1C5QA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5qA02
2BD9A 2Q6GA 3C1KA 1P11E 1BTUA 5DP7A 1P8VC 3T28A 1P06A 1EX3A 1GG6C 7KMEH 4MPUA 2ASUB 1CT0E 1HAZB 3LGTA 1QRWA 1C5OH 5C1YA 1MKWK 5F8TA 5DKMA 1O38A 2PGQB 1PPEE 1OP8A 4FUIA 1JIMA 1TAWA 4BTUB 1DY9A 1S84A 2OQ5A 4GCHF 5I25A 1XX9A 5A8XA 4UDWH 1OOKB 2BDBA 2OTVA 3UOUA 4YLQH 1K1MA 1UHBA 3QGJA 1XKBC 3NCLA 3RXJA 1PYTC 9ESTA 3U8RH 1GBJA 3CS7A 3GDVA 2H2ZA 2Z3EA 4JK5A 3UR9A 1Q31A 1TNHA 1C4V2 3PTNA 4SGBE 5DK1A 3GDUA 2VGCB 3SNAA 5FXLA 2SGFE 1GJCB 4AB9A 1AFQB 4IGDA 1VGCC 4CRCA 7LPRA 1UTJA 3E0PB 1QQUA 1MKXH 1ZPCA 3F68H 3PMJA 3T26A 2FM2A 4XOJA 1RTLA 1O3EA 4I31A 2PWXA 1KXFA 1DX5M 3T5FH 2BD2A 1DS2E 1TQ0B 5ABWA 1P2JA 1GJAB 4NWKA 2G00A 2B7DH 3SV8A 5EODA 5EOKA 2A4OA 3V7TA 1Y59T 4WH6A 3SU6A 3SO3A 1BTPA 3BEIB 5A2MH 1VJ9U 1ZTJA 1TPSA 2B9LA 2BZ6H 3SN8A 3MFJA 1FDPA 2SGDE 2Z6BD 1OYQA 2AYWA 1DT2A 1A1RA 3SUEA 1LCYA 1S85A 3BTGE 4X1PU 1ELBA 2PR3A 3SJKA 5J4SA 2W7SA 2ZU4A 3SHCH 1ETTH 4X2XA 4ZH8A 5C1UA 2SGPE 4TPYA 1HJ9A 4MPVA 3RMMH 1TGCA 4J2YB 5T6DA 2BY6X 2VVVA 1K1OA 1MTNB 4JMYA 1N1LA 2PSYA 4FUJA 1B7XB 4BAOB 1NU9A 1GJ7B 4BNRA 1NFWA 3ODFA 5EPNA 3ZVAA 2P8OB 1AB9B 1C5PA 1XUJA 3MOCA 3Q76A 1C1RA 2B8OH 3I77A 1C1MA 2GTBA 2F9BH 4HFPB 4UFDH 5ESTE 3STIA 1QB9A 3PYHA 1XUHA 2FYRA 2ZFPH 3SU2A 2ZU3A 3K6ZA 3PTBA 2BQ6B 2A2QH 3EA8A 2AGIX 2O8UA 2QV1A 4CRBA 1TBQH 2ZI2H 1XVMA 4XDEA 3FZZA 3KQCA 1O3KA 1BRUP 3A86A 1CGHA 3IG6B 4O03A 3SU5A 1GDUA 1V2UT 2A7JA 7GCHG 4I7YH 3S69A 4ISIH 1EQ9A 1SLVB 1HAGE 2J38A 2FMJA 1TPAE 2PKAB 1QGFA 4ZKSU 1SGNE 2JH6D 1O37A 1Z8RA 2ZFRH 1ZMLA 8ESTE 2PW8H 4NA9H 4CRDA 4INHA 1O2GH 5EGMA 1GI2A 3M36A 5C3NA 4KGAA 1AKSA 3HATH 1KXBA 1UVSH 3AVZA 1VITH 1WCZA 5T6GA 1XM1A 1SHHB 1K1PA 1EAWA 3Q77A 1GBEA 2OBQA 1OWIA 1DANH 1RIWC 4X2WA 3T62A 6GCHF 3ZZCA 3MO9A 1C5SA 1KLJH 2A5KA 3OSYA 4LOYH 2ZZUH 1GHAG 1YBWA 1SOTA 1W8BH 3FANA 4DW2U 4GUXA 3VB6A 2G81E 3MH4A 2F9OA 4X6OA 1RS0A 1VGCB 2J92A 2JETC 5HYOA 4E06H 2G55A 1TNKA 2P59A 2BTCE 1F5LA 2SFAA 4FU9A 4I33A 3UTUH 2ESTE 3BTTE 1A7SA 1CGIE 3RMLH 4ZXXH 3NUMA 1X7AC 3A89A 1J8AA 1THRH 1HJAC 4NIXA 1ESBA 4JCNA 1O33A 8GCHF 3SZNA 1GPZA 1KXEA 1T7CA 1TWXB 1FMGA 1QR3E 3RXEA 1FNIA 1O0DH 2BYAX 4JZIA 1V2TT 4ABHA 1GI6A 4O97A 1MQ5A 2P16A 3VB5A 1TOCB 4AG1A 1BB0B 3LGWA 4YZUA 2CMYA 4AB8A 1ELCA 1Y5UT 4LZ1H 1HAOH 3BTKE 4Y10E 3C27B 3HKJB 1QY6A 1SGTA 2BLVA 1HYLA 2F9PA 2V35A 4Q7ZA 2H9EH 1EPTA 3ZYDA 4U01A 4ZKRU 1HAYB 3PWBA 5C5OA 1EZSC 1TMTH 3FP6E 3V3MA 2AMQA 2D2DA 3LJOA 2BB4A 3MNCA 1D3TB 3UQVA 3D49H 3W94A 3QTVH 1BT7A 3SV6A 5EXNA 3HGNA 1SGYE 4D7FA 2C8XB 3SOSA 1GBCA 4RKOB 3EYDA 3BTEE 1GMHF 1Y5AT 3OY5U 3QZRA 4NFFA 4WXVA 1SLUB 1LPZB 3RXMA 1UTNA 4I8LA 1EP6A 1ZPZA 2QF0A 1PPBH 3M7TA 2PKSC 1Y3WA 4FVBA 3SGQE 3KIDU 1E0FD 2BDAA 4DCDA 6CHAB 4Y0YE 1C5MD 1V2KT 1CA0C 3P8FA 3RXKA 3TH3H 1TLDA 3AW1A 3VGCB 4D9RA 1UTLM 2GCTC 1C1PA 2W3KA 1PPCE 3MH5A 1K1LA 1HLTH 1HAIH 4OS7A 1GJDB 1GMDG 2OP9A 4ASHA 3KQDA 1O5EH 2OC7A 3KQBA 4Y7BA 1LVMA 1O3OA 1F5RA 2WYGA 4CH8B 1ELGA 1GHBG 2DUCA 1J15A 3GY6A 4D8NA 1YPGH 1NROH 9LPRA 1NTPA 1Y5BT 3FP8E 5J4QA 1L2EA 1HDTH 2CGAA 3SNBA 1TGBA 4X1RU 1O3LA 4BOHA 2PGBB 3MU1A 5EU8A 2KAIB 4I8KA 1WTHD 1AI8H 3L3TA 1PJPA 2KAIA 1DY8A 3BEUA 1O3HA 1B0EA 1DSUA 1EB1H 4TY6A 1G37A 2XWBI 2NU1E 1RIWB 2AH4X 4YM9A 3FFGA 4QT8C 1K21H 1D3PB 5AFYH 3EA7A 1G30B 3EA9A 3A83A 3A7VA 1VITG 4ZHMU 1NM6A 2NU3E 2UUFB 3PLBA 2JETB 1YPMH 3VB4A 2GV6A 2CHAC 2QN5T 1WBGB 2PUQH 1E38B 1UK3A 2ZDVH 3AW0A 1GMCG 4A1TA 1GI7B 1Z1IA 3K2UA 2H5DA 1KIGH 5JBTA 1HXEH 2J94A 1HJAB 1RGQA 2RA3A 1LQEA 1ZMNA 4XBBA 5JYIA 1HGTH 5JBBS 3GCOA 2ZHQH 4Y11E 3QTOH 3MU0A 1V2WT 5JB8S 1UTOA 5HXFA 3MYWA 1C2LA 5K0HA 3B9FH 3QUMP 1GHXH 2G51A 1AE8H 1AMHA 2ZO3H 1FAKH 2BMGB 1Z8GA 2C3SA 2HGTH 5H4IB 3TU7H 3U8OH 4BTTB 1NZQH 3BG4C 4MNXA 2TIOA 5C20A 4CBOA 2R0LA 2FYQA 1NFUA 1G3DA 1NRNH 1ZHMA 4DVAU 1UVPA 1WUNH 1A5HA 3UY9A 1KDQB 2FOEA 1O2SA 2BD4A 5DPAA 1SB1H 4AGJA 2ZFTA 1TGSZ 2BVSH 1AHTH 4DURA 1N6YA 4DIIH 2BHGA 1W12U 3LDXH 3M3TA 2BY5X 1LHGH 4D7GA 3VXFH 1AGJA 5ESBA 1ZGVA 3I78A 1SHYA 2G4UA 1SGIB 2FLBH 1QBNA 4K5ZA 1GJ6A 4Q2KA 4I8GA 1S0RA 1EJAA 2BQWB 3QGNB 1S5SA 2PKSB 3F9EA 1C2MA 3UUZA 1BRBE 3FAOA 3SUGA 5JPMH 1NRPH 4ABBA 1FONA 1GVLA 1C5VA 1MAXA 1TFXA 1BDAA 2ZPRA 3BTFE 1EAIA 1GJ4H 2VGCC 1DLKB 2GCTB 3ZVGA 1W2KH 4WH8A 2D26C 8KME2 4GHQA 4SGAE 3M7QA 4AYYB 1GBAA 1FI8A 4E05H 1M9UA 2UUJB 2VH6A 1KXCA 1ANDA 3QK1A 3L6PA 3O8BA 1IQGA 1O2HA 1EASA 2AERH 4MNVA 5JDUB 1XUIA 1QQ4A 2BVRH 3F9FA 1O2LA 1O32A 3TK5A 1V2VT 1C2HA 1T4UH 1O5DH 1BBRH 2A7HA 5C5NA 1K1JA 2A0QB 3MNXA 1LTOA 4RKJB 4X8UH 4OS1A 1YPHC 1BMLA 1SQTA 2QXIA 5E2OA 5EQSA 2V6NA 3JZ2B 1EZUC 3ZZ3A 1A5IA 4KTCA 1S0QA 4Y76A 3RLWH 4FUDA 2Y5FA 5LGOA 4H6TA 1V2PT 1IQNA 3BIUH 2F3CE 2B5TB 2VWLA 3OTJE 3EDXB 8LPRA 2STAE 1BUIA 2FOAA 3MU5A 3U69H 5GPIB 4KTUA 1C9PA 3MTYA 3GCTG 2WINI 3TNTA 4U30A 1MTNC 1TALA 1SQOA 4WMFA 4K8BA 1GHYH 1YCPH 2C8YB 1C5XB 2A1DB 1IAUA 2K1QA 1K1NA 2ZFQH 2Q6DA 1L4DA 1WTGH 2XRCA 1THSH 1UCYH 1AB9C 4B2CA 5EW2H 2ANYA 1O2VA 3LONA 1O2JA 3U8TH 2FZZA 1TOMH 4FUBA 3PV4A 1V2ST 1RXPA 1CT2E 1F0RA 2B0FA 2O8TA 1P2QA 