2FOFA

Structure of porcine pancreatic elastase in 80% isopropanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fofA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fofA01
2P3FH 1SR5C 3NWUA 2ILNA 2OBQA 1OWEA 2P95A 1GJCB 3EAJA 1PPGE 4NFFA 3NUMA 3M5NA 4DJZB 1HDTH 3RXTA 1O33A 1W0ZU 4PROA 1MTVA 2GCTC 4X1SU 1M9UA 5IYTA 1GBAA 1O5EH 2CF8H 3OX7U 2Z6BD 1HJAC 1H9HE 1O3MA 4ZHAA 1J15A 2A0QB 1EAIA 1S83A 1V2RT 2BDCA 5F6MA 1QQ4A 5C1UA 1C4Y2 1A5IA 4TY6A 1DWBH 1DVAH 1XXFA 2FESH 1QL7A 1IQJA 2W7SA 1O3OA 1CU1A 1HJAB 1W11U 2Q6FA 4WXIA 2O9QA 1T8LA 2Q1JA 3MHWU 2SGPE 6CHAC 1O2HA 1XUGA 1C5NH 1O5AB 1GBCA 3UOUA 1GVLA 2VJ1A 1MTWA 2ZDAH 3KHVA 3C1KA 1QBVH 3ZVGA 1MQ6A 5I25A 1XUIA 1TX7A 1D3DB 3D49H 1CHOF 3MU1A 4HZHA 1C5XB 1YLDA 1ANEA 4AB9A 1VCQA 1NRSH 1SOZA 6CHAB 2C4FH 1Z7KA 1MCVA 3PM3A 4IBLH 5J4SA 2C8ZB 2H5CA 1O3PB 2FOHA 2ZWLH 4NA8A 5C67A 1QA7A 1Q3XA 1UTLM 1SHHB 3TGIE 5C5NA 3ATIA 2R0KA 4HI3A 1OWHA 1BTHH 3C27B 1LHDH 1DWDH 1ZTLA 1H4WA 1GJ4H 4X8SH 2OINA 2UUKB 1TE0A 4CHAC 4OS6A 3S69A 1Y3UA 2ZCHP 2P59A 1ZMLA 1A7SA 2FO9A 2FMJA 1ZPBA 1LVOA 3NZIA 1UVTH 1TX6A 1C5VA 4I8LA 1BB0B 1NRQH 3GY7A 3PWCA 4FUJA 5HMAA 2OUAA 2D8WA 1ETSH 1G3BA 5FBEA 1Y3XA 2Z3DA 3TJNA 1V2NT 4ISOA 1DXPA 4AYYB 1KTSB 4CHAB 1W14U 1LQDB 1FN6A 3P92A 3TJOA 4Y7AA 1BRCE 2VIWA 3LDXH 4Z0KA 1Z6EA 1C2LA 1PPCE 4O3UA 4I8HA 3QWCH 1EP5A 1W8BH 3SU5A 3ZZBA 1BTZA 3ESTA 4H42U 4FUFA 3DHKH 1TRYA 4X6NA 3MU5A 2ODYB 3BEUA 4BNRA 1SLWB 4O03A 1A0HB 1EJAA 1F5KU 2NU3E 1C5ZB 1D3TB 1ELDE 3AVZA 4E7NA 1JIRA 5ETXA 1SGPE 3D65E 2GGVB 3Q3XA 1KDQA 1KY9A 5LPFA 4FUBA 3STJA 3M5MA 1ZGIA 1C5TA 1C5WB 2BZ6H 2G51A 1OSSA 1SGTA 3UR6A 4NWLA 2IOTA 1QJ1B 1TBQH 1F5RA 1D9IA 3SNCA 3PLBA 4UFFH 2O8WA 4R8TB 1UTKA 3GY3A 3A7ZA 1CA0C 1BRBE 3DT0H 4DIIH 1GHBG 2W5EA 3P95A 3ZZ4A 1FV9A 4K3JA 1O2GH 1Z71A 1NC6A 1EB2A 2ZHQH 3RMOH 1IQMA 1AWFH 1P05A 3RXRA 1CT4E 1O2SA 1O3HA 1GBKA 1JMOH 1S6HA 3A8AA 2XWAA 1DLKB 1FI8A 2IPHA 2WYJA 1CA0B 1K9OE 2XC4A 4YZUA 4WMFA 2B9LA 4OS2A 7GCHF 2CF9H 4NCYA 1Z8JB 4FU8A 1P2IA 4QT8C 4CRBA 1PJPA 5JBTA 1QA0A 5C20A 2BVRH 1YCPM 1KDQB 1UMAH 1P12E 4A5TS 4MNVA 1UVOA 4FXGH 3VXFH 1K28D 5FPTA 1EB1H 5DP9A 3SQHE 1MTSA 5DP6A 3FAOA 3PB1E 4TYDA 4DY7B 2AGGX 1GJBB 3QN7A 1W13U 1TGBA 1GL1A 3RMLH 1DY8A 1AFEH 1YF4A 2PGBB 1EPTA 2F9VA 4Y11E 3ATWA 3IWMA 1H1BA 2BXUH 3BV9B 3HKIB 4XSKU 2FLBH 1QQUA 1H9LB 2TGTA 2VVVA 1NRPH 4OGXA 1P09A 1GMHG 1KXCA 5L2YH 3LU9B 1DSTA 3BTFE 3SO3A 1NU9A 2SFAA 4KP0A 4DW2U 2J4IA 1ARCA 3LGVA 3MNCA 1UTNA 1O2ZA 1N6YA 2GCHG 1ZHPA 2PGQB 4X8UH 1SGEE 4SGAE 1HJ8A 2R0LA 1Y5UT 1ZHRA 1XUFA 1OX1A 1TONA 4CRDA 1Z8IB 7ESTE 4BAHB 3RXPA 5F03A 1RXPA 1S84A 5EW1H 3OU0A 2WPIS 1S82A 1BMNH 3PYHA 1ZTJA 2ODPA 3BG8A 1B0FA 2FS9A 1VITH 2Q6DA 1ACBE 1HLTH 2Y5GA 1T4UH 4MDSA 1TWXB 3SV9A 2FIRH 3QGNB 3ZVDA 2BX4A 5DP3A 1Y3YA 4ESTE 3M3VA 2BDYA 1EPTC 1JXPA 2ALPA 1O3FA 2OP9A 3A7YA 1T4VH 3VEQB 4YM9A 1MTUA 3RDZA 2QGRA 2FDAA 1AGJA 2GX4A 3QX5H 3TH3H 2GT8A 1O2MA 1TGCA 3VB5A 3M36A 3SJIA 1AMHA 2FPZA 3SJ8A 1ZOMA 2RA0A 1IQLA 3MH6A 2J2UA 2ZO3H 1EPTB 5GCHF 1BMMH 1VZQH 1LPKB 5FX6A 1GBFA 1P3EA 5DPAA 1SI5H 2BD8A 1AY6H 3GY2A 3M7TA 1F0TA 1LO6A 4OS5A 4BAMB 2ZFPH 1SL3A 1HUTH 1SFIA 2F9BH 4U32A 2QAAA 3BTEE 1FPCH 2EI6A 4DG4A 1IHSH 2A5KA 4F4OC 1HRTH 4X0WU 3TK6A 1SFQB 3VB3A 5EODA 4FUGA 1MAXA 3RXIA 3ZZ3A 4MQAA 1FNIA 2A1DB 1YKTA 2WPHS 2GT7A 2TGAA 1K1LA 1GCTB 3FFGA 4OGYA 3U1JB 1FIWA 1A3EH 5FAHA 1V2WT 3ZZAA 2ALVA 5A8ZA 1GHWH 3LH3A 3GCHB 4GCHG 2VH6A 4YOIA 1J17T 3SNAA 2XBWA 2V0BA 1GGDC 4Q7YA 1E38B 4XOJA 4CH8B 4GVUA 1O3BA 3G01A 2WUBA 1SG8B 4NIWA 2A2QH 1G30B 3F9HA 3GISB 2PWXA 4O3TA 1AB9C 1YPGH 1A0JA 3PMBB 1B0EA 3U1IB 4BOHA 4NWKA 2G00A 1O3EA 1KYNA 2A5AA 5SGAE 3RXUA 4B73A 1AVXA 1O2WA 1QGFA 2QY0B 1G2LA 5GPIB 2XBXA 1FUJA 1MTNC 3VGCC 1AB9B 4TPIZ 5EG4A 2A4OA 1OS8A 1F0SA 3QTOH 2HPPH 3PO1C 5EXNA 1ELTA 3TGKE 2A4QA 1A46H 5T6DA 1LCYA 1WV7H 3SUFA 1AHTH 3E8LA 3PTNA 1G3CA 3GY8A 1PPFE 1MTNB 3VGCB 1Y3WA 3BEFB 3M61U 3EE0B 2WV5A 3PO1B 5ABWA 1HAZB 3RXKA 5LH8A 3M7QA 1UCYH 4Y0ZE 2Y5FA 1H9IE 4ISLA 1F7ZA 1FY8E 3HATH 1GJ5H 1J8AA 1NO9H 3CENA 1ESTA 5F8ZA 3URDA 1FMGA 3UNRA 2V35A 1GJAB 1QL9A 3O8BA 2A5IA 3ZYDA 2C8WB 1GI0A 3NPSA 1TGTA 3MNSA 4LK4A 3HGNA 1MKXK 2FTMA 4GUXA 1O2IA 4MVNA 4AYVB 3TGJE 3I29A 1DS2E 3M35A 3RMMH 3RXSA 1O31A 3Q00A 4FVDA 5PTPA 2XRCA 2QC2A 2RDLA 4I8KA 1MH0A 4FUEA 2FOFA 3ODFA 1C2FA 3E0NB 2VB0A 1K22H 4AGJA 4MNYA 5FBIA 4AX9H 1VCPA 1KXAA 3MH4A 4X6OA 1LTOA 3H5CB 3GYLB 4AGKA 1C2HA 1SBWA 2FP7B 2LPRA 5JBBS 2XNIA 1PQ7A 3RXJA 2ZGCA 2CGAA 4D8NA 2FTLE 4Y8XA 4XBBA 1E37B 4GHTA 1EJNA 1P2QA 2GV6A 1JWTA 1GI1A 1V2KT 1TIOA 1T8OA 4K1SA 4Y0YE 1HXFH 4AZ2B 5GJ4B 3BIUH 3EQ0H 5EGMA 4JZ1A 2QXIA 2OLGA 2ZPRA 4Q7XA 1DUEA 3VXEH 1ZTKA 3A7TA 1ETTH 4WXVA 1GI3A 4X6MA 1GVKB 1HYLA 4Q7ZA 1GHYH 3SI4H 2BLQA 4XE4A 2GP9B 1EUFA 1W12U 2F3CE 2NU2E 1VITF 3RXLA 1ESBA 3DUXH 4AB8A 5E0HA 1K21H 2NWNA 1ARBA 2GMTC 3F6UH 1P2MA 2VWMA 1G2MA 2AEIH 3RXDA 4AFSA 1HAOH 2SGQE 2F91A 1S85A 1YC0A 1O3IA 4O9VA 1SQTA 5F8XA 2PSXA 1KTTB 1AWHB 3BTHE 2J9NA 3RXGA 1K2I1 1F5LA 2GMTB 1IQIA 5TCCA 1F0UA 1OWKA 4MTBA 1QY6A 2R3YA 4JZDH 3IITA 1YPJH 1HAGE 