED 3A8DA 5TCCA 1A0JA 1IQMA 1W11U 3GY2A 5HIYA 1BTHH 1MU8B 1UCYK 4RSPA 1O34A 3BG4C 3RXGA 1F5LA 4K1EA 5DO4H 1T7CA 2VB0A 1GBBA 3SHCH 1UCYH 2PFEA 1QHRB 4XBBA 2IJOB 2ZGBH 1AZ8A 4FUHA 4ACAA 2GTBA 1F5RA 2ZFRH 2F9VA 3SV7A 4I8JA 1S6FA 5HGGA 1UK3A 2F43B 3FVFB 5HKKD 4OGXA 4X2XA 3ZZCA 4K3JA 1GBEA 4WH6A 1MABB 3MU1A 4AN7A 1LHGH 3VGCC 4J2YB 2UWPA 1AQ7A 2ZGCA 4IC6A 3I77A 3HATH 2FS8A 3RC5A 2V7QD 6CHAC 4TWWA 3RXFA 2VH6A 2ANWA 4JMYA 1GHAG 3ZYEA 3LC5A 2PSXA 3EGKH 3TNSA 1UVOA 1TPPA 1AVWA 2J9NA 3F9GA 2OBOA 1OWJA 1PPHE 2ODQA 2ZPSA 4XBCA 4Y76A 1QY6A 1Z1JA 2AYWA 2QN5T 1YPMH 2Q6GA 1HNEE 3BSQA 4WF8A 2EI7A 2HWLB 4GUXA 1FN8A 4Q2KA 2XBXA 2XOKD 1HXEH 2GKVE 2WZQA 4K1TA 4AZ2B 1L1JA 1C5VA 1FX0B 2FI5E 1RFNA 3SU5A 1DITH 1J8AA 4ZHMU 1SSXA 1B7XB 2OCVB 2QF4A 1C1PA 1HJ9A 2AH4X 2ZFSA 1PPCE 1LVBA 1SPJA 1JMOH 2JJ2D 2NU4E 2A7CA 1C5NH 3UOUA 4NWLA 2AHME 2KR7A 4ABEA 5BRRE 5FX6A 4H4FA 1LPGB 2OP9A 3FOAA 2PHBA 3A7YA 3RXSA 2O8UA 1YPKH 4B6FA 1TALA 3W1EA 1TBRH 2W7UA 4KTUA 1HV7A 5TCAA 1KLIH 2Y82A 3AW1A 1HIAB 1E1RD 4IN1A 3KGPA 2HNTC 2FOCA 1SGFA 3KL6A 1C9PA 1JOUB 3QGNB 2OTVA 3LGUA 4NIXA 1TIOA 1OS8A 5EODA 1TWXB 2VIOA 2Y5HA 1T32A 1O30A 2BYAX 1O31A 3SJIA 2D2DA 2G4UA 3NPSA 2BY7X 3DT0H 1ZSKA 1BHXB 3A8BA 1Z8JB 3BG4B 5ABWA 1GBDA 1YKTA 3GYLB 1F0UA 2TGAA 1C4V2 2GX4A 3MNBA 5F8TA 1O3PB 3SU0A 1ELTA 1SL3A 1KIGH 1QRWA 4Y71A 2FESH 3EAJA 2BMGB 3GCNA 5EW1H 3GY5A 2A5KA 4B2BA 1DX5M 2W5EA 5HM9A 3A8AA 1ELFA 3A85A 5CDFE 3GY7A 3ZV9A 1GJCB 1Z6JH 1E79D 2AMDA 3FZDA 3SZEA 1FY8E 4NG9H 4RT0A 3HKIB 3RXTA 4YM9A 1SGEE 2BXUH 3OE7D 1MU6B 3T26A 2SGFE 3M36A 1V2JT 3OFND 1YP9A 1D9IA 4WMDA 1FXYA 2VGCC 1JWTA 4KTCA 9LPRA 2ZA5A 2VINA 3H5CB 4JYTA 2ZHFH 2FOFA 1HAHH 1TQ7B 2TRMA 1NFUA 2QGRA 2HPPH 3PYHA 4ZH8A 3SO3A 2CK3D 3GYMA 1V3XA 3SUGA 1C5SA 1OWEA 1TRNA 4YO9A 1BJVA 1O2TA 1ZMNA 1HAPH 2FTMA 1SQAA 4GAWA 3E3TA 1C1UH 1O2ZA 3P8NA 5DPAA 3Q3XA 2OC7A 1V2TT 5EXMA 5A8XA 1YC0A 5C1UA 3RXBA 2HLCA 1UHBB 4FU8A 2LP6A 1FN6A 2PSYA 1GJAB 2QF3A 4O97A 2XC5A 1V2NT 2O8TA 5A2MH 3UFAA 2R0KA 1A61H 1O2JA 3ZZ4A 1ZTKA 3EYDA 1GI9B 2Z9LA 1C1VH 4FUBA 4UFDH 1LPKB 4LZ4B 4ZAEA 2BDCA 3BTTE 3CP7A 3P8OA 2IPHA 1P03A 3F2GA 4CHAC 1D3DB 3A84A 1BMAA 8GCHG 3PLPA 4X8TH 3H7TA 1P2MA 2RDLA 2KM0A 3F68H 2KCAA 2OQUA 1UVPA 1TPSA 3KCGH 4SGBE 1VCQA 2ZDNA 7GCHG 2ZCKP 3O8BA 4F48B 3F9HA 3BTFE 4ABHA 1ZPCA 2WV5A 3GCTF 2J4IA 1ELAA 1AU8A 2BQ6B 2AIQA 4KKDA 4X6OA 4NFFA 2RDEA 5ESTE 2BX3A 2L6OA 2VWOA 2D8WA 2EY4C 4CR9A 2ZU2A 5LGOA 1N6XA 1OX1A 1CU1A 2Z9GA 3BEFB 4ABFA 2CN0H 2XTTB 5K7RA 3UWIA 1DVAH 2IN2A 1H9IE 1CO7E 3QN7A 2FYRA 4A1XA 1E37B 2P59A 5F03A 3TH2H 1GJ8B 1KLTA 1HRTH 1VGCC 3H09A 4Y7AA 3F2FA 2WPIS 2UUJB 1AWFH 1FV9A 2QXGA 3M7UA 1QIXB 3M7TA 1WQSA 1Y5BT 1K1MA 1C2HA 1LKBA 1UO6A 4U32A 2J38A 2JJ1D 3QTVH 1ZGIA 2PWXA 3S9CA 4YESB 5GNDA 1VZQH 1NM6A 1P2OA 2FEQH 1SQRA 1DICA 2BD5A 5L6NH 5EXNA 1GBTA 1W7XH 2JH6D 