3ATMA

Crystal structure of trypsin complexed with 2-(1h-indol-3-yl)ethanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atmA02
1O2RA 1EPTA 1OSSA 1GBJA 1C4U2 1V2KT 1SGCA 3D62A 1SGRE 1Y8TA 3NKKA 1ELEE 2NWNA 2J2UA 4X2XA 2VIWA 4ZKOU 1B0FA 3RUOA 3U1IB 8KME2 1ESBA 5DP7A 3PROA 2Y80A 1RS0A 2OC0A 1AUTC 4VGCB 5GIBA 3SJKA 3K6YA 2Y5HA 1NN6A 4I8GA 3PMAB 1OKXA 3E91A 1DLKB 3MFJA 3P8FA 5F8TA 1MBQA 1TBQH 1O3IA 2OTVA 1O3JA 2QAAA 4NA7A 4MNYA 1O2PA 1HAVA 4AX9H 1MD8A 3MH4A 4X6MA 2GV7A 3ZVDA 4KELA 1NU7B 1TRMA 3F1SB 1ZJKA 1O38A 1XX9A 3A8CA 3LDXH 1DICA 2D2DA 2G52A 4AYVB 3BSQA 3RU4E 2H5DA 5FX5A 2W7UA 1O35A 3STJA 2CN0H 1W10U 1GI6A 4MNWA 1BQYA 3M3VA 2SGEE 3EA8A 3TJNA 1BIOA 2A2QH 4RN6A 1RGQA 2D1JA 3D23A 7GCHG 3GYMA 3PLPA 2ASUB 1GDQA 4Y79A 5F8ZA 2A7HA 1EB1H 3BTHE 1GVZA 4GVUA 2FOGA 2ODYB 2ALPA 3ENSB 5ABWA 3GDUA 1O2YA 2ZQ1A 2BTCE 3GCHC 4ESTE 3RXLA 1L1JA 1ZR0A 1QRZA 3T5FH 3QX5H 1MKWK 4DGJA 4NFEA 3SHCH 4ABBA 1IQKA 1MTNB 1GI4A 1DDJA 4Y10E 2PKSB 2FLRH 3AASA 1CHOG 2Y7ZA 1EUFA 4ZUHA 4MNVA 5FPYA 1O3AA 1HDTH 1DY8A 2FS9A 2HOBA 1CGHA 3Q3YA 2VU8E 1A0HB 2Y7XA 4TY7A 3UOUA 3UNQA 1DY9A 1O3EA 5FCKA 1V2ST 2UWLA 1MCVA 2G5NA 1ZSLA 1C1NA 2VVUA 3DHKH 1MKXH 3VB4A 1K1PA 5C20A 5GPIB 1HPGA 1ZSJA 2BDGA 2ESTE 4NG9H 1MH0A 1N1LA 3GCTG 3A7TA 5ESBA 1SLVB 3BV9B 3B9FH 2VWNA 4B75A 4AG2A 2BY5X 3RXKA 4ABGA 5JBBS 2FS8A 2C93B 3F68H 5EQRA 2XWAA 4TY6A 4INKA 1Z7KA 1A5IA 1C1UH 1HAPH 8LPRA 4CH8B 2QGRA 2FX6A 2A2XH 3SNDA 1FY1A 1HAIH 2A0QB 2V35A 2V0BA 3W94A 3LGVA 3PYHA 1O2NA 3KQCA 5AF9H 1FIWA 1QBOA 2WYJA 3OTJE 2VIPA 2BY9X 4FUBA 1LKAA 2GT8A 1Q3XA 1T8OA 4INLA 1FIZA 4XSKU 1SI5H 1P04A 1O2VA 1K9OE 1C5MD 1C1MA 4J1YA 3RXJA 4DVAU 1O5BB 3SJ8A 4Y8YA 1AB9B 1OWKA 3BIVH 1BRUP 4DIHH 1P12E 1O5GH 1QRXA 2OC1A 3SO3A 2BDCA 1P2OA 2ZGJA 3TVJB 1O3GA 3CS0A 5DP5A 3U69H 2H1UA 4UFGH 4H6TA 4IMQA 5DK1A 2YOLA 3M35A 1LQEA 1MAXA 4BXSA 1C2LA 4IMZA 1P01A 1HAYB 2AS9A 3PV4A 1OX1A 2DE9A 5EXNA 3RXUA 1SHHB 2Z7FE 4ABIA 2AERH 3HK6B 1Y3XA 3S9AA 1LTOA 4SGAE 1IQHA 1QNJA 1CVWH 1HLTH 2SFAA 2ZI2H 1YPHC 1CE5A 4X8VH 1GCDA 3MU5A 3NPSA 3PMBB 3V3MA 4CBNA 2TRMA 2THFB 3GY7A 3A7YA 2YNBA 3M3TA 1SQTA 1YGCH 3BIUH 1BJUA 4K1SA 1G32B 3VGCB 1IHSH 4A5TS 1AE8H 1C5SA 3SUGA 1UTJA 2SNVA 3EAJA 3UOPA 2BY6X 2VWOA 2W5EA 1ABJH 1TOMH 2KAIB 4THNH 3MU8A 4DG4A 3MTYA 2R3YA 4AB8A 2AMDA 1KDQB 2F9VA 1LCYA 3RXOA 3SV2H 4ABHA 1H8IH 1TPOA 2Q1JA 2G8TA 4BXWA 1NRRH 2Z6BD 3K6ZA 2RG3A 4MPXA 3T27A 4WJG2 4HI3A 3FANA 3E0PB 1AMHA 1TQ7B 2PKSC 2FI4E 3H7TA 4I7YH 5AVDA 1QHRB 4Y6DA 3FZDA 1TFXA 2RA3A 1PFXC 3KQDA 3M5NA 1TNGA 1H1BA 1OPHB 1TIOA 1DITH 3PWCA 2Z9KA 1K28D 1SOTA 1AWFH 1QL9A 5DGJA 1OWJA 1OWHA 2OD3B 3ZVCA 1LVYA 1IQMA 2HALA 1DXPA 1BBRH 4Y76A 1HAXB 1UMAH 1XXFA 2PUXB 5LH8A 5GWZA 1GVLA 1ACBE 2TGAA 1T7CA 4XDEA 1Z6JH 4OS5A 1LVMA 1LHCH 3S7KB 5SGAE 1TALA 1P06A 1EPTC 1GI3A 4YZUA 1NM6A 3GY2A 3MO9A 3UPEA 1HGTH 4YOJA 3RP2A 3U8OH 1BMMH 2QC2A 1D6WA 2AIPA 2TGPZ 4WF8A 3RXQA 2XC4A 2XW9A 4A1TA 4NA9H 1GHWH 4FUFA 1JXPA 4OGYA 3D49H 2BD3A 1RD3B 1IOEA 1XXDA 3OSYA 1TX7A 2PWXA 1ARBA 4UD9H 2ZHFH 5BRRE 1KXDA 1V2WT 4TPYA 1UO6A 1MAYA 1V6DA 3HGNA 4ABFA 1EATA 3QK1A 3BTDE 3PO1C 3JZ2B 2KAIA 3MO3A 4ZXXH 1A2CH 1RJXB 4XBDA 5F6MA 1TGSZ 4O9VA 1SLWB 2ZGHA 1P9UA 4I8HA 4UONA 2ZCHP 1ANDA 1SGDE 4LZ4B 2BVRH 1C2EA 2Y5GA 1NT1A 3F9GA 3QWCH 3RXSA 3TJUA 3SJ9A 1ZLRA 2BD4A 3SU2A 1SGFG 1YPGH 2JH6D 2ZP0H 5C1YA 1T8MA 1TPSA 3Q76A 1F2SE 1BDAA 2Q6DA 1ZRBA 3BTEE 4FUGA 1P09A 1V2LT 1ZGVA 2CHAB 4Q7YA 3RMLH 1GMCG 2FOFA 1EAIA 2VIVA 2YNAA 5BPEA 1NRPH 1AKSB 3LGUA 3KQBA 3BTFE 4BAKB 4FUJA 2ZDKA 4B1TA 3SU3A 4CRBA 4X0WU 1VCQA 2P95A 3Q00A 1GMDF 4AFUA 1ZSKA 1TX6A 1NZQH 4X6NA 3T29A 2PSXA 2ZFFH 1C5TA 1G3CA 4YOGA 2A4GA 2FZZA 1GMHG 5HYOA 2WINI 2BD9A 4X6PA 3FVFB 4X8SH 2FESH 1BRAA 1UVOA 1LHEH 3RDZA 2GMTC 2OUAA 1SGTA 3A88A 1XKAC 3BG4B 3LPRA 4NIWA 5K0HA 1GJ9B 2G81E 2AH4X 5ETXA 5DP8A 5GDSH 1O2HA 1TABE 1QJ6B 4Q7ZA 1DE7H 3PLBA 1EPTB 3P8OA 2ZIQH 1O3MA 1X7AC 3WY8A 1QA7A 2IOTA 3N7OA 3MNSA 4JYTA 1P03A 1G37A 3GY4A 1C5PA 1VCWA 1O3DA 1T4VH 2P93A 1PPCE 1TOCB 1YKTA 3RC5A 1PQAA 2BHGA 1JIMA 1TNLA 1ABIH 4ISOA 1KYNA 4AFSA 1O2SA 1GHBF 3LIWA 2CF8H 3P8NA 1NFUA 2QYIA 3QTOH 2GX4A 1C4Y2 4B2AA 3VXFH 1WCZA 2B7DH 1XUGA 3RXPA 2NU1E 1D3PB 1O3KA 5HGGA 1EP6A 1EOJA 4ZROA 1LO6A 4FVBA 2BVXH 1DANH 1VZQH 3E8LA 4JK6A 5EQQA 4WWYA 1W3CA 1QGFA 1SGEE 2FPZA 1HXEH 4AGJA 1DX5M 1ZYOA 3TK5A 1VJ9U 1KXCA 2D26C 2ANWA 1TBRH 2HGTH 3MNBA 2FMJA 1ZMNA 4Y8XA 1KLIH 5C1XA 1O0DH 3MOCA 1ZHRA 1MQ5A 2A5IA 2J95A 4X8TH 1P3EA 3L3TA 4Y8ZA 3S7HB 1CBWB 1DUEA 1F5LA 1SC8U 3BTME 2F9PA 2FOEA 2ANYA 3RXDA 1DPOA 1HFDA 3Q3KA 3K9XB 4YO9A 6LPRA 1O3PB 3LOXA 5JB8S 1C5XB 2A45B 3TGJE 3A84A 3BF6H 1CT2E 5HM9A 3ITIA 2R3UA 1UHBA 1UVUH 2VIOA 4RSPA 4TPIZ 2ANKH 2BXTH 1YM0A 3O8CA 2QA9E 2GCHG 3NWUA 5TCAA 2V3HH 1GHZA 2WPJS 1QY6A 1GBLA 1NPMA 2PHBA 3SHAH 1K1JA 1P2NA 1J17T 3K2UA 5EODA 3M61U 3TJVA 1FN8A 1C2MA 5GXPA 5I25A 2BX4A 2ZPSA 3BTWE 3KHVA 4D9RA 1M9UA 1DWEH 4X2VA 1A46H 2CMYA 3W95A 5C67A 3GY5A 5EQSA 4ZXYH 1DFPA 1C1SA 4NWLA 4X1RU 1EQ9A 5GCHF 4R8TB 1PQ5A 5E0GA 1WQVH 1O5FH 2JKHA 2WUCA 2ZC9H 4B76A 1CSOE 1HJAB 