1NC6A

Potent, small molecule inhibitors of human mast cell tryptase. anti-asthmatic action of a dipeptide-based transition state analogue containing benzothiazole ketone
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen
publication title Potent, Small-Molecule Inhibitors of Human Mast Cell Tryptase. Antiasthmatic Action of a Dipeptide-Based Transition-State Analogue Containing a Benzothiazole Ketone.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nc6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nc6A02
3A8DA 1V3XA 7ESTE 1AGJA 2PTCE 2O9QA 2UWPA 1HGTH 2FODA 1Y3XA 3ZVEA 1D3PB 2WPJS 3ZZ8A 1VGCC 2WPHS 3H5CB 3VB4A 1AKSA 2OBOA 3E0NB 1EB2A 2FX6A 3M7TA 4DG4A 6CHAC 1AVWA 1P8VC 1OKXA 1FIWA 2D2DA 3SU2A 1GJ9B 3A80A 1DWEH 3BTGE 2CHAB 2P94A 4K8YA 2QF3A 2PKAB 2HNTF 7KMEH 1TPPA 3ZZ6A 1GBDA 1ZMNA 4K1TA 4B1TA 1G3CA 4ABHA 1J14A 4B75A 1AUTC 1IQKA 1ETRH 2PHBA 4NA8A 4AFZA 8GCHG 2FOEA 5K0HA 3SUEA 3A7WA 3LPRA 3BG4C 1SG8B 4OS5A 2H9TH 1KXDA 4B71A 1V2ST 1Q2WA 3ZVGA 1AFEH 1O2OA 2QY0B 2RA3A 3RM0H 2CJIA 2RG3A 2FI5E 1WQVH 1TAWA 3KHVA 1C5VA 5SGAE 1S6FA 2BVRH 1DWDH 4WMDA 2QA9E 4NIVA 2D8WA 3A8CA 3FP8E 4Q7YA 3F68H 5GIBA 2Y6TA 1MKWK 1NFUA 4VGCC 1TE0A 2XWBI 1HBTH 1V2KT 3QGNB 2BZ6H 1EJMA 2YNBA 4NSYA 1K1JA 1GBJA 2VVUA 1ZR0A 3D62A 4KGAA 1GI8B 5FPSA 3RXLA 1NU9A 1SBWA 2FEQH 4AFQA 4FUGA 1SR5C 1QJ7B 1K1PA 1SGNE 1WAYB 3PM3A 2Z9JA 1PPCE 4I8KA 2ZFTA 3DFJA 2ZQ2A 2RDLA 1O5DH 4NIXA 2AMPA 2ZHFH 1EASA 2BD2A 1S83A 4FUEA 1C1TA 1HAOH 3BN9A 3AAVA 3ZZ9A 1O3AA 4LXBH 3LKWA 5PTPA 2Z6BD 4FVDA 1TRYA 1L4DA 4J2YB 3SHAH 5A2MH 2ZPRA 3NWUA 3UQOA 4GCHF 1XVOA 3QZRA 3T25A 1V2TT 2GP9B 1OXGA 3RC4A 4DGJA 5LPRA 1HJAC 2STBE 5DPAA 4CRAA 1A1RA 1UTPA 1T31A 3F1SB 1B5GH 4OS1A 2ZFRH 2QV1A 3QWCH 2ASUB 1W2KH 2GCHG 2R2WU 2IN2A 1QL8A 2ZG0H 1IQHA 3SQHE 4DT7B 1LPGB 4A6LA 5GDSH 2QGRA 2OC1A 1KLJH 1T4UH 1DY8A 3SU3A 2UUFB 3A86A 3VB5A 2BDCA 3MH7A 1WTHD 4ZROA 2Q6DA 1NT1A 2SGFE 2VWLA 1AO5A 2VIPA 4UD9H 1J15A 2SNVA 5A8YA 1RXPA 1M9UA 3A8AA 2PTNA 4B2CA 3ELAH 5GCHG 2R2MB 1DUEA 3UREA 1EATA 4X1NU 1HAHH 1TGCA 4CH8B 4YLUA 2NU1E 2WUCA 1KLTA 4D8NA 1C5RA 4Y7AA 4Y0YE 3KEEA 4E7RG 2TPIZ 1FLEE 4B2AA 2OCVB 2FP7B 2EI8A 2ZIQH 1W14U 2OD3B 1N8OC 4Y71A 2BOKA 1ELFA 2XBWA 3Q3KA 1ZGVA 3O8BA 3T62A 1LPZB 1NRNH 1FONA 3I78A 1TQ0B 3M5OA 3LH1A 1P0SH 2ZHEH 2P8OB 1ANCA 3BTFE 1LHCH 4AYVB 1ELEE 1O2IA 1UHBA 2J9NA 3A7VA 4MG3A 2P3UB 2PSXA 1GBLA 1Y5UT 3HGNA 2VU8E 1A3EH 3SGAE 3BTHE 3ATKA 3V7TA 1UTLM 3RXRA 4E05H 1TIOA 3LJOA 7GCHG 1DSTA 1P3CA 2W3IA 1CA0C 3UOUA 3RC5A 3BTKE 1ZHPA 1T8MA 5FCRA 3KN2A 1BZXE 5CHAC 1DXPA 1CHOF 3BTTE 1J8AA 4Y79A 1D6RA 1MD7A 2G55A 5ESTE 2VVVA 1CT2E 3RM2H 4I8HA 2FI4E 3NKKA 1IQJA 3M5MA 1YPKH 3KCGH 4O3UA 1ANDA 1XX9A 2PR3A 3GOVB 3RXAA 1AHTH 1YPHE 4DY7B 3QX5H 3A89A 1Y3YA 4NFEA 1ZJKA 1UCYH 1AFQC 5EPYA 4ZKNU 2SGEE 3D65E 1QURH 4H42U 4IC6A 2G5NA 3VGCB 1S85A 1F2SE 1DSUA 1FZZA 3MU4A 5FBIA 3TGIE 3U98H 2Z3CA 2CF8H 1C1MA 1O30A 2BZAA 2ZDKA 4CREA 3P95A 1ZZZA 1TNJA 3PB1E 1P2KA 2UWOA 1H1BA 3RU4T 1SL3A 3LDXH 1AKSB 1BBRE 4DIHH 4AOQA 1UTMA 4ZKSU 4AFUA 3RMMH 4X8SH 2A7JA 1BDAA 1EPTC 1W7XH 3KGPA 4BAOB 3IG6B 3SN8A 1N6YA 3SGQE 3EGKH 4JMYA 1CT0E 1UTKA 2JH5D 2BD7A 1N1LA 1ESBA 1O35A 1V2QT 1GBKA 1OOKB 1EPTA 3TVJB 4ZUHA 1HJ9A 4MPVA 1ARBA 1OP2A 1BITA 5FPTA 1UVTH 1VITG 5TJXA 5A0BA 1SQOA 3QN7A 1K21H 2FLBH 1EXFA 4YM9A 2O8TA 1YPLH 1GBIA 4NWLA 2O8LA 5E0JA 4Z0KA 3PV4A 5FAHA 1O3FA 4NZQA 4UFDH 2BD8A 3SHCH 1O34A 1DLEA 2CF9H 1F0RA 3PTBA 1TMUH 4ISOA 3PO1B 1CGIE 3GY7A 1SFQB 1TNGA 4IW4E 1DVAH 1YGCH 3FP6E 4KKDA 2ZFSA 1QA0A 1ELBA 3ZVAA 4Q2KA 4F4OC 4B2BA 1NFXA 2A4RA 1EZQA 4D7FA 1GHAF 2WV5A 4KELA 5H4IB 1QBVH 1RTLA 1YCPK 2IOTA 5JB9S 4ESTE 1FY3A 2XRCA 2VJ1A 1OWHA 4YLQH 1C4U2 2A5AA 2CHAC 1GDUA 1P9SA 2ZTYA 1P06A 3GY4A 3N7OA 3D23A 2OUAA 1GGDB 2ZHDA 2XC5A 3P8GA 1MKXH 1HIAA 1WSSH 3MH6A 2PKAA 1SLUB 3BF6H 2C4FH 3FZZA 3PWCA 1AWFH 1O3CA 4RKOB 2GCTB 4Y10E 3ODFA 3RXKA 5JPMH 4U30A 4WXIA 5HM9A 3RXOA 3VEQB 1TPAE 4GPGA 2WINI 1FPCH 1GHYH 3H7TA 4X1SU 2XWAA 1MUEB 2FO9A 4YTAA 1EUFA 1FI8A 2QXIA 3S69A 4D9QA 2ZDNA 3HPTB 4RKJB 4AB8A 1FAXA 2FESH 3SJOA 1O2TA 3T28A 4CRGA 4R0IA 4FUCA 5C3NA 1GI3A 3TPIZ 1A3BH 1PPHE 2XBXA 4IMZA 1XKBC 2FOFA 4AGJA 1DWCH 1O2GH 1QJ6B 3LH3A 2ZGXH 3FANA 3KL6A 5FBEA 5EXLA 2ZA5A 3M61U 1LKAA 4SGBE 4Y6DA 1ABJH 4OS2A 3SU5A 1BA8B 1EAWA 3E16B 1F92A 1OX1A 3LGWA 3P17H 1UTNA 5C1YA 3ATWA 2BYAX 1O2XA 3BEUA 3MO3A 1MTWA 1E0FD 1J17T 2BVXH 1JIRA 2F9OA 5CMXH 1JOUB 4R8TB 1TPSA 3GY6A 3MH5A 4CR5A 2AYWA 3L6PA 1OWEA 3E3TA 1Y8TA 1P10A 3BTWE 1C1PA 1LQDB 1GMCG 2Y5GA 1QRWA 3S9BA 2HOBA 3SNDA 1O39A 2H5CA 3ZZBA 1YYY1 3GDUA 1MCVA 2FOCA 3UWIA 1J16A 2BY5X 2OQUA 2GGVB 4JK6A 5FXLA 1ESAA 3GDSA 1NFYA 4ABBA 1AZ8A 1SMFE 4O03A 3SNAA 1IHSH 2ZGHA 1MKWH 1TNIA 2VINA 1OP0A 1PQ5A 1A0LA 1VCPA 4DW2U 1Z8IB 2A2XH 1O31A 1BB0B 1GMCF 1G2MA 2ODPA 2XTTB 4OS4A 4K3JA 1AB9B 2BDGA 2Z94A 1C4V2 1X7AC 2ZGCA 1O3MA 1EAIA 3MU8A 4CRBA 1EB1H 3A88A 5A09A 1VJAU 3F6UH 2AGIX 4NWKA 5JBAS 1HAXB 1SQAA 1O2QA 1THPB 2VWMA 1GI9B 1UCYE 1DOJA 4UEHH 2BY6X 5L2ZH 2BQ7B 1XXFA 1KIGH 4K1SA 3NUMA 1C1QA 1Z1JA 1HJ8A 3GCTF 1V2WT 2BXTH 4X6MA 3BG8A 3SU6A 1LQEA 2P8OC 