2BD4A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and lys-ser at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd4A01
1L2EA 3M37A 1T31A 1ACBE 3UR6A 1P3EA 2EA3A 1QR3E 1QRXA 2ZZUH 1C1RA 5H4IB 1C2KA 1ZJKA 5BPEA 1KXAA 2V3OH 2FESH 4X2WA 4CRFA 2G55A 4H4FA 4NWLA 3GY7A 4K3JA 1GI6A 1UTQA 2HOBA 5A0BA 1C2IA 1FLEE 3A89A 1JMOH 3ZV9A 5FCKA 1HAVB 1PPZA 1J17T 2QF3A 1NU7B 3Q00A 3FZDA 3MI4A 2OP9A 4E7NA 1A3BH 1WU1A 4AG2A 1NTPA 2ZGCA 1C5RA 1DFPA 1ZMNA 3DFLA 5FCRA 5EW1H 1V2JT 1QQUA 5EGMA 1VCQA 4NCYA 1QBVH 4LK4A 1C5XB 5JB9S 2VINA 2ULLA 2VH0A 3LT3A 2FDAA 3UY9A 1DLKB 2FOCA 4KTUA 1RTKA 3S0NA 1V2NT 5EXMA 5TCAA 3IG6B 4AB9A 1C5NH 1AN1E 4WMEA 3PTNA 3F9EA 1SQAA 2XBWA 1TNIA 3BIVH 1ZPZA 2HRVA 8GCHG 1TAWA 5C3NA 1D4PB 1MTVA 5E2PA 1J8AA 3KNXA 1AQ7A 1BRAA 1RIWC 4GCHF 1O2QA 2A7CA 4UFEH 2BVRH 4JZEH 1HAZB 3P92A 1KXDA 1BHXF 2AMDA 4XBCA 1TX7A 1F0RA 3E90B 1HAPH 5C1XA 2RG3A 1O3FA 1LTOA 1TOCB 3SNCA 3QTVH 4I33A 1OPHB 1FDPA 1GBIA 1SBWA 2WPJS 2ZCHP 1TRNA 2Y5GA 4J2YB 3LIWA 1W7GH 4ZHLU 2FI3E 1LHFH 2K1QA 2FWWA 3BTQE 3A84A 2ZFQH 4CHAC 2P8OC 2FEQH 2C3SA 2J38A 4MPXA 5FPSA 2W7UA 5K0HA 5E0JA 1O2SA 1MQ5A 1C2JA 3RMLH 4FUIA 1FONA 5DO4H 1GMDG 1YP9A 1GBTA 1PPEE 2W5EA 3K6YA 4DT7B 1QIXB 1S6HA 1VJAU 3GDVA 2FMJA 2V3HH 4GHQA 1AUTC 2QXIA 1P2IA 1SHYA 3BG4C 3EYDA 1D3PB 4Q7ZA 4ABJA 5IDKA 1ARBA 1O5GH 2OC8A 3GYLB 4ABGA 1O2JA 2FOEA 3TLOA 3RMOH 2GCTB 1BUIA 4Q7YA 3UNSA 1ZLRA 3F1SB 2WINI 1TNGA 1O3DA 3BTHE 3BSQA 2TGPZ 3GY3A 2ZU4A 4HTCH 1TGCA 4X1SU 4YZUA 1LKAA 3UQOA 4U01A 4INLA 1Z7KA 2B7DH 4NFFA 1DX5M 4MNVA 4THNH 1HGTH 1PQAA 2RDLA 5F03A 5C67A 5DP6A 1YPHE 1O2OA 4NA7A 2AIQA 4Y0YE 1KXBA 1SGTA 2PKAB 1GBBA 3QK1A 3V13A 1YKTA 7LPRA 2G00A 1OWHA 4ESTE 1O2GH 2R3UA 1LVBA 1ZRBA 1V2OT 3C1KA 1AD8H 1KIGH 1SLVB 2ESTE 3SV2H 1CVWH 3MNSA 1FY5A 3BTKE 3N7OA 1S84A 1ZRKA 2ZHQH 1MTNC 3MHWU 2ZNKH 1C5TA 4IMQA 3SGBE 1GBAA 1JWTA 3QTOH 3RXGA 2Q6FA 1O2HA 2ZFPH 2VVVA 1GHBG 1UVSH 4OS2A 1O2YA 1K9OE 1BBRH 4UDWH 2BVXH 3TVJB 2J4IA 1BJUA 3DT0H 1MD8A 4A7IB 1EB2A 3M5LA 4ABBA 1C1WH 4BTIB 4MNYA 5CE1A 2ZEBA 3F9FA 2ZPRA 1HAYB 2VWMA 1W8BH 3PB1E 5GPIB 1DE7H 2A7HA 1WCZA 1BRCE 1RIWB 1ZPCA 1ETSH 1LPGB 1ZHMA 1Y3VA 4B73A 5JBAS 1ABJH 3LOXA 1SQTA 1PQ5A 1V2ST 4Y8ZA 3GY6A 3SHCH 3UOPA 1EASA 3M5OA 2ZECA 1XVMA 4ABDA 3U8TH 1RXPA 1YYY1 1T32A 2FIRH 3SU2A 2QGRA 1F0TA 1D3TB 5A0CA 4B71A 4ABAA 5EQSA 1O5FH 1Q3XA 1J15A 1TPPA 3T26A 2H2ZA 2SGEE 1G3CA 1GBFA 3SU6A 4D7GA 1DY8A 4GVUA 4YT7H 1HXFH 3S9BA 3GCHC 5IYTA 1WUNH 1JIMA 1KSNA 1YCPM 1C5QA 4CHAB 1BZXE 5EXLA 2F9NA 2A5AA 1O33A 2ZFSA 3P6ZB 2BX3A 2J34A 4BOHA 1MMJN 1O2PA 1HXEH 3OSYA 2AERH 5EW2H 1CT0E 2BD3A 4BAHB 1G30B 4TY6A 2FLRH 3T62A 1CE5A 4NZQA 4KELA 3TGJE 1FIZA 3GCTG 3CENA 3F68H 1BITA 2IN2A 2ZKSA 4JZFH 1AY6H 4ABFA 1B0EA 2CV3A 4B75A 3BG4B 4U32A 3HPTB 3RXCA 1MCTA 2DE8A 4B76A 1CBWC 3RXFA 2IOTA 3OY6U 1PPCE 1PQ7A 1O0DH 3E91A 2FOMB 1K1NA 3PMAB 3SU1A 1O3BA 1SGFA 2WPKS 4E06H 5T3HA 4NWKA 1O5BB 1O5DH 3H5CB 5CHAC 3LC5A 2A1DB 1SFIA 2GTBA 4LZ1H 4WF8A 4U2WA 1ZMLA 4WMDA 1HAOH 2FOFA 4MG3A 3BEFB 1IQGA 2ZPQA 3ODFA 3B23B 1S0QA 1AWFH 1W3CA 3RC4A 4X6NA 1Z71A 3SJ9A 2BLOA 1P2KA 3PM3A 1AGJA 4Y79A 3M3TA 4DOQA 1ORFA 2OC7A 4NSVA 1FPCH 1O5AB 1TGNA 1IQIA 2AGEX 3T2NA 3P17H 3RM0H 1DXPA 1GPZA 2YOLA 5DPAA 4YTAA 1SLUB 2ZCLP 3ZZ9A 1UTJA 1DVAH 4D9QA 1C2EA 3ZVBA 2J9NA 2AH4X 1VR1H 2BDIA 5FX6A 2NU3E 1HAGE 3TGIE 3P8GA 2G5NA 1GMDF 2RCEA 4ISLA 1GHZA 4X8VH 1OWEA 4WH6A 4CBOA 1TX8A 1O2MA 4BTUB 2VNTA 2SGQE 3FP7E 1DUEA 3R0FA 3QZQA 1TWXB 1OWKA 1MTSA 4O9VA 2BDAA 3PO1C 3H7TA 1SSXA 1UVOA 1UTPA 3U9AH 2I6QA 5DK1A 4Y0ZE 2HPQH 4NIYA 5A0AE 1OXGA 1NS3A 2QXGA 1AE5A 2O9QA 1RFNA 3AVZA 2C93B 2PUXB 1UJ1A 1O37A 2PKSC 4FUGA 2CHAC 4U30A 3IWMA 4RKOB 1NRPH 4MVNA 3MO9A 1S83A 4IMZA 1DITH 1OWIA 1HV7A 3BV9B 1L4ZA 1FV9A 1S85A 1O2VA 2A4RA 2Z7FE 3BEUA 3O8BA 4SGAE 5B6OA 5I46H 4CH8B 2H6MA 3ZYDA 2R9PA 1GBDA 4GCHG 4AZ2B 1C5PA 3QO6A 2OD3B 1LHDH 2EI7A 4D76A 4ISNA 2BDYA 1J9CH 3A88A 3K2UA 1FAKH 3M5MA 1O5CB 4JZ1A 1QB1A 1TE0A 1ESBA 1A61H 1IAUA 1QY6A 4Y11E 2V35A 2EI6A 3GDSA 5FAHA 3I29A 2YNAA 1GVLA 1O2XA 5E8EH 5JBBS 1OYTH 2FOAA 2VJ1A 2Z94A 3EA8A 1EAUA 2ANKH 4F4OC 1L1NA 1G2MA 4RN6A 1B5GH 2C8WB 1HIAA 3LGYA 4XFQA 1ANCA 2SFAA 3GCHB 1AFEH 1TNKA 4A5TS 2ZO3H 1H8DH 1HJAB 1DWCH 1TOMH 3E8LA 1LPZB 1GI7B 2PW8H 4IC5A 3KGPA 3HKJB 2BY9X 4INHA 1SI5H 3P70B 5SGAE 3PMHB 3ZV8A 3M61U 3DD2H 1GBLA 1AWHB 4DVAU 3V12A 4DCDA 3V7TA 4RSPA 2G51A 1WTHD 4F49A 5FPYA 4CREA 3EA7A 4QT8C 1QFKH 5FPTA 5GXPA 1CBWB 2NU0E 2F9UA 3ZVFA 1O3LA 5E2OA 1XUIA 2BM2A 3NPSA 1DPOA 3SNAA 1FN6A 4H42U 2FOHA 3BTDE 4MPWA 4ZXXH 1EP6A 3A82A 1C1SA 3GYMA 2Q6GA 1GG6B 1O3AA 3RU4E 2ANWA 1J14A 4VGCB 1MU8B 2QAAA 1THSH 3QN7A 1HIAB 1LQEA 3U1JB 2BYAX 5I25A 3U8RH 2ZGXH 2XNIA 3PV4A 2PV9B 1O2ZA 3A85A 1C1MA 1B7XB 1A46H 1WBGB 3BTGE 3E0PB 2BLVA 3RXDA 5FXLA 3KQDA 1EOLA 3RXAA 1P10A 1ZTKA 3A87A 1C4U2 3O8DA 4FUHA 1EZQA 2UWPA 2A4OA 4FUFA 1O3IA 4WXVA 1O2RA 3VEQB 1AVWA 3LPRA 2O8WA 2F83A 4X8TH 1ZMJA 5EPYA 4BANB 1KY9A 2A5KA 2P59A 3NKKA 4LZ4B 1H9LB 5EQRA 1F0SA 3L33A 2VIVA 4X6MA 1HPGA 4AYYB 2B0FA 3ATIA 3A8AA 3PO1B 1TRYA 4H6TA 1C5UA 1AUJA 