1NC6A

Potent, small molecule inhibitors of human mast cell tryptase. anti-asthmatic action of a dipeptide-based transition state analogue containing benzothiazole ketone
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsinogen
publication title Potent, Small-Molecule Inhibitors of Human Mast Cell Tryptase. Antiasthmatic Action of a Dipeptide-Based Transition-State Analogue Containing a Benzothiazole Ketone.
pubmed doi rcsb
source organism Bos taurus
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nc6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nc6A02
1PQ5A 2P8OB 3ATMA 2BQWB 1SFQB 3AW0A 1TOMH 1YBWA 1SLUB 1GI7B 1G32B 1EXFA 1FAXA 1OP8A 1SHYA 4YTAA 3BSQA 1KXFA 1C2MA 5PTPA 4YM9A 3E91A 4HI3A 2ZFSA 1NTPA 1L1NA 1PPFE 1SGIB 3SV2H 3IG6B 2J38A 3ELAH 1A4WH 4I7YH 1Y8TA 4LZ4B 4I8KA 1LVBA 1WV7H 1XKAC 1A2CH 3UR6A 4O3TA 1GCDA 2RA3A 4OS7A 3V12A 1KTSB 2FOFA 1GJ9B 2ZHWH 1W10U 1ZPBA 5C67A 1FXYA 3OSYA 2O9QA 1EZSC 1O3PB 1O2WA 1YPEH 1SLVB 3F9FA 1EATA 1O3BA 1GI4A 3M7TA 2PKAA 1UHBB 3RLWH 2VVVA 2DUCA 1FY5A 1O3EA 4NWKA 1ZR0A 1AI8H 2VIOA 3U1JB 1ETRH 1GCTC 1TBQH 4J1YA 2FDAA 1TMBH 2STAE 4OS4A 1P8VC 4WXIA 1XUFA 2HNTF 4XDEA 4A1TA 4X2VA 4AB9A 3P95A 1DPOA 1AO5A 4X2XA 2HPPH 6CHAB 2XTTB 1YPLH 1GVLA 5FHTA 1C5YB 1QURH 1UTMA 1YPKH 4CRBA 1TX6A 3LJOA 1ZTJA 3GICB 2ANWA 2GMTB 1F2SE 3ENSB 3PYHA 4U01A 1ZPCA 1UTJA 4BNRA 2BD2A 4MPUA 1V2OT 3E1XB 1Y3UA 3ZVGA 1T7CA 1UK4A 1T32A 3U9AH 1C5TA 2G00A 1C4V2 4TPIZ 1Z8IB 1GJ7B 1D3QB 3RXBA 2LPRA 1C2FA 2BDAA 3MO3A 2WYJA 4O3UA 2XCFA 1IQLA 4I8JA 4K60A 1G3DA 2PSXA 1Y5AT 5FAHA 4R8TB 4B76A 5E2PA 2FZZA 4ABIA 1EUFA 3RXVA 4ZHMU 1GBMA 1W11U 1YPMH 3Q3YA 2P3UB 1ELDE 1DLKB 2WPIS 4A92A 1OSSA 4A5TS 2PFEA 1Y3YA 5DP7A 3TK6A 1SGDE 1BDAA 1DT2A 4F49A 1Z71A 4D9RA 2GCTC 1MTVA 3RP2A 3RC4A 3MNCA 2G52A 2NU4E 1X7AC 1YCPK 3SZNA 2FOBA 4CHAC 3TGJE 1UVTH 1EZQA 3SI3H 4DG4A 4DW2U 4Y79A 4Y71A 1BA8B 1FDPA 1ZZZA 3B23B 2HWLB 2R0LA 1P0SH 2F3CE 5IYTA 4O03A 1UTKA 3RU4E 1AVXA 2GKVE 1C5RA 4FU9A 1WSSH 3BTFE 2C8YB 2O8WA 2BZ6H 5T6GA 5FBEA 6GCHF 1D3DB 4DY7B 3Q3KA 2AS9A 2K1QA 3MH4A 1NPMA 1UTNA 1ZSLA 5K0HA 5FCRA 1GGDC 2BDCA 8GCHG 1D6RA 2P3FH 2UWLA 3MHWU 3GY3A 3AAUA 1KIGH 2QF0A 4AFQA 2QCYA 3HKIB 1GL1A 1CT0E 4FUDA 1MKXH 5CMXH 5AFYH 1AFQB 4LXBH 3MH5A 2BX4A 1O37A 2BHGA 1P9SA 1TGBA 3GY7A 5JYIA 5T6DA 1GHZA 2CHAC 4KKDA 1HLTH 4K3JA 1UVUH 4NIWA 1EJNA 4K1TA 3A7TA 3HK3B 1YGCH 4FUGA 2GX4A 1VJ9U 2ZU4A 2ZFTA 4H6TA 2J92A 2PGBB 4ISHH 4GHQA 1KY9A 3RXKA 3B8JA 3V13A 9ESTA 1L4DA 1E35B 1NRNH 4DIHH 1WCZA 1MKWH 4AYVB 2AERH 1HRTH 1T8LA 4AFZA 4VGCB 1P04A 2ZTXA 4FXGH 1LPKB 1EASA 5A8ZA 1C9TA 1HB0B 1AUTC 2ZKSA 3SW2B 3S69A 5GWZA 2A5AA 4GUXA 2FPZA 1O3GA 3W95A 1RTKA 3GY2A 5ETXA 1E36B 1F0UA 1O2UA 5FPTA 1AQ7A 2WV4A 1Z8GA 2W7SA 3VXEH 4B2CA 2QGRA 1KXEA 3SU6A 1GI3A 1EAXA 2JH0D 3RXQA 4FU8A 3HKJB 1W2KH 1IQJA 1TPAE 1J17T 3ITIA 5FX5A 7GCHG 2RDLA 2VGCB 3HPTB 2Z9LA 4IW4E 3QO6A 4DVAU 1AB9C 4KP0A 1GBKA 2FODA 2SGPE 2OQ5A 3F6UH 1O5EH 2FESH 1UK3A 4NIYA 1LKBA 1TB6H 3U8OH 2P94A 3ZYEA 5L30H 3S9CA 1W7GH 1ANCA 2BXUH 1HAYB 4DGJA 3P6ZB 1O2TA 2SFAA 3STIA 4CBOA 3BEFB 5JBTA 2H9EH 1MU6B 2PR3A 4ABHA 2XBVA 2A4QA 3RDZA 4AB8A 2F9NA 1J9CH 5GPIB 1GBEA 2F9OA 2C8ZB 2HNTE 3UWJH 1OXGA 1SHHB 5GXPA 3SGBE 2Z3DA 4GCHF 1HFDA 1TOCB 2H9HA 2EA3A 3FZZA 3TPIZ 1G2MA 1O2VA 2G81E 4MPWA 2W26A 5FBIA 3NK8A 1GJAB 2R2MB 1S6HA 1SGFA 1UTQA 2VVUA 1HJ8A 3FP7E 1MAYA 3HGPA 3MWIU 2O8MA 3QTOH 2VIPA 4K1SA 1MZDA 2ZDVH 4AG2A 1XMNB 1GBBA 1GDQA 4WMEA 3BG4C 1G9IE 1DWBH 2QAAA 3RMNH 1T4UH 1QHRB 1GG6B 2F83A 5HGGA 4UDWH 4ISIH 7LPRA 2GT7A 3QGJA 3ZVCA 1UK2A 1FMGA 2G5VA 1MBQA 2AGGX 1CA0B 3TH4H 1D9IA 4K8YA 1O2QA 2ODQA 2Z9GA 2O8TA 2JH6D 2BVSH 3ZZ6A 2PHBA 1GBHA 3SU2A 2HRVA 2Y82A 1C5MD 1THSH 1GDUA 2LNCA 2VJ1A 2OQUA 3Q3XA 1ELTA 3ZYDA 1T8MA 3SV9A 3OTJE 3D65E 3ZZAA 2CJIA 5EOKA 1GHBF 5A8YA 2QIQA 3RXJA 1G2LA 4X8SH 5GCHF 1YM0A 1T31A 2HOBA 7ESTE 3MNBA 1TABE 3GISB 2BY6X 4NCYA 2OTVA 1KDQB 4FUHA 4CR9A 1V2KT 2FOGA 4XSKU 3RM2H 1IHSH 3A82A 1F0TA 2XBXA 1THPB 5DGJA 1HXEH 3O8RA 1P02A 5SGAE 1OS8A 1S5SA 4I8LA 3PLBA 4ESTE 2Z6BD 5AF9H 1BTWA 5DP8A 1BTZA 2TBSA 4ZROA 1H8IH 3M35A 1W14U 1ELGA 1Y3XA 3MU8A 1HJAB 3LH3A 1F5KU 4CRAA 2PKSC 2P95A 3EGKH 1MTSA 3TJNA 1LKAA 1YPHC 3V0XA 1H1BA 1TRYA 1MTNB 3GY5A 4JZIA 5DP5A 3VB7A 3F9EA 3SJ8A 1KLIH 5TCCA 1G3EA 1PPZA 1K1NA 1BITA 3GY8A 3MU4A 4MPXA 3VB4A 3JZ1B 5CHAB 1VZQH 1H9LB 3IWMA 2BM2A 1PPBH 3GYMA 2QY0B 1GMCF 2Y7XA 1AVWA 2H1UA 1O38A 1BOQA 2VWNA 2BQ7B 8LPRA 2H9TH 1DXWA 4JZFH 1KXDA 3SGAE 4D9QA 2TRMA 4WY3A 1SSXA 4UD9H 2PUXB 4BXWA 4QT8C 1QTFA 1DX5M 1NO9H 2UUFB 2ANKH 2A4GA 1GMDG 1LQDB 2ASUB 2BTCE 2C90B 2GZ7A 3BTHE 1TLDA 1EZUC 4YOIA 2W7UA 2HPQH 2PTCE 1C5XB 5F8XA 1BMLA 1DSTA 2VWOA 8ESTE 3RMMH 3PWCA 2BOKA 3E8LA 3TJOA 2XW9A 3NPSA 1C2EA 2R9PA 1E0FD 1V2PT 3KF2A 2ZO3H 1IQFA 1O2XA 3QZQA 3TGKE 4X8UH 1GBFA 3FVFB 1YYY1 1KXAA 1BMNH 1EOLA 2OXSA 3SGQE 5JBCS 2PTNA 3RXCA 3SUEA 1TRNA 2OC0A 1FPHH 2PSYA 4UEHH 4JYTA 4WH6A 3SUFA 1O30A 1KLJH 1LVOA 3A81A 3PO1C 1A46H 1ORFA 1C4Y2 3AASA 5DJ7A 1TNKA 2FTLE 1J8AA 2RG3A 1ARCA 2IN2A 3VGCB 1TNIA 4X1PU 1L1GA 4YT6H 3S9BA 2V35A 5EGMA 2ZI2H 3QGNB 1O31A 4UFFH 