2BXUH 3IWMA 3SHAH 3M37A 1D3QB 1FY5A 1VR1H 3TH4H 1DPOA 3ZZ8A 5A8YA 1AZ8A 1AUJA 4NIYA 1T8MA 1QURH 2ZDKA 2TGPZ 3R0FA 5DG6A 1HIAB 4NA8A 1MBQA 1YP9A 4BAHB 1HAHH 1ZSLA 1G3CA 3MWIU 1DWCH 1HIAA 2ZG0H 3PB1E 4Y6DA 5DP8A 1CGJE 3I29A 4TYDA 3LJJA 3HK6B 2BDGA 2GP9B 4BXWA 3HGPA 2G5NA 1HUTH 2J4IA 3RXFA 1O3PB 2RCEA 3SI3H 4MNYA 4GSOA 4MVNA 1G36A 1H9HE 1MTWA 3ZZ9A 1NFXA 3TJOA 1CVWH 5ETXA 3M7UA 1UHBB 5GXPA 1L1NA 1TQ7B 1OP0A 2TGAA 2GX4A 1AVGH 1QL7A 1XXFA 3T29A 1DLEA 2D1JA 1TABE 1ACBE 5GCHF 5GDSH 5A0BA 1O5GH 1PPHE 4Y8YA 1EOJA 2ODPA 2AFQB 2ZGBH 2UWOA 2Z7FE 4CHAB 2ZGHA 4AORA 1BRCE 2CJIA 5AHGH 2FOGA 2XNIA 5BPEA 1P10A 4ABAA 5HM9A 1SGFG 3A84A 4ZROA 4X6PA 1T31A 1E36B 1O5CB 3VXEH 3H7OA 1B5GH 4HI3A 4UFGH 5A8ZA 4ISLA 1ZTKA 3RC6A 1DUEA 3SI4H 3GY4A 1UVUH 3RXPA 4FU8A 5CMXH 3CP7A 3M3VA 4ESTE 1DWDH 1H9IE 2OQUA 3TPIZ 1FPCH 4K3JA 1TNIA 1H8DH 2V3HH 4DIHH 2Z9GA 4RSPA 2HPPH 2QXHA 1SGCA 1KY9A 3PLPA 4CR5A 2NU0E 1EPTC 3D62A 1A4WH 1EAUA 1JMOH 4YOJA 2YOLA 3A80A 4LK4A 3ZZBA 2FXRA 1E34B 1ORFA 4MPXA 1O2WA 1AVXA 3TGJE 1IOEA 1W3CA 2ZHDA 1MMJN 2VIQA 3M35A 3UR6A 4DY7B 3GDSA 1L1GA 4TWWA 3RXQA 1Y3UA 3MU4A 3FVFB 4Y71A 2ZDMA 3RXGA 1BMNH 2WUCA 2H1UA 2OXSA 2J9NA 2BDCA 2GV7A 1W7GH 4ABFA 3F6UH 4B2BA 1WV7H 4NCYA 4CREA 2HNTF 1EATA 3Q00A 2VIOA 3A82A 1ARCA 3D65E 3RC4A 1MZDA 1UMAH 2Z9KA 4WJG2 2GZ9A 2VIDA 5C1XA 2BVXH 3SJ9A 1C5NH 4X8VH 6CHAC 1C5YB 1XUGA 3H5CB 1O3GA 4U2WA 2Z3CA 3A7XA 1EZQA 3VGCC 3M5MA 5L2ZH 2ZQ1A 2XCNA 2H9HA 2GCHF 3PROA 1BCUH 1TYNA 1XVOA 3ZZ7A 1HRTH 1YPEH 2GZ8A 1O3NA 1WSSH 1Z8JB 1OYTH 4AG2A 1O3DA 2R2WU 1GBLA 2RDLA 1JRSA 3SV9A 1D9IA 1GVKB 1V2JT 1PPGE 1V2RT 7GCHF 3TLOA 2O8LA 1A3BH 1G3EA 3G01A 4VGCB 2F83A 1P05A 1EJMA 1S6FA 3FZDA 1P2IA 4F49A 1QRZA 4E7RG 2FTLE 1BJUA 1P9SA 1QB6A 1XKAC 2GDDA 1AKSB 4AFSA 4KP0A 5FHTA 1O30A 2ZU1A 1GCTC 2TPIZ 3QX5H 3RU4T 4IW4E 1Z6EA 3PLKA 3LH1A 4IMZA 3RXSA 2Y7XA 1HJ8A 1JOUB 1K22H 3MH6A 4R0IA 3A7WA 2M5TA 4DG4A 4XSKU 2VWNA 3ZVEA 3BTME 1TIOA 1EP5A 3PMAB 1O2XA 4MG3A 1DITH 3EE0B 1C2EA 4NZLA 4IMQA 3RXLA 1TGNA 1KSNA 2BD8A 4KTSA 4JZFH 4K60A 2TRMA 6GCHG 2ZIQH 2R0KA 1GI0A 4BXSA 1KYNA 3MMGA 1ZSKA 3OY6U 4CH2B 4UFEH 4FU7A 1CHOG 1DFPA 1BBRE 4A7IB 2ZTYA 5DP5A 1ZPBA 1ELDE 1ESAA 1TX6A 1FQ3A 1TX7A 1UTMA 1W10U 4AFQA 1QHRB 3DA9B 1ZGIA 1O2KA 2CF8H 1GI1A 3MI4A 2W3IA 3OX7U 4ZAEA 4WWYA 1QBOA 4NG9H 3UWJH 2HALA 3GCHB 1WYKA 8GCHG 1C1NA 1GJ9B 3N7OA 1G2LA 1O2IA 1SI5H 5FCKA 3TVJB 4B1TA 1ZJDA 1ZRBA 3T25A 1O35A 1EPTB 4B76A 3RUOA 1VJAU 3P70B 3TNSA 1IHTH 1S6HA 2WPIS 1SBWA 1ETRH 1F92A 1Z8IB 1O2MA 2VVUA 2A5IA 1MTVA 1WU1A 2WV5A 1YPJH 1NY22 3TGKE 2BX3A 4JYVH 2ZKSA 2P94A 2WUBA 3ATIA 4ABGA 1SSXA 5EQQA 1UCYE 1F0UA 2ZHFH 4Q80A 3P8GA 3SQHE 4ZHAA 1TB6H 2BY7X 1PQ8A 4BAQB 3LKWA 3KGPA 2ZTZA 1MCTA 1TGTA 4GAWA 1GMHG 1AZZA 5EPYA 2WPMS 4JZEH 1SGQE 3EAJA 4IC5A 3RXDA 2XC4A 5SGAE 1P9UA 3OYPA 1S82A 1GVZA 2UWLA 2P3UB 1WQVH 4HTCH 1SMFE 1LQDB 3Q3YA 1CA8B 1ZHPA 1SQAA 1AWHB 3KEEA 5PTPA 2QCYA 1KLIH 4NWLA 1QL8A 2C8WB 3HKIB 3RXHA 1C5WB 3B8JA 3Q3KA 1YF4A 5FCRA 1GMDF 1SOZA 3ZVBA 1YPLH 2QXJA 1MKWH 3B23B 4ISOA 3HPTB 2VVCA 1KTTB 4A1XA 1HB0B 4ISNA 5EXLA 1YGCH 1GCTB 1MKXK 1FAXA 2XBYA 1H8IH 3KF2A 1GBTA 2FOHA 2HRVA 2UUYA 5C2ZA 1DM4B 1FY1A 5JBCS 3RXBA 1C1SA 5B6OA 3CENA 4FUHA 3S9BA 1FXYA 3QZQA 3HK3B 2ZU2A 3AAUA 2ULLA 3U98H 5AF9H 1GI8B 3SV7A 1YLDA 3BTDE 4OGYA 4IC6A 3A7YA 2WPKS 3O8CA 2C93B 4M7GA 3SGBE 4DOQA 1DSTA 1C2IA 1VITF 2QGRA 3UNRA 2BD7A 1ANEA 1LHDH 3NKKA 2Y80A 4X0WU 2R3UA 2F9NA 1C5LH 3UFAA 1KXAA 3A8DA 1W13U 4HGCA 5E0JA 1O2YA 1LHEH 2DE8A 1PQ7A 2ILNA 1O3BA 2HNTC 3VFEA 4UEHH 2FS9A 1OX1A 4CRGA 1P2KA 1GI5A 1NRRH 4WMDA 4YLUA 1OWHA 3LC5A 5FBIA 1RD3B 1C9TA 2GGVB 1FV9A 3V12A 3LT3A 5A0AE 3SNCA 1P01A 3E3TA 3JZ1B 1V2NT 1MAYA 4TY7A 1DWBH 4UFFH 4NSVA 1EAXA 1DICA 2BM2A 5IYTA 3A85A 1QNJA 3TJNA 4ZMAH 4H42U 1TRNA 1SLXB 3SJOA 3SU1A 2P3FH 4WF8A 3RMOH 1C1TA 3P95A 2ZCHP 1C4Y2 3QWCH 1U6QA 5I46H 2ZGJA 3LIWA 2ZPQA 2ZCLP 1UTPA 1ZYOA 3WY8A 1MBMA 1SG8B 1C1WH 1P02A 2EI8A 1Y8TA 5E2PA 6LPRA 1P2NA 1Y3VA 2FX6A 4YO9A 4A5TS 1HAPH 2IPHA 3GICB 5TCCA 1ZLRA 4FUCA 4JZDH 2J2UA 5TCAA 1C2KA 2TBSA 1G32B 1DXPA 1OPHB 4OS6A 3S7HB 2XXLA 1A2CH 1TNGA 2ANMH 4AYVB 2C4FH 1CO7E 1BJVA 3E1XB 4MPWA 5FPYA 3S9AA 1QCPA 1BZXE 3UIRA 1WQSA 1AY6H 3ZZAA 1C4U2 2PSXA 3SV2H 4ABIA 4XBDA 4CHAC 2ZFFH 1SLWB 3QO6A 3U9AH 1W7XH 5IDKA 3RXOA 2LNCA 5DP9A 1XMNB 3Q3XA 5E0GA 3ATWA 3ZZDA 2WPHS 3L33A 1GI9B 2FESH 1F2SE 3SUFA 3T27A 3ATKA 2OCVB 1O2TA 1BA8B 1L4ZA 2W7UA 4IN2A 1K2I1 4WXIA 2ZGCA 4AN7A 5EW1H 1JWTA 2ZC9H 4J1YA 2AGEX 1AN1E 1FY3A 1P3EA 2A31A 3RC5A 3LOXA 5BRRE 4OS4A 3M3SA 2C8ZB 2Z9LA 1O2ZA 1O5BB 1HCGA 4K1EA 2XTTB 2AS9A 2IOTA 2FOMB 1QJ1B 2OC0A 1K9OE 4BAKB 1LKAA 2XC0A 1N8OC 1LHCH 1INCA 1KXDA 1TMUH 2GMTB 2QXGA 1CQQA 1TE0A 4YT7H 1ABIH 2QYIA 1QBVH 1A0LA 1ELEE 4TWYA 1GGDB 4Y8XA 4ABJA 4B2AA 2BDYA 4CBNA 3AAVA 1OP2A 1G9IE 1VCQA 2WPJS 2EI7A 5DP3A 3MU8A 4NIWA 1O36A 2JKHA 3SJIA 5JB9S 3NXPA 1P03A 2VU8E 4X2VA 4YTAA 1AO5A 1SFIA 2Q1JA 1GL1A 3ZYEA 1V2OT 4FXGH 2FPZA 1YKTA 1QIXB 1ELTA 1OSSA 1QRXA 2OUAA 1GHWH 3NWUA 5FBEA 2VIPA 1P12E 1G3BA 2Q6FA 3SNDA 2FOCA 2FP7B 4LXBH 