3TGKE 4Y11E 3GCOA 4X2WA 1TX8A 2SFAA 4Y8XA 1FDPA 2RA3A 1TA2A 1TGNA 1MTNC 2SGEE 5C5OA 3LGWA 1C1MA 2GMTC 4BXWA 4K1SA 2PTNA 4TPIZ 3QX5H 1D6WA 5FBEA 3K9XB 4UEHH 2B8OH 1AFQB 3KHVA 2QXHA 1PQ5A 1WBGB 1OWKA 3IITA 3TNTA 1K1PA 4FUJA 1T31A 3T25A 2ZU1A 1KXCA 4JK5A 3TLOA 3NCLA 3UQOA 2XWAA 3I29A 3M7QA 2VIDA 3P92A 1O2NA 3NWUA 1BBRE 3A8CA 3TJVA 1EXFA 2ZNKH 1Y8TA 2WUBA 1BQYA 4MNWA 5J4QA 1DXWA 1CBWC 2G5NA 1GG6C 2ZG0H 1O37A 1SR5C 1L4DA 1NU9A 3GY6A 4CHAB 4RT1A 4E06H 1J16A 1UK2A 3NZIA 4M9FA 1BT7A 4UFEH 2ZDAH 2EQNA 4ZXYH 1P09A 1W7GH 3RM2H 1C1OA 2OLGA 1E34B 2H9TH 1IQLA 1ZTJA 4MLFB 2SGDE 3F9FA 1HGTH 4CH8B 2I6QA 1FZZA 3OY5U 1TMTH 4RKOB 2FO9A 2ZGHA 3KQDA 1Q3XA 1SGRE 4K69A 1SGYE 5T6GA 2FDAA 1GI3A 5CHAC 3V13A 1C1RA 1BJUA 1P02A 1O2HA 3OX7U 1ZSJA 1GPZA 1LVMA 3PLBA 1Z8GA 4GCHF 1V2RT 1A5IA 4X6PA 2WPLS 3SNDA 1ZHRA 2ZZUH 1C5MD 2GV7A 2O8LA 3MNCA 1E35B 1WDIA 3SN8A 1GBCA 1NY22 1SGQE 2IPQX 3BF6H 2J97A 4JYVH 1IQFA 1NZQH 1HAGE 1K22H 2I6SA 2AEIH 4B71A 5FCKA 3RXPA 1C5QA 3BN9A 2A45B 1RRKA 1G3CA 1MD7A 4DGJA 2R9PA 3RXLA 1SVPA 3A7XA 1KXAA 1PPGE 1UTNA 3ZZ8A 1QA7A 2QYIA 3RXCA 4GSOA 1GI7B 4DJZB 1EP6A 1ABIH 2OD3B 3F1SB 4H6TA 1MTNB 2GJGA 1T8NA 1HCGA 3ZVFA 4B76A 1O3HA 3O8CA 1GMDF 4NIVA 3MWIU 1H1BA 1H9HE 1RGQA 1RTLA 3IG6B 2OUAA 1KMHB 4OS4A 1K1IA 2XBVA 5J4SA 5E2PA 2VVUA 1J17T 1TNKA 5IYTA 3VXEH 2ANKH 2KZ4A 3FN8A 4FUIA 4AFZA 2BD7A 2LPRA 2F83A 3PMBB 4LK4A 4ISHH 4FU9A 3K65B 2HVYB 2P8OC 4IS5A 2K8IA 3LH1A 4A92A 1XUKA 1FY5A 1C5RA 4OM9A 3SUEA 2K1QA 2PGQB 1GG6B 4X6MA 3RXOA 3OSYA 3P17H 1UMAH 3B23B 4BTTB 4X1NU 1HAVA 2ASUB 3H7OA 3RDZA 2BZAA 3ZZ5A 1C1NA 1UTPA 2ZDMA 1CHGA 5DP4A 3SGAE 1GMCF 2Y81A 4XRNA 1MZDA 4WY3A 4BAKB 1DWDH 1DWEH 1C1TA 4DIIH 1ZSLA 3BEIB 3GY3A 1O2MA 3SHAH 3UTUH 1KDQB 1O3KA 1UCYE 1EAWA 5HMAA 2Q6FA 2J34A 2D1JA 2Y5FA 1Y3UA 1YBWA 3HPTB 1P8VC 2BZ6H 5A8ZA 1H8DH 2V3MA 3UNRA 3HGPA 1BTZA 1TOCB 2J2UA 4X1QU 2WPJS 1BDAA 1PJPA 3U28C 3P8FA 5F8XA 3NKKA 2SGPE 4JCNA 4BXSA 5AVDA 2A5AA 1GGDC 1SGIB 1C2IA 4DIHH 3TH4H 3GDSA 2VJ1A 3U98H 1K1NA 1O3CA 1ZZZA 3BIVH 2QY0B 1DT2A 3E0NB 4UFGH 2NU2E 1V2KT 1C2MA 2FWWA 1CHOF 2A4RA 1O2XA 1BRBE 2Z9IA 5HXFA 1MAXA 1TGTA 3QLPH 3RXVA 6GCHF 1ZHPA 2KAIB 1P2NA 4ZROA 3PTBA 4CH2B 4ISOA 2BDAA 3VFEA 1ESAA 1ELBA 1HIAA 4GHQA 1YLNA 3KEEA 3AVZA 4NIYA 1RIWC 1C5PA 1CQQA 2BD3A 3SOSA 1O5GH 1GJDB 2AMQA 1EATA 2ZQ2A 4X6NA 2J92A 3BTGE 1GDUA 1O5CB 2ZHQH 5C0UA 3PV2A 3UOPA 2EEKA 1V2ST 3HGNA 5C67A 1ARCA 2P93A 2PGBB 3FP7E 4VGCC 4BAMB 8ESTE 3VG8A 5EJ1A 1PFXC 1LMWB 2R2MB 5DP8A 1W3CA 3PO1C 4YOGA 4O3UA 3FAOA 2OBQA 2R2WU 2SNWA 5EJLA 3S69A 5F53A 1SGFG 4P02A 3Q77A 3MU5A 1QURH 2ODYB 1O33A 5JPMH 3M37A 1U6QA 1AFEH 1C4U2 3SQEE 3GOVB 2OINA 2YMSD 1HDTH 1WTGH 4WJG2 1V6DA 1TRYA 1OPHB 4FOUC 2GZ9A 5KEDA 1F92A 1RTFB 3GDUA 5B6OA 3F0PA 3VB4A 2AFQB 1FY4A 1L4ZA 2ANYA 1V2LT 2B9LA 2WPKS 3S9BA 1ID5H 1P2JA 1V2WT 3SU4A 1XM1A 