4KKDA 2GCTC 1WQSA 3SGAE 1G9IE 2R2MB 1JRSA 2OQUA 1P04A 3URCA 1BTPA 3RXBA 5A8ZA 1ZHRA 5E0HA 1JXPA 1NU9A 1QRZA 1THPB 1Y8TA 1UK3A 1NRRH 3NCLA 3RC6A 4BXWA 3FZZA 1OS8A 1P0SH 2CHAB 1Q2WA 3U98H 1ZGVA 1RJXB 3UTUH 2GV6A 1ARCA 3EQ0H 2ZPSA 2ZU5A 1A5HA 2D8WA 2FPZA 3PROA 1DSUA 1AO5A 4TWYA 2G4UA 3LH1A 1FN8A 1WSSH 3LONA 5JPMH 1O3CA 3GOVB 4MPVA 1E0FD 1NN6A 2IJOB 4I7YH 3RC5A 4NG9H 3NUMA 1BIOA 1MAYA 2NU2E 3MO3A 4ZHMU 2XCNA 4K1SA 4DGJA 2TGTA 4AG1A 2BD8A 2ZGHA 3VXEH 3NK8A 3RUOA 2GDEH 4DIIH 1TBQH 1K28D 3MYWA 5G4BA 1PYTC 3SU4A 3HK6B 2KAIA 9LPRA 1SGRE 1CT4E 3RXKA 1Z8GA 1LO6A 2SGPE 3GY2A 1D3QB 1K1LA 2JH5D 1KTTB 1O2WA 2QYIA 2XWBI 3UWJH 1F5RA 3BG8A 4X1NU 1JOUB 2Z9LA 2FS8A 4MPUA 3C27B 2GKVE 2B5TB 3RXLA 4FU7A 2PSYA 3ZZBA 1BMNH 3E6PH 1XKBC 1MH0A 3UR9A 4CRBA 1QURH 3DUXH 1H9IE 1ZSKA 1FY4A 1GJBB 1YC0A 4UFFH 2C8YB 3Q77A 1KYNA 1W10U 1P09A 1B0FA 2SNVA 2QA9E 3EAJA 1K1PA 2O8MA 3MFJA 4ABHA 4FU9A 1DLEA 1MBQA 1T4UH 1NPMA 2FXRA 3UQVA 1AB9B 3FFGA 3L6PA 2YNBA 3TJNA 1GI4A 1QA7A 1C1QA 4OS1A 1P2NA 1QRWA 2ZIQH 1Y5UT 1GI0A 3MU8A 2OC0A 3G01A 5FBEA 1O3JA 4ZUHA 2VU8E 3A7VA 2QV1A 1KLTA 3TJUA 1IQJA 1UTNA 3RLYH 3E1XB 2LNCA 2BMGB 3S9AA 4X8UH 1HNEE 3MNCA 2ZFTA 4D8NA 1QL7A 2VVUA 5AFZH 1HUTH 1HFDA 1BOQA 1MQ6A 4KTSA 3ZZ7A 1NC6A 1QA0A 1FJSA 1UVUH 2BVSH 4K1TA 2ZC9H 1O3EA 4CR9A 3PLPA 4AORA 2XCFA 2FP7B 4FUBA 2ZDMA 3VB5A 1F0UA 1BBRK 2XRCA 5FBIA 1K2I1 3D49H 1LHGH 1AKSA 5ABWA 1K22H 1GBCA 4YESB 1GVKB 4Y8XA 5AFYH 2W3IA 3A7YA 1MUEB 1TQ7B 4FUCA 1TONA 1YLDA 8KME2 3RXPA 5FHTA 2H9TH 4IC6A 1QB6A 1GI5A 2EC9H 2VIWA 1MKWH 2V6NA 1SLXB 1CU1A 1XUFA 3QDZB 4WMFA 1T8LA 1N8OB 2SGFE 5DP7A 1P2QA 2RA0A 1UHBA 3RXRA 2XBVA 4X0WU 1OWDA 1WQVH 2Z3DA 1ELCA 1A0JA 1GL0E 2FS9A 4YT6H 4BAQB 3KQCA 1V2UT 5L2ZH 1TQ0B 1DY9A 2VIQA 1G32B 4ZHAA 1ZSLA 1O3MA 4AFZA 1EQ9A 1VJ9U 1ZHPA 3A8BA 1SPJA 1K1MA 3EA9A 1V2QT 1GJ5H 5DP4A 1Y3XA 1ZYOA 3SORA 1C2LA 1TPAE 4DG4A 3RXVA 1FXYA 1TABE 4B74A 2ODYB 1FPHH 1HB0B 1FY8E 1NM6A 1DXWA 2BXTH 1V2MT 4Z0KA 1XVOA 1KXEA 1IQEA 2D26C 3S7KB 3FANA 3MNXA 4MNWA 2OBQA 2G4TA 8ESTE 1T8OA 4ZXYH 1YPMH 2QC2A 3MTYA 1A0HB 2BTCE 3A81A 1FNIA 2BLWA 4DURA 3LGVA 2CMYA 1FMGA 1MZDA 5K7RA 1V2WT 1O36A 2C90B 2A5IA 1P01A 4X1PU 2ZHDA 1TGTA 2Q1JA 3I78A 4AGKA 1LDTT 2H1UA 3Q3YA 1ELTA 5LPRA 3NXPA 1IQMA 3A8DA 2D1JA 1P2OA 1MAXA 1OP8A 2GX4A 3SZNA 4Y7AA 2ZQ2A 3E16B 2XBXA 4Q80A 1YM0A 3AASA 3T28A 3VFEA 1O3NA 1W0YH 3HK3B 3SW2B 1BJVA 1P2MA 1EZSC 1MKXH 1EB1H 4NIXA 1GJ4H 3B9FH 4TPYA 3ZVCA 2G81E 1YCPH 1JIRA 3RXHA 1A1RA 2P94A 2F9PA 3U69H 4I8LA 1LHCH 1GBMA 1O3OA 4KGAA 3MU5A 1EAWA 1ZR0A 2AFQB 1INCA 3SU3A 1HJAC 1EPTA 3RXOA 3SQEE 2FOBA 1V2RT 1GBEA 4IW4E 1DSTA 2O8TA 5DKMA 4A1TA 2AIPA 4BNRA 1GGDB 3KQEA 2ZU2A 3MMGA 3EGKH 4XSKU 5EXNA 1GVZA 1V2LT 5F8ZA 4A6LA 1XUKA 1VITH 4FUJA 3SUFA 3TJOA 4O3TA 4AFQA 4AN7A 1Z1IA 1UCYH 4O03A 3GISB 4XDEA 2CXVA 3AAUA 2GMTC 1CHOG 3TJVA 3ATKA 1Z6JH 4RKJB 2SNWA 4MDSA 1UTKA 4I8GA 1P06A 1PPBH 4YLQH 3TH2H 5C1YA 7GCHF 1Y59T 1C5SA 2XC4A 2FX6A 1EP5A 1FY1A 3RXIA 1EXFA 1GG6C 3SQHE 4VGCC 1VCWA 1ZGIA 2XTTB 2ANMH 2A32A 1GBJA 3A83A 3ZVAA 1H8IH 1F7ZA 1TGSZ 1CGHA 1XXFA 3KF2A 4B2CA 1V2PT 1EPTB 2CN0H 2VGCB 3T5FH 3TK9A 1F5KU 3A7ZA 3UFAA 4MTBA 3A80A 3ZZ5A 3CS0A 3UNQA 1MTWA 1K1IA 1W14U 3M7TA 2VH6A 4JYUH 1GHXH 1C1OA 5C5NA 1SGDE 2VIOA 1RS0A 3QGJA 1LHEH 2BOKA 5A09A 1GI1A 3VB3A 1E36B 1LMWB 1VZQH 2UUFB 3BEIB 3D23A 1C5ZB 3SNDA 2CJIA 3UWIA 2GV7A 2FOGA 1GMCF 1E37B 1V2TT 3GY4A 2GZ9A 5J4QA 2HNTF 2ZFFH 2OLGA 2EEKA 1NFXA 2P3FH 1QHRB 1EJNA 2ZGJA 5J4SA 2WUBA 4LOYH 1OX1A 3A86A 1YPKH 1BCUH 1F2SE 3ATLA 4Y8YA 3MH5A 3PWBA 1IQLA 5LPFA 4K69A 3QGNB 1WAYB 5FX5A 1D6RA 1ZTJA 2H5DA 4FUEA 2QN5T 5TJXA 4Z6AH 1T8MA 1TNJA 1IHSH 2B9LA 3VGCB 1BTYA 4GAWA 1GJ9B 3W95A 2BDBA 3ENSB 1GJCB 3S9CA 1DICA 2GZ7A 1BMLA 3LDXH 1ELDE 1P11E 3A7TA 4BTTB 1AI8H 1UK2A 1YPJH 3WY8A 1QJ1B 2WPLS 4SGBE 1SL3A 6GCHF 4I8KA 1O2IA 2A0QB 4JYVH 3V0XA 3PWCA 1KXFA 1O2KA 2Y6TA 4A1XA 3SV7A 1SGFG 1UTMA 1NRQH 1VITG 1NT1A 1V3XA 2VVCA 4X2XA 1A5IA 2O8UA 1D6WA 1KLIH 4IN1A 3UOUA 4AFUA 2G8TA 5JB8S 1TBRH 2FODA 1O30A 2AMQA 4TPIZ 1SGQE 4B2AA 3SI3H 2H5CA 2FM2A 1TNLA 1GCTB 5AHGH 3SU0A 1Z8JB 3RU4D 3JZ1B 2ZDLA 4KTCA 1J16A 2QF0A 2C8XB 4YO9A 1O2UA 1XUHA 2BOHB 4Y7BA 2BY5X 1FUJA 1KDQA 2AGGX 2AYWA 3BTTE 3RXUA 3BTFE 1PFXC 2ZDKA 1EATA 4JMYA 1C2FA 2P95A 3PLBA 7KMEH 2GCHF 1FQ3A 1OYQA 1WV7H 2BD9A 2PGQB 2WYJA 4ISIH 1GI8B 1LPKB 1XKAC 2STAE 2WPMS 2GDDA 1GCDA 1ZJDA 1LVOA 2GMTB 4ZH8A 1G3DA 3ATWA 3SU5A 3ESTA 2ZTZA 2Q6DA 2J94A 3UNRA 4X6PA 5L30H 3FAOA 2A2QH 1UVTH 2FZZA 3RXMA 2HNTC 1UO6A 5HMAA 2BD5A 3M7UA 3Q3XA 1GMHF 3UREA 1BBRE 1RD3B 1HYLA 4O3UA 1W13U 3M7QA 1C1VH 1F92A 1IQHA 1BB0B 1AB9C 2QXHA 4CRCA 2THFB 4K2YA 3OY5U 1LKBA 1GI3A 2W26A 2CF8H 1PJPA 1A5GH 1XUJA 3ZZDA 1N6YA 3P95A 4XBDA 2A31A 2M5TA 2XC0A 1BRUP 5C2ZA 4WXIA 7ESTE 3P8FA 2ZTXA 5CMXH 1FZZA 2Y81A 3E0NB 2B8OH 2BZAA 1Z6EA 2AGIX 2BD4A 1P57B 2DE9A 2ZQ1A 1DUAA 2GVFA 1C2HA 1LVMA 5A8XA 2Y5FA 4UE7H 3ZZ8A 3SUGA 1TYNA 3TIUA 1XXDA 1GBKA 1C5LH 3KIDU 4X2YA 1O3PB 2VB0A 1SC8U 4BAOB 3BTME 3T29A 5T6DA 3ODDA 1S6FA 4CRDA 2FX4A 1GJ8B 1XX9A 1D3DB 2ILNA 2BY7X 1G3BA 5C1UA 