2Q6GA 2GZ7A 1GJ7B 3TH2H 3TNSA 1A7SA 1QB1A 3U1IB 5LGOA 3PTNA 4FXGH 3RXBA 4D7GA 1ELDE 1O3HA 2XXLA 2UUJB 1PPBH 4DOQA 4I8LA 5E0HA 2ZCLP 1AUJA 3VXFH 3STJA 1P2OA 1V2VT 3SNCA 5C5NA 1GG6B 2Z9GA 4BAMB 4ZHMU 1FN6A 4BXSA 1FY5A 6LPRA 1RS0A 3G01A 1MKXK 1GVZA 2DUCA 2PSYA 3M5NA 2VIQA 3TK6A 1C2GA 1TBRH 3HK3B 1TX8A 3RXFA 2I6SA 5DK1A 1YPGH 1T8NA 1QGFA 4ZXXH 1GJ6A 4X8TH 4JZIA 5ETXA 5JYIA 1ZGIA 2BX3A 2C90B 1HLTH 2G52A 4BXWA 1SC8U 1TRMA 3VGCC 5A0AE 3GDVA 1S6HA 2TRMA 4XOJA 1O3KA 1KXCA 2TGAA 1SGYE 5C1UA 9ESTA 1GHBF 4X2XA 3OY6U 2C93B 2TGPZ 3ATLA 3B23B 3FZDA 2AS9A 3SUGA 1ESTA 3E6PH 1ZSKA 3MTYA 3NK8A 5JB8S 2PFEA 3RXVA 3KQEA 1C5UA 1O3GA 1CVWH 1UTOA 1GCTB 1Q3XA 1JRTA 5EGMA 5I46H 4FU7A 4A92A 3LGVA 3MNSA 3EYDA 4K8BA 4Y8ZA 1ELVA 1GVLA 2BY7X 1B7XB 4X1QU 4YOJA 1S84A 1ARCA 2BY8X 4XFQA 2KAIA 1P03A 3QTOH 1HIAB 4Y7BA 2THFB 2F9VA 2VIWA 4ZXYH 8LPRA 4WJG2 4ZKOU 1YM0A 2ZFPH 2V3OH 1BMMH 2R9PA 4AGKA 1K1NA 1C5SA 1PFXC 1IQEA 5B6OA 3VFEA 1WUNH 1Y3UA 2BTCE 1NESE 1GHWH 2A4OA 5T3HA 1YC0A 2G81E 1W0YH 1DS2E 1XVMA 7LPRA 4X8UH 1MU8B 1O3OA 1SGFA 1OWIA 1ZOMA 1QBOA 3PO1C 5I25A 3RXCA 1FUJA 4UFEH 1V2JT 1MD8A 8GCHF 4X6PA 2FOAA 1GI7B 4I8GA 4WWYA 2G8TA 5JBBS 2PW8H 2BLQA 1AMHA 2J95A 3MI4A 1A0HB 3UY9A 2FWWA 2HGTH 2VIDA 2FIRH 1DICA 2ZC9H 1AVGH 1BCUH 1MCTA 1NN6A 1VCQA 1EZSC 1GGDC 1IQGA 1GHVH 1GCDA 3LGIA 1WBGB 4K69A 2V6NA 3AVZA 3PWBA 1LHGH 1OYTH 2PKSB 3A7YA 1Y3VA 2JH0D 1JIMA 2BDIA 1EAUA 3B8JA 1YPEH 2GCTC 2XBYA 4BAKB 4HZHA 4ZH8A 1LHEH 3MYWA 2QCYA 2GDDA 4AYYB 2FOMB 2PLXA 5FX5A 3BTQE 5LPEA 5DKMA 2O8MA 3FAOA 4RN6A 3SV9A 3S9CA 1UVUH 2PUXB 1FIZA 2TIOA 2ZHWH 1C2EA 1RD3B 1F5KU 1SGCA 5DO4H 1TNLA 2LNCA 1BOQA 4Z6AH 2Z9KA 2Y80A 2Z9LA 1P2JA 1SSXA 1Q31A 2Y7ZA 2ZGJA 4K2YA 1A5GH 4GVUA 2EEKA 2J4IA 2GZ8A 4H4FA 5F8TA 1C2MA 5FHTA 4CRCA 1O32A 4Q7XA 3F9EA 4QT8C 3TGJE 2EC9H 4WH6A 1FV9A 1LHDH 1K22H 1TWXB 2WPLS 3GCOA 1RRKA 4MDSA 1YCPM 2SFAA 3RXQA 1YCPH 2QF0A 4CR9A 1C5TA 2GKVE 2NU0E 1ZPBA 4IN1A 5C67A 1JBUH 2UUYA 2FS8A 4A7IB 2H5DA 4AG1A 2GCHF 1V2NT 3ESTA 4BNRA 1YPHC 4YOIA 1H8IH 2ZO3H 1AWHB 2F83A 3M36A 1TNKA 2UWLA 1O3BA 2Y7XA 3LONA 2A0QB 3VB7A 4OGXA 1G9IE 3MWIU 1A0JA 3UIRA 2VGCB 3MO6A 2Y82A 1O3EA 6GCHG 3U8OH 5JBTA 2EI6A 1LVMA 2GTBA 5HXFA 1QNJA 3ZZ4A 3PMHB 4K1EA 1BRAA 3GISB 3ITIA 5GCHF 3GCHB 3SZNA 4MNYA 1O2ZA 4MPUA 1C2JA 2CV3A 4FVBA 3KQCA 1HAGE 1V2OT 1VZQH 1JRSA 3OX7U 1O5BB 1P02A 4UE7H 3MU0A 2P93A 4INHA 1CE5A 4YESB 2ZCKP 3UNSA 4KTSA 2BD4A 3VB6A 1GI6A 1N6XA 2BDHA 5E8EH 1GPZA 3SQEE 1C1NA 1TGNA 2VNTA 1GI4A 4ISLA 4X1PU 2NU2E 3PMAB 1AB9C 2YNAA 5DP9A 3E91A 2P3FH 1RJXB 2HALA 1EX3A 1TA6A 2XBVA 1BHXB 2XNIA 4BTTB 4CH2B 5AF9H 2FZZA 1AD8H 3L33A 5J4QA 4YZUA 3HGPA 2H2ZA 5E2PA 1SOTA 5A8ZA 4AX9H 2BLWA 4ABIA 1JMOH 3RU4D 1Y5BT 4YO9A 5TCAA 2F9UA 2G00A 3FVFB 7GCHF 4AG2A 1Z8JB 2R3YA 1BRBE 1O2LA 2J34A 2ZU4A 4IN2A 3K9XB 1T7CA 1GWAA 4FUBA 1ID5H 5G4BA 5FCKA 1C5OH 4WVPE 3UFAA 1EAXA 3RC6A 4AORA 1YF4A 1F0SA 5K7RA 1PPGE 4GUXA 3Q00A 4CBOA 4JYVH 3S0NA 1GBHA 5E2OA 2EA3A 3AASA 2EI7A 3BEFB 3V13A 4SGAE 3R0FA 4CHAB 1P09A 1GDQA 2F9PA 3LC3A 3SNBA 5AFYH 1GG6C 5EPNA 2HPPH 1PQAA 1W7GH 1ZRBA 1O5GH 2BB4A 2GZ9A 2B0FA 1MBMA 2KAIB 1Z71A 3TITA 4X2VA 1HAIH 1C1UH 1C5WB 2JH6D 2ANMH 1QY6A 4ZKRU 4XBDA 1BJVA 5L2YH 3S7HB 4UFGH 4O9VA 1WTGH 3PLKA 4ISNA 1ZTKA 3SUDA 1O5CB 1T8LA 4MNWA 3RXSA 3SNEA 2OXSA 1Z6EA 1E36B 4ABFA 3M7UA 1A5HA 4JYUH 3SW2B 2A4GA 3RU4E 2QYIA 1MTVA 1CBWB 1GMHG 1ELAA 3O8RA 1SLVB 1ZMJA 1F7ZA 2W5EA 4MTBA 3WY8A 2QXHA 3AAUA 1GMDG 1VCWA 4MQAA 1C1OA 3ZZAA 1PJPA 3DUXH 1TX7A 1SFIA 1W13U 4ABJA 2QAAA 1E37B 1K28D 4XBCA 3TIUA 3OU0A 1NM6A 5GPIB 3S9AA 1O0DH 2OC7A 3M3VA 1THSH 1UVOA 1GCTC 4MPXA 1VITF 1GBEA 1CT4E 5DG6A 3A82A 1ANBA 4PROA 5J4SA 2ZU5A 1TNHA 2BLOA 1RGQA 2ZTZA 1SHHB 3HKIB 3KF2A 1P04A 3GCNA 5HGGA 1DXWA 2ALVA 1HDTH 1UK3A 1KXAA 5DP5A 1OSSA 1Y3WA 3C1KA 1H9IE 2V35A 2GD4B 5GJ4B 2VB0A 3PYHA 2SGQE 3RXEA 3ZZ5A 3UUZA 1MH0A 1SI5H 1SGQE 2QC2A 5F8ZA 1DLKB 3UPEA 2A4QA 2A1DB 5IDKA 1TOMH 3MNCA 1GJCB 1DFPA 3PLBA 3PMJA 2P3TB 1LO6A 1FJSA 1TYNA 4MLFB 1AU8A 4J1YA 1SGEE 1T32A 2CN0H 1V6DA 4GHQA 3VPKA 1GJ4H 4IBLH 2GMTB 1W0ZU 2HLCA 8KME2 3ODDA 1V2RT 2AEIH 1G3EA 1PPFE 3V12A 1DWBH 3RXUA 3K6ZA 2QIQA 1XUHA 2ZDVH 4A1XA 1BTUA 4HI3A 3BTEE 1C2LA 1ZSJA 1HFDA 2HVXA 1TLDA 2TGDA 5EU8A 1C9TA 1LMWB 5C5OA 2H6MA 1EKBB 1FNIA 2QN5T 4ABAA 1C5LH 1EQ9A 4Q7ZA 1TMTH 2BMGB 4FU9A 4FUFA 2PKSC 4JZEH 5ABWA 1MMJN 3DT0H 1QQ4A 4I32A 1DT2A 1F0UA 2ULLA 4U2WA 1NFWA 3MH4A 1IQFA 1GI0A 1GBMA 4FUHA 1ZLRA 1XUIA 2G5VA 2V3HH 2ZCHP 5EW1H 2O8UA 1C5ZB 1RIWB 3A87A 4HTCH 1MZDA 2A5IA 1O2MA 3SUFA 1BTYA 1TABE 1B0FA 3HATH 1NRRH 1GJBB 3M35A 3TU7H 5HYOA 2Q6FA 1A5IA 2HNTE 3KNXA 3SJKA 3SO3A 3TGKE 3P6ZB 3S7KB 4ZMAH 3Q3YA 4FUIA 1P9UA 1CO7E 1NRPH 3QK1A 1NZQH 1W11U 3TJOA 1BMNH 3P92A 4B73A 2VVCA 4E06H 1HB0B 4RSPA 1QBNA 3SJ9A 4Y11E 3U8RH 1O2NA 1GBAA 2ILNA 5IYTA 2OBQA 1YBWA 1KXFA 2SNWA 5EXMA 2FYRA 2C8XB 1HAVA 1ZMLA 4WMEA 3TH3H 2B9LA 4B76A 3E8LA 1ZRKA 5T6GA 4Y0ZE 2WPIS 1W8BH 5DP4A 4Y8XA 3RXIA 1MBQA 1HXFH 1ZTLA 3T2NA 3SJ8A 4ABDA 2ZWLH 1F5LA 1C5QA 2RA0A 4INLA 4I8JA 1ELGA 1VITH 1GHXH 3ZZCA 2VGCC 3MO9A 4BANB 2FM2A 3ZYDA 1HAYB 1CGHA 5A8XA 2F91A 3UWJH 4UDWH 