1C2GA 1BHXF 1J16A 4OS2A 4YOGA 2FX4A 4XE4A 2ZPSA 5HMAA 1GCDA 3F1SB 1ZOMA 4AFZA 2FODA 1MCVA 1SGPE 1JIRA 1A0HB 4B71A 1QL9A 2XBXA 3P8NA 3MNSA 1S81A 1MU6B 1QJ7B 3U1JB 3TITA 1Z71A 1O3JA 2EI6A 2ODYB 4NSYA 1ELAA 1D4PB 3TJUA 3F9GA 2XYAA 3NPSA 1ZRKA 2VWMA 1T32A 4KELA 3PM3A 2Y5HA 4OGXA 3AASA 4F4OC 2TGDA 2ZGXH 2BXTH 2W5EA 3GY7A 2VINA 4THNH 1LVOA 4IN1A 5L2YH 1UJ1A 2HLCA 2ZF0H 1C1OA 3P6ZB 3ZV9A 3H7TA 4VGCC 3SU3A 2RA0A 4FUFA 3SJ8A 2GT8A 3TK6A 2SGEE 3UWIA 1W0YH 5HM2A 4CRAA 1LO6A 1C5ZB 1JXPA 3DFLA 1OKXA 1GBFA 3A8BA 2D8WA 1DDJA 4X6MA 5L6NH 1V3XA 2NWNA 1O5FH 5GJ4B 4D76A 2AMDA 2ZWLH 2BLOA 5GWZA 4A1VA 5EQRA 3LGUA 2ANWA 3TJVA 1YCPM 1D6RA 2AMPA 4GCHG 2PUXB 4BTIB 1CT4E 1GJ8B 1SVPA 3LPRA 4KKDA 4YESB 3RLYH 4NZQA 1GI4A 3KN2A 4BANB 2BD5A 1VCPA 1LPKB 1MQ6A 3MO6A 1TA2A 1FY4A 2NU4E 2BOHB 2Z3DA 3GYLB 3RDZA 3A87A 1MUEB 2A4GA 4I8HA 2ZHWH 2QA9E 1Y3YA 2F9UA 4FUEA 5GCHG 2GZ7A 2JH5D 2ZTXA 4K8YA 2GD4B 1OWJA 2FEQH 4WY3A 2A4RA 2THFB 1LMWB 1NFYA 3P17H 1HXFH 2FI5E 4WMEA 2ZEBA 3BTQE 5FPTA 2VB0A 2P95A 3M5OA 4NA7A 1HPGA 2G52A 2QC2A 4AZ2B 1SL3A 1TONA 1QA0A 1GBIA 5LPRA 1BIOA 1GBHA 1BOQA 1RTFB 1DOJA 2WPLS 3F9HA 3GCHC 1FLEE 2OINA 3LC3A 1N8OB 2ZECA 4Y79A 1XXDA 1LDTT 2GT7A 1JBUH 1LVBA 1TX8A 1K1IA 1W0ZU 3ATMA 4JYTA 4PROA 3UOPA 2BDHA 2FOFA 1TRMA 1FY8E 1ANCA 4TPIZ 1CBWC 1TNLA 2ZDLA 1UK4A 1UVOA 1IQFA 3ZVDA 1CSOE 2I6SA 3RXTA 4R8TB 1HV7A 1FZZA 1GBDA 4FVDA 4A6LA 3S7KB 2XBVA 2Y82A 2A5AA 4U32A 3RM0H 1IQKA 3K9XB 2A7CA 2P3TB 1IHSH 1NESE 4GLYA 4X8SH 3VEQB 4ZXYH 1ABJH 1LKBA 4E7NA 2BDIA 4UE7H 1ELFA 2NU2E 1ELVA 3U1IB 2A4QA 1K28D 5CHAB 4UONA 2J34A 2XWAA 1QJ6B 3MH7A 4X1QU 1AWFH 3S0NA 3RXCA 1NN6A 1P09A 1GI3A 2HWLB 1FJSA 2HPQH 3E16B 3LGYA 2SNWA 5DJ7A 3T2NA 5C67A 3EQ0H 2Z9JA 1ARBA 3DT0H 3PO1C 2BY8X 1O2PA 1EJNA 1DUAA 1O3IA 5FAHA 1FN6A 2ALPA 4X1NU 4ZKNU 1BMAA 3QN7A 3RU4E 3LH3A 1ZTLA 2GCHG 5K7RA 2G5VA 4Q7YA 2LPRA 1AVWA 1NC6A 4AOQA 1E35B 2FTMA 1EKBB 2CF9H 3GOVB 3M5NA 3PMHB 3URDA 3A8CA 4ABDA 4Z0KA 1J14A 2SGAA 1QTFA 4Z6AH 4LZ4B 3GY5A 1F0TA 1NRSH 1VCWA 5A0CA 4K1SA 1C5QA 1EXFA 1GG6B 4NGAH 3A7TA 4X1SU 2PKAA 3LGVA 1OS8A 1TBRH 1V2QT 1T4VH 3RP2A 1BBRK 1AD8H 1HBTH 4HZHA 1FPHH 1UO6A 3S9CA 2FI3E 1O2UA 1PPZA 1EB2A 1A5GH 1BTZA 1P2MA 1PYTD 2FIRH 2ZNKH 1CE5A 4NIVA 5F6MA 1SC8U 1GHAF 5DP4A 3QDZB 2ZU5A 3TIUA 2EA3A 3GY2A 3ENSB 3R3GB 5A09A 3P92A 3LU9B 1C5RA 1ZR0A 2PV9B 3D23A 1TBZH 2RG3A 2H6MA 5FPSA 3GCNA 1XUKA 5HGGA 4NFEA 2ZHEH 1BITA 1CHOF 1O34A 1TRYA 2FWWA 3PMBB 1LHFH 2OC8A 4I8JA 4O3UA 4RN6A 1D6WA 1YCPK 1Z6JH 5E8EH 1UTKA 3A8AA 3GY3A 3SBKA 2QY0B 3BTHE 1YLCA 1A46H 5LPEA 4DJZB 1A61H 1Q2WA 4K1TA 1E37B 1UCYK 1YM0A 1HNEE 3RM2H 2V0BA 5DGJA 1D3DB 3RXRA 1G2MA 4K2YA 1FIZA 5CE1A 1MD7A 1CBWB 2BLWA 1P04A 4MNWA 1H9LB 1SGDE 1ZHRA 5F8ZA 3V0XA 4H6SB 4XFQA 3A7ZA 1O39A 5T6FA 1GL0E 2HNTE 3E0NB 1Z7KA 2JH0D 1WAYB 2ODQA 2EEKA 1UTQA 1XUFA 3ODDA 3BF6H 1GJ5H 3UREA 2O8WA 2A32A 3UNSA 5FX5A 4AX9H 4INKA 2F9VA 3SU0A 2C90B 4I32A 3VB7A 5L30H 1TMBH 1C5UA 1F5KU 1L0ZA 5DP6A 4CR9A 5E0HA 1MTUA 2BOKA 3DD2H 2UWPA 1T8LA 1GBMA 1GHVH 4YT6H 1FIWA 2W26A 2QIQA 1O2QA 2WYJA 3SW2B 1O2NA 2VIVA 1SGEE 2IN2A 3CS0A 3PO1B 4FUGA 5G4BA 2FS8A 1O2RA 2OLGA 2ZA5A 4O9VA 3UPEA 1ZJKA 3LGIA 2PHBA 2YNAA 3GISB 3KQEA 1AQ7A 1B0FA 1ZMJA 4DT7B 1ZZZA 1L1JA 4JK6A 3FP7E 1GHBF 3DHKH 2O8MA 4AFUA 4GVUA 5FX6A 3ZVFA 1AIXH 2UUKB 1C2JA 2BX4A 2Y6TA 1SFQB 3O8DA 1NPMA 1YC0A 2ZP0H 1NS3A 1UK2A 3ZZ6A 1O3AA 1DE7H 2Y7ZA 2FOBA 1BMMH 2ZDNA 1IQHA 2GMTC 5EXMA 4Y7AA 1A3EH 1BRAA 1NRQH 1GGDC 1IQIA 1F7ZA 1H1BA 2J95A 3ATLA 2GKVE 2O9QA 1C1QA 3BN9A 1TNJA 3RMNH 2GVFA 1YPHE 4JZ1A 2VH0A 3SORA 1C5TA 2QF3A 4Y8ZA 1BQYA 4ZKOU 2HVXA 3SUDA 5TJXA 1GBBA 1FN8A 1HAVB 4X2YA 2PTNA 2R2MB 2BLQA 2PTCE 2CXVA 1HAVA 3ZVCA 2ZFSA 3OU0A 2Y81A 2FO9A 4GPGA 1S83A 2CV3A 1GMCF 2VWOA 1C1VH 1MTSA 1BTXA 5JBAS 1QA7A 2A2XH 1AFEH 1IQLA 1EOLA 2WV4A 2P93A 2Y5GA 1BHXB 1F0SA 2I6QA 2OBOA 3KNXA 3SGAE 1GJBB 1N6XA 2XC5A 3PWCA 4BAMB 2FDAA 2F91A 1BTWA 3GYMA 2TGTA 4DGJA 1YPKH 1C1UH 4X8TH 2AGGX 3O8RA 2BY9X 1SR5C 1TA6A 3IITA 3URCA 1ID5H 4B74A 4AGKA 3W95A 4MLFB 2XBWA 3M61U 4WVPE 1NU7B 1OWKA 1YYY1 3QLPH 1CU1A 1W14U 3VPKA 3UQOA 4O3TA 2DE9A 3ZZ5A 2ALVA 4X6NA 3KCGH 2AIQA 4JYUH 7ESTE 2Z94A 1KDQA 2SGQE 4XBCA 1PQ5A 2YNBA 1BTHH 2VNTA 1GHZA 2OC1A 1O2OA 1PFXC 3SQEE 1MH0A 5F8XA 1RTKA 1MZAA 5DO4H 1ANBA 4K69A 1V2MT 3RU4D 3SNEA 6ESTA 1OXGA 1IQMA 3DUXH 4ISHH 2PLXA 1KLTA 1O5AB 2IJOB 1J17T 1LVYA 1P0SH 3BSQA 2H5CA 1TPOA 2QAAA 2BD3A 4B73A 5T3HA 1RFNA 3E8LA 1V6DA 2G4TA 4MDSA 3BV9B 1TPPA 3E91A 3ITIA 2ZQ2A 3TK9A 3UNQA 3MO3A 3RXUA 2XCFA 2AIPA 1CA0B 2Z9IA 1GBKA 1QFKH 3RXIA 1AE5A 1MD8A 1KTSB 3TH2H 2SNVA 1W11U 2BZAA 5GIBA 4INLA 4UD9H 1AFQC 1J9CH 1FUJA 1OWEA 1O3CA 3NZIA 1T8OA 4ZHLU 3NK8A 1NT1A 1GDQA 1PQAA 3A81A 1THPB 3BTWE 3EGKH 1SGFA 1AUTC 3MHWU 4H4FA 3ZZ4A 3STJA 3V13A 1A0JA 1RRKA 1AU8A 2G8TA 1VZQH 1JRTA 1ETSH 1MU8B 2V3OH 1Z1JA 4Y0ZE 3VB3A 2BQ7B 2FLRH 1DVAH 3BIVH 5LH8A 3RXAA 3ZV8A 1GWAA 1P57B 1DWEH 1QB1A 2R9PA 4B75A 2A45B 3A88A 3ELAH 3KL6A 4YOIA 3BG8A 1SPJA 4OS5A 4ZUHA 3GCTF 1C2DA 4CRFA 4ABEA 1CHGA 3E90B 5EG4A 2FI4E 1V2LT 5AVDA 3DFJA 5CHAC 4A92A 2ZCKP 1IQEA 1RJXB 3RXVA 1P2OA 1OWDA 3GY8A 1BTYA 1EUFA 2AEIH 2OD3B 3SU4A 2PFEA 1T8NA 4GHTA 2R3YA 2EC9H 5F03A 2CHAB 4IBLH 1SGRE 3E6PH 3BEFB 4MTBA 1HAXB 1C2FA 1WOFA 3P8OA 2P8OC 2VJ1A 1O31A 2CN0H 2ZDAH 2VIWA 3M5LA 3ESTA 1O3MA 2H9TH 3K65B 1ESTA 1P3CA 1GDNA 3K6YA 4MQAA 1PPFE 5LPFA 1UVTH 2XW9A 1LPGB 1Y3XA 4Q7XA 5AFZH 3TGIE 2HOBA 3MNBA 1ZSJA 1IQJA 1HFDA 4IS5A 1O3FA 2ANKH 3BG4B 3KHVA 4D9QA 1DXWA 1Q3XA 1H4WA 2GDEH 1EZXC 1NO9H 2STBE