3K9XB 3SBKA 4IBLH 5L6NH 5HM9A 2ZI2H 1CHOF 1MZAA 1NFWA 4H6SB 1HAIH 3K65B 2OTVA 4XBBA 3M36A 3FVFB 1RTFB 3LU9B 3PYHA 4JK6A 1BRBE 1P2JA 1JRTA 2FI5E 2ZU1A 3BIUH 1SR5C 3TK5A 2QIQA 1QGFA 3SJ8A 2ANYA 1TFXA 4A1VA 3LGUA 2PSXA 1NROH 4ABIA 1RTLA 3RLWH 1O3HA 2P3UB 4ASHA 1EX3A 3EE0B 2ZU3A 1HAVA 1U6QA 2FYRA 2PUQH 3SGQE 2UWOA 2FYQA 4ISHH 4DY7B 3SN8A 3LGTA 1CQQA 2PTCE 1A2CH 2Z3CA 1O5EH 4Q7XA 5A8YA 4OS4A 1QCPA 3OTJE 2Z9GA 3HGNA 1SQOA 1GDQA 2VIDA 2TGDA 5HGGA 1EAXA 1N8OC 1K21H 1F5LA 3SNBA 1SVPA 1NZQH 1C1PA 2JETB 3RU4T 1GJ7B 3ZZAA 1OP0A 2ZP0H 3UIRA 1SOTA 2OUAA 1VGCC 4JCNA 2SGDE 5HXFA 2FI4E 3ZZ6A 1SMFE 1TLDA 2GT8A 3QX5H 4GPGA 4K1EA 3D62A 1GDNA 4Y10E 3KL6A 2UWLA 1P9UA 3BTEE 4ZKRU 4CH2B 1P9SA 5DP8A 4AX9H 4GLYA 3GDUA 2ODPA 1QTFA 1EJAA 1G37A 4ISOA 1E35B 1A0LA 2WPIS 1TA6A 2F9VA 3ELAH 2A4QA 3M35A 3NZIA 3O8RA 4UFDH 2J92A 3DFJA 2BY6X 5T6GA 2OC1A 2ZDVH 4B2BA 1AZ8A 3RXTA 1DOJA 1P03A 1ELFA 1NFYA 2ZA5A 3ZZ4A 1ANDA 1IQNA 5L2YH 2A2XH 3ITIA 4I8JA 4CBNA 5ESBA 4NIVA 2Y7ZA 1HDTH 1THRH 1V2VT 4LXBH 3Q3KA 1N1LA 1C1UH 2ALPA 4KP0A 3SHAH 3ZVGA 7GCHG 4UEHH 3P8NA 3MOCA 1QL9A 5ESTE 1DWEH 3QUMP 2GD4B 2KAIB 4K5ZA 2ZHFH 1W12U 3RXQA 3RMMH 3GICB 1QNJA 2BB4A 1VITF 1E34B 4X8SH 3RDZA 4JYTA 4IS5A 4ZKOU 1JBUH 1C5WB 1MKWK 1O3KA 1TRMA 1YGCH 2P3TB 4HI3A 2ZCKP 1EOJA 5GDSH 3VXFH 4NGAH 2VIPA 1BDAA 2BLQA 2A45B 3A7XA 1SGNE 1YBWA 5HM2A 1ELEE 2PFEA 2Z3EA 2BZ6H 1GGDC 1Z1JA 1GHYH 5A2MH 4HGCA 6ESTA 4FUDA 4X1QU 2XXLA 2TIOA 2XBYA 3A7WA 3LGIA 8LPRA 1GMCG 1G2LA 1P05A 2QCYA 1LVYA 1BTHH 1YPGH 2OCVB 1AHTH 1N6XA 1ZSJA 4CRAA 3SV6A 1TA2A 1EZUC 1Z8RA 1PQ8A 4DIHH 4INKA 4NIWA 2PKAA 5EQQA 4YM9A 1SHHB 1CT2E 1ABIH 2Z9JA 1Y5AT 4PROA 1MBMA 2SGAA 4Y76A 3V3MA 2WV5A 2TRMA 2Y82A 3SJIA 1EPTC 2VGCC 1C2DA 3QWCH 3SOSA 4A92A 1LCYA 5GCHF 1TX6A 1BT7A 1W7XH 1O34A 1UTOA 3TH3H 1C9PA 6CHAB 3CS7A 1AFQB 4BAMB 3FP6E 1T8NA 2HALA 3LH3A 6GCHG 4OS5A 1YPLH 2WUCA 2GGVB 1G36A 2D2DA 2A4GA 3JZ2B 5E0GA 4ZAEA 1GBHA 1L0ZA 4WWYA 3SI4H 1C5VA 3BN9A 1Q31A 1MKXK 4UD9H 3VB4A 1L4DA 5BRRE 3MNBA 1YCPK 2ZDAH 1GHVH 4K8YA 4Y71A 1GWAA 4K60A 1PPHE 1UVPA 1O35A 1VGCB 3ZZCA 2STBE 2F91A 1AKSB 4X1RU 2C4FH 3U8OH 4AOQA 1BTWA 2QXJA 5C20A 2GP9B 1QBNA 1QL8A 2QY0B 4ZKSU 4JZIA 1MD7A 1ESTA 3OU0A 5JBCS 5EPNA 3URDA 1SGEE 1TPSA 2F3CE 5PTPA 1SGPE 1CA0C 1GJDB 5GIBA 1UCYK 2GCHG 5EU8A 1H1BA 3PMBB 1CO7E 1SLWB 1VCPA 2ZHEH 3VGCC 3H7OA 5EG4A 4AB8A 1BTXA 1YLCA 2GZ8A 1AE8H 3AAVA 5EOKA 2R2WU 3SUDA 4D7FA 1GI9B 1BTZA 1FY3A 3VB7A 1L1GA 1UHBB 1GMHG 1TMUH 1FAXA 2BY8X 4NZLA 3W94A 2ODQA 5ETXA 4TWWA 1GJAB 1QQ4A 3LC3A 1IHTH 1GDUA 1C5MD 2C8ZB 4WJG2 4YOJA 5LPEA 3TNSA 1CGIE 1CGJE 1KXCA 3F9GA 1SG8B 2ASUB 2FTMA 3M5NA 4HFPB 1MU6B 2HNTE 4X6OA 2ZHWH 4R0IA 1ZTLA 5F6MA 2JH6D 2NU1E 4DJZB 4B1TA 3Q76A 3RP2A 4NSYA 1GCTC 2Y7XA 5EODA 2PR3A 1S0RA 3M3VA 2H9HA 1Y3UA 3RM2H 5F8XA 2WPHS 4FVDA 1E38B 2OINA 4Y6DA 1ELBA 3PLKA 3AW1A 3SO3A 4FXGH 5T6FA 3VPKA 1DS2E 1MTUA 1IQFA 1BTUA 2PLXA 3TU7H 4AYVB 1SGIB 3FP8E 3KEEA 1GHAG 5AF9H 2Z6BD 2P8OB 1FI8A 3EDXB 1W0ZU 1Y5BT 1TMBH 1NRNH 2AS9A 3T27A 3RXSA 1SFQB 4YOIA 4K8BA 1O38A 1O31A 5JBTA 2BHGA 1NO9H 3NWUA 1M9UA 1LQDB 4ZROA 1TALA 4FU8A 2FO9A 2HPPH 4XE4A 1HBTH 1C1TA 4IGDA 1IQKA 1C4Y2 1BMAA 8GCHF 1QBOA 1T7CA 2BDHA 3PTBA 3HKIB 2BDGA 1KLJH 1ID5H 2NWNA 1L1JA 2EI8A 2ZDNA 3GCOA 4AFSA 2J2UA 3STIA 2ZWLH 3KHVA 5GJ4B 3OX7U 1SOZA 1PYTD 1AMHA 1EZXC 1O2LA 2UUKB 3MO6A 1SGCA 1ETTH 3U1IB 1OKXA 3MU1A 2BD2A 2HGTH 5TCCA 3LKWA 2W7SA 4ZMAH 1Y3YA 2J95A 1QJ6B 1RGQA 4I31A 4BXSA 1AU8A 1GHWH 2CGAA 2ZF0H 4GSOA 1W11U 1C4V2 3GY5A 1W2KH 5AVDA 2TBSA 1CA8B 1HAXB 4BAKB 5DJ7A 1V2KT 2Y5HA 4NA9H 1YPEH 4OS6A 2HLCA 2BX4A 4MQAA 1ELVA 4GHTA 1K1JA 1S82A 1KTSB 1DWBH 1O2TA 1S5SA 5JDUB 2DUCA 3B8JA 1ANBA 2PGBB 1OOKB 3QLPH 4ZKNU 4NA8A 3SNEA 1P3CA 1BHXB 3S69A 6LPRA 1ZPBA 1HCGA 2OBOA 2PWXA 1HRTH 3HGPA 2FLBH 4J1YA 1TGBA 5DP5A 3F9HA 1ELAA 1CA0B 1OP2A 1MTNB 1PPGE 2BQ7B 4TYDA 1EKBB 2G52A 2OXSA 1YF4A 3HATH 1HJ8A 2A7JA 2R0KA 2Z9KA 2Z9IA 2GT7A 4WVPE 4CRGA 1ZZZA 1DT2A 1DANH 2AMPA 1EAIA 1A3EH 1NESE 2H9EH 2UUYA 3ZYEA 1YPHC 2BQ6B 1TMTH 2ZG0H 1O3GA 3TITA 4I8HA 1GL1A 4E05H 1P12E 4CR5A 1DWDH 1A7SA 2JETC 4OS7A 1NY22 3MH4A 1NRSH 1S81A 1XUGA 2LPRA 1EJMA 4XOJA 1AZZA 3MH7A 1ELGA 3F6UH 4E7RG 1QJ7B 2ALVA 2TPIZ 4HZHA 4GUXA 4MLFB 1O32A 1PPFE 5DG6A 1C9TA 1X7AC 1K1OA 2JH0D 1TB6H 3LJOA 4TY7A 2P16A 4FVBA 2BQWB 3ZZ3A 2XW9A 1ANEA 4R8TB 1T4VH 3PMJA 2JKHA 1O2NA 2ZGBH 1GJ6A 3DHKH 3OYPA 1G3EA 1ETRH 1TBZH 2WV4A 2BDCA 5LH8A 1AVGH 3P8OA 3D65E 1TNHA 1ZOMA 2BD7A 4WH8A 4WY3A 3K6ZA 1HJ9A 1DM4B 1GHBF 1H9HE 4NFEA 4Q2KA 4AGJA 3KQBA 3KN2A 3ZVEA 3IITA 2G5VA 1NFUA 2I6SA 1BA8B 2VWLA 3MU0A 3T25A 4M7GA 4OGYA 1OWJA 2OQ5A 3TNTA 3KCGH 1EUFA 4D9RA 1A4WH 3VB6A 3DA9B 1C2GA 4DW2U 5JYIA 2ZTYA 1UMAH 3LJJA 3BTWE 3A8CA 1AIXH 1C5OH 3QZRA 1TPOA 3SV9A 5GCHG 3SJOA 2R3YA 4UFGH 2V0BA 2FTLE 5F8TA 3I77A 1HAHH 2HWLB 4JK5A 2XWAA 5CHAB 3SV8A 4I32A 1KDQB 3TGKE 2RA3A 1D9IA 3GCNA 1WYKA 9ESTA 1P02A 1V6DA 1SGYE 2PTNA 4JZDH 3UPEA 2IPHA 2F9BH 1GI2A 3M3SA 1C1NA 3ATMA 2BXUH 1C5YB 4UONA 5GWZA 1WTGH 3L3TA 3AW0A 1UK4A 2AEIH 2P93A 1H4WA 1DDJA 4ABEA 1BMMH 3RXEA 5DGJA 1GHAF 2TGAA 1AVXA 3STJA 1FIWA 4OGXA 2XC5A 3RMNH 1TIOA 2NU4E 3LGWA 3E3TA 1XMNB 5C5OA 2VWNA 1O39A 1MCVA 3S7HB 3SJKA 3CP7A 4MNXA 1OSSA 1BQYA 3MH6A 3MU4A 1WOFA 1XM1A 5LGOA 4IN2A 1CHGA 2CF9H 3GCTF 1RRKA 5DP3A 2PHBA 1UCYE 2WYGA 2VWOA 3BF6H 2ZFRH 2F9OA 1P8VC 1Z8IB 2HVXA 2UUJB 6CHAC 5HYOA 3TPIZ 1AFQC 1IOEA 4X2VA 3SUEA 1CSOE 2O8LA 1SB1H 4YOGA 3GY8A 3TK6A 3UUZA 4YLUA 1ESAA 3MWIU 2XYAA 2Y80A 3TH4H 3O8CA 3RXJA 2PKSB 1UTLM 2R0LA 3R3GB 1C2MA 4O97A 3ZVDA 2W3KA 1QB9A 5DP9A 1HLTH 1Y3WA
