1NC6A

Potent, small molecule inhibitors of human mast cell tryptase. anti-asthmatic action of a dipeptide-based transition state analogue containing benzothiazole ketone
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen
publication title Potent, Small-Molecule Inhibitors of Human Mast Cell Tryptase. Antiasthmatic Action of a Dipeptide-Based Transition-State Analogue Containing a Benzothiazole Ketone.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nc6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nc6A02
1YCPM 1P2NA 1XVMA 1SGYE 4UD9H 3RXJA 1K1OA 1HAYB 2NU4E 3GY3A 1W7GH 3V3MA 1SGIB 1MTUA 2C8YB 3T2NA 1YPJH 2Z7FE 4OS7A 4CRFA 1TGBA 2P8OB 1QCPA 2IOTA 3MH6A 4CRCA 8LPRA 1BRUP 1XUJA 1C2KA 1GHAF 2F83A 1AKSB 4VGCC 1SHHB 1RXPA 4I8JA 2TGTA 4WH8A 2GDDA 1QB6A 3HGNA 2BD2A 2FOFA 2ZHFH 1SGFA 3ZVBA 4FXGH 5FAHA 1TRMA 2VWLA 3A82A 3HKIB 3TNSA 2OP9A 1C1NA 5G4BA 1SBWA 2OLGA 3D62A 3URDA 1UHBB 2QF3A 3C27B 3ENSB 5DG6A 1P2OA 1O5CB 2HNTE 1S82A 3WY8A 1QBNA 2WPHS 3S0NA 4I31A 5EXNA 2FYRA 1GBIA 4O9VA 1F5RA 4X1PU 2VIQA 1GJ6A 1NC6A 1O2LA 4FUHA 2OINA 1KIGH 1O2OA 1HAGE 1O2GH 2BQ6B 4Z0KA 4OGXA 1QQ4A 1DY8A 2BY8X 1C1MA 1FI8A 6CHAB 1O3OA 3BG4B 1FONA 1A5GH 4KP0A 2W7SA 3U98H 1AO5A 4JK5A 3SJKA 4NA8A 2H5DA 3SV9A 3STIA 3VGCB 4ZHLU 1RFNA 1CT2E 4Y7BA 1ANDA 1S85A 3GCTG 3NWUA 1FDPA 1G9IE 4HI3A 3ZV8A 3H5CB 2ZDKA 3BEFB 1ZTLA 1ZJDA 1D3DB 4WXIA 1RIWC 1F5KU 1ZPZA 1ZPBA 1TA6A 1FPHH 1EAXA 1WCZA 2GCHG 1UVTH 1JRSA 2V3HH 1E36B 4ISLA 3LGYA 3SJ8A 2WPLS 5ABWA 5A2MH 1D3TB 5DP7A 1AUJA 1EQ9A 1HAZB 1V2JT 2DE9A 5B6OA 3FZZA 1OP8A 1QY6A 2Y5GA 3LIWA 3IG6B 1HJAC 1GG6C 1ZHPA 2ZI2H 2AEIH 1D4PB 2P94A 1EZUC 1NFXA 2HVXA 1Y5BT 3P17H 3GICB 3HATH 3MNXA 3M7UA 2A2XH 3ZVDA 1LHDH 2XBVA 2BLWA 1C1WH 3GYMA 4YOIA 1AQ7A 4LXBH 1DSTA 1C2HA 1HCGA 1VGCB 1P3EA 2RDLA 1O32A 2O9QA 4H6SB 4ZHMU 3A7YA 3UNQA 1J17T 1PPHE 1YPKH 3KL6A 1EAWA 3QZRA 1OX1A 2ZDNA 3SV2H 5LH8A 2A7HA 3LONA 3GYLB 4BOHA 1GGDC 3V0XA 1BHXB 2ZHEH 1VCQA 2BB4A 1T32A 1XVOA 1YYY1 1EJNA 4DIHH 3RMOH 4CR5A 1JWTA 1GVKB 4B73A 1HRTH 2XWAA 3A80A 1C2JA 1PYTD 2ASUB 1QJ1B 4NA7A 1FAKH 5EOKA 1A2CH 3SU5A 1GHAG 4U01A 1EX3A 4AGKA 1ETRH 5SGAE 2IJOB 3RXOA 1F5LA 1VCWA 4HTCH 2DUCA 1O2MA 3LGTA 3A7WA 8ESTE 4ZKNU 4ABBA 3Q76A 3ATIA 4ISOA 3TVJB 1KDQB 1CE5A 4ABIA 2NU3E 1BUIA 2TGPZ 5GIBA 3FVFB 2Y7ZA 2D26C 4FUCA 4BAHB 3P92A 4X8UH 3M5NA 1V2RT 3BF6H 5DJ7A 1A5IA 7ESTE 1C5YB 1W10U 3IWMA 3KF2A 3P6ZB 4MNVA 4RSPA 1FIZA 2OBOA 3NXPA 1E35B 1BDAA 4D7GA 2VH0A 3E1XB 6CHAC 3BG4C 3F6UH 1RRKA 1UVUH 2BD7A 1MQ6A 1O3HA 1A1RA 2ZIQH 3MO3A 4K2YA 1EASA 1MKXK 4YLQH 2H9EH 3OTJE 1NPMA 1YPEH 1O36A 5J4SA 1HUTH 2PKAA 4A5TS 2ZFSA 3DA9B 2OXSA 4BTUB 5L30H 2ZHWH 1GDQA 3Q77A 4E7NA 1W13U 1AY6H 3MYWA 2R0KA 2RCEA 1NT1A 1HB0B 1AN1E 1K1MA 2ZPSA 1GWAA 3ZZ4A 3R0FA 3ZZDA 2G4UA 2G4TA 4MTBA 2IN2A 4B2CA 1BBRH 1TPOA 4MG3A 5E0JA 4TPYA 1XUHA 5DP5A 1E38B 5JYIA 1TPPA 2FIRH 5DGJA 5GDSH 5IYTA 1GBTA 1P2KA 2PSYA 3OX7U 4ABHA 4ZHAA 5EPYA 3E8LA 1TMBH 2P3UB 1Z6EA 1F0TA 1TNJA 2CN0H 1O5BB 4X1SU 1EUFA 4CREA 4FUJA 2BDCA 1MH0A 1VITF 3P8NA 4DG4A 3HKJB 1TALA 1UTPA 1D3PB 3HPTB 2F91A 1GDNA 2Y6TA 1BOQA 3RUOA 3RXIA 1BITA 1OWJA 1IQMA 1RTFB 4AZ2B 2C8WB 1GBCA 1VGCC 3M36A 2ZU5A 5H4IB 3AAVA 3GDVA 2PKSB 1GJDB 5C3NA 1A5HA 4E06H 1C4Y2 2BVXH 4IMZA 3VEQB 4IN1A 3RXVA 2PKAB 1AHTH 4FUDA 1PPCE 2B0FA 1EOLA 4HFPB 2QCYA 2LPRA 1L1GA 2Y80A 3GY6A 3LH3A 2BY6X 1DICA 2RA0A 2PWXA 1Q2WA 2OC1A 3BIUH 1MKWH 5BRRE 1S5SA 1V2TT 5TCAA 1E34B 1C5NH 4KELA 4ABDA 1MBQA 2BDAA 2AFQB 1HJ9A 4NG9H 1GJ5H 4WMFA 3GDSA 4Q80A 1ARCA 4BAKB 2J94A 7GCHG 1YCPH 2J4IA 3VFEA 3URCA 3U69H 4MNXA 2GVFA 4HZHA 3R3GB 1THSH 4B74A 2H9TH 2A4GA 2CHAB 4WF8A 3BG8A 5ESTE 3PTNA 1YPHC 1TA2A 3PO1B 1O2YA 1LPKB 4IMQA 4JZEH 1BQYA 3RMMH 2BDYA 3S69A 1K22H 3EDXB 1Y3UA 1GJ8B 3QUMP 4AG2A 4O97A 1GBEA 1VJAU 4X8VH 2BD4A 1AFQB 1O3LA 3F9HA 4B75A 1DE7H 3SJOA 1AZZA 5C5NA 1T31A 1PPGE 1XKAC 1V3XA 2P3TB 4MNWA 2UUJB 5K0HA 3SUGA 4Y10E 5T6GA 1FN8A 5IDKA 3FP6E 4XBCA 4AFZA 2ALVA 4WH6A 3QZQA 1VJ9U 3MU4A 3UQVA 2Q6DA 1ZRKA 3SZNA 3VB3A 1E37B 1C1OA 1EJMA 5GPIB 3BTFE 2BDHA 3M3VA 1V2VT 4ZKOU 4CRDA 1BTUA 1W14U 5EODA 1D9IA 1OOKB 1UK2A 5C2ZA 4GUXA 1UK3A 5AVDA 4ZXXH 3F68H 3VB5A 5F6MA 2IPHA 3RC5A 3MH7A 4KGAA 5DP3A 4X1NU 5AFZH 4FU9A 1T4UH 1YLCA 1JMOH 1IQNA 4DIIH 2VH6A 1O3FA 4AGJA 2GV6A 4OS4A 1QB9A 4XFQA 3KQDA 2VVVA 2H2ZA 3I77A 4INKA 1THPB 1VITG 1CHGA 4RN6A 2XCNA 1BZXE 1C5SA 5JBCS 5ETXA 5A09A 3TJOA 1MU8B 2OD3B 4X2WA 4YT6H 1ABJH 5T3HA 1K21H 3MNSA 1XKBC 2R0LA 3FP8E 1YC0A 1NRQH 1KLIH 1F0RA 2AS9A 1NTPA 2D2DA 3BTME 3DFLA 5FCRA 4AFSA 2EC9H 2UUKB 3BTDE 3SOSA 5LPEA 4CH8B 5CMXH 1BTYA 1WQVH 4E7RG 1N8OC 1NS3A 1SGFG 1K1JA 2FODA 2JH5D 1CT4E 4I8LA 2H6MA 2O8MA 4YM9A 1MTNC 2VINA 3T29A 5F03A 1GI1A 3F1SB 3UNSA 3U9AH 1Z71A 3K65B 4AB8A 1HLTH 1V2QT 1P3CA 2TGDA 1W0YH 1XUIA 2XBYA 1ETSH 4JYUH 1UVOA 1LCYA 2BLVA 2C93B 4UEHH 1CSOE 3UIRA 1SHYA 1ZGVA 1XXFA 6GCHG 1J9CH 1A3BH 2UUFB 1Z7KA 4JYTA 4Y11E 1BMLA 1LHCH 2J38A 1A3EH 1O39A 4UFEH 1YLDA 3MMGA 4YTAA 2Z6BD 3DUXH 1PYTC 2CHAC 3QO6A 4I33A 4D7FA 2ZZUH 1YM0A 2A5AA 2PGQB 1RTKA 4NGAH 3PO1C 4NSYA 3K6YA 2P95A 1OWKA 2YNBA 2ESTE 2EI8A 2SGQE 