1KTTB 1O3PB 2WYGA 3GCHC 3RXMA 3SI4H 3ZVDA 1D3TB 3V3MA 2HRVA 1SVPA 1TQ7B 2FOBA 5EW2H 2XCFA 5HM2A 2DE8A 3ZVCA 3NXPA 1DITH 3CS7A 4HGCA 5EG4A 2GDEH 1THRH 2Y5HA 5JDUB 3ZYEA 4K60A 1ORFA 2AMQA 5GWZA 1LKBA 5C2ZA 3GYMA 1E38B 3F9HA 1HUTH 1C1VH 1C1SA 1UMAH 2XYAA 1EP5A 5LH8A 1D3QB 2TGTA 3KQDA 3STIA 1NROH 2ZU3A 2XCNA 2GVFA 2ZU1A 1AVXA 1FY1A 2J38A 1O2JA 3A83A 3Q77A 2Y81A 1YLCA 3A7XA 2NWNA 2ZECA 1L0ZA 1BUIA 4ISHH 3P8FA 4O97A 5EODA 4K5ZA 1BT7A 1P12E 1F0TA 1OWDA 2J94A 2BM2A 1O2SA 1L2EA 3Q76A 2SGAA 2IJOB 1INCA 4NSVA 6ESTA 3LT3A 3T5FH 1FQ3A 3U1JB 1BTZA 5F6MA 1P57B 4YOGA 3V0XA 1YP9A 1NRQH 4KTUA 1KXBA 1S0QA 4CHAC 1FDPA 2P16A 1PQ8A 4OS7A 2FDAA 1GJ8B 1D9IA 3KQBA 3P70B 1SQTA 1A46H 1GL0E 1F5RA 3JZ1B 4X2WA 1A61H 3P8NA 2PGQB 1CGJE 1NO9H 3ZV9A 1HCGA 1P2QA 1TX6A 2ODYB 1NPMA 4I33A 3JZ2B 5A0CA 1O38A 1NC6A 2AERH 1GI1A 4I7YH 1D4PB 2ALPA 1ZJDA 2RCEA 3EAJA 3EA9A 1GBCA 4ZHAA 2C8ZB 4Q80A 3TLOA 1XUJA 1TRNA 1CQQA 1CBWC 1UTQA 1WU1A 1Z6JH 2XC4A 1S82A 2WYJA 1LHFH 2PV9B 1CU1A 1C2IA 3PLPA 2VIOA 2AH4X 1BRUP 1BBRH 3ATMA 2GV6A 2BD3A 4U01A 3M37A 2VWOA 2GX4A 3D49H 3TK9A 3Q3XA 3UNRA 1P2NA 1V2UT 3RXTA 1AIXH 2Y5FA 1C2DA 1CHGA 1BMAA 1O3DA 2OQ5A 3RLYH 2UUKB 3H7OA 3RMLH 1XUGA 4ZHLU 5BRRE 2K1QA 2R0KA 4JZFH 1ETTH 1E34B 1EJNA 3SGBE 2SGDE 2C8WB 1ZHRA 3QDZB 4NFFA 5ESBA 5AFZH 3VB3A 1BQYA 3IWMA 1J9CH 3RLWH 3RMNH 1HV7A 1KYNA 4HFPB 2A7CA 4TY6A 1JXPA 2A7HA 1EP6A 4XBBA 1MTNB 1QR3E 4ABGA 3A7ZA 2GT8A 1G2LA 1QL7A 1ZSLA 3GY3A 4O3TA 1TONA 3C27B 2A45B 4ISIH 1H8DH 2BD5A 3A85A 1EOLA 1D6WA 3ZZ3A 4NA7A 1A2CH 4BOHA 1UK4A 1Y5AT 5AVDA 3EQ0H 3TK5A 1K1IA 3URDA 3ZVBA 2Z7FE 1BTWA 1QQUA 1WYKA 2GMTC 2VIVA 4GCHG 2DE9A 5LPFA 4TPYA 3MU1A 2F3CE 3SV6A 4A5TS 3TJUA 1KXEA 1O2YA 1ANEA 4GSOA 3RMOH 3T27A 1QB9A 1SGRE 2STAE 1IQLA 2AGEX 3LGYA 4X6OA 4BTIB 2QXJA 1BMLA 4WXVA 1K1MA 3RP2A 1KDQA 2G51A 2ZP0H 2AIPA 3ZZDA 1AE5A 1HAVB 3SV7A 1WCZA 2A2QH 4E7NA 5L6NH 3RXPA 2VH6A 3E0PB 1P05A 3F9FA 4NG9H 4GLYA 3PMBB 3FFGA 1GBFA 2H9HA 4X1RU 5JBCS 1P3EA 2ZDLA 3QZQA 1GDNA 4DIIH 2Z9IA 4JZ1A 4NZLA 2PUQH 1QRZA 2I6QA 1CSOE 1TALA 1GJ5H 1NU7B 1SOZA 2BXUH 3F9GA 1LVOA 3HK6B 1RIWC 3SORA 3LC5A 4Y76A 2CGAA 1EZUC 2ZF0H 2FLRH 2FPZA 4TWWA 1TGTA 2W7SA 3BIVH 1V2LT 1UVSH 1OWKA 1G37A 1QHRB 5FX6A 4F49A 1P2IA 3T26A 2FMJA 1GBBA 5EQSA 4KTCA 2C8YB 2PGBB 1BIOA 1QIXB 3K2UA 2OLGA 1QB6A 2VH0A 2BLVA 2FXRA 2BDBA 1SGPE 2ZKSA 1GJDB 4X2YA 5F03A 3RXDA 3TJVA 1H9LB 2ZTXA 1L4ZA 1MU6B 6GCHF 3R3GB 4KP0A 1GI2A 1W10U 1SPJA 4DCDA 3EE0B 3M7QA 3UOPA 4AZ2B 1MAXA 3MOCA 1CHOG 3GY2A 3MU5A 4X8VH 4WF8A 1SHYA 4MPWA 1O36A 1A4WH 2A31A 1BHXF 1DX5M 2AIQA 2XW9A 2CXVA 1IQIA 4WH8A 5T6FA 1GVKB 1S81A 4ASHA 2OINA 1GJAB 1ZPZA 1OWJA 3BEIB 2ZFFH 1BBRK 4LOYH 1SLWB 1MQ6A 1H4WA 4AN7A 4CBNA 4GAWA 1QL9A 1O3NA 2B5TB 1O2RA 3UTUH 3DD2H 1DY9A 5F8XA 1KTSB 5DP6A 3AW0A 3DA9B 2ODQA 5DP7A 4XSKU 2FI3E 1C2KA 1O2HA 1RFNA 1PPZA 2JETB 3A7TA 3I77A 1C5MD 4FUDA 1QJ1B 2ANWA 1ZYOA 3KIDU 1PQ7A 1GHZA 2J2UA 2QXGA 3QUMP 2W26A 3LOXA 2SGPE 1AN1E 2B7DH 1LTOA 1XKAC 1Z1IA 1U6QA 3CP7A 1ACBE 4LK4A 2ZI2H 1KLIH 2WUBA 1DANH 3OY5U 1LVYA 2FS9A 5BPEA 1TB6H 1Z8RA 1OS8A 2H9EH 1SGFG 3SI3H 3TNTA 3GICB 1HXEH 2WPMS 1L1NA 1UTJA 3VXEH 1TOCB 4MNVA 2FX4A 1YPMH 2B8OH 1VJ9U 3L3TA 4OGYA 4NIYA 1C2FA 1EZXC 1VGCB 3QTVH 2ZPQA 4MVNA 4AB9A 1AY6H 1LCYA 4YT6H 6CHAB 5CE1A 4JZDH 1EOJA 1NS3A 2CMYA 2OC8A 5EXNA 1P01A 3MHWU 3U8TH 3NCLA 1TBQH 3W95A 3ZZ7A 2ANKH 4DURA 4UFFH 5EQQA 2R3UA 1V2PT 4NCYA 1E35B 3K6YA 2BOHB 1XUFA 4JYTA 1GMHF 5FPYA 4OS6A 1GHAG 3UQVA 3BG4B 1QA7A 2ZGBH 1O5AB 1C1WH 1GMDF 5EQRA 3BTDE 3A8BA 3ATIA 1O2KA 1ELTA 2BD9A 1SGDE 1AI8H 3OSYA 3TJNA 4UONA 1K1OA 2ZNKH 2HWLB 2ZDAH 2LPRA 2OP9A 5L30H 2A5KA 3RUOA 3RXJA 1W12U 2FTLE 1AZZA 3FP7E 2W7UA 4BAQB 4CRDA 1HAPH 1TPOA 4INKA 1AQ7A 2BHGA 3M3SA 5DP8A 1C5XB 2J92A 2AFQB 1P11E 4VGCB 1G3BA 5EOKA 4IGDA 3UR6A 3A84A 3SJIA 1G30B 3MFJA 5DGJA 3URCA 3UR9A 1QFKH 1HRTH 3EDXB 2HNTC 1FMGA 1O3LA 4XE4A 4A1TA 3DFLA 3M5LA 1ELCA 1ZTJA 2ZZUH 1FPHH 2BQWB 8ESTE 1VR1H 2FOHA 3RXHA 1GBTA 4U32A 3MNBA 1ZPCA 5DP3A 3DHKH 1NTPA 3PROA 2ESTE 1XXDA 3GY8A 1OPHB 4ZAEA 1DUAA 1DPOA 2ZEBA 1UK2A 4LZ1H 1KDQB 3U9AH 4FUJA 2ZQ1A 1SB1H 2JKHA 1L1GA 1TGBA 3NPSA 1MQ5A 1OYQA 4NIWA 3EA7A 1NY22 1MTNC 4ABEA 3BV9B 1GI5A 1O33A 1O3JA 1WQSA 1YLDA 2D26C 4BAHB 1NRSH 1HJAB 1V2MT 1ABIH 1RTFB 2ZPSA 1YKTA 4A1VA 1G3DA 3OYPA 2P59A 4DJZB 2H1UA 1RTKA 1LPKB 3P8OA 1FAKH 1PYTC 3I29A 1O2VA 1HYLA 1O2PA 2R0LA 2G4TA 1MZAA 1PYTD 3T29A 5DJ7A 1W3CA 1C1RA 4D76A 5E0GA 1WOFA 2BVSH 4IS5A 1ETSH 2GT7A 1BJUA 4TYDA 1SGTA 1C5PA 1TFXA 3LGTA 2NU3E 3BIUH 4X0WU 1DM4B 4IMQA 2GV7A 1BTXA 1IOEA 1KSNA 1YPJH 2M5TA 1UCYK 1FY4A 1TBZH 2TBSA 1BTPA 1C4Y2 3OTJE 4BTUB 3RDZA 3AW1A 5HMAA 1G32B 1S0RA 1AE8H 2FTMA 5TCCA 3SU1A 1CA8B 1N8OB 4TWYA 3SU0A 1DE7H 4THNH 2A32A 4H6TA 4AFSA 1O2WA 2G4UA 1SGIB 1TGSZ 1UHBB 4DVAU 2P95A 4MNXA 3EA8A 4M7GA 1KY9A 1TA2A 4LZ4B 3TH4H 3M3TA 2W3KA 1T4VH 3CS0A 1C2HA 1QCPA 2Z3DA 1L1JA 1XM1A 1GL1A 1BTHH 1Z8GA 1P2MA 4NGAH 1LDTT 2NU4E 1C5NH 2Q1JA 1EJAA 1T8OA 4XDEA 1H9HE 4B74A 1FXYA 1K2I1 3O8DA 1XMNB 3BTME 3GCTG 2AGGX 1CA0B 5GXPA 2ZDMA 1BRCE 1IAUA 1QRXA 2F9BH 5CHAB 2ZHQH 1DDJA 5T6DA 4CRFA 4TY7A 2ANYA 3SV8A 