3ATMA

Crystal structure of trypsin complexed with 2-(1h-indol-3-yl)ethanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atmA02
1IQNA 5H4IB 1HBTH 3DFJA 4E7RG 4A1XA 1A4WH 2BTCE 4VGCB 5E0GA 4DJZB 2ANWA 4NA8A 1B0EA 4DCDA 2FOEA 4TPYA 1F0TA 3C27B 1UVSH 2WPMS 4NWLA 3GICB 4GVUA 1TNGA 1FONA 1ZPZA 1UTOA 2NU3E 3LGWA 1SQOA 3PO1C 4XBDA 3SU2A 3TJOA 2CXVA 4DGJA 1TE0A 3ZZ5A 4KELA 1GVZA 3A82A 1V3XA 3JZ1B 3SHCH 2VB0A 1G36A 1GJ6A 2Y5GA 1AVXA 3ATMA 4UFEH 1HAVA 2QN5T 4OS6A 1GI4A 3VB3A 4GUXA 1AO5A 1W12U 2AERH 2H9HA 3TJNA 4LZ1H 2TGAA 2PSXA 3RXKA 4B75A 2JETB 1GI5A 3E8LA 4NA7A 3RXBA 1H8IH 2R3UA 4O3UA 5JBAS 3E0PB 5LPRA 2ZHWH 5EPYA 2PKAA 1KDQA 1EAXA 1QL9A 2BLOA 1P2NA 3T28A 1VGCB 2FIRH 5TCCA 1XUKA 4F4OC 1TGNA 5A09A 2QAAA 2TGPZ 1NU9A 3A81A 1C1WH 3RXHA 1ZSKA 4ZHAA 5FCKA 1UO6A 4CREA 4AFZA 1YCPK 4HZHA 2ZDLA 1SGTA 1GI3A 2F83A 3K6YA 2ZFQH 1W0ZU 3U98H 4AYVB 1C2IA 1SGPE 1D3TB 5JB9S 1H8DH 5A0CA 5DK1A 1N6YA 1CBWB 1P2IA 1XMNB 4XFQA 1UHBB 1O2ZA 2BY9X 2F9PA 2Z6BD 1ARCA 2O8MA 3RMMH 4D8NA 5C5NA 1A46H 1YPJH 2PTNA 1KXAA 2FOFA 1ABJH 5HYOA 2WPHS 2ULLA 1V6DA 3M7UA 1J17T 2GDEH 1UJ1A 1YPMH 1QURH 2KAIB 1FLEE 4FUHA 1GMHF 5F03A 5L2YH 5EXMA 5E0HA 1ANDA 2BDHA 2Q6DA 1AZ8A 1MTNB 1FV9A 3LJJA 3SU5A 3GY5A 3H5CB 4BAQB 1Y8TA 4SGAE 3M3SA 5DP6A 1GMHG 1UVOA 2STAE 2Z3CA 1SPJA 3PWCA 2PGQB 2VVUA 3Q3YA 4B2CA 1LMWB 1MZAA 1F0UA 3A8DA 1OYTH 1Z7KA 3LGUA 3IITA 2BDBA 3RXUA 1C5PA 2GD4B 1PPEE 1O3GA 2CGAA 1SSXA 3QTOH 1MUEB 2FP7B 4A6LA 2VVVA 1O2SA 2ALVA 2RDLA 1MU8B 2P3FH 1L1NA 2D1JA 3KQBA 1O2YA 3SJ9A 1UK4A 1O3CA 1RJXB 3ITIA 1PPBH 1UVUH 3QZRA 1HPGA 1QQUA 1ZPBA 1QL8A 4BTUB 1DUAA 2ZQ1A 3EQ0H 3QWCH 1W13U 5CHAC 1GHZA 1YPHE 2GT7A 2Q6GA 5GDSH 2P8OB 5ETXA 1W14U 4JCNA 2A5KA 1CVWH 3P17H 3AVZA 3MFJA 4FUGA 4JZ1A 3GCTF 1ZOMA 2XWAA 3GYLB 3MU1A 1RTLA 3C1KA 3ZZCA 4DG4A 2ZHEH 1O5CB 2AMQA 3S9BA 1GJ8B 1OWKA 1NS3A 4DURA 2P95A 1NRSH 2CF8H 1F5LA 1LVYA 1FY4A 1Y3WA 5FCRA 1AE8H 3S9CA 3UNSA 3PYHA 1QGFA 1LDTT 2BM2A 5E2PA 1O5DH 4B1TA 2NWNA 1YP9A 5BRRE 4INKA 1GBFA 1V2ST 2H9EH 4AB9A 5LPFA 1BBRH 1OWEA 2ZU3A 4F49A 3M5MA 4OS1A 1G2MA 2FS8A 1GBIA 3QZQA 2GZ9A 3MU8A 1LPKB 4WY3A 4NSYA 4Q7YA 1Y5AT 4MNWA 2PWXA 1C5QA 2PUXB 2NU4E 1CU1A 2ZFRH 5K0HA 2Z7FE 1TQ0B 2ODPA 1SG8B 2BZ6H 3ZZ3A 4X2VA 4WWYA 1WSSH 4FUDA 3SV2H 1K1LA 1O3KA 3SUDA 1NZQH 3PLBA 1HV7A 1GJBB 1VCPA 3B8JA 3MHWU 2P3UB 1O2QA 1SQTA 3SW2B 3M5NA 4A7IB 1DWEH 1THPB 1QY6A 2CMYA 5LPEA 2ZQ2A 1VR1H 2R2MB 3RXEA 2FXRA 1B0FA 1E38B 3P6ZB 1CO7E 1GDNA 1O3PB 4I32A 4X2XA 2ZPQA 3KQDA 5HM2A 3ZVEA 1UVTH 4LOYH 4WVPE 2DE9A 2GT8A 2C8ZB 4HTCH 1KY9A 2Y80A 2HRVA 1O34A 3OYPA 4K3JA 1RD3B 2V0BA 2GV7A 1QCPA 1DVAH 1MH0A 5GWZA 4TWWA 1OWIA 4Z0KA 1P01A 3SUFA 1YC0A 1FAXA 1TALA 2W3IA 1WBGB 3M36A 3O8DA 1SOZA 3GY2A 1HFDA 2HNTC 2PTCE 1LTOA 1SOTA 1AWHB 1SVPA 1HIAA 1H1BA 1C1RA 3KQCA 1SI5H 1PYTC 3SNAA 1S85A 1CA0C 6CHAB 1O31A 5A0AE 2ZDNA 2XC4A 2FX4A 3RXSA 4YM9A 1P8VC 1LHDH 2TRMA 1OOKB 3UQOA 1TQ7B 2ANMH 3NKKA 2A4RA 4KTUA 3RC5A 2AIQA 1GDUA 1XUGA 2OXSA 4CH8B 4K8BA 4GHQA 1P2JA 2AYWA 1D9IA 2H1UA 1O5FH 8ESTE 1HB0B 5DPAA 4ESTE 4ABHA 1IHSH 1UHBA 2AFQB 1NT1A 4M7GA 5E2OA 2OBQA 1S83A 2BOKA 2VIOA 3OY5U 1JXPA 4BAOB 1O3IA 2FLBH 1L0ZA 1HUTH 3BEIB 2ZIQH 4B2AA 1KXBA 1ZLRA 2ANYA 2J92A 2PHBA 5GJ4B 3RM2H 1YLDA 4NSVA 1XXDA 5EQQA 1SHYA 3RUOA 1CGHA 4CRAA 2KAIA 4D9QA 4CR9A 5C67A 3F9GA 2C4FH 2C8WB 4A1TA 1UTJA 1DSTA 1PPZA 