3HGNA 1UCYH 2TIOA 2OC1A 4Y8XA 2VIQA 2ZPRA 4FU7A 3KEEA 2O8UA 4GSOA 2ZNKH 1XXFA 1DVAH 1S83A 2VWLA 4Y0ZE 4MTBA 1V2TT 1AZZA 1BJUA 5A0BA 1VJAU 4BAMB 2W3KA 4JZEH 3RMOH 4RKOB 2VINA 1XVOA 2BQ6B 2OLGA 4JMYA 1SLWB 3ZVEA 5JPMH 1P9UA 3SQHE 1V2QT 4OS6A 2HLCA 3S9AA 3DD2H 1W0ZU 4A1XA 4M7GA 2VIVA 1HAGE 1QA7A 4JK6A 1N8OB 5EPYA 1D3PB 1QCPA 2OBOA 3NUMA 3T27A 4Y7BA 4UE7H 3SQEE 1BHXB 3MH7A 4OS1A 2ZZUH 1M9UA 4WXVA 1F5RA 4I31A 2Y81A 3SV6A 1JRTA 1C1MA 3CS7A 4YLUA 1EPTC 4Y11E 1HYLA 5AVDA 1L1JA 1BTXA 2WUBA 4PROA 1ZHMA 3SUDA 3MFJA 1N6YA 3GCOA 1QL7A 3KQCA 2GZ9A 4U32A 4AFUA 3LONA 2A0QB 5BPEA 2FS8A 1YCPH 1NROH 3RXLA 2FEQH 1NESE 2GCHF 4DT7B 4IN2A 4R0IA 4SGBE 5HYOA 4AORA 4AFSA 3UIRA 1NZQH 4J2YB 4MG3A 5AFZH 2VIWA 1CHGA 2QXHA 4BAKB 1T4VH 1Q2WA 1YF4A 1F7ZA 2ZGJA 6GCHG 3MOCA 2WPLS 4IC5A 2FO9A 1O5DH 2Z7FE 2ZPQA 3SJIA 2ZCHP 2ZECA 1O3KA 2ODPA 3H7OA 1AU8A 1C1UH 1GBCA 2G4UA 2BZAA 4B2BA 3EA8A 3M5NA 1GBTA 2UWOA 3HATH 1HAHH 1EB2A 2P59A 2HVXA 3VB3A 2BD9A 1GI8B 1O5CB 4Y10E 1DE7H 5K7RA 4FUBA 3V7TA 1ZLRA 1QBOA 3GY6A 2H5DA 1DOJA 1Z1IA 4A7IB 1QGFA 1EAWA 1O34A 1AHTH 3TJUA 3K9XB 3K6ZA 3A8BA 4YOGA 2FIRH 1JBUH 3M5MA 4ABBA 1QRZA 1QB1A 1T8NA 1ELEE 1ELCA 1BRUP 2DE9A 4ZAEA 2AMDA 1GI0A 2ZC9H 1O3IA 4JZ1A 1OOKB 1IHTH 5C2ZA 1V2WT 4INKA 3BIVH 3I77A 2HALA 1C2LA 1FY1A 1P2OA 3A8AA 2CF9H 4OGYA 3M7QA 2VH6A 1QIXB 3M3VA 1ZOMA 3EAJA 1YP9A 2JETB 3A89A 1XUHA 3FAOA 2QXGA 1O3FA 1YLCA 3K65B 1Y5UT 2TGTA 3QZRA 1SL3A 4YOJA 3RXTA 1ELVA 3PTBA 5DK1A 2H2ZA 2BD3A 3SNDA 4AYYB 2ALPA 3T28A 3ZZ7A 4OGXA 1O3AA 1C2HA 1LDTT 2XC5A 1C5SA 2FOCA 2ZP0H 4DOQA 1C1WH 3LT3A 3UUZA 4FVDA 1P03A 1AKSA 5E0JA 1AIXH 1GJBB 1NS3A 1U6QA 1RTFB 3STJA 2A5KA 2XBYA 2Y5GA 1ZPZA 1SGTA 2XC0A 4IMZA 3ZZ5A 3BTME 1SBWA 1QL8A 2Z9JA 1GI5A 1FN8A 3PLKA 1SGCA 3JZ2B 1QRWA 1BTHH 3LKWA 2PLXA 3DUXH 5C1YA 4DURA 1NU9A 2XNIA 3CS0A 1FJSA 3BTQE 1SQOA 4MNVA 1VGCC 2WPMS 1ZRBA 4YZUA 4FUEA 1YPHE 3DHKH 1FUJA 2NU3E 4NZLA 5L6NH 4MDSA 4E7NA 2STBE 2EI7A 1GMHF 1C1SA 2SGAA 1P11E 1BT7A 3R0FA 4NIVA 5TCAA 3L3TA 3A84A 2BLOA 3MYWA 1NC6A 3A86A 3I29A 2VU8E 4WVPE 4O9VA 1Q3XA 3E0NB 1FV9A 1C5ZB 1KDQA 1GVKB 5FCKA 4Y7AA 3QLPH 1O36A 1QY6A 3AAVA 2BYAX 3SNAA 2FOHA 5C3NA 1FLEE 3UOPA 3BN9A 4ZXYH 1P09A 2R2WU 1SR5C 5HMAA 1ANDA 4MVNA 1V2VT 3A85A 1EAIA 1TA6A 1C2GA 3E3TA 1GWAA 3QTVH 3RXEA 1PFXC 1OYQA 5JBAS 1O39A 3UWIA 2ZDMA 1TX8A 1RIWC 1F5LA 3LC3A 3RM0H 3M7UA 2FLBH 1C2KA 2EI6A 1NRRH 1HUTH 3KN2A 4NA7A 1JRSA 1Z7KA 1D3TB 1O5GH 1GHBG 5FX6A 3SUGA 3H7TA 4D7FA 1CT2E 1NFWA 3BTWE 3D49H 1GCTB 3ZVBA 4GLYA 2TPIZ 1CHOF 3TGIE 4Q7YA 2GTBA 1AMHA 1TIOA 4GVUA 3LDXH 2PV9B 5AHGH 2VIDA 5A0AE 2CXVA 1GBJA 2CN0H 3UTUH 4ZKOU 3M3TA 1FNIA 1V2JT 1QQ4A 1F0RA 1LVMA 3SNEA 1QJ7B 1QJ6B 3A7WA 5JB9S 1UVOA 2GDDA 2BX3A 4I33A 4B75A 1C5UA 1GJ4H 1G36A 1TNLA 2D1JA 2ZWLH 1Y3WA 1ACBE 3K6YA 1O3LA 1K9OE 1BUIA 2Y5HA 3GYLB 2D2DA 3EYDA 4ABDA 1P2IA 3Q76A 4YO9A 4BTUB 2BDHA 2BY8X 4D76A 1C4U2 1HPGA 2ALVA 1EP5A 3EE0B 4NSVA 1DWEH 1HAVB 2ZU3A 3E0PB 1V2RT 3ATIA 3QK1A 3U1IB 3UFAA 5JBBS 4K5ZA 3RXRA 4RSPA 5DP4A 5L2YH 3K2UA 1VCQA 4IC6A 3RXHA 1GMCG 1WBGB 3O8BA 1O3MA 4MQAA 1B0EA 1B0FA 2GCTB 3ZVFA 1Z8JB 1ZMLA 2ZU2A 4CRFA 1XUGA 1C5OH 1EP6A 1DXPA 1GDNA 3NXPA 2ZCLP 1O2JA 1V2NT 3LGYA 1Z8RA 2UUKB 2FYRA 2OUAA 1Z1JA 1SPJA 5DP3A 4CHAB 4ZHLU 2ANYA 3PMAB 1SGRE 3S0NA 2SGDE 2Q1JA 2ZTYA 1QQUA 5C20A 3EDXB 2ZQ2A 1ARBA 4Y8YA 1BCUH 1YPGH 3VFEA 1SQTA 1GBDA 3MU5A 4MNYA 2ZU5A 1ANEA 1O3JA 1DITH 1AWHB 2IPHA 1A5GH 1VCWA 4DJZB 3QUMP 3RC6A 1BTUA 2PKAB 1THRH 1GGDB 4AN7A 1LO6A 4A6LA 1TGSZ 4MNWA 1SGEE 2D8WA 1XUJA 3Q77A 1C5NH 1BBRK 3TITA 3UNRA 2AEIH 2V3OH 2ZIQH 4X2WA 4TYDA 1J14A 1IQGA 2FI4E 1GHYH 2CHAB 4ZKNU 4INLA 2FTMA 4THNH 2A2QH 2I6SA 2OD3B 1LVYA 2GZ8A 2FMJA 4AX9H 2A7JA 3RXUA 1TNHA 3MI4A 1GJDB 3D62A 4TY6A 2NU1E 1JIRA 3RXOA 4BOHA 2W3IA 4IMQA 1O2PA 1SGYE 1OWKA 1GHWH 1FI8A 4O97A 3NCLA 1O5BB 1W7XH 3ZZBA 1ETSH 4BAHB 5IDKA 1MZAA 1E37B 1P01A 3TVJB 3BTGE 1LCYA 3MU1A 1ELBA 2SNWA 1C2JA 3SU1A 1UTOA 1ANBA 4KGAA 2D26C 2V3HH 1P57B 1KYNA 4NG9H 4Q80A 1ZTKA 5C1UA 2GV6A 3P70B 1W0YH 1IQNA 3UQOA 4WF8A 5HM9A 1VITG 2FI5E 1TONA 1PQAA 4Q7ZA 2RA0A 1BZXE 2RCEA 1TNGA 1AB9B 1K28D 2Y5FA 2THFB 4BAQB 4Y8ZA 1O2RA 1LHDH 5EG4A 3F9HA 3DFLA 4U2WA 4WMFA 1BBRE 1CA8B 1MU8B 3VPKA 3FP6E 8KME2 1YC0A 2AMPA 1P2NA 3I78A 4K69A 1KXCA 1GBAA 3HK6B 1XM1A 4CBNA 3OY6U 4BTTB 1AFEH 2XRCA 1TPSA 2GD4B 2Y6TA 1AGJA 3P8FA 3VXFH 1J15A 3ODFA 3BTTE 3M5OA 3GCHC 4GHTA 2ZDKA 4D7GA 4B73A 4TPYA 2BLWA 3C1KA 3L33A 5DPAA 3FANA 3MU0A 1C1RA 4Y76A 2XWAA 4JYUH 1N6XA 4CH2B 1UHBA 1UTLM 2FOMB 1PPCE 1XUIA 1DDJA 3GCTF 1IQHA 1OP2A 2AIQA 4NA8A 5JDUB 2XC4A 1CBWC 1GI6A 1PQ7A 7GCHF 3URDA 5LH8A 3BG4B 2XBWA 2TGDA 3VB5A 1OWEA 5FPSA 3GCNA 1BB0B 2EI8A 1CGJE 3NKKA 2AH4X 1ID5H 1IQMA 1BMAA 6LPRA 1WUNH 3KCGH 1ZJDA 3G01A 5T6FA 2FOAA 2OBQA 1CO7E 2BY7X 2WV5A 2A31A 1O2HA 1TRMA 4NIXA 2CF8H 4X6MA 3RXPA 4TY7A 1EOJA 3LH1A 1GI9B 5A8XA 1HNEE 4XFQA 4RKJB 1G37A 2IJOB 1SG8B 3RXGA 1NM6A 1P06A 5FXLA 2Z3EA 1C1QA 1C2IA 3ZZ4A 1Z6JH 1G3BA 2C3SA 1A0HB 3P8OA 2A2XH 2PUQH 1A7SA 3OYPA 2SGEE 2P8OC 2ZGXH 3DA9B 4AOQA 4UFEH 1E34B 2BMGB 2ZFFH 5FPYA 1VR1H 4E05H 4ASHA 2Q6GA 1A1RA 1A3EH 4XBBA 1FZZA 4H4FA 3S7HB 3BG8A 