1HAZB 4TPIZ 1QTFA 3LGUA 1Y59T 3RXGA 1UO6A 3ZVFA 3SU4A 4FU8A 3CENA 4Y8YA 1OP8A 1IQMA 1C9PA 1C5YB 1AFQB 1MTSA 3LJJA 3SBKA 3QGJA 1G36A 1IQNA 3SV2H 1O2UA 2BY9X 4IC5A 3GYLB 9LPRA 1FN8A 4WY3A 1O37A 5C20A 1MAYA 3ZV8A 4JCNA 2O8WA 1LVBA 1XUKA 3QLPH 1O5FH 3E1XB 1WV7H 3MNXA 2WPKS 1TMBH 5C1XA 3UNQA 3SOSA 4H6SB 3A81A 2YOLA 1JWTA 3BSQA 3LU9B 2OTVA 2FOGA 2BX4A 1S5SA 1D3DB 4JK5A 1O5EH 2FYQA 3ENSB 1EPTB 2C3SA 2IPHA 1B0EA 2Z3EA 3IITA 1O3IA 4NA9H 1GHBG 2JETC 2WV4A 1FY8E 1Z7KA 3E90B 1MTUA 4GHTA 5AHGH 3O8CA 2BDAA 3NZIA 2XC0A 3MMGA 1HPGA 2OC0A 1ZHMA 2ZU2A 1PPEE 3HKJB 1IHTH 1UJ1A 1SLXB 3QO6A 4X6NA 3B9FH 1K9OE 1K1LA 2HPQH 3GY5A 2BQ6B 4D9RA 3K65B 4I31A 2D1JA 3W94A 1HNEE 2BDYA 2V0BA 2VWNA 2PWXA 1UVPA 4YT7H 3U69H 2ZFQH 2F9NA 4WMFA 2AMDA 3LIWA
chains in the Genus database with same CATH superfamily
3A8DA 1V3XA 7ESTE 1AGJA 2PTCE 2O9QA 2JJ1D 2UWPA 1HGTH 2FODA 1Y3XA 3ZVEA 1D3PB 2WPJS 3ZZ8A 1VGCC 2IJD1 2WPHS 3H5CB 3VB4A 1AKSA 2OBOA 3E0NB 1EB2A 2FX6A 3M7TA 4DG4A 6CHAC 1AVWA 1P8VC 1OKXA 1FIWA 2D2DA 2KX4A 3SU2A 1GJ9B 3A80A 1DWEH 3BTGE 2CHAB 2P94A 4K8YA 1H8HD 4TT3D 2QF3A 2PKAB 2HNTF 7KMEH 1TPPA 3ZZ6A 1GBDA 1ZMNA 4K1TA 4B1TA 1G3CA 4ABHA 1J14A 4B75A 1AUTC 1IQKA 1ETRH 2PHBA 4NA8A 4AFZA 8GCHG 2FOEA 5K0HA 3SUEA 3A7WA 3LPRA 3BG4C 1SG8B 4OS5A 2H9TH 1KXDA 4B71A 1V2ST 1WDIA 1Q2WA 3ZVGA 1AFEH 1VKYA 1O2OA 2QY0B 2RA3A 3RM0H 2CJIA 2RG3A 2FI5E 1WQVH 1TAWA 3KHVA 1C5VA 5SGAE 1S6FA 2BVRH 1DWDH 4WMDA 4RI0A 2QA9E 4NIVA 2D8WA 4AC9A 3A8CA 3FP8E 4Q7YA 3F68H 5GIBA 2Y6TA 1MKWK 1NFUA 4VGCC 1TE0A 2XWBI 1HBTH 1V2KT 1MABB 3QGNB 2BZ6H 1EJMA 2YNBA 4NSYA 1K1JA 3U28C 1GBJA 2VVUA 1ZR0A 3D62A 4KGAA 1GI8B 5FPSA 3RXLA 1NU9A 1SBWA 2FEQH 4AFQA 4F55A 4FUGA 1SR5C 1QJ7B 1K1PA 1SGNE 1WAYB 3PM3A 2Z9JA 1PPCE 4I8KA 2ZFTA 3DFJA 2ZQ2A 2RDLA 1O5DH 4NIXA 2AMPA 2ZHFH 1EASA 2BD2A 1S83A 4FUEA 1C1TA 1HAOH 3BN9A 3AAVA 3ZZ9A 1O3AA 4LXBH 3LKWA 5PTPA 2Z6BD 4FVDA 1TRYA 1L4DA 4J2YB 3SHAH 5A2MH 2ZPRA 3NWUA 3UQOA 4GCHF 1XVOA 3QZRA 3T25A 1V2TT 2GP9B 1OXGA 3RC4A 4DGJA 5EJLA 5LPRA 1HJAC 2STBE 5DPAA 4CRAA 1A1RA 1UTPA 1T31A 3F1SB 1B5GH 4OS1A 2ZFRH 2QV1A 3QWCH 2ASUB 1W2KH 2GCHG 2R2WU 2IN2A 1QL8A 2ZG0H 1IQHA 3SQHE 4DT7B 1LPGB 4A6LA 5GDSH 2QGRA 2OC1A 1KLJH 1T4UH 1DY8A 3SU3A 2UUFB 3A86A 3VB5A 2BDCA 3MH7A 1W0KD 1WTHD 4ZROA 2Q6DA 1NT1A 2SGFE 2VWLA 1AO5A 2VIPA 4UD9H 5HIZA 4TSFD 1J15A 2SNVA 5A8YA 1RXPA 1M9UA 3A8AA 2PTNA 4B2CA 3ELAH 2KCPA 5GCHG 2R2MB 1DUEA 3UREA 1EATA 4X1NU 1HAHH 1TGCA 4CH8B 4YLUA 2NU1E 2WUCA 1KLTA 4D8NA 1C5RA 4Y7AA 4Y0YE 3KEEA 4E7RG 2TPIZ 1FLEE 4B2AA 2OCVB 2FP7B 2EI8A 2LP6A 2ZIQH 1W14U 2OD3B 1N8OC 4Y71A 2BOKA 1ELFA 2XBWA 3Q3KA 1ZGVA 3O8BA 3T62A 1LPZB 1NRNH 1FONA 3I78A 5HKKD 1TQ0B 3M5OA 3LH1A 1P0SH 2ZHEH 2P8OB 1ANCA 3BTFE 1LHCH 4AYVB 1ELEE 1O2IA 1UHBA 2J9NA 3A7VA 4MG3A 2WV9A 2P3UB 2PSXA 1GBLA 1Y5UT 3HGNA 2VU8E 1A3EH 3SGAE 3BTHE 3ATKA 3V7TA 1UTLM 3RXRA 4E05H 1TIOA 3LJOA 7GCHG 1DSTA 1P3CA 2W3IA 1CA0C 3UOUA 3RC5A 3BTKE 1ZHPA 1T8MA 5FCRA 3KN2A 1BZXE 5CHAC 1DXPA 1CHOF 3BTTE 1J8AA 3N7EA 4Y79A 1D6RA 1MD7A 2G55A 5ESTE 2VVVA 1CT2E 3RM2H 4I8HA 2FI4E 2YMSC 3NKKA 1IQJA 3M5MA 1YPKH 3KCGH 4O3UA 1ANDA 2WHXA 1XX9A 2PR3A 3GOVB 3RXAA 1AHTH 1YPHE 4DY7B 3QX5H 3A89A 1Y3YA 4NFEA 1ZJKA 1UCYH 2QE7D 1AFQC 5EPYA 4ZKNU 2SGEE 3D65E 1QURH 4H42U 4IC6A 2G5NA 5CDFE 3VGCB 1S85A 5KECA 1F2SE 1DSUA 1FZZA 3MU4A 5FBIA 3TGIE 3U98H 5T1VA 2Z3CA 2CF8H 1C1MA 1O30A 2BZAA 2ZDKA 4CREA 3P95A 1ZZZA 1TNJA 3PB1E 1P2KA 2UWOA 1H1BA 3VG8A 3RU4T 1SL3A 3LDXH 1AKSB 1BBRE 4DIHH 4AOQA 1UTMA 4ZKSU 4AFUA 3RMMH 4X8SH 2A7JA 1BDAA 1EPTC 1W7XH 3KGPA 4BAOB 3IG6B 3SN8A 1N6YA 3SGQE 3EGKH 4JMYA 1CT0E 1UTKA 2JH5D 2BD7A 1N1LA 1ESBA 1O35A 1NBMD 1V2QT 1GBKA 1OOKB 1EPTA 3TVJB 4ZUHA 1HJ9A 4MPVA 1ARBA 1OP2A 1BITA 5FPTA 1UVTH 1VITG 3EE7A 5TJXA 5A0BA 1SQOA 3OEHD 3QN7A 1K21H 2FLBH 1EXFA 4YM9A 2O8TA 1YPLH 1GBIA 4NWLA 2O8LA 5E0JA 4Z0KA 3PV4A 5FAHA 1O3FA 4NZQA 4UFDH 2BD8A 3SHCH 1O34A 1DLEA 2CF9H 1F0RA 3PTBA 1TMUH 4ISOA 3PO1B 1CGIE 3GY7A 1SFQB 1TNGA 4IW4E 1DVAH 1YGCH 5IK2D 3FP6E 4KKDA 2ZFSA 1QA0A 3NRLA 1ELBA 3ZVAA 4Q2KA 4F4OC 4B2BA 1NFXA 2A4RA 1EZQA 4D7FA 1GHAF 2WV5A 4KELA 5H4IB 2F43B 1QBVH 1RTLA 4P02A 1YCPK 2IOTA 5JB9S 4ESTE 1FY3A 2XRCA 2VJ1A 1OWHA 4YLQH 1C4U2 2A5AA 2CHAC 2AHME 1GDUA 1P9SA 2ZTYA 1P06A 3GY4A 3N7OA 3D23A 2OUAA 1GGDB 2ZHDA 2XC5A 3P8GA 1MKXH 1HIAA 1WSSH 3MH6A 2PKAA 1NBME 1SLUB 3BF6H 2C4FH 3FZZA 1KMHB 3PWCA 1AWFH 1O3CA 4RKOB 2GCTB 4Y10E 3ODFA 3RXKA 5JPMH 4U30A 4WXIA 5HM9A 2KCAA 5EJ1A 3RXOA 3VEQB 1TPAE 4GPGA 2WINI 2KM0A 1FPCH 1GHYH 3H7TA 4X1SU 2XWAA 1MUEB 4Z1MD 2FO9A 4YTAA 1EUFA 1FI8A 3OE7D 2QXIA 3S69A 4D9QA 2ZDNA 3HPTB 4RKJB 4AB8A 1FAXA 2FESH 3SJOA 1O2TA 3FKSD 3T28A 4CRGA 4R0IA 4FUCA 5C3NA 1GI3A 3TPIZ 1A3BH 1PPHE 2XBXA 4IMZA 1XKBC 2FOFA 4AGJA 1DWCH 1O2GH 1QJ6B 3LH3A 2ZGXH 3FANA 3KL6A 5FBEA 5EXLA 2ZA5A 3M61U 1LKAA 4SGBE 4Y6DA 3CNRA 1ABJH 4OS2A 3SU5A 1BA8B 3KYFA 1EAWA 3E16B 1F92A 2OK5A 1OX1A 3LGWA 3P17H 1E1RD 1UTNA 5C1YA 3ATWA 2BYAX 1O2XA 3BEUA 3MO3A 1MTWA 1E0FD 1J17T 2BVXH 1JIRA 2F9OA 5CMXH 1JOUB 4R8TB 1TPSA 2HLDD 3GY6A 3MH5A 4CR5A 2AYWA 3L6PA 1OWEA 3E3TA 1Y8TA 1P10A 3BTWE 1C1PA 1LQDB 1GMCG 