1SLXB 3L33A 1GHXH 4NIXA 5F8XA 1A0HB 1DY8A 1T8NA 2GDDA 3BF6H 1L2EA 1SGFG 2QXJA 1OS8A 1O3FA 1AFEH 1TGCA 3VGCB 2FODA 2OP9A 2CHAC 4UFFH 1NRQH 1QTFA 3PTNA 1V2QT 3K6ZA 1UMAH 1BCUH 4X1RU 4GHTA 1PQAA 1AGJA 1LHGH 1XUIA 3T25A 3MOCA 4YOIA 1NM6A 4UFGH 3AAVA 4MDSA 4ZUHA 1DLKB 1YCPH 2ZU1A 1GBHA 2PR3A 1BZXE 4U30A 1GMCF 3M5LA 2YNAA 1W7XH 3TK5A 1NRRH 2G5NA 1BTZA 2VH6A 4BAMB 1RIWB 4MPVA 1VITF 1A0JA 3SGBE 2SGAA 1GBJA 1Y3VA 4X6OA 3P8GA 6GCHG 2F9NA 2BB4A 2ESTE 3M5OA 3A7XA 2F91A 2WV5A 1O2UA 1F7ZA 1VITG 1TX8A 2D26C 2WINI 5AVDA 2Y5HA 3PLPA 1AFQC 4YOJA 1C5UA 2FI5E 5AHGH 2OQUA 2ZGJA 1SGIB 4IN2A 4XSKU 1Q2WA 3ATKA 4IW4E 4GSOA 4Q7XA 3LGTA 9LPRA 1GBAA 2BDCA 2JKHA 2XCNA 2ZU5A 1SL3A 2GCTC 4X1PU 3RC4A 2BMGB 3PMAB 1ZSJA 1GBLA 2R0LA 5EXNA 1DANH 1HJAB 4H4FA 1GGDC 2GGVB 2EA3A 1NC6A 2V3OH 2G55A 3ATLA 1UCYE 2O8UA 4X1SU 2CJIA 3E90B 1QA7A 1C9TA 4Y6DA 1P05A 1ZZZA 1S5SA 1CHGA 1MD7A 2PGBB 2XBWA 1N8OB 3T27A 5FXLA 3TH3H 1S0QA 2SGPE 3SO3A 1LQDB 1XXFA 3T2NA 2A4GA 1Z1JA 1WAYB 1OWDA 1UTMA 2BQWB 1C5XB 2QF3A 4NIWA 4DT7B 2ZKSA 1RFNA 1ZTJA 4YLUA 2ODQA 3EYDA 1BRCE 3ZV8A 3GY4A 2ZFPH 3STJA 1E35B 2ZCHP 1QR3E 3BIUH 2O9QA 1ZTLA 2WPIS 5FPTA 3CP7A 3SV7A 3SNCA 1ESTA 3GCHC 3S7HB 1BHXF 1G3BA 3QDZB 1LVMA 2I6SA 1C1MA 1KXCA 4ABBA 2BDGA 3GOVB 1D3DB 2VIWA 2ZCLP 1TFXA 5EQRA 4ZKSU 3RXPA 2ZHQH 3TK6A 1GBDA 1YPGH 5EXLA 5LGOA 3B9FH 2SFAA 4X8VH 2BD9A 4R8TB 2JH0D 2VU8E 2GZ7A 1AKSA 1CHOF 1IQGA 2BX3A 2FYQA 1EJMA 3KQEA 9ESTA 1XUFA 1BHXB 2H5CA 1MD8A 1NRNH 2FOGA 2XCFA 4FUBA 1GL0E 2SNVA 1CHOG 3M3TA 1X7AC 3UY9A 4NZQA 1FY8E 3F1SB 1TIOA 3U9AH 3BN9A 3LGYA 2BLWA 4AGJA 1GJDB 1MBMA 1D6WA 4IS5A 1NPMA 4GLYA 1RTFB 2AMPA 4XBCA 1QA0A 2V35A 3MTYA 1AVGH 1MU6B 3SV6A 1T31A 1CT4E 1DSUA 2ZGCA 3LC3A 1NTPA 2Z9LA 1LQEA 3BG4B 3KIDU 1HXFH 2PW8H 5JYIA 1O2XA 3UREA 4B71A 3ZYDA 1C5TA 2VINA 3SBKA 1DWCH 2HOBA 1AHTH 3GCNA 3KGPA 1FY1A 1MTUA 2ZP0H 2Z9GA 1QRZA 1P04A 3IG6B 3QGNB 1HLTH 5F8ZA 3RC6A 4XBBA 3VB6A 1GVKB 2BDAA 4MG3A 1C5NH 2D8WA 2Y5FA 2G52A 4X8SH 5IYTA 4B76A 4PROA 1O2TA 1QBVH 3QUMP 1QB6A 3FP8E 4MNVA 2BVRH 1O3HA 1UTNA 3STIA 2FOCA 2ASUB 3I78A 1ELBA 3LT3A 1NFUA 1KLIH 2BX4A 1K1JA 1WQSA 3NK8A 1O3AA 3O8BA 1BTPA 3G01A 3PO1B 4BTTB 1C5OH 3QLPH 3RXGA 1P2QA 2J38A 1C1UH 2ILNA 2F3CE 1PJPA 2ZDAH 4KKDA 1AE5A 1TRMA 3A8BA 1E37B 1V2JT 1FNIA 1XUHA 1FI8A 1EXFA 1GCTC 1GL1A 5ESTE 4HGCA 1WU1A 3DA9B 3EGKH 1BMMH 5C1XA 1LO6A 5T3HA 1E34B 5T6GA 3TJVA 3ZYEA 1O0DH 1XVOA 1HIAB 4MPXA 1FIWA 3DUXH 2PSYA 3KNXA 4JZEH 3SUGA 3OX7U 4IC6A 2WPLS 3TGKE 4DIHH 1MQ6A 1D6RA 1NFWA 1FZZA 2XC5A 5C5OA 3A8AA 2J2UA 5HMAA 4ZXXH 1FJSA 1O5AB 4U01A 2B7DH 3MNXA 1KSNA 4INLA 2A7CA 4AG2A 1F2SE 2DUCA 4RKJB 4YT7H 2XBVA 4JK6A 4AFUA 4MLFB 5FX6A 5JBBS 1QB1A 5LH8A 1TNHA 4X0WU 5DP8A 1O3NA 4I8JA 5L6NH 1C5RA 3L6PA 3F6UH 4O97A 1QQ4A 1PPHE 1A3BH 2FOMB 3U69H 4KGAA 1CQQA 2O8LA 3CENA 4CBNA 1LVBA 4Y8XA 1TYNA 1Z8GA 1TWXB 5JBTA 4DY7B 2GMTB 2IJOB 4NCYA 1GHVH 1BRBE 3T5FH 2SGFE 3LPRA 3Q3XA 1QFKH 3QO6A 1O2WA 1SGYE 4KP0A 3V13A 4X6PA 4U2WA 1ARBA 1O5BB 1ELAA 1OP8A 3P8FA 1PQ5A 1FPHH 5DG6A 1AZZA 5TCAA 1FDPA 1PPFE 4OS2A 3A7WA 2ZHFH 3PB1E 3HK6B 1V2MT 4B73A 4CRBA 3LOXA 4UD9H 1XM1A 2UUKB 3S7KB 1KYNA 1O38A 1DWBH 2BDIA 1MTWA 4KTCA 5F8TA 3RU4T 1GPZA 3P8NA 4OGYA 2VGCC 1UTKA 2UWLA 2ZFFH 1VCQA 3BG8A 4O03A 5FBEA 4I8HA 1LHFH 1XVMA 4CHAB 3SQHE 1O39A 1K1IA 4D7GA 2ZNKH 4DW2U 1EOJA 1AUTC 1H9IE 3ZZBA 4FXGH 