2ZHQH 3UWJH 2WUCA 2XC5A 2ZC9H 1BTWA 2UUYA 3PLBA 1AFQC 2FPZA 2XXLA 4ZKSU 1P04A 1MCVA 5E0GA 1SI5H 4NFFA 1BTHH 4X6NA 1WV7H 2W26A 1SGQE 1CHOF 1S84A 1AMHA 2HGTH 2GX4A 1CQQA 1GCTB 1O33A 2GV7A 1ELTA 3M7QA 5L2ZH 1NY22 2WPIS 2FM2A 4UONA 2PV9B 2FEQH 2XW9A 4NFEA 4OS5A 4BAMB 4X1RU 1UVPA 5AHGH 3OSYA 5A8YA 3DT0H 3LGWA 1QFKH 2XC0A 1QBVH 2ZQ2A 3QLPH 1P12E 2NU2E 1P0SH 1F0SA 4UFGH 2TRMA 4DGJA 1GBMA 1AKSA 2BDGA 4R0IA 3FAOA 1LVOA 2VWMA 3TU7H 1GHYH 2XRCA 2B9LA 1FY1A 4A1XA 4NSVA 1H9LB 2G8TA 1LMWB 4A1TA 2HALA 4WVPE 1GJCB 1UHBA 1DITH 3UY9A 1RGQA 7KMEH 1GDUA 2C3SA 1BTZA 3SV7A 1GI0A 2GTBA 3LKWA 5F8TA 1LDTT 2QXHA 2SGAA 4D9QA 1C2FA 4BAOB 1TONA 1C2LA 1GMCF 1LO6A 1AIXH 1W12U 1W0ZU 4CRAA 2C4FH 2ZHDA 2NWNA 2AIPA 1GGDB 3NKKA 1IAUA 2F9PA 3BN9A 1TX6A 3PTBA 1G3DA 5EQRA 4A1VA 2FOBA 3LGUA 1MU6B 4Q7YA 4HGCA 3UPEA 3AW1A 1C5LH 1NROH 1TPSA 1DXWA 1DLEA 1ELCA 1DPOA 1OSSA 1IOEA 1SC8U 1SLUB 3RXUA 3SI3H 3SNEA 1O30A 2VVCA 1MAXA 1TYNA 3EA7A 1CVWH 1F7ZA 3E0NB 3A89A 1TX7A 2Y5FA 1J14A 4Q7ZA 1LQEA 1P9UA 2GZ9A 1C5RA 1ZSKA 3AASA 3TH3H 3A85A 1EZXC 2ZPRA 1QJ7B 1O3CA 3RXSA 3BTEE 4OS2A 2J34A 2J95A 1Y3WA 1SPJA 1UCYK 1S0QA 1WU1A 4Y71A 1CGIE 1Q3XA 3P8GA 3TJUA 1S6FA 1UO6A 4GVUA 2QYIA 3ZV9A 3CS0A 4RKOB 4B76A 2OQ5A 3T27A 2H9HA 4CH2B 3BTHE 3MH4A 4K69A 4MPVA 5L2YH 3U8OH 1P2QA 3LDXH 3K9XB 1FY5A 4IW4E 3SO3A 1ZHMA 2OC7A 2ZGJA 4B1TA 1F2SE 1GBHA 1TABE 1BRAA 1NM6A 3UFAA 3A87A 1CHOG 1MUEB 1OYQA 3K6ZA 1AVWA 1V2NT 1AVXA 1QL7A 1J15A 3C1KA 3TH4H 1QA0A 2C8ZB 5C1XA 3UOPA 1GI7B 1XUGA 1GCTC 5FPTA 4B2BA 1LVBA 3RXQA 3GY7A 3ZZ8A 5A0BA 2FZZA 1ANBA 1EB2A 3MTYA 3EQ0H 3JZ1B 1C5TA 1DUAA 1XUKA 4GSOA 1Y5UT 1HAXB 3M3TA 1OXGA 2ULLA 1OKXA 1O0DH 4THNH 1L4ZA 4OS6A 1D6WA 1N6XA 2PTCE 1TBQH 2GCTC 3PYHA 2GGVB 4GPGA 4I8KA 3EE0B 3PMHB 1G2LA 3SU0A 5HXFA 3NPSA 3MI4A 1LKBA 3Q00A 1C2IA 2FWWA 4H42U 4KTCA 1C5QA 3L6PA 4FUEA 2QC2A 4ESTE 1DS2E 1TGNA 3ZZ9A 3TGKE 3T28A 1BRCE 1KDQA 2O8LA 1FAXA 3RMLH 1H1BA 1IHTH 5AF9H 1N1LA 3KQBA 1GMCG 2EA3A 1CGJE 3ZYDA 1ESBA 3TGIE 1O3AA 4XE4A 1PQ8A 3UOUA 2TIOA 5JBBS 1P57B 1FPCH 3SU4A 1W2KH 1YKTA 4OS1A 1CA0B 3SNBA 3STJA 2OC0A 1GJBB 3FANA 1EPTC 3BEIB 2ANYA 2ANKH 1QB1A 1P2IA 3EYDA 4NWKA 2GP9B 1ZMJA 1YF4A 2HLCA 3NK8A 4CBNA 3SGAE 2FS8A 1QTFA 2FOHA 3S9BA 1C5VA 2DE8A 4JZ1A 2PR3A 3RXKA 1GVLA 4NIVA 2O8WA 1SQOA 1TOCB 1G3BA 1U6QA 1TNGA 2SGDE 1GMHF 1NZQH 1V2LT 3RXRA 1SGDE 1A61H 1AUTC 5EW2H 1UTOA 4J2YB 2HWLB 7GCHF 3RU4T 3SHCH 1NU9A 1HYLA 4YESB 1AD8H 3O8RA 2R2MB 2OQUA 1ACBE 4Y6DA 9ESTA 4FU8A 4F4OC 2QXGA 1P03A 4BXSA 3PMAB 3UREA 3OYPA 2AGEX 1CGHA 2ODQA 3W95A 1AFEH 2VNTA 1KXAA 5FBIA 2G51A 5JBAS 2F9UA 1PQ5A 1ZMLA 3SU1A 1FQ3A 2BXUH 1GMDF 3NCLA 3QK1A 3I29A 1AWFH 1A0JA 1QA7A 1EXFA 4A92A 2Q6GA 3Q3KA 3RXTA 2A2QH 1GI4A 4BTTB 1GBAA 1O3JA 2O8TA 4ISNA 1D3QB 1KYNA 5DPAA 5EQSA 1QHRB 2ZCLP 1BCUH 3HGPA 2BY5X 2Z9IA 3KHVA 1GBDA 3UUZA 5FBEA 3A84A 1BMAA 2HOBA 3GCNA 4INLA 4YO9A 1OPHB 1BB0B 1TPAE 1O2HA 2ZQ1A 1O2WA 3A8BA 1KLJH 5L6NH 2Z94A 2UWLA 4WWYA 2SGPE 1C4V2 1O2XA 4AYVB 2H5CA 1J8AA 3TIUA 1C5PA 1ORFA 1PPEE 1DLKB 1KY9A 1TBRH 3RMNH 5DO4H 4O03A 4IS5A 2ZG0H 1SG8B 4I8GA 3F9GA 1TNLA 1JIMA 3VXEH 1QL8A 6LPRA 1BTPA 4Y79A 1XMNB 1CA8B 1OS8A 1C1TA 1UCYE 3AAUA 1VITH 3PM3A 3LU9B 1MTSA 1L1JA 3M35A 1IQLA 4JMYA 4K5ZA 4AFUA 1Y8TA 3CENA 1C9TA 2I6QA 1TE0A 4XBBA 3SNCA 2Q1JA 5FX6A 1P06A 4QT8C 3UNRA 3GY2A 1G37A 2W7UA 1TNIA 2ZO3H 1T8LA 2I6SA 3LC3A 2PLXA 1YPLH 2FDAA 2CMYA 3LH1A 4B71A 1SGRE 4H6TA 1N8OB 1ID5H 1CA0C 1UTKA 1VCPA 2BLOA 1P2MA 2BD8A 3TJVA 3A8CA 1V2MT 1MTNB 1FY4A 2TPIZ 3KEEA 1O2QA 2F9VA 1OWEA 4X8SH 4XSKU 3SNAA 2VGCB 2Z9JA 1BJUA 1PPBH 1Y5AT 3V7TA 1O2RA 1QRWA 1Z8RA 1GMHG 1BBRK 3A83A 1LPGB 1O5EH 1Z1IA 2J2UA 5A0AE 1PPFE 4MPXA 1L2EA 3SUEA 1QURH 3MNBA 3E91A 3ZZBA 2P59A 6ESTA 1AWHB 2ZGCA 3M3SA 6GCHF 1O3PB 1O38A 3OY6U 2HNTC 2FXRA 1G2MA 3PLPA 5DP6A 2NU0E 1EP6A 3A8AA 2XCFA 2ZF0H 2P16A 1IQHA 5HYOA 3KQEA 2FLRH 3RP2A 4DCDA 2M5TA 1GMDG 5T6DA 2VIDA 1IQEA 1GHZA 4B2AA 4LZ1H 4NWLA 1XXDA 3RLWH 1SSXA 5FPSA 5I25A 1NU7B 1BHXF 1K1LA 4OGYA 4PROA 1DSUA 1C2GA 3RXMA 1RD3B 3MO9A 2JETB 2ZU1A 1C5OH 1O2PA 2QY0B 1JOUB 4UFFH 1V2OT 2STAE 1BJVA 1L1NA 1TIOA 1IQJA 1PPZA 5JBTA 1AZ8A 2A7CA 4A7IB 1BMNH 1ELEE 3VXFH 3K2UA 4X6OA 1MKWK 4FUBA 2A0QB 3LC5A 3T62A 2NU1E 3TITA 2FESH 1TOMH 1TRYA 1WTHD 4ABGA 1TNKA 2BDIA 3V12A 2PHBA 1F92A 1O2ZA 1NRSH 3SORA 1YCPK 2HPPH 1HV7A 3VPKA 1INCA 2G5NA 2ZWLH 1B5GH 2VU8E 2BTCE 3KNXA 1GHWH 2ZFPH 2BD9A 1ELDE 2VWNA 3LT3A 1O35A 5DP8A 3ZZCA 9LPRA 3CP7A 4DOQA 3KQCA 3RXDA 3MFJA 4MLFB 1IQIA 2BX3A 1ZYOA 2D8WA 4JZFH 2ZFTA 1AVGH 1WAYB 1Y3XA 3UWIA 1ELVA 4Q2KA 2VIPA 4BANB 1G3CA 2CF9H 5EG4A 1FY3A 3BV9B 3OU0A 2O8UA 4YLUA 5A8XA 3IITA 3L3TA 1A7SA 2XBWA 1ZPCA 1THRH 1H8DH 2KAIB 1QL9A 5K7RA 2YNAA 1GJ9B 3QDZB 4M7GA 5FXLA 4XBDA 1T8OA 1QIXB 3ZVEA 4BTIB 4TYDA 2XWBI 2ZFQH 1C1RA 2OBQA 2WPJS 1UTJA 3SU3A 4ZUHA 4K1SA 4AG1A 1P2JA 2BM2A 4ABEA 4WXVA 3ODFA 2H1UA 1HAHH 1HGTH 1O3BA 1WOFA 4D76A 2SFAA 3SGBE 3CS7A 2ZTXA 2K1QA 2F9OA 2VGCC 1SOTA 3EAJA 5EXLA 1M9UA 4WJG2 4WY3A 1DFPA 1RTLA 4Y76A 3SJIA 1B0EA 1ANEA 2WV5A 1P01A 1CU1A 1NRPH 1WYKA 1LVYA 3MH5A 4KTUA 1GI6A 3E6PH 2XTTB 7LPRA 2ZGXH 3D65E 2G5VA 2AGGX 1GI2A 