1BTHH 4GHQA 2H5CA 2SGPE 3ZZ3A 2A4RA 3M3SA 1BTXA 3ZV9A 1ELAA 4AFQA 1XUHA 2TIOA 1PYTD 2GTBA 1L1GA 5E2OA 2AEIH 1MUEB 2Z9JA 1F5KU 2VWLA 4CR5A 1O5EH 1OOKB 1YPHE 2XXLA 2A1DB 1LDTT 2GCTB 1SFIA 1WV7H 1C5OH 1MTWA 1G36A 2A31A 2GZ7A 3E0NB 3PTBA 2FODA 3PMHB 1V2UT 2B5TB 3A7VA 2VVCA 1Z6EA 3B23B 4NFFA 1L0ZA 3OU0A 4YOIA 3SJOA 1C2HA 3PWBA 4K1EA 1FN6A 2ZKSA 4I8JA 3GICB 1O34A 2ZCLP 2ZGXH 2PV9B 1O3HA 4AB9A 3ZZ8A 3FFGA 2VIQA 3SUFA 5FXLA 1LMWB 1INCA 1ELGA 2WV4A 1TLDA 3H5CB 1A4WH 1UCYH 1C5RA 1HCGA 1J15A 1V3XA 1HAGE 4K3JA 1C1VH 1GMDG 2OLGA 2ZGCA 3ODFA 3MO6A 2Z9IA 1CGJE 2H2ZA 4KTUA 2WYGA 5DKMA 1E37B 1KDQA 3L6PA 3MU4A 4X1NU 1CA8B 1YF4A 1O5AB 3SV9A 4U2WA 1FLEE 3SU0A 1LHFH 2CXVA 1UJ1A 3E16B 3A80A 1A0JA 1BMAA 1KXFA 3U8TH 3T26A 4WY3A 1BTYA 1NS3A 5JPMH 1TNHA 3GCOA 1T32A 3A89A 2FM2A 2RCEA 5DP3A 4CREA 1YLDA 1P05A 4CRCA 1Y3WA 1MTNC 2XYAA 1ESAA 1MQ6A 8ESTE 2OQ5A 4JYVH 2SGQE 3GCHB 1SVPA 3RXAA 2BD7A 1MD7A 4MPWA 1F0RA 1BTWA 1N8OC 1YLCA 2PTCE 1C2DA 3SQHE 2XC5A 3RXTA 3VB5A 1Z1JA 3RLWH 4MPVA 2J94A 4FU7A 1TX8A 1PPFE 1JRTA 1ZRKA 3PLKA 1HRTH 1FY8E 3ZZ5A 4GHTA 1P2KA 3A7ZA 1GBMA 4UEHH 1CU1A 2ZDLA 3C27B 2UUKB 1O2LA 2C90B 4IC6A 4NZQA 3M5LA 4FXGH 5IYTA 1FI8A 3T62A 3SU4A 3TGIE 3QTVH 3CENA 4I32A 2WPLS 4O3TA 1C5WB 1QL7A 2HPPH 3NXPA 5A0AE 2J38A 1V2QT 1IQNA 4B71A 3RXIA 3SUDA 2W3KA 1IQJA 2FLBH 2VB0A 3ZVGA 2WPKS 2ZFTA 1MU6B 2IN2A 1NO9H 2XBWA 4H42U 7KMEH 1O2JA 2JETB 2QXHA 3TIUA 3DD2H 1TE0A 2HVXA 3HGPA 3ZVFA 1C5UA 1AU8A 1EB2A 2JH5D 1NTPA 4UFDH 2PGBB 1C5NH 2ZHDA 2F9NA 1UTPA 2XBXA 1BRBE 1EX3A 2PSYA 1DUAA 2P8OB 1ANCA 3UREA 3ODDA 2HNTE 1PPZA 2AGGX 1BMLA 1O2MA 3EYDA 1MU8B 2R0LA 1BCUH 2ZEBA 1PQ7A 1V2PT 3PO1B 3TK6A 4X1SU 1KXEA 3TH2H 2EI6A 1CHGA 5DP6A 3I77A 2Y82A 3ATLA 1FUJA 3AAUA 4BANB 7ESTE 1PPGE 2W7SA 2TPIZ 1A3EH 3GY3A 1TYNA 2W26A 5A8XA 4GCHG 3MWIU 1O3CA 1V2JT 2FYRA 3K65B 1G3EA 2ZHQH 1UTLM 1W0YH 4BTTB 1TPPA 3P92A 1Q31A 1DWBH 2FEQH 3KF2A 1G3DA 1WYKA 4K69A 1GBIA 1Y5UT 2J4IA 1D6RA 3RM2H 8GCHF 1S0QA 2Y81A 5JB9S 2A5AA 3QZQA 3T28A 1S6HA 1GG6C 3O8RA 1UVPA 4ASHA 4D7GA 3A7XA 4I33A 2PKAB 1WOFA 3IG6B 2GVFA 1SGYE 3EQ0H 2RDLA 3E3TA 4Q2KA 5G4BA 2UWOA 2AMQA 3UWIA 5EXMA 5LGOA 1G3BA 1TGBA 3ATKA 2ZQ2A 2ZU2A 4NA8A 4A1XA 2XBYA 5AFYH 1IQIA 1GBAA 1K21H 2IJOB 1GG6B 5FPSA 5EPYA 1FDPA 1ETTH 3ZZ9A 3KL6A 3EE0B 1EZUC 2Z9GA 2A4OA 2BOHB 2FWWA 1TRNA 1TRYA 1SFQB 4QT8C 1BHXF 1OS8A 1YPMH 3RXCA 3KQEA 1ZTJA 3I29A 2VJ1A 1DVAH 1Z8IB 2SGFE 1CGIE 2F83A 3S9BA 2BDYA 2ZHEH 3RC4A 4NIYA 6ESTA 2WPIS 1RIWB 1G2MA 1HB0B 2VIDA 4I8KA 1DLEA 5JBTA 1V2NT 1OWEA 2OINA 2QF0A 3E90B 1ELBA 2LPRA 4CRDA 1GI9B 1ZMJA 3UQOA 4JZFH 1QL8A 5E0HA 1H9HE 2P16A 1ZMLA 3SU6A 1W11U 2ODQA 2NU0E 4OS7A 1EJNA 2Q6GA 1ZPBA 1CHOF 2ANMH 3MH7A 4HGCA 1GI1A 3GDSA 1JOUB 1W13U 2CV3A 1QJ7B 1EZXC 4PROA 1L1NA 3TPIZ 1QTFA 2QN5T 4WXIA 2XCNA 1EKBB 3OX7U 1ZTKA 4CHAC 6CHAC 1BT7A 1F92A 1GBBA 1EP5A 4A7IB 5EW2H 1C5ZB 5DPAA 1SR5C 2GZ9A 3LC3A 1EOLA 1YCPK 1JIRA 1K1OA 4DJZB 1C1PA 1F0UA 2BLWA 4K8YA 2FOAA 3F9FA 1FV9A 1FZZA 2I6QA 2BZAA 2VWMA 1CA0B 2ZECA 3MYWA 5FX6A 5E8EH 1O2OA 1GWAA 2BMGB 2ZZUH 4MTBA 3S9CA 1F7ZA 1VITG 2JETC 4XFQA 4MNXA 1MBMA 3VEQB 4AN7A 2AGIX 9ESTA 1IQEA 3RXBA 5IDKA 1LVOA 2F9OA 4KGAA 1WBGB 2EC9H 3SNAA 1AVXA 4Y11E 1P2IA 2GDDA 1Z1IA 1XKBC 3RLYH 1GMHF 1VITF 2GZ8A 3QGJA 1GJAB 3V0XA 3RU4D 1ZTLA 1GI8B 2ZGBH 2TGDA 1C9PA 2EI7A 1JWTA 1ANBA 2SNWA 4LOYH 3FAOA 3ATMA 5L30H 1YCPM 2B9LA 3LKWA 3TNSA 1ORFA 1O2WA 5GCHG 3RXFA 2PLXA 1BTUA 4ZKNU 1XMNB 3KGPA 3KCGH 5FHTA 3LJOA 2PKAA 5A0BA 4I31A 3A8DA 4A1VA 2XCFA 3BN9A 1V2RT 1K22H 3LGYA 3V12A 1UK4A 4Y0YE 1SL3A 5FPTA 4JCNA 3BTTE 2BLOA 1FY5A 1H9IE 3LGIA 1F5RA 3AVZA 4A6LA 3ZZ4A 3BG8A 2FOMB 2QXIA 5HXFA 4XBBA 3SV8A 2BY7X 1BMNH 5C3NA 1O30A 3F9HA 1Z8JB 1KLTA 4U30A 2AYWA 3HATH 4MG3A 1ESTA 4D9QA 3UNRA 1S81A 1TMTH 4DW2U 2XWBI 1UCYE 1VGCC 2HLCA 4ZAEA 1MTVA 1YP9A 6GCHG 1L2EA 3MI4A 1HAVB 2G4UA 1W7XH 3QZRA 2ILNA 1AVWA 2BYAX 2UUJB 2BDHA 1HIAA 2NU3E 3OY6U 3GOVB 2P3TB 2K1QA 4ABAA 1P8VC 1N6XA 1OYQA 4JMYA 4UFFH 3AAVA 1GBEA 2AIQA 3SU5A 2F3CE 3VPKA 1HAHH 1UTNA 2QF3A 2OQUA 1B5GH 3UNSA 3SNCA 3U98H 1AGJA 1O36A 1Y59T 2P59A 3MNCA 3P6ZB 2G00A 3S69A 3P95A 3NUMA 3VGCC 5EPNA 4NIVA 3ZZ6A 1ZHPA 3RM0H 1P2QA 2CF9H 1W12U 3KEEA 8GCHG 2BD2A 1A5GH 1PPHE 2QXGA 1ELTA 1SSXA 1YPJH 3TH4H 1NC6A 1BZXE 1GHXH 1XUIA 1Y5BT 1FQ3A 2VGCB 1O2IA 1ELCA 1UCYK 5FBEA 1ZPZA 1GBHA 1FXYA 1TAWA 4X2WA 2ZA5A 1ZHMA 2GCTC 2HNTC 3M7QA 5TJXA 1CO7E 3BTGE 3M5OA 1BUIA 3SU1A 5FCRA 4DIIH 3DUXH 2AGEX 2BQ7B 5AHGH 2A5KA 4K5ZA 4K60A 1AZ8A 3IITA 4BAQB 1SG8B 2UUFB 4NCYA 3TJOA 1QQUA 2C8XB 4IW4E 2FI5E 4FVDA 1BJVA 3GCNA 1LPKB 2O8MA 5A0CA 1TNJA 2OC7A 1GDUA 3GCTF 4ZMAH 1PYTC 4BTIB 1C9TA 2XTTB 4Y7BA 3CS7A 3RMOH 1T31A 3MMGA 1BTPA 2ZU1A 3FZZA 1SB1H 3RMNH 5AFZH 1SLXB 2LNCA 1DSTA 1C1WH 3MHWU 1S5SA 3HK3B 1E34B 2BDBA 1GI7B 2VGCC 4Z6AH 5E2PA 1K2I1 3DT0H 1ELFA 2C3SA 3SI3H 1N6YA 1CBWC 4DURA 3FP6E 2M5TA 4ZHLU 5T6GA 2PFEA 6GCHF 3SGAE 3SV7A 2R2WU 2A32A 3NK8A 2SGDE 1Y3VA 1NY22 1C4V2 4E7NA 4HTCH 4OS2A 2JH0D 4ABJA 1Y5AT 1G2LA 1E36B 1HXFH 1GMCF 1V2VT 2R2MB 2W3IA 1L4DA 3G01A 1OWDA 2WPMS 2GD4B 3ZZDA 2OXSA 1NRSH 