1RXPA 4AGJA 4I8GA 1VITH 5F6MA 3EA9A 3RMLH 3SOSA 3SU5A 2UUYA 4TWYA 2G8TA 1XUKA 2HGTH 2PKSB 2VVCA 1YCPM 4B71A 1TFXA 3RLYH 1KLTA 1ZYOA 4FUFA 4DCDA 5A2MH 1FY4A 2ZHFH 2ZFRH 3CENA 1TMTH 4IN1A 4E06H 1ABIH 1AZ8A 2ZHEH 4OS5A 1E38B 4X8TH 3UREA 1C9PA 2P93A 5EXNA 4CRGA 1RS0A 1C1NA 3AVZA 4WH8A 1VCPA 2P3TB 1BMMH 1B5GH 3LGTA 1ZHPA 4KELA 2C93B 4A1VA 1QR3E 1IQEA 2C8WB 3A80A 3KHVA 5C1XA 3TH2H 1K1IA 3SNBA 1C1VH 3MO6A 5F8TA 1JMOH 4KTUA 4HZHA 1QL9A 6CHAC 3DFJA 2FXRA 3KQEA 1GJ5H 2A4RA 3M61U 1BTPA 1O2GH 1A5IA 3ATLA 2G5NA 5EW2H 4X8VH 3TH3H 2ODYB 2SNVA 1P3CA 1O2MA 2GMTC 4XBCA 4X6OA 1SGNE 1AD8H 1QJ1B 2GVFA 4AZ2B 1GL0E 2KAIB 1PPHE 1DANH 3ODDA 5GIBA 4B1TA 1TQ7B 3IITA 1GJ8B 2QF3A 2AGEX 2BVXH 1CSOE 2XYAA 1P05A 4BANB 1ZTLA 4X6PA 3GY4A 1BJVA 3U98H 3TK9A 1MBMA 3SI4H 1P12E 1B7XB 3OU0A 4I8HA 1V2MT 2NU0E 1RJXB 5ESBA 1UO6A 3PO1B 3KNXA 1PPGE 2AFQB 5DO4H 1DWCH 3QN7A 1HXFH 1GI1A 1GVZA 1SB1H 1CHOG 1XXDA 4NA9H 2Z94A 3M3SA 1ETTH 4NWLA 3AW1A 3ZZ8A 4X1RU 1CGIE 1S82A 2A7HA 1BQYA 1MCTA 1TPPA 4MLFB 1MH0A 1HAOH 1K1LA 5E2OA 3R3GB 1C5PA 1GMDF 3LGVA 3SNCA 4FVBA 1TA2A 1DWDH 1GJCB 1O2OA 1LPZB 2QA9E 1MAXA 2ZA5A 3TU7H 1O2NA 1TGNA 3KL6A 4YESB 5EODA 2BY9X 3A8CA 5F8ZA 2G55A 4LOYH 3U8RH 4D8NA 3V3MA 1TBRH 1IQKA 3E90B 4ABGA 3E6PH 2CV3A 3PLPA 1HV7A 2WUCA 2ZGBH 3TLOA 4NGAH 1MTUA 1AFQC 3P8NA 9LPRA 2OINA 5H4IB 3SU4A 4CRCA 1HAIH 1QB9A 3TIUA 1O3CA 1LHEH 2YOLA 2ZDNA 4UONA 5E0GA 1EPTB 4K1EA 1WQVH 1HGTH 1C5LH 4OS2A 4WMDA 1HAXB 5B6OA 1FY3A 1GPZA 4DIIH 2R3UA 4ZHAA 2ANMH 1TYNA 1P10A 1O5AB 1MQ6A 1UTPA 1A0LA 1UCYK 2QV1A 4CH8B 1EB1H 1K1PA 5CE1A 1N1LA 5LPRA 1GHXH 2ZFQH 2BVRH 2GDEH 1PPEE 1ZGIA 2ZGHA 3SORA 2A45B 1HIAB 4VGCC 5ABWA 2ZHQH 1AWFH 1O2IA 1XX9A 3ESTA 5GJ4B 1DICA 2P16A 2ZPSA 1WAYB 1QA0A 2FLRH 4H6SB 2GV7A 4Z0KA 1GHAF 4ZKRU 2I6QA 4GCHG 2CMYA 6ESTA 1EAUA 2VH0A 4Y0YE 1LHCH 1S0RA 4INHA 1PYTD 1HAZB 2AGIX 1PJPA 3SJOA 2A7CA 5HXFA 2WPKS 2BXTH 2VWMA 3GDUA 1BBRH 2J2UA 2WYGA 3PV4A 4NSYA 3VB6A 1LQEA 2J95A 5G4BA 2PWXA 2VGCC 2AIPA 1QBNA 1SLXB 3T62A 1O35A 5EPNA 2SGQE 5E8EH 1CVWH 3U8TH 3BEIB 3KQBA 1C5VA 3PMHB 2FS9A 5GDSH 2B8OH 4ABAA 1KTTB 3P92A 3MO9A 5A0CA 2BDYA 1TE0A 1C1PA 2BY5X 1S6FA 1FIWA 1DY8A 1DM4B 1NN6A 2B5TB 2UUJB 3MNXA 1O0DH 3C27B 5DKMA 2CGAA 5TJXA 3F68H 3SBKA 3RXMA 2C8XB 3A8DA 2ZG0H 3A88A 3M37A 1F92A 3RU4D 2WINI 7KMEH 3VEQB 2ZFPH 4BTIB 2WPHS 1UCYE 1PQ8A 1MMJN 4SGAE 4NFEA 3TNTA 4FUJA 5GCHG 1HJ9A 4K8BA 2PGQB 3UR9A 1S85A 4B74A 2VNTA 4ZXXH 1D6WA 3MH6A 1WTGH 1HCGA 4LZ1H 3LOXA 5J4SA 1H8DH 2AMQA 1TGCA 1YKTA 2OCVB 3UNQA 3RC5A 4F4OC 1SMFE 5A09A 2BD8A 2Z9KA 1TX7A 2V0BA 1DUEA 2AYWA 1W12U 2ESTE 1RRKA 3PWBA 1TQ0B 1V6DA 1K22H 1A5HA 1XKBC 1MCVA 1OWDA 2FWWA 1TGTA 3N7OA 1WU1A 1Y5BT 1OX1A 4JZDH 4FUIA 3ZV9A 1EJMA 2XWBI 1DSUA 1WQSA 1LHGH 2ZU1A 1A0JA 1GG6C 3MMGA 3SV7A 1L0ZA 2ZEBA 4E7RG 2IOTA 1AE8H 1AVGH 3BF6H 5DG6A 5EU8A 1AY6H 1QBVH 1CA0C 4U30A 1IAUA 3RXIA 3CP7A 1H9IE 2OC7A 2W5EA 1OPHB 3OY5U 1ZSJA 3UQVA 4X1QU 2J9NA 2Y80A 1W3CA 2VB0A 2G51A 4BXSA 1VGCB 1ZJKA 3TNSA 1CQQA 1NT1A 1O2LA 3LPRA 2J94A 3KIDU 1SGQE 1V2LT 3BTEE 1NU7B 5EQQA 3A7ZA 1L2EA 1ZRKA 2H6MA 3QDZB 3SJKA 1SVPA 4IS5A 5C5OA 4FUCA 1RFNA 3RXFA 4X1NU 1MTWA 5L2ZH 1IQIA 1NFXA 1UVSH 3BTKE 3GCTG 3KGPA 1L4ZA 1V3XA 1ZMNA 1CT4E 3E16B 4Q7XA 1V2ST 4WWYA 3LGUA 2EEKA 4KTCA 4XBDA 1ESTA 1P2MA 2A4OA 1BRAA 1Z6EA 2FX6A 1W8BH 5LGOA 1A61H 2A5IA 2Y7ZA 3PTNA 5LPFA 2ZF0H 1GJ6A 1ZHRA 1P2KA 4ZMAH 4UFGH 3ZZCA 4ABEA 1W13U 2OP9A 1C5QA 3ATKA 3KQDA 2ZCKP 1A3BH 3U69H 2TGAA 1HJAC 2BOHB 1CGHA 1JXPA 2QC2A 1SGPE 3UNSA 1NRPH 2F9UA 1J16A 3W94A 1MTNC 1UJ1A 3GOVB 1RIWB 3NZIA 2M5TA 3MNSA 2OC8A 3QWCH 1DFPA 1O3HA 1HAPH 4AGKA 4ZUHA 1Q31A 1FIZA 5I46H 5CHAC 3SHCH 1BRBE 1V2UT 2BLVA 3M5LA 1CU1A 4ISOA 3ZZDA 1AUJA 2J34A 1LPGB 1QB6A 1O32A 1SQAA 3T2NA 2BLQA 4X0WU 3P17H 2BB4A 3BTDE 4H42U 2QXJA 4JK5A 1ESBA 1LTOA 2ULLA 1FONA 2BD4A 2Z3CA 3DT0H 3H5CB 1AKSB 2ZQ1A 1ESAA 1C1TA 3PMJA 5EW1H 1JOUB 3SJ9A 1G30B 1EQ9A 3UPEA 4Q2KA 4X6NA 5I25A 1SGFG 3ZVDA 1O3DA 1QFKH 1KSNA 2Z9IA 1DLEA 1OP0A 8GCHF 1LHFH 3A7XA 3A7VA 1O33A 3ATWA 1O5FH 2KAIA 1WTHD 4MNXA 1MKXK 4JYVH 4ABFA 1KXBA 2ZDAH 5EQRA 1TALA 4GAWA 3F1SB 1ZMJA 2C4FH 4CR5A 1EJAA 2A32A 1G3CA 1P2JA 1OWIA 3URCA 2QXIA 1C2DA 1TPOA 1ELFA 2ILNA 3NWUA 4ISLA 4ABJA 1TMUH 1QNJA 3VGCC 1FPCH 3BIUH 2F9PA 4UFDH 1MKWK 1SOTA 3RUOA 1HDTH 1PYTC 5ESTE 3M36A 1OKXA 1C5WB 3B9FH 1GI2A 2GCHG 1TBZH 1O2ZA 4B2AA 3SN8A 1RD3B 1EX3A 3PMBB 2PW8H 1CE5A 3LU9B 3LGWA 2G4TA 5T3HA 3T5FH 4NZQA 3ZZ9A 3EQ0H 3PROA 4HGCA 4ZKSU 1S84A 2JKHA 4YLQH 3ZVAA 2FX4A 1DS2E 1N8OC 2R0KA 1T8OA 1AE5A 3T25A 2GP9B 4RN6A 1FY8E 2BD5A 1JWTA 2QN5T 5E0HA 4WJG2 1NRQH 5C5NA 3QX5H 4KTSA 2H5CA 1D4PB 1P3EA 4I32A 3F9GA 2ZDLA 3RU4T 3P8GA 5EXLA 4Z6AH 5J4QA 1H9HE 2UWPA 4NFFA 1K1JA 1OYTH 2F91A 4MPVA 5EXMA 2JH5D 2TGPZ 1FQ3A 1YLDA 3A83A 1S81A 1EPTA 4CREA 2BD7A 1BRCE 1MD7A 1NFYA 5BRRE 4XE4A 3D23A 3FP8E 1ELAA 1NRSH 1BTYA 4ZH8A 3A87A 1FN6A 3BV9B 1NFUA 4IBLH 2ZHDA 1HIAA 1NY22 2Q6DA 4ISNA 5DP6A 3TK5A 1TNJA 4Y6DA 4X2YA 1K21H 1MD8A 1TAWA 3ZZ3A 2YNBA 1GBLA 2EC9H 4K2YA 3RXAA 2QYIA 1DY9A 3T26A 1H4WA 1F0SA 5DP9A 1EZXC 3LC5A 4XOJA 2XXLA 1YPJH 2FP7B 3SU3A 3SV8A 3RXSA 3MTYA 2O8LA 1INCA 