2FI3E 2VH0A 1GMDG 1DM4B 2FLRH 1OXGA 2ZI2H 2PLXA 4B2BA 3OSYA 1AZ8A 1TNIA 1E0FD 3BG4C 1EATA 1UCYE 1THRH 3SJ9A 1NRNH 1XX9A 1NZQH 3F1SB 3HPTB 1O3JA 2AIQA 1ORFA 1C1VH 4IGDA 3FP8E 5JPMH 1SQOA 7GCHG 3E91A 3P6ZB 3A7VA 3BG4B 2GDEH 2ANYA 2NU1E 3U8TH 3RM2H 4LXBH 4KELA 1GI4A 3LONA 3PLPA 1WOFA 2VIDA 4ASHA 3SNDA 2BD5A 2CN0H 2FEQH 1FAXA 1EZUC 1UO6A 2ZECA 3RMNH 4D7GA 1SGIB 3A82A 3UQOA 1GDNA 1GI6A 2OC7A 3T5FH 1O5GH 1BITA 1THSH 2Z7FE 4H6SB 3MO6A 1CO7E 3AAUA 4E05H 1ELGA 4KTSA 5FCKA 1C2KA 4IW4E 1FY5A 3O8DA 1P06A 1C2EA 2W26A 4K1TA 1Q2WA 4AFUA 3T27A 2BDIA 1CA8B 4WVPE 2I6SA 4JYVH 1MAYA 1MUEB 2YNBA 4FVBA 4CRFA 4OS7A 1AN1E 3LGIA 1VCWA 1Y8TA 1HXEH 2B8OH 2PTNA 4R0IA 2A7HA 1O2VA 2BD2A 3PWBA 5A0CA 2XBVA 4ABIA 1OKXA 4UFEH 3L33A 4GLYA 2TPIZ 3A8BA 1EOLA 1UVPA 4WMDA 1WUNH 3RUOA 2P8OC 4D76A 1BMLA 1FN8A 1P3CA 3F9FA 1ZGVA 1LHFH 3MU4A 3TU7H 4WF8A 5CMXH 3TNSA 3T28A 1O2OA 2H9EH 1QNJA 2A7JA 4AG1A 2Y81A 2JH0D 3E3TA 4I8JA 4XDEA 4A6LA 2A45B 1IQNA 2P8OB 2Z9KA 3TVJB 1HCGA 3FP6E 4U30A 2FWWA 1ANBA 1HB0B 3BEIB 1UTPA 1GHAG 4KTUA 2ZPSA 3NCLA 2J94A 4INLA 4YESB 3T25A 1GPZA 2BMGB 4DT7B 2D26C 4UONA 1G3DA 2BD4A 1HPGA 4ABBA 2BVSH 1VR1H 2CJIA 1EZQA 3P8FA 1GBMA 1FY1A 2WINI 3RXOA 4LZ4B 1ID5H 2QF3A 1SC8U 1O2JA 3U8RH 1D4PB 1L4ZA 1BTUA 3GY4A 5JBAS 1ELEE 2OC8A 2SGDE 2A7CA 2WYGA 5GCHG 3ZZDA 1PQ5A 3UR9A 4XBDA 2WV4A 5HXFA 1C9PA 1B7XB 2FOEA 1J16A 1Z1IA 5LPRA 1A5GH 2A4GA 2AFQB 3LKWA 5DP4A 3LGTA 1E35B 5K7RA 2O8TA 1GHVH 1SGQE 2Z94A 3K6YA 2PSYA 1EQ9A 3TJUA 1TQ7B 3D23A 1PPBH 3SGBE 1TA2A 2GTBA 1OPHB 3S9BA 4ZKSU 2RCEA 1GMCG 3GYMA 1NFXA 4CBOA 4INHA 3BTWE 3BF6H 1PPHE 4I32A 2DE8A 5EQSA 1O38A 1FPHH 2R2WU 3ZV8A 2HPQH 4ZHMU 1AO5A 4NGAH 1P03A 1SGYE 2BDAA 4KTCA 2VU8E 2VINA 3MU8A 4RN6A 4B71A 1HJ9A 3M37A 1OP0A 5JBCS 1O34A 2SNWA 1D6WA 3RC6A 1KLTA 3E90B 3ATKA 4D9QA 6LPRA 4WY3A 3QO6A 2VIPA 2Y80A 1XMNB 3BSQA 3RU4T 3S9AA 4MPVA 3UNSA 1BBRH 2Y7XA 1L1JA 1LKBA 4AOQA 3DA9B 1ESAA 2ZKSA 2H6MA 1KXDA 2UUYA 1TA6A 3K2UA 5AHGH 4ZXXH 1O5CB 2AMPA 3TK9A 1SSXA 3EA8A 5DJ7A 2UWPA 2ZP0H 1MKWK 3UNQA 2YOLA 1FJSA 4I33A 2I6QA 2P94A 2J38A 2Q6GA 1LVYA 1DT2A 1CSOE 2ZDNA 1C5RA 4BAQB 1V2TT 4Y8ZA 4K8BA 1RJXB 1O3GA 1GI9B 1SPJA 1OWDA 3M3SA 4D9RA 3MI4A 2ANMH 3EDXB 4VGCC 3EA7A 4ABJA 2H5DA 1ZRBA 1OP8A 1V2OT 3BTGE 3U8OH 1PPEE 1SGFA 1TPAE 2M5TA 1NM6A 3FVFB 1T8NA 2AMQA 8LPRA 1FAKH 3GOVB 3MO9A 2BVXH 4ZUHA 1O32A 1GBDA 1B5GH 1QRXA 1EAUA 3SOSA 4VGCB 3S7KB 1WBGB 3PV4A 1BZXE 2VWOA 4WWYA 2G8TA 3RXVA 3UUZA 1T32A 1V2VT 1NT1A 1D3QB 3KQCA 1BTXA 1GL0E 4CRGA 2BLOA 1IAUA 1GBIA 1OWJA 3S7HB 2ZPQA 1AU8A 4FU9A 4X8VH 1LPGB 2CV3A 1GI5A 1C1NA 2R9PA 1EJMA 4NZLA 1JRSA 1C5YB 2BD9A 2Y82A 2OD3B 3KGPA 2STBE 3UOPA 2XWBI 3SUDA 1WCZA 2WPKS 1AVGH 1THPB 3ZVCA 2ZFSA 3FP7E 1QJ7B 1A2CH 1OYTH 2BQ7B 2ULLA 5HM2A 5JB8S 3B8JA 3P17H 2ZU2A 1C5PA 1XKAC 2ZU4A 1O5DH 1WAYB 1G3EA 3QUMP 3LJJA 4AFQA 1C1RA 1NTPA 1TB6H 2PV9B 1FZZA 5EPNA 3MNXA 3E6PH 1VITG 1NRRH 2FYRA 3OYPA 1LPZB 3KF2A 1AKSB 3E16B 3FZZA 5GDSH 1A1RA 1YPKH 4NIYA 3U98H 5A0AE 5E0GA 1BBRE 3RXEA 2ZFRH 2VIVA 1C1QA 1AVWA 1C5UA 1P04A 2W3KA 2P93A 2ZQ2A 3SGAE 1GCTC 4FUCA 1GBLA 4X6PA 1GBTA 2AS9A 2F9PA 3GCHC 2TGDA 5AFZH 1O39A 2XBYA 2XTTB 3MMGA 1O2QA 3DD2H 1AUJA 3F9EA 3GCTG 1O3CA 1EOJA 4NSYA 5FX5A 2ZHFH 2BZAA 1PQ8A 5EW2H 1DFPA 1T31A 2J95A 2W7UA 1VJ9U 4NG9H 3W94A 4BANB 5TCAA 3MWIU 1FIZA 2C3SA 2ZHEH 2PHBA 1LVBA 1C5SA 4Y6DA 4X2VA 2STAE 1YBWA 1A61H 2QA9E 3FZDA 1SMFE 4JYUH 3B9FH 3R3GB 1TGNA 2F83A 3GDUA 1BT7A 1SGNE 4A92A 2ZDMA 3SU6A 3BTQE 2WPMS 4NZQA 1G32B 3SN8A 2FXRA 3RXQA 2C8XB 3ZVFA 2ANKH 4MG3A 3EGKH 4WJG2 4X2XA 2ZFTA 2Y7ZA 1CVWH 5DP5A 4AFZA 1UJ1A 3H7TA 1EXFA 3S0NA 1AUTC 2XW9A 1QRWA 1QURH 2HVXA 1O0DH 3NXPA 5EQQA 1K1MA 1V2LT 5EXLA 3JZ1B 2VIOA 4IS5A 4DVAU 2H2ZA 4KKDA 3BTME 1A5HA 3U69H 4CR5A 4TY7A 1DITH 3TNTA 4ZROA 1P10A 1C5MD 4ZXYH 3TK5A 3A8DA 3UFAA 4I31A 3HK6B 2QN5T 3OTJE 1JOUB 1CGJE 1JRTA 1EX3A 4MPWA 1TABE 2RG3A 1C1SA 3LOXA 3R0FA 3L6PA 1F2SE 1YYY1 4A1XA 1CGIE 1GJ6A 2Z3CA 2D1JA 2Z9LA 1ZPZA 5BRRE 3ELAH 1E34B 1CHOG 1SGCA 4B76A 4IC5A 2PFEA 3ZVAA 3NKKA 4THNH 2GV7A 4O97A 3VFEA 1UHBA 1LHCH 1K1PA 2VWNA 2SGEE 1TNHA 1C1PA 2IJOB 1HAIH 5A8YA 4ISHH 1MBQA 3HGPA 1BTWA 1QCPA 2ZCKP 3K65B 3MOCA 1C5OH 1GBHA 1GJ9B 1P02A 2H1UA 5J4QA 1NN6A 5AFYH 2AIPA 1V3XA 3T29A 1W3CA 3QGJA 2FI4E 1PYTC 2XCFA 4HTCH 2V6NA 3UQVA 1V2QT 1BRAA 4GSOA 1T7CA 1UVSH 1IQFA 2G55A 2ZQ1A 3TJVA 4HGCA 2ZHWH 5H4IB 4YO9A 1XM1A 1V2MT 3L3TA 1XUHA 3M7UA 1SQAA 1J14A 1EP6A 1SVPA 4DOQA 4GPGA 1HIAA 3ZZ9A 1KXFA 3O8CA 3TIUA 1QB9A 2KAIB 3RXMA 2FOMB 3E1XB 1F92A 3K9XB 4Q80A 3CP7A 1P2JA 1TBRH 1BRUP 1HAVA 1MD8A 1C1TA 1BHXB 1TFXA 5C5OA 4ZMAH 4JYTA 2EC9H 1IQKA 3A8CA 1UHBB 1C2MA 3A80A 3GCOA 5B6OA 8GCHF 3PTBA 1MZDA 1PYTD 2PUQH 5JB9S 3KNXA 4JZEH 2BY6X 2R2MB 4YLUA 4CH2B 3SBKA 1P2NA 2QF0A 5DK1A 4Y7BA 1S81A 3MNBA 2ZGJA 3RXAA 2A4RA 2RA3A 1N6XA 1XUKA 1OOKB 3SV8A 2ZG0H 5G4BA 2TBSA 1TPSA 4ABEA 4FUIA 4GHQA 4CRCA 1C1UH 4X1RU 1ZHMA 3V13A 4DIHH 3SUGA 1NS3A 3ZV9A 2ZA5A 1NU7B 1O30A 5FPYA 1D3PB 2BHGA 5C3NA 1TPPA 2DE9A 1O2YA 1P9SA 1W2KH 4JK6A 3UIRA 4B2CA 4ZKOU 2BD7A 3P8OA 4CREA 1HIAB 3GICB 1N1LA 1MMJN 4BTIB 