chains in the Genus database with same CATH superfamily
1L2EA 3M37A 1T31A 1ACBE 3UR6A 1P3EA 2EA3A 1QR3E 1S6LA 1QRXA 2ZZUH 1C1RA 5H4IB 1C2KA 1ZJKA 5BPEA 1KXAA 2V3OH 2FESH 4X2WA 4CRFA 2G55A 4H4FA 4NWLA 3GY7A 4K3JA 1GI6A 1UTQA 2HOBA 5A0BA 1C2IA 1FLEE 2J97A 3A89A 1JMOH 3ZV9A 5FCKA 1HAVB 1FX0B 1PPZA 1J17T 2QF3A 1NU7B 3Q00A 3FZDA 3MI4A 2OP9A 4E7NA 2EY4C 1A3BH 1WU1A 2RDEA 1NTPA 2ZGCA 1C5RA 1DFPA 1ZMNA 3DFLA 5FCRA 4AG2A 5EW1H 1V2JT 1QQUA 5DN6D 3OAAD 5EGMA 1VCQA 4NCYA 1QBVH 4LK4A 1C5XB 5JB9S 2VINA 2ULLA 2VH0A 3LT3A 2FDAA 3UY9A 1DLKB 2FOCA 4KTUA 1RTKA 3S0NA 1V2NT 5EXMA 5TCAA 3IG6B 4AB9A 1C5NH 1AN1E 4WMEA 3PTNA 3F9EA 1SQAA 2XBWA 1TNIA 3BIVH 1ZPZA 2HRVA 8GCHG 1TAWA 2HLDD 5C3NA 1D4PB 1MTVA 5E2PA 1J8AA 3KNXA 1AQ7A 1BRAA 1RIWC 4GCHF 1O2QA 2A7CA 4UFEH 2BVRH 4JZEH 1HAZB 3P92A 1KXDA 1BHXF 2AMDA 4XBCA 1TX7A 1F0RA 3E90B 1HAPH 5IK2D 5C1XA 2RG3A 1O3FA 1LTOA 1TOCB 3SNCA 3FKSD 3QTVH 4I33A 2F4LA 1OPHB 1FDPA 1GBIA 1SBWA 2WPJS 2ZCHP 1TRNA 2Y5GA 4J2YB 3LIWA 1W7GH 4ZHLU 2FI3E 1LHFH 2K1QA 1OHHD 2FWWA 3BTQE 3A84A 2ZFQH 4CHAC 2P8OC 2FEQH 2C3SA 2J38A 4MPXA 5FPSA 2W7UA 5K0HA 5E0JA 1O2SA 1MQ5A 1C2JA 3F2GA 3RMLH 4FUIA 1FONA 5DO4H 1GMDG 1YP9A 3UB0A 1GBTA 1PPEE 2W5EA 3K6YA 2KCYA 4DT7B 1QIXB 1S6HA 1VJAU 3GDVA 4YXWD 3DCLA 2FMJA 2V3HH 4GHQA 1AUTC 2QXIA 1P2IA 1SHYA 3BG4C 3EYDA 1D3PB 4Q7ZA 4ABJA 5IDKA 1ARBA 1O5GH 2OC8A 3GYLB 4ABGA 1O2JA 2FOEA 3TLOA 3RMOH 1KMHB 2GCTB 1BUIA 4Q7YA 3UNSA 1ZLRA 3F1SB 2WINI 1TNGA 1O3DA 3BTHE 3BSQA 5CHBA 2TGPZ 3GY3A 2ZU4A 4HTCH 2QF4A 1TGCA 4X1SU 4YZUA 1LKAA 2KM0A 3UQOA 4U01A 4INLA 1Z7KA 2B7DH 4NFFA 1DX5M 4MNVA 4THNH 1HGTH 1PQAA 2RDLA 5F03A 5C67A 5DP6A 4RI0A 1YPHE 1O2OA 4NA7A 2AIQA 4Y0YE 1KXBA 1SGTA 2PKAB 3ZIAD 1GBBA 2YMSD 3QK1A 3V13A 3GS9A 1YKTA 7LPRA 2G00A 1OWHA 4ESTE 1O2GH 2R3UA 2LELA 1LVBA 1ZRBA 1V2OT 3C1KA 1AD8H 1KIGH 1SLVB 2ESTE 3SV2H 1CVWH 3MNSA 1FY5A 3BTKE 3N7OA 1S84A 1ZRKA 2ZHQH 1MTNC 3MHWU 3VG8A 2ZNKH 1C5TA 4IMQA 3SGBE 1GBAA 1JWTA 3QTOH 3RXGA 2Q6FA 1O2HA 2ZFPH 2VVVA 1GHBG 1UVSH 4OS2A 1O2YA 1K9OE 1BBRH 4UDWH 2BVXH 3TVJB 5EJZA 2J4IA 1BJUA 3DT0H 1MD8A 2J98B 4A7IB 1EB2A 3M5LA 4ABBA 1C1WH 4BTIB 4MNYA 5CE1A 2ZEBA 3F9FA 2ZPRA 1HAYB 2IPQX 2VWMA 3U28C 1W8BH 3DSOA 3PB1E 5GPIB 1DE7H 2A7HA 1WCZA 1BRCE 1RIWB 4RT1A 1ZPCA 1ETSH 1LPGB 1ZHMA 1Y3VA 4B73A 5JBAS 1ABJH 3LOXA 1SQTA 1PQ5A 1V2ST 4Y8ZA 3GY6A 3SHCH 3UOPA 1EASA 3M5OA 2ZECA 1XVMA 4ABDA 3U8TH 1RXPA 1YYY1 1T32A 2FIRH 3SU2A 2QGRA 1F0TA 1D3TB 4B6EA 4B71A 5A0CA 4ABAA 5EQSA 1O5FH 1Q3XA 1J15A 1TPPA 3T26A 2H2ZA 2SGEE 1G3CA 2WPDD 1GBFA 3SU6A 4D7GA 1DY8A 4GVUA 4FETA 4YT7H 1HXFH 3S9BA 3GCHC 5IYTA 1WUNH 1JIMA 1KSNA 1YCPM 1C5QA 4CHAB 1BZXE 5EXLA 2F9NA 2W6ID 2A5AA 1O33A 2ZFSA 3FN8A 3P6ZB 2BX3A 2J34A 4BOHA 1MMJN 1O2PA 1HXEH 3OSYA 2AERH 5EW2H 1CT0E 2BD3A 4BAHB 1G30B 4TY6A 2FLRH 3T62A 1CE5A 1NBME 4NZQA 3FO8D 4KELA 3TGJE 1FIZA 3GCTG 3CENA 3F68H 1BITA 2IN2A 2ZKSA 4JZFH 1AY6H 4ABFA 1B0EA 2CV3A 4B75A 3BG4B 4U32A 3HPTB 3RXCA 1MCTA 2DE8A 4B76A 1CBWC 3RXFA 2IOTA 4DT4A 3OY6U 1PPCE 1PQ7A 1O0DH 3E91A 2FOMB 1K1NA 3PMAB 3SU1A 1O3BA 1SGFA 2WPKS 3NRLA 5T3HA 4E06H 4NWKA 1O5BB 1O5DH 3H5CB 5CHAC 3LC5A 2A1DB 1SFIA 2GTBA 4LZ1H 4WF8A 4U2WA 1ZMLA 4WMDA 1HAOH 2FOFA 4MG3A 3BEFB 1IQGA 2ZPQA 3ODFA 3B23B 1S0QA 1AWFH 1W3CA 3RC4A 4X6NA 1Z71A 3SJ9A 2BLOA 1P2KA 3PM3A 1AGJA 4Y79A 3M3TA 4DOQA 1ORFA 3DSPA 2OC7A 4NSVA 1FPCH 1O5AB 1TGNA 1IQIA 2AGEX 3T2NA 3P17H 3RM0H 1DXPA 1GPZA 3PV5A 2YOLA 5DPAA 4YTAA 1SLUB 2ZCLP 3ZZ9A 1UTJA 1DVAH 4D9QA 1C2EA 3ZVBA 2J9NA 2AH4X 1VR1H 2BDIA 5FX6A 2NU3E 1HAGE 3TGIE 3P8GA 2G5NA 1GMDF 2RCEA 4ISLA 1GHZA 4X8VH 1OWEA 4WH6A 4CBOA 1TX8A 1O2MA 4BTUB 1COWD 2VNTA 2SGQE 3FP7E 1DUEA 3R0FA 5DSFA 3QZQA 1TWXB 1OWKA 1MTSA 4O9VA 2BDAA 3PO1C 3H7TA 1SSXA 1UVOA 1UTPA 3U9AH 2I6QA 5DK1A 4Y0ZE 2HPQH 4NIYA 5A0AE 1OXGA 1NS3A 2QXGA 2V3MA 1AE5A 2O9QA 1RFNA 3AVZA 2C93B 2PUXB 1UJ1A 1O37A 2PKSC 4FUGA 2CHAC 4U30A 1VKYA 3IWMA 4RKOB 1NRPH 4MVNA 3MO9A 1S83A 4IMZA 1DITH 1OWIA 1HV7A 3BV9B 1L4ZA 1FV9A 1S85A 1O2VA 2A4RA 2Z7FE 3BEUA 3O8BA 4SGAE 5B6OA 5I46H 4CH8B 2H6MA 3ZYDA 2R9PA 1GBDA 4GCHG 4AZ2B 1C5PA 2KZ4A 3QO6A 2OD3B 1LHDH 2EI7A 4D76A 4ISNA 2BDYA 1J9CH 3A88A 3K2UA 1FAKH 3M5MA 1O5CB 3KQ5A 4JZ1A 1QB1A 1TE0A 3PRBA 1ESBA 1A61H 2WHXA 1IAUA 1QY6A 4Y11E 3KYFA 2V35A 2EI6A 3GDSA 5FAHA 3I29A 2YNAA 4FOUC 1GVLA 1O2XA 5E8EH 5JBBS 4OM9A 1OYTH 2FOAA 2VJ1A 2JJ1D 2Z94A 3EA8A 1EAUA 2ANKH 4F4OC 1L1NA 1G2MA 4RN6A 1B5GH 2C8WB 1HIAA 3LGYA 4XFQA 3WW7A 1ANCA 2SFAA 3GCHB 1AFEH 1TNKA 4A5TS 2ZO3H 1H8DH 1HJAB 1DWCH 1TOMH 3OEHD 3E8LA 1LPZB 1GI7B 2PW8H 4IC5A 3KGPA 3HKJB 