2SGFE 3LJJA 3GDSA 1K1MA 1UMAH 2B7DH 5EQSA 2A1DB 4HFPB 3LGIA 2BDGA 1SFIA 1Y59T 2J4IA 1O3NA 1QRXA 2YNAA 1SC8U 5F03A 4X1SU 1FAKH 1BHXF 4IGDA 4CRDA 2F9BH 3LIWA 3O8DA 4TWWA 2FYQA 1K1OA 2NWNA 3GCHB 4AG1A 1RTLA 1GHAG 1MUEB 1XVMA 1K2I1 1JIMA 2BDBA 1SI5H 5HM2A 3S7KB 3A7YA 1SOZA 4HTCH 3FFGA 2JETC 1O2SA 1O2KA 2WPJS 1GMHG 1RGQA 1EKBB 3Q00A 3SU0A 1C1OA 2F9VA 1ZSKA 2V6NA 2XCNA 1WOFA 1VITF 1CBWB 1OWJA 3SHAH 3L6PA 5JB8S 4GPGA 1BIOA 1GHVH 1P2QA 2NU2E 3BEUA 3OX7U 4JCNA 3FZDA 1IOEA 2DE8A 2BDIA 3ZV8A 2ZTZA 3UY9A 3WY8A 3RXDA 3O8CA 1O3OA 4YT7H 5LPEA 1MQ5A 3T29A 2HNTC 1ABJH 1HBTH 1O2YA 1ZGVA 3EA7A 2ZGCA 1OWHA 4LK4A 1LMWB 1DUAA 3UOUA 1WYKA 2GGVB 3SO3A 2B9LA 1GBIA 1S0QA 1TWXB 1Y3VA 2GT8A 2FM2A 2R3YA 3GDVA 1AN1E 3PB1E 3PM3A 2FI3E 4BAOB 2B0FA 1HAVA 1UVPA 2Q6FA 3TJVA 2FOEA
chains in the Genus database with same CATH superfamily
1PQ5A 2P8OB 3ATMA 2BQWB 1SFQB 3AW0A 4Z1MD 1TOMH 1YBWA 1SLUB 1GI7B 1G32B 1EXFA 1FAXA 1OP8A 1SHYA 4YTAA 3BSQA 1KXFA 1C2MA 5PTPA 4YM9A 3E91A 4HI3A 2ZFSA 1NTPA 1L1NA 1PPFE 1SGIB 3SV2H 3IG6B 2J38A 3ELAH 1A4WH 4I7YH 1Y8TA 4LZ4B 2W6ID 4I8KA 1LVBA 1WV7H 1XKAC 1A2CH 3UR6A 4O3TA 2V7QD 1GCDA 2RA3A 4OS7A 3V12A 1KTSB 2FOFA 1GJ9B 2ZHWH 3F2GA 1W10U 1ZPBA 5C67A 1FXYA 3OSYA 2O9QA 1EZSC 1O3PB 1O2WA 1YPEH 1SLVB 3F9FA 1EATA 1O3BA 1GI4A 3M7TA 2PKAA 1UHBB 3F3BA 3RLWH 2VVVA 2DUCA 1FY5A 1O3EA 4NWKA 1ZR0A 1AI8H 2VIOA 3U1JB 1ETRH 1GCTC 1TBQH 4DT4A 4J1YA 2FDAA 1TMBH 2STAE 4OS4A 1P8VC 4WXIA 1XUFA 2HNTF 4XDEA 4A1TA 4X2VA 4AB9A 3P95A 1DPOA 3DSGA 1AO5A 4X2XA 2HPPH 6CHAB 2XTTB 1YPLH 1GVLA 5FHTA 4TSFD 1C5YB 1QURH 1UTMA 1YPKH 4CRBA 5CHBA 1TX6A 3LJOA 1ZTJA 3GICB 2ANWA 2GMTB 1F2SE 3ENSB 3PYHA 4U01A 1ZPCA 1UTJA 4B6FA 2BD2A 4BNRA 3SYJA 4MPUA 1V2OT 3E1XB 1Y3UA 3ZVGA 1T7CA 1UK4A 5CDFE 2JIZD 1T32A 3U9AH 1C5TA 2G00A 1C4V2 4TPIZ 1Z8IB 1GJ7B 1D3QB 3RXBA 2LPRA 1C2FA 2BDAA 3MO3A 2WYJA 4O3UA 2XCFA 1IQLA 4I8JA 4K60A 2K0QA 1G3DA 2PSXA 1Y5AT 5FAHA 4R8TB 4B76A 5E2PA 2FZZA 4ABIA 1EUFA 3RXVA 4ZHMU 1GBMA 1W11U 1YPMH 3Q3YA 2P3UB 1ELDE 1DLKB 2WPIS 4A92A 1OSSA 4A5TS 2PFEA 1Y3YA 5DP7A 3TK6A 1SGDE 1BDAA 1DT2A 4F49A 1Z71A 4D9RA 2GCTC 1MTVA 3RP2A 3RC4A 2W6JD 3MNCA 2G52A 2NU4E 1X7AC 1YCPK 4ACAA 3SZNA 2FOBA 4CHAC 3TGJE 1UVTH 1EZQA 3SI3H 4DG4A 4DW2U 4Y79A 4Y71A 1BA8B 1FDPA 1ZZZA 3B23B 2HWLB 2R0LA 1P0SH 2F3CE 5IYTA 4O03A 1UTKA 3RU4E 1AVXA 2GKVE 1C5RA 4FU9A 1WSSH 3BTFE 4Q4LA 2C8YB 2O8WA 4Q63A 2BZ6H 5T6GA 5FBEA 6GCHF 1D3DB 4DY7B 3Q3KA 2AS9A 2K1QA 3MH4A 1NPMA 1UTNA 1ZSLA 5K0HA 5FCRA 1GGDC 2BDCA 8GCHG 1D6RA 1WDIA 2P3FH 2UWLA 3MHWU 3GY3A 3AAUA 1KIGH 2QF0A 4AFQA 2QCYA 3HKIB 1GL1A 1CT0E 4FUDA 1MKXH 5CMXH 5AFYH 1AFQB 4LXBH 3MH5A 2BX4A 1O37A 2BHGA 1P9SA 1TGBA 3GY7A 5JYIA 5T6DA 1GHZA 3KYGA 2CHAC 4KKDA 1HLTH 4K3JA 1UVUH 4NIWA 1EJNA 4K1TA 3A7TA 3HK3B 1YGCH 4FUGA 2GX4A 1VJ9U 2ZU4A 2ZFTA 4H6TA 2J92A 2PGBB 4ISHH 4GHQA 1KY9A 3RXKA 3B8JA 3V13A 9ESTA 1L4DA 1E35B 1NRNH 2KCOA 4DIHH 1WCZA 1MKWH 4AYVB 2AERH 1HRTH 2AHME 1T8LA 4AFZA 4VGCB 1P04A 2ZTXA 4FXGH 1LPKB 1EASA 5A8ZA 3FN8A 1C9TA 1HB0B 1AUTC 2ZKSA 3SW2B 3S69A 5GWZA 2A5AA 4GUXA 3OAAD 2FPZA 1O3GA 3W95A 1RTKA 3GY2A 4XD7D 5ETXA 2WZQA 1E36B 1F0UA 1O2UA 5FPTA 1AQ7A 2WV4A 1Z8GA 2W7SA 3VXEH 4B2CA 2QGRA 1KXEA 3SU6A 1GI3A 1EAXA 2JH0D 3RXQA 4FU8A 3HKJB 1W2KH 1IQJA 1TPAE 1J17T 3ITIA 5FX5A 7GCHG 2RDLA 2VGCB 3HPTB 2Z9LA 4IW4E 3QO6A 4DVAU 1AB9C 4KP0A 1GBKA 2FODA 2SGPE 2OQ5A 3F6UH 1O5EH 2FESH 1UK3A 4NIYA 1LKBA 1TB6H 3U8OH 2P94A 3ZYEA 5L30H 3S9CA 1W7GH 2WPDD 1ANCA 2LELA 2BXUH 1HAYB 4DGJA 3P6ZB 1O2TA 2SFAA 3STIA 4CBOA 3BEFB 5JBTA 3H09A 2H9EH 1MU6B 2L74A 2PR3A 4ABHA 2XBVA 1S6LA 2A4QA 3RDZA 2WHXA 4AB8A 2F9NA 1J9CH 5GPIB 1GBEA 2F9OA 2C8ZB 2HNTE 3UWJH 1OXGA 1SHHB 5GXPA 3SGBE 2Z3DA 4GCHF 1HFDA 1TOCB 2H9HA 2EA3A 2KCPA 3FZZA 3TPIZ 1G2MA 1O2VA 3W1EA 5HKKD 2G81E 4MPWA 2W26A 5FBIA 3NK8A 1GJAB 2KCAA 2R2MB 1S6HA 1SGFA 1UTQA 2VVUA 1HJ8A 3FP7E 1MAYA 3HGPA 3MWIU 2O8MA 3QTOH 2VIPA 4K1SA 1MZDA 2ZDVH 4AG2A 1XMNB 1GBBA 1GDQA 4WMEA 3BG4C 1G9IE 1DWBH 2QAAA 3RMNH 1T4UH 1QHRB 1GG6B 2F83A 5HGGA 4RI0A 4UDWH 4ISIH 7LPRA 2GT7A 3QGJA 3ZVCA 1UK2A 1FMGA 2G5VA 1MBQA 2AGGX 1CA0B 3TH4H 1D9IA 4K8YA 1O2QA 2ODQA 2Z9GA 2O8TA 2JH6D 2BVSH 3ZZ6A 2PHBA 1GBHA 3SU2A 2HRVA 2Y82A 1C5MD 1THSH 1GDUA 2LNCA 2VJ1A 2OQUA 3Q3XA 1ELTA 3ZYDA 1T8MA 3SV9A 3OTJE 3D65E 3ZZAA 2CJIA 5EOKA 1GHBF 5A8YA 2QIQA 3RXJA 1G2LA 4X8SH 5GCHF 1YM0A 1T31A 2HOBA 7ESTE 3MNBA 1TABE 3GISB 2BY6X 4NCYA 5T1VA 2OTVA 1KDQB 4FUHA 4CR9A 1V2KT 2FOGA 4XSKU 3RM2H 1FX0B 1IHSH 3A82A 1F0TA 2XBXA 1THPB 5DGJA 1HXEH 3O8RA 1P02A 5SGAE 1OS8A 1S5SA 4I8LA 3PLBA 4ESTE 2Z6BD 5AF9H 1BTWA 5DP8A 1BTZA 2TBSA 4ZROA 1H8IH 3M35A 1W14U 1ELGA 2IPQX 1Y3XA 3MU8A 1HJAB 3LH3A 1F5KU 4CRAA 2PKSC 2P95A 3EGKH 1MTSA 3TJNA 1LKAA 1YPHC 3V0XA 1H1BA 4TT3D 3U28C 1TRYA 1MTNB 3GY5A 4JZIA 5DP5A 3VB7A 3F9EA 3SJ8A 1KLIH 5TCCA 3OTPA 1G3EA 1PPZA 1K1NA 1BITA 3GY8A 3MU4A 4MPXA 3VB4A 3JZ1B 5CHAB 1VZQH 1H9LB 3IWMA 2BM2A 1PPBH 3GYMA 2QY0B 1GMCF 2Y7XA 1AVWA 2H1UA 1O38A 1BOQA 2KCYA 2VWNA 3OEED 2BQ7B 8LPRA 2H9TH 1DXWA 4JZFH 1KXDA 3SGAE 4D9QA 2TRMA 4WY3A 1SSXA 4UD9H 1YWUA 2PUXB 4BXWA 4QT8C 1QTFA 1DX5M 1NO9H 2UUFB 2ANKH 2A4GA 