chains in the Genus database with same CATH superfamily
2BD9A 2Q6GA 3C1KA 1P11E 1BTUA 5DP7A 1P8VC 3T28A 1P06A 2J98B 1EX3A 1GG6C 7KMEH 4MPUA 5F53A 2ASUB 1CT0E 1HAZB 2J98A 3LGTA 1QRWA 1C5OH 5C1YA 1MKWK 5F8TA 5DKMA 1O38A 2PGQB 1PPEE 1OP8A 4FUIA 1JIMA 2RDEA 1TAWA 4BTUB 1DY9A 1S84A 2OQ5A 4GCHF 5I25A 1XX9A 5A8XA 4UDWH 1OOKB 2BDBA 2OTVA 3UOUA 4YLQH 1K1MA 1UHBA 3QGJA 1XKBC 3KYGA 4ASUD 2W6ID 3NCLA 1PYTC 3RXJA 9ESTA 3U8RH 1GBJA 3CS7A 3GDVA 2H2ZA 2Z3EA 4JK5A 3UR9A 1Q31A 1TNHA 1C4V2 3PTNA 4SGBE 5DK1A 5KGOA 3GDUA 2VGCB 3SNAA 5FXLA 2SGFE 1GJCB 4AB9A 1AFQB 4IGDA 1VGCC 3PV2A 4CRCA 7LPRA 1UTJA 3E0PB 1QQUA 4RI0A 1MKXH 1ZPCA 3F68H 3PMJA 3T26A 2FM2A 4XOJA 1RTLA 1O3EA 4I31A 2PWXA 1KXFA 1DX5M 3T5FH 2EQNA 2BD2A 1DS2E 1TQ0B 5ABWA 1P2JA 1GJAB 4NWKA 2G00A 2B7DH 3SV8A 5EODA 5EOKA 2A4OA 3V7TA 1Y59T 4WH6A 3SU6A 3SO3A 1BTPA 3BEIB 5A2MH 1VJ9U 1ZTJA 1TPSA 2B9LA 2BZ6H 3SN8A 3MFJA 1FDPA 2SGDE 2Z6BD 1OYQA 2AYWA 1DT2A 1A1RA 3SUEA 1LCYA 1S85A 3BTGE 4X1PU 1ELBA 2PR3A 3SJKA 5J4SA 2W7SA 2ZU4A 3SHCH 1ETTH 4X2XA 4ZH8A 5C1UA 2SGPE 4TPYA 1HJ9A 4MPVA 3RMMH 1TGCA 4J2YB 5T6DA 2BY6X 2VVVA 5DSFA 1K1OA 1MTNB 4JMYA 1N1LA 2PSYA 4FUJA 1B7XB 4BAOB 1NU9A 1GJ7B 4BNRA 1NFWA 3ODFA 5EPNA 3ZVAA 2P8OB 3DCLA 1AB9B 1C5PA 1XUJA 3MOCA 3Q76A 1C1RA 2B8OH 3I77A 1C1MA 2GTBA 2F9BH 4HFPB 4UFDH 5ESTE 3STIA 1QB9A 3PYHA 1XUHA 2FYRA 2ZFPH 3SU2A 2ZU3A 3K6ZA 3PTBA 2BQ6B 2A2QH 3EA8A 2AGIX 2O8UA 2QV1A 4CRBA 1TBQH 2ZI2H 1XVMA 4XDEA 3FZZA 3KQCA 1O3KA 2W6JD 1BRUP 3A86A 1CGHA 3IG6B 4O03A 3SU5A 1GDUA 1V2UT 2A7JA 7GCHG 4I7YH 3S69A 2F4LA 4ISIH 1EQ9A 1SLVB 2WZQA 1HAGE 2J38A 2FMJA 1TPAE 2PKAB 1QGFA 4ZKSU 1SGNE 3OEED 2JH6D 1O37A 1Z8RA 2ZFRH 1ZMLA 8ESTE 2PW8H 4NA9H 4CRDA 4INHA 1O2GH 5EGMA 1GI2A 3M36A 5C3NA 4KGAA 1AKSA 3HATH 1KXBA 1UVSH 3AVZA 1VITH 1WCZA 5T6GA 1XM1A 1SHHB 2HVYB 4ACBA 1K1PA 1EAWA 3Q77A 5HIZA 1GBEA 2L6OA 2OBQA 1OWIA 1DANH 1RIWC 4X2WA 3T62A 6GCHF 3ZZCA 3MO9A 1C5SA 1KLJH 2A5KA 3OSYA 4LOYH 2ZZUH 1GHAG 1YBWA 1SOTA 1W8BH 3FANA 4DW2U 4GUXA 2LELA 3VB6A 2G81E 3MH4A 2F9OA 4X6OA 1RS0A 1VGCB 2J92A 2JETC 5HYOA 4TSFD 4E06H 2G55A 1TNKA 2P59A 2BTCE 1F5LA 2SFAA 4FU9A 4I33A 3UTUH 2ESTE 3BTTE 1A7SA 1CGIE 1NBME 3RMLH 4ZXXH 3NUMA 1X7AC 3A89A 1J8AA 1THRH 1HJAC 1WXRA 4NIXA 1ESBA 5GNDA 4JCNA 1O33A 8GCHF 3SZNA 1GPZA 1KXEA 1T7CA 1TWXB 1FMGA 1QR3E 3RXEA 1FNIA 1O0DH 2BYAX 4JZIA 1V2TT 4F48B 4ABHA 1GI6A 2V3MA 4O97A 1MQ5A 2P16A 3VB5A 1TOCB 4AG1A 1BB0B 3LGWA 4YZUA 2CMYA 4AB8A 1ELCA 1Y5UT 4LZ1H 1HAOH 3BTKE 4Y10E 3C27B 3HKJB 1QY6A 1SGTA 2BLVA 1HYLA 2F9PA 2V35A 5C17A 4Q7ZA 2H9EH 1EPTA 3ZYDA 4U01A 4ZKRU 1HAYB 3PWBA 5C5OA 1EZSC 1TMTH 3FP6E 3V3MA 2AMQA 2D2DA 2YMSD 3LJOA 2BB4A 3MNCA 1D3TB 3UQVA 3D49H 3W94A 3QTVH 1BT7A 1YWUA 3SV6A 5EXNA 3HGNA 1SGYE 4D7FA 2C8XB 3SOSA 1GBCA 4RKOB 3EYDA 3BTEE 1GMHF 1Y5AT 3OY5U 3QZRA 4NFFA 4WXVA 1SLUB 1LPZB 3RXMA 1UTNA 4I8LA 1EP6A 3F0OA 1ZPZA 2QF0A 1PPBH 3M7TA 5CDFE 2PKSC 1Y3WA 4FVBA 3SGQE 3KIDU 1E0FD 2BDAA 2WV9A 4DCDA 6CHAB 4Y0YE 1C5MD 1V2KT 1CA0C 3P8FA 3RXKA 3N99A 3TH3H 1TLDA 3AW1A 3VGCB 4D9RA 1UTLM 2GCTC 1C1PA 2W3KA 1PPCE 3MH5A 1K1LA 1HLTH 1HAIH 4OS7A 2RFKC 1GJDB 2JDID 1GMDG 2OP9A 2JIZD 4ASHA 3KQDA 1O5EH 2OC7A 3KQBA 4Y7BA 1LVMA 1O3OA 1F5RA 2WYGA 3F0PA 4CH8B 1ELGA 1GHBG 2DUCA 1J15A 3GY6A 4D8NA 4TT3D 1YPGH 1NROH 9LPRA 1NTPA 1Y5BT 3FP8E 5J4QA 3DSOA 1L2EA 1HDTH 2CGAA 3SNBA 1TGBA 4X1RU 1O3LA 4BOHA 2PGBB 3MU1A 5EU8A 2KAIB 4I8KA 1WTHD 1AI8H 3L3TA 1PJPA 2V7QD 2KAIA 1DY8A 3BEUA 1O3HA 1B0EA 1DSUA 1EB1H 4TY6A 1G37A 2XWBI 2NU1E 1RIWB 2AH4X 4YM9A 3FFGA 4QT8C 1K21H 1D3PB 5AFYH 3EA7A 1G30B 3EA9A 3A83A 5C0TA 3A7VA 1VITG 4ZHMU 1NM6A 2NU3E 2UUFB 3PLBA 2JETB 1YPMH 3VB4A 2GV6A 2CHAC 2QN5T 1WBGB 2PUQH 1E38B 1UK3A 2ZDVH 3AW0A 1GMCG 4A1TA 2IJD1 1GI7B 1Z1IA 3K2UA 2H5DA 1KIGH 5JBTA 1HXEH 2J94A 1HJAB 1RGQA 2RA3A 1LQEA 1ZMNA 4XBBA 5JYIA 1HGTH 5JBBS 3GCOA 2ZHQH 4Y11E 3QTOH 3MU0A 1V2WT 5JB8S 3AK5A 1UTOA 5EJZA 5HXFA 3MYWA 1C2LA 5K0HA 2QE7D 3B9FH 3QUMP 1GHXH 2G51A 1AE8H 1AMHA 2ZO3H 1FAKH 2BMGB 1Z8GA 2C3SA 2HGTH 5H4IB 3TU7H 3U8OH 4BTTB 1NZQH 3BG4C 4MNXA 2TIOA 1H8HD 5C20A 2R0LA 2FYQA 1NFUA 1G3DA 1NRNH 1ZHMA 4DVAU 1UVPA 1WUNH 1A5HA 3UY9A 1KDQB 2FOEA 1O2SA 3PRDA 2BD4A 5DPAA 1SB1H 4AGJA 2ZFTA 1TGSZ 2BVSH 1AHTH 4DURA 1N6YA 4DIIH 2BHGA 1W12U 3LDXH 3M3TA 4P02A 2BY5X 1LHGH 4D7GA 3VXFH 1AGJA 5ESBA 1ZGVA 3I78A 1SHYA 2G4UA 1SGIB 2FLBH 1QBNA 4K5ZA 5KEDA 1GJ6A 4Q2KA 4I8GA 2F43B 1S0RA 1EJAA 2BQWB 3QGNB 1S5SA 2PKSB 3F9EA 1C2MA 3UUZA 1BRBE 3FAOA 3SUGA 5JPMH 1NRPH 4ABBA 1FONA 1GVLA 1C5VA 1MAXA 1TFXA 1BDAA 2ZPRA 3BTFE 1EAIA 1GJ4H 2VGCC 1DLKB 2GCTB 3ZVGA 1W2KH 4WH8A 2D26C 8KME2 4GHQA 