2Y5GA 1QRWA 3S9BA 2HOBA 3SNDA 1O39A 2H5CA 3ZZBA 1YYY1 3GDUA 1MCVA 2FOCA 3UWIA 1J16A 2BY5X 2OQUA 2GGVB 4JK6A 5FXLA 1ESAA 3GDSA 1NFYA 4ABBA 1AZ8A 1SMFE 4O03A 3SNAA 4XRNA 1IHSH 2ZGHA 1MKWH 1TNIA 2VINA 1OP0A 1PQ5A 3WW7A 1A0LA 1VCPA 4DW2U 1Z8IB 5C94A 2A2XH 3DCLA 1O31A 1BB0B 1GMCF 1G2MA 2ODPA 2XTTB 4OS4A 4K3JA 1AB9B 2BDGA 2Z94A 1C4V2 1X7AC 2ZGCA 3N7DA 1O3MA 1EAIA 3MU8A 4CRBA 1EB1H 3A88A 5A09A 1VJAU 2J98A 3F6UH 2AGIX 4NWKA 5JBAS 1HAXB 1SQAA 1O2QA 1THPB 1E79D 1GI9B 2VWMA 1UCYE 3F2GA 1DOJA 4UEHH 2BY6X 5L2ZH 4Q63A 2BQ7B 1XXFA 1KIGH 3F2FA 4K1SA 3NUMA 3PV5A 1C1QA 1Z1JA 1HJ8A 3GCTF 1V2WT 2BXTH 4X6MA 3BG8A 3SU6A 5EIYA 1LQEA 2P8OC 2Q6GA 2GZ7A 1GJ7B 3TH2H 3TNSA 1A7SA 1QB1A 3U1IB 2GJGA 5LGOA 3PTNA 4FXGH 3RXBA 4D7GA 1ELDE 1O3HA 2XXLA 2UUJB 1PPBH 4DOQA 4I8LA 5E0HA 2ZCLP 1AUJA 1OHHD 3VXFH 3STJA 1P2OA 4DT4A 1V2VT 3SNCA 5C5NA 1GG6B 2Z9GA 4BAMB 4ZHMU 1FN6A 4BXSA 1FY5A 6LPRA 1RS0A 1SQRA 3G01A 1MKXK 1GVZA 2DUCA 2PSYA 3M5NA 2VIQA 3TK6A 1C2GA 1TBRH 3HK3B 1TX8A 3RXFA 2I6SA 5DK1A 1YPGH 1T8NA 1QGFA 4ZXXH 1GJ6A 4X8TH 4JZIA 5ETXA 5JYIA 1ZGIA 2BX3A 2C90B 1HLTH 2G52A 4BXWA 1SC8U 1TRMA 3VGCC 4ACBA 5A0AE 3GDVA 1S6HA 2TRMA 4XOJA 1O3KA 1KXCA 2TGAA 1SGYE 5C1UA 9ESTA 1GHBF 4X2XA 3OY6U 2C93B 2TGPZ 3ATLA 3B23B 3FZDA 2AS9A 3SUGA 1ESTA 3E6PH 1ZSKA 3MTYA 3NK8A 5JB8S 2PFEA 3RXVA 3KQEA 1C5UA 1O3GA 1CVWH 1UTOA 1GCTB 1Q3XA 1JRTA 3PV2A 5EGMA 5I46H 4FU7A 4A92A 3LGVA 3MNSA 3EYDA 4K8BA 4Y8ZA 1ELVA 1GVLA 2BY7X 4P00A 1B7XB 4X1QU 4YOJA 1S84A 1ARCA 2BY8X 4XFQA 2KAIA 1P03A 3QTOH 1HIAB 4Y7BA 2THFB 2F9VA 3FOAA 2VIWA 4ZXYH 8LPRA 4WJG2 4ZKOU 1YM0A 2ZFPH 2V3OH 1BMMH 2R9PA 4AGKA 1K1NA 1C5SA 1PFXC 1IQEA 5B6OA 3VFEA 4RT0A 1WUNH 1Y3UA 2BTCE 1NESE 1GHWH 2A4OA 5T3HA 1YC0A 2G81E 1W0YH 5GNDA 1DS2E 5KGOA 1XVMA 7LPRA 4X8UH 1MU8B 1O3OA 1SGFA 1OWIA 1ZOMA 1QBOA 3PO1C 5I25A 3RXCA 4ZCNA 1FUJA 4UFEH 1V2JT 1MD8A 8GCHF 4X6PA 2FOAA 1GI7B 4I8GA 4WWYA 2G8TA 5JBBS 2PW8H 2BLQA 1AMHA 2J95A 3MI4A 1A0HB 2KCYA 2FWWA 2HGTH 2VIDA 3UY9A 2FIRH 1DICA 2ZC9H 1AVGH 5KEDA 1YWUA 1BCUH 1MCTA 1NN6A 1VCQA 1EZSC 1GGDC 1IQGA 1GHVH 1GCDA 3LGIA 1WBGB 4K69A 2V6NA 3AVZA 2WSSD 3PWBA 1LHGH 1OYTH 2PKSB 3A7YA 1Y3VA 2JH0D 1JIMA 2BDIA 3N99A 1EAUA 2QF5A 3B8JA 1YPEH 2GCTC 2XBYA 4BAKB 4HZHA 4ZH8A 1LHEH 3MYWA 2QCYA 2GDDA 4AYYB 2FOMB 2PLXA 5FX5A 3BTQE 5LPEA 5DKMA 2O8MA 3FAOA 4RN6A 3SV9A 3S9CA 1UVUH 2PUXB 1FIZA 2TIOA 2ZHWH 1C2EA 1RD3B 1F5KU 1SGCA 5DO4H 1TNLA 2LNCA 1BOQA 4Z6AH 2Z9KA 2Y80A 2Z9LA 1P2JA 1SSXA 1Q31A 2Y7ZA 2ZGJA 4K2YA 1A5GH 4GVUA 2EEKA 1COWD 2J4IA 2GZ8A 4H4FA 5F8TA 1C2MA 5FHTA 4CRCA 1O32A 4Q7XA 3F9EA 4QT8C 3TGJE 2EC9H 4WH6A 1FV9A 1LHDH 3SZEA 1K22H 1TWXB 2WPLS 3GCOA 1RRKA 4MDSA 1YCPM 2SFAA 3RXQA 1YCPH 2QF0A 4CR9A 1C5TA 2GKVE 3F3BA 2NU0E 1ZPBA 2J98B 4IN1A 5C67A 1JBUH 2UUYA 2FS8A 4A7IB 2H5DA 4AG1A 2GCHF 1V2NT 3ESTA 4BNRA 2RFKC 1YPHC 4YOIA 1H8IH 2ZO3H 3F0OA 1AWHB 4ACAA 2F83A 3M36A 1TNKA 2UWLA 1O3BA 2Y7XA 3LONA 2A0QB 3VB7A 4OGXA 1G9IE 3MWIU 1A0JA 3UIRA 2VGCB 3MO6A 2Y82A 1O3EA 6GCHG 3U8OH 5JBTA 2EI6A 1LVMA 2GTBA 4RT1A 5HXFA 1QNJA 3ZZ4A 3PMHB 4K1EA 1BRAA 3GISB 3ITIA 5GCHF 3GCHB 3SZNA 4MNYA 1O2ZA 4MPUA 1C2JA 2CV3A 3PRDA 4FVBA 3KQCA 1HAGE 1V2OT 1VZQH 2EY4C 1JRSA 3OX7U 1O5BB 1P02A 4UE7H 3MU0A 2P93A 4INHA 1CE5A 4YESB 2ZCKP 3UNSA 4KTSA 2BD4A 2L6OA 3VB6A 1GI6A 1N6XA 2BDHA 5E8EH 1GPZA 3SQEE 1C1NA 1TGNA 2VNTA 1GI4A 4ISLA 4X1PU 2NU2E 3PMAB 1BMFD 1AB9C 2YNAA 5DP9A 3E91A 2P3FH 1RJXB 2HALA 1EX3A 1TA6A 2XBVA 1BHXB 2XNIA 4BTTB 4CH2B 5AF9H 2FZZA 1AD8H 3L33A 5J4QA 4YZUA 1YLNA 3HGPA 2H2ZA 5E2PA 1SOTA 5A8ZA 4AX9H 2BLWA 4ABIA 1JMOH 3RU4D 1Y5BT 4YO9A 5TCAA 2F9UA 2G00A 3FVFB 7GCHF 4AG2A 1Z8JB 2R3YA 4B6FA 1BRBE 1O2LA 3DSOA 2J34A 2ZU4A 4IN2A 3K9XB 1T7CA 1GWAA 4FUBA 1ID5H 5G4BA 5FCKA 1C5OH 4WVPE 3UFAA 1EAXA 3RC6A 4AORA 4F48B 1YF4A 1F0SA 5K7RA 1PPGE 4GUXA 3Q00A 4CBOA 4JYVH 3S0NA 2WZQA 1GBHA 5E2OA 2EA3A 3AASA 2EI7A 3BEFB 3V13A 4SGAE 3R0FA 4CHAB 1P09A 1GDQA 2F9PA 3LC3A 3SNBA 5AFYH 1GG6C 5EPNA 2HPPH 1PQAA 1W7GH 1ZRBA 1O5GH 2BB4A 2GZ9A 2B0FA 1MBMA 2KAIB 1Z71A 3TITA 4X2VA 1YY3A 1HAIH 1C1UH 1C5WB 2JH6D 2ANMH 2KFWA 1QY6A 4ZKRU 4XBDA 1BJVA 5L2YH 3GS9A 3S7HB 4UFGH 4O9VA 1WTGH 3PLKA 4ISNA 1ZTKA 3SUDA 1O5CB 1T8LA 4MNWA 3RXSA 3SNEA 2OXSA 1Z6EA 1E36B 2F4LA 3M7UA 4ABFA 1A5HA 4JYUH 3SW2B 2A4GA 3RU4E 2QYIA 1MTVA 1CBWB 1GMHG 1ELAA 3O8RA 1SLVB 1ZMJA 1F7ZA 2W5EA 4MTBA 3WY8A 2QXHA 3AAUA 1GMDG 1VCWA 4MQAA 4B6EA 1C1OA 3ZZAA 1PJPA 3DUXH 1TX7A 1SFIA 1W13U 4ABJA 2QAAA 1E37B 1K28D 4XBCA 2IPQX 3TIUA 3OU0A 1NM6A 5GPIB 3S9AA 1O0DH 2OC7A 3M3VA 1W0JD 1THSH 1UVOA 1GCTC 4MPXA 1VITF 1GBEA 1CT4E 5DG6A 3A82A 1ANBA 4PROA 5CHBA 5J4SA 2ZU5A 1TNHA 2BLOA 1RGQA 2ZTZA 1SHHB 3HKIB 3KF2A 1P04A 3GCNA 5HGGA 1DXWA 2ALVA 1HDTH 1UK3A 1KXAA 5DP5A 1OSSA 2JJ2D 1Y3WA 3C1KA 1H9IE 3UAIC 2V35A 2GD4B 5GJ4B 2VB0A 3PYHA 2SGQE 3RXEA 3ZZ5A 3UUZA 1MH0A 1SI5H 1SGQE 2QC2A 5F8ZA 1DLKB 3UPEA 2A4QA 2A1DB 5IDKA 1TOMH 3MNCA 1GJCB 1DFPA 3PLBA 3WWFA 3PMJA 2P3TB 1LO6A 1FJSA 1TYNA 4MLFB 1AU8A 4J1YA 1SGEE 1T32A 2CN0H 1V6DA 4GHQA 3VPKA 1GJ4H 4IBLH 2GMTB 1W0ZU 2HLCA 8KME2 3ODDA 1V2RT 2AEIH 1G3EA 1PPFE 3V12A 1DWBH 3RXUA 3K6ZA 2QIQA 1XUHA 2ZDVH 