2BY9X 4INHA 1SI5H 3P70B 5SGAE 3PMHB 1BMFD 3ZV8A 3M61U 3DD2H 1GBLA 5T1VA 3DSGA 1AWHB 4DVAU 3V12A 4DCDA 3V7TA 4RSPA 2G51A 1WTHD 4F49A 5FPYA 4CREA 3EA7A 4QT8C 1QFKH 5FPTA 5GXPA 1CBWB 2NU0E 2F9UA 3FOAA 3ZVFA 1O3LA 5E2OA 2W6JD 1XUIA 2BM2A 3NPSA 1DPOA 3SNAA 1FN6A 4H42U 2FOHA 3BTDE 4M9FA 4MPWA 4ZXXH 1EP6A 3A82A 1C1SA 3GYMA 2Q6GA 5KECA 1GG6B 1O3AA 3RU4E 2ANWA 1J14A 4VGCB 1MU8B 2QAAA 1THSH 3QN7A 1HIAB 1LQEA 3U1JB 2BYAX 5I25A 3U8RH 2ZGXH 2XNIA 3PV4A 2PV9B 1O2ZA 3A85A 1C1MA 1B7XB 1A46H 1WBGB 3BTGE 3E0PB 2BLVA 3RXDA 5FXLA 3KQDA 1EOLA 3RXAA 1P10A 1ZTKA 3A87A 1C4U2 3O8DA 4FUHA 1EZQA 2UWPA 2A4OA 4FUFA 1O3IA 4WXVA 1O2RA 3VEQB 1AVWA 3OFND 3LPRA 2O8WA 2F83A 1W0JD 4X8TH 1ZMJA 5EPYA 4BANB 1YLNA 1KY9A 2A5KA 2P59A 3NKKA 4LZ4B 1H9LB 2XNDD 5EQRA 1F0SA 3L33A 2VIVA 4X6MA 1HPGA 4AYYB 2B0FA 3ATIA 3A8AA 3PO1B 1TRYA 4H6TA 1C5UA 1AUJA 4KKDA 2F43B 2GCTC 1WQSA 3SGAE 1G9IE 2R2MB 1JRSA 2OQUA 1P04A 3URCA 1BTPA 3RXBA 5A8ZA 1ZHRA 5E0HA 1JXPA 1NU9A 1QRZA 1THPB 1Y8TA 1UK3A 1NRRH 3NCLA 3RC6A 4BXWA 3FZZA 1OS8A 1P0SH 2CHAB 1Q2WA 3U98H 2L6OA 1ZGVA 4P00A 1RJXB 3UTUH 2GV6A 1ARCA 3EQ0H 2ZPSA 2ZU5A 1A5HA 2D8WA 2FPZA 3PROA 1DSUA 1AO5A 4TWYA 1E1RD 2G4UA 3LH1A 1FN8A 1WSSH 3LONA 5JPMH 1O3CA 3GOVB 4MPVA 1E0FD 1NN6A 2IJOB 4I7YH 3RC5A 4NG9H 3NUMA 1BIOA 1MAYA 2NU2E 3MO3A 4ZHMU 2XCNA 5KEDA 4K1SA 4DGJA 2TGTA 4AG1A 2BD8A 2ZGHA 3VXEH 3NK8A 3RUOA 2GDEH 4DIIH 1TBQH 1K28D 3MYWA 5G4BA 1PYTC 3SU4A 3HK6B 3SYJA 2KAIA 9LPRA 1SGRE 1CT4E 3RXKA 1Z8GA 1LO6A 2SGPE 3GY2A 1D3QB 1K1LA 2JH5D 1KTTB 1O2WA 2QYIA 2XWBI 3UWJH 1F5RA 5GNDA 3BG8A 4X1NU 1JOUB 2Z9LA 2FS8A 4MPUA 3C27B 2GKVE 2B5TB 3RXLA 4FU7A 2PSYA 3ZZBA 1BMNH 3E6PH 1XKBC 2YMSB 1MH0A 3UR9A 4CRBA 1QURH 3DUXH 1H9IE 1ZSKA 1FY4A 1GJBB 1YC0A 4UFFH 2C8YB 3Q77A 1KYNA 1W10U 1P09A 2AHME 1B0FA 2SNVA 2QA9E 3EAJA 1K1PA 2O8MA 3MFJA 4ABHA 4FU9A 1DLEA 1MBQA 1T4UH 1NPMA 2FXRA 3UQVA 1AB9B 3FFGA 3L6PA 2YNBA 3TJNA 1GI4A 1QA7A 1C1QA 4OS1A 1P2NA 1QRWA 2ZIQH 1Y5UT 1GI0A 3MU8A 2OC0A 3H09A 3G01A 5FBEA 1O3JA 4ZUHA 2VU8E 3A7VA 2QV1A 1KLTA 3TJUA 3KYGA 1IQJA 1UTNA 3RLYH 3E1XB 2LNCA 2BMGB 2RFKC 3S9AA 4X8UH 1HNEE 3MNCA 4XD7D 2ZFTA 4D8NA 1QL7A 2VVUA 5AFZH 1HUTH 1HFDA 1BOQA 1MQ6A 4KTSA 3ZZ7A 1NC6A 1QA0A 1FJSA 1UVUH 2BVSH 4K1TA 2ZC9H 1O3EA 4CR9A 3PLPA 4AORA 2XCFA 2FP7B 4FUBA 2ZDMA 3VB5A 1F0UA 1BBRK 2XRCA 5FBIA 1K2I1 3D49H 1LHGH 1AKSA 5ABWA 1K22H 1GBCA 4YESB 1GVKB 4Y8XA 5AFYH 2W3IA 3A7YA 1MUEB 1TQ7B 4FUCA 1TONA 1YLDA 8KME2 3RXPA 5FHTA 1E79D 2H9TH 4IC6A 1QB6A 1GI5A 2EC9H 4Z1MD 2VIWA 1MKWH 2V6NA 1SLXB 4RT0A 1CU1A 1XUFA 3QDZB 4WMFA 1T8LA 1N8OB 2SGFE 5DP7A 1P2QA 3F2FA 2RA0A 1UHBA 3RXRA 2XBVA 4X0WU 1OWDA 1WQVH 2Z3DA 1ELCA 1A0JA 1GL0E 2FS9A 4YT6H 4BAQB 3KQCA 1V2UT 5L2ZH 1TQ0B 1DY9A 2VIQA 1G32B 4ZHAA 1ZSLA 1O3MA 4AFZA 1EQ9A 1VJ9U 2K0QA 1ZHPA 3A8BA 1SPJA 1K1MA 5EJLA 3EA9A 1V2QT 1GJ5H 5DP4A 1Y3XA 1ZYOA 3SORA 1C2LA 1TPAE 4DG4A 3RXVA 1FXYA 1TABE 4B74A 2ODYB 1FPHH 1HB0B 1FY8E 1NM6A 1DXWA 2BXTH 1V2MT 4Z0KA 1XVOA 1KXEA 5KGOA 1IQEA 1SKYE 2D26C 3S7KB 3FANA 3MNXA 4MNWA 2OBQA 2G4TA 8ESTE 1T8OA 4ZXYH 1YPMH 2QC2A 3MTYA 1A0HB 2BTCE 3A81A 1FNIA 2BLWA 1K0HA 4DURA 3LGVA 2CMYA 1FMGA 1MZDA 5K7RA 1V2WT 1O36A 2C90B 2A5IA 5HIZA 1P01A 4X1PU 2ZHDA 1TGTA 2Q1JA 3I78A 4AGKA 1LDTT 2H1UA 3Q3YA 1ELTA 5LPRA 3NXPA 1IQMA 3A8DA 2D1JA 1P2OA 1MAXA 1NBMD 1OP8A 2GX4A 3SZNA 4Y7AA 2ZQ2A 3E16B 2XBXA 4Q80A 1YM0A 3AASA 3T28A 3VFEA 1O3NA 3F3BA 1W0YH 3HK3B 3SW2B 1WXRA 2WSSD 1BJVA 1P2MA 1EZSC 1MKXH 1EB1H 4NIXA 1GJ4H 3B9FH 4TPYA 3ZVCA 2G81E 1YCPH 1JIRA 3RXHA 1A1RA 2P94A 2F9PA 3U69H 4I8LA 1LHCH 1GBMA 1O3OA 4KGAA 3MU5A 1EAWA 1ZR0A 2AFQB 3OTPA 1INCA 3SU3A 1HJAC 1EPTA 3RXOA 3SQEE 2FOBA 1V2RT 1GBEA 4IW4E 1DSTA 2O8TA 5DKMA 4A1TA 2AIPA 4BNRA 1GGDB 3KQEA 2ZU2A 3MMGA 3EGKH 4XSKU 5EXNA 1GVZA 1V2LT 5F8ZA 4A6LA 1XUKA 1VITH 4FUJA 3SUFA 3TJOA 4O3TA 4AFQA 4AN7A 1Z1IA 1UCYH 4O03A 3GISB 4XDEA 2CXVA 3AAUA 2GMTC 1CHOG 3TJVA 3ATKA 1Z6JH 4RKJB 2SNWA 4MDSA 1UTKA 4I8GA 1P06A 1PPBH 4YLQH 3TH2H 5C1YA 7GCHF 1Y59T 1C5SA 2XC4A 2GJGA 2KR7A 2L74A 2FX6A 1EP5A 1FY1A 3RXIA 1EXFA 1GG6C 3SQHE 4VGCC 5C0UA 1VCWA 1ZGIA 2XTTB 2ANMH 2A32A 1GBJA 3A83A 3ZVAA 1H8IH 1F7ZA 1TGSZ 1CGHA 1XXFA 2KCPA 3KF2A 1V2PT 4B2CA 1EPTB 2CN0H 2VGCB 3T5FH 3TK9A 1F5KU 3A7ZA 2J5UA 3UFAA 4MTBA 3A80A 3EE7A 3ZZ5A 3CS0A 2KFWA 3UNQA 1MTWA 1K1IA 1W14U 3M7TA 2VH6A 4JYUH 1GHXH 1C1OA 5C5NA 1SGDE 2VIOA 1RS0A 3QGJA 3UAIC 1LHEH 2BOKA 5A09A 1GI1A 3VB3A 1E36B 1LMWB 1VZQH 2UUFB 3BEIB 3D23A 1C5ZB 3SNDA 2CJIA 3UWIA 2VBCA 2GV7A 2FOGA 1GMCF 1E37B 1V2TT 3GY4A 5EIYA 2GZ9A 5J4QA 2HNTF 2ZFFH 2OLGA 2EEKA 1NFXA 2P3FH 1QHRB 1EJNA 2ZGJA 5J4SA 2WUBA 4LOYH 1OX1A 3A86A 1YPKH 1BCUH 1EFRD 1F2SE 3ATLA 5C94A 4Y8YA 3MH5A 3PWBA 1IQLA 5LPFA 4K69A 3QGNB 1WAYB 2PP6A 5FX5A 1D6RA 1ZTJA 2H5DA 4FUEA 2QN5T 5TJXA 4Z6AH 1T8MA 1TNJA 1IHSH 2B9LA 3VGCB 1BTYA 4GAWA 1GJ9B 3W95A 2BDBA 3ENSB 1GJCB 3S9CA 1DICA 2GZ7A 1BMLA 3LDXH 1ELDE 1P11E 2LP6A 3A7TA 4BTTB 1AI8H 1UK2A 1YPJH 3WY8A 1QJ1B 2WPLS 4SGBE 1SL3A 6GCHF 4HG6A 4I8KA 1O2IA 2A0QB 4JYVH 3V0XA 3PWCA 1KXFA 1O2KA 2Y6TA 4A1XA 3SV7A 1SGFG 1UTMA 1NRQH 1VITG 1NT1A 