4SGAE 3M7QA 4AYYB 1GBAA 1FI8A 4E05H 1M9UA 2UUJB 2VH6A 2IPQX 1KXCA 1ANDA 3QK1A 2OK5A 3L6PA 3O8BA 1IQGA 1O2HA 1EASA 2AERH 4MNVA 5JDUB 1XUIA 1QQ4A 2BVRH 3F9FA 1O2LA 3UAIC 1O32A 3TK5A 1V2VT 1C2HA 1T4UH 1O5DH 1BBRH 2A7HA 5C5NA 1K1JA 2A0QB 3MNXA 1LTOA 4RKJB 4X8UH 4OS1A 1YPHC 5EJ1A 1BMLA 1SQTA 2QXIA 5E2OA 5EQSA 2V6NA 3JZ2B 1EZUC 3ZZ3A 1A5IA 4OM9A 4KTCA 1S0QA 4Y76A 2WHXA 3RLWH 4FUDA 2Y5FA 5LGOA 4H6TA 1V2PT 1IQNA 3BIUH 3DSGA 2F3CE 3KYFA 2B5TB 2VWLA 3OTJE 3EDXB 8LPRA 2STAE 1VKYA 1BUIA 2FOAA 3MU5A 3U69H 2KR7A 5GPIB 4KTUA 1C9PA 3MTYA 3GCTG 2WINI 3TNTA 3MQKC 1NBMD 1YLNA 4U30A 1MTNC 1TALA 1SQOA 4WMFA 4K8BA 1GHYH 1YCPH 2C8YB 1C5XB 2A1DB 4Q63A 1IAUA 2K1QA 1K1NA 2ZFQH 2Q6DA 1L4DA 1WTGH 2XRCA 1THSH 1UCYH 1AB9C 4B2CA 5EW2H 2ANYA 5C94A 1O2VA 3LONA 1O2JA 3U8TH 1E79D 2FZZA 1TOMH 4FUBA 2XOKD 3PV4A 2GJGA 1V2ST 1RXPA 1CT2E 1F0RA 2B0FA 2O8TA 1P2QA 2BXUH 3IWMA 3SHAH 3M37A 1D3QB 1FY5A 1VR1H 3TH4H 1DPOA 3ZZ8A 5A8YA 1AZ8A 1AUJA 4NIYA 1T8MA 1QURH 2ZDKA 2TGPZ 3R0FA 5DG6A 1HIAB 4NA8A 1MBQA 1YP9A 4BAHB 1HAHH 1ZSLA 1G3CA 3MWIU 1DWCH 1HIAA 3OFND 2ZG0H 3PB1E 4Y6DA 5DP8A 1CGJE 3I29A 4TYDA 3LJJA 3HK6B 2BDGA 2GP9B 4BXWA 3HGPA 2G5NA 1HUTH 2J4IA 3F2HA 3RXFA 2KFWA 1O3PB 2RCEA 3SI3H 4MNYA 4GSOA 4MVNA 1G36A 1H9HE 5FL7D 1MTWA 3ZZ9A 1NFXA 3TJOA 1CVWH 5ETXA 3M7UA 1UHBB 5GXPA 1L1NA 1TQ7B 3PV5A 1OP0A 2TGAA 3FOAA 2GX4A 1AVGH 1QL7A 1XXFA 3T29A 3WW7A 1DLEA 2D1JA 1TABE 1ACBE 5GCHF 5GDSH 5A0BA 1O5GH 1PPHE 4Y8YA 1EOJA 2ODPA 2AFQB 2ZGBH 2UWOA 2Z7FE 4CHAB 2ZGHA 4AORA 1BRCE 2CJIA 5AHGH 2FOGA 2PP6A 2XNIA 5BPEA 1P10A 4ABAA 3OAAD 5HM9A 1SGFG 3A84A 4ZROA 4X6PA 1T31A 1E36B 1O5CB 3VXEH 3H7OA 1B5GH 4HI3A 2J5UA 4UFGH 5A8ZA 4ISLA 1ZTKA 3RC6A 4M9FA 1E1QD 1DUEA 3SI4H 3GY4A 1UVUH 3RXPA 4FU8A 5CMXH 3CP7A 3M3VA 4ESTE 1DWDH 1H9IE 2OQUA 3TPIZ 1FPCH 4K3JA 1TNIA 1H8DH 2V3HH 4DIHH 2Z9GA 4RSPA 2HPPH 2QXHA 1SGCA 1KY9A 3PLPA 4CR5A 2NU0E 1EPTC 3D62A 1A4WH 1EAUA 1JMOH 4YOJA 2YOLA 3A80A 4LK4A 3ZZBA 2FXRA 1E34B 1ORFA 4MPXA 1O2WA 1AVXA 3TGJE 1IOEA 1W3CA 5EIYA 2ZHDA 1MMJN 2VIQA 3M35A 3UR6A 4DY7B 3GDSA 1L1GA 4TWWA 3RXQA 1Y3UA 3MU4A 3FVFB 4Y71A 2YMSC 2ZDMA 3RXGA 1BMNH 2WUCA 2H1UA 2OXSA 2J9NA 2BDCA 2GV7A 1W7GH 4ABFA 3F6UH 4B2BA 1WV7H 4NCYA 4CREA 2HNTF 1EATA 3Q00A 2VIOA 3A82A 1ARCA 3D65E 3RC4A 1MZDA 1UMAH 2Z9KA 4WJG2 2GZ9A 2VIDA 5C1XA 2BVXH 3SJ9A 1C5NH 4X8VH 6CHAC 1C5YB 1XUGA 3H5CB 3SZEA 1O3GA 4U2WA 2Z3CA 3A7XA 1EZQA 3VGCC 3M5MA 5L2ZH 2ZQ1A 2XCNA 2H9HA 2GCHF 3PROA 1BCUH 1TYNA 1XVOA 3ZZ7A 1HRTH 1YPEH 2GZ8A 1O3NA 1WSSH 1Z8JB 1OYTH 4AG2A 1O3DA 1UW7A 2R2WU 1GBLA 2RDLA 1JRSA 1WDIA 3SV9A 1D9IA 1GVKB 1V2JT 1PPGE 1V2RT 7GCHF 3TLOA 2O8LA 1A3BH 1G3EA 3G01A 4VGCB 2F83A 1P05A 1EJMA 1S6FA 3FZDA 1P2IA 4F49A 1QRZA 4E7RG 2FTLE 1BJUA 1P9SA 1QB6A 1XKAC 2GDDA 1AKSB 4AFSA 4KP0A 5FHTA 1O30A 2XNDD 2ZU1A 1GCTC 2TPIZ 3QX5H 3RU4T 4IW4E 1Z6EA 3PLKA 3LH1A 4IMZA 3RXSA 2Y7XA 1HJ8A 1JOUB 1K22H 3MH6A 4R0IA 3A7WA 2M5TA 4DG4A 4XSKU 2VWNA 3ZVEA 3BTME 1TIOA 1EP5A 3PMAB 4Z1MD 1O2XA 4MG3A 1DITH 1SQRA 3EE0B 1C2EA 4NZLA 4IMQA 3RXLA 1TGNA 4YXWD 1KSNA 2BD8A 4KTSA 4JZFH 4K60A 2TRMA 6GCHG 2ZIQH 2R0KA 1GI0A 4BXSA 1KYNA 3MMGA 1ZSKA 2VBCA 3OY6U 4CH2B 4UFEH 4FU7A 1CHOG 1DFPA 1BBRE 5EJLA 4A7IB 2ZTYA 5DP5A 1ZPBA 1ELDE 1ESAA 1TX6A 1FQ3A 1TX7A 1UTMA 1W10U 4AFQA 1QHRB 3DA9B 1ZGIA 1O2KA 2CF8H 1GI1A 3MI4A 2W3IA 3OX7U 4ZAEA 4WWYA 1QBOA 4NG9H 2WPDD 3UWJH 2HALA 3GCHB 1WYKA 3F2GA 8GCHG 1H8ED 1C1NA 1GJ9B 3N7OA 1G2LA 1O2IA 1SI5H 5FCKA 3TVJB 4B1TA 1ZJDA 1ZRBA 3T25A 1O35A 1EPTB 4B76A 3RUOA 1VJAU 3P70B 3TNSA 1IHTH 1S6HA 2WPIS 1SBWA 1ETRH 1F92A 1Z8IB 1O2MA 2VVUA 2A5IA 1MTVA 1WU1A 2WV5A 1YPJH 1NY22 3TGKE 2BX3A 4JYVH 1W0KD 2ZKSA 2P94A 2WUBA 3ATIA 2YMSB 4ABGA 1SSXA 5EQQA 1UCYE 1F0UA 2ZHFH 4Q80A 3P8GA 3EE7A 3SQHE 4ZHAA 1TB6H 2BY7X 1PQ8A 4BAQB 3LKWA 3KGPA 2ZTZA 1MCTA 1TGTA 4GAWA 1GMHG 1AZZA 5EPYA 3WWBA 2WPMS 4JZEH 1SGQE 4RT0A 3EAJA 4IC5A 3RXDA 2XC4A 5SGAE 1P9UA 3OYPA 1S82A 1GVZA 2UWLA 2P3UB 1WQVH 4HTCH 1SMFE 1LQDB 1EFRD 3Q3YA 5KECA 1CA8B 1ZHPA 1SQAA 1AWHB 3KEEA 5PTPA 2QCYA 1KLIH 4NWLA 1QL8A 3KQ5A 2C8WB 3HKIB 3RXHA 1C5WB 3B8JA 3Q3KA 1YF4A 5FCRA 1GMDF 1SOZA 3ZVBA 1YPLH 2QXJA 1MKWH 3B23B 4ISOA 2JJ1D 1SKYE 3HPTB 2VVCA 1KTTB 4A1XA 1HB0B 4ISNA 5EXLA 1YGCH 1GCTB 1MKXK 1FAXA 2XBYA 1H8IH 3KF2A 1GBTA 2FOHA 2HRVA 2UUYA 5C2ZA 1DM4B 2KCOA 1FY1A 5JBCS 3RXBA 1C1SA 5B6OA 3CENA 4FUHA 3S9BA 1FXYA 3QZQA 3HK3B 2ZU2A 3AAUA 2ULLA 3U98H 5AF9H 1GI8B 3SV7A 1YLDA 3BTDE 4OGYA 4IC6A 3A7YA 2WPKS 3O8CA 2C93B 4M7GA 3SGBE 4DOQA 1DSTA 1C2IA 1VITF 2QGRA 3UNRA 2KZ4A 2BD7A 1ANEA 1LHDH 3NKKA 2Y80A 4X0WU 2R3UA 2F9NA 1C5LH 3UFAA 1KXAA 3A8DA 1W13U 4HGCA 5E0JA 1O2YA 1LHEH 3F2FA 2DE8A 1PQ7A 2ILNA 1O3BA 2HNTC 3VFEA 4UEHH 2FS9A 4AC9A 1OX1A 4CRGA 1P2KA 1GI5A 1NRRH 4WMDA 4YLUA 1OWHA 3LC5A 5FBIA 1RD3B 1C9TA 2GGVB 1FV9A 3V12A 3LT3A 5A0AE 3SNCA 1P01A 3E3TA 3JZ1B 1V2NT 5HKKD 1MAYA 4TY7A 1DWBH 4UFFH 4NSVA 1EAXA 1DICA 2BM2A 5IYTA 3A85A 1QNJA 3TJNA 4ZMAH 1YY3A 1TRNA 4H42U 1SLXB 3SJOA 3SU1A 2P3FH 4WF8A 3RMOH 1C1TA 3P95A 2ZCHP 1C4Y2 3QWCH 1U6QA 5I46H 2CK3D 2ZGJA 3LIWA 2ZPQA 2ZCLP 1UTPA 