4A1XA 1BTUA 4HI3A 3BTEE 1C2LA 1ZSJA 1HFDA 2HVXA 1TLDA 2TGDA 2K0QA 5EU8A 1C9TA 1LMWB 5C5OA 2H6MA 1EKBB 1FNIA 2QN5T 4ABAA 1C5LH 4HG6A 1EQ9A 4Q7ZA 1TMTH 2BMGB 4FU9A 4FUFA 2PKSC 4JZEH 5ABWA 1MMJN 3DT0H 1QQ4A 4I32A 1DT2A 5C0UA 1F0UA 2ULLA 4U2WA 1NFWA 3MH4A 5F53A 1IQFA 2K8IA 1GI0A 1GBMA 4FUHA 1ZLRA 1XUIA 2G5VA 2V3HH 2ZCHP 5EW1H 2O8UA 1C5ZB 1RIWB 3A87A 4HTCH 1MZDA 2A5IA 1O2MA 3KQ5A 3SUFA 1BTYA 1TABE 1B0FA 3HATH 4I86A 1NRRH 1GJBB 3M35A 3TU7H 5HYOA 2Q6FA 1A5IA 2HNTE 3KNXA 3SJKA 3SO3A 3TGKE 3P6ZB 3S7KB 4ZMAH 3Q3YA 4FUIA 1P9UA 1CO7E 1NRPH 3QK1A 1NZQH 1W11U 3TJOA 1BMNH 3P92A 4B73A 2VVCA 4E06H 1HB0B 4RSPA 1QBNA 3SJ9A 4Y11E 3U8RH 1O2NA 1GBAA 2ILNA 5IYTA 2OBQA 1YBWA 1KXFA 2SNWA 5EXMA 2FYRA 2C8XB 1HAVA 1ZMLA 4WMEA 3TH3H 2B9LA 4B76A 3E8LA 1ZRKA 5T6GA 4Y0ZE 2WPIS 1W8BH 5DP4A 4Y8XA 3RXIA 1MBQA 1HXFH 1ZTLA 3T2NA 1K0HA 3SJ8A 4ABDA 2ZWLH 1F5LA 1C5QA 2RA0A 4INLA 4I8JA 1ELGA 1VITH 2J5UA 1GHXH 3ZZCA 2VGCC 3MO9A 4BANB 2FM2A 3ZYDA 1HAYB 1CGHA 5A8XA 2F91A 3UWJH 4UDWH 1KTTB 1O3PB 2WYGA 3GCHC 3RXMA 2J97A 3SI4H 3ZVDA 1D3TB 3V3MA 2HRVA 1SVPA 1TQ7B 2FOBA 5EW2H 2XCFA 5HM2A 2DE8A 3ZVCA 3NXPA 1DITH 3CS7A 4HGCA 5EG4A 2GDEH 1THRH 2Y5HA 5JDUB 3ZYEA 4K60A 1ORFA 2AMQA 5GWZA 1LKBA 5C2ZA 3GYMA 3OFND 1E38B 3F9HA 1HUTH 2VBCA 3FO8D 1C1VH 1C1SA 1UMAH 2XYAA 1EP5A 5LH8A 1D3QB 2TGTA 3KQDA 3STIA 1NROH 2ZU3A 2XCNA 2GVFA 2ZU1A 1AVXA 1FY1A 2J38A 1O2JA 3A83A 3Q77A 2Y81A 1YLCA 3A7XA 2NWNA 2ZECA 1L0ZA 1BUIA 4ISHH 3P8FA 4O97A 5EODA 4K5ZA 1BT7A 1P12E 1F0TA 1OWDA 2J94A 2BM2A 1O2SA 4Q4LA 1L2EA 3Q76A 2SGAA 2IJOB 1INCA 4NSVA 6ESTA 3LT3A 3T5FH 1FQ3A 4OM9A 3U1JB 1BTZA 5F6MA 1P57B 4YOGA 3V0XA 1YP9A 1NRQH 4KTUA 1KXBA 1S0QA 4CHAC 1FDPA 2P16A 1PQ8A 4OS7A 2FDAA 1GJ8B 1D9IA 3KQBA 3P70B 1SQTA 2W6ID 1A46H 1GL0E 1F5RA 3JZ1B 4X2WA 1A61H 3KYGA 3PRBA 3P8NA 2PGQB 1CGJE 1NO9H 3ZV9A 1HCGA 1P2QA 1TX6A 2ODYB 1NPMA 4I33A 3JZ2B 5A0CA 1O38A 1NC6A 2AERH 1GI1A 4I7YH 1D4PB 2ALPA 1ZJDA 2RCEA 3EAJA 5HIYA 3EA9A 1GBCA 2HVYB 4ZHAA 2C8ZB 4Q80A 3TLOA 1XUJA 1TRNA 1CQQA 1CBWC 1UTQA 2WPDD 1WU1A 1Z6JH 2V7QD 5C0TA 2XC4A 1S82A 2WYJA 1LHFH 2PV9B 1CU1A 1C2IA 3PLPA 2VIOA 2AH4X 1BRUP 1BBRH 3ATMA 2GV6A 3W1EA 2BD3A 2XNDD 3M37A 4U01A 2VWOA 2GX4A 3D49H 3TK9A 3Q3XA 3UNRA 1P2NA 1V2UT 3RXTA 1AIXH 2Y5FA 1C2DA 5B6LA 1CHGA 1BMAA 1O3DA 2OQ5A 3RLYH 2UUKB 3H7OA 3RMLH 1XUGA 1EFRD 4ZHLU 5BRRE 2K1QA 2R0KA 4JZFH 1ETTH 1E34B 1EJNA 3SGBE 2SGDE 2C8WB 1ZHRA 3QDZB 4NFFA 5ESBA 5AFZH 3VB3A 1BQYA 3IWMA 1J9CH 3RLWH 3RMNH 1HV7A 1KYNA 4HFPB 2A7CA 4TY6A 1JXPA 2A7HA 1EP6A 4XBBA 1MTNB 1QR3E 4ABGA 3A7ZA 2GT8A 1G2LA 1QL7A 1ZSLA 3GY3A 2JDID 4O3TA 1TONA 3C27B 2A45B 4ISIH 1H8DH 2BD5A 3A85A 1EOLA 1D6WA 3ZZ3A 4NA7A 1A2CH 4BOHA 1UK4A 1Y5AT 5AVDA 3EQ0H 3TK5A 1K1IA 3URDA 3ZVBA 3F2HA 2Z7FE 1BTWA 1QQUA 1WYKA 2GMTC 2VIVA 4GCHG 2DE9A 5LPFA 4TPYA 3MU1A 2F3CE 3SV6A 4A5TS 3TJUA 1KXEA 1O2YA 1ANEA 4GSOA 3RMOH 3T27A 1QB9A 1SGRE 2STAE 1IQLA 1S6LA 2AGEX 3LGYA 4X6OA 4BTIB 2QXJA 1BMLA 4WXVA 1K1MA 3RP2A 1KDQA 2G51A 2ZP0H 2AIPA 3ZZDA 1AE5A 5DSFA 1HAVB 3SV7A 1WCZA 2A2QH 4E7NA 5L6NH 3RXPA 2VH6A 3E0PB 1P05A 3F9FA 4NG9H 4GLYA 3PMBB 3FFGA 1GBFA 2H9HA 4X1RU 5JBCS 1P3EA 2ZDLA 3QZQA 1GDNA 4DIIH 2Z9IA 4JZ1A 4NZLA 2PUQH 1QRZA 2I6QA 1CSOE 1TALA 1GJ5H 1NU7B 1SOZA 2BXUH 3F9GA 1LVOA 3HK6B 1RIWC 3SORA 3LC5A 4Y76A 2CGAA 1EZUC 2M2AA 2W6JD 2ZF0H 2FLRH 2FPZA 4TWWA 1TGTA 3OTPA 2W7SA 3BIVH 1V2LT 1UVSH 1OWKA 1G37A 1QHRB 5FX6A 4F49A 1P2IA 3T26A 2FMJA 1GBBA 5EQSA 4KTCA 2C8YB 2PGBB 1BIOA 1QIXB 1UW7A 3K2UA 2OLGA 1QB6A 2VH0A 2BLVA 2FXRA 2BDBA 1SGPE 2ZKSA 1GJDB 4X2YA 5F03A 3RXDA 3TJVA 2CK3D 1H9LB 2ZTXA 1L4ZA 1MU6B 6GCHF 3R3GB 4KP0A 1GI2A 1W10U 1SPJA 4DCDA 3EE0B 3M7QA 3UOPA 4AZ2B 1MAXA 3MOCA 1CHOG 3GY2A 3MU5A 4X8VH 4WF8A 1SHYA 4MPWA 5DN6D 1O36A 1A4WH 2A31A 1BHXF 1DX5M 2AIQA 2XW9A 5EJZA 2CXVA 1IQIA 4WH8A 5T6FA 1GVKB 1S81A 4ASHA 2OINA 1GJAB 1ZPZA 1OWJA 3BEIB 2ZFFH 1BBRK 4LOYH 1SLWB 1MQ6A 1H4WA 4AN7A 4CBNA 4GAWA 1QL9A 1O3NA 2B5TB 1O2RA 3UTUH 3H09A 3DD2H 4ASUD 1DY9A 5F8XA 1KTSB 5DP6A 3AW0A 3DA9B 2ODQA 5DP7A 4XSKU 2FI3E 1C2KA 1O2HA 1RFNA 1PPZA 2JETB 2YMSD 3A7TA 3I77A 1C5MD 4FUDA 1QZ8A 1QJ1B 2ANWA 1ZYOA 3KIDU 1PQ7A 1GHZA 2J2UA 2QXGA 3QUMP 1H8ED 2W26A 3LOXA 4M9FA 2SGPE 1AN1E 2B7DH 1LTOA 1FX0B 1XKAC 5FL7D 1Z1IA 1U6QA 3CP7A 1ACBE 4LK4A 2ZI2H 1KLIH 2WUBA 1DANH 3OY5U 1LVYA 2FS9A 3FN8A 5BPEA 1TB6H 1Z8RA 1OS8A 2H9EH 1SGFG 3SI3H 3TNTA 3GICB 1HXEH 2WPMS 1L1NA 1UTJA 3VXEH 1TOCB 4MNVA 2FX4A 1YPMH 2B8OH 3SYJA 1VJ9U 3L3TA 4OGYA 4NIYA 1C2FA 1EZXC 1VGCB 2KZ4A 3QTVH 2ZPQA 4MVNA 5C17A 4AB9A 1AY6H 1LCYA 3F0PA 4YT6H 6CHAB 5CE1A 4JZDH 1EOJA 1NS3A 2CMYA 2OC8A 5EXNA 1P01A 3MHWU 3U8TH 3NCLA 1TBQH 3W95A 3ZZ7A 2ANKH 4DURA 3MQKC 4UFFH 2EQNA 5EQQA 3OEED 2R3UA 1V2PT 4NCYA 1E35B 3K6YA 2BOHB 1XUFA 4JYTA 1GMHF 5FPYA 4OS6A 1GHAG 3UQVA 3BG4B 1QA7A 2ZGBH 1O5AB 1C1WH 1GMDF 5EQRA 3BTDE 3A8BA 3ATIA 1O2KA 1ELTA 2BD9A 1SGDE 1AI8H 3OSYA 3TJNA 4UONA 1K1OA 2ZNKH 2HWLB 2ZDAH 2LPRA 2OP9A 5L30H 2A5KA 3RUOA 3RXJA 1W12U 2FTLE 1AZZA 3FP7E 2W7UA 4BAQB 4CRDA 1HAPH 1TPOA 2RDEA 2QF4A 4INKA 1AQ7A 1SKYE 2BHGA 3M3SA 5DP8A 1C5XB 2J92A 2AFQB 1P11E 4VGCB 1G3BA 5EOKA 4IGDA 3UR6A 