4NGAH 1G3CA 1ZR0A 1BRAA 3RP2A 1KXDA 3AASA 3DD2H 1DXWA 1C9PA 5A2MH 2NU2E 1QRWA 3PROA 3SJOA 4X1NU 1TNKA 1HXEH 1THSH 1HAPH 1LVOA 1ZRKA 4RN6A 5CHAB 1HAXB 2VIPA 3ESTA 1LPGB 7ESTE 1TONA 1GHAF 3VXFH 1EUFA 1Z71A 2G51A 3QN7A 1QBNA 2ZDVH 1AVWA 1TA6A 2K1QA 1C5ZB 2TGDA 4K69A 1GHAG 1SMFE 3GCTG 4I7YH 1O2GH 2H2ZA 4I8LA 1A2CH 2P93A 1O36A 3BTEE 1OP0A 2AMDA 4ASHA 1W0YH 2HPPH 3MYWA 4AOQA 1F5RA 2VIQA 3V0XA 1JRTA 1O2JA 4ABIA 1DS2E 1T8LA 1TOCB 1SFIA 1ELEE 1TPOA 3RMLH 2DE8A 1O30A 1K1PA 1RTKA 3P8OA 2WPKS 4X2YA 1ZSLA 3T62A 3UWJH 4AGKA 1P09A 1AD8H 2B8OH 3BEFB 3L3TA 1JBUH 2BD7A 2FO9A 1BBRE 3UUZA 2BY7X 1ZHPA 1TAWA 3CS0A 2ZDKA 1GHBF 4X6MA 2QXHA 3U8RH 3TK9A 1GMDF 1ZHRA 2UWPA 1Y3UA 1WCZA 1TB6H 1C5WB 1OWHA 1GHBG 1W11U 2QIQA 3BTME 5HGGA 4Y8ZA 3RXMA 1O3JA 1GMDG 1DITH 1GJAB 4Y0ZE 4D9RA 3UR9A 1ZTKA 3TJUA 1PPGE 2PFEA 3SI4H 2BXTH 2FTMA 1MBQA 1V2WT 2XC0A 2ZO3H 3ZZ7A 1GI0A 3HATH 4FUFA 3FP7E 5A8YA 3TGIE 4ISNA 4LXBH 1EQ9A 3B23B 3TU7H 3QTVH 1PYTD 2FTLE 1A61H 2HNTF 1Z8IB 1O2LA 2VWNA 1SHHB 1THRH 2I6QA 3A80A 3Q77A 1AMHA 4A5TS 1O2OA 4WH6A 1EKBB 2ZGHA 4FU8A 3TIUA 2AGGX 4TPIZ 3M3VA 3TH4H 1GG6C 1IQFA 1V2NT 1OXGA 1TNJA 4X1QU 2EC9H 3MNCA 4ABGA 7GCHF 1P06A 1IQEA 1Y5BT 2LNCA 1VCWA 1AKSB 1C5YB 1CA0B 1V2UT 4WMDA 2ZCKP 1ETSH 1SLVB 3TNTA 1C2HA 3A8CA 3V3MA 3BTWE 3KL6A 1QBOA 1GI8B 2VIVA 3P92A 3U8TH 3K9XB 2BZAA 1KIGH 1MKXK 2F9VA 3PTBA 1WUNH 5EG4A 1KTTB 1EZXC 1ESAA 2UWOA 1SGNE 1OKXA 1CGIE 1V2TT 3A84A 1BJVA 3M61U 1EPTC 1N6XA 3T26A 3EAJA 1Q31A 4MPUA 3SV9A 2JH6D 4BAHB 3OU0A 2FWWA 1NN6A 1OWJA 3NWUA 4I8GA 2Z9KA 1C2LA 1UTPA 1P2KA 3UWIA 1EAIA 1C1PA 4E06H 1C2KA 3FAOA 1SLUB 2PKSC 4ZHLU 2ANKH 2Y81A 3SV8A 2GKVE 4YZUA 1ZMLA 1TA2A 1ACBE 1C2DA 5F6MA 3K65B 4WF8A 4MNXA 1D4PB 1E36B 3SU0A 2VWOA 5DJ7A 3A7ZA 3VPKA 3E0NB 4KTSA 2CHAB 2O8WA 2FX6A 1SGRE 1ZJKA 1TMBH 4DOQA 3ZVFA 2GP9B 1TOMH 2OTVA 1EB2A 4JZIA 3ZVAA 3MU4A 1GHYH 1GBBA 1RS0A 3O8RA 2W7UA 3FANA 1EB1H 1C1VH 5BPEA 5FPYA 1UK2A 2A45B 1ZPCA 1EX3A 3FZZA 1FXYA 1DICA 2G00A 4THNH 4UE7H 1GMCG 3DHKH 1HAIH 1YM0A 5CE1A 3BTGE 1J16A 2LPRA 1SGDE 3RXJA 1EAUA 5FHTA 4Y7BA 5FX5A 2ZF0H 3U1JB 1MAYA 4AFSA 1IAUA 2FM2A 2XTTB 1BOQA 2TGTA 2FI3E 5L2ZH 1G3EA 2C3SA 3FFGA 2ZA5A 1P02A 2A2XH 3VEQB 5DP4A 1AFQB 1A5IA 4OGXA 1C2FA 3PV4A 1O3DA 1JMOH 1TPAE 3A83A 1YLCA 3KN2A 4K60A 4IMQA 3SJKA 2OC8A 4ISLA 1A5GH 3ZV9A 4BANB 3M35A 3V12A 3D65E 1O2KA 1YBWA 3UTUH 2QXGA 2GCTB 3SU6A 5AF9H 1ELCA 1P3CA 5EW1H 1DX5M 4CBOA 1GGDB 4JYUH 1EP5A 3SU4A 3D62A 1ETRH 3A89A 1KTSB 3ATIA 4U32A 4DVAU 2HNTE 1J8AA 3LC5A 4IGDA 3W95A 2ZZUH 4J1YA 1Z6EA 3RDZA 1C1QA 4ZKRU 1P9SA 2FDAA 2ZHDA 2HALA 2UUYA 1H4WA 1ELTA 4ABAA 1AQ7A 1EP6A 5A0BA 1TNLA 2PUQH 1CT2E 2OC1A 4CRFA 1FY5A 1PQ7A 3H7TA 3GDUA 2AGIX 2FESH 3UOUA 5EQSA 1HNEE 1ZJDA 4IN1A 1O37A 1O5GH 3RXRA 1LPZB 3UIRA 2RCEA 3FP6E 2QF0A 1C1SA 3SZNA 1ZGVA 1K1OA 1NO9H 3VFEA 1W3CA 3GY6A 1M9UA 1DM4B 1BTUA 1DLEA 4NIVA 2W5EA 2NU1E 2VNTA 5DGJA 1MZDA 5EODA 1GJCB 4UDWH 2SGEE 2YNBA 1Z1IA 2OC0A 4UFDH 3LONA 3SU1A 2ODYB 1MCVA 1V2VT 2EI6A 1LKBA 1GBEA 1O33A 1Z8RA 3GDVA 3NUMA 5C1YA 3GCHB 5B6OA 5AFYH 1S81A 3RU4D 4ZKOU 2IOTA 1FN6A 1K9OE 3MU5A 2G4TA 1CGJE 1L1GA 1L1JA 1S6FA 2A4OA 3UR6A 5CMXH 1LCYA 2BY5X 2BLQA 1IQLA 1ABIH 2PLXA 1P03A 1AWFH 3OSYA 4BNRA 1AUJA 2SNWA 4NZLA 4AG1A 1KXEA 5DP3A 4ZAEA 1OX1A 3PMJA 2ZU4A 2SGQE 4AZ2B 1YF4A 3BV9B 3MU0A 4Y0YE 4H6TA 4YTAA 5SGAE 1DXPA 1N1LA 2ZG0H 