3V0XA 4MPVA 5LPFA 1VITF 3NXPA 1ELGA 3U8TH 1O39A 1O5AB 1TQ0B 2VVVA 5I25A 4FUCA 2W3KA 3SJKA 1PQ8A 4Q4LA 3A7VA 1D4PB 1WOFA 1C4Y2 3UR6A 3ZIAD 3DA9B 1K1LA 1Y59T 3RMLH 2AGGX 1BHXF 4ISNA 4I8GA 5JBBS 1UHBA 4O3TA 3IWMA 2STBE 1HAVB 3T29A 3GCTG 4WWYA 1P06A 1P04A 1AUJA 4JK6A 4CRFA 2GV6A 1NRPH 4U2WA 2V35A 5K0HA 1J15A 4KP0A 3ZVBA 1GI2A 5FAHA 3D65E 1J9CH 1XUIA 2FX6A 3VB3A 2FP7B 1SQOA 4INKA 3GISB 3TITA 2PUQH 2V6NA 1QRXA 1K0HA 1B0FA 1BMLA 1D3QB 4MDSA 3TU7H 4B74A 3ZZ6A 2OC8A 1GCTB 3M5OA 2BHGA 4YLUA 1IQJA 3LGYA 2HVXA 4I86A 1AUTC 5HYOA 3TIUA 5ETXA 1PPEE 5EXLA 1OP0A 1AD8H 3WWFA 2ZHDA 1XMNB 4JZDH 1NRQH 1Y3WA 3P95A 3SNAA 2RA0A 2JDID 2QE7D 2JETB 2ZPQA 3A87A 3RXKA 3SV6A 2ZCHP 1TX7A 3F2HA 2A7JA 2OXSA 3U69H 1P0SH 1C5XB 2F9NA 3E6PH 4YXWD 1UTMA 3PO1B 5EQRA 3TK9A 1ANDA 1MTSA 4ZKNU 1AI8H 4CRGA 1SOZA 1SGNE 2GGVB 1HJAB 5FXLA 3UPEA 2H5CA 5EQSA 3QK1A 1EZQA 2XXLA 3ODFA 1WAYB 1NFWA 1KXDA 2BY6X 1XVOA 4E7RG 5DP9A 1XX9A 1P11E 3QGJA 1SBWA 2QF5A 3LJOA 4KGAA 3ZZ3A 1OHHD 4ZKOU 5C20A 1LDTT 5PTPA 1O3FA 3U8RH 3MNXA 4YOIA 4DW2U 1OWDA 3OYPA 1PPFE 4AG2A 3A89A 1MBQA 2GP9B 4U01A 4BOHA 2Y80A 3E8LA 4ZUHA 1GJ6A 2HNTF 3DFLA 1LQEA 4LOYH 5A8YA 1K2I1 3SBKA 1DANH 4ABGA 5C1XA 1A0HB 3PMJA 2ZTYA 2EI8A 3E90B 4Y6DA 2ZFFH 4DY7B 2WV4A 3EQ0H 3SI3H 2CMYA 2SGAA 2ZC9H 3D62A 1V2MT 1P05A 4YT6H 3PRDA 1AVGH 1TABE 4IBLH 3S7KB 4AFUA 3VGCB 1IQNA 3PTNA 1G36A 1SGCA 1V2OT 5FL7D 1Z7KA 6CHAB 1O3JA 1FIZA 4B73A 4MPXA 4D9QA 3RP2A 4CBOA 1G30B 3GY4A 3BG8A 2ANMH 3LGTA 1G3DA 4GCHG 1DSUA 5JBTA 1XUFA 1LKAA 1PQ7A 4CBNA 4XSKU 4CRAA 2A32A 1A2CH 1O3EA 1AY6H 1W13U 3ATIA 3KQEA 4I8KA 5IDKA 2A31A 4MNXA 4OS5A 1TGCA 1S85A 3LH3A 4MNYA 1BB0B 1S82A 1VJAU 1Z1IA 2JKHA 1FNIA 4B2AA 1ZOMA 1FUJA 1QBOA 1SLXB 2C3SA 4WVPE 3TJNA 2A4OA 3SV8A 3PROA 4JZIA 1W0KD 1DWBH 3RU4E 2WUCA 4A7IB 1W2KH 1NBME 1QB9A 1MCTA 1H8ED 1RTKA 3AAVA 2PLXA 3MH6A 1SFQB 2THFB 3RXIA 1XVMA 5EGMA 2UUYA 2GZ7A 2FOHA 5HM2A 4FUEA 3FKSD 4A6LA 1GMDG 1LQDB 1WV7H 1QQ4A 2TBSA 3CS0A 1O3NA 1F0SA 2GDDA 1CA0C 4KELA 3ZZDA 2CXVA 2QXIA 5FPSA 1DE7H 2XC4A 2P16A 2ALVA 2FOGA 4LZ1H 1EKBB 1SLVB 2FM2A 1V2UT 5JB8S 1N1LA 5C1YA 1C2EA 2ZDLA 5CMXH 2PKAA 4KTSA 4MPWA 1FIWA 1EPTC 2ZI2H 2M5TA 4AGKA 3RXAA 3STJA 3SUFA 5CHBA 1CGJE 2SGQE 2YOLA 3LU9B 3ZYDA 1ANBA 1FAKH 1RD3B 3MU0A 1TNHA 5FPYA 4IC5A 2XCFA 2FOMB 2H5DA 6LPRA 1N6YA 3SU1A 4RKJB 4JZFH 2ZFQH 2HNTE 2ZEBA 4NIWA 3ZVAA 5C17A 3BEUA 1VITH 1YYY1 1EASA 2HLDD 2M2AA 2B5TB 5A0BA 5E0GA 1GMCG 2XCNA 1GHVH 1K28D 3VPKA 6ESTA 3ZZ9A 3F3BA 5A09A 2Q1JA 2KX4A 1SLWB 3RLYH 3BTDE 5DP5A 3ZV8A 1LTOA 1IQIA 3GCHC 4B1TA 3TK5A 1N8OC 1ZR0A 4NGAH 1BTPA 4K5ZA 2VWNA 1P10A 2GCTC 3TK6A 1H9LB 5EG4A 2VGCB 2G51A 1C5OH 4ZKSU 3QZQA 2WSSD 2FLBH 1MTWA 5JB9S 4INHA 3OY6U 1A4WH 2H9HA 2VIPA 3SJ8A 1G2LA 3UNQA 1A0LA 1O2SA 1PQAA 1SI5H 4AB8A 3FP6E 1H4WA 2IJD1 2Y7ZA 3JZ2B 1XUGA 4Z1MD 3F9EA 1C5WB 1ZRKA 5GIBA 