1V3XA 2VVCA 4X2XA 1A5IA 1YWUA 2O8UA 1D6WA 1KLIH 1UW7A 4IN1A 3UOUA 4AFUA 2G8TA 5JB8S 1TBRH 2FODA 1O30A 2AMQA 4TPIZ 1SGQE 4B2AA 4ZCNA 3SI3H 2H5CA 2FM2A 1TNLA 1GCTB 4TSFD 5AHGH 3SU0A 1Z8JB 3RU4D 3JZ1B 2ZDLA 4KTCA 1J16A 2QF0A 2C8XB 4YO9A 1O2UA 1XUHA 2BOHB 4Y7BA 2BY5X 1FUJA 1KDQA 2AGGX 2AYWA 3BTTE 3RXUA 3BTFE 1PFXC 2ZDKA 1EATA 4JMYA 1C2FA 2P95A 3PLBA 7KMEH 2YMSC 2GCHF 1FQ3A 1OYQA 1WV7H 2BD9A 2PGQB 2WYJA 4ISIH 1GI8B 1LPKB 1XKAC 2STAE 2WPMS 2GDDA 1GCDA 1ZJDA 1LVOA 2GMTB 4ZH8A 1G3DA 3ATWA 3SU5A 3ESTA 2ZTZA 2Q6DA 2J94A 3UNRA 4X6PA 5L30H 3FAOA 2A2QH 1UVTH 2FZZA 3RXMA 5FL7D 2HNTC 1UO6A 5HMAA 2BD5A 3M7UA 3Q3XA 1GMHF 3UREA 1BBRE 1RD3B 2WV9A 4F55A 1HYLA 4O3UA 1W13U 3M7QA 1H8ED 1C1VH 1F92A 1IQHA 1BB0B 1AB9C 2QXHA 4CRCA 2THFB 4K2YA 3OY5U 1LKBA 1GI3A 2W26A 2CF8H 1PJPA 1A5GH 1XUJA 3ZZDA 1N6YA 3P95A 2JIZD 4XBDA 2A31A 2M5TA 2XC0A 1BRUP 5C2ZA 4WXIA 1E1QD 7ESTE 3P8FA 2ZTXA 5CMXH 1FZZA 2Y81A 3E0NB 2B8OH 2BZAA 1Z6EA 2AGIX 2BD4A 1P57B 2DE9A 2ZQ1A 1DUAA 2GVFA 1C2HA 1LVMA 5A8XA 2Y5FA 4UE7H 3ZZ8A 3SUGA 1TYNA 3TIUA 1XXDA 1GBKA 1C5LH 3KIDU 4X2YA 1O3PB 2VB0A 1SC8U 4BAOB 3BTME 3T29A 5T6DA 3ODDA 1S6FA 4CRDA 2FX4A 3CNRA 1GJ8B 1XX9A 1D3DB 2ILNA 2BY7X 1G3BA 5C1UA 3K9XB 3SBKA 4IBLH 5L6NH 5HM9A 2ZI2H 1CHOF 1MZAA 1NFWA 4H6SB 1HAIH 3K65B 2OTVA 4XBBA 3M36A 3FVFB 1RTFB 3LU9B 3PYHA 2CK3D 4JK6A 1BRBE 1P2JA 1JRTA 2FI5E 2ZU1A 3BIUH 1SR5C 3TK5A 2QIQA 1QGFA 3SJ8A 2ANYA 1TFXA 4A1VA 1MABB 4B6FA 3LGUA 2PSXA 1NROH 4ABIA 1RTLA 3RLWH 1O3HA 2P3UB 4ASHA 1EX3A 3EE0B 2ZU3A 1HAVA 1U6QA 2FYRA 2PUQH 3SGQE 2UWOA 2FYQA 3N7DA 4ISHH 4DY7B 3SN8A 3LGTA 1CQQA 2PTCE 1A2CH 2Z3CA 3AK5A 1O5EH 4Q7XA 5A8YA 4OS4A 1QCPA 3OTJE 2Z9GA 3HGNA 1SQOA 1GDQA 2VIDA 2TGDA 5HGGA 1EAXA 1N8OC 1K21H 1F5LA 3SNBA 4ACAA 1SVPA 1NZQH 1C1PA 2JETB 3RU4T 1GJ7B 4Q4LA 3ZZAA 1OP0A 2ZP0H 3UIRA 1SOTA 2OUAA 1VGCC 4JCNA 2SGDE 5HXFA 1H8HD 2FI4E 3ZZ6A 1SMFE 1TLDA 2GT8A 3QX5H 4GPGA 4K1EA 3D62A 1GDNA 4Y10E 3KL6A 2UWLA 1P9UA 3BTEE 4ZKRU 4CH2B 1P9SA 5DP8A 4AX9H 4GLYA 3WWBA 3GDUA 2ODPA 1QTFA 1EJAA 1G37A 3PRDA 4ISOA 1E35B 1A0LA 2WPIS 1TA6A 2F9VA 3ELAH 2A4QA 3M35A 3NZIA 3F2HA 3O8RA 4UFDH 2J92A 3DFJA 2BY6X 3PV2A 5T6GA 2OC1A 2ZDVH 2M2AA 4B2BA 2JJ2D 1AZ8A 3RXTA 1DOJA 1P03A 5HKKD 1ELFA 1NFYA 2ZA5A 3ZZ4A 1ANDA 1IQNA 5L2YH 2A2XH 3ITIA 4I8JA 4CBNA 5ESBA 4NIVA 2Y7ZA 1HDTH 1THRH 1V2VT 3MQKC 4LXBH 3Q3KA 1N1LA 1C1UH 2ALPA 4KP0A 3SHAH 3ZVGA 7GCHG 4UEHH 3P8NA 3MOCA 1QL9A 5ESTE 1DWEH 3QUMP 2GD4B 2KAIB 4K5ZA 2ZHFH 1W12U 3RXQA 3RMMH 3GICB 1QNJA 2BB4A 1VITF 1E34B 4X8SH 5HIYA 3RDZA 4JYTA 4IS5A 4ZKOU 1JBUH 1C5WB 1MKWK 1O3KA 1TRMA 1YGCH 2P3TB 4HI3A 2ZCKP 1EOJA 5GDSH 3VXFH 4NGAH 2VIPA 1BDAA 2BLQA 2A45B 3A7XA 1SGNE 1YBWA 5HM2A 1ELEE 2PFEA 2Z3EA 2BZ6H 1GGDC 1Z1JA 1GHYH 5A2MH 4HGCA 6ESTA 4FUDA 4X1QU 2XXLA 2TIOA 2XBYA 3A7WA 3N7EA 3LGIA 8LPRA 1GMCG 1G2LA 1P05A 2QCYA 1LVYA 1BTHH 1YPGH 2OCVB 1AHTH 1N6XA 1ZSJA 4CRAA 3SV6A 1TA2A 1EZUC 1Z8RA 1PQ8A 2K8IA 4DIHH 4INKA 4NIWA 2PKAA 5EQQA 4YM9A 1SHHB 4TT3D 1CT2E 1ABIH 2Z9JA 1Y5AT 4PROA 2KX4A 1MBMA 2SGAA 4Y76A 1YY3A 3V3MA 2WV5A 2TRMA 2Y82A 3SJIA 1EPTC 2VGCC 1C2DA 3QWCH 3SOSA 4A92A 1LCYA 5GCHF 1TX6A 1BT7A 1W7XH 1O34A 1UTOA 3TH3H 1C9PA 6CHAB 3CS7A 1AFQB 4BAMB 3FP6E 1T8NA 2HALA 3LH3A 6GCHG 4OS5A 1YPLH 2WUCA 3N99A 2GGVB 1G36A 2D2DA 2A4GA 3JZ2B 5E0GA 4ZAEA 1GBHA 1L0ZA 2XOKD 4WWYA 3SI4H 1C5VA 3BN9A 1Q31A 1MKXK 4UD9H 3VB4A 1L4DA 5BRRE 3MNBA 1YCPK 2ZDAH 1GHVH 2J98A 4K8YA 4Y71A 1GWAA 4K60A 1PPHE 1UVPA 1O35A 1VGCB 3ZZCA 2STBE 2F91A 1AKSB 4X1RU 2C4FH 3U8OH 4AOQA 1BTWA 2QXJA 5C20A 4XRNA 2GP9B 1QBNA 1QL8A 2QY0B 4ZKSU 4JZIA 1MD7A 1ESTA 3OU0A 5JBCS 5EPNA 3URDA 1SGEE 1TPSA 2F3CE 5PTPA 1SGPE 1CA0C 1GJDB 5GIBA 1UCYK 2GCHG 5EU8A 1H1BA 3PMBB 1CO7E 1SLWB 1VCPA 2ZHEH 3VGCC 3H7OA 5EG4A 4AB8A 1BTXA 1YLCA 2GZ8A 1AE8H 3AAVA 2HVYB 5EOKA 2R2WU 3SUDA 4D7FA 3SZEA 1GI9B 1BTZA 1FY3A 3VB7A 2KCOA 1L1GA 1UHBB 1GMHG 1TMUH 1FAXA 2BY8X 4NZLA 3W94A 2ODQA 5ETXA 4TWWA 1GJAB 1QQ4A 3LC3A 1IHTH 1GDUA 1C5MD 2C8ZB 4WJG2 4YOJA 5LPEA 3TNSA 1CGIE 1CGJE 1KXCA 3F9GA 1SG8B 2ASUB 2FTMA 3M5NA 4HFPB 1MU6B 2HNTE 4X6OA 2ZHWH 4R0IA 1ZTLA 5F6MA 2JH6D 2NU1E 4DJZB 4B1TA 3Q76A 3RP2A 4NSYA 1GCTC 2Y7XA 2EQNA 5EODA 2PR3A 2IJD1 1S0RA 3M3VA 2H9HA 1Y3UA 3RM2H 5F8XA 2WPHS 4FVDA 1E38B 2OINA 4Y6DA 1ELBA 3PLKA 3AW1A 3SO3A 4FXGH 5T6FA 3VPKA 1DS2E 2QE7D 1MTUA 1IQFA 5EJ1A 1BTUA 2PLXA 3TU7H 4AYVB 1SGIB 3FP8E 3KEEA 1GHAG 5AF9H 2Z6BD 2P8OB 1FI8A 3EDXB 1W0ZU 1Y5BT 1SQRA 1TMBH 1NRNH 2AS9A 3T27A 3RXSA 1SFQB 4YOIA 4K8BA 1O38A 1O31A 5JBTA 2BHGA 1NO9H 3NWUA 5F53A 1M9UA 1LQDB 4ZROA 1TALA 4FU8A 2FO9A 2HPPH 4XE4A 1HBTH 1C1TA 4IGDA 1IQKA 1C4Y2 1BMAA 8GCHF 1QBOA 1T7CA 2BDHA 3PTBA 3HKIB 2BDGA 1KLJH 1ID5H 4P02A 2NWNA 2WZQA 5CDFE 1L1JA 2EI8A 2ZDNA 3GCOA 4AFSA 2J2UA 3STIA 2ZWLH 3KHVA 5GJ4B 3OX7U 1SOZA 1PYTD 1AMHA 1EZXC 1O2LA 2UUKB 3MO6A 1SGCA 1ETTH 3U1IB 1OKXA 3MU1A 2BD2A 2HGTH 5TCCA 3LKWA 2W7SA 4ZMAH 1Y3YA 2J95A 1QJ6B 1RGQA 4I31A 4BXSA 1AU8A 1GHWH 2CGAA 2ZF0H 4GSOA 1W11U 1C4V2 3GY5A 4I86A 1W2KH 5AVDA 2TBSA 1CA8B 1HAXB 4BAKB 5DJ7A 1V2KT 2Y5HA 4NA9H 1YPEH 4OS6A 3OE7D 2HLCA 