2FYQA 4HFPB 1ZJKA 3KCGH 3V12A 5JDUB 2A31A 5FPSA 1MD7A 1WU1A 3SI3H 1W7GH 1HV7A 2BLVA 1HAVB 2QXHA 1QRZA 1L1NA 1CT0E 4JCNA 5E2OA 3A7XA 1SOTA 1TMUH 4Y8YA 2ZIQH 1K1NA 4MNXA 4GCHF 2B0FA 1VJAU 2ZHDA 5T3HA 2ASUB 4DCDA 1GI7B 3PROA 2O8MA 5FHTA 5DG6A 3PMJA 3U9AH 1Z6JH 5E0JA 4NA7A 3AASA 4BTTB 1TMTH 1EZXC 1OP2A 3SU0A 4XFQA 2SNVA 1L2EA 1O3DA 3A85A 9LPRA 3RC4A 2ZU5A 3UY9A 1GJ7B 1XVOA 1ZSKA 5A8XA 1DLEA 1UK3A 4ZAEA 1O2NA 1MCTA 4NFEA 4YLQH 3KN2A 3RLYH 1Y59T 2UWOA 3QZQA 3T62A 3V3MA 1QJ6B 1CHGA 5E8EH 8KME2 2VIQA 1TGSZ 1ZYOA 4OS4A 2V3OH 2D2DA 3LIWA 4UDWH 1S6FA 4FUDA 5IDKA 1QBNA 2H9TH 2OXSA 2BTCE 5T6FA 2GCTB 2AMDA 3FANA 1QBOA 4YOGA 1TAWA 3OY5U 1LVMA 4BXWA 2OBOA 1UVUH 2AGIX 5LGOA 1GDUA 1LHEH 2ZTYA 1GBEA 5EQRA 1ELFA 1GBBA 1P0SH 3PLKA 1A4WH 4YT6H 2AERH 2XXLA 1YLCA 2ZU1A 1CGHA 1BOQA 2HNTE 5FXLA 3A89A 2P16A 3ODDA 1P01A 3SW2B 5C2ZA 5DGJA 1ZSJA 1BDAA 1G37A 3KEEA 3Q3YA 1NROH 1HBTH 1O2TA 1RTLA 5ESTE 5GIBA 2AGEX 2BY9X 3ZZ8A 1QR3E 5C1XA 1H8DH 5DP8A 4YT7H 5L30H 3BTDE 4RKOB 1C2DA 2BQWB 3S9CA 5JYIA 4TWYA 1X7AC 3RU4E 3A87A 8ESTE 1GJDB 1DWCH 1YCPK 2ANWA 5EU8A 1FDPA 5A0BA 2OQ5A 3ITIA 2VGCC 3LGUA 5L6NH 2PTCE 1HAXB 3UPEA 1MKWH 1RFNA 3BIVH 4LZ1H 2BOHB 3SV2H 6GCHF 2BDBA 2HGTH 1HAPH 2W3IA 1IQHA 2CHAC 1ZSLA 4Y76A 2ZEBA 3RLWH 4AN7A 5AF9H 1G9IE 1QHRB 4Y79A 1DANH 1AI8H 4NIVA 1NPMA 1GI8B 3ZYEA 3UWIA 1DPOA 2VGCB 6ESTA 1Q31A 3SV6A 2HWLB 2OQUA 2FX4A 2OCVB 2ZNKH 5C1YA 1DOJA 1EZSC 2CHAB 5HYOA 3T2NA 3MYWA 3ZVBA 3QLPH 3HKJB 5AVDA 4ISIH 2JH6D 4UEHH 4AORA 2ODQA 4UD9H 4B1TA 3V7TA 4J2YB 1J9CH 1TMBH 1YPEH 2Y5HA 1ZMNA 3UWJH 4H6TA 2YNAA 1O2KA 3H7OA 2ZCLP 2WPLS 3VB7A 3O8RA 3OY6U 3VPKA 1GWAA 2BDHA 4M7GA 2ZTXA 3LC5A 2Z9JA 5EXMA 3LJOA 3MU0A 1RRKA 2HNTF 1NESE 3MO3A 3AAVA 4JK5A 5ESBA 5TJXA 3MFJA 3SV7A 1KXEA 1PFXC 1RD3B 4ABFA 1ZMJA 1AQ7A 4DURA 1GHXH 4CR9A 1Y5BT 1O2UA 2ZDVH 5GWZA 1MU6B 1DE7H 3F68H 1TALA 1NFYA 4U2WA 2IN2A 3ZZCA 1YP9A 4JZFH 1V2ST 1N8OC 1DSUA 4AG2A 2HLCA 1GMDF 3RP2A 3STIA 2ZF0H 1RTKA 1W7XH 2WPJS 2GZ7A 3N7OA 3ZZ5A 2FOCA 3RXFA 1O35A 3RXBA 4K60A 3TH2H 4K5ZA 1DICA 1QB6A 2PKSC 4WH6A 4WMEA 1G36A 1UTJA 2CMYA 5E2PA 1N8OB 1RS0A 2O8LA 1JIMA 4ABGA 1O3NA 3LC3A 1TNJA 4Q2KA 1BA8B 2LNCA 3ENSB 3ZVEA 1NFUA 2PKSB 4FUHA 3SHAH 2V3HH 3Q76A 1V2PT 3QDZB 2A32A 3I77A 4ZH8A 1ABJH 1BHXF 1NY22 3GY5A 1GI2A 2TGPZ 2AYWA 1WTHD 1AKSA 2G52A 3UREA 2FOGA 4IC6A 3F9GA 3A83A 1YPHE 1O2PA 1DDJA 4BAOB 1ZJDA 2H9HA 4MNWA 1L4DA 2GDDA 4ZKNU 1CT2E 2QV1A 3GDVA 1TQ0B 2F9UA 1GJ8B 2XCNA 1GBJA 4A1VA 3PMHB 1P9UA 1XUJA 4TWWA 4IMZA 4MPXA 3SZNA 1QTFA 2ZGBH 5BPEA 1L0ZA 2BQ6B 2GKVE 5A09A 1K1IA 4Y71A 1ELBA 1INCA 5F8TA 3SU2A 1RTFB 5EPYA 1FQ3A 3BTKE 1MQ5A 1HFDA 2FOAA 2WUCA 5K0HA 4X8TH 3ZZ6A 1C5QA 1JBUH 2SGFE 1D6RA 2BY8X 3ATMA 1A3BH 1TBZH 2GD4B 1QFKH 3KQDA 1GCDA 4MLFB 4KGAA 2G4TA 2QXGA 2FM2A 4NA9H 4J1YA 4LOYH 2ESTE 1V2JT 1C1OA 1IHTH 1S0QA 1BBRK 1O3AA 2UUJB 1ABIH 3GDSA 4XBCA 2XC0A 4BTUB 2FZZA 1AFQC 2BOKA 4YTAA 2P3TB 3SJKA 1ZR0A 4GAWA 1TRNA 2Z9GA 1OWIA 2G5NA 1GHAF 5FCRA 3NK8A 2VVCA 1GG6C 8GCHG 1O2RA 4SGBE 1VGCC 3SJOA 3P8NA 3I78A 3A84A 3W95A 1DXWA 1UTQA 1P8VC 1EAXA 1O2LA 2OC1A 1AFQB 2BXTH 4YOJA 3SU4A 3SU1A 1TOCB 2FOBA 3LGYA 1Z8RA 4X2YA 2EI7A 4CBNA 2VVUA 3TITA 1ANDA 2OC0A 2SGAA 2ZFQH 1MZAA 1XKBC 1GG6B 2R3UA 3EYDA 2XC5A 3KL6A 1Y5AT 3SORA 4JZIA 1VGCB 1BIOA 2PW8H 1HGTH 3SNBA 4IN2A 4MPUA 1RGQA 5EOKA 3RXCA 3SUEA 1CE5A 3GCNA 4X1NU 4CRAA 2J34A 1O37A 3DFLA 1AIXH 1O5FH 1ZZZA 1MKXH 1WSSH 2ZGHA 3MH5A 2NU4E 3A7WA 4TPYA 2OTVA 3AW1A 3K6ZA 1A0LA 3M5LA 1HAYB 4B2AA 1UTMA 1GMCF 2P3UB 1RIWC 1SGRE 2C93B 1CQQA 4OS1A 1KXBA 3EA9A 1HNEE 3P70B 2BX3A 3LPRA 1OYQA 3JZ2B 2O8UA 4X1QU 4ABHA 2B5TB 1EASA 1SGDE 1TYNA 1P2KA 4ABAA 4U01A 2CXVA 3CS7A 2GVFA 3SGQE 3LT3A 2JETC 1LHGH 1C4V2 4B75A 4BAKB 2ZDLA 1ELAA 1RIWB 5CE1A 1BTPA 1DUAA 4UFDH 1WQSA 3TH4H 1WTGH 1L1GA 1TPOA 4ISNA 1PPZA 2JKHA 1KLIH 4Y10E 1C2GA 3BTTE 1O5BB 1LQEA 3LH1A 3M5OA 2TIOA 1GGDB 4K8YA 5GXPA 2JETB 2GZ8A 4BXSA 1FY4A 2G5VA 3D62A 3GY6A 1GHBF 1SGFG 2F9NA 1QB1A 1F0RA 2THFB 1C5LH 3ZZ7A 1TNGA 1DY9A 3T26A 3TPIZ 3MTYA 1E36B 1QIXB 1C1MA 2PR3A 2HNTC 4IMQA 5I46H 4B74A 4Z6AH 2KAIA 2ZC9H 4E06H 3DFJA 3IG6B 2HRVA 1YGCH 2K1QA 2BY7X 2EI8A 4RKJB 1DX5M 1FLEE 2FODA 1W10U 2TRMA 3QZRA 2PUXB 5L2ZH 3SQEE 4NSVA 1TOMH 3A88A 1ANCA 3Q77A 4X1PU 2EA3A 1GHZA 1ZRKA 1YPMH 2C8YB 2ZFFH 4K2YA 3V0XA 2GZ9A 4I7YH 3Q3KA 2VWLA 7KMEH 1P2OA 3UTUH 1ELCA 1KIGH 5DO4H 1BJVA 2BD3A 1TNLA 1AZZA 1BTYA 1IQGA 1V2UT 1Z1JA 4H4FA 1XVMA 1S0RA 2UWLA 1HAHH 4X2WA 4E7RG 3E0PB 3RC5A 2BB4A 4WH8A 4DGJA 3SU3A 2HOBA 1SLVB 3M3TA 2C90B 3QK1A 3WY8A 1U6QA 1FONA 1TLDA 4UE7H 2EEKA 1TNKA 1WQVH 2A2XH 1MU8B 4F49A 1NFWA 1GMHF 1TRMA 2QCYA 3ATLA 4IN1A 1FY3A 1FXYA 3MH7A 4ABDA 2BLWA 5LPEA 1XXDA 1LDTT 1O2XA 1Y3VA 1IQEA 1EKBB 1AE5A 6GCHG 1C1WH 2GCHF 2QXJA 2Y6TA 3RXHA 1C2JA 5CHAC 3RU4D 1UK2A 3RM0H 4ZHLU 1S5SA 2QYIA 1MBMA 1UTOA 2XYAA 5A2MH 1YM0A 2Z3EA 1BUIA 1PQAA 2ZZUH 2PKAA 3QTVH 1ZLRA 1LMWB 1DWEH 1AE8H 4A7IB 1SHYA 1YPLH 1ZPCA 1KSNA 1ELVA 3VB6A 2FX6A 2JH5D 5CHAB 1O36A 1GDQA 1UK4A 2HALA 1ETRH 2F9OA 1C9TA 2G81E 1GVZA 1IOEA 5HM9A 3BN9A 3HK3B 3KQBA 7LPRA 4D7FA 1UCYK 4K1EA 4RSPA 2BYAX 2ZU3A 4JMYA 1W0YH 4A1TA 1CBWC 2Z9IA 4INKA 1T8MA 1P11E 3A86A 4FU7A 3TLOA 2UUFB 1SB1H 1K1OA 1O3KA 1WYKA 3KIDU 3B23B 1O3LA 3PMAB 3URCA 2J92A 1BMAA 3SHCH 2B7DH 1CBWB 1Z8GA 2DUCA 3AW0A 9ESTA 1V6DA 3SNEA 1P57B 3CS0A 4I8GA 4UFGH 2BY5X 5DP7A 2VNTA 1QL8A 2FS8A 1KLJH 1K1JA 2ZDKA 3VB4A 2G4UA 2AH4X 3GCTF 2PKAB 1SLXB 1BQYA 4NIXA 1AD8H 1TX8A 3A81A 1C2IA 1BJUA 3KQEA 1LKAA 2BM2A 1SLUB 5HGGA 1EAWA 2NU0E 5DKMA 1YPHC 4ZKRU 2QIQA 2BDGA 1H8IH 3LGWA 5T6GA 4K69A 3P8GA 1C4U2 1BCUH 2ZTZA 2FI5E 2ZGXH 1YCPH