1O5FH 1UTJA 2AMPA 2W6JD 1KXFA 1EFRD 1VR1H 2Y5GA 1UVTH 4YOJA 3E1XB 1O2WA 1NRSH 2FOEA 1GVLA 5CE1A 1C5ZB 4HZHA 5C5NA 3ATMA 1KDQA 1NROH 2ZECA 1O5DH 4BNRA 2CF9H 1WQVH 1FPCH 3SV2H 2BM2A 3P70B 1PYTD 4ZCNA 1KTTB 3RXHA 1CHOG 3SU2A 3SNCA 2PUXB 6GCHG 3MYWA 2BXTH 3WWBA 1FAXA 4NWKA 2LNCA 1INCA 4D76A 4NZQA 3UUZA 1XKBC 1Z8IB 4A5TS 1MCVA 1YPHC 3LGIA 4X1PU 1T4VH 3FFGA 3PLKA 2FOAA 1NS3A 1O2PA 1YPLH 3DSGA 2ALPA 5DKMA 5IK2D 2O8WA 1ANEA 3ENSB 1G37A 1QL9A 4DURA 2AS9A 3RXRA 4AFSA 5DP6A 1SOTA 4Q7XA 3KF2A 1YCPM 4BAOB 4AGJA 3QTOH 2BLVA 2XRCA 2ZQ1A 2BDYA 3SJOA 1WXRA 3ZVGA 1KY9A 2KAIA 4NA8A 4OS2A 3EDXB 3GY8A 2ESTE 2BVXH 1TNJA 1AE5A 1YGCH 3N99A 4Z6AH 1A5HA 1DPOA 4R0IA 3T28A 2NU1E 5H4IB 1O3MA 1DWCH 1SC8U 1UW7A 4UFFH 3DFJA 3QUMP 1SLUB 1JIMA 1O0DH 1VGCB 4Q80A 2ZHWH 4MPUA 1Z6EA 1JXPA 1XXDA 4I8HA 3ZZAA 2ZTXA 4AYVB 1GCDA 4YLQH 4Y0YE 5GPIB 3MH4A 1DSTA 1C1WH 2VIWA 3A86A 1TNLA 1TBQH 2ZDVH 1ZTLA 2EA3A 3DD2H 3K6YA 4FVDA 2AGEX 3GCHB 1N8OB 1VITG 1UTKA 1EAIA 1G3BA 1ZMLA 3EE7A 1LVYA 2F9UA 3R3GB 1M9UA 1EJMA 2PKAB 1QL8A 4AORA 1AKSB 3RU4D 1ZRBA 1NBMD 4TY6A 3MH7A 1CE5A 4FUDA 4CRCA 2ZWLH 3A82A 1TPOA 2F9OA 2XBYA 4ABIA 4IGDA 2GZ8A 4JYUH 4HFPB 3NUMA 2RCEA 3HKJB 2GMTB 1O3LA 1P3CA 2NWNA 1MBMA 1GI4A 1Q31A 2WV9A 1LO6A 5C2ZA 1O2VA 2BDGA 1OOKB 3PMHB 1O3BA 3RC6A 1ZJKA 1HYLA 2KCOA 4SGAE 2BLWA 1SG8B 1GBHA 4Y10E 1H8HD 3V12A 3L3TA 2ZGJA 1QR3E 2JH0D 5EPYA 4TPYA 5AFZH 2YNBA 1W0ZU 2QA9E 3EA8A 1AO5A 2C4FH 3SQHE 5C3NA 1QJ6B 1O2IA 5AHGH 1E38B 1CT4E 1ETSH 2GVFA 1G2MA 2G52A 1NRRH 1CBWB 2BD4A 1CGIE 1UVSH 4DCDA 1NO9H 1T8OA 1IQKA 1JRTA 1DLEA 1O35A 2QF0A 2B0FA 3Q3KA 1FONA 1O3DA 3LGVA 1QB6A 1F0TA 1RXPA 1ANCA 1EZXC 1Z71A 3TVJB 1WTHD 1GL0E 3Q3YA 5A0CA 3RXUA 2VWMA 1NESE 1MKXK 1KYNA 1QZ8A 3K6ZA 1HAYB 3MI4A 5CHAB 3AASA 3AAUA 1IOEA 4CR5A 2XNDD 1MKXH 2B7DH 2BQWB 5JBCS 4CRDA 1XUHA 2A7HA 4Q63A 1HAXB 2WPDD 5TJXA 3ZZBA 1TNIA 4K60A 2UUFB 1F5KU 2FYQA 4BAHB 1OP2A 4GLYA 3MQKC 1BUIA 2Y7XA 1K9OE 3R0FA 3GS9A 3F6UH 5EJZA 2H2ZA 2W3IA 2GT7A 2ZF0H 3MO9A 1IAUA 1SB1H 1ABJH 1EUFA 2A0QB 3TPIZ 2R3UA 3D49H 1IQGA 5E2OA 2OC1A 3E16B 3MO6A 3TJOA 3M3SA 2BX4A 3URDA 5G4BA 1GVZA 1G3EA 1PPZA 1P2QA 1O5EH 3L6PA 1GHBF 1ETRH 1QA0A 3LONA 4WH8A 1YPGH 1KXBA 1B5GH 2YNAA 1AMHA 1AVXA 3U8OH 1KSNA 3RMNH 2FLRH 2TIOA 2F9PA 4HGCA 1S0QA 5C0TA 4HG6A 3T2NA 2FI4E 3RXQA 1QJ1B 1C2FA 3SJ9A 4E05H 2STAE 3ZVCA 5L30H 1YPJH 4NA9H 5EIYA 1ELVA 3A7TA 5T1VA 1XXFA 3C27B 1YLCA 1EAUA 3P6ZB 3F0OA 4INLA 2A1DB 4XDEA 4YTAA 3FANA 2W6ID 1THSH 2ZIQH 4ACBA 1GHWH 1TLDA 4ZHLU 3KQBA 3NRLA 2BY9X 3ZVEA 1TMUH 1QRZA 1XKAC 2D26C 2FX4A 1MTVA 1BMFD 3VB5A 2P8OB 2FZZA 4CRBA 2G4TA 4YZUA 2OC0A 3BTKE 1Q2WA 3RXMA 1LHDH 1SHHB 1GJ4H 4BTUB 2C8XB 2ZU5A 1ZLRA 2Z3CA 1O2YA 1XUJA 4X1RU 3UY9A 1GHYH 2DE8A 3BTEE 4DT7B 3TGIE 1ZJDA 1O36A 2OK5A 2QCYA 7LPRA 1LHCH 2A2XH 2GCHF 1KTSB 1C5TA 4ESTE 1EJNA 1NN6A 2G8TA 5DSFA 