1PQ8A 4WMFA 2ALVA 2BDAA 1SHYA 3VB7A 1QJ1B 1AWHB 1EASA 1WQSA 3UWJH 4BAMB 3NZIA 3EGKH 3S0NA 2VINA 1C1QA 1AY6H 3GY8A 1WUNH 3VFEA 1NFYA 1GJBB 2BZ6H 4ISIH 4B2CA 3TU7H 1QBVH 3F6UH 1K1MA 1O2TA 1CQQA 1VGCB 1TMBH 1SGQE 3C1KA 1OXGA 1H9LB 3M7TA 1Y3YA 5C2ZA 5FAHA 1C2KA 5HM2A 1TMUH 2BB4A 4OS4A 2FYQA 1UTQA 3A7WA 1O3LA 3M7UA 1T8LA 4K8BA 3SV6A 4H6SB 1A0LA 1VR1H 1PJPA 4GPGA 4D76A 2QY0B 2HWLB 3TITA 1FY4A 1QCPA 2R0KA 2C8WB 2FIRH 4Q80A 1MZDA 2BQWB 3TH3H 4RKOB 3O8BA 1ZJDA 2CGAA 1EJMA 4YT7H 1WTGH 3VB3A 2FP7B 4D8NA 2GMTB 1EXFA 1HJ9A 2FTLE 4NZLA 1GHAF 1HIAB 3OY5U 3SORA 1XUFA 1GJ4H 5PTPA 1Q2WA 2OBQA 1QBNA 1V2TT 2PGQB 2QV1A 4TWYA 1XUKA 4IS5A 1O3NA 3HKJB 5J4QA 3ZV8A 4AG1A 1GGDB 3BTKE 3JZ1B 5JBAS 2F9BH 1ANEA 1KSNA 1K1LA 1B7XB 1O5CB 1WU1A 1C1OA 1GJ6A 1TGCA 1FAXA 4ZKRU 2CHAC 3GY6A 1T8NA 4AORA 1CT0E 1C2GA 1HAZB 4AOQA 1U6QA 1HYLA 1ZPCA 1NRQH 3QN7A 3V13A 1IQGA 4YESB 1TA2A 3SJIA 1UHBB 3Q3XA 4VGCC 2P8OC 1QA0A 3OYPA 1CT4E 2J92A 1C2IA 3PTNA 3SN8A 5FBIA 2D8WA 1C2FA 1C5YB 2IPHA 2ZDNA 4ABEA 5C1UA 2ZU3A 4MPUA 1PPEE 2Y5FA 2ZG0H 4ISLA 2B0FA 4YT6H 2BD8A 4BAOB 4AFZA 1J9CH 1QQ4A 1SGPE 3EA9A 5EG4A 3LONA 2ZPRA 3MNXA 5LPFA 4Q7XA 2DUCA 4CHAB 3LGTA 2HPQH 1O3BA 1A7SA 1AZZA 3H7OA 2GV6A 4O3UA 3LH1A 2GKVE 4BOHA 1GL0E 4FU8A 1EAUA 4YM9A 2C8ZB 5C5OA 3UY9A 2PW8H 3ZYDA 1A3BH 5JBCS 2Q6FA 5T6FA 3UR9A 1ETSH 1DOJA 1GJ5H 1S85A 1OP8A 3BEUA 4RKJB 2EA3A 3A82A 4GUXA 3SI4H 1RTLA 3ATWA 1C1TA 4WMDA 3LJJA 4OS1A 3FP8E 3ESTA 3RXVA 3A83A 4SGBE 1SGFA 4CH2B 4WMEA 4LK4A 1GHYH 4CRGA 1SPJA 3IWMA 3LC5A 1TNKA 5ESTE 3A8AA 3ZZAA 5A2MH 1TWXB 4ZKSU 3GDVA 1XM1A 1BBRE 2VH6A 3NCLA 1P0SH 3ATIA 1O33A 2BQ6B 3BEIB 4JZ1A 3ZVBA 4U32A 1GGDC 1MCTA 1GBDA 4JZDH 5GJ4B 3V7TA 2EEKA 2FOBA 4DY7B 2ZU5A 2PR3A 1JRSA 1Z71A 1P11E 1SGNE 5I46H 3LGWA 3UUZA 5L2ZH 4XBCA 1UTOA 1LVBA 3P70B 2G55A 2AFQB 3B8JA 2FI3E 1TGNA 2NU4E 4H4FA 1BTZA 4IBLH 5DP9A 1W14U 1O39A 3SNEA 4OS6A 5C5NA 1O3OA 1P3CA 3RMMH 1BITA 4M7GA 5DP4A 1GHAG 4E7RG 4X1QU 1SGIB 1ARCA 4FUIA 1GI2A 3QLPH 3RXHA 4WH8A 4GAWA 1HAOH 1P02A 1O31A 4X8UH 1GBTA 1ELVA 3T25A 1G30B 3RXMA 1O2GH 3RC6A 1NFWA 1Z8GA 2PUQH 1AFQC 3E1XB 2FXRA 2CJIA 1GBKA 2FOHA 3CP7A 1HNEE 2ZDVH 1GL1A 1MTUA 4NGAH 4Y7AA 1AIXH 4CRFA 2V3OH 1O5DH 2STAE 2PTNA 4IGDA 1GBFA 2STBE 4A92A 1FNIA 1LQDB 1QURH 4IN1A 2XRCA 1THRH 3SQEE 4O03A 1V2MT 1W8BH 2I6SA 1LPGB 1GBCA 2VH0A 5JYIA 1TQ0B 4Z0KA 1AE5A 4WH6A 1K1IA 1XUJA 4D7FA 5J4SA 1XVMA 5T6DA 3M36A 3SZNA 4KTCA 5EXLA 2H9TH 4J2YB 1FAKH 1SQAA 3RXGA 1D3QB 4YTAA 2H9EH 1IAUA 1MKWH 2GGVB 1KTSB 4F4OC 1IQLA 5A8YA 1EZQA 2H9HA 1KY9A 1AB9C 2ULLA 2P3FH 1S84A 1AFEH 4ZH8A 4WXVA 5B6OA 1BOQA 1O3FA 1GI5A 3BTQE 3URCA 1AI8H 4X6OA 3ZZ7A 1FONA 4TYDA 1TONA 3MU0A 4X2YA 3GISB 4K1TA 4HZHA 1BA8B 1GCTC 3A87A 4AYYB 1GVKB 2J9NA 3RXRA 1T4UH 1P57B 2O8WA 2FO9A 3SW2B 5L2YH 4FU9A 1E38B 2RA0A 4BNRA 3RXEA 5HMAA 1P10A 1QIXB 2EI8A 3VXEH 1AUJA 2ZFQH 4KKDA 1F0SA 1EJAA 1P9SA 1D3TB 4BAHB 5DG6A 1QFKH 2OP9A 2ZCKP 4CBOA 5E0JA 4YLUA 1L4ZA 1SBWA 3L33A 2ZTXA 1JMOH 3SGBE 1P2MA 1ZZZA 4OGXA 1KXAA 2UWPA 3QUMP 4XOJA 3TGKE 1TA6A 4DOQA 1THSH 2VVVA 1KXBA 1N8OB 1DS2E 4X1PU 1G9IE 1GJDB 1O2UA 2WPHS 3F9EA 5EGMA 4U01A 2ZFSA 2XBVA 5F03A 1TNIA 2BX3A 4NWKA 1KTTB 2Z3EA 3A85A 2QCYA 1AFQB 1O2KA 1THPB 7LPRA 3UQVA 4F49A 3EA7A 9LPRA 4B2BA 3SOSA 1P2JA 3P17H 4UE7H 1MKXK 4IC5A 2BVSH 1EAXA 2A7CA 1WAYB 1UVTH 1VITH 1UTMA 3TLOA 5LPEA 3R3GB 3SGQE 3M5MA 1O2XA 1YPLH 1NRNH 4FUEA 4B73A 3KNXA 1DWDH 2HRVA 2XNIA 3RU4T 3MH6A 3T2NA 3SBKA 4Y0ZE 4XE4A 1A5HA 1IHTH 7GCHF 1VCPA 1SMFE 2G4TA 1GHVH 4BTUB 4R0IA 5EU8A 2G5VA 3A86A 4NSYA 4ABDA 2ZPQA 2TGTA 1J8AA 1C5VA 1FJSA 1JBUH 1NU9A 1UK2A 4JK5A 1RXPA 1A61H 2ZDAH 3P8GA 1RTFB 2OC8A 2ZFRH 4MDSA 1AKSA 3TNTA 1D9IA 1EAWA 1OYTH 4JYUH 3TK9A 2BD5A 2A7JA 1O32A 2O9QA 2R9PA 1GJ7B 3DFLA 1LKBA 1GPZA 3UR6A 1YC0A 2ZDMA 2P94A 5EW1H 4KTSA 3BG4C 5DO4H 1H4WA 1NFXA 4GSOA 1ID5H 4E05H 5CE1A 3ZVAA 2AMPA 1FMGA 2ZU4A 3QO6A 1UK3A 3PM3A 1C5LH 1GHBG 1GJ8B 1O2ZA 3KN2A 3R0FA 4E06H 2BLQA 1LHGH 1SQOA 1BHXB 2ZTZA 3STIA 1F0TA 1J16A 3U1JB 1GDNA 1HV7A 2F9UA 1CA0C 3E6PH 2GCHF 4ISHH 3I78A 3DA9B 5JDUB 1AHTH 1HJAC 1ELDE 1GCTB 1IQFA 1MMJN 5LPRA 3SNBA 2GT7A 1C2JA 1H8DH 1RRKA 4AZ2B 3AW1A 1MZAA 1RFNA 1J14A 1W0ZU 1S82A 2Z3DA 2ZHWH 1DSUA 2DE8A 3LH3A 1LHDH 2BLVA 3QGNB 4FUHA 3HKIB 1WSSH 5CMXH 1TPAE 4NSVA 2WV5A 2QXJA 4CRAA 1QB1A 1S0RA 2BOKA 2BM2A 1S6FA 1V2OT 3ZVEA 2Y6TA 2ZF0H 2VNTA 1K1NA 1OP2A 3SUEA 2BDIA 1SLUB 3GYLB 2C4FH 3A81A 4UDWH 5DJ7A 3LU9B 5K7RA 1FY3A 6CHAB 2O8LA 1XVOA 4GLYA 4INHA 4ZHMU 3PMJA 1BRCE 1QR3E 2WUBA 1RTKA 4NIXA 3ZZCA 1QB9A 1ZGIA 2J34A 2TBSA 1QB6A 4JZIA 1YYY1 1KLJH 1RIWC 2GDEH 3Q77A 1ZOMA 1OP0A 1FPHH 1TGTA 2C8YB 3QDZB 1UTKA 2O8TA 5F8XA 1C5QA 4MLFB 4CR9A 3HPTB 4KP0A 1QRWA 5L6NH 1OWIA 4Y71A 1AN1E 2B8OH 1WTHD 2Z94A 5A8ZA 2ZO3H 3MU1A 1YBWA 1DM4B 1BB0B 4YLQH 1HUTH 4ZHAA 1SOZA 1HBTH 5CHAB 2O8UA 3M37A 1VJAU 1DWCH 4FUCA 4HFPB 2OBOA 1DT2A 1NESE 4I8LA 2OCVB 5TCCA 2HNTF 3PB1E 2QIQA 1D4PB 2H6MA 3LT3A 2A4QA 1GJCB 1YPKH 4ISNA 1BBRK 3U9AH 1D3DB 1W7GH 2ZTYA 3FP7E 1Z8RA 5CHAC 1AQ7A 3KIDU 1KIGH 3URDA 1AD8H 4LXBH 3D65E 4JZEH 1LPZB 2V6NA 1S83A 4MQAA 4UFEH 4GCHF 2Z3CA 2ZNKH 4AGKA 1FPCH 2P3UB 2GP9B 4DCDA 1C1RA 2FDAA 3AW0A 1E0FD 3MH5A 2BY8X 1B0EA 3O8DA 5EOKA 1AVGH 1GI0A 3UIRA 1O2QA 2Z9LA 2FOCA 2ZWLH 4MVNA 3ZZBA 3ELAH 1NROH 2ZFPH 3ZYEA 1O37A 2SGAA 4IN2A 5A09A 1ETRH 1PPBH 2NU2E 4K2YA 4DT7B 1TB6H 2FTMA 1YPEH 1UVSH 1W2KH 4B74A 4TWWA 1HJ8A 2XC0A 3BEFB 4WVPE 2ODPA 1A1RA 3UTUH 3EDXB 3VB6A 4O97A 1EZSC 2F91A 2G51A 1MTSA 1YCPH 5H4IB 2FX4A 1DXWA 1TBZH 1E35B 5T3HA 2BXUH 3UFAA 3A8BA 1Y3UA 3DFJA 2UUYA 1AO5A 4LZ1H 3U8RH 4FUDA