chains in the Genus database with same CATH superfamily
2P3FH 1SR5C 3NWUA 2ILNA 2OBQA 1OWEA 2P95A 5FL7D 1GJCB 3EAJA 1PPGE 4NFFA 3NUMA 3M5NA 4DJZB 1HDTH 3RXTA 1O33A 1W0ZU 4PROA 1MTVA 2GCTC 4X1SU 1M9UA 5IYTA 1GBAA 1O5EH 2CF8H 3OX7U 2Z6BD 1HJAC 1H9HE 1O3MA 4ZHAA 1J15A 2A0QB 1EAIA 1S83A 1V2RT 2BDCA 5F6MA 1QQ4A 5C1UA 1C4Y2 1A5IA 4TY6A 1DWBH 1DVAH 1XXFA 2FESH 1QL7A 1IQJA 2W7SA 1O3OA 1CU1A 1HJAB 2KFWA 2JIZD 1W11U 2Q6FA 4WXIA 2O9QA 1T8LA 2Q1JA 3MHWU 2SGPE 6CHAC 1O2HA 1XUGA 1C5NH 1O5AB 1GBCA 3UOUA 1GVLA 2VJ1A 1MTWA 2ZDAH 3KHVA 3C1KA 1QBVH 3ZVGA 1MQ6A 5I25A 1XUIA 1TX7A 1D3DB 3D49H 1CHOF 3MU1A 4HZHA 1C5XB 1YLDA 1ANEA 4AB9A 1VCQA 3OE7D 1NRSH 1SOZA 6CHAB 2C4FH 1Z7KA 1MCVA 3PM3A 4IBLH 5J4SA 2C8ZB 2H5CA 1O3PB 2FOHA 2ZWLH 4NA8A 5C67A 1QA7A 1Q3XA 1UTLM 1SHHB 3TGIE 5C5NA 3ATIA 2R0KA 4HI3A 1OWHA 1BTHH 3C27B 1LHDH 1DWDH 1ZTLA 1H4WA 1GJ4H 4X8SH 2OINA 2UUKB 1TE0A 4CHAC 4OS6A 3S69A 1Y3UA 2ZCHP 2P59A 1ZMLA 1A7SA 2FO9A 2FMJA 1ZPBA 1LVOA 5DSFA 3NZIA 1UVTH 1TX6A 1C5VA 4I8LA 1BB0B 1NRQH 3GY7A 3PWCA 4FUJA 5HMAA 2OUAA 2D8WA 1ETSH 1G3BA 5FBEA 1Y3XA 2Z3DA 3TJNA 1V2NT 4ISOA 1DXPA 4AYYB 1KTSB 4CHAB 1W14U 1LQDB 1FN6A 3P92A 5HIZA 3TJOA 4Y7AA 1EFRD 1BRCE 2VIWA 3LDXH 4Z0KA 1Z6EA 1C2LA 1PPCE 4O3UA 4I8HA 3QWCH 1EP5A 5CHBA 1W8BH 3SU5A 3ZZBA 1BTZA 3ESTA 4H42U 4FUFA 1SQRA 3DHKH 1TRYA 5C0TA 4X6NA 1E1QD 3MU5A 2ODYB 3BEUA 4BNRA 1SLWB 4O03A 1A0HB 1EJAA 1F5KU 2NU3E 1C5ZB 1D3TB 1ELDE 3AVZA 4E7NA 1JIRA 5ETXA 1SGPE 3D65E 2GGVB 3Q3XA 1KDQA 2V7QD 1KY9A 1NBMD 5LPFA 4OM9A 4FUBA 3STJA 3M5MA 5KECA 1ZGIA 1C5TA 1C5WB 2BZ6H 2G51A 1OSSA 1SGTA 3UR6A 4NWLA 2IOTA 2KZ4A 3OAAD 1QJ1B 1TBQH 1F5RA 1D9IA 3SNCA 3PLBA 4UFFH 2O8WA 4R8TB 1UTKA 3GY3A 3A7ZA 1CA0C 1BRBE 2KCPA 3DT0H 4DIIH 1GHBG 2W5EA 3P95A 3ZZ4A 1FV9A 4K3JA 1O2GH 1Z71A 1NC6A 1EB2A 2ZHQH 3RMOH 1IQMA 1AWFH 1P05A 3RXRA 1CT4E 1O2SA 1O3HA 1GBKA 1JMOH 1S6HA 3A8AA 2XWAA 1DLKB 1FI8A 2IPHA 2WYJA 1CA0B 1K9OE 2XC4A 4YZUA 4WMFA 2B9LA 4OS2A 7GCHF 2CF9H 4NCYA 1Z8JB 4FU8A 1P2IA 4QT8C 4CRBA 1PJPA 5JBTA 1QA0A 5C20A 2BVRH 1YCPM 1KDQB 1UMAH 1P12E 4A5TS 4MNVA 1UVOA 4FXGH 3VXFH 1K28D 5FPTA 1EB1H 5DP9A 3SQHE 1MTSA 5DP6A 3FAOA 3PB1E 3F3BA 4TYDA 4DY7B 2AGGX 1GJBB 3QN7A 1W13U 1BMFD 1TGBA 1GL1A 3RMLH 1DY8A 1AFEH 1YF4A 2PGBB 1EPTA 2F9VA 4Y11E 3ATWA 3IWMA 1H1BA 2BXUH 3BV9B 3HKIB 4XSKU 2FLBH 1QQUA 1H9LB 2TGTA 1YY3A 2VVVA 1NRPH 4OGXA 1P09A 1GMHG 1KXCA 5L2YH 3LU9B 1DSTA 3BTFE 3SO3A 1NU9A 2SFAA 4KP0A 4DW2U 2J4IA 1ARCA 3LGVA 3MNCA 1UTNA 1O2ZA 1N6YA 2GCHG 1ZHPA 2PGQB 4X8UH 1SGEE 4SGAE 1HJ8A 2R0LA 1Y5UT 1ZHRA 1XUFA 1OX1A 1TONA 4CRDA 1Z8IB 7ESTE 4BAHB 3RXPA 5F03A 1RXPA 1S84A 4Q63A 3OU0A 5EW1H 2WPIS 3EE7A 1S82A 1BMNH 3PYHA 1ZTJA 2ODPA 3BG8A 1B0FA 2FS9A 1VITH 2Q6DA 1ACBE 1HLTH 2Y5GA 5F53A 1T4UH 4MDSA 1TWXB 3SV9A 2FIRH 3QGNB 3ZVDA 2BX4A 2J5UA 5DP3A 1Y3YA 4ESTE 3M3VA 2BDYA 1EPTC 1JXPA 2ALPA 3WW7A 1O3FA 2OP9A 3A7YA 1KMHB 1T4VH 3VEQB 4YM9A 1MTUA 3RDZA 2QGRA 2FDAA 1AGJA 4I86A 2GX4A 3QX5H 3TH3H 2GT8A 1O2MA 1TGCA 3VB5A 1S6LA 3M36A 3SJIA 1AMHA 2FPZA 3SJ8A 1ZOMA 2RA0A 1IQLA 3MH6A 2J97A 2J2UA 2ZO3H 1EPTB 5GCHF 1BMMH 4P00A 1VZQH 1LPKB 5FX6A 1GBFA 1P3EA 5DPAA 1SI5H 2BD8A 1AY6H 3GY2A 3M7TA 1F0TA 1LO6A 4OS5A 3ZIAD 4BAMB 2ZFPH 1SL3A 1HUTH 1SFIA 2F9BH 4U32A 2QAAA 3BTEE 1W0JD 1FPCH 2EI6A 4DG4A 1IHSH 2A5KA 4F4OC 1HRTH 4X0WU 3TK6A 1NBME 1SFQB 3VB3A 3MQKC 5EODA 4FUGA 1MAXA 3RXIA 3ZZ3A 4MQAA 1FNIA 2A1DB 1YKTA 2WPHS 2GT7A 4B6FA 2TGAA 1K1LA 1GCTB 3FFGA 4OGYA 3U1JB 1FIWA 1A3EH 5FAHA 1V2WT 3F2GA 3ZZAA 2ALVA 5A8ZA 1GHWH 3LH3A 3GCHB 4GCHG 2VH6A 4YOIA 1J17T 3SNAA 2XBWA 2V0BA 1GGDC 4Q7YA 1E38B 4XOJA 4CH8B 4GVUA 1O3BA 3G01A 2WUBA 1SG8B 4NIWA 2A2QH 1G30B 3F9HA 3GISB 2PWXA 2F4LA 1AB9C 1YPGH 4O3TA 1A0JA 3PMBB 1B0EA 3U1IB 4BOHA 4NWKA 2G00A 1O3EA 1KYNA 2A5AA 5SGAE 3RXUA 4RI0A 4B73A 1AVXA 1O2WA 1QGFA 2QY0B 1G2LA 5GPIB 2XBXA 1FUJA 1MTNC 3VGCC 1AB9B 4TPIZ 5EG4A 2A4OA 1OS8A 1F0SA 3QTOH 2HPPH 4ACAA 3PO1C 5EXNA 1ELTA 3TGKE 2A4QA 1A46H 5T6DA 1LCYA 1WV7H 3SUFA 3FO8D 1AHTH 3E8LA 3PTNA 1G3CA 3GY8A 1PPFE 1MTNB 3VGCB 1Y3WA 3BEFB 3M61U 3EE0B 2WV5A 3PO1B 5HKKD 5ABWA 1HAZB 3RXKA 5LH8A 1E1RD 3M7QA 2LELA 1UCYH 4Y0ZE 2Y5FA 1H9IE 4ISLA 1F7ZA 1FY8E 3HATH 1GJ5H 1J8AA 1NO9H 3CENA 1ESTA 5F8ZA 3URDA 1FMGA 2HVYB 3UNRA 4XRNA 2V35A 1GJAB 1QL9A 3O8BA 2A5IA 3ZYDA 2C8WB 1GI0A 3NPSA 3N7EA 1TGTA 3MNSA 4LK4A 3HGNA 1MKXK 2FTMA 4GUXA 1O2IA 4MVNA 4AYVB 3TGJE 3I29A 1DS2E 3M35A 3RMMH 3RXSA 1O31A 3Q00A 4FVDA 5PTPA 2XRCA 2QC2A 2RDLA 4I8KA 1MH0A 2K8IA 4FUEA 2FOFA 3ODFA 1C2FA 3E0NB 2VB0A 2KCAA 1K22H 4AGJA 4MNYA 5FBIA 