5EW2H 1ESBA 3LOXA 1GHZA 5HIZA 5JDUB 2P95A 4K8YA 4I8LA 3DSOA 1WUNH 1TAWA 5GCHF 2F91A 4B75A 4TT3D 5T6DA 3PB1E 3FZZA 1AZZA 4TWYA 4ZKRU 1K1OA 5KGOA 1SQTA 2SNVA 1SGDE 5DJ7A 3OTJE 1D3PB 1OYQA 1GWAA 2BOHB 4H6SB 1EOJA 1WCZA 1A5GH 4Y8ZA 2IOTA 1BMNH 2A4QA 3JZ1B 5L2ZH 4AFQA 4Z0KA 1L2EA 3RU4T 4X2VA 1SKYE 3U1JB 2ZU3A 5EQQA 2W26A 2XWBI 3AK5A 1GGDB 1QCPA 1GI8B 3KQ5A 1OKXA 2TPIZ 3MO3A 4OGYA 4PROA 4NCYA 4DVAU 4E7NA 1L1NA 4P00A 3U1IB 1JBUH 4Y0ZE 2CHAC 2VU8E 5T3HA 2RFKC 1S6HA 2ZHEH 1BTWA 2Y6TA 1NRNH 4BANB 1H8IH 1BRCE 2F9BH 4B2CA 2CF8H 1HLTH 4ABJA 1UTQA 1ESTA 1RIWB 3BIUH 1QL7A 3UB0A 2FOBA 1O2UA 4XBDA 1NC6A 5E0JA 3P8GA 1HAZB 4X8UH 2Q6DA 1DY9A 1TB6H 2QV1A 1HFDA 1FI8A 1L1GA 4Y79A 1EZSC 3UNSA 4ASUD 4VGCB 1O5BB 1W8BH 4X0WU 3MU8A 3SNEA 1C1SA 3EA7A 1S83A 4TY7A 3SZNA 5KECA 1O2QA 1O2OA 3GDVA 1AHTH 2FMJA 4MG3A 3Q00A 1TGBA 3UIRA 2P3TB 2BVSH 3UAIC 4NZLA 5EU8A 3OEHD 4I31A 3VB6A 4AB9A 1C2KA 1MQ6A 1E1QD 5DN6D 2K0QA 2Z9KA 2JIZD 3RC4A 4B6EA 2HALA 4F49A 3LIWA 4XD7D 4FU7A 3FP8E 2TGTA 2UWOA 3MOCA 2GT8A 3M5NA 3WW7A 3MU4A 1X7AC 1RJXB 9ESTA 3KN2A 2P3UB 3QWCH 4X8VH 3RM0H 1EB2A 3Q76A 4AYYB 1NT1A 1TONA 3QZRA 1COWD 1QFKH 3VB7A 1C2GA 1MMJN 1T4UH 4ABAA 2BOKA 3RUOA 1TRMA 1ZGVA 2BD8A 1A7SA 1BZXE 3C1KA 3S7HB 4MVNA 3PWBA 2ZFPH 1YF4A 2C8YB 1QB1A 3HK3B 3N7OA 3M61U 1LHEH 5ESBA 4I7YH 2UWLA 3O8DA 1P2KA 5DP7A 4OS1A 5C94A 1MH0A 2ZPRA 1GJ7B 2QAAA 5FX5A 2GDEH 1OSSA 1ETTH 4GPGA 4NFEA 1YY3A 2PTCE 1EOLA 3SU6A 2CHAB 4XOJA 4CREA 4ABDA 4O03A 3G01A 1NU7B 2C8ZB 1YM0A 5I46H 3ATKA 4Q7ZA 1Y3XA 1GMHF 1OWHA 1W0YH 2J98B 3SW2B 1MUEB 5SGAE 3MHWU 3BTHE 1O3AA 3DUXH 1HJ8A 1P2IA 3STIA 1VCPA 2AERH 5LPEA 2G81E 1IQHA 1QGFA 3T27A 2V3HH 1IHSH 1EPTA 1MTUA 5LH8A 1GBFA 2F3CE 1AB9C 5GXPA 3CNRA 1BTUA 2VBCA 1THPB 1O32A 1BA8B 2H9EH 4GVUA 2FODA 2KCPA 2O9QA 4NA7A 4D8NA 4FETA 1ZHMA 1AFQC 4OS6A 1RS0A 1UTOA 1UTLM 1DXPA 1GI1A 3RXDA 4UE7H 3MMGA 3MNSA 1MKWK 1FMGA 2BY8X 1V2PT 3BTWE 5B6LA 1TX6A 4IMQA 2J5UA 2A4GA 1UK4A 1FPHH 2Z94A 1QJ7B 1MKWH 1Y3YA 4UD9H 1O3GA 1EJAA 2F4LA 2C90B 1NTPA 2DUCA 3PRBA 2FXRA 4X8SH 3QO6A 1SHYA 4UDWH 1P12E 1GBMA 4ISLA 4WMEA 1GBAA 3SU3A 1AKSA 2YMSC 1WSSH 5GDSH 2WPMS 2VNTA 4H42U 2ILNA 1T8MA 3TH3H 5DGJA 4D7FA 1LHFH 1F7ZA 2EC9H 2JH5D 1CT0E 2PV9B 5EPNA 2CJIA 3LDXH 2EI6A 3BTME 4RN6A 2ZFTA 4I33A 4M7GA 2HPQH 1FLEE 3N7EA 1GBKA 1GHXH 1J14A 8KME2 1GHAF 3KYFA 1HBTH 1NFXA 2BD2A 2WYJA 3RMOH 4A1VA 3OAAD 5AFYH 4O9VA 1EX3A 1YLDA 4ZMAH 1S81A 1KLJH 1ZPZA 2V0BA 1ZYOA 7ESTE 1LCYA 2R3YA 2Z9JA 1ZPBA 4FXGH 4AG1A 2FS9A 3LPRA 5DP3A 1GI0A 4A1TA 1TPAE 3M35A 3KYGA 3AW0A 5E8EH 4AOQA 5BPEA 3PMAB 3M3VA 4ZHAA 2WYGA 3VXFH 1ELDE 4DT4A 2VVCA 3PM3A 4D7GA 3URCA 1O38A 1O3IA 1QQUA 2BLOA 3KIDU 1Y5UT 1IHTH 2BDIA 3M5LA 1D6RA 5GWZA 2G00A 1MAYA 2FTLE 2CV3A 1QBNA 2W7SA 1V2VT 3SGBE 1GJ9B 1OWIA 4LXBH 1W14U 1AB9B 1GHBG 2V3OH 1V2QT 1TFXA 1HPGA 2L74A 2VIQA 1F0RA 