2R0KA 4FU9A 1O2HA 1IHTH 1TBRH 2A0QB 1QJ6B 2R3YA 1QNJA 1P2MA 1D3QB 3F9EA 3SHAH 3KHVA 1O2RA 4UONA 1LHEH 3SNDA 1YPKH 3PMHB 4ISOA 1JIRA 1C4U2 1GI7B 1BB0B 1L4ZA 3SN8A 4IBLH 2BQ7B 3UPEA 3URCA 2EI7A 3EA9A 1P57B 2W26A 8KME2 2B9LA 2FI4E 1GBKA 2TPIZ 1HDTH 2P94A 2RG3A 4FVBA 2GVFA 3FZDA 1VITH 1BIOA 2ZDMA 2Y6TA 3FVFB 3GYMA 2BD5A 3A85A 1BMNH 3BEUA 1ZRBA 1K1NA 1FPCH 4MVNA 1AB9C 1C1OA 4ABEA 3TGJE 3ENSB 3UOPA 1FIZA 1Y3XA 4K1TA 3ZVCA 1UK3A 4MNYA 4CRDA 3I77A 2F9OA 5DP7A 1AI8H 3MO3A 3H7OA 1C1TA 3RM0H 2HPQH 1YYY1 5HM9A 1ZHMA 3MNBA 3MO9A 2STBE 2FOBA 5E0JA 4NFEA 1J14A 5EU8A 2XW9A 4VGCC 3RXVA 1ZYOA 1GWAA 1YPHC 1B5GH 3MI4A 2QA9E 2A1DB 3MH7A 3ODDA 3HKJB 3BTQE 2A5IA 3R3GB 5A8ZA 1XX9A 2O8TA 1ELFA 3EA7A 1GCTB 2AH4X 2BY6X 2GV6A 1ANEA 1AN1E 2ZPRA 2ZTZA 1RGQA 1C2GA 1QIXB 2BY8X 3KF2A 3QK1A 1CE5A 4A92A 4OS4A 1QJ7B 2QY0B 1GVLA 2JETC 2VJ1A 1MAXA 4FUJA 2BD2A 3A7YA 4Q7ZA 1HAHH 4BAKB 1O3OA 1XKAC 1IQIA 3ZVBA 1BDAA 1WOFA 4E05H 1HJ9A 5L30H 2G5VA 5JB8S 1ELVA 1VGCC 2WV4A 1HYLA 4WXVA 1MTSA 2BVSH 1CSOE 1T4UH 1AU8A 1NRPH 1XUJA 1WV7H 1J15A 2Q1JA 3P95A 2BYAX 2V3HH 1S0RA 2ZGXH 5C1UA 1CT0E 3PMBB 1Q3XA 1BA8B 1P9UA 1MKWK 2Z9IA 1CBWC 1V2RT 1G3DA 5GPIB 3RU4E 4K2YA 4X8UH 1FMGA 2J9NA 1DDJA 1GI2A 1HAZB 2A7HA 3GDSA 1C2MA 1FQ3A 3MH6A 1GDQA 1SR5C 2GMTC 2BD3A 4XOJA 1ANBA 4Y7AA 3SGAE 4B2BA 4DIIH 1EATA 4Q2KA 4R0IA 4Y79A 1MCTA 3ZZ6A 1MTNC 3ZVDA 1EOLA 4WJG2 2ZECA 4LZ4B 4BTIB 2F9UA 3M37A 3S69A 3U1IB 4H6SB 1UTQA 5GCHF 3TPIZ 4TYDA 2V6NA 2VGCB 4FUIA 3TLOA 1A7SA 7LPRA 1H9LB 1IOEA 1MQ5A 1P12E 6LPRA 2A2QH 3GISB 5GCHG 5PTPA 1UCYK 3LGIA 4TY6A 3RLYH 1ZMJA 2PV9B 1P0SH 3ZVGA 4Y8YA 4GCHF 4CHAC 1FY3A 1DT2A 4CR5A 2AS9A 1SLWB 2D2DA 2RA3A 1DUEA 3EE0B 3QGJA 4IC5A 1GJ5H 1SBWA 1EJAA 2WUCA 4JZDH 4GCHG 1W2KH 2A5AA 1O35A 2QV1A 3RXAA 3MH4A 2BOHB 1YPLH 5DO4H 2AEIH 3Q3KA 3RXFA 2EEKA 4WH8A 4AYYB 1A1RA 1MTVA 2GTBA 1GI1A 3LJOA 1DY9A 1ZMNA 2P8OC 1ELGA 1TMTH 3GY8A 3A87A 1T8OA 4CH2B 1BT7A 1EAWA 4Z6AH 4X2WA 2P3TB 1QL7A 3TVJB 3UFAA 1BITA 2XBXA 3ODFA 1ETTH 3HKIB 3I29A 2AGEX 3MNSA 5JPMH 1IQJA 1K2I1 1WYKA 1JOUB 1JWTA 5GXPA 4K8YA 4SGBE 3WY8A 3LH3A 2OINA 3D49H 1HJ8A 3OY6U 5ESBA 3TITA 3TNSA 3VB7A 3SJ8A 2GX4A 3NZIA 3T29A 2Z3DA 2ZWLH 5FAHA 1SGEE 2FOAA 2C8YB 3K2UA 3S9AA 3E91A 1VJAU 4NFFA 3O8CA 2XXLA 5C2ZA 3NXPA 4AFQA 1ESBA 3P70B 1AY6H 4JMYA 1LKAA 3M7QA 3M7TA 1BTXA 1C2JA 3E6PH 3VB4A 2HWLB 3JZ2B 2A32A 3PLKA 2H5DA 3E3TA 4X8TH 2H9TH 1DPOA 1TLDA 2CN0H 5JDUB 4WMEA 3AW1A 5FPSA 2FLRH 1PPCE 3N7OA 3ATWA 5AFZH 5DP5A 2HVXA 4ZHMU 4Y76A 1D3PB 2VWMA 2Y82A 1GCDA 5EPNA 3RXOA 3MH5A 2J34A 1TBQH 1SQAA 3S0NA 3OTJE 1T8MA 1UTLM 1SC8U 3BTKE 5DP9A 1JRSA 1O3BA 2OBOA 1GG6B 4A1VA 1O3LA 2ZTXA 4J2YB 1BTWA 1BMLA 4TY7A 1RXPA 1GBMA 2FZZA 1TMUH 2OCVB 5I25A 4ZKNU 1K28D 3SUEA 2Z94A 3ZZ4A 2OD3B 7GCHG 1K21H 4HI3A 2CF9H 4CRCA 3NCLA 2Q6FA 1BJUA 4YESB 2A31A 2G4UA 1K1MA 4NG9H 3SU3A 1QRXA 6CHAC 1T7CA 1MMJN 1J9CH 1C4Y2 2R9PA 1C5MD 1TNIA 2WPJS 2J4IA 3UQVA 4NA9H 2RA0A 2P16A 2F9BH 3RXTA 1C5SA 2BQ6B 4XDEA 3BIVH 4RSPA 1TPSA 2QGRA 1YKTA 1QB9A 3RXQA 3RXDA 1W8BH 3SGQE 1KLJH 2AIPA 3PWBA 1BTYA 2BLVA 4MTBA 1V2KT 1PFXC 1V2LT 4AORA 3KCGH 1EPTB 3QX5H 4JYVH 3HGPA 5TJXA 2WYGA 1OSSA 3RMNH 2Z9JA 4UEHH 3SORA 5IDKA 3BTHE 1Y5UT 1TRNA 1UVPA 3V7TA 2GCHF 4O3TA 4RKOB 4BOHA 1G2LA 3TH2H 1L4DA 2PKSB 1Y3YA 1NROH 3HK3B 1OP2A 1T4VH 2OUAA 1FN8A 4K1SA 2GCHG 3SNBA 1E0FD 3UNQA 1TABE 