chains in the Genus database with same CATH superfamily
1O2RA 1EPTA 1OSSA 1GBJA 1C4U2 1V2KT 1SGCA 2WZQA 3D62A 1SGRE 1Y8TA 3NKKA 1ELEE 2NWNA 2J2UA 4X2XA 2VIWA 4ZKOU 1B0FA 3RUOA 3U1IB 8KME2 1ESBA 5DP7A 3PROA 2HVYB 2Y80A 1RS0A 2OC0A 1AUTC 4VGCB 5GIBA 3SJKA 3K6YA 2Y5HA 1NN6A 4I8GA 3PMAB 1OKXA 3E91A 1DLKB 3MFJA 3P8FA 5F8TA 1MBQA 1TBQH 1O3IA 2OTVA 1O3JA 2QAAA 4NA7A 4MNYA 2XNDD 1O2PA 1HAVA 4AX9H 1MD8A 3MH4A 4X6MA 2GV7A 3ZVDA 4KELA 4I86A 1NU7B 3FO8D 1TRMA 3F1SB 1ZJKA 1O38A 1XX9A 3A8CA 3LDXH 1DICA 2D2DA 3MQKC 2G52A 4AYVB 3BSQA 3RU4E 2H5DA 5FX5A 2W7UA 1O35A 3STJA 2CN0H 1W10U 1GI6A 4MNWA 1BQYA 3M3VA 2SGEE 3EA8A 3TJNA 1BIOA 2A2QH 4RN6A 1RGQA 2D1JA 3D23A 7GCHG 3GYMA 3PLPA 2ASUB 1GDQA 4XD7D 4Y79A 5F8ZA 2A7HA 1EB1H 3BTHE 1GVZA 4GVUA 2FOGA 2ODYB 2ALPA 3ENSB 5ABWA 3GDUA 1O2YA 2ZQ1A 2BTCE 3GCHC 4ESTE 3RXLA 1L1JA 1ZR0A 1QRZA 3T5FH 3QX5H 1MKWK 4DGJA 4NFEA 3SHCH 4ABBA 1IQKA 5C0UA 1MTNB 1GI4A 2YMSC 1DDJA 4Y10E 2PKSB 2FLRH 3AASA 1CHOG 2Y7ZA 1EUFA 4ZUHA 1YY3A 4MNVA 5FPYA 1O3AA 1HDTH 1DY8A 2FS9A 2HOBA 1CGHA 3Q3YA 2VU8E 1A0HB 2Y7XA 4TY7A 3UOUA 3UNQA 1DY9A 1O3EA 5FCKA 1V2ST 2UWLA 1MCVA 2G5NA 1ZSLA 1C1NA 2VVUA 3DHKH 1MKXH 3VB4A 1K1PA 5C20A 5GPIB 1HPGA 1ZSJA 2BDGA 2ESTE 4NG9H 1MH0A 1N1LA 3GCTG 3A7TA 5ESBA 1SLVB 3BV9B 3B9FH 1BMFD 2VWNA 4B75A 4AG2A 2BY5X 3RXKA 4ABGA 5EJLA 5JBBS 2FS8A 2C93B 3F68H 5EQRA 2XWAA 4TY6A 4INKA 1Z7KA 1A5IA 1C1UH 1HAPH 8LPRA 4CH8B 2QGRA 2FX6A 2A2XH 3SNDA 2V3MA 1FY1A 1HAIH 2A0QB 2V35A 3DSOA 2V0BA 2F4LA 3W94A 3LGVA 3PYHA 1O2NA 3KQCA 5AF9H 1FIWA 1QBOA 2WYJA 3OTJE 2VIPA 2BY9X 4FUBA 1LKAA 2GT8A 1Q3XA 1T8OA 4INLA 1FIZA 4XSKU 1SI5H 1P04A 5B6LA 1O2VA 1K9OE 1C5MD 1C1MA 4J1YA 3RXJA 4DVAU 1O5BB 4P02A 3SJ8A 4Y8YA 5CDFE 1AB9B 1OWKA 3BIVH 1BRUP 4DIHH 1P12E 1O5GH 1QRXA 2OC1A 3SO3A 2BDCA 1P2OA 2ZGJA 4P00A 3TVJB 1O3GA 3CS0A 5DP5A 3U69H 2H1UA 4UFGH 4H6TA 4IMQA 5DK1A 2YOLA 3M35A 1LQEA 2KX4A 1MAXA 3PV2A 1C2LA 4IMZA 4BXSA 2KCOA 1P01A 1HAYB 2AS9A 3PV4A 4RT1A 1OX1A 2KFWA 2DE9A 5EXNA 3RXUA 1SHHB 2Z7FE 4ABIA 2AERH 3HK6B 2VBCA 1Y3XA 3S9AA 1LTOA 4SGAE 1IQHA 1QNJA 1CVWH 1HLTH 2SFAA 2ZI2H 1YPHC 1CE5A 4X8VH 1GCDA 3MU5A 3NPSA 3PMBB 3V3MA 4CBNA 2TRMA 2THFB 3GY7A 3A7YA 2YNBA 3M3TA 1SQTA 1YGCH 5EJ1A 3BIUH 1BJUA 4K1SA 1G32B 3VGCB 1IHSH 4A5TS 4ASUD 1AE8H 1C5SA 3SUGA 4B6EA 1UTJA 2SNVA 3EAJA 3UOPA 2BY6X 2VWOA 2W5EA 1ABJH 1TOMH 2KAIB 4THNH 3MU8A 4DG4A 3MTYA 2R3YA 1SQRA 4AB8A 3NRLA 2AMDA 2IPQX 1KDQB 2F9VA 1LCYA 3RXOA 3SV2H 4ABHA 1H8IH 1TPOA 2Q1JA 2G8TA 4BXWA 1NRRH 4Z1MD 2Z6BD 3K6ZA 2RG3A 4MPXA 3T27A 4WJG2 4HI3A 3FANA 3E0PB 1AMHA 1TQ7B 2PKSC 2FI4E 3H7TA 4RT0A 4I7YH 5AVDA 1QHRB 4Y6DA 3FZDA 1TFXA 2RA3A 1PFXC 3KQDA 3M5NA 1TNGA 1H1BA 1OPHB 1TIOA 4F55A 1DITH 3PWCA 3KYGA 2Z9KA 1K28D 1W0KD 1SOTA 1AWFH 1QL9A 5DGJA 1OWJA 1OWHA 2OD3B 3ZVCA 1LVYA 1IQMA 2HALA 1DXPA 1BBRH 4Y76A 1HAXB 1UMAH 1XXFA 2PUXB 5LH8A 5GWZA 1GVLA 1ACBE 2TGAA 2OK5A 1T7CA 4XDEA 1Z6JH 4OS5A 1LVMA 1LHCH 3S7KB 5SGAE 1TALA 1P06A 1EPTC 1GI3A 4YZUA 1NM6A 3GY2A 3MO9A 3UPEA 1HGTH 4YOJA 3RP2A 3U8OH 1BMMH 3CNRA 2QC2A 1D6WA 2AIPA 2TGPZ 4WF8A 2J97A 2XC4A 2XW9A 3RXQA 4NA9H 4A1TA 1GHWH 4FUFA 1JXPA 4OGYA 3D49H 2BD3A 1RD3B 1IOEA 1XXDA 3OSYA 1TX7A 2PWXA 2V7QD 1ARBA 4UD9H 2ZHFH 5BRRE 1KXDA 1V2WT 4TPYA 1H8HD 1UO6A 1MAYA 1V6DA 3HGNA 4ABFA 1EATA 3QK1A 1YWUA 3BTDE 3PO1C 3JZ2B 2KAIA 3MO3A 4ZXXH 1A2CH 1RJXB 4XBDA 5F6MA 1TGSZ 4O9VA 1SLWB 2ZGHA 1P9UA 4I8HA 4UONA 2ZCHP 1ANDA 1SGDE 4LZ4B 2BVRH 1C2EA 2Y5GA 1NT1A 3F9GA 3QWCH 3RXSA 3TJUA 3SJ9A 1ZLRA 2BD4A 3SU2A 1SGFG 1YPGH 2JH6D 2ZP0H 5C1YA 1T8MA 1TPSA 3Q76A 1F2SE 1BDAA 2Q6DA 1ZRBA 3BTEE 3W1EA 4FUGA 1P09A 1V2LT 1ZGVA 2CHAB 4Q7YA 3RMLH 1GMCG 2FOFA 1EAIA 2VIVA 2YNAA 3DCLA 5BPEA 2J5UA 1NRPH 1AKSB 3LGUA 3KQBA 3BTFE 4BAKB 2F43B 4FUJA 2ZDKA 4B1TA 3SU3A 4CRBA 4X0WU 1VCQA 2P95A 3Q00A 1GMDF 4AFUA 1ZSKA 1TX6A 1NZQH 4X6NA 3T29A 2PSXA 2ZFFH 1C5TA 1G3CA 4YOGA 2A4GA 2FZZA 1GMHG 5HYOA 2WINI 2BD9A 4X6PA 3FVFB 4X8SH 2FESH 1BRAA 1UVOA 1LHEH 3RDZA 2GMTC 2OUAA 1SGTA 3A88A 1XKAC 3BG4B 3LPRA 4NIWA 5K0HA 1GJ9B 2G81E 2AH4X 2XOKD 5DP8A 5ETXA 5GDSH 1O2HA 1TABE 1QJ6B 4Q7ZA 1DE7H 3PLBA 1EPTB 3P8OA 4FOUC 2ZIQH 1O3MA 1X7AC 3WY8A 1QA7A 2IOTA 3N7OA 3MNSA 4JYTA 1P03A 1G37A 3GY4A 1C5PA 1VCWA 1O3DA 1T4VH 2P93A 1PPCE 1TOCB 1YKTA 3RC5A 1PQAA 2BHGA 1JIMA 5CHBA 1TNLA 1ABIH 4ISOA 1KYNA 4AFSA 2W6ID 1O2SA 1GHBF 3LIWA 2CF8H 3P8NA 1NFUA 2QYIA 3QTOH 2GX4A 1C4Y2 4B2AA 3VXFH 1WCZA 2B7DH 1XUGA 3RXPA 2NU1E 1D3PB 1O3KA 5HGGA 1EP6A 1EOJA 4ZROA 1LO6A 4FVBA 2BVXH 1DANH 3SYJA 1VZQH 3E8LA 4JK6A 5EQQA 4WWYA 1W3CA 1QGFA 1SGEE 2FPZA 1HXEH 4AGJA 3OAAD 