3SYJA 4BAQB 8LPRA 1LPZB 1UVUH 3I78A 1DDJA 4GHTA 4OS7A 1S5SA 1DM4B 2VH0A 2XBWA 1W12U 3SORA 4WXIA 1K1JA 1P3EA 3GICB 1CT2E 4NSVA 1BCUH 2XNIA 1A3EH 3E91A 4X1SU 2PKSC 1W0JD 4MNVA 5DK1A 5E0HA 1TA6A 1E0FD 3HK6B 4Y8YA 1TNGA 2QIQA 2BB4A 2ZDKA 1C2DA 1CA0B 1TBZH 2FIRH 7KMEH 4TSFD 2HRVA 1B0EA 1PPBH 1OP8A 2BLQA 1O2RA 4NSYA 3FO8D 1DUEA 3ZZ7A 2Z6BD 3RXEA 1EPTB 2YMSB 1BITA 2CGAA 1QTFA 2KFWA 1BOQA 1FQ3A 2GD4B 1FY3A 2RG3A 3BV9B 3ZVDA 1BTXA 3S9AA 4F4OC 4YT7H 1EQ9A 4UONA 3EE0B 3ATLA 1TYNA 3T5FH 2C93B 2NU0E
chains in the Genus database with same CATH topology
1D3TB 2WINI 4ASHA 4JZ1A 4FVBA 5FPTA 4I32A 1S0RA 2C8WB 1E36B 3A83A 1LVOA 3M5MA 2GCHG 3DHKH 3WY8A 1AN1E 1O3OA 2ZKSA 4Y7BA 1HAIH 2BTCE 3KNXA 3V7TA 4IW4E 1QNJA 2WPHS 2QC2A 1P01A 5GCHG 1EZUC 3U9AH 2GCTB 2ZCLP 1TGSZ 3T62A 1GBJA 4DG4A 1SGTA 3UR9A 3SV9A 3MTYA 3NK8A 5A0AE 2ZP0H 1O2LA 3KQCA 3LT3A 1T8LA 2ODPA 1EP5A 1TOMH 3B9FH 1FY1A 2A2QH 2NU3E 1AE8H 1QBVH 4X2YA 3O8RA 1MD8A 3QDZB 4AX9H 1C5LH 5LPRA 3ESTA 3ODDA 3PWCA 1AIXH 1P9SA 2ULLA 2Z3DA 5FCRA 1HXFH 1Y3VA 2Z3EA 4WXVA 3A80A 1GBIA 3TJUA 1DUAA 1C1QA 4HI3A 4XFQA 1SGPE 8GCHF 1P57B 2HGTH 4ABBA 1BMMH 1DFPA 4FUGA 1CA8B 3A81A 4U30A 5GJ4B 4K8BA 1FJSA 2AIPA 7GCHF 4HTCH 2FI3E 1GDNA 3CENA 2BDHA 3LKWA 3RXJA 4D9RA 2O8MA 3UREA 4MTBA 3MFJA 1O2GH 2BD9A 2PKSB 1BBRK 1GJBB 2XYAA 5EOKA 3SI4H 3A7WA 4DOQA 3VEQB 1VCWA 4IN2A 4R8TB 1BBRH 2UUKB 1YCPK 2G55A 1VJ9U 5F6MA 1EB1H 2VIVA 3RLWH 4WMFA 1AWHB 3TGJE 1A3BH 1YCPH 3EA9A 2PW8H 1ZMJA 2J94A 1Z8RA 2FPZA 1CSOE 1EAXA 4BTIB 1SFIA 3MH5A 1C5UA 1K21H 1YPHE 4XE4A 1KXEA 3OU0A 3W95A 1A1RA 1BIOA 5JYIA 1ELCA 3M3TA 1A46H 4Q7YA 1GBLA 2P94A 4QT8C 3SGQE 1DS2E 3S0NA 3A88A 1L0ZA 1W10U 1WYKA 3W94A 4J1YA 5FBIA 4JZEH 1TMBH 1YPEH 4ZXXH 1F2SE 1C5YB 1THRH 3A7ZA 3LC3A 2BY5X 2BDBA 1WU1A 4K2YA 2DE9A 2OQ5A 2P3FH 4TYDA 3L33A 2A5IA 3E0PB 4IMZA 2ZTZA 2TGPZ 1OXGA 2J95A 3PV4A 1Y5AT 3ELAH 3V3MA 3SNBA 3CS7A 1NFYA 1GDQA 3RMMH 3ITIA 1OYTH 1BTYA 2QXJA 1O2KA 1CGHA 2ZO3H 2G5VA 5FHTA 1TE0A 1MZAA 1GVKB 4ISIH 2XC0A 1GL1A 5T6FA 3K2UA 1CVWH 2BQ7B 5JBAS 1DLKB 1DY8A 5F8ZA 1AGJA 1BRUP 1G32B 3B8JA 1C2JA 2BVRH 2H6MA 1HUTH 1NPMA 1GCTC 1DOJA 3UWJH 2HOBA 1BRAA 1UJ1A 3UQVA 2AGIX 1SMFE 2Z7FE 1P9UA 4MQAA 4FUFA 1PYTC 2JETC 1GMHG 2VWLA 1S84A 5AF9H 5L2YH 2H1UA 2ZU4A 1ORFA 1ELEE 3SUDA 3ATWA 1GI6A 2R0LA 1C2LA 1HAOH 1IQEA 1HJAC 1ARBA 4THNH 2ZGXH 3D23A 3BTQE 1GI5A 1ACBE 3LJJA 1GJ5H 2TGDA 1JIRA 1C9TA 1G9IE 5DG6A 1HB0B 1JRSA 2XW9A 2PR3A 1MQ5A 3A8DA 5TCCA 1A0JA 1IQMA 1W11U 3GY2A 1BTHH 1MU8B 1UCYK 4RSPA 1O34A 3BG4C 3RXGA 1F5LA 4K1EA 5DO4H 1T7CA 2VB0A 1GBBA 3SHCH 1UCYH 2PFEA 1QHRB 4XBBA 2IJOB 2ZGBH 1AZ8A 4FUHA 2GTBA 1F5RA 2ZFRH 2F9VA 3SV7A 4I8JA 1S6FA 5HGGA 1UK3A 3FVFB 4OGXA 4X2XA 3ZZCA 4K3JA 1GBEA 4WH6A 3MU1A 4AN7A 1LHGH 3VGCC 4J2YB 2UWPA 1AQ7A 2ZGCA 4IC6A 3I77A 3HATH 2FS8A 3RC5A 6CHAC 4TWWA 3RXFA 2VH6A 