1W11U 3ESTA 5FCKA 1GBFA 1EATA 3ZVCA 5HM2A 1OP2A 1ABIH 1BRBE 1GPZA 2ZTZA 4IGDA 1TQ0B 4MNYA 3I78A 4ASHA 8GCHF 3QX5H 1SGCA 4DY7B 1A4WH 1TGSZ 4I7YH 8KME2 2FI3E 1ZOMA 1TX8A 2EI6A 1SVPA 1TB6H 4BAQB 1NRNH 3ATLA 1FIWA 1P9SA 5C67A 1EPTA 2A4RA 1S83A 2Y5HA 1V2KT 2ZU2A 5EPNA 4AFQA 3TGJE 2JETC 1S81A 1HNEE 3E0PB 1SQTA 2GT8A 2J9NA 5T6FA 3RC6A 2GZ8A 3GISB 4Y8XA 3UTUH 3RXAA 2VB0A 1KXDA 1FZZA 2AIQA 2RA3A 5E8EH 1Y3YA 1HIAB 2UWPA 1LHEH 2FYQA 4YT7H 1H9IE 3RU4E 4UE7H 4YOGA 3ZZ7A 4AN7A 1O34A 2AMDA 2EI7A 4LZ4B 2Y7XA 1ZRBA 2ZNKH 4ABAA 4UFDH 2GCTB 3RXLA 2G52A 3A7ZA 5EU8A 1ELGA 1S6HA 3TPIZ 4IBLH 2BLQA 3UR6A 2QN5T 1UVSH 3PV4A 3P95A 1YP9A 3U1JB 4JZDH 1MBMA 2FLBH 3BTQE 1O2TA 1UJ1A 1C1QA 1TQ7B 4O3UA 4KKDA 2LNCA 2WPMS 1MD7A 2ANMH 2BXTH 3GY8A 2HPQH 2QAAA 2ZCKP 1AGJA 2BHGA 2JH6D 2P3FH 1DVAH 1HXFH 4ZH8A 5DK1A 1TWXB 3VB7A 3MWIU 1EPTB 1O5FH 1SQAA 2BQWB 3LGVA 3HK3B 1GBBA 4MVNA 1O3IA 1J16A 1NFYA 1IQGA 3ZZ5A 1HAIH 3EA9A 2B5TB 2Z9GA 4TY7A 2GDEH 1Y3VA 2AGIX 2XYAA 2HRVA 3T5FH 3TK5A 3BTGE 1CBWC 1EB1H 2P93A 3BTTE 2Z3CA 1MMJN 5GCHF 1K1NA 3BEUA 4FVDA 2BOHB 2FOAA 3Q3YA 4ISHH 1W8BH 2RG3A 1MCTA 3N7OA 1E0FD 1S0RA 1TFXA 2BD5A 2ILNA 1ZZZA 4CBOA 1FLEE 3KGPA 3GY4A 1O2UA 2ZGBH 3SHAH 1EZQA 2QA9E 1OWIA 1BIOA 2FI5E 5DKMA 4TY6A 2PFEA 1ESAA 1HAVB 1QJ6B 3ITIA 3PLKA 2EEKA 1DDJA 2FOEA 2ALPA 4SGAE 3P70B 2OTVA 3ZZ3A 1QR3E 1SFIA 2OCVB 2FS9A 3S9AA 8GCHG 1XUFA 5J4QA 2WUBA 1NFWA 1G32B 2QXIA 2ZDAH 3A81A 2FI4E 2Q6FA 5CE1A 1FN6A 4MPWA 2BZ6H 4DVAU 3RM2H 1FMGA 2BX4A 3BIVH 3KN2A 3M5OA 2FMJA 1GHVH 4YZUA 3ZZ6A 1P8VC 3SBKA 2ZTYA 3MHWU 1LHFH 1O3MA 1C5WB 1YPHE 3PWCA 3H7TA 3SN8A 2GMTB 2ZFFH 3UQOA 4J1YA 1Z6JH 1O2IA 4Y0ZE 1G3EA 1B0FA 4FVBA 1YPGH 2FP7B 5C20A 1GHBG 1AB9B 3LJJA 1TLDA 1YPMH 1GCDA 3ATWA 1K2I1 1DOJA 1O37A 1ZR0A 4Y8ZA 2QGRA 1T4VH 5JDUB 2ANWA 4K8BA 1LKAA 3TK6A 3SGQE 5FPYA 2VJ1A 1EAUA 2CGAA 1HJ8A 3M37A 5EQQA 1O2VA 1IQFA 5I46H 4DJZB 3UR9A 2FTLE 3T25A 1KTTB 3ODDA 3PB1E 3PMBB 3SU6A 4ABJA 3E16B 1SGEE 2V6NA 4NZQA 5JB8S 2WYGA 4A6LA 1IHSH 4ISIH 1GBLA 2GZ7A 2PUQH 3QWCH 2ZPQA 3DHKH 3TK9A 5PTPA 1OYTH 1KXBA 1QRZA 3D23A 2V0BA 2ZDMA 1MZDA 4X0WU 4ZXYH 1GL0E 2Z9KA 1SOZA 3ATMA 1WTGH 3A8DA 3HK6B 1PJPA 2FX6A 5E0HA 3D49H 2CXVA 2BVSH 3FFGA 3SI4H 4ZKRU 5ESBA 2GT7A 5GCHG 1Z1JA 3QN7A 4K1TA 4K3JA 1KTSB 1LHGH 1OP0A 1H9HE 4WMEA 1KLTA 1YGCH 4U32A 1MKXH 2D1JA 1Y59T 1FY8E 1Z8JB 1TAWA 1GI9B 5HM9A 3F9FA 3B8JA 3FP7E 4WMDA 4K60A 2BZAA 1HBTH 2P8OC 4LOYH 1TRNA 2R9PA 4Y8YA 1DUEA 5C5OA 5HMAA 2XBXA 1BTXA 4XOJA 1L4DA 2A45B 1K1IA 2A5KA 4ZROA 4ABFA 2QIQA 1KXEA 1DM4B 1O5DH 2VWOA 3SJ9A 2Y81A 3RC4A 1GI8B 1TBZH 3EA8A 2Z3EA 1PQ7A 2BVRH 2CJIA 5GXPA 3NUMA 3A86A 1JXPA 5FHTA 2VIVA 1SLWB 2G55A 2C8XB 1SR5C 1ANCA 2PGBB 1ETTH 3ZVAA 1UTNA 1CT0E 3TLOA 1SGPE 2ODPA 2AMPA 2GMTC 1NESE 4AX9H 3H7OA 4IN2A 1FJSA 1ARBA 1PQAA 4AORA 2ZU3A 1NN6A 3E3TA 5FX5A 1V2WT 4I8HA 2ZA5A 1EZSC 1A0HB 1EJAA 2C90B 4X6MA 3RM0H 4DT7B 3SQEE 1AB9C 2THFB 1C5ZB 2QV1A 3RDZA 3VGCC 2ZGHA 3SV8A 3JZ2B 3L33A 2F3CE 2ZDVH 3RXHA 3ZVGA 3PROA 1TGCA 5EXMA 1MQ5A 3GDUA 1HPGA 1O3DA 3MU0A 1QBOA 4NIXA 1C5MD 3ZZAA 2ZDLA 1SGTA 4FUGA 3W94A 1AE8H 3ELAH 3V13A 3TJNA 4Y0YE 1JIRA 1C1PA 4MPUA 4TWWA 3ZVFA 4CRBA 5E2PA 5LPFA 3T26A 4UDWH 1O2KA 2SGFE 5DP9A 2A4QA 2BOKA 2ZCHP 4CR9A 1GBKA 1SB1H 4TWYA 1FNIA 1UTLM 2AMQA 2Y82A 5LGOA 4NCYA 1ELAA 3B23B 4KTSA 2AYWA 1V2UT 4NIYA 3U8TH 3O8BA 5GWZA 5C1YA 1ELBA 2A5IA 4O3TA 2SNVA 3O8DA 1C1SA 3DD2H 3VB4A 4JZIA 3MU5A 4K8YA 1DWBH 1IQKA 5E2OA 3A88A 2VIWA 1FUJA 3RXFA 1H8IH 2F9NA 1QNJA 2WYJA 4AOQA 4DURA 2BQ7B 4I32A 1A0LA 2A1DB 3M5MA 5CHAB 1SL3A 1BT7A 1N6YA 2ZECA 3S7KB 4Y7AA 3NZIA 4X6PA 1C4U2 2GKVE 3KCGH 1JBUH 2XNIA 1EAIA 1KXCA 4GLYA 1AI8H 1HAPH 5F8XA 1K9OE 2FO9A 1DWDH 1QRXA 1O3EA 4INHA 1P05A 1WSSH 2FOGA 1ZTJA 4ZAEA 1WUNH 5AFYH 4JCNA 3BTWE 1P09A 4H4FA 1MZAA 1L0ZA 4F49A 1O3GA 3M5LA 3SV6A 1O5AB 4X8TH 3SUDA 1JRTA 2B7DH 2J92A 4FUFA 5JPMH 1MAYA 1ESTA 1CO7E 1C1VH 1A46H 3U8RH 2KAIA 1EP5A 3MNCA 2STBE 3P8FA 3MU1A 1TGTA 1TMTH 2B8OH 4MDSA 1K28D 1C5XB 4DW2U 4GCHF 2BDBA 2HNTF 4FUIA 1C9PA 1Q31A 1ZSLA 1HXEH 3SU2A 2SGEE 3F9EA 3TNTA 2A4OA 1O31A 3E90B 4K1EA 2QXJA 4X2YA 2A32A 2BY9X 1V2PT 3GCHB 4AB9A 2PTNA 2V35A 3O8CA 1T7CA 1KXFA 2OUAA 3GOVB 2PW8H 1Z8GA 4NZLA 1AU8A 1OWDA 5JB9S 2VVUA 1UTMA 1C2MA 4CRGA 3U1IB 3G01A 3SQHE 1P02A 3M61U 3B9FH 2W3IA 5EW1H 2SNWA 1GHXH 1ZTKA 3RXBA 4BXWA 2QF0A 1GJ7B 4JK6A 1X7AC 4Q7XA 1TNHA 4X2VA 3OY5U 1O3NA 2TBSA 1Z8IB 1GJAB 1O2JA 2BD3A 1DXPA 3PMJA 1LPZB 4YOJA 1GBJA 1O2NA 3M7TA 1KSNA 2OC8A 1HAOH 2R3YA 2ODYB 2VIOA 3QGNB 1CBWB 4CHAB 1C2DA 1D6RA 2AERH 2WINI 2W3KA 2ZFRH 1O2SA 2AH4X 3Q3XA 3LPRA 1QQUA 3EGKH 1EKBB 1UK4A 1K1PA 1HIAA 1ZLRA 3A7VA 1VZQH 1DT2A 1FXYA 2PKSC 2R2WU 1H4WA 2CF8H 1HDTH 1G30B 2ZU4A 2UWOA 4D8NA 4IC6A 1BA8B 1VR1H 3RXCA 5A0CA 1MTVA 2CV3A 1FV9A 1GL1A 2XC4A 3KIDU 4U2WA 4VGCB 1GJ4H 5C1UA 2W5EA 5CHAC 2WV4A 1AE5A 3DFJA 2ZEBA 1DX5M 1EOJA 2PUXB 2Z3DA 2FOMB 3S9CA 4SGBE 1DY9A 3RU4D 5GJ4B 1ZGIA 2JKHA 1DWEH 1WBGB 2PSXA 4D9RA 1C5UA 1PFXC 4AYYB 4GHQA 4TPIZ 1QGFA 3SW2B 2BMGB 4IC5A 1NO9H 1G36A 1RS0A 5EGMA 1SLVB 1LVMA 1V6DA 1YBWA 1T8NA 4U30A 3AVZA 1MD8A 1XX9A 4GHTA 3PWBA 3GCOA 1TMUH 2G81E 4FU7A 