1GMDG 1LQDB 2ASUB 2BTCE 2C90B 2GZ7A 3BTHE 1TLDA 1EZUC 4YOIA 2W7UA 2HPQH 2PTCE 1C5XB 2OK5A 5F8XA 1BMLA 1DSTA 2VWOA 8ESTE 3RMMH 3PWCA 2BOKA 3E8LA 3TJOA 2XW9A 3NPSA 1C2EA 2R9PA 1E0FD 1V2PT 1KMHB 3KF2A 2ZO3H 1IQFA 1O2XA 2QE7D 3QZQA 4X8UH 3TGKE 1GBFA 3FVFB 1YYY1 1KXAA 1BMNH 1EOLA 2OXSA 3SGQE 5DN6D 5JBCS 2PTNA 3OFND 3RXCA 1TRNA 2OC0A 3SUEA 1FPHH 2PSYA 4UEHH 1YLNA 4JYTA 4WH6A 3SUFA 1O30A 1KLJH 1LVOA 1QZ8A 3A81A 3PO1C 1A46H 1ORFA 1C4Y2 3AASA 5DJ7A 1TNKA 2FTLE 1J8AA 2RG3A 1ARCA 2IN2A 3VGCB 1TNIA 4X1PU 1L1GA 4YT6H 3S9BA 2V35A 5EGMA 2ZI2H 3QGNB 1O31A 4UFFH 1EFRD 3HGNA 1UCYH 2TIOA 2OC1A 4Y8XA 1UW7A 2VIQA 2ZPRA 4FU7A 3KEEA 2O8UA 4GSOA 2ZNKH 1XXFA 1DVAH 1S83A 2VWLA 4Y0ZE 4MTBA 1V2TT 1AZZA 1BJUA 5A0BA 1VJAU 4BAMB 1H8HD 2W3KA 4JZEH 3RMOH 4RKOB 2VINA 1XVOA 2BQ6B 2OLGA 4JMYA 1SLWB 3ZVEA 5JPMH 1P9UA 3SQHE 1V2QT 4OS6A 2HLCA 3S9AA 3ZIAD 3DD2H 1W0ZU 4A1XA 4M7GA 2VIVA 1HAGE 1QA7A 4JK6A 1N8OB 5EPYA 1D3PB 1QCPA 2OBOA 3NUMA 3T27A 4Y7BA 4UE7H 3SQEE 5HIZA 1BHXB 3MH7A 4OS1A 2ZZUH 1M9UA 4WXVA 1F5RA 4I31A 2Y81A 3SV6A 1JRTA 1C1MA 3CS7A 4YLUA 1EPTC 3KQ5A 4Y11E 1HYLA 5AVDA 1L1JA 1BTXA 2WUBA 4PROA 1ZHMA 3SUDA 3MFJA 1N6YA 3GCOA 1QL7A 3KQCA 2GZ9A 4U32A 4AFUA 3LONA 2A0QB 5BPEA 2FS8A 1YCPH 1NROH 3RXLA 2FEQH 1NESE 2GCHF 4DT7B 4IN2A 4R0IA 4SGBE 5HYOA 4AORA 4AFSA 3UIRA 1NZQH 4J2YB 4MG3A 5AFZH 2VIWA 1CHGA 2QXHA 4BAKB 1T4VH 1Q2WA 1YF4A 1F7ZA 2ZGJA 6GCHG 3MOCA 2WPLS 4IC5A 2FO9A 1O5DH 2Z7FE 2ZPQA 3SJIA 2ZCHP 2ZECA 1O3KA 2ODPA 3H7OA 1AU8A 1C1UH 1GBCA 2G4UA 2BZAA 4B2BA 3EA8A 3M5NA 1GBTA 2UWOA 3HATH 1HAHH 1EB2A 2P59A 2HVXA 3VB3A 2BD9A 1GI8B 1O5CB 4Y10E 1DE7H 5K7RA 4FUBA 3V7TA 1ZLRA 1QBOA 3GY6A 2H5DA 1DOJA 1Z1IA 5IK2D 2RDEA 4A7IB 1QGFA 1EAWA 1O34A 1AHTH 3TJUA 3K9XB 3WWFA 3K6ZA 3A8BA 4YOGA 2FIRH 1JBUH 3M5MA 4ABBA 1QRZA 1QB1A 1T8NA 1ELEE 1ELCA 1BRUP 2DE9A 4ZAEA 2AMDA 1GI0A 2ZC9H 1O3IA 4JZ1A 5HIYA 1OOKB 1IHTH 5C2ZA 3N7EA 1V2WT 4INKA 3BIVH 3I77A 2HALA 1C2LA 1FY1A 1P2OA 3A8AA 2CF9H 4OGYA 3M7QA 2VH6A 1QIXB 3M3VA 1ZOMA 3EAJA 1YP9A 2JETB 3A89A 1XUHA 3FAOA 2QXGA 1O3FA 1YLCA 3K65B 1Y5UT 2TGTA 3QZRA 1SL3A 4YOJA 3RXTA 1ELVA 3PTBA 5DK1A 2H2ZA 2BD3A 3SNDA 4AYYB 2ALPA 3T28A 3ZZ7A 4OGXA 1O3AA 1C2HA 1LDTT 2XC5A 1C5SA 2FOCA 2ZP0H 4DOQA 1C1WH 3LT3A 2WV9A 3UUZA 2YMSB 4FVDA 1P03A 1AKSA 5E0JA 1AIXH 1GJBB 1NS3A 1U6QA 1RTFB 3WW7A 3STJA 2A5KA 2XBYA 2Y5GA 2QF4A 1ZPZA 1SGTA 2XC0A 4IMZA 3ZZ5A 3BTME 1SBWA 1QL8A 2Z9JA 1GI5A 1FN8A 3PLKA 1SGCA 3JZ2B 1QRWA 1BTHH 3LKWA 2PLXA 3DUXH 5C1YA 4DURA 1NU9A 2XNIA 3CS0A 1FJSA 3BTQE 1SQOA 4MNVA 1VGCC 2KFWA 2WPMS 1ZRBA 4YZUA 4FUEA 1YPHE 3DHKH 1FUJA 2NU3E 4NZLA 5L6NH 4MDSA 4E7NA 2STBE 2EI7A 1GMHF 1C1SA 2SGAA 1P11E 4B6EA 1BT7A 3R0FA 4NIVA 5TCAA 3L3TA 3A84A 2BLOA 3MYWA 1NC6A 3A86A 3I29A 2VU8E 4WVPE 4O9VA 1Q3XA 3E0NB 1FV9A 1C5ZB 1KDQA 1GVKB 2EY4C 4Y7AA 5FCKA 3QLPH 1O36A 2JJ2D 1QY6A 3AAVA 4HG6A 2BYAX 3SNAA 2FOHA 5C3NA 1FLEE 3UOPA 3BN9A 4ZXYH 1P09A 2XNDD 2R2WU 1SR5C 5HMAA 1ANDA 4MVNA 1V2VT 3A85A 1EAIA 1TA6A 1C2GA 3E3TA 1GWAA 3QTVH 3RXEA 1PFXC 1OYQA 5JBAS 1O39A 3UWIA 2ZDMA 1TX8A 1RIWC 1F5LA 3LC3A 2V3MA 3RM0H 4P00A 3M7UA 2FLBH 2J98B 1C2KA 2EI6A 1NRRH 1HUTH 3KN2A 4NA7A 1W0JD 1JRSA 1Z7KA 1D3TB 1O5GH 1GHBG 5FX6A 3SUGA 3H7TA 4D7FA 1CT2E 1NFWA 3BTWE 3D49H 1GCTB 3ZVBA 4GLYA 2TPIZ 1CHOF 3TGIE 4Q7YA 2GTBA 1AMHA 1TIOA 5B6LA 4GVUA 3LDXH 2PV9B 5AHGH 2VIDA 5A0AE 2M2AA 2CXVA 1GBJA 2CN0H 3UTUH 4ZKOU 3M3TA 1FNIA 3KYFA 1V2JT 1QQ4A 1F0RA 1LVMA 3SNEA 1QJ7B 1QJ6B 3A7WA 5JB9S 1UVOA 2GDDA 2BX3A 4I33A 1NBMD 3F2HA 4B75A 1C5UA 1GJ4H 1G36A 1TNLA 2D1JA 2ZWLH 1Y3WA 4RT1A 1ACBE 3K6YA 1O3LA 1K9OE 1BUIA 2Y5HA 3GYLB 2D2DA 3EYDA 4ABDA 1P2IA 3Q76A 4YO9A 4BTUB 2BDHA 2BY8X 4D76A 1C4U2 1HPGA 2ALVA 1EP5A 3EE0B 4NSVA 1SQRA 1DWEH 1HAVB 2ZU3A 3E0PB 1V2RT 2J5UA 3ATIA 3QK1A 3U1IB 3UFAA 5JBBS 4K5ZA 3RXRA 4RSPA 1K0HA 3CNRA 5DP4A 5L2YH 3K2UA 1VCQA 4IC6A 3RXHA 1GMCG 1WBGB 3O8BA 1O3MA 4MQAA 1B0EA 1B0FA 2GCTB 3ZVFA 1Z8JB 1ZMLA 2ZU2A 4CRFA 1XUGA 1C5OH 1EP6A 1DXPA 1GDNA 3NXPA 2ZCLP 1O2JA 1V2NT 3LGYA 1Z8RA 2UUKB 2FYRA 2OUAA 1Z1JA 1SPJA 5DP3A 4CHAB 4ZHLU 2ANYA 3PMAB 1SGRE 3S0NA 2SGDE 2Q1JA 2ZTYA 1QQUA 5C20A 3EDXB 2ZQ2A 3AK5A 1ARBA 4Y8YA 1BCUH 3OE7D 1YPGH 3VFEA 1SQTA 1GBDA 3MU5A 4MNYA 2ZU5A 1ANEA 1O3JA 2K8IA 1DITH 1AWHB 2IPHA 1A5GH 1VCWA 2JJ1D 4DJZB 3QUMP 3RC6A 1BTUA 2PKAB 1THRH 1GGDB 4AN7A 1LO6A 4A6LA 4F55A 1TGSZ 4MNWA 1SGEE 2D8WA 1XUJA 3Q77A 1C5NH 1BBRK 3TITA 3PRDA 3UNRA 2AEIH 2V3OH 2ZIQH 4X2WA 4TYDA 1E79D 1J14A 1IQGA 2FI4E 1GHYH 2CHAB 4ZKNU 4INLA 2FTMA 4THNH 2A2QH 2I6SA 2OD3B 1LVYA 2GZ8A 2FMJA 4AX9H 2A7JA 3RXUA 1TNHA 3MI4A 1GJDB 3D62A 4RT0A 4TY6A 2NU1E 1JIRA 3RXOA 4BOHA 2W3IA 4IMQA 1O2PA 1SGYE 4ACBA 1OWKA 1GHWH 1FI8A 4O97A 3NCLA 1O5BB 1W7XH 3ZZBA 1ETSH 4BAHB 5IDKA 1MZAA 1E37B 1P01A 3TVJB 2QF5A 3BTGE 5C17A 1LCYA 3MU1A 1ELBA 2SNWA 1C2JA 3SU1A 1UTOA 1ANBA 4KGAA 2D26C 2V3HH 1P57B 1KYNA 4NG9H 4Q80A 1ZTKA 5C1UA 2GV6A 3P70B 1W0YH 1IQNA 3UQOA 4WF8A 2PP6A 5HM9A 1VITG 2FI5E 1TONA 1PQAA 3PV2A 4Q7ZA 2RA0A 1BZXE 2RCEA 1TNGA 1AB9B 1K28D 2Y5FA 2THFB 4BAQB 4Y8ZA 1O2RA 1LHDH 3DSOA 3F9HA 5EG4A 3DFLA 4U2WA 4WMFA 1BBRE 1CA8B 1MU8B 3VPKA 3FP6E 8KME2 1YC0A 