3ELAH 1ELDE 1Z8JB 3A7TA 1HCGA 4JZFH 4OS5A 1SB1H 4ZH8A 1F0RA 3VGCC 3F9FA 1TBZH 3E1XB 2OLGA 1H9HE 1S6HA 4D7FA 3ZZDA 2YOLA 1P3EA 1DFPA 1ANCA 1B7XB 7KMEH 2BHGA 2C8XB 2C90B 1GI6A 1P10A 5EW2H 1KXFA 3GCOA 2QCYA 4D76A 1IQMA 1BTHH 2FYRA 1BRUP 4AN7A 4ZROA 1TGSZ 2XRCA 4I8KA 3VXEH 1O2PA 1O2NA 4CRGA 1YPEH 2VVCA 4YT6H 3D23A 1HAOH 3SOSA 2ALPA 1MKWH 3EA8A 3SNEA 8LPRA 2G8TA 2IN2A 1IQHA 1XKBC 1SGCA 1OYQA 1RIWC 3LKWA 6GCHF 1O2MA 3VB5A 2XYAA 2B5TB 1AIXH 1W7GH 3U8OH 3LGVA 1EZSC 2ZFTA 6ESTA 4K1EA 1ORFA 2Y7XA 3ZZ9A 2VH0A 2J95A 1PQ8A 3IWMA 1T32A 3URDA 3EDXB 1K22H 1F5KU 4Q80A 2OC7A 5C3NA 1HAVB 3CS7A 1RRKA 2WUBA 4K5ZA 1EASA 4TWYA 2BDYA 4ISIH 1FUJA 2OQ5A 4WXIA 3NPSA 1G32B 2FOHA 2HLCA 1Y59T 2VIDA 3LU9B 5GIBA 1CA8B 5JBCS 2A4QA 2IPHA 5FBIA 1HAYB 2UUFB 1HJAC 4I33A 2NU0E 1DWDH 2PKAB 1KDQB 3PM3A 1UCYH 4BXSA 4ABFA 1BMAA 2VWLA 2TBSA 1FAKH 1VZQH 4FUEA 3SI3H 4FVDA 4YO9A 4JYTA 5A8XA 4X6NA 1C1NA 4MQAA 2GZ8A 3A7VA 4QT8C 5J4SA 5HXFA 1N8OC 3A86A 5J4QA 4ABDA 1S82A 3UNRA 2ZU2A 2ZC9H 1GI9B 4YLQH 2R2WU 1INCA 1Z6JH 1G37A 2B0FA 1QHRB 4AB8A 4ZXYH 4O9VA 1O3MA 5K7RA 1LHCH 3GY7A 1IQKA 4MPWA 3RMOH 3RLWH 4FU7A 1G30B 3BSQA 1W10U 1EJNA 1ID5H 1GJ7B 1NESE 4BXWA 5T6DA 2FS9A 2G81E 2FMJA 4ZMAH 8GCHF 5DKMA 1V2PT 2TIOA 1WQVH 2HGTH 1F0SA 3A88A 1KLTA 3DT0H 1BQYA 3F9HA 3HGNA 4E7NA 2BXUH 1EZUC 2ZI2H 3MO6A 8GCHG 4H42U 3HPTB 2UUJB 4OS7A 2SGDE 5ABWA 1WTGH 2FEQH 2XNIA 1O32A 2ZTYA 1GJ9B 2ZFSA 3SJIA 5T6FA 1GHWH 1U6QA 1NFXA 1TGBA 4YOGA 5C20A 1BBRK 2ZGBH 2Z3EA 3AW0A 1ZGIA 4WMFA 2W7SA 1C2EA 1WTHD 1TX7A 1TX6A 1TPPA 3LH1A 4AX9H 3R0FA 1BUIA 1YCPM 1TGTA 3E16B 1G9IE 4Y71A 5E8EH 3MMGA 1A3EH 2QC2A 3MWIU 2W3KA 2XWBI 3ZZ8A 3DFLA 3BTTE 4HFPB 4ABJA 2J94A 1VJ9U 4FUCA 1O2VA 4Y11E 1O5EH 2ZEBA 3BTFE 2M5TA 3AAUA 1EPTA 5EGMA 1SFQB 2BD8A 2P59A 2FPZA 3Q00A 1GBTA 1P11E 1TRYA 1DE7H 2ZPSA 1QJ1B 3SQEE 1NY22 5I46H 1NFYA 3ZZAA 1DOJA 4INHA 2BVXH 4IMZA 4I31A 4ISHH 4NIYA 2H6MA 3BG4C 2BD4A 1SGQE 2WYJA 1OPHB 2CV3A 3W94A 2A7JA 2QYIA 4GAWA 3Q76A 4LK4A 3F68H 2XBYA 3RXIA 2Y7ZA 2QXIA 3KEEA 4GPGA 4JK5A 1GJ4H 2THFB 4NWKA 1O2IA 1V2OT 1HRTH 3BTDE 4XE4A 1C5VA 2JH5D 2EI8A 5G4BA 1P2OA 4Y10E 4B74A 1NU7B 1A5HA 1EZQA 3LIWA 1AB9B 1S84A 3RXLA 1HAGE 1HGTH 1MKXH 1C4V2 1GBCA 3LDXH 3RXCA 1YGCH 2C93B 5EOKA 1JIMA 1F92A 1C5LH 1SGFA 3GY3A 1O3EA 1A0LA
chains in the Genus database with same CATH superfamily
1IQNA 5H4IB 1HBTH 3DFJA 4E7RG 4A1XA 1A4WH 2BTCE 4VGCB 5E0GA 4DJZB 2ANWA 4NA8A 1B0EA 4DCDA 2FOEA 4TPYA 1F0TA 3C27B 1UVSH 2WPMS 4NWLA 3GICB 4GVUA 1TNGA 1FONA 1ZPZA 1UTOA 2NU3E 3LGWA 1SQOA 3PO1C 4XBDA 3SU2A 3TJOA 2CXVA 4DGJA 1TE0A 3ZZ5A 4KELA 1GVZA 3A82A 1V3XA 3JZ1B 3SHCH 2OK5A 2VB0A 1G36A 1GJ6A 2Y5GA 1AVXA 3ATMA 4UFEH 1HAVA 2QN5T 4OS6A 1GI4A 3VB3A 4GUXA 1AO5A 1W12U 2AERH 2H9HA 3TJNA 4LZ1H 2TGAA 2PSXA 3PRBA 3RXKA 4B75A 2JETB 1GI5A 3E8LA 4NA7A 3RXBA 1H8IH 2R3UA 4O3UA 5JBAS 3E0PB 5LPRA 2ZHWH 5EPYA 2PKAA 1KDQA 1EAXA 1QL9A 2BLOA 1P2NA 5DSFA 3T28A 1VGCB 2FIRH 5TCCA 1XUKA 4F4OC 1TGNA 5A09A 2QAAA 2TGPZ 1NU9A 3A81A 1C1WH 3RXHA 1ZSKA 4ZHAA 5FCKA 1UO6A 4CREA 4AFZA 1YCPK 4HZHA 2ZDLA 1SGTA 1GI3A 2F83A 3K6YA 2ZFQH 1W0ZU 3U98H 4AYVB 1C2IA 1SGPE 1D3TB 5JB9S 1H8DH 5A0CA 5DK1A 1N6YA 1CBWB 1P2IA 1XMNB 4XFQA 1UHBB 1O2ZA 2BY9X 2F9PA 2Z6BD 1ARCA 2O8MA 3RMMH 4D8NA 5C5NA 1A46H 1YPJH 2PTNA 1KXAA 2FOFA 1ABJH 3KYFA 5HYOA 2WPHS 2ULLA 5C17A 1V6DA 3M7UA 1J17T 