1DX5M 1ZYOA 3TK5A 1VJ9U 1KXCA 2D26C 2ANWA 1TBRH 2HGTH 3MNBA 2FMJA 1ZMNA 4Y8XA 1KLIH 5C1XA 1O0DH 3MOCA 1ZHRA 1MQ5A 2A5IA 2J95A 4X8TH 1P3EA 3L3TA 4Y8ZA 3S7HB 1CBWB 1DUEA 1F5LA 1SC8U 3BTME 2F9PA 2FOEA 2ANYA 3RXDA 1DPOA 1HFDA 3Q3KA 3K9XB 4YO9A 6LPRA 1O3PB 3LOXA 5JB8S 1C5XB 2A45B 3TGJE 3A84A 3BF6H 1CT2E 5HM9A 3ITIA 2R3UA 1UHBA 1UVUH 2VIOA 4RSPA 4TPIZ 2ANKH 2BXTH 1YM0A 3O8CA 2QA9E 2GCHG 3NWUA 5TCAA 2V3HH 3UB0A 3WW7A 1GHZA 2WV9A 2WPJS 1QY6A 1GBLA 3DSGA 4B6FA 1NPMA 2PHBA 3SHAH 1K1JA 1P2NA 2J98A 1J17T 3K2UA 5EODA 3M61U 3TJVA 1FN8A 1C2MA 5GXPA 5I25A 2BX4A 2ZPSA 3BTWE 3KHVA 4D9RA 1M9UA 1DWEH 3DSPA 4X2VA 1A46H 2CMYA 1K0HA 3W95A 5C67A 3GY5A 1WDIA 5EQSA 4ZXYH 1DFPA 1C1SA 4NWLA 4X1RU 1EQ9A 5GCHF 4R8TB 1PQ5A 5E0GA 1WQVH 1O5FH 2JKHA 2WUCA 2ZC9H 4B76A 1CSOE 1HJAB 2JJ2D 1BTHH 3FKSD 2H5CA 4GHQA 2SGPE 3ZZ3A 2A4RA 3M3SA 1BTXA 3ZV9A 5GNDA 1ELAA 4AC9A 4AFQA 1XUHA 2TIOA 1PYTD 2GTBA 1L1GA 5E2OA 4YXWD 2AEIH 1MUEB 2Z9JA 1F5KU 4TSFD 2VWLA 4CR5A 1O5EH 1OOKB 1YPHE 2XXLA 2A1DB 1LDTT 2GCTB 1SFIA 1WV7H 1C5OH 1MTWA 1G36A 2A31A 2GZ7A 3E0NB 3PTBA 2FODA 3PMHB 1V2UT 2B5TB 3A7VA 2VVCA 1Z6EA 3B23B 4NFFA 1L0ZA 3OU0A 4YOIA 3SJOA 1C2HA 3PWBA 4K1EA 1FN6A 2ZKSA 4I8JA 3GICB 1O34A 2ZCLP 2ZGXH 2PV9B 1O3HA 4AB9A 3ZZ8A 3FFGA 2VIQA 3SUFA 5FXLA 1LMWB 2YMSD 1INCA 1ELGA 2WV4A 1TLDA 3H5CB 1A4WH 1UCYH 1C5RA 1HCGA 1J15A 1V3XA 1HAGE 4K3JA 1C1VH 1GMDG 2OLGA 2ZGCA 3ODFA 3MO6A 2Z9IA 1CGJE 2H2ZA 4KTUA 2WYGA 5DKMA 1E37B 1KDQA 3L6PA 3MU4A 4X1NU 1CA8B 4XRNA 1YF4A 1O5AB 3SV9A 4U2WA 1FLEE 2WHXA 3SU0A 1LHFH 2CXVA 1UJ1A 3E16B 3A80A 1A0JA 1BMAA 1KXFA 3U8TH 3T26A 4WY3A 1BTYA 1NS3A 5JPMH 1TNHA 3GCOA 1T32A 3A89A 2FM2A 2RCEA 5DP3A 4CREA 1YLDA 1P05A 4CRCA 1Y3WA 1MTNC 2KZ4A 2XYAA 1ESAA 1MQ6A 8ESTE 2OQ5A 4JYVH 2SGQE 3GCHB 1SVPA 3RXAA 2BD7A 1MD7A 4MPWA 1WXRA 1F0RA 1BTWA 1N8OC 1YLCA 2PTCE 1C2DA 3F3BA 2XC5A 3SQHE 3SZEA 3RXTA 3VB5A 1Z1JA 3RLWH 4MPVA 2J94A 4FU7A 1TX8A 1PPFE 1JRTA 1ZRKA 3PLKA 1HRTH 1FY8E 3ZZ5A 4GHTA 1P2KA 3A7ZA 1GBMA 4UEHH 1CU1A 2ZDLA 3C27B 2UUKB 1O2LA 2C90B 4IC6A 4NZQA 3M5LA 4FXGH 5IYTA 1FI8A 3T62A 3SU4A 3TGIE 3QTVH 3CENA 4I32A 2WPLS 4O3TA 3N7EA 1C5WB 1QL7A 2HPPH 3NXPA 5A0AE 2J38A 1V2QT 1IQNA 4B71A 3RXIA 3SUDA 2W3KA 1IQJA 2FLBH 2VB0A 3ZVGA 2WPKS 2ZFTA 1MU6B 2IN2A 1NO9H 2XBWA 4H42U 7KMEH 1O2JA 2JETB 2QXHA 3TIUA 3DD2H 1TE0A 2HVXA 3HGPA 3ZVFA 1C5UA 1AU8A 1EB2A 2JH5D 1NTPA 4UFDH 2PGBB 1C5NH 2ZHDA 2F9NA 1UTPA 2XBXA 1BRBE 1EX3A 2PSYA 1DUAA 2P8OB 1ANCA 3UREA 3ODDA 2HNTE 1PPZA 2AGGX 1BMLA 1O2MA 3EYDA 1MU8B 2R0LA 1BCUH 2ZEBA 1PQ7A 1V2PT 3PO1B 3TK6A 2QF4A 4X1SU 1KXEA 3TH2H 2EI6A 1CHGA 5DP6A 3I77A 2Y82A 2K8IA 3ATLA 1FUJA 3AAUA 5IK2D 4BANB 7ESTE 1PPGE 2W7SA 2TPIZ 1A3EH 5HIZA 3GY3A 1TYNA 2W26A 5A8XA 4GCHG 3MWIU 1O3CA 1V2JT 2FYRA 3K65B 1G3EA 2ZHQH 2L74A 1UTLM 1W0YH 4BTTB 1TPPA 3P92A 1Q31A 1DWBH 2FEQH 3KF2A 1G3DA 1WYKA 4K69A 2LP6A 1GBIA 1Y5UT 2J4IA 1D6RA 3RM2H 8GCHF 1S0QA 2Y81A 5JB9S 2A5AA 3QZQA 3T28A 1S6HA 1GG6C 3O8RA 1UVPA 4ASHA 4D7GA 3A7XA 4I33A 2PKAB 1WOFA 3IG6B 2GVFA 1SGYE 3EQ0H 2RDLA 3E3TA 4Q2KA 5G4BA 2UWOA 2AMQA 3UWIA 5EXMA 3F2HA 5LGOA 1G3BA 1TGBA 3ATKA 2ZQ2A 2ZU2A 4NA8A 4A1XA 2XBYA 5AFYH 1IQIA 1GBAA 1KMHB 1K21H 2IJOB 1GG6B 5FPSA 5EPYA 1FDPA 1ETTH 3ZZ9A 3WWFA 3KL6A 3EE0B 1EZUC 2Z9GA 2A4OA 2BOHB 2FWWA 1TRNA 1TRYA 1SFQB 4QT8C 1BHXF 1OS8A 1YPMH 3RXCA 3KQEA 1ZTJA 3I29A 2VJ1A 1DVAH 1Z8IB 2SGFE 1CGIE 2F83A 3S9BA 2BDYA 2ZHEH 3RC4A 4NIYA 6ESTA 2WPIS 1RIWB 1G2MA 1HB0B 2VIDA 4I8KA 1DLEA 5JBTA 1V2NT 1OWEA 2OINA 2QF0A 3E90B 1ELBA 2LPRA 4CRDA 1GI9B 1ZMJA 3UQOA 4JZFH 1QL8A 5E0HA 1H9HE 2P16A 1ZMLA 3SU6A 1YLNA 1W11U 2ODQA 2NU0E 4OS7A 1EJNA 1H8ED 4Q63A 2Q6GA 1ZPBA 1CHOF 2ANMH 3MH7A 4HGCA 1GI1A 3GDSA 1JOUB 1W13U 2CV3A 1QJ7B 1EZXC 4PROA 1L1NA 3TPIZ 1QTFA 2QN5T 4WXIA 2XCNA 1EKBB 3OX7U 1ZTKA 2IJD1 4CHAC 6CHAC 1BT7A 1F92A 1GBBA 1EP5A 4A7IB 5EW2H 1C5ZB 5DPAA 1SR5C 2GZ9A 3LC3A 2EQNA 1EOLA 1YCPK 1JIRA 1K1OA 4DJZB 1C1PA 1F0UA 2BLWA 4K8YA 2FOAA 3F9FA 1FV9A 1FZZA 2I6QA 2BZAA 2VWMA 1CA0B 2ZECA 3MYWA 5FX6A 5E8EH 1O2OA 1GWAA 2BMGB 2L6OA 2ZZUH 4MTBA 3S9CA 1F7ZA 1VITG 2JETC 4XFQA 4MNXA 1MBMA 3VEQB 4AN7A 2AGIX 9ESTA 1IQEA 3RXBA 5IDKA 1LVOA 2F9OA 4KGAA 1WBGB 2EC9H 3SNAA 1AVXA 4Y11E 1P2IA 2GDDA 1Z1IA 1XKBC 3RLYH 1GMHF 1VITF 2GZ8A 3QGJA 1GJAB 5F53A 1S6LA 3V0XA 3RU4D 1ZTLA 1GI8B 2ZGBH 2TGDA 5DSFA 1C9PA 2EI7A 1JWTA 1ANBA 2SNWA 4LOYH 3FAOA 3ATMA 5L30H 1YCPM 2B9LA 2J98B 3LKWA 3TNSA 1ORFA 1O2WA 5GCHG 3H09A 3RXFA 2PLXA 1BTUA 4ZKNU 1XMNB 3KGPA 3KCGH 2PP6A 5FHTA 3LJOA 2PKAA 5A0BA 4I31A 3A8DA 4A1VA 2KCAA 2AHME 2XCFA 3BN9A 1V2RT 1K22H 3LGYA 3V12A 1UK4A 4Y0YE 1SL3A 5FPTA 4JCNA 3BTTE 2BLOA 1FY5A 1H9IE 3LGIA 1F5RA 3AVZA 4A6LA 3ZZ4A 3BG8A 2FOMB 2QXIA 5HXFA 4XBBA 3SV8A 2BY7X 1BMNH 5C3NA 1O30A 3F9HA 1Z8JB 1KLTA 4U30A 2AYWA 3HATH 4MG3A 1ESTA 4D9QA 3UNRA 1S81A 1TMTH 4DW2U 1VKYA 1UCYE 2XWBI 1VGCC 2HLCA 4ZAEA 1MTVA 1YP9A 6GCHG 1L2EA 3MI4A 1HAVB 2G4UA 1W7XH 3QZRA 2ILNA 1AVWA 2BYAX 2UUJB 2BDHA 1HIAA 2NU3E 3OY6U 3GOVB 2P3TB 2K1QA 4ABAA 1P8VC 4M9FA 1N6XA 1OYQA 4JMYA 4UFFH 3AAVA 1GBEA 2AIQA 3SU5A 2F3CE 3VPKA 1HAHH 