1ZYOA 3WY8A 1MBMA 2QF5A 1SG8B 3GS9A 1C1WH 1P02A 2EI8A 1Y8TA 5E2PA 6LPRA 1P2NA 1Y3VA 2FX6A 4YO9A 4A5TS 1HAPH 1K0HA 2IPHA 3GICB 5TCCA 1ZLRA 4FUCA 4JZDH 2J2UA 5TCAA 1C2KA 3FO8D 2TBSA 1G32B 1DXPA 1OPHB 4OS6A 3S7HB 2XXLA 1A2CH 1TNGA 2ANMH 4AYVB 2C4FH 1CO7E 1BJVA 3E1XB 4MPWA 5FPYA 3S9AA 1QCPA 1BZXE 1MABB 3UIRA 1WQSA 1AY6H 3ZZAA 1C4U2 2PSXA 3SV2H 4ABIA 4XBDA 4CHAC 2ZFFH 1SLWB 3QO6A 3U9AH 1W7XH 5IDKA 3RXOA 2LNCA 5DP9A 1XMNB 3Q3XA 5E0GA 3ATWA 3ZZDA 2WPHS 3L33A 1GI9B 2FESH 1F2SE 3SUFA 3T27A 3ATKA 2OCVB 1O2TA 1BA8B 1L4ZA 4FOUC 2W7UA 4IN2A 1K2I1 3N7EA 4WXIA 2ZGCA 4XRNA 4AN7A 5EW1H 1JWTA 2ZC9H 4J1YA 2AGEX 1AN1E 1FY3A 1P3EA 2A31A 3RC5A 3LOXA 5BRRE 4OS4A 3M3SA 2C8ZB 2Z9LA 1O2ZA 1O5BB 1HCGA 4K1EA 2XTTB 2AS9A 3CNRA 2IOTA 2FOMB 1QJ1B 2OC0A 1K9OE 4BAKB 1LKAA 2QF4A 2XC0A 1N8OC 1LHCH 3H09A 1INCA 1KXDA 1TMUH 2GMTB 2QXGA 1CQQA 1TE0A 4YT7H 1ABIH 2QYIA 1QBVH 1A0LA 1ELEE 4TWYA 1GGDB 4Y8XA 4ABJA 4B2AA 2BDYA 4CBNA 3AAVA 1OP2A 1G9IE 1VCQA 2WPJS 2EI7A 5DP3A 3MU8A 4NIWA 1O36A 2JKHA 3SJIA 5JB9S 3NXPA 1P03A 2VU8E 4X2VA 4YTAA 1AO5A 1SFIA 2Q1JA 1GL1A 3ZYEA 1V2OT 4FXGH 2FPZA 1YKTA 1QIXB 3UB0A 1ELTA 1OSSA 1QRXA 2OUAA 1GHWH 3NWUA 5FBEA 2VIPA 1P12E 4XD7D 1G3BA 2Q6FA 3SNDA 2FOCA 2FP7B 4LXBH 1C2GA 1BHXF 1J16A 4OS2A 4YOGA 2FX4A 4XE4A 2ZPSA 5HMAA 1GCDA 3F1SB 1ZOMA 4AFZA 2FODA 1MCVA 1SGPE 1JIRA 1A0HB 4B71A 1QL9A 2XBXA 3P8NA 3MNSA 1S81A 1MU6B 4RT1A 1QJ7B 3U1JB 3TITA 1Z71A 1O3JA 2EI6A 2ODYB 4NSYA 1ELAA 1D4PB 3TJUA 3F9GA 2XYAA 4I86A 2WSSD 3NPSA 1ZRKA 2VWMA 1T32A 4KELA 3PM3A 2Y5HA 4OGXA 3AASA 4ACAA 4F4OC 2TGDA 2ZGXH 2BXTH 2W5EA 3GY7A 2VINA 4THNH 1LVOA 4IN1A 5L2YH 1UJ1A 2HLCA 2ZF0H 1C1OA 3P6ZB 3ZV9A 3H7TA 4VGCC 3SU3A 4DT4A 2RA0A 4FUFA 3SJ8A 2GT8A 3TK6A 2SGEE 3UWIA 1W0YH 5HM2A 4CRAA 1LO6A 1C5ZB 1JXPA 4B6EA 3DFLA 1OKXA 1GBFA 3A8BA 2D8WA 1DDJA 4X6MA 5L6NH 1V3XA 2NWNA 1O5FH 5GJ4B 4P00A 2AMDA 4D76A 2ZWLH 2BLOA 5GWZA 4A1VA 5EQRA 3LGUA 2ANWA 3TJVA 1YCPM 1D6RA 2AMPA 4GCHG 2PUXB 4BTIB 1CT4E 1GJ8B 1SVPA 3LPRA 4KKDA 4YESB 3RLYH 4NZQA 1GI4A 3KN2A 4BANB 2BD5A 1VCPA 1LPKB 1MQ6A 3MO6A 1TA2A 1FY4A 2NU4E 2BOHB 2Z3DA 3GYLB 3RDZA 3A87A 1MUEB 2A4GA 2LP6A 4I8HA 2ZHWH 3DSPA 2QA9E 1Y3YA 2F9UA 4FUEA 5GCHG 2GZ7A 2JH5D 2ZTXA 3OE7D 4K8YA 2GD4B 1OWJA 2FEQH 4WY3A 2A4RA 2THFB 1LMWB 1NFYA 3P17H 1HXFH 2FI5E 4WMEA 2ZEBA 3BTQE 5FPTA 2VB0A 2P95A 3M5OA 4NA7A 1HPGA 2G52A 3F3BA 2QC2A 4AZ2B 1SL3A 1TONA 1QA0A 1GBIA 5LPRA 1BIOA 1GBHA 1W0JD 1BOQA 1RTFB 1DOJA 2WPLS 3F9HA 3GCHC 1FLEE 2KCAA 2OINA 1S6LA 1N8OB 2ZECA 3LC3A 4Y79A 1XXDA 1LDTT 2GT7A 1JBUH 1LVBA 1TX8A 1K1IA 1W0ZU 3ATMA 4JYTA 4PROA 3UOPA 2BDHA 2FOFA 1TRMA 1FY8E 4B6FA 1ANCA 4TPIZ 1CBWC 1TNLA 2ZDLA 1UK4A 1UVOA 1IQFA 3ZVDA 1CSOE 2I6SA 3RXTA 4R8TB 1HV7A 1FZZA 1GBDA 4FVDA 4A6LA 3S7KB 2XBVA 2Y82A 2A5AA 4U32A 3RM0H 1IQKA 4F55A 3K9XB 2A7CA 2P3TB 1IHSH 1NESE 4GLYA 4X8SH 3VEQB 4ZXYH 1ABJH 1LKBA 4E7NA 2BDIA 1KMHB 4UE7H 1ELFA 2NU2E 1QZ8A 1ELVA 3U1IB 2A4QA 1K28D 5CHAB 4UONA 2J34A 2XWAA 1QJ6B 3MH7A 4X1QU 1AWFH 3S0NA 3RXCA 1NN6A 1P09A 1GI3A 2HWLB 1FJSA 2HPQH 3E16B 3LGYA 2SNWA 5DJ7A 3T2NA 5C67A 3EQ0H 3OEHD 2Z9JA 1ARBA 3DT0H 3PO1C 2BY8X 1O2PA 1EJNA 1DUAA 1O3IA 5FAHA 1FN6A 2ALPA 4X1NU 4ZKNU 1BMAA 3QN7A 3RU4E 3LH3A 1ZTLA 2GCHG 5K7RA 2G5VA 4Q7YA 3OTPA 2LPRA 1AVWA 1NC6A 4AOQA 1E35B 2FTMA 1EKBB 2CF9H 3GOVB 3M5NA 3PMHB 3URDA 3A8CA 4ABDA 2J97A 4Z0KA 1J14A 2SGAA 1QTFA 4Z6AH 4LZ4B 3GY5A 1F0TA 1NRSH 1VCWA 5A0CA 4K1SA 1C5QA 1EXFA 1GG6B 4NGAH 2M2AA 3A7TA 4X1SU 2PKAA 3LGVA 2K8IA 1OS8A 1TBRH 1V2QT 1T4VH 3RP2A 1BBRK 1AD8H 1HBTH 4HZHA 1FPHH 1UO6A 3S9CA 2FI3E 1O2UA 1PPZA 1EB2A 1A5GH 1BTZA 1P2MA 1PYTD 2FIRH 2ZNKH 1CE5A 4NIVA 5F6MA 1SC8U 1GHAF 5CHBA 5DP4A 3QDZB 2ZU5A 3TIUA 2EA3A 3GY2A 3ENSB 3R3GB 5A09A 3P92A 3LU9B 1C5RA 1ZR0A 2PV9B 3D23A 1TBZH 2RG3A 2H6MA 5FPSA 3GCNA 1XUKA 5HGGA 4NFEA 2ZHEH 1BITA 1CHOF 1O34A 1TRYA 2FWWA 3PMBB 1LHFH 2OC8A 4I8JA 4O3UA 4RN6A 1D6WA 1YCPK 1Z6JH 5E8EH 1UTKA 3A8AA 3GY3A 3SBKA 2QY0B 3BTHE 5DN6D 1YLCA 1A46H 5LPEA 4DJZB 1A61H 4FETA 1Q2WA 4K1TA 1E37B 1UCYK 1YM0A 1HNEE 3RM2H 2V0BA 5DGJA 1D3DB 3RXRA 1G2MA 4K2YA 1FIZA 5CE1A 1MD7A 1CBWB 2BLWA 1P04A 4MNWA 1H9LB 1SGDE 1ZHRA 5F8ZA 3V0XA 4H6SB 4XFQA 3A7ZA 1O39A 5T6FA 1GL0E 2HNTE 3E0NB 1Z7KA 2JH0D 1WAYB 2ODQA 4HG6A 2EEKA 1UTQA 1XUFA 3ODDA 3BF6H 1GJ5H 3UREA 2O8WA 2A32A 3UNSA 5FX5A 4AX9H 4INKA 2F9VA 3SU0A 2C90B 4I32A 3VB7A 5L30H 1BMFD 3NRLA 1TMBH 1C5UA 1F5KU 1COWD 1L0ZA 5DP6A 4CR9A 5E0HA 1MTUA 2BOKA 3DD2H 2UWPA 1T8LA 2JJ2D 1GBMA 1GHVH 4YT6H 1FIWA 2W26A 2QIQA 1O2QA 2WYJA 3SW2B 1O2NA 2VIVA 1SGEE 2IN2A 3CS0A 3PO1B 4FUGA 5G4BA 2FS8A 1O2RA 2OLGA 2ZA5A 4O9VA 4ZCNA 3UPEA 5B6LA 1ZJKA 3LGIA 2PHBA 2YNAA 3GISB 3KQEA 1AQ7A 1B0FA 1ZMJA 4DT7B 1ZZZA 1L1JA 2K0QA 4JK6A 3FP7E 1GHBF 3DHKH 2O8MA 4AFUA 4GVUA 5FX6A 3ZVFA 1AIXH 1FX0B 2UUKB 1C2JA 2BX4A 2Y6TA 1SFQB 3O8DA 1NPMA 1YC0A 2ZP0H 1NS3A 1UK2A 3ZZ6A 1O3AA 1DE7H 2Y7ZA 3U28C 2FOBA 1BMMH 2ZDNA 1IQHA 2GMTC 5EXMA 3N7DA 4Y7AA 1A3EH 1BRAA 1NRQH 1GGDC 1IQIA 4CBOA 1F7ZA 1H1BA 2J95A 5T1VA 3ATLA 2HLDD 2GKVE 2O9QA 1C1QA 3BN9A 5C0UA 1TNJA 3RMNH 2GVFA 1YPHE 4JZ1A 