2GDEH 1UJ1A 1YPMH 1QURH 2KAIB 1FLEE 4FUHA 1GMHF 5F03A 5L2YH 5EXMA 5E0HA 1ANDA 2BDHA 2Q6DA 1AZ8A 1MTNB 1FV9A 3LJJA 3SU5A 3GY5A 3H5CB 4BAQB 1Y8TA 4SGAE 3M3SA 5DP6A 1GMHG 1UVOA 2STAE 3DSPA 2Z3CA 1SPJA 3PWCA 2PGQB 2VVUA 3Q3YA 4B2CA 1LMWB 1MZAA 1F0UA 3A8DA 1OYTH 1Z7KA 3LGUA 3EE7A 3IITA 2BDBA 2L6OA 3RXUA 1C5PA 2GD4B 1PPEE 1O3GA 2CGAA 1SSXA 3QTOH 1MUEB 2FP7B 1UW7A 4A6LA 2VVVA 1O2SA 2ALVA 2RDLA 1MU8B 2P3FH 1L1NA 2D1JA 3KQBA 1O2YA 3SJ9A 1UK4A 1O3CA 1RJXB 3ITIA 1PPBH 1UVUH 3QZRA 1HPGA 1QQUA 1ZPBA 1QL8A 4BTUB 1DUAA 2ZQ1A 3EQ0H 3QWCH 1W13U 5CHAC 1GHZA 1YPHE 2GT7A 2Q6GA 5GDSH 2P8OB 5ETXA 1W14U 4JCNA 2A5KA 1CVWH 3P17H 3AVZA 3MFJA 4FUGA 4JZ1A 3GCTF 1ZOMA 2XWAA 3GYLB 3MU1A 1RTLA 3C1KA 3ZZCA 4DG4A 2ZHEH 1O5CB 2AMQA 3S9BA 1GJ8B 1OWKA 1NS3A 4DURA 2P95A 1NRSH 2CF8H 1F5LA 1LVYA 1FY4A 1Y3WA 5FCRA 1AE8H 3S9CA 3UNSA 3PYHA 1QGFA 2J98A 1LDTT 2BM2A 5E2PA 1O5DH 4B1TA 2NWNA 1YP9A 5BRRE 4INKA 1GBFA 1V2ST 2H9EH 4AB9A 5LPFA 1BBRH 1OWEA 2ZU3A 4F49A 3M5MA 4OS1A 1G2MA 2FS8A 1GBIA 2V7QD 3QZQA 2GZ9A 3MU8A 4FOUC 1LPKB 4WY3A 4NSYA 3N99A 4Q7YA 1Y5AT 4MNWA 2PWXA 1C5QA 2PUXB 2NU4E 1CU1A 2ZFRH 5K0HA 2Z7FE 1TQ0B 2ODPA 5CHBA 1SG8B 2BZ6H 3ZZ3A 4X2VA 4WWYA 3ZIAD 1WSSH 4FUDA 3SV2H 1K1LA 1O3KA 3SUDA 1NZQH 3PLBA 1HV7A 3F2GA 1GJBB 1VCPA 3B8JA 3MHWU 2P3UB 1O2QA 1SQTA 3SW2B 3M5NA 4A7IB 1DWEH 1THPB 1QY6A 2CMYA 5LPEA 2ZQ2A 3F0OA 1VR1H 2R2MB 3RXEA 2FXRA 1B0FA 1E38B 3P6ZB 1CO7E 1GDNA 1O3PB 4I32A 4P02A 4X2XA 2ZPQA 3KQDA 5HM2A 3ZVEA 1UVTH 4LOYH 4WVPE 2DE9A 2GT8A 4YXWD 2C8ZB 4HTCH 1KY9A 2Y80A 2HRVA 1O34A 3OYPA 4K3JA 1RD3B 2V0BA 2GV7A 1QCPA 1DVAH 1MH0A 5GWZA 4TWWA 1OWIA 4Z0KA 1P01A 3SUFA 1E1QD 1YC0A 1FAXA 1TALA 2W3IA 1WBGB 3M36A 3O8DA 1SOZA 3GY2A 1HFDA 2HNTC 2PTCE 1LTOA 1SOTA 1AWHB 1SVPA 1HIAA 1H1BA 1C1RA 3KQCA 1SI5H 1PYTC 3SNAA 1S85A 1CA0C 6CHAB 1O31A 5A0AE 2ZDNA 2XC4A 5C0TA 2FX4A 3RXSA 4YM9A 1P8VC 1LHDH 2TRMA 1OOKB 3UQOA 1TQ7B 2ANMH 3NKKA 2A4RA 4KTUA 3RC5A 2AIQA 1GDUA 1XUGA 2OXSA 4CH8B 4K8BA 4GHQA 1P2JA 2AYWA 1H8HD 1D9IA 2H1UA 1O5FH 8ESTE 1HB0B 5DPAA 3OAAD 3UB0A 4ESTE 4ABHA 1IHSH 1UHBA 2AFQB 1NT1A 4M7GA 5E2OA 2OBQA 1S83A 2BOKA 2VIOA 3OY5U 1JXPA 4BAOB 1O3IA 2FLBH 1L0ZA 1HUTH 3BEIB 2XNDD 2ZIQH 4B2AA 1KXBA 1ZLRA 2ANYA 2J92A 2PHBA 5GJ4B 3RM2H 1YLDA 5B6LA 4NSVA 1XXDA 5EQQA 1SHYA 3RUOA 1CGHA 4CRAA 2KAIA 4D9QA 4CR9A 5C67A 3F9GA 2C4FH 2J97A 2C8WB 4A1TA 1UTJA 1DSTA 1PPZA 1SLXB 3L33A 1GHXH 3F0PA 4NIXA 5F8XA 1A0HB 1DY8A 1T8NA 2GDDA 2JIZD 3BF6H 1L2EA 1SGFG 2QXJA 1OS8A 2KCOA 2VBCA 1O3FA 1AFEH 1TGCA 3VGCB 2FODA 2OP9A 2CHAC 4UFFH 1NRQH 1QTFA 3PTNA 1V2QT 3K6ZA 1UMAH 1BCUH 4X1RU 4GHTA 1PQAA 1AGJA 1LHGH 1XUIA 3T25A 3MOCA 3PRDA 4YOIA 1NM6A 4UFGH 3AAVA 4MDSA 4ZUHA 1DLKB 1YCPH 2ZU1A 1GBHA 2PR3A 1BZXE 4U30A 1GMCF 3M5LA 2YNAA 1W7XH 3TK5A 1NRRH 2G5NA 1BTZA 2VH6A 4BAMB 1RIWB 4MPVA 1VITF 1A0JA 3SGBE 2SGAA 1GBJA 1Y3VA 4X6OA 3P8GA 6GCHG 2F9NA 4XD7D 2BB4A 2ESTE 3M5OA 3A7XA 2F91A 2WV5A 1O2UA 1F7ZA 1VITG 1TX8A 2D26C 2WINI 2RDEA 5AVDA 2Y5HA 3PLPA 1AFQC 4YOJA 1C5UA 2FI5E 5AHGH 2OQUA 2ZGJA 1SGIB 4IN2A 4XSKU 3VG8A 1Q2WA 3ATKA 4IW4E 4GSOA 4Q7XA 3LGTA 9LPRA 1GBAA 2BDCA 2JKHA 2XCNA 2ZU5A 1SL3A 2GCTC 4X1PU 3RC4A 2XOKD 2BMGB 3PMAB 1ZSJA 1GBLA 2R0LA 5EXNA 1DANH 1HJAB 4H4FA 1GGDC 4AC9A 3N7DA 2GGVB 2EA3A 1NC6A 2KZ4A 2V3OH 2G55A 3ATLA 1UCYE 2O8UA 4X1SU 2CJIA 3E90B 1QA7A 1C9TA 4Y6DA 1P05A 1ZZZA 1S5SA 