2ANWA 4JMYA 1GHAG 3ZYEA 3LC5A 2PSXA 3EGKH 3TNSA 1UVOA 1TPPA 1AVWA 2J9NA 3F9GA 2OBOA 1OWJA 1PPHE 2ODQA 2ZPSA 4XBCA 4Y76A 1QY6A 1Z1JA 2AYWA 2QN5T 1YPMH 2Q6GA 1HNEE 3BSQA 4WF8A 2EI7A 2HWLB 4GUXA 1FN8A 4Q2KA 2XBXA 1HXEH 2GKVE 4K1TA 4AZ2B 1L1JA 1C5VA 2FI5E 1RFNA 3SU5A 1DITH 1J8AA 4ZHMU 1SSXA 1B7XB 2OCVB 1C1PA 1HJ9A 2AH4X 2ZFSA 1PPCE 1LVBA 1SPJA 1JMOH 2NU4E 2A7CA 1C5NH 3UOUA 4NWLA 4ABEA 5BRRE 5FX6A 4H4FA 1LPGB 2OP9A 2PHBA 3A7YA 3RXSA 2O8UA 1YPKH 1TALA 1TBRH 2W7UA 4KTUA 1HV7A 5TCAA 1KLIH 2Y82A 3AW1A 1HIAB 4IN1A 3KGPA 2HNTC 2FOCA 1SGFA 3KL6A 1C9PA 1JOUB 3QGNB 2OTVA 3LGUA 4NIXA 1TIOA 1OS8A 5EODA 1TWXB 2VIOA 2Y5HA 1T32A 1O30A 2BYAX 1O31A 3SJIA 2D2DA 2G4UA 3NPSA 2BY7X 3DT0H 1ZSKA 1BHXB 3A8BA 1Z8JB 3BG4B 5ABWA 1GBDA 1YKTA 3GYLB 1F0UA 2TGAA 1C4V2 2GX4A 3MNBA 5F8TA 1O3PB 3SU0A 1ELTA 1SL3A 1KIGH 1QRWA 4Y71A 2FESH 3EAJA 2BMGB 3GCNA 5EW1H 3GY5A 2A5KA 4B2BA 1DX5M 2W5EA 5HM9A 3A8AA 1ELFA 3A85A 3GY7A 3ZV9A 1GJCB 1Z6JH 2AMDA 3FZDA 1FY8E 4NG9H 3HKIB 3RXTA 4YM9A 1SGEE 2BXUH 1MU6B 3T26A 2SGFE 3M36A 1V2JT 1YP9A 1D9IA 4WMDA 1FXYA 2VGCC 1JWTA 4KTCA 9LPRA 2ZA5A 2VINA 3H5CB 4JYTA 2ZHFH 2FOFA 1HAHH 1TQ7B 2TRMA 1NFUA 2QGRA 2HPPH 3PYHA 4ZH8A 3SO3A 3GYMA 1V3XA 3SUGA 1C5SA 1OWEA 1TRNA 4YO9A 1BJVA 1O2TA 1ZMNA 1HAPH 2FTMA 1SQAA 4GAWA 3E3TA 1C1UH 1O2ZA 3P8NA 5DPAA 3Q3XA 2OC7A 1V2TT 5EXMA 5A8XA 1YC0A 5C1UA 3RXBA 2HLCA 1UHBB 4FU8A 1FN6A 2PSYA 1GJAB 2QF3A 4O97A 2XC5A 1V2NT 2O8TA 5A2MH 3UFAA 2R0KA 1A61H 1O2JA 3ZZ4A 1ZTKA 3EYDA 1GI9B 2Z9LA 1C1VH 4FUBA 4UFDH 1LPKB 4LZ4B 4ZAEA 2BDCA 3BTTE 3CP7A 3P8OA 2IPHA 1P03A 4CHAC 1D3DB 3A84A 1BMAA 8GCHG 3PLPA 4X8TH 3H7TA 1P2MA 2RDLA 3F68H 2OQUA 1UVPA 1TPSA 3KCGH 4SGBE 1VCQA 2ZDNA 7GCHG 2ZCKP 3O8BA 3F9HA 3BTFE 4ABHA 1ZPCA 2WV5A 3GCTF 2J4IA 1ELAA 1AU8A 2BQ6B 2AIQA 4KKDA 4X6OA 4NFFA 5ESTE 2BX3A 2VWOA 2D8WA 4CR9A 2ZU2A 5LGOA 1N6XA 1OX1A 1CU1A 2Z9GA 3BEFB 4ABFA 2CN0H 2XTTB 5K7RA 3UWIA 1DVAH 2IN2A 1H9IE 1CO7E 3QN7A 2FYRA 4A1XA 1E37B 2P59A 5F03A 3TH2H 1GJ8B 1KLTA 1HRTH 1VGCC 4Y7AA 2WPIS 2UUJB 1AWFH 1FV9A 2QXGA 3M7UA 1QIXB 3M7TA 1WQSA 1Y5BT 1K1MA 1C2HA 1LKBA 1UO6A 4U32A 2J38A 3QTVH 1ZGIA 2PWXA 3S9CA 4YESB 1VZQH 1NM6A 1P2OA 2FEQH 1DICA 2BD5A 5L6NH 5EXNA 1GBTA 1W7XH 2JH6D 3TGKE 4Y11E 3GCOA 4X2WA 1TX8A 2SFAA 4Y8XA 1FDPA 2RA3A 1TA2A 1TGNA 1MTNC 2SGEE 5C5OA 3LGWA 1C1MA 2GMTC 4BXWA 4K1SA 2PTNA 4TPIZ 3QX5H 1D6WA 5FBEA 3K9XB 4UEHH 2B8OH 1AFQB 3KHVA 2QXHA 1PQ5A 1WBGB 1OWKA 3IITA 3TNTA 1K1PA 4FUJA 1T31A 3T25A 2ZU1A 1KXCA 4JK5A 3TLOA 3NCLA 3UQOA 2XWAA 3I29A 3M7QA 2VIDA 3P92A 1O2NA 3NWUA 1BBRE 3A8CA 3TJVA 1EXFA 2ZNKH 1Y8TA 2WUBA 1BQYA 4MNWA 5J4QA 1DXWA 1CBWC 2G5NA 1GG6C 2ZG0H 1O37A 1SR5C 1L4DA 1NU9A 3GY6A 4CHAB 4E06H 1J16A 1UK2A 3NZIA 1BT7A 4UFEH 2ZDAH 4ZXYH 1P09A 1W7GH 3RM2H 1C1OA 2OLGA 1E34B 2H9TH 1IQLA 1ZTJA 4MLFB 2SGDE 3F9FA 1HGTH 4CH8B 2I6QA 1FZZA 3OY5U 1TMTH 