3A84A 3SJIA 1G30B 3MFJA 5DGJA 3URCA 3UR9A 1QFKH 1HRTH 3EDXB 2HNTC 1FMGA 1O3LA 4XE4A 4A1TA 3DFLA 3M5LA 1ELCA 1ZTJA 2ZZUH 1FPHH 2BQWB 8ESTE 3AK5A 1VR1H 2FOHA 3RXHA 1GBTA 4U32A 3MNBA 2LELA 1ZPCA 5DP3A 3DHKH 1NTPA 2JIZD 3PROA 2ESTE 1XXDA 3GY8A 1OPHB 4ZAEA 1DUAA 1DPOA 2ZEBA 1UK2A 2KCOA 4LZ1H 1KDQB 3U9AH 4FUJA 2ZQ1A 1SB1H 2JKHA 1L1GA 1TGBA 4XD7D 3NPSA 1MQ5A 1OYQA 4NIWA 3DSPA 1NY22 3EA7A 1MTNC 4ABEA 3BV9B 1GI5A 1O33A 1O3JA 1WQSA 1YLDA 2D26C 4BAHB 1NRSH 1HJAB 1V2MT 1ABIH 1RTFB 2ZPSA 4YXWD 1YKTA 4A1VA 1G3DA 3OYPA 2P59A 4DJZB 2H1UA 1RTKA 1LPKB 3P8OA 1FAKH 1PYTC 3I29A 1O2VA 1HYLA 1O2PA 2R0LA 2G4TA 1MZAA 1PYTD 3T29A 5DJ7A 1W3CA 3OAAD 1C1RA 2XOKD 4D76A 5E0GA 1WOFA 2BVSH 4IS5A 1ETSH 2GT7A 1BJUA 4TYDA 1SGTA 1C5PA 1TFXA 3LGTA 2NU3E 3BIUH 4X0WU 1DM4B 4IMQA 2GV7A 1BTXA 1IOEA 1KSNA 3ZIAD 2L74A 1YPJH 2M5TA 1UCYK 1FY4A 1TBZH 2TBSA 1BTPA 1C4Y2 3OTJE 4BTUB 3RDZA 3AW1A 5HMAA 1G32B 1S0RA 1E1QD 1AE8H 2FTMA 5TCCA 3SU1A 1CA8B 1N8OB 4TWYA 3SU0A 1DE7H 4THNH 2A32A 4H6TA 4AFSA 1O2WA 2G4UA 1SGIB 1TGSZ 1UHBB 2V3MA 4DVAU 2P95A 4MNXA 3EA8A 4M7GA 1KY9A 1TA2A 4LZ4B 3TH4H 3M3TA 2W3KA 1T4VH 3CS0A 1C2HA 1QCPA 2Z3DA 1L1JA 1XM1A 1GL1A 1BTHH 1Z8GA 1P2MA 4NGAH 1LDTT 2NU4E 1C5NH 2Q1JA 1EJAA 1T8OA 4XDEA 1H9HE 4B74A 1FXYA 1K2I1 3O8DA 1XMNB 3BTME 3GCTG 2AGGX 1CA0B 5GXPA 2ZDMA 1BRCE 1IAUA 1QRXA 2F9BH 5CHAB 2ZHQH 4FOUC 1DDJA 5T6DA 4CRFA 4TY7A 2ANYA 3SV8A 1HAZB 2YMSB 4TPIZ 1QTFA 3LGUA 1Y59T 3RXGA 1UO6A 3ZVFA 3SU4A 4FU8A 3CENA 4Y8YA 1OP8A 1IQMA 1C9PA 1C5YB 1AFQB 1MTSA 3LJJA 3SBKA 3QGJA 1G36A 1IQNA 3SV2H 2PP6A 1O2UA 2BY9X 4IC5A 3GYLB 1WXRA 9LPRA 1FN8A 4WY3A 1O37A 5C20A 1MAYA 3ZV8A 4JCNA 2O8WA 1LVBA 1XUKA 3QLPH 1O5FH 3E1XB 1WV7H 3DSGA 3MNXA 3UB0A 2WPKS 1TMBH 5C1XA 3UNQA 3SOSA 4H6SB 3A81A 2YOLA 1JWTA 3BSQA 3LU9B 2OTVA 2FOGA 2BX4A 1S5SA 1D3DB 4JK5A 1O5EH 2FYQA 3ENSB 1EPTB 2C3SA 2IPHA 1B0EA 2Z3EA 3IITA 1O3IA 4NA9H 1GHBG 2JETC 2WV4A 1FY8E 1Z7KA 3E90B 1MTUA 4GHTA 5AHGH 3O8CA 2BDAA 3NZIA 2XC0A 3MMGA 1HPGA 2OC0A 1ZHMA 2KR7A 2ZU2A 1PPEE 3HKJB 1IHTH 1UJ1A 1SLXB 3QO6A 4FETA 4X6NA 3B9FH 1K9OE 1K1LA 2HPQH 3GY5A 2BQ6B 3WWBA 4D9RA 3K65B 4I31A 2D1JA 3W94A 1HNEE 2BDYA 2V0BA 2VWNA 2PWXA 1UVPA 4YT7H 3U69H 2ZFQH 2F9NA 4WMFA 2AMDA 3LIWA
chains in the Genus database with same CATH topology
3A8DA 1V3XA 7ESTE 1AGJA 2PTCE 2O9QA 2UWPA 1HGTH 2FODA 1Y3XA 3ZVEA 1D3PB 2WPJS 3ZZ8A 1VGCC 2WPHS 3H5CB 3VB4A 1AKSA 2OBOA 3E0NB 1EB2A 2FX6A 3M7TA 4DG4A 6CHAC 1AVWA 1P8VC 1OKXA 1FIWA 2D2DA 3SU2A 1GJ9B 3A80A 1DWEH 3BTGE 2CHAB 2P94A 4K8YA 2QF3A 2PKAB 2HNTF 7KMEH 1TPPA 3ZZ6A 1GBDA 1ZMNA 4K1TA 4B1TA 1G3CA 4ABHA 1J14A 4B75A 1AUTC 1IQKA 1ETRH 2PHBA 4NA8A 4AFZA 8GCHG 2FOEA 5K0HA 3SUEA 3A7WA 3LPRA 3BG4C 1SG8B 4OS5A 2H9TH 1KXDA 4B71A 1V2ST 1Q2WA 3ZVGA 1AFEH 1O2OA 2QY0B 2RA3A 3RM0H 2CJIA 2RG3A 2FI5E 1WQVH 1TAWA 3KHVA 1C5VA 5SGAE 1S6FA 2BVRH 1DWDH 4WMDA 2QA9E 4NIVA 2D8WA 3A8CA 3FP8E 4Q7YA 3F68H 5GIBA 2Y6TA 1MKWK 1NFUA 4VGCC 1TE0A 2XWBI 1HBTH 1V2KT 3QGNB 2BZ6H 1EJMA 2YNBA 4NSYA 1K1JA 1GBJA 2VVUA 1ZR0A 3D62A 4KGAA 1GI8B 5FPSA 3RXLA 1NU9A 1SBWA 2FEQH 4AFQA 4FUGA 1SR5C 1QJ7B 1K1PA 1SGNE 1WAYB 3PM3A 2Z9JA 1PPCE 4I8KA 2ZFTA 3DFJA 2ZQ2A 2RDLA 1O5DH 4NIXA 2AMPA 2ZHFH 1EASA 2BD2A 1S83A 4FUEA 1C1TA 1HAOH 3BN9A 3AAVA 3ZZ9A 1O3AA 4LXBH 3LKWA 5PTPA 2Z6BD 4FVDA 1TRYA 1L4DA 4J2YB 3SHAH 5A2MH 2ZPRA 3NWUA 3UQOA 4GCHF 1XVOA 3QZRA 3T25A 1V2TT 2GP9B 1OXGA 3RC4A 4DGJA 5LPRA 1HJAC 2STBE 5DPAA 4CRAA 1A1RA 1UTPA 1T31A 3F1SB 1B5GH 4OS1A 2ZFRH 2QV1A 3QWCH 2ASUB 1W2KH 2GCHG 2R2WU 2IN2A 1QL8A 2ZG0H 1IQHA 3SQHE 4DT7B 1LPGB 4A6LA 5GDSH 2QGRA 2OC1A 1KLJH 1T4UH 1DY8A 3SU3A 2UUFB 3A86A 3VB5A 2BDCA 3MH7A 1WTHD 4ZROA 2Q6DA 1NT1A 2SGFE 2VWLA 1AO5A 2VIPA 4UD9H 1J15A 2SNVA 5A8YA 1RXPA 1M9UA 3A8AA 2PTNA 4B2CA 3ELAH 5GCHG 2R2MB 1DUEA 3UREA 1EATA 4X1NU 1HAHH 1TGCA 4CH8B 4YLUA 2NU1E 2WUCA 1KLTA 4D8NA 1C5RA 4Y7AA 4Y0YE 3KEEA 4E7RG 2TPIZ 1FLEE 4B2AA 2OCVB 2FP7B 2EI8A 2ZIQH 1W14U 2OD3B 1N8OC 4Y71A 2BOKA 1ELFA 2XBWA 3Q3KA 1ZGVA 3O8BA 3T62A 1LPZB 1NRNH 1FONA 3I78A 1TQ0B 3M5OA 3LH1A 1P0SH 2ZHEH 2P8OB 1ANCA 3BTFE 1LHCH 4AYVB 1ELEE 1O2IA 1UHBA 2J9NA 3A7VA 4MG3A 2P3UB 2PSXA 1GBLA 1Y5UT 3HGNA 2VU8E 1A3EH 3SGAE 3BTHE 3ATKA 3V7TA 1UTLM 3RXRA 4E05H 1TIOA 3LJOA 7GCHG 1DSTA 1P3CA 2W3IA 1CA0C 3UOUA 3RC5A 3BTKE 1ZHPA 1T8MA 5FCRA 3KN2A 1BZXE 5CHAC 1DXPA 1CHOF 3BTTE 1J8AA 4Y79A 1D6RA 1MD7A 2G55A 5ESTE 2VVVA 1CT2E 3RM2H 4I8HA 2FI4E 3NKKA 1IQJA 3M5MA 1YPKH 3KCGH 4O3UA 1ANDA 1XX9A 2PR3A 3GOVB 3RXAA 1AHTH 1YPHE 4DY7B 3QX5H 3A89A 1Y3YA 4NFEA 1ZJKA 1UCYH 1AFQC 5EPYA 4ZKNU 2SGEE 3D65E 1QURH 4H42U 4IC6A 2G5NA 3VGCB 1S85A 1F2SE 1DSUA 1FZZA 3MU4A 5FBIA 3TGIE 3U98H 2Z3CA 2CF8H 1C1MA 1O30A 2BZAA 2ZDKA 4CREA 3P95A 1ZZZA 1TNJA 3PB1E 1P2KA 2UWOA 1H1BA 3RU4T 1SL3A 3LDXH 1AKSB 1BBRE 4DIHH 4AOQA 1UTMA 4ZKSU 4AFUA 3RMMH 4X8SH 2A7JA 1BDAA 1EPTC 1W7XH 3KGPA 4BAOB 3IG6B 3SN8A 1N6YA 3SGQE 3EGKH 4JMYA 1CT0E 1UTKA 2JH5D 2BD7A 1N1LA 1ESBA 1O35A 1V2QT 1GBKA 1OOKB 1EPTA 3TVJB 4ZUHA 1HJ9A 4MPVA 1ARBA 1OP2A 1BITA 5FPTA 1UVTH 1VITG 5TJXA 5A0BA 1SQOA 3QN7A 1K21H 2FLBH 1EXFA 4YM9A 2O8TA 1YPLH 1GBIA 4NWLA 2O8LA 5E0JA 4Z0KA 3PV4A 