2VH0A 3SORA 1C5TA 2QF3A 4Y8ZA 1BQYA 4ZKOU 2HVXA 3SUDA 5TJXA 3SYJA 1GBBA 1FN8A 1HAVB 4X2YA 2PTNA 2R2MB 2BLQA 2PTCE 2CXVA 1HAVA 3ZVCA 2ZFSA 3OU0A 2Y81A 3VG8A 2FO9A 4GPGA 1S83A 2CV3A 1GMCF 2VWOA 1C1VH 1MTSA 1BTXA 5JBAS 1QA7A 2A2XH 1AFEH 1IQLA 1EOLA 2WV4A 2P93A 2Y5GA 1BHXB 1F0SA 2I6QA 2OBOA 3KNXA 3SGAE 1GJBB 1N6XA 2KCYA 2XC5A 3PWCA 4BAMB 2FDAA 2F91A 1BTWA 3GYMA 2TGTA 4DGJA 1YPKH 1C1UH 4X8TH 2AGGX 3O8RA 2BY9X 1SR5C 1TA6A 3IITA 3PRBA 3URCA 1ID5H 4B74A 4AGKA 3W95A 4MLFB 2XBWA 3M61U 4WVPE 3WWFA 1NU7B 1OWKA 1YYY1 3QLPH 3ZIAD 1CU1A 1W14U 3VPKA 3UQOA 4O3TA 2DE9A 1E1RD 3ZZ5A 5IK2D 2ALVA 4X6NA 3KCGH 2AIQA 4JYUH 7ESTE 2Z94A 1KDQA 2SGQE 4XBCA 1PQ5A 2YNBA 1BTHH 2VNTA 1GHZA 2OC1A 1O2OA 1PFXC 3SQEE 1MH0A 5F8XA 1RTKA 3FN8A 1MZAA 5DO4H 1ANBA 4K69A 1V2MT 3RU4D 3SNEA 6ESTA 1OXGA 1IQMA 3DUXH 4ISHH 2PLXA 1KLTA 1O5AB 2IJOB 1J17T 1LVYA 1P0SH 3BSQA 2H5CA 1TPOA 2QAAA 2BD3A 4B73A 5T3HA 1RFNA 3E8LA 1V6DA 2G4TA 4MDSA 3BV9B 1TPPA 3E91A 3ITIA 2ZQ2A 3TK9A 3UNQA 3MO3A 3RXUA 2XCFA 2AIPA 1CA0B 2Z9IA 1GBKA 1QFKH 3RXIA 1AE5A 1MD8A 1KTSB 3TH2H 2SNVA 1W11U 2BZAA 5GIBA 4INLA 4UD9H 1AFQC 1J9CH 1FUJA 1OWEA 1O3CA 3NZIA 1T8OA 4ZHLU 3NK8A 1NT1A 1GDQA 1PQAA 3A81A 1THPB 2KX4A 3BTWE 3EGKH 1SGFA 1AUTC 3MHWU 4H4FA 3ZZ4A 3STJA 3V13A 1A0JA 1RRKA 1AU8A 2G8TA 1VZQH 1JRTA 1ETSH 1MU8B 2V3OH 1Z1JA 4Y0ZE 3VB3A 2BQ7B 2FLRH 1DVAH 3BIVH 5LH8A 3RXAA 3ZV8A 1GWAA 1P57B 1DWEH 1QB1A 2R9PA 4B75A 3FKSD 2A45B 3A88A 3ELAH 3KL6A 4YOIA 3BG8A 1SPJA 4OS5A 4ZUHA 3GCTF 4Q4LA 1C2DA 4CRFA 4ABEA 1CHGA 3E90B 5EG4A 2L74A 2FI4E 1V2LT 5AVDA 3DFJA 5CHAC 1OHHD 2ZCKP 4A92A 1IQEA 1RJXB 3RXVA 1P2OA 1OWDA 3GY8A 1BTYA 1EUFA 2AEIH 2EY4C 2KM0A 2OD3B 3SU4A 2PFEA 1T8NA 4GHTA 2R3YA 2EC9H 5F03A 2CHAB 4IBLH 1SGRE 3E6PH 3BEFB 2KCPA 4MTBA 1HAXB 1C2FA 1WOFA 3P8OA 2P8OC 2VJ1A 5HIYA 1O31A 2CN0H 2ZDAH 2VIWA 3M5LA 3ESTA 1O3MA 2H9TH 3K65B 1ESTA 1P3CA 1GDNA 3K6YA 4MQAA 1PPFE 5LPFA 1UVTH 2XW9A 1LPGB 1Y3XA 4Q7XA 5AFZH 3TGIE 2HOBA 3MNBA 3W1EA 1ZSJA 1IQJA 1HFDA 4IS5A 2AHME 1O3FA 2ANKH 3BG4B 3KHVA 4D9QA 1DXWA 1Q3XA 1H4WA 2GDEH 1EZXC 1NO9H 2STBE
chains in the Genus database with same CATH topology
2BD9A 2Q6GA 3C1KA 1P11E 1BTUA 5DP7A 1P8VC 3T28A 1P06A 1EX3A 1GG6C 7KMEH 4MPUA 2ASUB 1CT0E 1HAZB 3LGTA 1QRWA 1C5OH 5C1YA 1MKWK 5F8TA 5DKMA 1O38A 2PGQB 1PPEE 1OP8A 4FUIA 1JIMA 1TAWA 4BTUB 1DY9A 1S84A 2OQ5A 4GCHF 5I25A 1XX9A 5A8XA 4UDWH 1OOKB 2BDBA 2OTVA 3UOUA 4YLQH 1K1MA 1UHBA 3QGJA 1XKBC 3NCLA 3RXJA 1PYTC 9ESTA 3U8RH 1GBJA 3CS7A 3GDVA 2H2ZA 2Z3EA 4JK5A 3UR9A 1Q31A 1TNHA 1C4V2 3PTNA 4SGBE 5DK1A 3GDUA 2VGCB 3SNAA 5FXLA 2SGFE 1GJCB 4AB9A 1AFQB 4IGDA 1VGCC 4CRCA 7LPRA 1UTJA 3E0PB 1QQUA 1MKXH 1ZPCA 3F68H 3PMJA 3T26A 2FM2A 4XOJA 1RTLA 1O3EA 4I31A 2PWXA 1KXFA 1DX5M 3T5FH 2BD2A 1DS2E 1TQ0B 5ABWA 1P2JA 1GJAB 4NWKA 2G00A 2B7DH 3SV8A 5EODA 5EOKA 2A4OA 3V7TA 1Y59T 4WH6A 3SU6A 3SO3A 1BTPA 3BEIB 5A2MH 1VJ9U 1ZTJA 1TPSA 2B9LA 2BZ6H 3SN8A 3MFJA 1FDPA 2SGDE 2Z6BD 1OYQA 2AYWA 1DT2A 1A1RA 3SUEA 1LCYA 1S85A 3BTGE 4X1PU 1ELBA 2PR3A 3SJKA 5J4SA 2W7SA 2ZU4A 3SHCH 1ETTH 4X2XA 4ZH8A 5C1UA 2SGPE 4TPYA 1HJ9A 4MPVA 3RMMH 1TGCA 4J2YB 5T6DA 2BY6X 2VVVA 1K1OA 1MTNB 4JMYA 1N1LA 2PSYA 4FUJA 1B7XB 4BAOB 1NU9A 1GJ7B 4BNRA 1NFWA 3ODFA 5EPNA 3ZVAA 2P8OB 1AB9B 1C5PA 1XUJA 3MOCA 3Q76A 1C1RA 2B8OH 3I77A 1C1MA 2GTBA 2F9BH 4HFPB 4UFDH 5ESTE 3STIA 1QB9A 3PYHA 1XUHA 2FYRA 2ZFPH 3SU2A 2ZU3A 3K6ZA 3PTBA 2BQ6B 2A2QH 3EA8A 2AGIX 2O8UA 2QV1A 4CRBA 1TBQH 2ZI2H 1XVMA 4XDEA 3FZZA 3KQCA 1O3KA 1BRUP 3A86A 1CGHA 3IG6B 4O03A 3SU5A 1GDUA 1V2UT 2A7JA 7GCHG 4I7YH 3S69A 4ISIH 1EQ9A 1SLVB 1HAGE 2J38A 2FMJA 1TPAE 2PKAB 1QGFA 4ZKSU 1SGNE 2JH6D 1O37A 1Z8RA 2ZFRH 1ZMLA 8ESTE 2PW8H 4NA9H 4CRDA 4INHA 1O2GH 5EGMA 1GI2A 3M36A 5C3NA 4KGAA 1AKSA 3HATH 1KXBA 1UVSH 3AVZA 1VITH 1WCZA 5T6GA 1XM1A 1SHHB 1K1PA 1EAWA 3Q77A 1GBEA 2OBQA 1OWIA 1DANH 1RIWC 4X2WA 3T62A 6GCHF 3ZZCA 3MO9A 1C5SA 1KLJH 2A5KA 3OSYA 4LOYH 2ZZUH 1GHAG 1YBWA 1SOTA 1W8BH 3FANA 4DW2U 4GUXA 3VB6A 2G81E 3MH4A 2F9OA 4X6OA 1RS0A 1VGCB 2J92A 2JETC 5HYOA 4E06H 2G55A 1TNKA 2P59A 2BTCE 1F5LA 2SFAA 4FU9A 4I33A 3UTUH 2ESTE 3BTTE 1A7SA 1CGIE 3RMLH 4ZXXH 3NUMA 1X7AC 3A89A 1J8AA 1THRH 1HJAC 4NIXA 1ESBA 4JCNA 1O33A 8GCHF 3SZNA 1GPZA 1KXEA 1T7CA 1TWXB 1FMGA 1QR3E 3RXEA 1FNIA 1O0DH 2BYAX 4JZIA 1V2TT 4ABHA 1GI6A 4O97A 1MQ5A 2P16A 3VB5A 1TOCB 4AG1A 1BB0B 3LGWA 4YZUA 2CMYA 4AB8A 1ELCA 1Y5UT 4LZ1H 1HAOH 3BTKE 4Y10E 3C27B 3HKJB 1QY6A 1SGTA 2BLVA 1HYLA 2F9PA 2V35A 4Q7ZA 2H9EH 1EPTA 3ZYDA 4U01A 4ZKRU 1HAYB 3PWBA 5C5OA 1EZSC 1TMTH 3FP6E 3V3MA 2AMQA 2D2DA 3LJOA 2BB4A 3MNCA 1D3TB 3UQVA 3D49H 3W94A 3QTVH 1BT7A 3SV6A 5EXNA 3HGNA 1SGYE 4D7FA 2C8XB 3SOSA 1GBCA 4RKOB 3EYDA 3BTEE 1GMHF 1Y5AT 3OY5U 3QZRA 4NFFA 4WXVA 1SLUB 1LPZB 3RXMA 1UTNA 4I8LA 1EP6A 1ZPZA 2QF0A 1PPBH 3M7TA 2PKSC 1Y3WA 4FVBA 3SGQE 3KIDU 1E0FD 2BDAA 4DCDA 6CHAB 4Y0YE 1C5MD 1V2KT 1CA0C 3P8FA 3RXKA 3TH3H 1TLDA 3AW1A 3VGCB 4D9RA 1UTLM 2GCTC 1C1PA 2W3KA 1PPCE 3MH5A 1K1LA 1HLTH 1HAIH 4OS7A 1GJDB 1GMDG 2OP9A 4ASHA 3KQDA 1O5EH 2OC7A 3KQBA 4Y7BA 1LVMA 1O3OA 1F5RA 2WYGA 4CH8B 