1E1RD 1UTNA 2QF3A 2QE7D 2OQUA 1B5GH 3UNSA 3SNCA 3U98H 1AGJA 1O36A 1Y59T 2P59A 3MNCA 3P6ZB 2G00A 3S69A 3P95A 3NUMA 3VGCC 5EPNA 4NIVA 3ZZ6A 1ZHPA 3RM0H 1P2QA 2CF9H 1W12U 3KEEA 8GCHG 5C17A 2BD2A 1A5GH 1PPHE 2QXGA 1ELTA 1SSXA 1YPJH 3TH4H 1NC6A 1BZXE 1GHXH 1XUIA 1Y5BT 1FQ3A 2VGCB 1O2IA 1ELCA 1UCYK 5FBEA 1ZPZA 1GBHA 1FXYA 3AK5A 1TAWA 4X2WA 2ZA5A 1ZHMA 2GCTC 2HNTC 3M7QA 5TJXA 1OHHD 1CO7E 3BTGE 3M5OA 1BUIA 3SU1A 5FCRA 4DIIH 3DUXH 3KYFA 2AGEX 2BQ7B 5AHGH 2A5KA 4K5ZA 4K60A 1AZ8A 3IITA 4BAQB 1SG8B 2UUFB 4NCYA 3TJOA 1QQUA 2C8XB 4IW4E 5C94A 2FI5E 4FVDA 1BJVA 3GCNA 1LPKB 2O8MA 5A0CA 1TNJA 2OC7A 1GDUA 3GCTF 4ZMAH 1PYTC 4BTIB 1C9TA 2XTTB 4Y7BA 3CS7A 3RMOH 1T31A 3OTPA 3MMGA 1BTPA 2ZU1A 3FZZA 5HIYA 1SB1H 3RMNH 5AFZH 1SLXB 2LNCA 1DSTA 1C1WH 3F2GA 3MHWU 1S5SA 3HK3B 1E34B 2BDBA 1GI7B 2VGCC 4Z6AH 3PRDA 5HKKD 5E2PA 1K2I1 3DT0H 1ELFA 2C3SA 3OEED 1N6YA 1CBWC 3SI3H 3FP6E 2M5TA 4DURA 4ZHLU 5T6GA 2PFEA 3N99A 6GCHF 3SGAE 3SV7A 2R2WU 2A32A 3NK8A 2SGDE 1Y3VA 1NY22 1C4V2 4E7NA 4HTCH 4OS2A 2JH0D 3N7DA 3FOAA 4ABJA 1Y5AT 1G2LA 1E36B 1HXFH 1GMCF 1V2VT 2R2MB 2W3IA 1L4DA 3G01A 1OWDA 2WPMS 2GD4B 3ZZDA 2OXSA 1NRSH 1PQ8A 4WMFA 2ALVA 2BDAA 1SHYA 3VB7A 1QJ1B 1AWHB 1EASA 1WQSA 3UWJH 4BAMB 3NZIA 3EGKH 3S0NA 2VINA 1C1QA 1QZ8A 1AY6H 3GY8A 1WUNH 3VFEA 1NFYA 1GJBB 2BZ6H 4ISIH 4B2CA 3TU7H 1QBVH 3F6UH 1K1MA 1O2TA 1CQQA 1VGCB 1TMBH 1SGQE 3C1KA 1OXGA 1H9LB 3M7TA 1Y3YA 5C2ZA 5FAHA 1C2KA 5HM2A 1TMUH 2BB4A 4OS4A 3U28C 2FYQA 1UTQA 3A7WA 2KCYA 2YMSB 1O3LA 3M7UA 1T8LA 4K8BA 3SV6A 4H6SB 1A0LA 1VR1H 2JDID 1E1QD 1PJPA 4GPGA 2QY0B 4D76A 2HWLB 3TITA 1FY4A 1QCPA 2R0KA 2C8WB 2FIRH 4Q80A 2K0QA 1MZDA 2BQWB 3TH3H 4RKOB 3O8BA 1ZJDA 2CGAA 1EJMA 4YT7H 1WTGH 3VB3A 2FP7B 4D8NA 2GMTB 1EXFA 1HJ9A 2FTLE 4NZLA 1GHAF 1HIAB 3OY5U 3SORA 1XUFA 1GJ4H 5PTPA 1Q2WA 2OBQA 1QBNA 1V2TT 2PGQB 2QV1A 4TWYA 1XUKA 4IS5A 1O3NA 3HKJB 5J4QA 3ZV8A 4AG1A 1GGDB 3BTKE 3JZ1B 5EJZA 5JBAS 2F9BH 1ANEA 1KSNA 1K1LA 1B7XB 1O5CB 1WU1A 1C1OA 1GJ6A 1TGCA 1FAXA 4ZKRU 2CHAC 3GY6A 1T8NA 4AORA 1NBMD 1CT0E 1C2GA 1HAZB 4AOQA 1U6QA 1HYLA 1ZPCA 1NRQH 3QN7A 3V13A 1IQGA 4YESB 1TA2A 3SJIA 1UHBB 3Q3XA 4VGCC 2P8OC 1QA0A 3OYPA 1CT4E 2J92A 1C2IA 3PTNA 3SN8A 5FBIA 2D8WA 1C2FA 1C5YB 2IPHA 2ZDNA 4ABEA 5C1UA 2ZU3A 4MPUA 1PPEE 2Y5FA 2ZG0H 4ISLA 2B0FA 4YT6H 2BD8A 4BAOB 4AFZA 1J9CH 1QQ4A 1SGPE 3EA9A 5EG4A 3LONA 2ZPRA 3MNXA 5LPFA 4Q7XA 2DUCA 4CHAB 3LGTA 2HPQH 1O3BA 1A7SA 1AZZA 3H7OA 2GV6A 4O3UA 3LH1A 2GKVE 4BOHA 4ZCNA 1GL0E 4FU8A 1EAUA 4YM9A 2C8ZB 5C5OA 3UY9A 2PW8H 3ZYDA 1A3BH 5JBCS 2Q6FA 5T6FA 3UR9A 1ETSH 1DOJA 1GJ5H 1S85A 1OP8A 3BEUA 4RKJB 2EA3A 2KR7A 3A82A 4GUXA 3SI4H 1RTLA 3ATWA 1C1TA 4WMDA 3LJJA 4OS1A 3FP8E 3ESTA 3RXVA 3A83A 4SGBE 1SGFA 4CH2B 4WMEA 4LK4A 1GHYH 4CRGA 1SPJA 3IWMA 3LC5A 4OM9A 5DN6D 1TNKA 5ESTE 3A8AA 3ZZAA 5A2MH 1TWXB 4ZKSU 3GDVA 1XM1A 1BBRE 2VH6A 3NCLA 1P0SH 3ATIA 1O33A 2BQ6B 3BEIB 4JZ1A 3ZVBA 4U32A 1GGDC 1MCTA 1GBDA 4JZDH 5GJ4B 3V7TA 2EEKA 3FN8A 2FOBA 4DY7B 2ZU5A 2PR3A 1JRSA 1Z71A 1P11E 1SGNE 5I46H 3LGWA 3UUZA 1UW7A 5L2ZH 4XBCA 1UTOA 1LVBA 3P70B 2G55A 2AFQB 3B8JA 2FI3E 1TGNA 2NU4E 4H4FA 1BTZA 4IBLH 5DP9A 1W14U 1O39A 3SNEA 4OS6A 5C5NA 1O3OA 1P3CA 3RMMH 1BITA 2KCPA 4M7GA 5DP4A 1GHAG 4E7RG 4X1QU 1SGIB 1ARCA 4FUIA 1GI2A 3QLPH 3RXHA 2W6JD 4WH8A 4F48B 4GAWA 1HAOH 1P02A 1O31A 4X8UH 3PRBA 4TT3D 1GBTA 1ELVA 3T25A 1G30B 2RDEA 3RXMA 1SKYE 1O2GH 1NBME 3RC6A 1NFWA 1Z8GA 2PUQH 1AFQC 3E1XB 1W0JD 2FXRA 2CJIA 1GBKA 2FOHA 3UAIC 3CP7A 1HNEE 2ZDVH 1GL1A 1MTUA 1FX0B 4NGAH 4Y7AA 1AIXH 4CRFA 2V3OH 1O5DH 2JIZD 2STAE 2PTNA 4IGDA 1GBFA 2CK3D 2STBE 4A92A 1FNIA 1LQDB 1QURH 4IN1A 2XRCA 1THRH 3SQEE 4O03A 1V2MT 1W8BH 2I6SA 1LPGB 1GBCA 2VH0A 5JYIA 1TQ0B 4Z0KA 1AE5A 4WH6A 1K1IA 1EFRD 5C0TA 1XUJA 4D7FA 5J4SA 5FL7D 1XVMA 5T6DA 3M36A 3SZNA 4KTCA 5EXLA 2H9TH 4J2YB 1FAKH 1SQAA 3RXGA 1D3QB 4YTAA 2H9EH 1IAUA 1MKWH 5KECA 2GGVB 1KTSB 4F4OC 1IQLA 5A8YA 1EZQA 2H9HA 1KY9A 1AB9C 2ULLA 2P3FH 1S84A 1AFEH 4ZH8A 4WXVA 2M2AA 5B6OA 1BOQA 1O3FA 1GI5A 3BTQE 3URCA 1AI8H 4X6OA 4HG6A 3PV5A 3ZZ7A 1FONA 4TYDA 1TONA 3MU0A 4X2YA 3GISB 4K1TA 4HZHA 1BA8B 1GCTC 3A87A 4AYYB 1GVKB 2J9NA 3RXRA 1T4UH 1P57B 2O8WA 2FO9A 3SW2B 5L2YH 4FU9A 1E38B 2RA0A 4BNRA 3RXEA 5HMAA 1P10A 1QIXB 2EI8A 3VXEH 1AUJA 2ZFQH 4KKDA 1F0SA 1EJAA 1P9SA 1D3TB 4BAHB 5DG6A 1QFKH 2OP9A 2ZCKP 4CBOA 5E0JA 4YLUA 1L4ZA 1SBWA 3L33A 2ZTXA 1JMOH 3SGBE 5KEDA 1P2MA 1ZZZA 4OGXA 1KXAA 2UWPA 3QUMP 4XOJA 3TGKE 1TA6A 4DOQA 1THSH 2VVVA 1KXBA 1N8OB 1DS2E 4X1PU 1G9IE 1GJDB 1O2UA 2WPHS 3F9EA 5EGMA 4U01A 2ZFSA 2XBVA 5F03A 1TNIA 2KM0A 2BX3A 4NWKA 1KTTB 2Z3EA 3A85A 2QCYA 1AFQB 1O2KA 1THPB 7LPRA 3UQVA 4F49A 3EA7A 9LPRA 4B2BA 3SOSA 1P2JA 3P17H 4UE7H 1MKXK 4IC5A 2BVSH 1EAXA 2A7CA 1WAYB 1UVTH 1VITH 1UTMA 3TLOA 5LPEA 3R3GB 3SGQE 3M5MA 1O2XA 1YPLH 3KQ5A 1NRNH 4FUEA 4B73A 3KNXA 1DWDH 2HRVA 2XNIA 3RU4T 3WWBA 3MH6A 3T2NA 3SBKA 4Y0ZE 4XE4A 1A5HA 3OEHD 2HLDD 1IHTH 7GCHF 1VCPA 1SMFE 2G4TA 5EIYA 3GS9A 1GHVH 4BTUB 4R0IA 5EU8A 1COWD 2G5VA 4DT4A 3A86A 4NSYA 4ABDA 2ZPQA 2TGTA 1J8AA 1C5VA 1FJSA 1JBUH 1NU9A 1UK2A 4JK5A 1RXPA 3F0PA 1A61H 