1CHGA 1MD7A 2PGBB 2XBWA 1N8OB 3T27A 5FXLA 3TH3H 5IK2D 1S0QA 2SGPE 3SO3A 1LQDB 1XXFA 3T2NA 2A4GA 1Z1JA 1WAYB 1OWDA 1UTMA 2BQWB 1C5XB 2QF3A 4NIWA 4DT7B 2ZKSA 1RFNA 4B6FA 1ZTJA 4YLUA 3PV5A 2ODQA 3EYDA 1BRCE 3ZV8A 5HKKD 3GY4A 2ZFPH 3STJA 1E35B 2ZCHP 1QR3E 4HG6A 3BIUH 2O9QA 1ZTLA 2WPIS 5FPTA 3CP7A 3SV7A 3SNCA 1ESTA 3GCHC 3S7HB 1BHXF 1G3BA 3QDZB 1LVMA 2I6SA 1C1MA 1KXCA 4ABBA 2BDGA 3GOVB 1D3DB 2VIWA 2ZCLP 1TFXA 5EQRA 4ZKSU 3RXPA 2ZHQH 3TK6A 1GBDA 1YPGH 2WSSD 5EXLA 3B9FH 5LGOA 2SFAA 4X8VH 2BD9A 1COWD 4R8TB 2JH0D 2VU8E 2GZ7A 1AKSA 1CHOF 2KCAA 1IQGA 2BX3A 2FYQA 1EJMA 3KQEA 9ESTA 1XUFA 1BHXB 2H5CA 1MD8A 1NRNH 2FOGA 2XCFA 4FUBA 1GL0E 2SNVA 1CHOG 3M3TA 1X7AC 3UY9A 4NZQA 1FY8E 3F1SB 1TIOA 3U9AH 3BN9A 3LGYA 2BLWA 4AGJA 1GJDB 1MBMA 1D6WA 4IS5A 1NPMA 4GLYA 1RTFB 2AMPA 4XBCA 1QA0A 2V35A 3MTYA 1AVGH 1MU6B 3SV6A 1T31A 1CT4E 1DSUA 2ZGCA 3LC3A 1NTPA 2AHME 2J98B 4Z1MD 2Z9LA 1LQEA 3BG4B 3KIDU 3KYGA 3OE7D 1HXFH 2PW8H 5JYIA 1O2XA 3UREA 4B71A 3ZYDA 1C5TA 2VINA 3WW7A 3SBKA 1DWCH 2HOBA 1AHTH 3GCNA 3KGPA 1FY1A 1MTUA 2ZP0H 2Z9GA 2V3MA 1QRZA 1P04A 2LELA 3IG6B 3QGNB 1HLTH 5F8ZA 3RC6A 4XBBA 3VB6A 1GVKB 2BDAA 4MG3A 1C5NH 2D8WA 2Y5FA 2G52A 4X8SH 5IYTA 4B76A 4PROA 1O2TA 1QBVH 3QUMP 1QB6A 3FP8E 2L74A 4MNVA 2BVRH 1O3HA 1UTNA 3STIA 2FOCA 2ASUB 3I78A 1ELBA 3LT3A 1NFUA 1KLIH 2BX4A 1K1JA 1WQSA 3NK8A 1O3AA 3AK5A 3O8BA 1BTPA 3G01A 2KX4A 3PO1B 4BTTB 2CK3D 1C5OH 3QLPH 3RXGA 1P2QA 2J38A 1C1UH 2ILNA 2F3CE 1PJPA 2ZDAH 3OEED 4KKDA 1AE5A 1TRMA 2F4LA 1E37B 1V2JT 3A8BA 1FNIA 1XUHA 1FI8A 1EXFA 1GCTC 1GL1A 5ESTE 4HGCA 5GNDA 1WU1A 3DA9B 2M2AA 3EGKH 1BMMH 2EQNA 5C1XA 3OTPA 1LO6A 4I86A 5T3HA 1E34B 5T6GA 3TJVA 3ZYEA 1O0DH 1XVOA 1HIAB 4MPXA 1FIWA 3DUXH 2PSYA 3KNXA 4JZEH 3SUGA 3OX7U 4IC6A 2WPLS 3TGKE 4DIHH 1MQ6A 1D6RA 1NFWA 1FZZA 2XC5A 5C5OA 3A8AA 2J2UA 5HMAA 4ZXXH 1FJSA 1O5AB 4U01A 2B7DH 3MNXA 1KSNA 4INLA 2A7CA 4AG2A 1F2SE 1MABB 2DUCA 4RKJB 4YT7H 2XBVA 4JK6A 4AFUA 4MLFB 5FX6A 5JBBS 1QB1A 2KM0A 1TNHA 5LH8A 2JJ2D 4X0WU 5DP8A 1O3NA 4I8JA 5L6NH 1C5RA 3L6PA 3F6UH 4O97A 1QQ4A 1PPHE 1A3BH 2FOMB 3U69H 4KGAA 1CQQA 2O8LA 3CENA 4CBNA 1LVBA 4Y8XA 1TYNA 1Z8GA 1TWXB 5JBTA 4DY7B 2GMTB 2IJOB 2W6ID 4NCYA 1GHVH 1BRBE 3T5FH 2SGFE 3LPRA 3Q3XA 1QFKH 3QO6A 1O2WA 1SGYE 4KP0A 3V13A 4X6PA 4U2WA 1ARBA 1O5BB 1ELAA 1OP8A 3P8FA 1PQ5A 1FPHH 5DG6A 1AZZA 5TCAA 1FDPA 1PPFE 4OS2A 3A7WA 2ZHFH 3PB1E 3HK6B 1V2MT 4B73A 4CRBA 3LOXA 4UD9H 5EJLA 1XM1A 2UUKB 3S7KB 1KYNA 1O38A 1DWBH 2BDIA 1MTWA 4KTCA 5F8TA 3RU4T 1GPZA 3P8NA 4OGYA 2J5UA 1UTKA 2UWLA 2VGCC 1VCQA 2ZFFH 3BG8A 4O03A 5FBEA 4I8HA 1LHFH 1XVMA 4CHAB 3SQHE 1O39A 1K1IA 4D7GA 1E1RD 2ZNKH 4DW2U 1EOJA 1AUTC 1H9IE 3ZZBA 4FXGH 4NGAH 1G3CA 4XRNA 1ZR0A 1BRAA 3RP2A 3DCLA 3NRLA 2HVYB 1KXDA 3AASA 3DD2H 1DXWA 1YY3A 1C9PA 5A2MH 2NU2E 1QRWA 3PROA 3SJOA 1KMHB 4X1NU 1TNKA 5FL7D 1HXEH 1THSH 1HAPH 1LVOA 1ZRKA 4RN6A 5CHAB 1HAXB 2VIPA 4B6EA 3ESTA 1LPGB 7ESTE 1TONA 1GHAF 3VXFH 1EUFA 1Z71A 3UAIC 2G51A 3QN7A 1QBNA 2ZDVH 1AVWA 1TA6A 2K1QA 1C5ZB 2TGDA 4K69A 1GHAG 1SMFE 3GCTG 4I7YH 1O2GH 2H2ZA 4I8LA 1A2CH 2P93A 4ZCNA 1O36A 3BTEE 1OP0A 2AMDA 4ASHA 1W0YH 2HPPH 3MYWA 4AOQA 1F5RA 2VIQA 3V0XA 1JRTA 1O2JA 4ABIA 1DS2E 1T8LA 1TOCB 1SFIA 1ELEE 1TPOA 3RMLH 2DE8A 1O30A 1K1PA 1RTKA 3P8OA 2WPKS 4X2YA 1ZSLA 3T62A 3UWJH 4AGKA 1P09A 1AD8H 2B8OH 3BEFB 3L3TA 1JBUH 2BD7A 2FO9A 1BBRE 3UUZA 2BY7X 