4AX9H 1VCPA 1KXAA 3MH4A 1WDIA 4X6OA 1LTOA 3H5CB 3GYLB 4AGKA 1C2HA 1SBWA 2FP7B 2LPRA 5JBBS 2XNIA 1PQ7A 3RXJA 2ZGCA 2CGAA 4D8NA 2FTLE 4Y8XA 2J98A 4XBBA 1E37B 4GHTA 1EJNA 1P2QA 2GV6A 1JWTA 1GI1A 1V2KT 1TIOA 1T8OA 4K1SA 4Y0YE 1HXFH 4AZ2B 5GJ4B 3BIUH 3EQ0H 5EGMA 4JZ1A 2QXIA 2OLGA 2ZPRA 4Q7XA 1DUEA 3VXEH 1ZTKA 3A7TA 3DSPA 1ETTH 4WXVA 1GI3A 1UW7A 1GVKB 4X6MA 1HYLA 4Q7ZA 1GHYH 3SI4H 2BLQA 4XE4A 2GP9B 1EUFA 1W12U 2F3CE 2NU2E 1VITF 3RXLA 1ESBA 3DUXH 4AB8A 5E0HA 1K21H 2NWNA 1ARBA 2GMTC 3F6UH 1P2MA 1H8ED 2VWMA 1G2MA 2AEIH 3RXDA 4AFSA 1HAOH 2SGQE 2F91A 4ACBA 1S85A 1YC0A 1O3IA 4O9VA 1SQTA 5F8XA 2PSXA 1KTTB 1AWHB 3BTHE 2J9NA 3RXGA 1K2I1 1F5LA 2GMTB 1IQIA 5TCCA 1F0UA 1OWKA 4MTBA 1QY6A 2R3YA 4JZDH 4AC9A 3IITA 1YPJH 1HAGE 2FI3E 2VH0A 1GMDG 1DM4B 2FLRH 1OXGA 2ZI2H 2PLXA 4B2BA 3OSYA 2J98B 1AZ8A 1TNIA 1E0FD 3BG4C 1EATA 1UCYE 1THRH 2WPDD 3SJ9A 1NRNH 1XX9A 1NZQH 3F1SB 3HPTB 1O3JA 2AIQA 1ORFA 1C1VH 4IGDA 4RT0A 3CNRA 5IK2D 3FP8E 5JPMH 1SQOA 7GCHG 3E91A 3P6ZB 3A7VA 2JDID 3BG4B 2GDEH 2ANYA 2NU1E 3U8TH 3RM2H 4LXBH 4KELA 1GI4A 3LONA 3PLPA 1WOFA 2VIDA 4ASHA 3SNDA 2L74A 2BD5A 2CN0H 2FEQH 1FAXA 1EZUC 1UO6A 2ZECA 3RMNH 4D7GA 1SGIB 3A82A 3UQOA 1GDNA 1GI6A 2OC7A 3T5FH 1O5GH 1BITA 1THSH 2Z7FE 4H6SB 3MO6A 1CO7E 3AAUA 4E05H 1ELGA 4KTSA 5FCKA 1C2KA 4IW4E 1FY5A 3O8DA 1P06A 1C2EA 2W26A 4K1TA 1Q2WA 2WSSD 4AFUA 3T27A 2BDIA 1CA8B 4WVPE 2I6SA 2JJ1D 4JYVH 1MAYA 1MUEB 2WV9A 2YNBA 4FVBA 4CRFA 4OS7A 1AN1E 3LGIA 1VCWA 1Y8TA 1HXEH 2B8OH 2PTNA 4R0IA 2A7HA 1O2VA 4TT3D 2BD2A 3PWBA 5A0CA 2XBVA 4ABIA 1OKXA 4UFEH 3L33A 4GLYA 2TPIZ 5C94A 3A8BA 1EOLA 1UVPA 3N7DA 1WUNH 4WMDA 3RUOA 2P8OC 4D76A 1BMLA 1FN8A 1P3CA 3U28C 3VG8A 3F9FA 1ZGVA 1LHFH 3MU4A 3TU7H 3FN8A 4WF8A 5CMXH 3TNSA 1MABB 3T28A 1O2OA 5C0UA 2H9EH 1QNJA 2CK3D 3WWFA 2A7JA 4AG1A 2Y81A 2JH0D 3E3TA 4I8JA 4XDEA 4A6LA 2A45B 1IQNA 2P8OB 2Z9KA 3TVJB 1H8HD 1HCGA 3FP6E 4U30A 2FWWA 1ANBA 1HB0B 3BEIB 1UTPA 1GHAG 4KTUA 2ZPSA 3NCLA 2J94A 4INLA 4YESB 3T25A 1GPZA 2BMGB 4DT7B 2D26C 4UONA 1G3DA 2BD4A 1HPGA 4ABBA 2BVSH 1VR1H 2CJIA 1EZQA 3P8FA 1GBMA 1FY1A 2WINI 3RXOA 4LZ4B 1ID5H 2QF3A 1SC8U 3PV5A 1O2JA 3U8RH 1D4PB 1L4ZA 1BTUA 3GY4A 5JBAS 1ELEE 2OC8A 5EJLA 2SGDE 2A7CA 2WYGA 5GCHG 3ZZDA 1PQ5A 3UR9A 4XBDA 2WV4A 2KR7A 5HXFA 1C9PA 1B7XB 2FOEA 1J16A 1Z1IA 5LPRA 1A5GH 2A4GA 2AFQB 3LKWA 5DP4A 3LGTA 1E35B 5K7RA 2O8TA 1GHVH 1SGQE 2Z94A 3K6YA 2PSYA 1EQ9A 3TJUA 1TQ7B 3D23A 2AHME 1PPBH 3SGBE 1TA2A 2GTBA 1OPHB 3S9BA 4ZKSU 2RCEA 1GMCG 3GYMA 1NFXA 4CBOA 4INHA 5KGOA 3BTWE 3BF6H 1PPHE 4I32A 2OK5A 2DE8A 5EQSA 1O38A 1FPHH 3KQ5A 2R2WU 3FOAA 3ZV8A 2HPQH 4ZHMU 1AO5A 4NGAH 1P03A 1SGYE 2BDAA 4KTCA 2VU8E 2VINA 3MU8A 4RN6A 2RFKC 4B71A 1HJ9A 3M37A 1OP0A 5JBCS 1O34A 2SNWA 1D6WA 3RC6A 1KLTA 3E90B 3ATKA 4D9QA 6LPRA 4WY3A 3QO6A 2VIPA 2Y80A 3OEED 1XMNB 3BSQA 3RU4T 3S9AA 4MPVA 3UNSA 1BBRH 1WXRA 2Y7XA 3F0PA 1L1JA 1LKBA 4AOQA 3DA9B 1ESAA 2ZKSA 2H6MA 1KXDA 2UUYA 1TA6A 3K2UA 5AHGH 4ZXXH 1O5CB 2AMPA 4B6EA 3TK9A 1SSXA 3EA8A 5DJ7A 2UWPA 2ZP0H 1MKWK 3UNQA 2YOLA 1FJSA 4I33A 2JJ2D 2I6QA 2P94A 2J38A 2Q6GA 1LVYA 1DT2A 1CSOE 5EJ1A 2ZDNA 1C5RA 4BAQB 1V2TT 4Y8ZA 4K8BA 1RJXB 1O3GA 1GI9B 1SPJA 3PV2A 1OWDA 3M3SA 4D9RA 3MI4A 2ANMH 3EDXB 4VGCC 3EA7A 3WWBA 4ABJA 2H5DA 1ZRBA 1OP8A 1V2OT 5EJZA 3BTGE 3U8OH 1PPEE 4DT4A 1SGFA 1TPAE 2M5TA 1NM6A 3FVFB 2W6ID 1T8NA 2AMQA 8LPRA 1FAKH 3GOVB 3MO9A 2BVXH 4ZUHA 1O32A 1GBDA 1B5GH 1QRXA 1EAUA 3SOSA 4VGCB 3S7KB 1WBGB 3PV4A 1BZXE 2VWOA 4WWYA 2G8TA 3RXVA 3UUZA 1T32A 1V2VT 1NT1A 1D3QB 3KQCA 1BTXA 1GL0E 4CRGA 2BLOA 1IAUA 1GBIA 1OWJA 3S7HB 2ZPQA 1AU8A 2VBCA 4FU9A 4X8VH 1LPGB 4M9FA 2CV3A 1GI5A 1C1NA 2R9PA 1EJMA 4FOUC 4NZLA 1JRSA 1C5YB 2BD9A 2Y82A 2OD3B 2QF5A 3KGPA 2STBE 3UOPA 2XWBI 3SUDA 1WCZA 2WPKS 1AVGH 1THPB 2IJD1 2V3MA 3ZVCA 2ZFSA 3FP7E 1QJ7B 1A2CH 1OYTH 2BQ7B 2ULLA 5HM2A 5JB8S 3B8JA 3P17H 2ZU2A 1C5PA 1XKAC 2ZU4A 1O5DH 1WAYB 1G3EA 3QUMP 3LJJA 4AFQA 1YWUA 1C1RA 1NTPA 1TB6H 2PV9B 3OFND 1FZZA 5EPNA 3MNXA 3E6PH 1VITG 1NRRH 2FYRA 3OYPA 1LPZB 3KF2A 1AKSB 3E16B 3FZZA 5GDSH 1A1RA 1YPKH 4NIYA 1E79D 3U98H 5A0AE 5E0GA 1BBRE 3RXEA 2ZFRH 2VIVA 1C1QA 1AVWA 1C5UA 1P04A 4TSFD 2W3KA 2P93A 2ZQ2A 3SGAE 1GCTC 4FUCA 1GBLA 4X6PA 2YMSC 1GBTA 2AS9A 2F9PA 3GCHC 2TGDA 5AFZH 1O39A 2XBYA 2XTTB 3MMGA 1O2QA 3DD2H 1AUJA 3F9EA 3GCTG 1O3CA 1EOJA 2M2AA 4NSYA 5FX5A 2ZHFH 2BZAA 3SYJA 1PQ8A 3DCLA 5EW2H 1DFPA 1QZ8A 1T31A 2J95A 2W7UA 1VJ9U 4NG9H 3W94A 4BANB 5TCAA 2YMSB 3MWIU 1FIZA 2C3SA 4F55A 2ZHEH 2PHBA 1LVBA 1C5SA 4Y6DA 4X2VA 2STAE 1YBWA 1A61H 2QA9E 3DSOA 3FZDA 1SMFE 2KCYA 4JYUH 3B9FH 3R3GB 1TGNA 2F83A 3GDUA 1BT7A 3OTPA 1SGNE 4A92A 2ZDMA 3SU6A 3BTQE 2WPMS 4NZQA 1G32B 3SN8A 2FXRA 3RXQA 2C8XB 3ZVFA 2ANKH 4MG3A 3EGKH 2YMSD 4WJG2 4X2XA 2ZFTA 2Y7ZA 1CVWH 5DP5A 4AFZA 1UJ1A 3H7TA 1EXFA 3S0NA 1AUTC 2XW9A 1QRWA 1QURH 2EY4C 2HVXA 1O0DH 3NXPA 5EQQA 1K1MA 1V2LT 5EXLA 3JZ1B 2VIOA 4IS5A 4DVAU 2H2ZA 4KKDA 3BTME 1A5HA 3U69H 4CR5A 4TY7A 1DITH 3TNTA 3UAIC 4ZROA 1P10A 1C5MD 4ZXYH 3TK5A 3A8DA 3UFAA 4I31A 3HK6B 2QN5T 3OTJE 1JOUB 1CGJE 1JRTA 1EX3A 4MPWA 1TABE 5GNDA 2RG3A 1C1SA 3LOXA 3R0FA 