2ZDAH 3P8GA 1RTFB 2OC8A 2ZFRH 4MDSA 1AKSA 3TNTA 1D9IA 1EAWA 1OYTH 4JYUH 3TK9A 2BD5A 4FETA 2A7JA 5T1VA 3EE7A 1O32A 2O9QA 2R9PA 1GJ7B 3DFLA 1LKBA 1GPZA 3UR6A 1YC0A 2JJ1D 2ZDMA 2P94A 5EW1H 4KTSA 3BG4C 5DO4H 1H4WA 1NFXA 4GSOA 1ID5H 4E05H 5CE1A 3ZVAA 2AMPA 1FMGA 2ZU4A 3QO6A 1UK3A 3PM3A 1C5LH 1GHBG 1GJ8B 1O2ZA 3ZIAD 3KN2A 3R0FA 4E06H 2BLQA 1LHGH 1SQOA 2LELA 1BHXB 2ZTZA 3STIA 1F0TA 1J16A 3U1JB 1GDNA 1HV7A 3VG8A 2F9UA 1CA0C 3E6PH 2GCHF 5KGOA 4ISHH 3I78A 3DA9B 4ACAA 1AHTH 5JDUB 1HJAC 1ELDE 1GCTB 1IQFA 1MMJN 5LPRA 3SNBA 2GT7A 1C2JA 1H8DH 1RRKA 4AZ2B 3AW1A 2WSSD 1MZAA 1RFNA 1J14A 1W0ZU 1S82A 2Z3DA 2WPDD 2ZHWH 1DSUA 2DE8A 3LH3A 1LHDH 2BLVA 3QGNB 4FUHA 3HKIB 1WSSH 5CMXH 1TPAE 4NSVA 2WV5A 2QXJA 4CRAA 1QB1A 1S0RA 2GJGA 2BOKA 2BM2A 1S6FA 1V2OT 3ZVEA 2Y6TA 2ZF0H 2VNTA 2RFKC 3OFND 1K1NA 1OP2A 3SUEA 2BDIA 1SLUB 3GYLB 2C4FH 3A81A 4UDWH 5DJ7A 3LU9B 5K7RA 1FY3A 6CHAB 2O8LA 1XVOA 4GLYA 4INHA 4ZHMU 3PMJA 1BRCE 1QR3E 2WUBA 1RTKA 4NIXA 3ZZCA 1QB9A 1ZGIA 2J34A 2TBSA 1QB6A 4JZIA 1YYY1 1KLJH 1RIWC 2GDEH 3Q77A 1ZOMA 1OP0A 1FPHH 1TGTA 2EY4C 2C8YB 3QDZB 1UTKA 2O8TA 5F8XA 1C5QA 4MLFB 4CR9A 3HPTB 4KP0A 1QRWA 5L6NH 1OWIA 4Y71A 1AN1E 2B8OH 1WTHD 2Z94A 5A8ZA 2ZO3H 3MU1A 1YBWA 1DM4B 1BB0B 4YLQH 1HUTH 4ZHAA 1SOZA 1HBTH 5CHAB 2O8UA 3M37A 1VJAU 1DWCH 4FUCA 4HFPB 2OBOA 1DT2A 4RI0A 1NESE 4I8LA 2OCVB 5TCCA 2HNTF 3PB1E 2QIQA 1D4PB 4ACBA 2H6MA 3LT3A 2A4QA 1GJCB 1YPKH 4ISNA 1BBRK 3U9AH 1D3DB 1W7GH 1E79D 2ZTYA 3FP7E 1Z8RA 5CHAC 1AQ7A 3KIDU 1KIGH 3URDA 1AD8H 4LXBH 3D65E 4JZEH 1LPZB 2V6NA 1S83A 4MQAA 4UFEH 4GCHF 2Z3CA 2ZNKH 4AGKA 1FPCH 2P3UB 2GP9B 4DCDA 1C1RA 2FDAA 3AW0A 1E0FD 3OE7D 3MH5A 2BY8X 1B0EA 3O8DA 5EOKA 1AVGH 1GI0A 3UIRA 1O2QA 2Z9LA 3F0OA 2FOCA 2ZWLH 4MVNA 3ZZBA 3ELAH 1NROH 2ZFPH 3F2FA 3ZYEA 1O37A 2SGAA 4IN2A 5A09A 1ETRH 4Q4LA 1PPBH 2NU2E 4K2YA 4DT7B 1TB6H 2FTMA 1YPEH 1UVSH 1W2KH 4B74A 4TWWA 1HJ8A 2XC0A 3BEFB 4WVPE 2ODPA 1A1RA 3UTUH 3EDXB 1MABB 3VB6A 4O97A 1EZSC 2F91A 2G51A 1MTSA 1YCPH 5H4IB 2FX4A 1DXWA 1TBZH 1E35B 5T3HA 2BXUH 3UFAA 3A8BA 1Y3UA 3DFJA 2QF5A 2UUYA 1AO5A 4LZ1H 3U8RH 4FUDA
chains in the Genus database with same CATH topology
1O2RA 1EPTA 1OSSA 1GBJA 1C4U2 1V2KT 1SGCA 3D62A 1SGRE 1Y8TA 3NKKA 1ELEE 2NWNA 2J2UA 4X2XA 2VIWA 4ZKOU 1B0FA 3RUOA 3U1IB 8KME2 1ESBA 5DP7A 3PROA 2Y80A 1RS0A 2OC0A 1AUTC 4VGCB 5GIBA 3SJKA 3K6YA 2Y5HA 1NN6A 4I8GA 3PMAB 1OKXA 3E91A 1DLKB 3MFJA 3P8FA 5F8TA 1MBQA 1TBQH 1O3IA 2OTVA 1O3JA 2QAAA 4NA7A 4MNYA 1O2PA 1HAVA 4AX9H 1MD8A 3MH4A 4X6MA 2GV7A 3ZVDA 4KELA 1NU7B 1TRMA 3F1SB 1ZJKA 1O38A 1XX9A 3A8CA 3LDXH 1DICA 2D2DA 2G52A 4AYVB 3BSQA 3RU4E 2H5DA 5FX5A 2W7UA 1O35A 3STJA 2CN0H 1W10U 1GI6A 4MNWA 1BQYA 3M3VA 2SGEE 3EA8A 3TJNA 1BIOA 2A2QH 4RN6A 1RGQA 2D1JA 3D23A 7GCHG 3GYMA 3PLPA 2ASUB 1GDQA 4Y79A 5F8ZA 2A7HA 1EB1H 3BTHE 1GVZA 4GVUA 2FOGA 2ODYB 2ALPA 3ENSB 5ABWA 3GDUA 1O2YA 2ZQ1A 2BTCE 3GCHC 4ESTE 3RXLA 1L1JA 1ZR0A 1QRZA 3T5FH 3QX5H 1MKWK 4DGJA 4NFEA 3SHCH 4ABBA 1IQKA 1MTNB 1GI4A 1DDJA 4Y10E 2PKSB 2FLRH 3AASA 1CHOG 2Y7ZA 1EUFA 4ZUHA 4MNVA 5FPYA 1O3AA 1HDTH 1DY8A 2FS9A 2HOBA 1CGHA 3Q3YA 2VU8E 1A0HB 2Y7XA 4TY7A 3UOUA 3UNQA 1DY9A 1O3EA 5FCKA 1V2ST 2UWLA 1MCVA 2G5NA 1ZSLA 1C1NA 2VVUA 3DHKH 1MKXH 3VB4A 1K1PA 5C20A 5GPIB 1HPGA 1ZSJA 2BDGA 2ESTE 4NG9H 1MH0A 1N1LA 3GCTG 3A7TA 5ESBA 1SLVB 3BV9B 3B9FH 2VWNA 4B75A 4AG2A 2BY5X 3RXKA 4ABGA 5JBBS 2FS8A 2C93B 3F68H 5EQRA 2XWAA 4TY6A 4INKA 1Z7KA 1A5IA 1C1UH 1HAPH 8LPRA 4CH8B 2QGRA 2FX6A 2A2XH 3SNDA 1FY1A 1HAIH 2A0QB 2V35A 2V0BA 3W94A 3LGVA 3PYHA 1O2NA 3KQCA 5AF9H 1FIWA 1QBOA 2WYJA 3OTJE 2VIPA 2BY9X 4FUBA 1LKAA 2GT8A 1Q3XA 1T8OA 4INLA 1FIZA 4XSKU 1SI5H 1P04A 1O2VA 1K9OE 1C5MD 1C1MA 4J1YA 3RXJA 4DVAU 1O5BB 3SJ8A 4Y8YA 1AB9B 1OWKA 3BIVH 1BRUP 4DIHH 1P12E 1O5GH 1QRXA 2OC1A 3SO3A 2BDCA 1P2OA 2ZGJA 3TVJB 1O3GA 3CS0A 5DP5A 3U69H 2H1UA 4UFGH 4H6TA 4IMQA 5DK1A 2YOLA 3M35A 1LQEA 1MAXA 4BXSA 1C2LA 4IMZA 1P01A 1HAYB 2AS9A 3PV4A 1OX1A 2DE9A 5EXNA 3RXUA 1SHHB 2Z7FE 4ABIA 2AERH 3HK6B 1Y3XA 3S9AA 1LTOA 4SGAE 1IQHA 1QNJA 1CVWH 1HLTH 2SFAA 2ZI2H 1YPHC 1CE5A 4X8VH 1GCDA 3MU5A 3NPSA 3PMBB 3V3MA 4CBNA 2TRMA 2THFB 3GY7A 3A7YA 2YNBA 3M3TA 1SQTA 1YGCH 3BIUH 1BJUA 4K1SA 1G32B 3VGCB 1IHSH 4A5TS 1AE8H 1C5SA 3SUGA 1UTJA 2SNVA 3EAJA 3UOPA 2BY6X 2VWOA 2W5EA 1ABJH 1TOMH 2KAIB 4THNH 3MU8A 4DG4A 3MTYA 2R3YA 4AB8A 2AMDA 1KDQB 2F9VA 1LCYA 3RXOA 3SV2H 4ABHA 1H8IH 1TPOA 2Q1JA 2G8TA 4BXWA 1NRRH 2Z6BD 3K6ZA 2RG3A 4MPXA 3T27A 4WJG2 4HI3A 3FANA 3E0PB 1AMHA 1TQ7B 2PKSC 2FI4E 3H7TA 4I7YH 5AVDA 1QHRB 4Y6DA 3FZDA 1TFXA 2RA3A 1PFXC 3KQDA 3M5NA 1TNGA 1H1BA 1OPHB 1TIOA 1DITH 3PWCA 2Z9KA 1K28D 1SOTA 1AWFH 1QL9A 5DGJA 1OWJA 1OWHA 2OD3B 3ZVCA 1LVYA 1IQMA 2HALA 1DXPA 1BBRH 4Y76A 1HAXB 1UMAH 1XXFA 2PUXB 5LH8A 5GWZA 1GVLA 1ACBE 2TGAA 1T7CA 4XDEA 1Z6JH 4OS5A 1LVMA 1LHCH 3S7KB 5SGAE 1TALA 1P06A 1EPTC 1GI3A 4YZUA 1NM6A 3GY2A 3MO9A 3UPEA 1HGTH 4YOJA 3RP2A 3U8OH 1BMMH 2QC2A 1D6WA 2AIPA 2TGPZ 4WF8A 3RXQA 2XC4A 2XW9A 4A1TA 4NA9H 1GHWH 4FUFA 1JXPA 4OGYA 3D49H 2BD3A 1RD3B 1IOEA 1XXDA 3OSYA 1TX7A 2PWXA 1ARBA 4UD9H 2ZHFH 5BRRE 