3RLYH 1GI3A 3P8OA 3LJOA 2A7JA 1OWHA 4X2XA 5A8ZA 4JYVH 3GY5A 2ZKSA 1SGNE 4GCHG 2A31A 3ATKA 3MU8A 1GHBF 1LQDB 3SNDA 2JH0D 4MQAA 1HFDA 1GI5A 2FTMA 1O5GH 5LPRA 3MO6A 1BBRE 1NRRH 3GCTF 1F0UA 2TGAA 1RIWB 5F8ZA 4X1QU 1W7XH 3LGIA 1T8MA 1ZHRA 4BNRA 5TCCA 3A7TA 1SLXB 1LTOA 2ZP0H 1B7XB 2BY7X 3BTKE 1C1UH 1MTWA 3FZDA 3LOXA 3RXGA 4LK4A 3GCHC 2FOCA 1RJXB 3BSQA 4GAWA 3QGJA 5DP4A 1ELFA 2Z9LA 2GCHF 5HGGA 1HAVA 3QTVH 1C2EA 1GVZA 4Z6AH 5TJXA 1ZSJA 1DANH 2WPKS 2YOLA 3A7XA 1HJAB 1GG6B 2V3OH 2R3UA 4ZMAH 3MOCA 1WQSA 3S7HB 1P11E 4XDEA 3RXPA 3SUFA 3VB6A 1DWCH 3AW0A 1XM1A 1UMAH 1P10A 1SMFE 1ZMNA 4RKJB 4NA9H 4R8TB 2BYAX 1W3CA 1NFUA 4E05H 3RXEA 3ZYEA 2FX4A 1V2ST 1UCYH 5BPEA 2G00A 1UTQA 4NIWA 1BMMH 2GD4B 1ZJKA 3TH2H 1SFQB 1O3KA 3QTOH 4CHAC 2F9BH
chains in the Genus database with same CATH superfamily
3KYFA 1YCPM 1P2NA 1E1RD 1XVMA 1SGYE 5HIZA 4UD9H 3RXJA 1K1OA 1HAYB 2NU4E 3GY3A 1W7GH 3V3MA 1SGIB 1MTUA 2C8YB 3T2NA 1YPJH 2Z7FE 4OS7A 4CRFA 1TGBA 2P8OB 1QCPA 2IOTA 3MH6A 4CRCA 8LPRA 1BRUP 1XUJA 1C2KA 1GHAF 2F83A 4Z1MD 1AKSB 4VGCC 1SHHB 1RXPA 4I8JA 2TGTA 4WH8A 2GDDA 1QB6A 3HGNA 2BD2A 2FOFA 2ZHFH 1SGFA 3ZVBA 4FXGH 5FAHA 1TRMA 2VWLA 3A82A 3HKIB 3TNSA 2OP9A 1C1NA 5G4BA 1SBWA 2OLGA 3D62A 3URDA 1UHBB 2QF3A 3C27B 3ENSB 5DG6A 1P2OA 2K8IA 1O5CB 2HNTE 1S82A 3WY8A 1QBNA 2WPHS 3S0NA 4I31A 5EXNA 2FYRA 1GBIA 4O9VA 1F5RA 4X1PU 2VIQA 1GJ6A 1NC6A 1O2LA 4FUHA 2OINA 1KIGH 1O2OA 1HAGE 1O2GH 2BQ6B 3EE7A 4Z0KA 4OGXA 1QQ4A 1DY8A 4B6EA 2BY8X 1C1MA 1FI8A 6CHAB 1O3OA 3BG4B 1FONA 5EJ1A 1A5GH 4KP0A 2W7SA 3U98H 1AO5A 4JK5A 3SJKA 4NA8A 2H5DA 3SV9A 3STIA 3VGCB 4ZHLU 1RFNA 1CT2E 4Y7BA 1ANDA 1S85A 3GCTG 3NWUA 3WWFA 1FDPA 1G9IE 5EJLA 4HI3A 3ZV8A 3H5CB 2ZDKA 3BEFB 1ZTLA 1ZJDA 1D3DB 4WXIA 1RIWC 1F5KU 1ZPZA 1SQRA 1ZPBA 1TA6A 1FPHH 1EAXA 1WCZA 2GCHG 1UVTH 1JRSA 2V3HH 1E36B 4ISLA 3LGYA 3SJ8A 2WPLS 5ABWA 5A2MH 1D3TB 5DP7A 5HIYA 1AUJA 1EQ9A 2KCAA 1HAZB 1V2JT 2DE9A 5B6OA 3FZZA 1OP8A 1QY6A 2Y5GA 3LIWA 3IG6B 1HJAC 1GG6C 1ZHPA 2ZI2H 2AEIH 1D4PB 2P94A 1EZUC 1NFXA 2HVXA 1Y5BT 2V7QD 3P17H 3GICB 3HATH 3MNXA 3M7UA 2A2XH 3ZVDA 3KQ5A 1LHDH 2XBVA 2BLWA 1C1WH 3GYMA 4YOIA 1AQ7A 4LXBH 1DSTA 1C2HA 1HCGA 1VGCB 1P3EA 2RDLA 1O32A 2O9QA 4H6SB 4ZHMU 3A7YA 3UNQA 1J17T 2WPDD 1PPHE 1YPKH 3KL6A 3ZIAD 1EAWA 3QZRA 1OX1A 2ZDNA 3SV2H 5LH8A 2A7HA 3LONA 4ACBA 3GYLB 4BOHA 1GGDC 3V0XA 1BHXB 2ZHEH 1VCQA 2BB4A 1T32A 1XVOA 1YYY1 1EJNA 4DIHH 3RMOH 4CR5A 1JWTA 1GVKB 2WSSD 4B73A 2EQNA 1HRTH 2XWAA 4F55A 3A80A 1C2JA 1PYTD 2ASUB 1QJ1B 4NA7A 1FAKH 5EOKA 1A2CH 3SU5A 1GHAG 4U01A 1EX3A 4AGKA 1ETRH 5SGAE 2IJOB 3RXOA 1F5LA 1VCWA 4HTCH 2DUCA 1O2MA 3LGTA 3A7WA 8ESTE 5C17A 4ZKNU 4ABBA 3Q76A 3ATIA 4ISOA 3TVJB 1KDQB 1CE5A 4ABIA 2NU3E 1BUIA 2TGPZ 5GIBA 3FVFB 2Y7ZA 2D26C 4FUCA 4BAHB 3P92A 4X8UH 3M5NA 1V2RT 3BF6H 3PRDA 5DJ7A 1A5IA 7ESTE 1C5YB 1W10U 3IWMA 3KF2A 3P6ZB 4DT4A 4MNVA 4RSPA 1FIZA 2OBOA 3NXPA 1E35B 1BDAA 2XOKD 4D7GA 2HVYB 2VH0A 3E1XB 6CHAC 3BG4C 3F6UH 1RRKA 1UVUH 2BD7A 1MQ6A 1O3HA 1A1RA 2ZIQH 3MO3A 4K2YA 1EASA 1MKXK 4YLQH 2H9EH 3OTJE 1NPMA 1YPEH 1O36A 5J4SA 1HUTH 1NBME 2PKAA 4A5TS 2ZFSA 3DA9B 2OXSA 4BTUB 5L30H 2ZHWH 1GDQA 3Q77A 4E7NA 1W13U 1AY6H 3MYWA 2R0KA 5CHBA 2RCEA 1NT1A 3N7DA 1HB0B 1AN1E 1K1MA 2ZPSA 1GWAA 3ZZ4A 3R0FA 3ZZDA 4RI0A 2G4UA 2G4TA 4MTBA 2IN2A 4B2CA 1BBRH 1TPOA 4MG3A 5E0JA 4TPYA 1XUHA 5DP5A 1E38B 5JYIA 1TPPA 2FIRH 5DGJA 5GDSH 5IYTA 1GBTA 1P2KA 2PSYA 3OX7U 4ABHA 1MABB 1COWD 4ZHAA 2KX4A 3UAIC 5EPYA 3E8LA 1TMBH 2P3UB 1WXRA 1Z6EA 1F0TA 5KGOA 1TNJA 2F43B 2CN0H 1O5BB 4X1SU 1EUFA 4CREA 4FUJA 2BDCA 1MH0A 1VITF 3P8NA 4DG4A 3HKJB 1TALA 1UTPA 1D3PB 3HPTB 2F91A 1GDNA 2Y6TA 1BOQA 3RUOA 3RXIA 1BITA 1OWJA 2JJ2D 1IQMA 1RTFB 4AZ2B 2C8WB 1GBCA 1VGCC 1BMFD 4RT1A 3M36A 2ZU5A 5H4IB 3AAVA 3GDVA 2PKSB 1GJDB 5C3NA 1A5HA 4E06H 1C4Y2 2BVXH 4FOUC 4IMZA 3VEQB 4IN1A 3RXVA 2PKAB 1AHTH 4FUDA 1PPCE 2B0FA 1EOLA 4HFPB 2QCYA 2LPRA 5KEDA 1L1GA 2Y80A 3GY6A 3LH3A 2BY6X 1DICA 2RA0A 3DSOA 2PWXA 1Q2WA 2OC1A 3BIUH 1MKWH 5BRRE 1S5SA 1V2TT 5TCAA 1E34B 1C5NH 4KELA 5EJZA 4ABDA 1MBQA 2BDAA 2AFQB 1HJ9A 4NG9H 1GJ5H 4WMFA 3GDSA 4Q80A 1ARCA 4BAKB 2J94A 7GCHG 2M2AA 1YCPH 2J4IA 3VFEA 3URCA 3U69H 4MNXA 2GVFA 3F0PA 4HZHA 3R3GB 1THSH 4B74A 2H9TH 2A4GA 2CHAB 4WF8A 3BG8A 5ESTE 3PTNA 1YPHC 1TA2A 3PO1B 1O2YA 1LPKB 4IMQA 4JZEH 1BQYA 3RMMH 2BDYA 3S69A 1K22H 3EDXB 1Y3UA 1GJ8B 3QUMP 4AG2A 4O97A 1GBEA 1VJAU 4X8VH 2BD4A 1AFQB 1O3LA 3F9HA 4B75A 1DE7H 3SJOA 1AZZA 5C5NA 1T31A 1PPGE 1XKAC 1V3XA 2P3TB 4MNWA 2UUJB 5K0HA 3SUGA 4Y10E 5T6GA 1FN8A 5IDKA 2J97A 3FP6E 4XBCA 4AFZA 2ALVA 2LELA 4WH6A 3QZQA 1VJ9U 3MU4A 3UQVA 2Q6DA 1ZRKA 3SZNA 3VB3A 1E37B 1C1OA 1EJMA 5GPIB 3BTFE 2BDHA 3M3VA 1V2VT 4ZKOU 4CRDA 1BTUA 1W14U 5EODA 1D9IA 1OOKB 1UK2A 5C2ZA 4GUXA 1UK3A 5AVDA 4ZXXH 4FETA 3F68H 3VB5A 5F6MA 2IPHA 3RC5A 3MH7A 4KGAA 5DP3A 4X1NU 5AFZH 4FU9A 1T4UH 1YLCA 1JMOH 1IQNA 4DIIH 2VH6A 1O3FA 4AGJA 2GV6A 4OS4A 1QB9A 4XFQA 3KQDA 2VVVA 2H2ZA 2KZ4A 3I77A 4INKA 1THPB 1VITG 1CHGA 4RN6A 2XCNA 1BZXE 1C5SA 5JBCS 5ETXA 5A09A 3TJOA 1MU8B 2OD3B 4X2WA 4YT6H 1ABJH 5T3HA 1K21H 3MNSA 1XKBC 2R0LA 3FP8E 1YC0A 1NRQH 1KLIH 1F0RA 2AS9A 1NTPA 2D2DA 