3L6PA 1F2SE 1YYY1 4A1XA 1CGIE 1GJ6A 2Z3CA 2D1JA 2Z9LA 1ZPZA 2XOKD 5BRRE 3ELAH 1E34B 1CHOG 1SGCA 4B76A 4IC5A 1OHHD 2PFEA 3ZVAA 3NKKA 4THNH 2GV7A 4O97A 3VFEA 1UHBA 1LHCH 3NRLA 1K1PA 1SKYE 2VWNA 2SGEE 1TNHA 1C1PA 2IJOB 1HAIH 5A8YA 4ISHH 1MBQA 3HGPA 3UB0A 1BTWA 1QCPA 2ZCKP 3K65B 3MOCA 1C5OH 1GBHA 1GJ9B 1P02A 2H1UA 5J4QA 1NN6A 5AFYH 2AIPA 1V3XA 2EQNA 1W3CA 3T29A 3QGJA 2FI4E 1PYTC 2XCFA 4HTCH 2V6NA 3UQVA 1V2QT 1BRAA 4GSOA 1T7CA 1UVSH 1IQFA 2G55A 2ZQ1A 3TJVA 4HGCA 2ZHWH 5H4IB 4YO9A 1XM1A 1V2MT 3L3TA 1XUHA 3M7UA 1SQAA 1J14A 1EP6A 1SVPA 4DOQA 4GPGA 1HIAA 3ZZ9A 1KXFA 3O8CA 3TIUA 1QB9A 2KAIB 3RXMA 2FOMB 3E1XB 1F92A 3K9XB 4Q80A 3CP7A 1P2JA 1TBRH 1BRUP 1HAVA 1MD8A 1C1TA 1BHXB 1TFXA 5C5OA 4ZMAH 4JYTA 2EC9H 1IQKA 3A8CA 1UHBB 1C2MA 3A80A 3GCOA 5B6OA 8GCHF 3PTBA 1MZDA 1PYTD 2PUQH 5JB9S 3KNXA 4JZEH 2BY6X 2R2MB 4YLUA 4CH2B 3SBKA 1P2NA 2QF0A 5DK1A 4Y7BA 1S81A 3MNBA 2ZGJA 3RXAA 2A4RA 3DSGA 2RA3A 1N6XA 1XUKA 1OOKB 3SV8A 2ZG0H 5G4BA 2TBSA 1TPSA 4ABEA 4FUIA 4GHQA 4CRCA 1C1UH 4X1RU 1K0HA 1ZHMA 3V13A 4DIHH 3SUGA 1NS3A 3ZV9A 2ZA5A 1NU7B 1COWD 1O30A 5FPYA 1D3PB 2BHGA 5C3NA 1TPPA 2DE9A 1O2YA 1P9SA 1W2KH 4JK6A 3UIRA 4B2CA 4ZKOU 3KYGA 2BD7A 3P8OA 4CREA 1HIAB 3GICB 1N1LA 1MMJN 4BTIB 2FYQA 4HFPB 1ZJKA 3KCGH 3V12A 5JDUB 2A31A 5FPSA 1MD7A 1WU1A 3SI3H 1W7GH 3N99A 1HV7A 2BLVA 1HAVB 2QXHA 1QRZA 1L1NA 1CT0E 4JCNA 5E2OA 3A7XA 1SOTA 1TMUH 4Y8YA 2ZIQH 1K1NA 4MNXA 4GCHF 5EIYA 2B0FA 1YLNA 1VJAU 2ZHDA 5T3HA 2ASUB 4DCDA 1GI7B 3PROA 2O8MA 5FHTA 5DG6A 3PMJA 3U9AH 1Z6JH 5E0JA 4NA7A 3AASA 4BTTB 1TMTH 1EZXC 1OP2A 3SU0A 4XFQA 2SNVA 1L2EA 1O3DA 3A85A 9LPRA 3RC4A 2ZU5A 3UY9A 1GJ7B 1XVOA 1ZSKA 5A8XA 1DLEA 1UK3A 3PRBA 4ZAEA 1O2NA 1MCTA 4NFEA 4YLQH 3KN2A 2PP6A 3RLYH 1Y59T 2UWOA 3QZQA 3T62A 3V3MA 1QJ6B 1CHGA 5E8EH 8KME2 2VIQA 1TGSZ 1ZYOA 4OS4A 2V3OH 2D2DA 3LIWA 4UDWH 1S6FA 4FUDA 5IDKA 3FKSD 1QBNA 2H9TH 2OXSA 2BTCE 5T6FA 2GCTB 2AMDA 3W1EA 3FANA 1QBOA 4YOGA 1TAWA 3OY5U 1LVMA 4BXWA 2OBOA 1UVUH 1W0KD 2AGIX 5LGOA 1GDUA 1LHEH 2ZTYA 1GBEA 4HG6A 5EQRA 1ELFA 1GBBA 1P0SH 3PLKA 1A4WH 4YT6H 2AERH 2XXLA 1YLCA 2ZU1A 1CGHA 1BOQA 2HNTE 5FXLA 3A89A 2P16A 3ODDA 1P01A 3SW2B 5C2ZA 5DGJA 1ZSJA 1BDAA 1G37A 3KEEA 3Q3YA 1NROH 3SZEA 1HBTH 1O2TA 1RTLA 5CDFE 5ESTE 5GIBA 2AGEX 2BY9X 3ZZ8A 1QR3E 5C1XA 1H8DH 5DP8A 4YT7H 5KEDA 5L30H 3BTDE 4RKOB 1C2DA 2BQWB 3S9CA 5JYIA 4TWYA 1X7AC 3RU4E 3A87A 8ESTE 1GJDB 1DWCH 1YCPK 2ANWA 5EU8A 1FDPA 5A0BA 2OQ5A 3ITIA 2VGCC 3LGUA 5L6NH 2PTCE 1HAXB 2RDEA 3UPEA 1MKWH 1RFNA 3BIVH 4LZ1H 2BOHB 3SV2H 6GCHF 2BDBA 2HGTH 1HAPH 2W3IA 1IQHA 2CHAC 1ZSLA 2HLDD 5B6LA 4Y76A 2ZEBA 3RLWH 4AN7A 3PRDA 5AF9H 1G9IE 1QHRB 4Y79A 1DANH 1AI8H 4F48B 4NIVA 1NPMA 1GI8B 4RT1A 3ZYEA 3UWIA 1DPOA 2VGCB 3F2HA 6ESTA 1Q31A 3SV6A 2HWLB 2OQUA 2FX4A 2OCVB 2ZNKH 5C1YA 1DOJA 1EZSC 2CHAB 5HYOA 3T2NA 3MYWA 3ZVBA 3QLPH 3HKJB 5AVDA 4ISIH 2JH6D 4UEHH 4AORA 2ODQA 4UD9H 4B1TA 3V7TA 4J2YB 1J9CH 1TMBH 1YPEH 3AK5A 5DN6D 2Y5HA 1ZMNA 3UWJH 4H6TA 2YNAA 1O2KA 3H7OA 2ZCLP 2WPLS 3VB7A 3O8RA 3OY6U 3VPKA 1GWAA 2QF4A 2BDHA 4M7GA 2ZTXA 3LC5A 2Z9JA 5EXMA 3LJOA 3MU0A 4YXWD 1RRKA 2KCOA 2HNTF 1NESE 3MO3A 1FX0B 3AAVA 4JK5A 5ESBA 5TJXA 3MFJA 3SV7A 1KXEA 1PFXC 1RD3B 4ABFA 1ZMJA 2F43B 1AQ7A 4DURA 1GHXH 4CR9A 1Y5BT 1O2UA 2ZDVH 5GWZA 1MU6B 1DE7H 3F68H 1TALA 1NFYA 4U2WA 2IN2A 2KX4A 3ZZCA 1YP9A 4JZFH 3GS9A 1V2ST 1N8OC 1DSUA 4AG2A 2HLCA 2L6OA 1GMDF 3RP2A 3STIA 2ZF0H 1RTKA 1W7XH 2WPJS 2GZ7A 3N7OA 3ZZ5A 2FOCA 3RXFA 1O35A 3RXBA 4K60A 3TH2H 4K5ZA 1DICA 1QB6A 2PKSC 4WH6A 4WMEA 1G36A 1UTJA 2CMYA 5E2PA 1N8OB 1RS0A 2O8LA 1JIMA 4ABGA 1O3NA 2LP6A 3LC3A 1TNJA 4Q2KA 1BA8B 2LNCA 3ENSB 3ZVEA 1NFUA 2PKSB 4FUHA 3SHAH 2V3HH 3Q76A 4XD7D 1V2PT 3QDZB 2A32A 3I77A 4ZH8A 1ABJH 1BHXF 1NY22 3GY5A 1GI2A 2TGPZ 2AYWA 1WTHD 1AKSA 2G52A 3UREA 2FOGA 4IC6A 3F9GA 3A83A 1YPHE 1O2PA 1DDJA 4BAOB 1ZJDA 2H9HA 3F2FA 4MNWA 1L4DA 2GDDA 4ZKNU 1CT2E 2QV1A 3GDVA 1TQ0B 2F9UA 1GJ8B 2XCNA 1GBJA 4A1VA 3PMHB 1P9UA 1XUJA 4TWWA 4IMZA 4MPXA 5HIYA 3SZNA 1QTFA 2ZGBH 5BPEA 1L0ZA 2BQ6B 2GKVE 5A09A 1K1IA 4Y71A 1ELBA 1INCA 5F8TA 3OEHD 3SU2A 1RTFB 5EPYA 1FQ3A 3BTKE 1MQ5A 1HFDA 2FOAA 2WUCA 5K0HA 4X8TH 3ZZ6A 1C5QA 1JBUH 2SGFE 1D6RA 2BY8X 3ATMA 1A3BH 1TBZH 2GD4B 1QFKH 3KQDA 1GCDA 4MLFB 4KGAA 2G4TA 2QXGA 2FM2A 4NA9H 4J1YA 4LOYH 2ESTE 1V2JT 1C1OA 1IHTH 1S0QA 1BBRK 1O3AA 2UUJB 1ABIH 3GDSA 4XBCA 2XC0A 4BTUB 2FZZA 4Z1MD 1AFQC 2BOKA 4YTAA 2P3TB 3SJKA 1ZR0A 4P02A 4GAWA 1TRNA 2Z9GA 1OWIA 2G5NA 1GHAF 5FCRA 3NK8A 2VVCA 1GG6C 8GCHG 1O2RA 4SGBE 1VGCC 3SJOA 3P8NA 3I78A 3A84A 3W95A 1DXWA 1UTQA 1P8VC 1EAXA 1O2LA 2OC1A 1AFQB 2BXTH 4YOJA 3SU4A 3SU1A 1TOCB 2FOBA 2KM0A 3LGYA 1Z8RA 4X2YA 2EI7A 4CBNA 2VVUA 3TITA 1ANDA 2OC0A 2SGAA 2ZFQH 1MZAA 1XKBC 1GG6B 2R3UA 3EYDA 2XC5A 3KL6A 1Y5AT 3SORA 4JZIA 1VGCB 1BIOA 2PW8H 1HGTH 3SNBA 4IN2A 4MPUA 1RGQA 4Q4LA 5EOKA 3RXCA 3SUEA 1CE5A 3GCNA 4X1NU 4CRAA 2J34A 1O37A 3DFLA 1AIXH 1O5FH 1ZZZA 5T1VA 2IPQX 1MKXH 1WSSH 2ZGHA 3MH5A 2NU4E 3A7WA 4TPYA 2OTVA 3AW1A 3K6ZA 1A0LA 3M5LA 1HAYB 4B2AA 1UTMA 1GMCF 2P3UB 2WZQA 1RIWC 1SGRE 2C93B 1CQQA 4OS1A 1KXBA 3EA9A 1HNEE 3P70B 2BX3A 