2AMPA 1P2NA 3I78A 4K69A 1KXCA 1GBAA 3HK6B 1XM1A 4CBNA 3OY6U 4YXWD 4BTTB 1AFEH 2XRCA 1TPSA 2GD4B 2Y6TA 1AGJA 3P8FA 3VXFH 1J15A 3ODFA 3BTTE 3M5OA 3GCHC 4GHTA 2ZDKA 4D7GA 4B73A 4TPYA 2BLWA 3C1KA 3L33A 5DPAA 3FANA 3MU0A 1C1RA 4Y76A 2XWAA 4JYUH 1N6XA 4CH2B 1UHBA 1UTLM 2FOMB 1PPCE 1XUIA 1DDJA 3GCTF 1IQHA 1OP2A 2AIQA 4NA8A 5JDUB 2XC4A 1CBWC 1GI6A 1PQ7A 7GCHF 3URDA 5LH8A 3BG4B 2XBWA 2TGDA 3VB5A 1OWEA 5FPSA 3GCNA 1BB0B 2EI8A 1CGJE 2EQNA 3NKKA 2AH4X 1ID5H 1IQMA 3N7DA 1BMAA 6LPRA 1WUNH 3KCGH 1ZJDA 3G01A 5T6FA 2FOAA 2OBQA 1CO7E 2BY7X 2WV5A 2A31A 1O2HA 1TRMA 4NIXA 2CF8H 4X6MA 3RXPA 4TY7A 1EOJA 3F2FA 3LH1A 1GI9B 5A8XA 1HNEE 4XFQA 4RKJB 2IJD1 1G37A 2IJOB 1SG8B 3N99A 3RXGA 1NM6A 1P06A 5FXLA 2Z3EA 1C1QA 1C2IA 3ZZ4A 1Z6JH 1G3BA 2C3SA 1A0HB 3P8OA 2A2XH 2L6OA 2PUQH 1A7SA 3OYPA 2SGEE 2P8OC 2ZGXH 3DA9B 5DSFA 4AOQA 4UFEH 1E34B 2BMGB 2ZFFH 1SKYE 5FPYA 1VR1H 4AC9A 4ASHA 4E05H 2Q6GA 1A1RA 1A3EH 4XBBA 1FZZA 4H4FA 3S7HB 3BG8A 1RXPA 4AGJA 4I8GA 1VITH 5F6MA 3EA9A 3RMLH 3SOSA 3SU5A 2UUYA 4TWYA 2G8TA 1XUKA 2HGTH 2PKSB 2VVCA 1YCPM 5FL7D 4B71A 1TFXA 3RLYH 1KLTA 1ZYOA 4FUFA 4DCDA 5A2MH 1FY4A 2ZHFH 2ZFRH 3CENA 1TMTH 4IN1A 4E06H 1ABIH 1AZ8A 2ZHEH 4OS5A 1E38B 4X8TH 3UREA 1C9PA 2P93A 5EXNA 4CRGA 1RS0A 1C1NA 3AVZA 4WH8A 1VCPA 2P3TB 1BMMH 1B5GH 3LGTA 1ZHPA 4KELA 2C93B 4A1VA 1QR3E 1IQEA 2C8WB 3A80A 3KHVA 5C1XA 3TH2H 1K1IA 3SNBA 1C1VH 3MO6A 5F8TA 1JMOH 4KTUA 4HZHA 1QL9A 6CHAC 3DFJA 2FXRA 3KQEA 1GJ5H 2A4RA 3M61U 1BTPA 1O2GH 1A5IA 3ATLA 2G5NA 5EW2H 4X8VH 3TH3H 2ODYB 2SNVA 1P3CA 1O2MA 2GMTC 4XBCA 4X6OA 1SGNE 1AD8H 1QJ1B 2GVFA 4AZ2B 1GL0E 2KAIB 1PPHE 2KR7A 1DANH 3ODDA 5GIBA 4B1TA 5C0UA 1TQ7B 3IITA 1GJ8B 2QF3A 2AGEX 2BVXH 1CSOE 2XYAA 1P05A 4BANB 1ZTLA 4X6PA 3GY4A 1BJVA 3U98H 3TK9A 1MBMA 3SI4H 1P12E 1B7XB 3OU0A 4I8HA 1V2MT 2NU0E 1RJXB 5ESBA 1UO6A 3PO1B 3KNXA 1PPGE 2AFQB 3DCLA 5DO4H 1DWCH 3QN7A 2JDID 1HXFH 1GI1A 1GVZA 1SB1H 1CHOG 1XXDA 4NA9H 5KEDA 2Z94A 3M3SA 1ETTH 4NWLA 3AW1A 3ZZ8A 4X1RU 1CGIE 1S82A 2A7HA 1BQYA 1MCTA 3PV5A 1TPPA 2CK3D 4MLFB 1MH0A 1HAOH 1WXRA 1K1LA 5E2OA 3R3GB 1C5PA 1GMDF 3LGVA 3SNCA 4FVBA 1TA2A 1DWDH 2F43B 1GJCB 1O2OA 1LPZB 2QA9E 1MAXA 2ZA5A 3TU7H 4P02A 1O2NA 1TGNA 3KL6A 4YESB 5EODA 2BY9X 3A8CA 5F8ZA 2G55A 5EJ1A 4LOYH 3U8RH 4D8NA 3V3MA 1TBRH 3PRBA 1IQKA 1COWD 3E90B 4ABGA 3E6PH 2CV3A 3PLPA 1HV7A 2WUCA 2ZGBH 3TLOA 4NGAH 1MTUA 1AFQC 3P8NA 5EJZA 9LPRA 2OINA 5H4IB 3SU4A 4CRCA 1HAIH 1QB9A 3TIUA 1O3CA 1LHEH 2YOLA 2ZDNA 4UONA 5E0GA 1EPTB 4K1EA 1WQVH 1HGTH 1C5LH 4OS2A 4WMDA 1HAXB 5B6OA 1FY3A 1GPZA 4DIIH 2R3UA 4ZHAA 2ANMH 1TYNA 1P10A 1O5AB 1MQ6A 1UTPA 1A0LA 1UCYK 2QV1A 4CH8B 1EB1H 1K1PA 5CE1A 1N1LA 5LPRA 1GHXH 2ZFQH 2BVRH 2GDEH 1PPEE 1ZGIA 2ZGHA 3SORA 2A45B 1HIAB 4VGCC 5ABWA 2ZHQH 1AWFH 1O2IA 1XX9A 3ESTA 5GJ4B 3SZEA 1DICA 2P16A 2ZPSA 1WAYB 1QA0A 2FLRH 4H6SB 2GV7A 4Z0KA 1GHAF 4ZKRU 2I6QA 4GCHG 2CMYA 6ESTA 1EAUA 2VH0A 4Y0YE 1LHCH 1S0RA 5EJLA 4INHA 1PYTD 1HAZB 2AGIX 1PJPA 3SJOA 3FO8D 2A7CA 5HXFA 2WPKS 2BXTH 2VWMA 3GDUA 1BBRH 2J2UA 2WYGA 3PV4A 4NSYA 3VB6A 1LQEA 2J95A 5G4BA 2PWXA 2VGCC 2AIPA 1QBNA 1SLXB 2KM0A 3EE7A 3T62A 1O35A 5EPNA 2SGQE 5E8EH 3F0OA 1CVWH 3FKSD 3U8TH 3BEIB 3KQBA 1C5VA 3PMHB 2FS9A 5GDSH 2B8OH 4ABAA 5EIYA 1KTTB 3P92A 3MO9A 5A0CA 2BDYA 1TE0A 1C1PA 2BY5X 1S6FA 1FIWA 1DY8A 1DM4B 1NN6A 2B5TB 2UUJB 3MNXA 1O0DH 3C27B 5DKMA 2CGAA 5TJXA 3F68H 3SBKA 3RXMA 2C8XB 3A8DA 2ZG0H 3A88A 3M37A 1F92A 3RU4D 2WINI 7KMEH 3VEQB 2ZFPH 4BTIB 2WPHS 1UCYE 1PQ8A 1MMJN 4SGAE 4NFEA 3TNTA 4FUJA 5GCHG 1HJ9A 4K8BA 2PGQB 3UR9A 1S85A 4B74A 2VNTA 4ZXXH 1D6WA 3MH6A 5F53A 1WTGH 5KGOA 1HCGA 4LZ1H 3LOXA 5J4SA 1H8DH 2AMQA 1TGCA 1YKTA 2OCVB 3UNQA 3RC5A 4F4OC 1SMFE 5A09A 2BD8A 2Z9KA 1TX7A 4ZCNA 2V0BA 1DUEA 2AYWA 1W12U 4FOUC 2ESTE 1RRKA 3PWBA 1TQ0B 1V6DA 1K22H 1A5HA 1XKBC 1NBME 1MCVA 1OWDA 2FWWA 1TGTA 3N7OA 1WU1A 1Y5BT 1OX1A 4JZDH 4FUIA 3ZV9A 1EJMA 2XWBI 1DSUA 1WQSA 1LHGH 2ZU1A 1A0JA 1GG6C 3MMGA 3SV7A 1L0ZA 2ZEBA 4E7RG 2IOTA 1AE8H 1AVGH 3BF6H 5DG6A 5EU8A 1AY6H 1QBVH 1CA0C 4U30A 1IAUA 3RXIA 3CP7A 1H9IE 2OC7A 2W5EA 1OPHB 3OY5U 3WWBA 1ZSJA 3UQVA 4X1QU 2J9NA 2Y80A 2LP6A 1W3CA 2VB0A 2G51A 4BXSA 1VGCB 1ZJKA 3TNSA 1CQQA 1NT1A 1O2LA 3LPRA 2J94A 3KIDU 1SGQE 1V2LT 3BTEE 2KZ4A 1NU7B 5EQQA 3A7ZA 3GS9A 3UB0A 1L2EA 1ZRKA 2H6MA 3QDZB 3SJKA 1SVPA 4IS5A 5C5OA 4FUCA 1RFNA 3RXFA 4X1NU 1MTWA 5L2ZH 1IQIA 1NFXA 1UVSH 3BTKE 3GCTG 3KGPA 1L4ZA 1V3XA 1ZMNA 1CT4E 3E16B 4Q7XA 1V2ST 4WWYA 3LGUA 2EEKA 2XOKD 4KTCA 4XBDA 1ESTA 1P2MA 2A4OA 1BRAA 1Z6EA 2FX6A 1W8BH 5LGOA 1A61H 2A5IA 2Y7ZA 3PTNA 5LPFA 2ZF0H 1GJ6A 1ZHRA 1P2KA 4ZMAH 4UFGH 3ZZCA 4ABEA 1W13U 2OP9A 1C5QA 3ATKA 3KQDA 2ZCKP 1A3BH 3U69H 2TGAA 1HJAC 2BOHB 1CGHA 1JXPA 2QC2A 1SGPE 3UNSA 1NRPH 2F9UA 1J16A 3W94A 1MTNC 1UJ1A 3GOVB 1RIWB 3NZIA 2M5TA 3MNSA 2OC8A 3QWCH 1DFPA 1O3HA 1HAPH 4AGKA 4ZUHA 1Q31A 3OEHD 1FIZA 5I46H 2YMSD 5CHAC 3SHCH 1BRBE 1V2UT 4M9FA 2BLVA 3M5LA 1CU1A 4ISOA 4XRNA 3ZZDA 1AUJA 2J34A 1LPGB 1QB6A 1O32A 1SQAA 3T2NA 2BLQA 4I86A 4X0WU 3P17H 2BB4A 3BTDE 4H42U 2QXJA 4JK5A 1ESBA 1LTOA 2ULLA 3UAIC 1FONA 2BD4A 2Z3CA 3DT0H 3H5CB 1AKSB 2ZQ1A 1E1RD 1ESAA 1C1TA 3PMJA 5EW1H 1JOUB 3SJ9A 