3BTME 3DFLA 3SZEA 5FCRA 4AFSA 2EC9H 2UUKB 3BTDE 5EIYA 3SOSA 5LPEA 4CH8B 5CMXH 3DSGA 1BTYA 1WQVH 4E7RG 1N8OC 1NS3A 1SGFG 1K1JA 2FODA 2JH5D 1CT4E 4I8LA 2H6MA 2O8MA 4YM9A 1MTNC 2VINA 3T29A 5F03A 1GI1A 3F1SB 3OE7D 3UNSA 3U9AH 1Z71A 3K65B 4AB8A 1HLTH 1V2QT 1P3CA 2TGDA 1W0YH 1XUIA 2XBYA 1ETSH 4JYUH 1UVOA 1LCYA 2BLVA 2C93B 4UEHH 1CSOE 3UIRA 1SHYA 1ZGVA 1XXFA 2QF5A 6GCHG 1J9CH 1A3BH 2UUFB 1Z7KA 4JYTA 4Y11E 1BMLA 1LHCH 2J38A 1A3EH 1O39A 4UFEH 1YLDA 3MMGA 4YTAA 2Z6BD 3DUXH 1PYTC 2CHAC 3QO6A 4I33A 4D7FA 2ZZUH 1YM0A 2A5AA 2PGQB 1FX0B 1RTKA 3PO1C 2KFWA 4NGAH 4NSYA 3K6YA 2P95A 1OWKA 2YNBA 2ESTE 2EI8A 2SGQE 2ZHQH 3UWJH 2WUCA 2XC5A 2ZC9H 1BTWA 2UUYA 3PLBA 1AFQC 2FPZA 2XXLA 4ZKSU 1P04A 1MCVA 5E0GA 1SI5H 4NFFA 1BTHH 4X6NA 1WV7H 2W26A 1SGQE 1CHOF 1S84A 1AMHA 2HGTH 2GX4A 1CQQA 1GCTB 1O33A 2GV7A 2XNDD 3F2FA 1ELTA 3M7QA 5L2ZH 1NY22 2WPIS 2FM2A 4UONA 2PV9B 2FEQH 2XW9A 4NFEA 4OS5A 4BAMB 4X1RU 1UVPA 5AHGH 3OSYA 5A8YA 3DT0H 3LGWA 5KECA 1QFKH 2XC0A 1QBVH 2ZQ2A 3QLPH 1P12E 2NU2E 1P0SH 1F0SA 4UFGH 2TRMA 4DGJA 1GBMA 1AKSA 2BDGA 4R0IA 3FAOA 1LVOA 2VWMA 3TU7H 1GHYH 2XRCA 2B9LA 1FY1A 4A1XA 4NSVA 1H9LB 2G8TA 1LMWB 4A1TA 2HALA 4WVPE 1GJCB 1UHBA 1DITH 3UY9A 1RGQA 7KMEH 1GDUA 2C3SA 1BTZA 3SV7A 1GI0A 2GTBA 3LKWA 3UB0A 5F8TA 1LDTT 2QXHA 2SGAA 4D9QA 1C2FA 4BAOB 1TONA 1C2LA 1GMCF 5DSFA 1LO6A 1AIXH 1W12U 1W0ZU 4CRAA 2C4FH 2ZHDA 2NWNA 2AIPA 1E1QD 1GGDB 1W0KD 3NKKA 1IAUA 2F9PA 3BN9A 1TX6A 3PTBA 1G3DA 5EQRA 4A1VA 2FOBA 3LGUA 1MU6B 4Q7YA 4HGCA 3UPEA 3AW1A 1C5LH 1NROH 1TPSA 1DXWA 1KMHB 1DLEA 1ELCA 1DPOA 1OSSA 1IOEA 1SC8U 1SLUB 2AHME 3RXUA 3SI3H 3SNEA 1O30A 2VVCA 1MAXA 1TYNA 3EA7A 1CVWH 1F7ZA 3E0NB 3A89A 1TX7A 2Y5FA 1J14A 4Q7ZA 1LQEA 1P9UA 2GZ9A 1C5RA 1ZSKA 3AASA 3TH3H 3A85A 1EZXC 2ZPRA 1QJ7B 1O3CA 3RXSA 3BTEE 4OS2A 2J34A 2J95A 1Y3WA 1SPJA 1UCYK 1S0QA 1WU1A 4Y71A 1CGIE 1Q3XA 3P8GA 3TJUA 4B6FA 1S6FA 5CDFE 1UO6A 4GVUA 2QYIA 3ZV9A 3CS0A 4RKOB 4B76A 2OQ5A 3T27A 2H9HA 4CH2B 3BTHE 3MH4A 4K69A 4MPVA 5L2YH 3U8OH 1P2QA 3LDXH 4P00A 3K9XB 1FY5A 4IW4E 3SO3A 3CNRA 1ZHMA 2OC7A 2ZGJA 4B1TA 1F2SE 1GBHA 3PV2A 1TABE 1BRAA 1NM6A 3UFAA 3A87A 1CHOG 1MUEB 1OYQA 3K6ZA 1AVWA 1V2NT 1AVXA 1QL7A 1J15A 3C1KA 3TH4H 1QA0A 2C8ZB 5C1XA 3UOPA 5HKKD 1GI7B 1XUGA 1GCTC 5FPTA 4B2BA 1LVBA 3RXQA 3GY7A 3ZZ8A 5A0BA 2FZZA 1ANBA 2EY4C 1EB2A 3MTYA 5B6LA 3EQ0H 3JZ1B 1C5TA 1DUAA 1XUKA 4GSOA 1Y5UT 1HAXB 3M3TA 1OXGA 2ULLA 1OKXA 1O0DH 4THNH 1L4ZA 4OS6A 1D6WA 1N6XA 2PTCE 1TBQH 3WW7A 2GCTC 3PYHA 2GGVB 4GPGA 4I8KA 5IK2D 3EE0B 3PMHB 1G2LA 3SU0A 5HXFA 3NPSA 3MI4A 1LKBA 3Q00A 1C2IA 2FWWA 4H42U 4KTCA 1C5QA 3H09A 3L6PA 4FUEA 2QC2A 4ESTE 1DS2E 1TGNA 3ZZ9A 3TGKE 3AK5A 3T28A 1BRCE 1KDQA 2O8LA 1FAXA 3RMLH 1H1BA 1IHTH 5AF9H 1N1LA 3KQBA 1GMCG 2EA3A 1CGJE 3ZYDA 1ESBA 3PV5A 1O3AA 4XE4A 1PQ8A 3UOUA 3TGIE 2TIOA 5JBBS 1P57B 1FPCH 3SU4A 1W2KH 1YKTA 2WV9A 4OS1A 1CA0B 3SYJA 3SNBA 3STJA 2OC0A 1GJBB 3FANA 1EPTC 3BEIB 2ANYA 2ANKH 1QB1A 2J5UA 1P2IA 3EYDA 4NWKA 2GP9B 1ZMJA 1YF4A 2HLCA 3NK8A 4CBNA 3SGAE 2FS8A 1QTFA 2FOHA 3S9BA 1C5VA 2DE8A 4JZ1A 2PR3A 3RXKA 1GVLA 4NIVA 2O8WA 1SQOA 1TOCB 1G3BA 1U6QA 1TNGA 2SGDE 1GMHF 1NZQH 1V2LT 3RXRA 1SGDE 1A61H 1AUTC 5EW2H 1UTOA 4J2YB 2HWLB 7GCHF 3RU4T 3SHCH 4RT0A 2OK5A 1NU9A 1HYLA 4YESB 1AD8H 3O8RA 2R2MB 2OQUA 1ACBE 4Y6DA 1NBMD 9ESTA 4FU8A 4F4OC 2QXGA 1P03A 4BXSA 3PMAB 3FKSD 3UREA 3OYPA 2AGEX 1CGHA 2ODQA 3W95A 1AFEH 2VNTA 1KXAA 5FBIA 2G51A 5JBAS 2F9UA 1PQ5A 1ZMLA 3SU1A 1FQ3A 2BXUH 1GMDF 3NCLA 3QK1A 3I29A 1AWFH 1A0JA 1QA7A 1EXFA 4A92A 2Q6GA 3Q3KA 3RXTA 2A2QH 1GI4A 4BTTB 1GBAA 3OFND 1O3JA 2O8TA 4ISNA 1D3QB 1KYNA 5DPAA 5EQSA 1QHRB 2ZCLP 1BCUH 3HGPA 2BY5X 2Z9IA 3KHVA 1GBDA 2LP6A 3UUZA 5FBEA 2K0QA 3A84A 1BMAA 2HOBA 3GCNA 4INLA 4YO9A 1OPHB 1BB0B 1TPAE 1O2HA 2ZQ1A 1O2WA 3A8BA 1KLJH 5L6NH 2Z94A 2UWLA 4WWYA 2SGPE 1C4V2 1O2XA 4AYVB 2H5CA 1J8AA 3TIUA 1C5PA 1ORFA 1PPEE 1DLKB 1KY9A 1TBRH 2YMSC 3RMNH 5DO4H 4O03A 4IS5A 2ZG0H 1SG8B 4I8GA 3F9GA 1TNLA 1JIMA 3VXEH 1QL8A 6LPRA 1BTPA 3PRBA 4Y79A 1XMNB 1CA8B 1OS8A 1C1TA 1UCYE 3AAUA 1VITH 3PM3A 3LU9B 1MTSA 1L1JA 3M35A 1IQLA 4JMYA 4K5ZA 4AFUA 1Y8TA 3CENA 1C9TA 2I6QA 1TE0A 1YWUA 4XBBA 3SNCA 2Q1JA 5FX6A 1P06A 4QT8C 3UNRA 3GY2A 1G37A 2W7UA 1TNIA 2ZO3H 1T8LA 2I6SA 3LC3A 2PLXA 1YPLH 1VKYA 2CMYA 2FDAA 3LH1A 4B71A 1SGRE 4ZCNA 4H6TA 1N8OB 1ID5H 1CA0C 1UTKA 1VCPA 2BLOA 1P2MA 2BD8A 3TJVA 3A8CA 2KR7A 1V2MT 1MTNB 1FY4A 2TPIZ 3KEEA 1O2QA 2F9VA 1OWEA 5GNDA 4X8SH 4XSKU 3SNAA 2VGCB 2Z9JA 1BJUA 1YLNA 1PPBH 1Y5AT 3V7TA 1O2RA 1QRWA 1Z8RA 1GMHG 1BBRK 3A83A 1LPGB 1O5EH 1Z1IA 2J2UA 5A0AE 1PPFE 4MPXA 1L2EA 2KCYA 3SUEA 1QURH 3MNBA 3E91A 3ZZBA 2P59A 6ESTA 1AWHB 2ZGCA 3M3SA 6GCHF 1O3PB 1O38A 3OY6U 2HNTC 2FXRA 1G2MA 3PLPA 5DP6A 2NU0E 1EP6A 3A8AA 2XCFA 2ZF0H 2P16A 1IQHA 5HYOA 3KQEA 2FLRH 3RP2A 4DCDA 2M5TA 1GMDG 5T6DA 2VIDA 1IQEA 1GHZA 4B2AA 4LZ1H 4NWLA 1XXDA 3RLWH 1SSXA 5FPSA 5I25A 1NU7B 1BHXF 1K1LA 4OGYA 4PROA 1DSUA 1C2GA 3RXMA 1RD3B 3MO9A 2JETB 2ZU1A 1C5OH 1O2PA 2QY0B 1JOUB 4UFFH 1V2OT 2STAE 1BJVA 1L1NA 1TIOA 1IQJA 1PPZA 5JBTA 1AZ8A 2KCOA 2A7CA 4A7IB 1BMNH 1ELEE 3VXFH 3K2UA 2WHXA 4X6OA 1MKWK 4FUBA 2A0QB 3LC5A 3T62A 