2BX4A 4MQAA 1ELVA 4GHTA 1K1JA 1S82A 1KTSB 1DWBH 1O2TA 1S5SA 5JDUB 3F0OA 2DUCA 3B8JA 1ANBA 2PGBB 1OOKB 3QLPH 4ZKNU 4NA8A 2V7QD 3SNEA 1P3CA 1BHXB 2JDID 3S69A 6LPRA 1ZPBA 1HCGA 2OBOA 2PWXA 1HRTH 2QF5A 3HGPA 2FLBH 4J1YA 1QZ8A 1TGBA 5DP5A 3F9HA 1ELAA 1CA0B 1OP2A 1MTNB 1PPGE 2BQ7B 4TYDA 1EKBB 4ASUD 2G52A 2OXSA 1YF4A 3HATH 1HJ8A 2A7JA 2R0KA 2Z9KA 2Z9IA 2GT7A 4WVPE 3WWFA 5C0TA 4CRGA 1ZZZA 1DT2A 1DANH 2AMPA 1EAIA 1A3EH 1NESE 2H9EH 2UUYA 3ZYEA 1YPHC 2BQ6B 1TMTH 2ZG0H 1O3GA 3TITA 4I8HA 1GL1A 3W1EA 4E05H 1P12E 3F0PA 1DWDH 4CR5A 1A7SA 2JETC 3OEED 4OS7A 1NY22 3MH4A 1NRSH 1S81A 1XUGA 2LPRA 1EJMA 4XOJA 1AZZA 3MH7A 1ELGA 3F6UH 4E7RG 1QJ7B 2ALVA 2TPIZ 4HZHA 4GUXA 4MLFB 2KCAA 1O32A 1PPFE 5DG6A 1C9TA 1X7AC 1K1OA 4Q63A 2JH0D 1TB6H 3LJOA 4F48B 4TY7A 2P16A 4FVBA 2BQWB 3ZZ3A 2XW9A 1ANEA 4R8TB 1T4VH 3PMJA 2JKHA 1O2NA 2ZGBH 1GJ6A 3DHKH 3OYPA 1G3EA 4AC9A 1ETRH 1TBZH 2WV4A 2BDCA 5LH8A 1AVGH 3P8OA 3D65E 1TNHA 1ZOMA 2BD7A 4WH8A 4WY3A 3K6ZA 1HJ9A 1DM4B 1GHBF 1H9HE 4NFEA 4Q2KA 4AGJA 3KQBA 3KN2A 3ZVEA 3IITA 2G5VA 1NFUA 2I6SA 1BA8B 2VWLA 3MU0A 3T25A 4M7GA 4OGYA 1OWJA 2OQ5A 3TNTA 3KCGH 1EUFA 4ACBA 4D9RA 1A4WH 3VB6A 3DA9B 1C2GA 4DW2U 5JYIA 2ZTYA 1UMAH 3LJJA 3BTWE 3A8CA 1AIXH 1C5OH 3QZRA 1TPOA 3SV9A 5GCHG 3SJOA 2R3YA 4UFGH 2V0BA 2FTLE 5F8TA 3I77A 1HAHH 2HWLB 4JK5A 2XWAA 5CHAB 3SV8A 4I32A 1KDQB 3TGKE 2RA3A 1D9IA 3GCNA 1WYKA 9ESTA 1P02A 1V6DA 1SGYE 2PTNA 4JZDH 3UPEA 5C17A 2IPHA 2F9BH 1W0KD 1GI2A 3M3SA 1C1NA 3ATMA 2BXUH 1C5YB 4UONA 5GWZA 1WTGH 3L3TA 3AW0A 1UK4A 2AEIH 2P93A 1H4WA 1DDJA 4ABEA 1BMMH 3RXEA 5DGJA 1GHAF 2TGAA 1AVXA 3STJA 1FIWA 1WDIA 4OGXA 2XC5A 3RMNH 1TIOA 2NU4E 3LGWA 3E3TA 1XMNB 5C5OA 2VWNA 1O39A 1MCVA 3S7HB 3SJKA 3CP7A 4MNXA 1OSSA 1BQYA 3MH6A 3MU4A 1WOFA 1XM1A 5LGOA 4IN2A 1CHGA 2CF9H 3GCTF 1RRKA 5DP3A 2PHBA 2OK5A 1UCYE 2WYGA 2VWOA 3BF6H 2ZFRH 2F9OA 1P8VC 1Z8IB 2HVXA 2UUJB 6CHAC 5HYOA 3TPIZ 5B6LA 1AFQC 1IOEA 4X2VA 3SUEA 1CSOE 2O8LA 1SB1H 4YOGA 3GY8A 3TK6A 3UUZA 4YLUA 1ESAA 3MWIU 2XYAA 2Y80A 3TH4H 3O8CA 3RXJA 2PKSB 1UTLM 2R0LA 3R3GB 1C2MA 4O97A 3ZVDA 2W3KA 1QB9A 5DP9A 1HLTH 1Y3WA
chains in the Genus database with same CATH topology
1L2EA 3M37A 1T31A 1ACBE 3UR6A 1P3EA 2EA3A 1QR3E 1QRXA 2ZZUH 1C1RA 5H4IB 1C2KA 1ZJKA 5BPEA 1KXAA 2V3OH 2FESH 4X2WA 4CRFA 2G55A 4H4FA 4NWLA 3GY7A 4K3JA 1GI6A 1UTQA 2HOBA 5A0BA 1C2IA 1FLEE 3A89A 1JMOH 3ZV9A 5FCKA 1HAVB 1PPZA 1J17T 2QF3A 1NU7B 3Q00A 3FZDA 3MI4A 2OP9A 4E7NA 1A3BH 1WU1A 4AG2A 1NTPA 2ZGCA 1C5RA 1DFPA 1ZMNA 3DFLA 5FCRA 5EW1H 1V2JT 1QQUA 5EGMA 1VCQA 4NCYA 1QBVH 4LK4A 1C5XB 5JB9S 2VINA 2ULLA 2VH0A 3LT3A 2FDAA 3UY9A 1DLKB 2FOCA 4KTUA 1RTKA 3S0NA 1V2NT 5EXMA 5TCAA 3IG6B 4AB9A 1C5NH 1AN1E 4WMEA 3PTNA 3F9EA 1SQAA 2XBWA 1TNIA 3BIVH 1ZPZA 2HRVA 8GCHG 1TAWA 5C3NA 1D4PB 1MTVA 5E2PA 1J8AA 3KNXA 1AQ7A 1BRAA 1RIWC 4GCHF 1O2QA 2A7CA 4UFEH 2BVRH 4JZEH 1HAZB 3P92A 1KXDA 1BHXF 2AMDA 4XBCA 1TX7A 1F0RA 3E90B 1HAPH 5C1XA 2RG3A 1O3FA 1LTOA 1TOCB 3SNCA 3QTVH 4I33A 1OPHB 1FDPA 1GBIA 1SBWA 2WPJS 2ZCHP 1TRNA 2Y5GA 4J2YB 3LIWA 1W7GH 4ZHLU 2FI3E 1LHFH 2K1QA 2FWWA 3BTQE 3A84A 2ZFQH 4CHAC 2P8OC 2FEQH 2C3SA 2J38A 4MPXA 5FPSA 2W7UA 5K0HA 5E0JA 1O2SA 1MQ5A 1C2JA 3RMLH 4FUIA 1FONA 5DO4H 1GMDG 1YP9A 1GBTA 1PPEE 2W5EA 3K6YA 4DT7B 1QIXB 1S6HA 1VJAU 3GDVA 2FMJA 2V3HH 4GHQA 1AUTC 2QXIA 1P2IA 1SHYA 3BG4C 3EYDA 1D3PB 4Q7ZA 4ABJA 5IDKA 1ARBA 1O5GH 2OC8A 3GYLB 4ABGA 1O2JA 2FOEA 3TLOA 3RMOH 2GCTB 1BUIA 4Q7YA 3UNSA 1ZLRA 3F1SB 2WINI 1TNGA 1O3DA 3BTHE 3BSQA 2TGPZ 3GY3A 2ZU4A 4HTCH 1TGCA 4X1SU 4YZUA 1LKAA 3UQOA 4U01A 4INLA 1Z7KA 2B7DH 4NFFA 1DX5M 4MNVA 4THNH 1HGTH 1PQAA 2RDLA 5F03A 5C67A 5DP6A 1YPHE 1O2OA 4NA7A 2AIQA 4Y0YE 1KXBA 1SGTA 2PKAB 1GBBA 3QK1A 3V13A 1YKTA 7LPRA 2G00A 1OWHA 4ESTE 1O2GH 2R3UA 1LVBA 1ZRBA 1V2OT 3C1KA 1AD8H 1KIGH 1SLVB 2ESTE 3SV2H 1CVWH 3MNSA 1FY5A 3BTKE 3N7OA 1S84A 1ZRKA 2ZHQH 1MTNC 3MHWU 2ZNKH 1C5TA 4IMQA 3SGBE 1GBAA 1JWTA 3QTOH 3RXGA 2Q6FA 1O2HA 2ZFPH 2VVVA 1GHBG 1UVSH 4OS2A 1O2YA 1K9OE 1BBRH 4UDWH 2BVXH 3TVJB 2J4IA 1BJUA 3DT0H 1MD8A 4A7IB 1EB2A 3M5LA 4ABBA 1C1WH 4BTIB 4MNYA 5CE1A 2ZEBA 3F9FA 2ZPRA 1HAYB 2VWMA 1W8BH 3PB1E 5GPIB 1DE7H 2A7HA 1WCZA 1BRCE 1RIWB 1ZPCA 1ETSH 1LPGB 1ZHMA 1Y3VA 4B73A 5JBAS 1ABJH 3LOXA 1SQTA 1PQ5A 1V2ST 4Y8ZA 3GY6A 3SHCH 3UOPA 1EASA 3M5OA 2ZECA 1XVMA 4ABDA 3U8TH 1RXPA 1YYY1 1T32A 2FIRH 3SU2A 2QGRA 1F0TA 1D3TB 5A0CA 4B71A 4ABAA 5EQSA 1O5FH 1Q3XA 1J15A 1TPPA 3T26A 2H2ZA 2SGEE 1G3CA 1GBFA 3SU6A 4D7GA 1DY8A 4GVUA 4YT7H 1HXFH 3S9BA 3GCHC 5IYTA 1WUNH 1JIMA 1KSNA 1YCPM 1C5QA 4CHAB 1BZXE 5EXLA 2F9NA 2A5AA 1O33A 2ZFSA 3P6ZB 2BX3A 2J34A 4BOHA 1MMJN 1O2PA 1HXEH 3OSYA 2AERH 5EW2H 1CT0E 2BD3A 4BAHB 1G30B 4TY6A 2FLRH 3T62A 1CE5A 4NZQA 4KELA 3TGJE 1FIZA 3GCTG 3CENA 3F68H 1BITA 2IN2A 2ZKSA 4JZFH 1AY6H 4ABFA 1B0EA 2CV3A 4B75A 3BG4B 4U32A 3HPTB 3RXCA 1MCTA 2DE8A 4B76A 1CBWC 3RXFA 2IOTA 3OY6U 1PPCE 1PQ7A 1O0DH 3E91A 2FOMB 1K1NA 3PMAB 3SU1A 1O3BA 1SGFA 2WPKS 4E06H 5T3HA 4NWKA 1O5BB 1O5DH 3H5CB 5CHAC 3LC5A 2A1DB 1SFIA 2GTBA 4LZ1H 4WF8A 4U2WA 1ZMLA 4WMDA 1HAOH 2FOFA 4MG3A 3BEFB 1IQGA 2ZPQA 