4RKOB 2FO9A 2ZGHA 3KQDA 1Q3XA 1SGRE 4K69A 1SGYE 5T6GA 2FDAA 1GI3A 5CHAC 3V13A 1C1RA 1BJUA 1P02A 1O2HA 3OX7U 1ZSJA 1GPZA 1LVMA 3PLBA 1Z8GA 4GCHF 1V2RT 1A5IA 4X6PA 2WPLS 3SNDA 1ZHRA 2ZZUH 1C5MD 2GV7A 2O8LA 3MNCA 1E35B 3SN8A 1GBCA 1NY22 1SGQE 3BF6H 4JYVH 1IQFA 1NZQH 1HAGE 1K22H 2I6SA 2AEIH 4B71A 5FCKA 3RXPA 1C5QA 3BN9A 2A45B 1RRKA 1G3CA 1MD7A 4DGJA 2R9PA 3RXLA 1SVPA 3A7XA 1KXAA 1PPGE 1UTNA 3ZZ8A 1QA7A 2QYIA 3RXCA 4GSOA 1GI7B 4DJZB 1EP6A 1ABIH 2OD3B 3F1SB 4H6TA 1MTNB 1T8NA 1HCGA 3ZVFA 4B76A 1O3HA 3O8CA 1GMDF 4NIVA 3MWIU 1H1BA 1H9HE 1RGQA 1RTLA 3IG6B 2OUAA 4OS4A 1K1IA 2XBVA 5J4SA 5E2PA 2VVUA 1J17T 1TNKA 5IYTA 3VXEH 2ANKH 4FUIA 4AFZA 2BD7A 2LPRA 2F83A 3PMBB 4LK4A 4ISHH 4FU9A 3K65B 2P8OC 4IS5A 3LH1A 4A92A 1XUKA 1FY5A 1C5RA 3SUEA 2K1QA 2PGQB 1GG6B 4X6MA 3RXOA 3OSYA 3P17H 1UMAH 3B23B 4BTTB 4X1NU 1HAVA 2ASUB 3H7OA 3RDZA 2BZAA 3ZZ5A 1C1NA 1UTPA 2ZDMA 1CHGA 5DP4A 3SGAE 1GMCF 2Y81A 1MZDA 4WY3A 4BAKB 1DWDH 1DWEH 1C1TA 4DIIH 1ZSLA 3BEIB 3GY3A 1O2MA 3SHAH 3UTUH 1KDQB 1O3KA 1UCYE 1EAWA 5HMAA 2Q6FA 2J34A 2D1JA 2Y5FA 1Y3UA 1YBWA 3HPTB 1P8VC 2BZ6H 5A8ZA 1H8DH 3UNRA 3HGPA 1BTZA 1TOCB 2J2UA 4X1QU 2WPJS 1BDAA 1PJPA 3P8FA 5F8XA 3NKKA 2SGPE 4JCNA 4BXSA 5AVDA 2A5AA 1GGDC 1SGIB 1C2IA 4DIHH 3TH4H 3GDSA 2VJ1A 3U98H 1K1NA 1O3CA 1ZZZA 3BIVH 2QY0B 1DT2A 3E0NB 4UFGH 2NU2E 1V2KT 1C2MA 2FWWA 1CHOF 2A4RA 1O2XA 1BRBE 2Z9IA 5HXFA 1MAXA 1TGTA 3QLPH 3RXVA 6GCHF 1ZHPA 2KAIB 1P2NA 4ZROA 3PTBA 4CH2B 4ISOA 2BDAA 3VFEA 1ESAA 1ELBA 1HIAA 4GHQA 3KEEA 3AVZA 4NIYA 1RIWC 1C5PA 1CQQA 2BD3A 3SOSA 1O5GH 1GJDB 2AMQA 1EATA 2ZQ2A 4X6NA 2J92A 3BTGE 1GDUA 1O5CB 2ZHQH 3UOPA 2EEKA 1V2ST 3HGNA 5C67A 1ARCA 2P93A 2PGBB 3FP7E 4VGCC 4BAMB 8ESTE 1PFXC 1LMWB 2R2MB 5DP8A 1W3CA 3PO1C 4YOGA 4O3UA 3FAOA 2OBQA 2R2WU 2SNWA 3S69A 1SGFG 3Q77A 3MU5A 1QURH 2ODYB 1O33A 5JPMH 3M37A 1U6QA 1AFEH 1C4U2 3SQEE 3GOVB 2OINA 1HDTH 1WTGH 4WJG2 1V6DA 1TRYA 1OPHB 2GZ9A 1F92A 1RTFB 3GDUA 5B6OA 3VB4A 2AFQB 1FY4A 1L4ZA 2ANYA 1V2LT 2B9LA 2WPKS 3S9BA 1ID5H 1P2JA 1V2WT 3SU4A 1XM1A 3V0XA 4MPVA 5LPFA 1VITF 3NXPA 1ELGA 3U8TH 1O39A 1O5AB 1TQ0B 2VVVA 5I25A 4FUCA 2W3KA 3SJKA 1PQ8A 3A7VA 1D4PB 1WOFA 1C4Y2 3UR6A 3DA9B 1K1LA 1Y59T 3RMLH 2AGGX 1BHXF 4ISNA 4I8GA 5JBBS 1UHBA 4O3TA 3IWMA 2STBE 1HAVB 3T29A 3GCTG 4WWYA 1P06A 1P04A 1AUJA 4JK6A 4CRFA 2GV6A 1NRPH 4U2WA 2V35A 5K0HA 1J15A 4KP0A 3ZVBA 1GI2A 5FAHA 3D65E 1J9CH 1XUIA 2FX6A 3VB3A 2FP7B 1SQOA 4INKA 3GISB 3TITA 2PUQH 2V6NA 1QRXA 1B0FA 1BMLA 1D3QB 4MDSA 3TU7H 4B74A 3ZZ6A 2OC8A 1GCTB 3M5OA 2BHGA 4YLUA 1IQJA 3LGYA 2HVXA 1AUTC 5HYOA 3TIUA 5ETXA 1PPEE 5EXLA 1OP0A 1AD8H 2ZHDA 1XMNB 4JZDH 1NRQH 1Y3WA 3P95A 3SNAA 2RA0A 2ZPQA 3A87A 2JETB 3RXKA 3SV6A 2ZCHP 1TX7A 2A7JA 2OXSA 3U69H 1P0SH 1C5XB 2F9NA 3E6PH 1UTMA 3PO1B 5EQRA 3TK9A 1ANDA 1MTSA 4ZKNU 1AI8H 4CRGA 1SOZA 1SGNE 2GGVB 1HJAB 5FXLA 3UPEA 2H5C