2NU1E 3TITA 2FESH 1TOMH 1TRYA 3F2HA 1WTHD 4ABGA 1TNKA 2BDIA 3V12A 2PHBA 1F92A 1O2ZA 1NRSH 3SORA 1YCPK 2HPPH 1HV7A 3VPKA 1INCA 2G5NA 2ZWLH 1B5GH 2VU8E 2BTCE 3KNXA 1GHWH 2V3MA 2ZFPH 2J98B 2BD9A 1ELDE 2VWNA 3LT3A 1O35A 5DP8A 3ZZCA 9LPRA 3CP7A 4DOQA 3KQCA 3RXDA 3MFJA 4MLFB 1IQIA 2BX3A 1ZYOA 2D8WA 4JZFH 2ZFTA 1AVGH 1WAYB 1Y3XA 3UWIA 1ELVA 4Q2KA 2VIPA 4BANB 5C0UA 1G3CA 2CF9H 5EG4A 1FY3A 3BV9B 3OU0A 2O8UA 4YLUA 3DSPA 5A8XA 3IITA 3L3TA 1A7SA 2XBWA 1ZPCA 1THRH 1H8DH 2KAIB 1QL9A 5K7RA 2YNAA 1GJ9B 3QDZB 4M7GA 5FXLA 4XBDA 1T8OA 1QIXB 3ZVEA 4BTIB 4TYDA 2XWBI 2ZFQH 1C1RA 2OBQA 2WPJS 1UTJA 3SU3A 4ZUHA 4K1SA 4AG1A 1P2JA 2BM2A 4ABEA 4WXVA 3ODFA 2H1UA 1HAHH 1HGTH 1O3BA 1WOFA 4D76A 2SFAA 3SGBE 3CS7A 2ZTXA 3FN8A 2K1QA 2F9OA 2VGCC 1SOTA 3EAJA 5EXLA 1M9UA 4WJG2 4WY3A 1DFPA 1RTLA 4Y76A 3SJIA 1B0EA 1ANEA 1K0HA 2RDEA 1P01A 2WV5A 1CU1A 1NRPH 1WYKA 1LVYA 3MH5A 4KTUA 1GI6A 3E6PH 2XTTB 7LPRA 2ZGXH 3D65E 2G5VA 2AGGX 1GI2A 1W11U 2L6OA 3ESTA 5FCKA 1GBFA 1EATA 3W1EA 3ZVCA 5HM2A 1OP2A 1ABIH 1BRBE 1GPZA 2ZTZA 4IGDA 1TQ0B 4MNYA 3I78A 4ASHA 8GCHF 3QX5H 1SGCA 1EFRD 4DY7B 1A4WH 1TGSZ 4I7YH 8KME2 2FI3E 1ZOMA 1TX8A 2EI6A 1SVPA 1TB6H 4BAQB 1NRNH 3ATLA 1FIWA 1P9SA 5C67A 2YMSD 1EPTA 2A4RA 1S83A 2GJGA 1V2KT 2Y5HA 2ZU2A 5EPNA 4AFQA 3TGJE 2JETC 1S81A 1HNEE 3E0PB 1SQTA 2GT8A 2J9NA 5T6FA 3RC6A 2GZ8A 3GISB 4Y8XA 3UTUH 3RXAA 2VB0A 1KXDA 1FZZA 2AIQA 2RA3A 5E8EH 1Y3YA 1HIAB 2UWPA 1LHEH 2FYQA 4YT7H 1H9IE 3RU4E 4UE7H 4YOGA 3ZZ7A 4AN7A 1O34A 3U28C 2AMDA 2EI7A 4LZ4B 2Y7XA 1ZRBA 2ZNKH 4ABAA 4UFDH 2GCTB 3RXLA 2G52A 3A7ZA 5EU8A 1ELGA 1S6HA 3TPIZ 4IBLH 2BLQA 3UR6A 2QN5T 2CK3D 1UVSH 3PV4A 3P95A 1UW7A 1YP9A 3U1JB 4JZDH 1MBMA 2FLBH 3BTQE 1O2TA 1UJ1A 3MQKC 1C1QA 1TQ7B 4O3UA 4KKDA 2LNCA 2WPMS 1MD7A 2ANMH 2BXTH 3GY8A 2HPQH 2QAAA 3F3BA 2ZCKP 1AGJA 2BHGA 2JH6D 2P3FH 1DVAH 4OM9A 1HXFH 4ZH8A 5DK1A 1TWXB 3VB7A 1OHHD 3MWIU 1EPTB 1O5FH 1SQAA 2BQWB 3LGVA 3HK3B 1GBBA 4MVNA 1O3IA 1J16A 1NFYA 1IQGA 3ZZ5A 1HAIH 3EA9A 2B5TB 3OTPA 2Z9GA 4TY7A 2GDEH 1Y3VA 2AGIX 2XYAA 2HRVA 3T5FH 3TK5A 3BTGE 1CBWC 1EB1H 2P93A 3BTTE 2Z3CA 1MMJN 5GCHF 1K1NA 3BEUA 4FVDA 2BOHB 2FOAA 3Q3YA 4ISHH 1W8BH 2RG3A 1MCTA 3N7OA 1E0FD 1S0RA 1TFXA 2BD5A 2ILNA 1ZZZA 4CBOA 1FLEE 3KGPA 3GY4A 1O2UA 2ZGBH 3SHAH 5T1VA 1EZQA 2QA9E 1OWIA 1BIOA 1YY3A 2FI5E 4TY6A 2PFEA 5DKMA 1ESAA 1HAVB 1QJ6B 3ITIA 3PLKA 2EEKA 1W0JD 1DDJA 2JJ1D 4I86A 2FOEA 2ALPA 4SGAE 3P70B 2OTVA 3ZZ3A 1QR3E 1SFIA 2JDID 2OCVB 2FS9A 3S9AA 8GCHG 1XUFA 5J4QA 2WUBA 1NFWA 1G32B 2QXIA 2ZDAH 3A81A 2FI4E 2Q6FA 5CE1A 1FN6A 4MPWA 2BZ6H 4DVAU 3RM2H 1FMGA 2BX4A 3BIVH 3KN2A 3M5OA 2FMJA 2QF4A 1GHVH 4YZUA 3ZZ6A 1P8VC 3SBKA 2ZTYA 3MHWU 1LHFH 1O3MA 1C5WB 1YPHE 3PWCA 5F53A 3H7TA 3SN8A 2GMTB 1QZ8A 2ZFFH 3UQOA 2L74A 4XD7D 4J1YA 1Z6JH 1O2IA 4Y0ZE 1G3EA 1B0FA 4FVBA 1YPGH 2FP7B 5C20A 1GHBG 1AB9B 3LJJA 1TLDA 1YPMH 1GCDA 3ATWA 1K2I1 1DOJA 2YMSB 1O37A 1ZR0A 4Y8ZA 2QGRA 1T4VH 5JDUB 2ANWA 4K8BA 1LKAA 3TK6A 3SGQE 5FPYA 3OAAD 2VJ1A 1EAUA 2CGAA 1HJ8A 3M37A 5EQQA 1O2VA 1IQFA 5I46H 4DJZB 3UR9A 2FTLE 3T25A 1KTTB 3ODDA 3PB1E 3PMBB 3SU6A 1H8HD 4TT3D 4ABJA 3E16B 1SGEE 2V6NA 4NZQA 5JB8S 2WYGA 4A6LA 1IHSH 4ISIH 1GBLA 2GZ7A 2KM0A 2PUQH 3QWCH 2ZPQA 3DHKH 3TK9A 5PTPA 1OYTH 1KXBA 1QRZA 3D23A 2V0BA 2ZDMA 1MZDA 4X0WU 4ZXYH 1GL0E 2Z9KA 1SOZA 3ATMA 1WTGH 3A8DA 3HK6B 1PJPA 2FX6A 5E0HA 3D49H 2CXVA 2BVSH 3FFGA 3SI4H 4ZKRU 5ESBA 2GT7A 5GCHG 1Z1JA 3QN7A 4K1TA 4K3JA 1KTSB 1LHGH 1OP0A 1H9HE 4WMEA 1KLTA 1YGCH 4U32A 1MKXH 2D1JA 4P02A 1Y59T 1FY8E 1Z8JB 1TAWA 1GI9B 2IPQX 5HM9A 3F9FA 3B8JA 3FP7E 4WMDA 3OEED 4K60A 2BZAA 1HBTH 2P8OC 4LOYH 1TRNA 2R9PA 4Y8YA 1DUEA 5C5OA 5HMAA 2XBXA 1BTXA 4XOJA 1L4DA 2A45B 1K1IA 2A5KA 4ZROA 4ABFA 2QIQA 1KXEA 3GS9A 1DM4B 1O5DH 2VWOA 3SJ9A 2Y81A 3RC4A 1GI8B 1TBZH 3EA8A 2Z3EA 1PQ7A 2BVRH 2CJIA 5GXPA 3NUMA 3A86A 1JXPA 5FHTA 2VIVA 1SLWB 2G55A 4AC9A 2C8XB 5C0TA 1SR5C 1ANCA 2PGBB 1ETTH 3ZVAA 1UTNA 1CT0E 4Q63A 3TLOA 1SGPE 2ODPA 2AMPA 2GMTC 3VG8A 1NESE 4AX9H 3H7OA 4IN2A 1FJSA 1ARBA 1PQAA 4AORA 2ZU3A 1NN6A 3E3TA 5FX5A 1V2WT 3N99A 4I8HA 2ZA5A 1EZSC 1A0HB 1EJAA 2C90B 4X6MA 3RM0H 4DT7B 3SQEE 1AB9C 2THFB 1C5ZB 2QV1A 3NRLA 3OEHD 3RDZA 3VGCC 4ASUD 2ZGHA 3SV8A 3JZ2B 3L33A 2F3CE 2ZDVH 3RXHA 3ZVGA 3PROA 1TGCA 4YXWD 5EXMA 1MQ5A 3GDUA 1HPGA 1O3DA 2KCPA 3MU0A 1QBOA 4NIXA 1C5MD 3ZZAA 5DN6D 2ZDLA 1SGTA 4FUGA 3W94A 1AE8H 3ELAH 3V13A 3TJNA 4Y0YE 1JIRA 1C1PA 4MPUA 4TWWA 3ZVFA 4CRBA 5E2PA 5LPFA 3T26A 4UDWH 1O2KA 2SGFE 5DP9A 2A4QA 2BOKA 2ZCHP 4CR9A 3KYGA 1GBKA 1SB1H 4TWYA 1FNIA 1UTLM 2AMQA 2Y82A 5LGOA 4NCYA 1ELAA 3B23B 4KTSA 3FOAA 2AYWA 1V2UT 4NIYA 3U8TH 3O8BA 5GWZA 5C1YA 1ELBA 2A5IA 4O3TA 2SNVA 5FL7D 4Q4LA 3O8DA 1C1SA 3DD2H 2F4LA 3VB4A 4JZIA 3MU5A 4K8YA 1DWBH 1IQKA 5E2OA 3A88A 2VIWA 1FUJA 3RXFA 1H8IH 2F9NA 1QNJA 2WYJA 4AOQA 4DURA 2BQ7B 4I32A 1A0LA 2A1DB 3M5MA 5CHAB 1SL3A 1BT7A 1N6YA 2ZECA 3S7KB 4Y7AA 3NZIA 4X6PA 1C4U2 4M9FA 2GKVE 3KCGH 2J98A 4TSFD 3WWBA 1JBUH 2XNIA 1EAIA 2W6ID 1KXCA 4GLYA 1AI8H 1HAPH 5F8XA 1K9OE 2FO9A 1DWDH 1QRXA 1O3EA 3FO8D 1P05A 1WSSH 4INHA 2FOGA 1ZTJA 4ZAEA 1WUNH 5AFYH 1H8ED 4JCNA 3BTWE 1P09A 4H4FA 1MZAA 1L0ZA 4F49A 1O3GA 