3LPRA 2W6JD 1OYQA 3JZ2B 2O8UA 4X1QU 4ABHA 2B5TB 1EASA 1SGDE 1TYNA 1P2KA 4ABAA 4U01A 2CXVA 3CS7A 2GVFA 3SGQE 3LT3A 2JETC 1LHGH 1C4V2 4B75A 4BAKB 2ZDLA 1ELAA 1RIWB 5CE1A 1BTPA 1DUAA 4UFDH 1WQSA 3TH4H 1WTGH 1L1GA 1TPOA 4ISNA 1PPZA 2JKHA 1KLIH 4Y10E 2QE7D 1C2GA 3BTTE 1O5BB 1LQEA 3LH1A 3M5OA 2TIOA 1GGDB 4K8YA 5GXPA 2JETB 2GZ8A 4BXSA 1FY4A 2G5VA 3D62A 3GY6A 1GHBF 1SGFG 2F9NA 1QB1A 1F0RA 2THFB 1C5LH 3ZZ7A 1TNGA 1DY9A 3T26A 3TPIZ 3MTYA 1E36B 1QIXB 1C1MA 2PR3A 2HNTC 4IMQA 5I46H 4B74A 4Z6AH 2KAIA 2ZC9H 4E06H 3DFJA 3IG6B 2HRVA 1YGCH 2K1QA 2BY7X 2EI8A 4RKJB 1DX5M 1FLEE 2FODA 1W10U 2TRMA 3QZRA 2PUXB 5L2ZH 3SQEE 4ASUD 4NSVA 1TOMH 3A88A 1ANCA 3Q77A 4X1PU 2EA3A 1GHZA 1ZRKA 1YPMH 3F0OA 2C8YB 2ZFFH 4K2YA 3V0XA 2GZ9A 4I7YH 3Q3KA 2VWLA 7KMEH 1P2OA 3UTUH 1ELCA 1KIGH 5DO4H 1BJVA 2BD3A 2WHXA 1TNLA 1AZZA 1BTYA 1IQGA 1V2UT 1Z1JA 4H4FA 1XVMA 1S0RA 2UWLA 5C17A 1HAHH 2K0QA 4X2WA 4E7RG 3E0PB 3RC5A 2BB4A 4WH8A 4DGJA 3SU3A 2HOBA 1SLVB 3M3TA 2C90B 3QK1A 3WY8A 1U6QA 1FONA 1TLDA 4UE7H 2EEKA 1TNKA 1WQVH 2A2XH 1MU8B 4F49A 1NFWA 1GMHF 1TRMA 2QCYA 3ATLA 4IN1A 3KYFA 1FY3A 1FXYA 3MH7A 4ABDA 2BLWA 5LPEA 1VKYA 1XXDA 1LDTT 1O2XA 1Y3VA 1IQEA 1EKBB 1AE5A 6GCHG 1C1WH 2GCHF 2QXJA 2Y6TA 3RXHA 1C2JA 5CHAC 3RU4D 1UK2A 3RM0H 4ZHLU 1S5SA 2QYIA 1MBMA 1UTOA 2XYAA 5A2MH 1YM0A 2Z3EA 1BUIA 1PQAA 2ZZUH 4FETA 2PKAA 3QTVH 1ZLRA 1LMWB 1DWEH 1AE8H 4A7IB 1SHYA 1YPLH 1ZPCA 1KSNA 1ELVA 3VB6A 2FX6A 2JH5D 5CHAB 1O36A 1GDQA 1UK4A 2HALA 1ETRH 2F9OA 1C9TA 2G81E 1GVZA 1IOEA 5HM9A 3H09A 3BN9A 3HK3B 3KQBA 7LPRA 4D7FA 1UCYK 4K1EA 4RSPA 2BYAX 2ZU3A 4JMYA 1W0YH 4A1TA 1CBWC 2Z9IA 4INKA 1T8MA 1P11E 3A86A 4FU7A 3TLOA 2UUFB 1SB1H 1K1OA 1O3KA 1WYKA 3KIDU 3B23B 1O3LA 3PMAB 3URCA 2J92A 1BMAA 3SHCH 2B7DH 1CBWB 1Z8GA 2DUCA 3AW0A 9ESTA 1V6DA 3SNEA 1P57B 3CS0A 4I8GA 4UFGH 2BY5X 5DP7A 2VNTA 1QL8A 2XNDD 2FS8A 1KLJH 1K1JA 2ZDKA 3VB4A 2G4UA 2AH4X 3GCTF 2PKAB 1SLXB 1BQYA 4NIXA 1AD8H 1TX8A 3A81A 1C2IA 1BJUA 3KQEA 4ZCNA 1LKAA 2BM2A 1SLUB 5HGGA 1EAWA 2NU0E 5DKMA 1YPHC 4ZKRU 2QIQA 2BDGA 1H8IH 3LGWA 5T6GA 4K69A 3P8GA 1C4U2 2GJGA 1BCUH 2ZTZA 2FI5E 2ZGXH 1YCPH
chains in the Genus database with same CATH topology
2P3FH 1SR5C 3NWUA 2ILNA 2OBQA 1OWEA 2P95A 1GJCB 3EAJA 1PPGE 4NFFA 3NUMA 3M5NA 4DJZB 1HDTH 3RXTA 1O33A 1W0ZU 4PROA 1MTVA 2GCTC 4X1SU 1M9UA 5IYTA 1GBAA 1O5EH 2CF8H 3OX7U 2Z6BD 1HJAC 1H9HE 1O3MA 4ZHAA 1J15A 2A0QB 1EAIA 1S83A 1V2RT 2BDCA 5F6MA 1QQ4A 5C1UA 1C4Y2 1A5IA 4TY6A 1DWBH 1DVAH 1XXFA 2FESH 1QL7A 1IQJA 2W7SA 1O3OA 1CU1A 1HJAB 1W11U 2Q6FA 4WXIA 2O9QA 1T8LA 2Q1JA 3MHWU 2SGPE 6CHAC 1O2HA 1XUGA 1C5NH 1O5AB 1GBCA 3UOUA 1GVLA 2VJ1A 1MTWA 2ZDAH 3KHVA 3C1KA 1QBVH 3ZVGA 1MQ6A 5I25A 1XUIA 1TX7A 1D3DB 3D49H 1CHOF 3MU1A 4HZHA 1C5XB 1YLDA 1ANEA 4AB9A 1VCQA 1NRSH 1SOZA 6CHAB 2C4FH 1Z7KA 1MCVA 3PM3A 4IBLH 5J4SA 2C8ZB 2H5CA 1O3PB 2FOHA 2ZWLH 4NA8A 5C67A 1QA7A 1Q3XA 1UTLM 1SHHB 3TGIE 5C5NA 3ATIA 2R0KA 4HI3A 1OWHA 1BTHH 3C27B 1LHDH 1DWDH 1ZTLA 1H4WA 1GJ4H 4X8SH 2OINA 2UUKB 1TE0A 4CHAC 4OS6A 3S69A 1Y3UA 2ZCHP 2P59A 1ZMLA 1A7SA 2FO9A 2FMJA 1ZPBA 1LVOA 3NZIA 1UVTH 1TX6A 1C5VA 4I8LA 1BB0B 1NRQH 3GY7A 3PWCA 4FUJA 5HMAA 2OUAA 2D8WA 1ETSH 1G3BA 5FBEA 1Y3XA 2Z3DA 3TJNA 1V2NT 4ISOA 1DXPA 4AYYB 1KTSB 4CHAB 1W14U 1LQDB 1FN6A 3P92A 3TJOA 4Y7AA 1BRCE 2VIWA 3LDXH 4Z0KA 1Z6EA 1C2LA 1PPCE 4O3UA 4I8HA 3QWCH 1EP5A 1W8BH 3SU5A 3ZZBA 1BTZA 3ESTA 4H42U 4FUFA 3DHKH 1TRYA 4X6NA 3MU5A 2ODYB 3BEUA 4BNRA 1SLWB 4O03A 1A0HB 1EJAA 1F5KU 2NU3E 1C5ZB 1D3TB 1ELDE 3AVZA 4E7NA 1JIRA 5ETXA 1SGPE 3D65E 2GGVB 3Q3XA 1KDQA 1KY9A 5LPFA 4FUBA 3STJA 3M5MA 1ZGIA 1C5TA 1C5WB 2BZ6H 2G51A 1OSSA 1SGTA 3UR6A 4NWLA 2IOTA 1QJ1B 1TBQH 1F5RA 1D9IA 3SNCA 3PLBA 4UFFH 2O8WA 4R8TB 1UTKA 3GY3A 3A7ZA 1CA0C 1BRBE 3DT0H 4DIIH 1GHBG 2W5EA 3P95A 3ZZ4A 1FV9A 4K3JA 1O2GH 1Z71A 1NC6A 1EB2A 2ZHQH 3RMOH 1IQMA 1AWFH 1P05A 3RXRA 1CT4E 1O2SA 1O3HA 1GBKA 1JMOH 1S6HA 3A8AA 2XWAA 1DLKB 1FI8A 2IPHA 2WYJA 1CA0B 1K9OE 2XC4A 4YZUA 4WMFA 2B9LA 4OS2A 7GCHF 2CF9H 4NCYA 1Z8JB 4FU8A 1P2IA 4QT8C 4CRBA 1PJPA 5JBTA 1QA0A 5C20A 2BVRH 1YCPM 1KDQB 1UMAH 1P12E 4A5TS 4MNVA 1UVOA 4FXGH 3VXFH 1K28D 5FPTA 1EB1H 5DP9A 3SQHE 1MTSA 5DP6A 3FAOA 3PB1E 4TYDA 4DY7B 2AGGX 1GJBB 3QN7A 1W13U 1TGBA 1GL1A 3RMLH 1DY8A 1AFEH 1YF4A 2PGBB 1EPTA 2F9VA 4Y11E 3ATWA 3IWMA 1H1BA 2BXUH 3BV9B 3HKIB 4XSKU 2FLBH 1QQUA 1H9LB 2TGTA 2VVVA 1NRPH 4OGXA 1P09A 1GMHG 1KXCA 5L2YH 3LU9B 1DSTA 3BTFE 3SO3A 1NU9A 2SFAA 4KP0A 4DW2U 2J4IA 1ARCA 3LGVA 3MNCA 1UTNA 1O2ZA 1N6YA 2GCHG 1ZHPA 2PGQB 4X8UH 1SGEE 4SGAE 1HJ8A 2R0LA 1Y5UT 1ZHRA 1XUFA 1OX1A 1TONA 4CRDA 1Z8IB 7ESTE 4BAHB 3RXPA 5F03A 1RXPA 1S84A 5EW1H 3OU0A 2WPIS 1S82A 1BMNH 3PYHA 1ZTJA 2ODPA 3BG8A 1B0FA 2FS9A 1VITH 2Q6DA 1ACBE 1HLTH 2Y5GA 1T4UH 4MDSA 1TWXB 3SV9A 2FIRH 3QGNB 3ZVDA 2BX4A 5DP3A 1Y3YA 4ESTE 3M3VA 2BDYA 1EPTC 1JXPA 2ALPA 1O3FA 2OP9A 3A7YA 1T4VH 3VEQB 4YM9A 1MTUA 3RDZA 2QGRA 2FDAA 1AGJA 2GX4A 3QX5H 3TH3H 2GT8A 1O2MA 1TGCA 3VB5A 3M36A 3SJIA 1AMHA 2FPZA 3SJ8A 1ZOMA 2RA0A 1IQLA 3MH6A 2J2UA 2ZO3H 1EPTB 5GCHF 1BMMH 1VZQH 1LPKB 5FX6A 1GBFA 1P3EA 5DPAA 1SI5H 2BD8A 