1G30B 2F4LA 3F0PA 1EQ9A 3UPEA 4Q2KA 4X6NA 5I25A 1SGFG 2KX4A 3ZVDA 4ASUD 1O3DA 1QFKH 1KSNA 2Z9IA 1DLEA 1OP0A 2HVYB 8GCHF 1LHFH 3A7XA 3A7VA 1O33A 3ATWA 1O5FH 2KAIA 1WTHD 4MNXA 1MKXK 4JYVH 4ABFA 1OHHD 1KXBA 2ZDAH 5EQRA 1TALA 4GAWA 3F1SB 1ZMJA 2C4FH 4CR5A 1EJAA 2A32A 1G3CA 1P2JA 1OWIA 5C0TA 3URCA 2QXIA 1C2DA 1TPOA 1ELFA 2ILNA 3MQKC 3NWUA 4ISLA 4ABJA 1TMUH 1QNJA 3VGCC 1FPCH 3BIUH 2F9PA 4UFDH 1MKWK 1SOTA 1MABB 3RUOA 1HDTH 1W0KD 1PYTC 3VG8A 5ESTE 3M36A 1OKXA 1C5WB 3B9FH 1GI2A 2GCHG 1TBZH 4OM9A 1O2ZA 4B2AA 3SN8A 1RD3B 1EX3A 3PMBB 2PW8H 1CE5A 3LU9B 1E1QD 3LGWA 2G4TA 5T3HA 3T5FH 4NZQA 3ZZ9A 3EQ0H 3PROA 4HGCA 4ZKSU 1S84A 2JKHA 2WSSD 4YLQH 3ZVAA 2FX4A 1DS2E 1N8OC 2R0KA 1T8OA 1AE5A 3T25A 2GP9B 4RN6A 1FY8E 5C94A 2GJGA 2BD5A 1JWTA 2QN5T 5E0HA 4WJG2 1NRQH 5C5NA 3QX5H 4KTSA 2H5CA 1D4PB 1P3EA 3NRLA 4I32A 3F9GA 2ZDLA 3RU4T 3P8GA 5EXLA 4Z6AH 5J4QA 1H9HE 2UWPA 4NFFA 1K1JA 1OYTH 2F91A 4MPVA 5EXMA 2JH5D 2TGPZ 5KECA 1FQ3A 1YLDA 3DSPA 3A83A 1S81A 1EPTA 4CREA 1H8ED 2BD7A 1BRCE 1MD7A 1NFYA 5BRRE 4XE4A 3D23A 3FP8E 1ELAA 1NRSH 1BTYA 4ZH8A 3A87A 1FN6A 3BV9B 1NFUA 4IBLH 2ZHDA 1HIAA 1NY22 2Q6DA 4F48B 4ISNA 5DP6A 3TK5A 1TNJA 1VKYA 4Y6DA 4X2YA 1K21H 1MD8A 1TAWA 3ZZ3A 2YNBA 1GBLA 2EC9H 4K2YA 3RXAA 2QYIA 1DY9A 3T26A 1H4WA 1F0SA 5DP9A 1EZXC 3LC5A 4XOJA 2XXLA 1YPJH 2FP7B 3SU3A 1YY3A 2RFKC 3SV8A 2J97A 3RXSA 3MTYA 2O8LA 1INCA 2SGFE 3LJJA 3GDSA 1K1MA 1UMAH 2B7DH 5EQSA 2A1DB 4HFPB 3LGIA 2BDGA 1SFIA 1Y59T 2J4IA 1O3NA 1QRXA 2YNAA 2HLDD 1SC8U 5F03A 4X1SU 1FAKH 1BHXF 4IGDA 4CRDA 2F9BH 3LIWA 3O8DA 4TWWA 2FYQA 1K1OA 2NWNA 3GCHB 4AG1A 1RTLA 1GHAG 1MUEB 1XVMA 1K2I1 1JIMA 2BDBA 2J98A 1SI5H 5HM2A 3S7KB 3A7YA 1SOZA 4HTCH 3FFGA 2JETC 1O2SA 1O2KA 2WPJS 1GMHG 1RGQA 1EKBB 3Q00A 3SU0A 1C1OA 2F9VA 1ZSKA 2V6NA 2XCNA 1WOFA 1VITF 1CBWB 1OWJA 3SHAH 3L6PA 3FOAA 4GPGA 1BIOA 5JB8S 1GHVH 1P2QA 5GNDA 2NU2E 3BEUA 2VBCA 3OX7U 4JCNA 3FZDA 1IOEA 2DE8A 1BMFD 2BDIA 3ZV8A 2ZTZA 3UY9A 3WY8A 2YMSC 3RXDA 3O8CA 1O3OA 4YT7H 5LPEA 1MQ5A 3T29A 2HNTC 1ABJH 1HBTH 4FETA 1O2YA 1ZGVA 3EA7A 2ZGCA 1OWHA 4LK4A 1LMWB 1DUAA 3UOUA 1WYKA 2GGVB 3SO3A 2B9LA 1GBIA 1S0QA 1TWXB 1Y3VA 2GT8A 2FM2A 2R3YA 3GDVA 1AN1E 3PB1E 3PM3A 2FI3E 4BAOB 2B0FA 1HAVA 1UVPA 2Q6FA 3TJVA 2FOEA
chains in the Genus database with same CATH topology
1PQ5A 2P8OB 3ATMA 2BQWB 1SFQB 3AW0A 1TOMH 1YBWA 1SLUB 1GI7B 1G32B 1EXFA 1FAXA 1OP8A 1SHYA 4YTAA 3BSQA 1KXFA 1C2MA 5PTPA 4YM9A 3E91A 4HI3A 2ZFSA 1NTPA 1L1NA 1PPFE 1SGIB 3SV2H 3IG6B 2J38A 3ELAH 1A4WH 4I7YH 1Y8TA 4LZ4B 4I8KA 1LVBA 1WV7H 1XKAC 1A2CH 3UR6A 4O3TA 1GCDA 2RA3A 4OS7A 3V12A 1KTSB 2FOFA 1GJ9B 2ZHWH 1W10U 1ZPBA 5C67A 1FXYA 3OSYA 2O9QA 1EZSC 1O3PB 1O2WA 1YPEH 1SLVB 3F9FA 1EATA 1O3BA 1GI4A 3M7TA 2PKAA 1UHBB 3RLWH 2VVVA 2DUCA 1FY5A 1O3EA 4NWKA 1ZR0A 1AI8H 2VIOA 3U1JB 1ETRH 1GCTC 1TBQH 4J1YA 2FDAA 1TMBH 2STAE 4OS4A 1P8VC 4WXIA 1XUFA 2HNTF 4XDEA 4A1TA 4X2VA 4AB9A 3P95A 1DPOA 1AO5A 4X2XA 2HPPH 6CHAB 2XTTB 1YPLH 1GVLA 5FHTA 1C5YB 1QURH 1UTMA 1YPKH 4CRBA 1TX6A 3LJOA 1ZTJA 3GICB 2ANWA 2GMTB 1F2SE 3ENSB 3PYHA 4U01A 1ZPCA 1UTJA 4BNRA 2BD2A 4MPUA 1V2OT 3E1XB 1Y3UA 3ZVGA 1T7CA 1UK4A 1T32A 3U9AH 1C5TA 2G00A 1C4V2 4TPIZ 1Z8IB 1GJ7B 1D3QB 3RXBA 2LPRA 1C2FA 2BDAA 3MO3A 2WYJA 4O3UA 2XCFA 1IQLA 4I8JA 4K60A 1G3DA 2PSXA 1Y5AT 5FAHA 4R8TB 4B76A 5E2PA 2FZZA 4ABIA 1EUFA 3RXVA 4ZHMU 1GBMA 1W11U 1YPMH 3Q3YA 2P3UB 1ELDE 1DLKB 2WPIS 4A92A 1OSSA 4A5TS 2PFEA 1Y3YA 5DP7A 3TK6A 1SGDE 1BDAA 1DT2A 4F49A 1Z71A 4D9RA 2GCTC 1MTVA 3RP2A 3RC4A 3MNCA 2G52A 2NU4E 1X7AC 1YCPK 3SZNA 2FOBA 4CHAC 3TGJE 1UVTH 1EZQA 3SI3H 4DG4A 4DW2U 4Y79A 4Y71A 1BA8B 1FDPA 1ZZZA 3B23B 2HWLB 2R0LA 1P0SH 2F3CE 5IYTA 4O03A 1UTKA 3RU4E 1AVXA 2GKVE 1C5RA 4FU9A 1WSSH 3BTFE 2C8YB 2O8WA 2BZ6H 5T6GA 5FBEA 6GCHF 1D3DB 4DY7B 3Q3KA 2AS9A 2K1QA 3MH4A 1NPMA 1UTNA 1ZSLA 5K0HA 5FCRA 1GGDC 2BDCA 8GCHG 1D6RA 2P3FH 2UWLA 3MHWU 3GY3A 3AAUA 1KIGH 2QF0A 4AFQA 2QCYA 3HKIB 1GL1A 1CT0E 4FUDA 1MKXH 5CMXH 5AFYH 1AFQB 4LXBH 3MH5A 2BX4A 1O37A 2BHGA 1P9SA 1TGBA 3GY7A 5JYIA 5T6DA 1GHZA 2CHAC 4KKDA 1HLTH 4K3JA 1UVUH 4NIWA 1EJNA 4K1TA 3A7TA 3HK3B 1YGCH 4FUGA 2GX4A 1VJ9U 2ZU4A 2ZFTA 4H6TA 2J92A 2PGBB 4ISHH 4GHQA 1KY9A 3RXKA 3B8JA 3V13A 9ESTA 1L4DA 1E35B 1NRNH 4DIHH 1WCZA 1MKWH 4AYVB 2AERH 1HRTH 1T8LA 4AFZA 4VGCB 1P04A 2ZTXA 4FXGH 1LPKB 1EASA 5A8ZA 1C9TA 1HB0B 1AUTC 2ZKSA 3SW2B 3S69A 5GWZA 2A5AA 4GUXA 2FPZA 1O3GA 3W95A 1RTKA 3GY2A 5ETXA 1E36B 1F0UA 1O2UA 5FPTA 1AQ7A 2WV4A 1Z8GA 2W7SA 3VXEH 4B2CA 2QGRA 1KXEA 3SU6A 1GI3A 1EAXA 2JH0D 3RXQA 4FU8A 3HKJB 1W2KH 1IQJA 1TPAE 1J17T 3ITIA 5FX5A 7GCHG 2RDLA 2VGCB 3HPTB 2Z9LA 4IW4E 3QO6A 4DVAU 1AB9C 4KP0A 1GBKA 2FODA 2SGPE 2OQ5A 3F6UH 1O5EH 2FESH 1UK3A 4NIYA 1LKBA 1TB6H 3U8OH 2P94A 3ZYEA 5L30H 3S9CA 1W7GH 1ANCA 2BXUH 1HAYB 4DGJA 3P6ZB 1O2TA 2SFAA 3STIA 4CBOA 3BEFB 5JBTA 2H9EH 1MU6B 2PR3A 4ABHA 2XBVA 2A4QA 3RDZA 4AB8A 2F9NA 1J9CH 5GPIB 1GBEA 2F9OA 2C8ZB 2HNTE 3UWJH 1OXGA 1SHHB 5GXPA 3SGBE 2Z3DA 4GCHF 1HFDA 1TOCB 2H9HA 2EA3A 3FZZA 3TPIZ 1G2MA 1O2VA 2G81E 4MPWA 2W26A 5FBIA 3NK8A 1GJAB 2R2MB 1S6HA 1SGFA 1UTQA 2VVUA 1HJ8A 3FP7E 1MAYA 3HGPA 3MWIU 2O8MA 3QTOH 2VIPA 4K1SA 