1ELGA 1GHBG 2DUCA 1J15A 3GY6A 4D8NA 1YPGH 1NROH 9LPRA 1NTPA 1Y5BT 3FP8E 5J4QA 1L2EA 1HDTH 2CGAA 3SNBA 1TGBA 4X1RU 1O3LA 4BOHA 2PGBB 3MU1A 5EU8A 2KAIB 4I8KA 1WTHD 1AI8H 3L3TA 1PJPA 2KAIA 1DY8A 3BEUA 1O3HA 1B0EA 1DSUA 1EB1H 4TY6A 1G37A 2XWBI 2NU1E 1RIWB 2AH4X 4YM9A 3FFGA 4QT8C 1K21H 1D3PB 5AFYH 3EA7A 1G30B 3EA9A 3A83A 3A7VA 1VITG 4ZHMU 1NM6A 2NU3E 2UUFB 3PLBA 2JETB 1YPMH 3VB4A 2GV6A 2CHAC 2QN5T 1WBGB 2PUQH 1E38B 1UK3A 2ZDVH 3AW0A 1GMCG 4A1TA 1GI7B 1Z1IA 3K2UA 2H5DA 1KIGH 5JBTA 1HXEH 2J94A 1HJAB 1RGQA 2RA3A 1LQEA 1ZMNA 4XBBA 5JYIA 1HGTH 5JBBS 3GCOA 2ZHQH 4Y11E 3QTOH 3MU0A 1V2WT 5JB8S 1UTOA 5HXFA 3MYWA 1C2LA 5K0HA 3B9FH 3QUMP 1GHXH 2G51A 1AE8H 1AMHA 2ZO3H 1FAKH 2BMGB 1Z8GA 2C3SA 2HGTH 5H4IB 3TU7H 3U8OH 4BTTB 1NZQH 3BG4C 4MNXA 2TIOA 5C20A 4CBOA 2R0LA 2FYQA 1NFUA 1G3DA 1NRNH 1ZHMA 4DVAU 1UVPA 1WUNH 1A5HA 3UY9A 1KDQB 2FOEA 1O2SA 2BD4A 5DPAA 1SB1H 4AGJA 2ZFTA 1TGSZ 2BVSH 1AHTH 4DURA 1N6YA 4DIIH 2BHGA 1W12U 3LDXH 3M3TA 2BY5X 1LHGH 4D7GA 3VXFH 1AGJA 5ESBA 1ZGVA 3I78A 1SHYA 2G4UA 1SGIB 2FLBH 1QBNA 4K5ZA 1GJ6A 4Q2KA 4I8GA 1S0RA 1EJAA 2BQWB 3QGNB 1S5SA 2PKSB 3F9EA 1C2MA 3UUZA 1BRBE 3FAOA 3SUGA 5JPMH 1NRPH 4ABBA 1FONA 1GVLA 1C5VA 1MAXA 1TFXA 1BDAA 2ZPRA 3BTFE 1EAIA 1GJ4H 2VGCC 1DLKB 2GCTB 3ZVGA 1W2KH 4WH8A 2D26C 8KME2 4GHQA 4SGAE 3M7QA 4AYYB 1GBAA 1FI8A 4E05H 1M9UA 2UUJB 2VH6A 1KXCA 1ANDA 3QK1A 3L6PA 3O8BA 1IQGA 1O2HA 1EASA 2AERH 4MNVA 5JDUB 1XUIA 1QQ4A 2BVRH 3F9FA 1O2LA 1O32A 3TK5A 1V2VT 1C2HA 1T4UH 1O5DH 1BBRH 2A7HA 5C5NA 1K1JA 2A0QB 3MNXA 1LTOA 4RKJB 4X8UH 4OS1A 1YPHC 1BMLA 1SQTA 2QXIA 5E2OA 5EQSA 2V6NA 3JZ2B 1EZUC 3ZZ3A 1A5IA 4KTCA 1S0QA 4Y76A 3RLWH 4FUDA 2Y5FA 5LGOA 4H6TA 1V2PT 1IQNA 3BIUH 2F3CE 2B5TB 2VWLA 3OTJE 3EDXB 8LPRA 2STAE 1BUIA 2FOAA 3MU5A 3U69H 5GPIB 4KTUA 1C9PA 3MTYA 3GCTG 2WINI 3TNTA 4U30A 1MTNC 1TALA 1SQOA 4WMFA 4K8BA 1GHYH 1YCPH 2C8YB 1C5XB 2A1DB 1IAUA 2K1QA 1K1NA 2ZFQH 2Q6DA 1L4DA 1WTGH 2XRCA 1THSH 1UCYH 1AB9C 4B2CA 5EW2H 2ANYA 1O2VA 3LONA 1O2JA 3U8TH 2FZZA 1TOMH 4FUBA 3PV4A 1V2ST 1RXPA 1CT2E 1F0RA 2B0FA 2O8TA 1P2QA 2BXUH 3IWMA 3SHAH 3M37A 1D3QB 1FY5A 1VR1H 3TH4H 1DPOA 3ZZ8A 5A8YA 1AZ8A 1AUJA 4NIYA 1T8MA 1QURH 2ZDKA 2TGPZ 3R0FA 5DG6A 1HIAB 4NA8A 1MBQA 1YP9A 4BAHB 1HAHH 1ZSLA 1G3CA 3MWIU 1DWCH 1HIAA 2ZG0H 3PB1E 4Y6DA 5DP8A 1CGJE 3I29A 4TYDA 3LJJA 3HK6B 2BDGA 2GP9B 4BXWA 3HGPA 2G5NA 1HUTH 2J4IA 3RXFA 1O3PB 2RCEA 3SI3H 4MNYA 4GSOA 4MVNA 1G36A 1H9HE 1MTWA 3ZZ9A 1NFXA 3TJOA 1CVWH 5ETXA 3M7UA 1UHBB 5GXPA 1L1NA 1TQ7B 1OP0A 2TGAA 2GX4A 1AVGH 1QL7A 1XXFA 3T29A 1DLEA 2D1JA 1TABE 1ACBE 5GCHF 5GDSH 5A0BA 1O5GH 1PPHE 4Y8YA 1EOJA 2ODPA 2AFQB 2ZGBH 2UWOA 2Z7FE 4CHAB 2ZGHA 4AORA 1BRCE 2CJIA 5AHGH 2FOGA 2XNIA 5BPEA 1P10A 4ABAA 5HM9A 1SGFG 3A84A 4ZROA 4X6PA 1T31A 1E36B 1O5CB 3VXEH 3H7OA 1B5GH 4HI3A 4UFGH 5A8ZA 4ISLA 1ZTKA 3RC6A 1DUEA 3SI4H 3GY4A 1UVUH 3RXPA 4FU8A 5CMXH 3CP7A 3M3VA 4ESTE 1DWDH 1H9IE 2OQUA 3TPIZ 1FPCH 4K3JA 1TNIA 1H8DH 2V3HH 4DIHH 2Z9GA 4RSPA 2HPPH 2QXHA 1SGCA 1KY9A 3PLPA 4CR5A 2NU0E 1EPTC 3D62A 1A4WH 1EAUA 1JMOH 4YOJA 2YOLA 3A80A 4LK4A 3ZZBA 2FXRA 1E34B 1ORFA 4MPXA 1O2WA 1AVXA 3TGJE 1IOEA 1W3CA 2ZHDA 1MMJN 2VIQA 3M35A 3UR6A 4DY7B 3GDSA 1L1GA 4TWWA 3RXQA 1Y3UA 3MU4A 3FVFB 4Y71A 2ZDMA 3RXGA 1BMNH 2WUCA 2H1UA 2OXSA 2J9NA 2BDCA 2GV7A 1W7GH 4ABFA 3F6UH 4B2BA 1WV7H 4NCYA 4CREA 2HNTF 1EATA 3Q00A 2VIOA 3A82A 1ARCA 3D65E 3RC4A 1MZDA 1UMAH 2Z9KA 4WJG2 2GZ9A 2VIDA 5C1XA 2BVXH 3SJ9A 1C5NH 4X8VH 6CHAC 1C5YB 1XUGA 3H5CB 1O3GA 4U2WA 2Z3CA 3A7XA 1EZQA 3VGCC 3M5MA 5L2ZH 2ZQ1A 2XCNA 2H9HA 2GCHF 3PROA 1BCUH 1TYNA 1XVOA 3ZZ7A 1HRTH 1YPEH 2GZ8A 1O3NA 1WSSH 1Z8JB 1OYTH 4AG2A 1O3DA 2R2WU 1GBLA 2RDLA 1JRSA 3SV9A 1D9IA 1GVKB 1V2JT 1PPGE 1V2RT 7GCHF 3TLOA 2O8LA 1A3BH 1G3EA 3G01A 4VGCB 2F83A 1P05A 1EJMA 1S6FA 3FZDA 1P2IA 4F49A 1QRZA 4E7RG 2FTLE 1BJUA 1P9SA 1QB6A 1XKAC 2GDDA 1AKSB 4AFSA 4KP0A 5FHTA 1O30A 2ZU1A 1GCTC 2TPIZ 3QX5H 3RU4T 4IW4E 1Z6EA 3PLKA 3LH1A 4IMZA 3RXSA 2Y7XA 1HJ8A 1JOUB 1K22H 3MH6A 4R0IA 3A7WA 2M5TA 4DG4A 4XSKU 2VWNA 3ZVEA 3BTME 1TIOA 1EP5A 3PMAB 1O2XA 4MG3A 1DITH 3EE0B 1C2EA 4NZLA 4IMQA 3RXLA 1TGNA 1KSNA 2BD8A 4KTSA 4JZFH 4K60A 2TRMA 6GCHG 2ZIQH 2R0KA 1GI0A 4BXSA 1KYNA 3MMGA 1ZSKA 3OY6U 4CH2B 4UFEH 4FU7A 1CHOG 1DFPA 1BBRE 4A7IB 2ZTYA 5DP5A 1ZPBA 1ELDE 1ESAA 1TX6A 1FQ3A 1TX7A 1UTMA 1W10U 4AFQA 1QHRB 3DA9B 1ZGIA 1O2KA 2CF8H 1GI1A 3MI4A 2W3IA 3OX7U 4ZAEA 4WWYA 1QBOA 4NG9H 3UWJH 2HALA 3GCHB 1WYKA 8GCHG 1C1NA 1GJ9B 3N7OA 1G2LA 1O2IA 1SI5H 5FCKA 3TVJB 4B1TA 1ZJDA 1ZRBA 3T25A 1O35A 1EPTB 4B76A 3RUOA 1VJAU 3P70B 3TNSA 1IHTH 1S6HA 2WPIS 1SBWA 1ETRH 1F92A 1Z8IB 1O2MA 2VVUA 2A5IA 1MTVA 1WU1A 2WV5A 1YPJH 1NY22 3TGKE 2BX3A 4JYVH 2ZKSA 2P94A 2WUBA 3ATIA 4ABGA 1SSXA 5EQQA 1UCYE 1F0UA 2ZHFH 4Q80A 3P8GA 3SQHE 4ZHAA 1TB6H 2BY7X 1PQ8A 4BAQB 3LKWA 3KGPA 2ZTZA 1MCTA 1TGTA 4GAWA 1GMHG 1AZZA 5EPYA 2WPMS 4JZEH 1SGQE 3EAJA 4IC5A 3RXDA 2XC4A 5SGAE 1P9UA 3OYPA 1S82A 1GVZA 2UWLA 2P3UB 1WQVH 4HTCH 1SMFE 1LQDB 3Q3YA 1CA8B 1ZHPA 1SQAA 1AWHB 3KEEA 5PTPA 2QCYA 1KLIH 4NWLA 1QL8A 2C8WB 3HKIB 3RXHA 1C5WB 3B8JA 3Q3K