5FAHA 1O3FA 4NZQA 4UFDH 2BD8A 3SHCH 1O34A 1DLEA 2CF9H 1F0RA 3PTBA 1TMUH 4ISOA 3PO1B 1CGIE 3GY7A 1SFQB 1TNGA 4IW4E 1DVAH 1YGCH 3FP6E 4KKDA 2ZFSA 1QA0A 1ELBA 3ZVAA 4Q2KA 4F4OC 4B2BA 1NFXA 2A4RA 1EZQA 4D7FA 1GHAF 2WV5A 4KELA 5H4IB 1QBVH 1RTLA 1YCPK 2IOTA 5JB9S 4ESTE 1FY3A 2XRCA 2VJ1A 1OWHA 4YLQH 1C4U2 2A5AA 2CHAC 1GDUA 1P9SA 2ZTYA 1P06A 3GY4A 3N7OA 3D23A 2OUAA 1GGDB 2ZHDA 2XC5A 3P8GA 1MKXH 1HIAA 1WSSH 3MH6A 2PKAA 1SLUB 3BF6H 2C4FH 3FZZA 3PWCA 1AWFH 1O3CA 4RKOB 2GCTB 4Y10E 3ODFA 3RXKA 5JPMH 4U30A 4WXIA 5HM9A 3RXOA 3VEQB 1TPAE 4GPGA 2WINI 1FPCH 1GHYH 3H7TA 4X1SU 2XWAA 1MUEB 2FO9A 4YTAA 1EUFA 1FI8A 2QXIA 3S69A 4D9QA 2ZDNA 3HPTB 4RKJB 4AB8A 1FAXA 2FESH 3SJOA 1O2TA 3T28A 4CRGA 4R0IA 4FUCA 5C3NA 1GI3A 3TPIZ 1A3BH 1PPHE 2XBXA 4IMZA 1XKBC 2FOFA 4AGJA 1DWCH 1O2GH 1QJ6B 3LH3A 2ZGXH 3FANA 3KL6A 5FBEA 5EXLA 2ZA5A 3M61U 1LKAA 4SGBE 4Y6DA 1ABJH 4OS2A 3SU5A 1BA8B 1EAWA 3E16B 1F92A 1OX1A 3LGWA 3P17H 1UTNA 5C1YA 3ATWA 2BYAX 1O2XA 3BEUA 3MO3A 1MTWA 1E0FD 1J17T 2BVXH 1JIRA 2F9OA 5CMXH 1JOUB 4R8TB 1TPSA 3GY6A 3MH5A 4CR5A 2AYWA 3L6PA 1OWEA 3E3TA 1Y8TA 1P10A 3BTWE 1C1PA 1LQDB 1GMCG 2Y5GA 1QRWA 3S9BA 2HOBA 3SNDA 1O39A 2H5CA 3ZZBA 1YYY1 3GDUA 1MCVA 2FOCA 3UWIA 1J16A 2BY5X 2OQUA 2GGVB 4JK6A 5FXLA 1ESAA 3GDSA 1NFYA 4ABBA 1AZ8A 1SMFE 4O03A 3SNAA 1IHSH 2ZGHA 1MKWH 1TNIA 2VINA 1OP0A 1PQ5A 1A0LA 1VCPA 4DW2U 1Z8IB 2A2XH 1O31A 1BB0B 1GMCF 1G2MA 2ODPA 2XTTB 4OS4A 4K3JA 1AB9B 2BDGA 2Z94A 1C4V2 1X7AC 2ZGCA 1O3MA 1EAIA 3MU8A 4CRBA 1EB1H 3A88A 5A09A 1VJAU 3F6UH 2AGIX 4NWKA 5JBAS 1HAXB 1SQAA 1O2QA 1THPB 2VWMA 1GI9B 1UCYE 1DOJA 4UEHH 2BY6X 5L2ZH 2BQ7B 1XXFA 1KIGH 4K1SA 3NUMA 1C1QA 1Z1JA 1HJ8A 3GCTF 1V2WT 2BXTH 4X6MA 3BG8A 3SU6A 1LQEA 2P8OC 2Q6GA 2GZ7A 1GJ7B 3TH2H 3TNSA 1A7SA 1QB1A 3U1IB 5LGOA 3PTNA 4FXGH 3RXBA 4D7GA 1ELDE 1O3HA 2XXLA 2UUJB 1PPBH 4DOQA 4I8LA 5E0HA 2ZCLP 1AUJA 3VXFH 3STJA 1P2OA 1V2VT 3SNCA 5C5NA 1GG6B 2Z9GA 4BAMB 4ZHMU 1FN6A 4BXSA 1FY5A 6LPRA 1RS0A 3G01A 1MKXK 1GVZA 2DUCA 2PSYA 3M5NA 2VIQA 3TK6A 1C2GA 1TBRH 3HK3B 1TX8A 3RXFA 2I6SA 5DK1A 1YPGH 1T8NA 1QGFA 4ZXXH 1GJ6A 4X8TH 4JZIA 5ETXA 5JYIA 1ZGIA 2BX3A 2C90B 1HLTH 2G52A 4BXWA 1SC8U 1TRMA 3VGCC 5A0AE 3GDVA 1S6HA 2TRMA 4XOJA 1O3KA 1KXCA 2TGAA 1SGYE 5C1UA 9ESTA 1GHBF 4X2XA 3OY6U 2C93B 2TGPZ 3ATLA 3B23B 3FZDA 2AS9A 3SUGA 1ESTA 3E6PH 1ZSKA 3MTYA 3NK8A 5JB8S 2PFEA 3RXVA 3KQEA 1C5UA 1O3GA 1CVWH 1UTOA 1GCTB 1Q3XA 1JRTA 5EGMA 5I46H 4FU7A 4A92A 3LGVA 3MNSA 3EYDA 4K8BA 4Y8ZA 1ELVA 1GVLA 2BY7X 1B7XB 4X1QU 4YOJA 1S84A 1ARCA 2BY8X 4XFQA 2KAIA 1P03A 3QTOH 1HIAB 4Y7BA 2THFB 2F9VA 2VIWA 4ZXYH 8LPRA 4WJG2 4ZKOU 1YM0A 2ZFPH 2V3OH 1BMMH 2R9PA 4AGKA 1K1NA 1C5SA 1PFXC 1IQEA 5B6OA 3VFEA 1WUNH 1Y3UA 2BTCE 1NESE 1GHWH 2A4OA 5T3HA 1YC0A 2G81E 1W0YH 1DS2E 1XVMA 7LPRA 4X8UH 1MU8B 1O3OA 1SGFA 1OWIA 1ZOMA 1QBOA 3PO1C 5I25A 3RXCA 1FUJA 4UFEH 1V2JT 1MD8A 8GCHF 4X6PA 2FOAA 1GI7B 4I8GA 4WWYA 2G8TA 5JBBS 2PW8H 2BLQA 1AMHA 2J95A 3MI4A 1A0HB 3UY9A 2FWWA 2HGTH 2VIDA 2FIRH 1DICA 2ZC9H 1AVGH 1BCUH 1MCTA 1NN6A 1VCQA 1EZSC 1GGDC 1IQGA 1GHVH 1GCDA 3LGIA 1WBGB 4K69A 2V6NA 3AVZA 3PWBA 1LHGH 1OYTH 2PKSB 3A7YA 1Y3VA 2JH0D 1JIMA 2BDIA 1EAUA 3B8JA 1YPEH 2GCTC 2XBYA 4BAKB 4HZHA 4ZH8A 1LHEH 3MYWA 2QCYA 2GDDA 4AYYB 2FOMB 2PLXA 5FX5A 3BTQE 5LPEA 5DKMA 2O8MA 3FAOA 4RN6A 3SV9A 3S9CA 1UVUH 2PUXB 1FIZA 2TIOA 2ZHWH 1C2EA 1RD3B 1F5KU 1SGCA 5DO4H 1TNLA 2LNCA 1BOQA 4Z6AH 2Z9KA 2Y80A 2Z9LA 1P2JA 1SSXA 1Q31A 2Y7ZA 2ZGJA 4K2YA 1A5GH 4GVUA 2EEKA 2J4IA 2GZ8A 4H4FA 5F8TA 1C2MA 5FHTA 4CRCA 1O32A 4Q7XA 3F9EA 4QT8C 3TGJE 2EC9H 4WH6A 1FV9A 1LHDH 1K22H 1TWXB 2WPLS 3GCOA 1RRKA 4MDSA 1YCPM 2SFAA 3RXQA 1YCPH 2QF0A 4CR9A 1C5TA 2GKVE 2NU0E 1ZPBA 4IN1A 5C67A 1JBUH 2UUYA 2FS8A 4A7IB 2H5DA 4AG1A 2GCHF 1V2NT 3ESTA 4BNRA 1YPHC 4YOIA 1H8IH 2ZO3H 1AWHB 2F83A 3M36A 1TNKA 2UWLA 1O3BA 2Y7XA 3LONA 2A0QB 3VB7A 4OGXA 1G9IE 3MWIU 1A0JA 3UIRA 2VGCB 3MO6A 2Y82A 1O3EA 6GCHG 3U8OH 5JBTA 2EI6A 1LVMA 2GTBA 5HXFA 1QNJA 3ZZ4A 3PMHB 4K1EA 1BRAA 3GISB 3ITIA 5GCHF 3GCHB 3SZNA 4MNYA 1O2ZA 4MPUA 1C2JA 2CV3A 4FVBA 3KQCA 1HAGE 1V2OT 1VZQH 1JRSA 3OX7U 1O5BB 1P02A 4UE7H 3MU0A 2P93A 4INHA 1CE5A 4YESB 2ZCKP 3UNSA 4KTSA 2BD4A 3VB6A 1GI6A 1N6XA 2BDHA 5E8EH 1GPZA 3SQEE 1C1NA 1TGNA 2VNTA 1GI4A 4ISLA 4X1PU 2NU2E 3PMAB 1AB9C 2YNAA 5DP9A 3E91A 2P3FH 1RJXB 2HALA 1EX3A 1TA6A 2XBVA 1BHXB 2XNIA 4BTTB 4CH2B 5AF9H 2FZZA 1AD8H 3L33A 5J4QA 4YZUA 3HGPA 2H2ZA 5E2PA 1SOTA 5A8ZA 4AX9H 2BLWA 4ABIA 1JMOH 3RU4D 1Y5BT 4YO9A 5TCAA 2F9UA 2G00A 3FVFB 7GCHF 4AG2A 1Z8JB 2R3YA 1BRBE 1O2LA 2J34A 2ZU4A 4IN2A 3K9XB 1T7CA 1GWAA 4FUBA 1ID5H 5G4BA 5FCKA 1C5OH 4WVPE 3UFAA 1EAXA 3RC6A 4AORA 1YF4A 1F0SA 5K7RA 1PPGE 4GUXA 3Q00A 4CBOA 4JYVH 3S0NA 1GBHA 5E2OA 2EA3A 3AASA 2EI7A 3BEFB 3V13A 4SGAE 3R0FA 4CHAB 1P09A 1GDQA 2F9PA 3LC3A 3SNBA 5AFYH 1GG6C 5EPNA 2HPPH 1PQAA 1W7GH 1ZRBA 1O5GH 2BB4A 2GZ9A 2B0FA 1MBMA 2KAIB 1Z71A 3TITA 4X2VA 1HAIH 1C1UH 1C5WB 2JH6D 2ANMH 1QY6A 4ZKRU 4XBDA 1BJVA 5L2YH 3S7HB 4UFGH 4O9VA 1WTGH 3PLKA 4ISNA 1ZTKA 3SUDA 1O5CB 1T8LA 4MNWA 3RXSA 3SNEA 2OXSA 1Z6EA 1E36B 4ABFA 3M7UA 1A5HA 4JYUH 3SW2B 2A4GA 3RU4E 2QYIA 1MTVA 1CBWB 1GMHG 1ELAA