1AY6H 3GY2A 3M7TA 1F0TA 1LO6A 4OS5A 4BAMB 2ZFPH 1SL3A 1HUTH 1SFIA 2F9BH 4U32A 2QAAA 3BTEE 1FPCH 2EI6A 4DG4A 1IHSH 2A5KA 4F4OC 1HRTH 4X0WU 3TK6A 1SFQB 3VB3A 5EODA 4FUGA 1MAXA 3RXIA 3ZZ3A 4MQAA 1FNIA 2A1DB 1YKTA 2WPHS 2GT7A 2TGAA 1K1LA 1GCTB 3FFGA 4OGYA 3U1JB 1FIWA 1A3EH 5FAHA 1V2WT 3ZZAA 2ALVA 5A8ZA 1GHWH 3LH3A 3GCHB 4GCHG 2VH6A 4YOIA 1J17T 3SNAA 2XBWA 2V0BA 1GGDC 4Q7YA 1E38B 4XOJA 4CH8B 4GVUA 1O3BA 3G01A 2WUBA 1SG8B 4NIWA 2A2QH 1G30B 3F9HA 3GISB 2PWXA 4O3TA 1AB9C 1YPGH 1A0JA 3PMBB 1B0EA 3U1IB 4BOHA 4NWKA 2G00A 1O3EA 1KYNA 2A5AA 5SGAE 3RXUA 4B73A 1AVXA 1O2WA 1QGFA 2QY0B 1G2LA 5GPIB 2XBXA 1FUJA 1MTNC 3VGCC 1AB9B 4TPIZ 5EG4A 2A4OA 1OS8A 1F0SA 3QTOH 2HPPH 3PO1C 5EXNA 1ELTA 3TGKE 2A4QA 1A46H 5T6DA 1LCYA 1WV7H 3SUFA 1AHTH 3E8LA 3PTNA 1G3CA 3GY8A 1PPFE 1MTNB 3VGCB 1Y3WA 3BEFB 3M61U 3EE0B 2WV5A 3PO1B 5ABWA 1HAZB 3RXKA 5LH8A 3M7QA 1UCYH 4Y0ZE 2Y5FA 1H9IE 4ISLA 1F7ZA 1FY8E 3HATH 1GJ5H 1J8AA 1NO9H 3CENA 1ESTA 5F8ZA 3URDA 1FMGA 3UNRA 2V35A 1GJAB 1QL9A 3O8BA 2A5IA 3ZYDA 2C8WB 1GI0A 3NPSA 1TGTA 3MNSA 4LK4A 3HGNA 1MKXK 2FTMA 4GUXA 1O2IA 4MVNA 4AYVB 3TGJE 3I29A 1DS2E 3M35A 3RMMH 3RXSA 1O31A 3Q00A 4FVDA 5PTPA 2XRCA 2QC2A 2RDLA 4I8KA 1MH0A 4FUEA 2FOFA 3ODFA 1C2FA 3E0NB 2VB0A 1K22H 4AGJA 4MNYA 5FBIA 4AX9H 1VCPA 1KXAA 3MH4A 4X6OA 1LTOA 3H5CB 3GYLB 4AGKA 1C2HA 1SBWA 2FP7B 2LPRA 5JBBS 2XNIA 1PQ7A 3RXJA 2ZGCA 2CGAA 4D8NA 2FTLE 4Y8XA 4XBBA 1E37B 4GHTA 1EJNA 1P2QA 2GV6A 1JWTA 1GI1A 1V2KT 1TIOA 1T8OA 4K1SA 4Y0YE 1HXFH 4AZ2B 5GJ4B 3BIUH 3EQ0H 5EGMA 4JZ1A 2QXIA 2OLGA 2ZPRA 4Q7XA 1DUEA 3VXEH 1ZTKA 3A7TA 1ETTH 4WXVA 1GI3A 4X6MA 1GVKB 1HYLA 4Q7ZA 1GHYH 3SI4H 2BLQA 4XE4A 2GP9B 1EUFA 1W12U 2F3CE 2NU2E 1VITF 3RXLA 1ESBA 3DUXH 4AB8A 5E0HA 1K21H 2NWNA 1ARBA 2GMTC 3F6UH 1P2MA 2VWMA 1G2MA 2AEIH 3RXDA 4AFSA 1HAOH 2SGQE 2F91A 1S85A 1YC0A 1O3IA 4O9VA 1SQTA 5F8XA 2PSXA 1KTTB 1AWHB 3BTHE 2J9NA 3RXGA 1K2I1 1F5LA 2GMTB 1IQIA 5TCCA 1F0UA 1OWKA 4MTBA 1QY6A 2R3YA 4JZDH 3IITA 1YPJH 1HAGE 2FI3E 2VH0A 1GMDG 1DM4B 2FLRH 1OXGA 2ZI2H 2PLXA 4B2BA 3OSYA 1AZ8A 1TNIA 1E0FD 3BG4C 1EATA 1UCYE 1THRH 3SJ9A 1NRNH 1XX9A 1NZQH 3F1SB 3HPTB 1O3JA 2AIQA 1ORFA 1C1VH 4IGDA 3FP8E 5JPMH 1SQOA 7GCHG 3E91A 3P6ZB 3A7VA 3BG4B 2GDEH 2ANYA 2NU1E 3U8TH 3RM2H 4LXBH 4KELA 1GI4A 3LONA 3PLPA 1WOFA 2VIDA 4ASHA 3SNDA 2BD5A 2CN0H 2FEQH 1FAXA 1EZUC 1UO6A 2ZECA 3RMNH 4D7GA 1SGIB 3A82A 3UQOA 1GDNA 1GI6A 2OC7A 3T5FH 1O5GH 1BITA 1THSH 2Z7FE 4H6SB 3MO6A 1CO7E 3AAUA 4E05H 1ELGA 4KTSA 5FCKA 1C2KA 4IW4E 1FY5A 3O8DA 1P06A 1C2EA 2W26A 4K1TA 1Q2WA 4AFUA 3T27A 2BDIA 1CA8B 4WVPE 2I6SA 4JYVH 1MAYA 1MUEB 2YNBA 4FVBA 4CRFA 4OS7A 1AN1E 3LGIA 1VCWA 1Y8TA 1HXEH 2B8OH 2PTNA 4R0IA 2A7HA 1O2VA 2BD2A 3PWBA 5A0CA 2XBVA 4ABIA 1OKXA 4UFEH 3L33A 4GLYA 2TPIZ 3A8BA 1EOLA 1UVPA 4WMDA 1WUNH 3RUOA 2P8OC 4D76A 1BMLA 1FN8A 1P3CA 3F9FA 1ZGVA 1LHFH 3MU4A 3TU7H 4WF8A 5CMXH 3TNSA 3T28A 1O2OA 2H9EH 1QNJA 2A7JA 4AG1A 2Y81A 2JH0D 3E3TA 4I8JA 4XDEA 4A6LA 2A45B 1IQNA 2P8OB 2Z9KA 3TVJB 1HCGA 3FP6E 4U30A 2FWWA 1ANBA 1HB0B 3BEIB 1UTPA 1GHAG 4KTUA 2ZPSA 3NCLA 2J94A 4INLA 4YESB 3T25A 1GPZA 2BMGB 4DT7B 2D26C 4UONA 1G3DA 2BD4A 1HPGA 4ABBA 2BVSH 1VR1H 2CJIA 1EZQA 3P8FA 1GBMA 1FY1A 2WINI 3RXOA 4LZ4B 1ID5H 2QF3A 1SC8U 1O2JA 3U8RH 1D4PB 1L4ZA 1BTUA 3GY4A 5JBAS 1ELEE 2OC8A 2SGDE 2A7CA 2WYGA 5GCHG 3ZZDA 1PQ5A 3UR9A 4XBDA 2WV4A 5HXFA 1C9PA 1B7XB 2FOEA 1J16A 1Z1IA 5LPRA 1A5GH 2A4GA 2AFQB 3LKWA 5DP4A 3LGTA 1E35B 5K7RA 2O8TA 1GHVH 1SGQE 2Z94A 3K6YA 2PSYA 1EQ9A 3TJUA 1TQ7B 3D23A 1PPBH 3SGBE 1TA2A 2GTBA 1OPHB 3S9BA 4ZKSU 2RCEA 1GMCG 3GYMA 1NFXA 4CBOA 4INHA 3BTWE 3BF6H 1PPHE 4I32A 2DE8A 5EQSA 1O38A 1FPHH 2R2WU 3ZV8A 2HPQH 4ZHMU 1AO5A 4NGAH 1P03A 1SGYE 2BDAA 4KTCA 2VU8E 2VINA 3MU8A 4RN6A 4B71A 1HJ9A 3M37A 1OP0A 5JBCS 1O34A 2SNWA 1D6WA 3RC6A 1KLTA 3E90B 3ATKA 4D9QA 6LPRA 4WY3A 3QO6A 2VIPA 2Y80A 1XMNB 3BSQA 3RU4T 3S9AA 4MPVA 3UNSA 1BBRH 2Y7XA 1L1JA 1LKBA 4AOQA 3DA9B 1ESAA 2ZKSA 2H6MA 1KXDA 2UUYA 1TA6A 3K2UA 5AHGH 4ZXXH 1O5CB 2AMPA 3TK9A 1SSXA 3EA8A 5DJ7A 2UWPA 2ZP0H 1MKWK 3UNQA 2YOLA 1FJSA 4I33A 2I6QA 2P94A 2J38A 2Q6GA 1LVYA 1DT2A 1CSOE 2ZDNA 1C5RA 4BAQB 1V2TT 4Y8ZA 4K8BA 1RJXB 1O3GA 1GI9B 1SPJA 1OWDA 3M3SA 4D9RA 3MI4A 2ANMH 3EDXB 4VGCC 3EA7A 4ABJA 2H5DA 1ZRBA 1OP8A 1V2OT 3BTGE 3U8OH 1PPEE 1SGFA 1TPAE 2M5TA 1NM6A 3FVFB 1T8NA 2AMQA 8LPRA 1FAKH 3GOVB 3MO9A 2BVXH 4ZUHA 1O32A 1GBDA 1B5GH 1QRXA 1EAUA 3SOSA 4VGCB 3S7KB 1WBGB 3PV4A 1BZXE 2VWOA 4WWYA 2G8TA 3RXVA 3UUZA 1T32A 1V2VT 1NT1A 1D3QB 3KQCA 1BTXA 1GL0E 4CRGA 2BLOA 1IAUA 1GBIA 1OWJA 3S7HB 2ZPQA 1AU8A 4FU9A 4X8VH 1LPGB 2CV3A 1GI5A 1C1NA 2R9PA 1EJMA 4NZLA 1JRSA 1C5YB 2BD9A 2Y82A 2OD3B 3KGPA 2STBE 3UOPA 2XWBI 3SUDA 1WCZA 2WPKS 1AVGH 1THPB 3ZVCA 2ZFSA 3FP7E 1QJ7B 1A2CH 1OYTH 2BQ7B 2ULLA 5HM2A 5JB8S 3B8JA 3P17H 2ZU2A 1C5PA 1XKAC 2ZU4A 1O5DH 1WAYB 1G3EA 3QUMP 3LJJA 4AFQA 1C1RA 1NTPA 1TB6H 2PV9B 1FZZA 5EPNA 3MNXA 3E6PH 1VITG 1NRRH 2FYRA 3OYPA 1LPZB 3KF2A 1AKSB 3E16B 3FZZA 5GDSH 1A1RA 1YPKH 4NIYA 3U98H 5A0AE 5E0GA 1BBRE 3RXEA 2ZFRH 2VIVA 1C1QA 1AVWA 1C5UA 1P04A 2W3KA 2P93A 2ZQ2A 3SGAE 1GCTC 4FUCA 1GBLA