3M5LA 5C94A 3SV6A 1O5AB 4X8TH 3SUDA 1JRTA 2B7DH 2J92A 4FUFA 5JPMH 1MAYA 1ESTA 2IJD1 1CO7E 1C1VH 1A46H 3U8RH 2KAIA 1EP5A 3MNCA 2STBE 3P8FA 3MU1A 1TGTA 2PP6A 1TMTH 2B8OH 4MDSA 1K28D 1C5XB 4DW2U 4GCHF 2BDBA 2HNTF 4FUIA 1C9PA 1Q31A 1ZSLA 1HXEH 3SU2A 2SGEE 3F9EA 3TNTA 2A4OA 1O31A 3E90B 3F0OA 4K1EA 3N7EA 2QXJA 2VBCA 4X2YA 2A32A 2BY9X 1V2PT 3GCHB 4AB9A 2PTNA 2V35A 3O8CA 1T7CA 1KXFA 2OUAA 3GOVB 2PW8H 1Z8GA 4NZLA 1AU8A 1OWDA 5JB9S 2VVUA 1UTMA 1C2MA 4CRGA 3U1IB 3G01A 3SQHE 1P02A 3M61U 2RFKC 3B9FH 2W3IA 5EW1H 1S6LA 2SNWA 1GHXH 1ZTKA 3RXBA 4BXWA 2QF0A 1GJ7B 4JK6A 1X7AC 4Q7XA 1TNHA 4X2VA 3OY5U 1O3NA 2TBSA 1Z8IB 1GJAB 1O2JA 2BD3A 1DXPA 3PMJA 1LPZB 4YOJA 1GBJA 1O2NA 3M7TA 1KSNA 2OC8A 1HAOH 2R3YA 2ODYB 2VIOA 3QGNB 1CBWB 4CHAB 1C2DA 1D6RA 2AERH 2WINI 2W3KA 2ZFRH 1O2SA 2AH4X 3Q3XA 3LPRA 1QQUA 3EGKH 1EKBB 1UK4A 4F48B 1K1PA 1HIAA 1ZLRA 3A7VA 1VZQH 1DT2A 1FXYA 2PKSC 2R2WU 1H4WA 2CF8H 1HDTH 1G30B 2ZU4A 2UWOA 4D8NA 4IC6A 1BA8B 1VR1H 3RXCA 5A0CA 1MTVA 2CV3A 1FV9A 2HLDD 1GL1A 2XC4A 3DCLA 3KIDU 3F2GA 4U2WA 4VGCB 1GJ4H 5C1UA 2W5EA 5CHAC 1E79D 2WV4A 1AE5A 3DFJA 2ZEBA 1DX5M 1EOJA 2PUXB 2Z3DA 2FOMB 3S9CA 4SGBE 1DY9A 3RU4D 5GJ4B 1ZGIA 2JKHA 1DWEH 1WBGB 2PSXA 4D9RA 1C5UA 1PFXC 4AYYB 4GHQA 4TPIZ 1QGFA 3SW2B 2BMGB 4IC5A 1NO9H 1G36A 1RS0A 5EGMA 1SLVB 1LVMA 1V6DA 1YBWA 1T8NA 4U30A 3AVZA 1MD8A 1XX9A 4GHTA 3PWBA 3GCOA 1TMUH 2G81E 4FU7A 3RLYH 1GI3A 1WDIA 3P8OA 3LJOA 2A7JA 1OWHA 4X2XA 5A8ZA 4JYVH 3GY5A 2ZKSA 1SGNE 4GCHG 2A31A 3ATKA 4XRNA 3MU8A 1GHBF 1LQDB 3SNDA 2JH0D 4MQAA 1HFDA 1GI5A 2FTMA 1O5GH 5LPRA 3MO6A 2QE7D 1BBRE 1NRRH 3GCTF 1F0UA 2TGAA 1RIWB 5F8ZA 4X1QU 1W7XH 3LGIA 1T8MA 1ZHRA 4BNRA 5TCCA 3A7TA 1SLXB 1LTOA 2ZP0H 1B7XB 2BY7X 3BTKE 1C1UH 1MTWA 3FZDA 3LOXA 4HG6A 3RXGA 4LK4A 3GCHC 2FOCA 1RJXB 3BSQA 2W6JD 4GAWA 3QGJA 5DP4A 1ELFA 1SKYE 2Z9LA 2GCHF 5HGGA 1HAVA 3QTVH 1C2EA 1GVZA 4Z6AH 5TJXA 1ZSJA 1DANH 2WPKS 2YOLA 3A7XA 1HJAB 1GG6B 2V3OH 2R3UA 4ZMAH 2JIZD 3MOCA 1WQSA 3S7HB 2WZQA 1P11E 4XDEA 3RXPA 3SUFA 3VB6A 1DWCH 3AW0A 1XM1A 1UMAH 1P10A 1SMFE 1ZMNA 4RKJB 4NA9H 4R8TB 2BYAX 4ACAA 1W3CA 1NFUA 4E05H 3RXEA 3ZYEA 2FX4A 1V2ST 1UCYH 5BPEA 2G00A 1UTQA 4NIWA 1BMMH 2GD4B 1ZJKA 3TH2H 1SFQB 1O3KA 3QTOH 4CHAC 2F9BH
chains in the Genus database with same CATH topology
1YCPM 1P2NA 1XVMA 1SGYE 4UD9H 3RXJA 1K1OA 1HAYB 2NU4E 3GY3A 1W7GH 3V3MA 1SGIB 1MTUA 2C8YB 3T2NA 1YPJH 2Z7FE 4OS7A 4CRFA 1TGBA 2P8OB 1QCPA 2IOTA 3MH6A 4CRCA 8LPRA 1BRUP 1XUJA 1C2KA 1GHAF 2F83A 1AKSB 4VGCC 1SHHB 1RXPA 4I8JA 2TGTA 4WH8A 2GDDA 1QB6A 3HGNA 2BD2A 2FOFA 2ZHFH 1SGFA 3ZVBA 4FXGH 5FAHA 1TRMA 2VWLA 3A82A 3HKIB 3TNSA 2OP9A 1C1NA 5G4BA 1SBWA 2OLGA 3D62A 3URDA 1UHBB 2QF3A 3C27B 3ENSB 5DG6A 1P2OA 1O5CB 2HNTE 1S82A 3WY8A 1QBNA 2WPHS 3S0NA 4I31A 5EXNA 2FYRA 1GBIA 4O9VA 1F5RA 4X1PU 2VIQA 1GJ6A 1NC6A 1O2LA 4FUHA 2OINA 1KIGH 1O2OA 1HAGE 1O2GH 2BQ6B 4Z0KA 4OGXA 1QQ4A 1DY8A 2BY8X 1C1MA 1FI8A 6CHAB 1O3OA 3BG4B 1FONA 1A5GH 4KP0A 2W7SA 3U98H 1AO5A 4JK5A 3SJKA 4NA8A 2H5DA 3SV9A 3STIA 3VGCB 4ZHLU 1RFNA 1CT2E 4Y7BA 1ANDA 1S85A 3GCTG 3NWUA 1FDPA 1G9IE 4HI3A 3ZV8A 3H5CB 2ZDKA 3BEFB 1ZTLA 1ZJDA 1D3DB 4WXIA 1RIWC 1F5KU 1ZPZA 1ZPBA 1TA6A 1FPHH 1EAXA 1WCZA 2GCHG 1UVTH 1JRSA 2V3HH 1E36B 4ISLA 3LGYA 3SJ8A 2WPLS 5ABWA 5A2MH 1D3TB 5DP7A 1AUJA 1EQ9A 1HAZB 1V2JT 2DE9A 5B6OA 3FZZA 1OP8A 1QY6A 2Y5GA 3LIWA 3IG6B 1HJAC 1GG6C 1ZHPA 2ZI2H 2AEIH 1D4PB 2P94A 1EZUC 1NFXA 2HVXA 1Y5BT 3P17H 3GICB 3HATH 3MNXA 3M7UA 2A2XH 3ZVDA 1LHDH 2XBVA 2BLWA 1C1WH 3GYMA 4YOIA 1AQ7A 4LXBH 1DSTA 1C2HA 1HCGA 1VGCB 1P3EA 2RDLA 1O32A 2O9QA 4H6SB 4ZHMU 3A7YA 3UNQA 1J17T 1PPHE 1YPKH 3KL6A 1EAWA 3QZRA 1OX1A 2ZDNA 3SV2H 5LH8A 2A7HA 3LONA 3GYLB 4BOHA 1GGDC 3V0XA 1BHXB 2ZHEH 1VCQA 2BB4A 1T32A 1XVOA 1YYY1 1EJNA 4DIHH 3RMOH 4CR5A 1JWTA 1GVKB 4B73A 1HRTH 2XWAA 3A80A 1C2JA 1PYTD 2ASUB 1QJ1B 4NA7A 1FAKH 5EOKA 1A2CH 3SU5A 1GHAG 4U01A 1EX3A 4AGKA 1ETRH 5SGAE 2IJOB 3RXOA 1F5LA 1VCWA 4HTCH 2DUCA 1O2MA 3LGTA 3A7WA 8ESTE 4ZKNU 4ABBA 3Q76A 3ATIA 4ISOA 3TVJB 1KDQB 1CE5A 4ABIA 2NU3E 1BUIA 2TGPZ 5GIBA 3FVFB 2Y7ZA 2D26C 4FUCA 4BAHB 3P92A 4X8UH 3M5NA 1V2RT 3BF6H 5DJ7A 1A5IA 7ESTE 1C5YB 1W10U 3IWMA 3KF2A 3P6ZB 4MNVA 4RSPA 1FIZA 2OBOA 3NXPA 1E35B 1BDAA 4D7GA 2VH0A 3E1XB 6CHAC 3BG4C 3F6UH 1RRKA 1UVUH 2BD7A 1MQ6A 1O3HA 1A1RA 2ZIQH 3MO3A 4K2YA 1EASA 1MKXK 4YLQH 2H9EH 3OTJE 1NPMA 1YPEH 1O36A 5J4SA 1HUTH 2PKAA 4A5TS 2ZFSA 3DA9B 2OXSA 4BTUB 5L30H 2ZHWH 1GDQA 3Q77A 4E7NA 1W13U 1AY6H 3MYWA 2R0KA 2RCEA 1NT1A 1HB0B 1AN1E 1K1MA 2ZPSA 1GWAA 3ZZ4A 3R0FA 3ZZDA 2G4UA 2G4TA 4MTBA 2IN2A 4B2CA 1BBRH 1TPOA 4MG3A 5E0JA 4TPYA 1XUHA 5DP5A 1E38B 5JYIA 1TPPA 2FIRH 5DGJA 5GDSH 5IYTA 1GBTA 1P2KA 2PSYA 3OX7U 4ABHA 4ZHAA 5EPYA 3E8LA 1TMBH 2P3UB 1Z6EA 1F0TA 1TNJA 2CN0H 1O5BB 4X1SU 1EUFA 4CREA 4FUJA 2BDCA 1MH0A 1VITF 3P8NA 4DG4A 3HKJB 1TALA 1UTPA 1D3PB 3HPTB 2F91A 1GDNA 2Y6TA 1BOQA 3RUOA 3RXIA 1BITA 1OWJA 1IQMA 1RTFB 4AZ2B 2C8WB 1GBCA 1VGCC 3M36A 2ZU5A 5H4IB 3AAVA 3GDVA 2PKSB 1GJDB 5C3NA 1A5HA 4E06H 1C4Y2 2BVXH 4IMZA 3VEQB 4IN1A 3RXVA 2PKAB 1AHTH 4FUDA 1PPCE 2B0FA 1EOLA 4HFPB 2QCYA 2LPRA 1L1GA 2Y80A 3GY6A 3LH3A 2BY6X 1DICA 2RA0A 