1MZDA 2ZDVH 4AG2A 1XMNB 1GBBA 1GDQA 4WMEA 3BG4C 1G9IE 1DWBH 2QAAA 3RMNH 1T4UH 1QHRB 1GG6B 2F83A 5HGGA 4UDWH 4ISIH 7LPRA 2GT7A 3QGJA 3ZVCA 1UK2A 1FMGA 2G5VA 1MBQA 2AGGX 1CA0B 3TH4H 1D9IA 4K8YA 1O2QA 2ODQA 2Z9GA 2O8TA 2JH6D 2BVSH 3ZZ6A 2PHBA 1GBHA 3SU2A 2HRVA 2Y82A 1C5MD 1THSH 1GDUA 2LNCA 2VJ1A 2OQUA 3Q3XA 1ELTA 3ZYDA 1T8MA 3SV9A 3OTJE 3D65E 3ZZAA 2CJIA 5EOKA 1GHBF 5A8YA 2QIQA 3RXJA 1G2LA 4X8SH 5GCHF 1YM0A 1T31A 2HOBA 7ESTE 3MNBA 1TABE 3GISB 2BY6X 4NCYA 2OTVA 1KDQB 4FUHA 4CR9A 1V2KT 2FOGA 4XSKU 3RM2H 1IHSH 3A82A 1F0TA 2XBXA 1THPB 5DGJA 1HXEH 3O8RA 1P02A 5SGAE 1OS8A 1S5SA 4I8LA 3PLBA 4ESTE 2Z6BD 5AF9H 1BTWA 5DP8A 1BTZA 2TBSA 4ZROA 1H8IH 3M35A 1W14U 1ELGA 1Y3XA 3MU8A 1HJAB 3LH3A 1F5KU 4CRAA 2PKSC 2P95A 3EGKH 1MTSA 3TJNA 1LKAA 1YPHC 3V0XA 1H1BA 1TRYA 1MTNB 3GY5A 4JZIA 5DP5A 3VB7A 3F9EA 3SJ8A 1KLIH 5TCCA 1G3EA 1PPZA 1K1NA 1BITA 3GY8A 3MU4A 4MPXA 3VB4A 3JZ1B 5CHAB 1VZQH 1H9LB 3IWMA 2BM2A 1PPBH 3GYMA 2QY0B 1GMCF 2Y7XA 1AVWA 2H1UA 1O38A 1BOQA 2VWNA 2BQ7B 8LPRA 2H9TH 1DXWA 4JZFH 1KXDA 3SGAE 4D9QA 2TRMA 4WY3A 1SSXA 4UD9H 2PUXB 4BXWA 4QT8C 1QTFA 1DX5M 1NO9H 2UUFB 2ANKH 2A4GA 1GMDG 1LQDB 2ASUB 2BTCE 2C90B 2GZ7A 3BTHE 1TLDA 1EZUC 4YOIA 2W7UA 2HPQH 2PTCE 1C5XB 5F8XA 1BMLA 1DSTA 2VWOA 8ESTE 3RMMH 3PWCA 2BOKA 3E8LA 3TJOA 2XW9A 3NPSA 1C2EA 2R9PA 1E0FD 1V2PT 3KF2A 2ZO3H 1IQFA 1O2XA 3QZQA 3TGKE 4X8UH 1GBFA 3FVFB 1YYY1 1KXAA 1BMNH 1EOLA 2OXSA 3SGQE 5JBCS 2PTNA 3RXCA 3SUEA 1TRNA 2OC0A 1FPHH 2PSYA 4UEHH 4JYTA 4WH6A 3SUFA 1O30A 1KLJH 1LVOA 3A81A 3PO1C 1A46H 1ORFA 1C4Y2 3AASA 5DJ7A 1TNKA 2FTLE 1J8AA 2RG3A 1ARCA 2IN2A 3VGCB 1TNIA 4X1PU 1L1GA 4YT6H 3S9BA 2V35A 5EGMA 2ZI2H 3QGNB 1O31A 4UFFH 3HGNA 1UCYH 2TIOA 2OC1A 4Y8XA 2VIQA 2ZPRA 4FU7A 3KEEA 2O8UA 4GSOA 2ZNKH 1XXFA 1DVAH 1S83A 2VWLA 4Y0ZE 4MTBA 1V2TT 1AZZA 1BJUA 5A0BA 1VJAU 4BAMB 2W3KA 4JZEH 3RMOH 4RKOB 2VINA 1XVOA 2BQ6B 2OLGA 4JMYA 1SLWB 3ZVEA 5JPMH 1P9UA 3SQHE 1V2QT 4OS6A 2HLCA 3S9AA 3DD2H 1W0ZU 4A1XA 4M7GA 2VIVA 1HAGE 1QA7A 4JK6A 1N8OB 5EPYA 1D3PB 1QCPA 2OBOA 3NUMA 3T27A 4Y7BA 4UE7H 3SQEE 1BHXB 3MH7A 4OS1A 2ZZUH 1M9UA 4WXVA 1F5RA 4I31A 2Y81A 3SV6A 1JRTA 1C1MA 3CS7A 4YLUA 1EPTC 4Y11E 1HYLA 5AVDA 1L1JA 1BTXA 2WUBA 4PROA 1ZHMA 3SUDA 3MFJA 1N6YA 3GCOA 1QL7A 3KQCA 2GZ9A 4U32A 4AFUA 3LONA 2A0QB 5BPEA 2FS8A 1YCPH 1NROH 3RXLA 2FEQH 1NESE 2GCHF 4DT7B 4IN2A 4R0IA 4SGBE 5HYOA 4AORA 4AFSA 3UIRA 1NZQH 4J2YB 4MG3A 5AFZH 2VIWA 1CHGA 2QXHA 4BAKB 1T4VH 1Q2WA 1YF4A 1F7ZA 2ZGJA 6GCHG 3MOCA 2WPLS 4IC5A 2FO9A 1O5DH 2Z7FE 2ZPQA 3SJIA 2ZCHP 2ZECA 1O3KA 2ODPA 3H7OA 1AU8A 1C1UH 1GBCA 2G4UA 2BZAA 4B2BA 3EA8A 3M5NA 1GBTA 2UWOA 3HATH 1HAHH 1EB2A 2P59A 2HVXA 3VB3A 2BD9A 1GI8B 1O5CB 4Y10E 1DE7H 5K7RA 4FUBA 3V7TA 1ZLRA 1QBOA 3GY6A 2H5DA 1DOJA 1Z1IA 4A7IB 1QGFA 1EAWA 1O34A 1AHTH 3TJUA 3K9XB 3K6ZA 3A8BA 4YOGA 2FIRH 1JBUH 3M5MA 4ABBA 1QRZA 1QB1A 1T8NA 1ELEE 1ELCA 1BRUP 2DE9A 4ZAEA 2AMDA 1GI0A 2ZC9H 1O3IA 4JZ1A 1OOKB 1IHTH 5C2ZA 1V2WT 4INKA 3BIVH 3I77A 2HALA 1C2LA 1FY1A 1P2OA 3A8AA 2CF9H 4OGYA 3M7QA 2VH6A 1QIXB 3M3VA 1ZOMA 3EAJA 1YP9A 2JETB 3A89A 1XUHA 3FAOA 2QXGA 1O3FA 1YLCA 3K65B 1Y5UT 2TGTA 3QZRA 1SL3A 4YOJA 3RXTA 1ELVA 3PTBA 5DK1A 2H2ZA 2BD3A 3SNDA 4AYYB 2ALPA 3T28A 3ZZ7A 4OGXA 1O3AA 1C2HA 1LDTT 2XC5A 1C5SA 2FOCA 2ZP0H 4DOQA 1C1WH 3LT3A 3UUZA 4FVDA 1P03A 1AKSA 5E0JA 1AIXH 1GJBB 1NS3A 1U6QA 1RTFB 3STJA 2A5KA 2XBYA 2Y5GA 1ZPZA 1SGTA 2XC0A 4IMZA 3ZZ5A 3BTME 1SBWA 1QL8A 2Z9JA 1GI5A 1FN8A 3PLKA 1SGCA 3JZ2B 1QRWA 1BTHH 3LKWA 2PLXA 3DUXH 5C1YA 4DURA 1NU9A 2XNIA 3CS0A 1FJSA 3BTQE 1SQOA 4MNVA 1VGCC 2WPMS 1ZRBA 4YZUA 4FUEA 1YPHE 3DHKH 1FUJA 2NU3E 4NZLA 5L6NH 4MDSA 4E7NA 2STBE 2EI7A 1GMHF 1C1SA 2SGAA 1P11E 1BT7A 3R0FA 4NIVA 5TCAA 3L3TA 3A84A 2BLOA 3MYWA 1NC6A 3A86A 3I29A 2VU8E 4WVPE 4O9VA 1Q3XA 3E0NB 1FV9A 1C5ZB 1KDQA 1GVKB 5FCKA 4Y7AA 3QLPH 1O36A 1QY6A 3AAVA 2BYAX 3SNAA 2FOHA 5C3NA 1FLEE 3UOPA 3BN9A 4ZXYH 1P09A 2R2WU 1SR5C 5HMAA 1ANDA 4MVNA 1V2VT 3A85A 1EAIA 1TA6A 1C2GA 3E3TA 1GWAA 3QTVH 3RXEA 1PFXC 1OYQA 5JBAS 1O39A 3UWIA 2ZDMA 1TX8A 1RIWC 1F5LA 3LC3A 3RM0H 3M7UA 2FLBH 1C2KA 2EI6A 1NRRH 1HUTH 3KN2A 4NA7A 1JRSA 1Z7KA 1D3TB 1O5GH 1GHBG 5FX6A 3SUGA 3H7TA 4D7FA 1CT2E 1NFWA 3BTWE 3D49H 1GCTB 3ZVBA 4GLYA 2TPIZ 1CHOF 3TGIE 4Q7YA 2GTBA 1AMHA 1TIOA 4GVUA 3LDXH 2PV9B 5AHGH 2VIDA 5A0AE 2CXVA 1GBJA 2CN0H 3UTUH 4ZKOU 3M3TA 1FNIA 1V2JT 1QQ4A 1F0RA 1LVMA 3SNEA 1QJ7B 1QJ6B 3A7WA 5JB9S 1UVOA 2GDDA 2BX3A 4I33A 4B75A 1C5UA 1GJ4H 1G36A 1TNLA 2D1JA 2ZWLH 1Y3WA 1ACBE 3K6YA 1O3LA 1K9OE 1BUIA 2Y5HA 3GYLB 2D2DA 3EYDA 4ABDA 1P2IA 3Q76A 4YO9A 4BTUB 2BDHA 2BY8X 4D76A 1C4U2 1HPGA 2ALVA 1EP5A 3EE0B 4NSVA 1DWEH 1HAVB 2ZU3A 3E0PB 1V2RT 3ATIA 3QK1A 3U1IB 3UFAA 5JBBS 4K5ZA 3RXRA 4RSPA 5DP4A 5L2YH 3K2UA 1VCQA 4IC6A 3RXHA 1GMCG 1WBGB 3O8BA 1O3MA 4MQAA 1B0EA 1B0FA 2GCTB 3ZVFA 1Z8JB 1ZMLA 2ZU2A 4CRFA 1XUGA 1C5OH 1EP6A 1DXPA 1GDNA 3NXPA 2ZCLP 1O2JA 1V2NT 3LGYA 1Z8RA 2UUKB 2FYRA 2OUAA 1Z1JA 1SPJA 5DP3A 4CHAB 4ZHLU 2ANYA 3PMAB 1SGRE 3S0NA 2SGDE 2Q1JA 2ZTYA 1QQUA 5C20A 3EDXB 2ZQ2A 1ARBA 4Y8YA 1BCUH 1YPGH 3VFEA 1SQTA 1GBDA 3MU5A 4MNYA 2ZU5A 1ANEA 1O3JA 1DITH 1AWHB 2IPHA 1A5GH 1VCWA 4DJZB 3QUM