1KXDA 1V2WT 4TPYA 1UO6A 1MAYA 1V6DA 3HGNA 4ABFA 1EATA 3QK1A 3BTDE 3PO1C 3JZ2B 2KAIA 3MO3A 4ZXXH 1A2CH 1RJXB 4XBDA 5F6MA 1TGSZ 4O9VA 1SLWB 2ZGHA 1P9UA 4I8HA 4UONA 2ZCHP 1ANDA 1SGDE 4LZ4B 2BVRH 1C2EA 2Y5GA 1NT1A 3F9GA 3QWCH 3RXSA 3TJUA 3SJ9A 1ZLRA 2BD4A 3SU2A 1SGFG 1YPGH 2JH6D 2ZP0H 5C1YA 1T8MA 1TPSA 3Q76A 1F2SE 1BDAA 2Q6DA 1ZRBA 3BTEE 4FUGA 1P09A 1V2LT 1ZGVA 2CHAB 4Q7YA 3RMLH 1GMCG 2FOFA 1EAIA 2VIVA 2YNAA 5BPEA 1NRPH 1AKSB 3LGUA 3KQBA 3BTFE 4BAKB 4FUJA 2ZDKA 4B1TA 3SU3A 4CRBA 4X0WU 1VCQA 2P95A 3Q00A 1GMDF 4AFUA 1ZSKA 1TX6A 1NZQH 4X6NA 3T29A 2PSXA 2ZFFH 1C5TA 1G3CA 4YOGA 2A4GA 2FZZA 1GMHG 5HYOA 2WINI 2BD9A 4X6PA 3FVFB 4X8SH 2FESH 1BRAA 1UVOA 1LHEH 3RDZA 2GMTC 2OUAA 1SGTA 3A88A 1XKAC 3BG4B 3LPRA 4NIWA 5K0HA 1GJ9B 2G81E 2AH4X 5ETXA 5DP8A 5GDSH 1O2HA 1TABE 1QJ6B 4Q7ZA 1DE7H 3PLBA 1EPTB 3P8OA 2ZIQH 1O3MA 1X7AC 3WY8A 1QA7A 2IOTA 3N7OA 3MNSA 4JYTA 1P03A 1G37A 3GY4A 1C5PA 1VCWA 1O3DA 1T4VH 2P93A 1PPCE 1TOCB 1YKTA 3RC5A 1PQAA 2BHGA 1JIMA 1TNLA 1ABIH 4ISOA 1KYNA 4AFSA 1O2SA 1GHBF 3LIWA 2CF8H 3P8NA 1NFUA 2QYIA 3QTOH 2GX4A 1C4Y2 4B2AA 3VXFH 1WCZA 2B7DH 1XUGA 3RXPA 2NU1E 1D3PB 1O3KA 5HGGA 1EP6A 1EOJA 4ZROA 1LO6A 4FVBA 2BVXH 1DANH 1VZQH 3E8LA 4JK6A 5EQQA 4WWYA 1W3CA 1QGFA 1SGEE 2FPZA 1HXEH 4AGJA 1DX5M 1ZYOA 3TK5A 1VJ9U 1KXCA 2D26C 2ANWA 1TBRH 2HGTH 3MNBA 2FMJA 1ZMNA 4Y8XA 1KLIH 5C1XA 1O0DH 3MOCA 1ZHRA 1MQ5A 2A5IA 2J95A 4X8TH 1P3EA 3L3TA 4Y8ZA 3S7HB 1CBWB 1DUEA 1F5LA 1SC8U 3BTME 2F9PA 2FOEA 2ANYA 3RXDA 1DPOA 1HFDA 3Q3KA 3K9XB 4YO9A 6LPRA 1O3PB 3LOXA 5JB8S 1C5XB 2A45B 3TGJE 3A84A 3BF6H 1CT2E 5HM9A 3ITIA 2R3UA 1UHBA 1UVUH 2VIOA 4RSPA 4TPIZ 2ANKH 2BXTH 1YM0A 3O8CA 2QA9E 2GCHG 3NWUA 5TCAA 2V3HH 1GHZA 2WPJS 1QY6A 1GBLA 1NPMA 2PHBA 3SHAH 1K1JA 1P2NA 1J17T 3K2UA 5EODA 3M61U 3TJVA 1FN8A 1C2MA 5GXPA 5I25A 2BX4A 2ZPSA 3BTWE 3KHVA 4D9RA 1M9UA 1DWEH 4X2VA 1A46H 2CMYA 3W95A 5C67A 3GY5A 5EQSA 4ZXYH 1DFPA 1C1SA 4NWLA 4X1RU 1EQ9A 5GCHF 4R8TB 1PQ5A 5E0GA 1WQVH 1O5FH 2JKHA 2WUCA 2ZC9H 4B76A 1CSOE 1HJAB 1BTHH 4GHQA 2H5CA 2SGPE 3ZZ3A 2A4RA 3M3SA 1BTXA 3ZV9A 1ELAA 4AFQA 1XUHA 2TIOA 1PYTD 2GTBA 1L1GA 5E2OA 2AEIH 1MUEB 2Z9JA 1F5KU 2VWLA 4CR5A 1O5EH 1OOKB 1YPHE 2XXLA 2A1DB 1LDTT 2GCTB 1SFIA 1WV7H 1C5OH 1MTWA 1G36A 2A31A 2GZ7A 3E0NB 3PTBA 2FODA 3PMHB 1V2UT 2B5TB 3A7VA 2VVCA 1Z6EA 3B23B 4NFFA 1L0ZA 3OU0A 4YOIA 3SJOA 1C2HA 3PWBA 4K1EA 1FN6A 2ZKSA 4I8JA 3GICB 1O34A 2ZCLP 2ZGXH 2PV9B 1O3HA 4AB9A 3ZZ8A 3FFGA 2VIQA 3SUFA 5FXLA 1LMWB 1INCA 1ELGA 2WV4A 1TLDA 3H5CB 1A4WH 1UCYH 1C5RA 1HCGA 1J15A 1V3XA 1HAGE 4K3JA 1C1VH 1GMDG 2OLGA 2ZGCA 3ODFA 3MO6A 2Z9IA 1CGJE 2H2ZA 4KTUA 2WYGA 5DKMA 1E37B 1KDQA 3L6PA 3MU4A 4X1NU 1CA8B 1YF4A 1O5AB 3SV9A 4U2WA 1FLEE 3SU0A 1LHFH 2CXVA 1UJ1A 3E16B 3A80A 1A0JA 1BMAA 1KXFA 3U8TH 3T26A 4WY3A 1BTYA 1NS3A 5JPMH 1TNHA 3GCOA 1T32A 3A89A 2FM2A 2RCEA 5DP3A 4CREA 1YLDA 1P05A 4CRCA 1Y3WA 1MTNC 2XYAA 1ESAA 1MQ6A 8ESTE 2OQ5A 4JYVH 2SGQE 3GCHB 1SVPA 3RXAA 2BD7A 1MD7A 4MPWA 1F0RA 1BTWA 1N8OC 1YLCA 2PTCE 1C2DA 3SQHE 2XC5A 3RXTA 3VB5A 1Z1JA 3RLWH 4MPVA 2J94A 4FU7A 1TX8A 1PPFE 1JRTA 1ZRKA 3PLKA 1HRTH 1FY8E 3ZZ5A 4GHTA 1P2KA 3A7ZA 1GBMA 4UEHH 1CU1A 2ZDLA 3C27B 2UUKB 1O2LA 2C90B 4IC6A 4NZQA 3M5LA 4FXGH 5IYTA 1FI8A 3T62A 3SU4A 3TGIE 3QTVH 3CENA 4I32A 2WPLS 4O3TA 1C5WB 1QL7A 2HPPH 3NXPA 5A0AE 2J38A 1V2QT 1IQNA 4B71A 3RXIA 3SUDA 2W3KA 1IQJA 2FLBH 2VB0A 3ZVGA 2WPKS 2ZFTA 1MU6B 2IN2A 1NO9H 2XBWA 4H42U 7KMEH 1O2JA 2JETB 2QXHA 3TIUA 3DD2H 1TE0A 2HVXA 3HGPA 3ZVFA 1C5UA 1AU8A 1EB2A 2JH5D 1NTPA 4UFDH 2PGBB 1C5NH 2ZHDA 2F9NA 1UTPA 2XBXA 1BRBE 1EX3A 2PSYA 1DUAA 2P8OB 1ANCA 3UREA 3ODDA 2HNTE 1PPZA 2AGGX 1BMLA 1O2MA 3EYDA 1MU8B 2R0LA 1BCUH 2ZEBA 1PQ7A 1V2PT 3PO1B 3TK6A 4X1SU 1KXEA 3TH2H 2EI6A 1CHGA 5DP6A 3I77A 2Y82A 3ATLA 1FUJA 3AAUA 4BANB 7ESTE 1PPGE 2W7SA 2TPIZ 1A3EH 3GY3A 1TYNA 2W26A 5A8XA 4GCHG 3MWIU 1O3CA 1V2JT 2FYRA 3K65B 1G3EA 2ZHQH 1UTLM 1W0YH 4BTTB 1TPPA 3P92A 1Q31A 1DWBH 2FEQH 3KF2A 1G3DA 1WYKA 4K69A 1GBIA 1Y5UT 2J4IA 1D6RA 3RM2H 8GCHF 1S0QA 2Y81A 5JB9S 2A5AA 3QZQA 3T28A 1S6HA 1GG6C 3O8RA 1UVPA 4ASHA 4D7GA 3A7XA 4I33A 2PKAB 1WOFA 3IG6B 2GVFA 1SGYE 3EQ0H 2RDLA 3E3TA 4Q2KA 5G4BA 2UWOA 2AMQA 3UWIA 5EXMA 5LGOA 1G3BA 1TGBA 3ATKA 2ZQ2A 2ZU2A 4NA8A 4A1XA 2XBYA 5AFYH 1IQIA 1GBAA 1K21H 2IJOB 1GG6B 5FPSA 5EPYA 1FDPA 1ETTH 3ZZ9A 3KL6A 3EE0B 1EZUC 2Z9GA 2A4OA 2BOHB 2FWWA 1TRNA 1TRYA 1SFQB 4QT8C 1BHXF 1OS8A 1YPMH 3RXCA 3KQEA 1ZTJA 3I29A 2VJ1A 1DVAH 1Z8IB 2SGFE 1CGIE 2F83A 3S9BA 2BDYA 2ZHEH 3RC4A 4NIYA 6ESTA 2WPIS 1RIWB 1G2MA 1HB0B 2VIDA 4I8KA 1DLEA 5JBTA 1V2NT 1OWEA 2OINA 2QF0A 3E90B 1ELBA 2LPRA 4CRDA 1GI9B 1ZMJA 3UQOA 4JZFH 1QL8A 5E0HA 1H9HE 2P16A 1ZMLA 3SU6A 1W11U 2ODQA 2NU0E 4OS7A 1EJNA 2Q6GA 1ZPBA 1CHOF 2ANMH 3MH7A 4HGCA 1GI1A 3GDSA 1JOUB 1W13U 2CV3A 1QJ7B 1EZXC 4PROA 1L1NA 3TPIZ 1QTFA 2QN5T 4WXIA 2XCNA 1EKBB 3OX7U 1ZTKA 4CHAC 6CHAC 1BT7A 1F92A 1GBBA 1EP5A 4A7IB 5EW2H 1C5ZB 5DPAA 1SR5C 2GZ9A 3LC3A 1EOLA 1YCPK 1JIRA 1K1OA 4DJZB 1C1PA 1F0UA 2BLWA 4K8YA 2FOAA 3F9FA 1FV9A 1FZZA 2I6QA 2BZAA 2VWMA 1CA0B 2ZECA 3MYWA 5FX6A 5E8EH 1O2OA 1GWAA 2BMGB