2PWXA 1Q2WA 2OC1A 3BIUH 1MKWH 5BRRE 1S5SA 1V2TT 5TCAA 1E34B 1C5NH 4KELA 4ABDA 1MBQA 2BDAA 2AFQB 1HJ9A 4NG9H 1GJ5H 4WMFA 3GDSA 4Q80A 1ARCA 4BAKB 2J94A 7GCHG 1YCPH 2J4IA 3VFEA 3URCA 3U69H 4MNXA 2GVFA 4HZHA 3R3GB 1THSH 4B74A 2H9TH 2A4GA 2CHAB 4WF8A 3BG8A 5ESTE 3PTNA 1YPHC 1TA2A 3PO1B 1O2YA 1LPKB 4IMQA 4JZEH 1BQYA 3RMMH 2BDYA 3S69A 1K22H 3EDXB 1Y3UA 1GJ8B 3QUMP 4AG2A 4O97A 1GBEA 1VJAU 4X8VH 2BD4A 1AFQB 1O3LA 3F9HA 4B75A 1DE7H 3SJOA 1AZZA 5C5NA 1T31A 1PPGE 1XKAC 1V3XA 2P3TB 4MNWA 2UUJB 5K0HA 3SUGA 4Y10E 5T6GA 1FN8A 5IDKA 3FP6E 4XBCA 4AFZA 2ALVA 4WH6A 3QZQA 1VJ9U 3MU4A 3UQVA 2Q6DA 1ZRKA 3SZNA 3VB3A 1E37B 1C1OA 1EJMA 5GPIB 3BTFE 2BDHA 3M3VA 1V2VT 4ZKOU 4CRDA 1BTUA 1W14U 5EODA 1D9IA 1OOKB 1UK2A 5C2ZA 4GUXA 1UK3A 5AVDA 4ZXXH 3F68H 3VB5A 5F6MA 2IPHA 3RC5A 3MH7A 4KGAA 5DP3A 4X1NU 5AFZH 4FU9A 1T4UH 1YLCA 1JMOH 1IQNA 4DIIH 2VH6A 1O3FA 4AGJA 2GV6A 4OS4A 1QB9A 4XFQA 3KQDA 2VVVA 2H2ZA 3I77A 4INKA 1THPB 1VITG 1CHGA 4RN6A 2XCNA 1BZXE 1C5SA 5JBCS 5ETXA 5A09A 3TJOA 1MU8B 2OD3B 4X2WA 4YT6H 1ABJH 5T3HA 1K21H 3MNSA 1XKBC 2R0LA 3FP8E 1YC0A 1NRQH 1KLIH 1F0RA 2AS9A 1NTPA 2D2DA 3BTME 3DFLA 5FCRA 4AFSA 2EC9H 2UUKB 3BTDE 3SOSA 5LPEA 4CH8B 5CMXH 1BTYA 1WQVH 4E7RG 1N8OC 1NS3A 1SGFG 1K1JA 2FODA 2JH5D 1CT4E 4I8LA 2H6MA 2O8MA 4YM9A 1MTNC 2VINA 3T29A 5F03A 1GI1A 3F1SB 3UNSA 3U9AH 1Z71A 3K65B 4AB8A 1HLTH 1V2QT 1P3CA 2TGDA 1W0YH 1XUIA 2XBYA 1ETSH 4JYUH 1UVOA 1LCYA 2BLVA 2C93B 4UEHH 1CSOE 3UIRA 1SHYA 1ZGVA 1XXFA 6GCHG 1J9CH 1A3BH 2UUFB 1Z7KA 4JYTA 4Y11E 1BMLA 1LHCH 2J38A 1A3EH 1O39A 4UFEH 1YLDA 3MMGA 4YTAA 2Z6BD 3DUXH 1PYTC 2CHAC 3QO6A 4I33A 4D7FA 2ZZUH 1YM0A 2A5AA 2PGQB 1RTKA 4NGAH 3PO1C 4NSYA 3K6YA 2P95A 1OWKA 2YNBA 2ESTE 2EI8A 2SGQE 2ZHQH 3UWJH 2WUCA 2XC5A 2ZC9H 1BTWA 2UUYA 3PLBA 1AFQC 2FPZA 2XXLA 4ZKSU 1P04A 1MCVA 5E0GA 1SI5H 4NFFA 1BTHH 4X6NA 1WV7H 2W26A 1SGQE 1CHOF 1S84A 1AMHA 2HGTH 2GX4A 1CQQA 1GCTB 1O33A 2GV7A 1ELTA 3M7QA 5L2ZH 1NY22 2WPIS 2FM2A 4UONA 2PV9B 2FEQH 2XW9A 4NFEA 4OS5A 4BAMB 4X1RU 1UVPA 5AHGH 3OSYA 5A8YA 3DT0H 3LGWA 1QFKH 2XC0A 1QBVH 2ZQ2A 3QLPH 1P12E 2NU2E 1P0SH 1F0SA 4UFGH 2TRMA 4DGJA 1GBMA 1AKSA 2BDGA 4R0IA 3FAOA 1LVOA 2VWMA 3TU7H 1GHYH 2XRCA 2B9LA 1FY1A 4A1XA 4NSVA 1H9LB 2G8TA 1LMWB 4A1TA 2HALA 4WVPE 1GJCB 1UHBA 1DITH 3UY9A 1RGQA 7KMEH 1GDUA 2C3SA 1BTZA 3SV7A 1GI0A 2GTBA 3LKWA 5F8TA 1LDTT 2QXHA 2SGAA 4D9QA 1C2FA 4BAOB 1TONA 1C2LA 1GMCF 1LO6A 1AIXH 1W12U 1W0ZU 4CRAA 2C4FH 2ZHDA 2NWNA 2AIPA 1GGDB 3NKKA 1IAUA 2F9PA 3BN9A 1TX6A 3PTBA 1G3DA 5EQRA 4A1VA 2FOBA 3LGUA 1MU6B 4Q7YA 4HGCA 3UPEA 3AW1A 1C5LH 1NROH 1TPSA 1DXWA 1DLEA 1ELCA 1DPOA 1OSSA 1IOEA 1SC8U 1SLUB 3RXUA 3SI3H 3SNEA 1O30A 2VVCA 1MAXA 1TYNA 3EA7A 1CVWH 1F7ZA 3E0NB 3A89A 1TX7A 2Y5FA 1J14A 4Q7ZA 1LQEA 1P9UA 2GZ9A 1C5RA 1ZSKA 3AASA 3TH3H 3A85A 1EZXC 2ZPRA 1QJ7B 1O3CA 3RXSA 3BTEE 4OS2A 2J34A 2J95A 1Y3WA 1SPJA 1UCYK 1S0QA 1WU1A 4Y71A 1CGIE 1Q3XA 3P8GA 3TJUA 1S6FA 1UO6A 4GVUA 2QYIA 3ZV9A 3CS0A 4RKOB 4B76A 2OQ5A 3T27A 2H9HA 4CH2B 3BTHE 3MH4A 4K69A 4MPVA 5L2YH 3U8OH 1P2QA 3LDXH 3K9XB 1FY5A 4IW4E 3SO3A 1ZHMA 2OC7A 2ZGJA 4B1TA 1F2SE 1GBHA 1TABE 1BRAA 1NM6A 3UFAA 3A87A 1CHOG 1MUEB 1OYQA 3K6ZA 1AVWA 1V2NT 1AVXA 1QL7A 1J15A 3C1KA 3TH4H 1QA0A 2C8ZB 5C1XA 3UOPA 1GI7B 1XUGA 1GCTC 5FPTA 4B2BA 1LVBA 3RXQA 3GY7A 3ZZ8A 5A0BA 2FZZA 1ANBA 1EB2A 3MTYA 3EQ0H 3JZ1B 1C5TA 1DUAA 1XUKA 4GSOA 1Y5UT 1HAXB 3M3TA 1OXGA 2ULLA 1OKXA 1O0DH 4THNH 1L4ZA 4OS6A 1D6WA 1N6XA 2PTCE 1TBQH 2GCTC 3PYHA 2GGVB 4GPGA 4I8KA 3EE0B 3PMHB 1G2LA 3SU0A 5HXFA 3NPSA 3MI4A 1LKBA 3Q00A 1C2IA 2FWWA 4H42U 4KTCA 1C5QA 3L6PA 4FUEA 2QC2A 4ESTE 1DS2E 1TGNA 3ZZ9A 3TGKE 3T28A 1BRCE 1KDQA 2O8LA 1FAXA 3RMLH 1H1BA 1IHTH 5AF9H 1N1LA 3KQBA 1GMCG 2EA3A 1CGJE 3ZYDA 1ESBA 3TGIE 1O3AA 4XE4A 1PQ8A 3UOUA 2TIOA 5JBBS 1P57B 1FPCH 3SU4A 1W2KH 1YKTA 4OS1A 1CA0B 3SNBA 3STJA 2OC0A 1GJBB 3FANA 1EPTC 3BEIB 2ANYA 2ANKH 1QB1A 1P2IA 3EYDA 4NWKA 2GP9B 1ZMJA 1YF4A 2HLCA 3NK8A 4CBNA 3SGAE 2FS8A 1QTFA 2FOHA 3S9BA 1C5VA 2DE8A 4JZ1A 2PR3A 3RXKA 1GVLA 4NIVA 2O8WA 1SQOA 1TOCB 1G3BA 1U6QA 1TNGA 2SGDE 1GMHF 1NZQH 1V2LT 3RXRA 1SGDE 1A61H 1AUTC 5EW2H 1UTOA 4J2YB 2HWLB 7GCHF 3RU4T 3SHCH 1NU9A 1HYLA 4YESB 1AD8H 3O8RA 2R2MB 2OQUA 1ACBE 4Y6DA 9ESTA 4FU8A 4F4OC 2QXGA 1P03A 4BXSA 3PMAB 3UREA 3OYPA 2AGEX 1CGHA 2ODQA 3W95A 1AFEH 2VNTA 1KXAA 5FBIA 2G51A 5JBAS 2F9UA 1PQ5A 1ZMLA 3SU1A 1FQ3A 2BXUH 1GMDF 3NCLA 3QK1A 3I29A 1AWFH 1A0JA 1QA7A 1EXFA 4A92A 2Q6GA 3Q3KA 3RXTA 2A2QH 1GI4A 4BTTB 1GBAA 1O3JA 2O8TA 4ISNA 1D3QB 1KYNA 5DPAA 5EQSA 1QHRB 2ZCLP 1BCUH 3HGPA 2BY5X 2Z9IA 3KHVA 1GBDA 3UUZA 5FBEA 3A84A 1BMAA 2HOBA 3GCNA 4INLA 4YO9A 1OPHB 1BB0B 1TPAE 1O2HA 2ZQ1A 1O2WA 3A8BA 1KLJH 5L6NH 2Z94A 2UWLA 4WWYA 2SGPE 1C4V2 1O2XA 4AYVB 2H5CA 1J8AA 3TIUA 1C5PA 1ORFA 1PPEE 1DLKB 1KY9A 1TBRH 3RMNH 5DO4H 4O03A 4IS5A 2ZG0H 1SG8B 4I8GA 3F9GA 1TNLA 1JIMA 3VXEH 1QL8A 6LPRA 1BTPA 4Y79A 1XMNB 1CA8B 1OS8A 1C1TA 1UCYE 3AAUA 1VITH 3PM3A 3LU9B 1MTSA 1L1JA 3M35A 1IQLA 4JMYA 4K5ZA 4AFUA 1Y8TA 3CENA 1C9TA 2I6QA 1TE0A 4XBBA 3SNCA 2Q1JA 5FX6A 1P06A 4QT8C 3UNRA 3GY2A 1G37A 2W7UA 1TNIA 2ZO3H 1T8LA 2I6SA 3LC3A 2PLXA 1YPLH 2FDAA 2CMYA