3ODFA 3B23B 1S0QA 1AWFH 1W3CA 3RC4A 4X6NA 1Z71A 3SJ9A 2BLOA 1P2KA 3PM3A 1AGJA 4Y79A 3M3TA 4DOQA 1ORFA 2OC7A 4NSVA 1FPCH 1O5AB 1TGNA 1IQIA 2AGEX 3T2NA 3P17H 3RM0H 1DXPA 1GPZA 2YOLA 5DPAA 4YTAA 1SLUB 2ZCLP 3ZZ9A 1UTJA 1DVAH 4D9QA 1C2EA 3ZVBA 2J9NA 2AH4X 1VR1H 2BDIA 5FX6A 2NU3E 1HAGE 3TGIE 3P8GA 2G5NA 1GMDF 2RCEA 4ISLA 1GHZA 4X8VH 1OWEA 4WH6A 4CBOA 1TX8A 1O2MA 4BTUB 2VNTA 2SGQE 3FP7E 1DUEA 3R0FA 3QZQA 1TWXB 1OWKA 1MTSA 4O9VA 2BDAA 3PO1C 3H7TA 1SSXA 1UVOA 1UTPA 3U9AH 2I6QA 5DK1A 4Y0ZE 2HPQH 4NIYA 5A0AE 1OXGA 1NS3A 2QXGA 1AE5A 2O9QA 1RFNA 3AVZA 2C93B 2PUXB 1UJ1A 1O37A 2PKSC 4FUGA 2CHAC 4U30A 3IWMA 4RKOB 1NRPH 4MVNA 3MO9A 1S83A 4IMZA 1DITH 1OWIA 1HV7A 3BV9B 1L4ZA 1FV9A 1S85A 1O2VA 2A4RA 2Z7FE 3BEUA 3O8BA 4SGAE 5B6OA 5I46H 4CH8B 2H6MA 3ZYDA 2R9PA 1GBDA 4GCHG 4AZ2B 1C5PA 3QO6A 2OD3B 1LHDH 2EI7A 4D76A 4ISNA 2BDYA 1J9CH 3A88A 3K2UA 1FAKH 3M5MA 1O5CB 4JZ1A 1QB1A 1TE0A 1ESBA 1A61H 1IAUA 1QY6A 4Y11E 2V35A 2EI6A 3GDSA 5FAHA 3I29A 2YNAA 1GVLA 1O2XA 5E8EH 5JBBS 1OYTH 2FOAA 2VJ1A 2Z94A 3EA8A 1EAUA 2ANKH 4F4OC 1L1NA 1G2MA 4RN6A 1B5GH 2C8WB 1HIAA 3LGYA 4XFQA 1ANCA 2SFAA 3GCHB 1AFEH 1TNKA 4A5TS 2ZO3H 1H8DH 1HJAB 1DWCH 1TOMH 3E8LA 1LPZB 1GI7B 2PW8H 4IC5A 3KGPA 3HKJB 2BY9X 4INHA 1SI5H 3P70B 5SGAE 3PMHB 3ZV8A 3M61U 3DD2H 1GBLA 1AWHB 4DVAU 3V12A 4DCDA 3V7TA 4RSPA 2G51A 1WTHD 4F49A 5FPYA 4CREA 3EA7A 4QT8C 1QFKH 5FPTA 5GXPA 1CBWB 2NU0E 2F9UA 3ZVFA 1O3LA 5E2OA 1XUIA 2BM2A 3NPSA 1DPOA 3SNAA 1FN6A 4H42U 2FOHA 3BTDE 4MPWA 4ZXXH 1EP6A 3A82A 1C1SA 3GYMA 2Q6GA 1GG6B 1O3AA 3RU4E 2ANWA 1J14A 4VGCB 1MU8B 2QAAA 1THSH 3QN7A 1HIAB 1LQEA 3U1JB 2BYAX 5I25A 3U8RH 2ZGXH 2XNIA 3PV4A 2PV9B 1O2ZA 3A85A 1C1MA 1B7XB 1A46H 1WBGB 3BTGE 3E0PB 2BLVA 3RXDA 5FXLA 3KQDA 1EOLA 3RXAA 1P10A 1ZTKA 3A87A 1C4U2 3O8DA 4FUHA 1EZQA 2UWPA 2A4OA 4FUFA 1O3IA 4WXVA 1O2RA 3VEQB 1AVWA 3LPRA 2O8WA 2F83A 4X8TH 1ZMJA 5EPYA 4BANB 1KY9A 2A5KA 2P59A 3NKKA 4LZ4B 1H9LB 5EQRA 1F0SA 3L33A 2VIVA 4X6MA 1HPGA 4AYYB 2B0FA 3ATIA 3A8AA 3PO1B 1TRYA 4H6TA 1C5UA 1AUJA 4KKDA 2GCTC 1WQSA 3SGAE 1G9IE 2R2MB 1JRSA 2OQUA 1P04A 3URCA 1BTPA 3RXBA 5A8ZA 1ZHRA 5E0HA 1JXPA 1NU9A 1QRZA 1THPB 1Y8TA 1UK3A 1NRRH 3NCLA 3RC6A 4BXWA 3FZZA 1OS8A 1P0SH 2CHAB 1Q2WA 3U98H 1ZGVA 1RJXB 3UTUH 2GV6A 1ARCA 3EQ0H 2ZPSA 2ZU5A 1A5HA 2D8WA 2FPZA 3PROA 1DSUA 1AO5A 4TWYA 2G4UA 3LH1A 1FN8A 1WSSH 3LONA 5JPMH 1O3CA 3GOVB 4MPVA 1E0FD 1NN6A 2IJOB 4I7YH 3RC5A 4NG9H 3NUMA 1BIOA 1MAYA 2NU2E 3MO3A 4ZHMU 2XCNA 4K1SA 4DGJA 2TGTA 4AG1A 2BD8A 2ZGHA 3VXEH 3NK8A 3RUOA 2GDEH 4DIIH 1TBQH 1K28D 3MYWA 5G4BA 1PYTC 3SU4A 3HK6B 2KAIA 9LPRA 1SGRE 1CT4E 3RXKA 1Z8GA 1LO6A 2SGPE 3GY2A 1D3QB 1K1LA 2JH5D 1KTTB 1O2WA 2QYIA 2XWBI 3UWJH 1F5RA 3BG8A 4X1NU 1JOUB 2Z9LA 2FS8A 4MPUA 3C27B 2GKVE 2B5TB 3RXLA 4FU7A 2PSYA 3ZZBA 1BMNH 3E6PH 1XKBC 1MH0A 3UR9A 4CRBA 1QURH 3DUXH 1H9IE 1ZSKA 1FY4A 1GJBB 1YC0A 4UFFH 2C8YB 3Q77A 1KYNA 1W10U 1P09A 1B0FA 2SNVA 2QA9E 3EAJA 1K1PA 2O8MA 3MFJA 4ABHA 4FU9A 1DLEA 1MBQA 1T4UH 1NPMA 2FXRA 3UQVA 1AB9B 3FFGA 3L6PA 2YNBA 3TJNA 1GI4A 1QA7A 1C1QA 4OS1A 1P2NA 1QRWA 2ZIQH 1Y5UT 1GI0A 3MU8A 2OC0A 3G01A 5FBEA 1O3JA 4ZUHA 2VU8E 3A7VA 2QV1A 1KLTA 3TJUA 1IQJA 1UTNA 3RLYH 3E1XB 2LNCA 2BMGB 3S9AA 4X8UH 1HNEE 3MNCA 2ZFTA 4D8NA 1QL7A 2VVUA 5AFZH 1HUTH 1HFDA 1BOQA 1MQ6A 4KTSA 3ZZ7A 1NC6A 1QA0A 1FJSA 1UVUH 2BVSH 4K1TA 2ZC9H 1O3EA 4CR9A 3PLPA 4AORA 2XCFA 2FP7B 4FUBA 2ZDMA 3VB5A 1F0UA 1BBRK 2XRCA 5FBIA 1K2I1 3D49H 1LHGH 1AKSA 5ABWA 1K22H 1GBCA 4YESB 1GVKB 4Y8XA 5AFYH 2W3IA 3A7YA 1MUEB 1TQ7B 4FUCA 1TONA 1YLDA 8KME2 3RXPA 5FHTA 2H9TH 4IC6A 1QB6A 1GI5A 2EC9H 2VIWA 1MKWH 2V6NA 1SLXB 1CU1A 1XUFA 3QDZB 4WMFA 1T8LA 1N8OB 2SGFE 5DP7A 1P2QA 2RA0A 1UHBA 3RXRA 2XBVA 4X0WU 1OWDA 1WQVH 2Z3DA 1ELCA 1A0JA 1GL0E 2FS9A 4YT6H 4BAQB 3KQCA 1V2UT 5L2ZH 1TQ0B 1DY9A 2VIQA 1G32B 4ZHAA 1ZSLA 1O3MA 4AFZA 1EQ9A 1VJ9U 1ZHPA 3A8BA 1SPJA 1K1MA 3EA9A 1V2QT 1GJ5H 5DP4A 1Y3XA 1ZYOA 3SORA 1C2LA 1TPAE 4DG4A 3RXVA 1FXYA 1TABE 4B74A 2ODYB 1FPHH 1HB0B 1FY8E 1NM6A 1DXWA 2BXTH 1V2MT 4Z0KA 1XVOA 1KXEA 1IQEA 2D26C 3S7KB 3FANA 3MNXA 4MNWA 2OBQA 2G4TA 8ESTE 1T8OA 4ZXYH 1YPMH 2QC2A 3MTYA 1A0HB 2BTCE 3A81A 1FNIA 2BLWA 4DURA 3LGVA 2CMYA 1FMGA 1MZDA 5K7RA 1V2WT 1O36A 2C90B 2A5IA 1P01A 4X1PU 2ZHDA 1TGTA 2Q1JA 3I78A 4AGKA 1LDTT 2H1UA 3Q3YA 1ELTA 5LPRA 3NXPA 1IQMA 3A8DA 2D1JA 1P2OA 1MAXA 1OP8A 2GX4A 3SZNA 4Y7AA 2ZQ2A 3E16B 2XBXA 4Q80A 1YM0A 3AASA 3T28A 3VFEA 1O3NA 1W0YH 3HK3B 3SW2B 1BJVA 1P2MA 1EZSC 1MKXH 1EB1H 4NIXA 1GJ4H 3B9FH 4TPYA 3ZVCA 2G81E 1YCPH 1JIRA 3RXHA 1A1RA 2P94A 2F9PA 3U69H 4I8LA 1LHCH 1GBMA 1O3OA 4KGAA 3MU5A 1EAWA 1ZR0A 2AFQB 1INCA 3SU3A 1HJAC 1EPTA 3RXOA 3SQEE 2FOBA 1V2RT 1GBEA 4IW4E 1DSTA 2O8TA 5DKMA 4A1TA 2AIPA 4BNRA 1GGDB 3KQEA 2ZU2A 3MMGA 3EGKH 4XSKU 5EXNA 1GVZA 1V2LT 5F8ZA 4A6LA 1XUKA 1VITH 4FUJA 3SUFA 3TJOA 4O3TA 4AFQA 4AN7A 1Z1IA 1UCYH 4O03A 3GISB 4XDEA 2CXVA 3AAUA 2GMTC 1CHOG 3TJVA 3ATKA 1Z6JH 4RKJB 2SNWA 4MDSA 1UTKA 4I8GA 1P06A 1PPBH 4YLQH 3TH2H 5C1YA 7GCHF 1Y59T 1C5SA 2XC4A 2FX6A 1EP5A 1FY1A 3RXIA 1EXFA 1GG6C 3SQHE 4VGCC 1VCWA 1ZGIA 2XTTB 2ANMH 2A32A 1GBJA