1ZHPA 1TAWA 3CS0A 2ZDKA 1GHBF 4X6MA 2QXHA 3U8RH 3TK9A 1GMDF 1ZHRA 2UWPA 1Y3UA 1WCZA 1TB6H 1C5WB 1OWHA 1GHBG 1W11U 2QIQA 3BTME 5HGGA 4Y8ZA 3RXMA 1O3JA 1GMDG 1DITH 1GJAB 4Y0ZE 4D9RA 3UR9A 1ZTKA 3TJUA 1PPGE 2PFEA 3SI4H 2YMSC 2BXTH 2FTMA 4ACAA 1MBQA 1V2WT 2XC0A 2ZO3H 3ZZ7A 1GI0A 3HATH 4FUFA 3MQKC 3FP7E 5A8YA 3TGIE 4ISNA 4LXBH 1EQ9A 3B23B 3TU7H 3QTVH 1PYTD 2FTLE 1A61H 2HNTF 1Z8IB 1O2LA 2VWNA 1SHHB 1THRH 2I6QA 3A80A 3Q77A 1AMHA 4A5TS 1O2OA 4WH6A 1EKBB 1QZ8A 2ZGHA 4FU8A 3TIUA 2AGGX 4TPIZ 3M3VA 3TH4H 1GG6C 1IQFA 5F53A 1V2NT 1OXGA 1TNJA 4X1QU 2EC9H 3MNCA 2W6JD 4ABGA 1WXRA 7GCHF 1P06A 1IQEA 1Y5BT 1VCWA 2LNCA 1AKSB 1C5YB 1CA0B 1V2UT 4WMDA 2ZCKP 1ETSH 1SLVB 3TNTA 1C2HA 3A8CA 3V3MA 3BTWE 3KL6A 1QBOA 1GI8B 2VIVA 4TSFD 3P92A 2K0QA 3U8TH 3K9XB 3KQ5A 2BZAA 1KIGH 1MKXK 2F9VA 3PTBA 1WUNH 2LP6A 5EG4A 1KTTB 1EZXC 5KECA 1ESAA 2UWOA 1SGNE 1OKXA 2QF4A 1CGIE 1V2TT 3A84A 1BJVA 1H8ED 3M61U 1EPTC 1N6XA 3T26A 3EAJA 1Q31A 4MPUA 3SV9A 2JH6D 4BAHB 3OU0A 2FWWA 1NN6A 1OWJA 3NWUA 4I8GA 2Z9KA 1C2LA 1UTPA 1P2KA 3UWIA 1EAIA 1C1PA 4E06H 1C2KA 2WPDD 3FAOA 1SLUB 2PKSC 4ZHLU 2ANKH 2Y81A 3SV8A 2GKVE 4YZUA 1ZMLA 1TA2A 1ACBE 1C2DA 5F6MA 3K65B 4WF8A 4MNXA 1D4PB 1WDIA 1E36B 3SU0A 2VWOA 5DJ7A 3A7ZA 3VPKA 3E0NB 4KTSA 2CHAB 2O8WA 2FX6A 1SGRE 5DN6D 1ZJKA 1TMBH 4DOQA 3ZVFA 2GP9B 1TOMH 2OTVA 1EB2A 4JZIA 3ZVAA 3MU4A 1GHYH 1GBBA 1RS0A 3O8RA 2W7UA 3FANA 1EB1H 1C1VH 5BPEA 5FPYA 1UK2A 2A45B 5EIYA 1ZPCA 1EX3A 3FZZA 1FXYA 1DICA 2G00A 4THNH 4UE7H 1GMCG 3DHKH 1HAIH 1YM0A 5CE1A 3BTGE 1J16A 2LPRA 1SGDE 3RXJA 1EAUA 5FHTA 4Y7BA 5FX5A 2ZF0H 3U1JB 1MAYA 4AFSA 1IAUA 2FM2A 2XTTB 1BOQA 2TGTA 2FI3E 5L2ZH 1G3EA 4RT0A 1VKYA 2C3SA 3FFGA 2ZA5A 5EJ1A 1P02A 2A2XH 3VEQB 5DP4A 1AFQB 1A5IA 4OGXA 1C2FA 1W0KD 3PV4A 1O3DA 1JMOH 1TPAE 3A83A 1YLCA 3KN2A 4K60A 4IMQA 3SJKA 2OC8A 4ISLA 1A5GH 3ZV9A 4BANB 3M35A 3V12A 3D65E 1O2KA 1YBWA 3UTUH 2QXGA 2GCTB 3SU6A 5AF9H 1ELCA 1P3CA 5EW1H 1DX5M 4CBOA 1GGDB 1S6LA 4JYUH 1EP5A 3SU4A 3D62A 1ETRH 3A89A 1KTSB 3ATIA 4U32A 2WZQA 4DVAU 2HNTE 1J8AA 2KFWA 3LC5A 4IGDA 3W95A 3PV2A 2ZZUH 4J1YA 1Z6EA 3RDZA 1C1QA 2K8IA 4ZKRU 1P9SA 2FDAA 2ZHDA 2HALA 2UUYA 4F55A 5HIZA 1H4WA 1ELTA 4ABAA 1AQ7A 3CNRA 1EP6A 5A0BA 1TNLA 2PUQH 1CT2E 2OC1A 4CRFA 1FY5A 1PQ7A 3H7TA 3GDUA 2AGIX 2FESH 3UOUA 5EQSA 1HNEE 1ZJDA 4IN1A 1O37A 1O5GH 3RXRA 1LPZB 3UIRA 2RCEA 3FP6E 2QF0A 1C1SA 3SZNA 1ZGVA 1K1OA 1NO9H 3VFEA 1W3CA 3GY6A 1M9UA 1DM4B 1BTUA 1DLEA 2IJD1 4NIVA 2W5EA 2NU1E 2VNTA 5DGJA 1MZDA 5EODA 1GJCB 4UDWH 2SGEE 2YNBA 1Z1IA 2OC0A 4UFDH 3LONA 3SU1A 2ODYB 1MCVA 1V2VT 2EI6A 1LKBA 1GBEA 1O33A 1Z8RA 3GDVA 3NUMA 5C1YA 3GCHB 5B6OA 5AFYH 5CDFE 1S81A 3RU4D 4ZKOU 2IOTA 1FN6A 1K9OE 4P00A 3MU5A 2G4TA 1CGJE 1L1GA 1L1JA 1S6FA 2A4OA 3UR6A 5CMXH 1LCYA 2BY5X 2BLQA 1IQLA 1ABIH 2PLXA 1P03A 1AWFH 3OSYA 4BNRA 1AUJA 2SNWA 3OFND 4NZLA 4AG1A 1KXEA 5DP3A 4ZAEA 1OX1A 2PP6A 3PMJA 2ZU4A 2SGQE 3GS9A 4AZ2B 1YF4A 3BV9B 3MU0A 4Y0YE 4H6TA 4YTAA 5SGAE 1DXPA 1N1LA 2ZG0H 2R0KA 4FU9A 1O2HA 1IHTH 1TBRH 2A0QB 1QJ6B 2R3YA 1QNJA 1P2MA 1D3QB 3F9EA 3SHAH 3KHVA 1O2RA 4UONA 1LHEH 3SNDA 1YPKH 3PMHB 4ISOA 1JIRA 1C4U2 1GI7B 1BB0B 1L4ZA 3SN8A 4TT3D 4IBLH 2BQ7B 3UPEA 3URCA 2EI7A 3EA9A 1P57B 2W26A 8KME2 2B9LA 2FI4E 1GBKA 2TPIZ 1HDTH 2P94A 2RG3A 4FVBA 2GVFA 3FZDA 1VITH 1BIOA 2ZDMA 2Y6TA 3FVFB 3GYMA 2BD5A 3A85A 1BMNH 3BEUA 1ZRBA 2KCPA 1K1NA 3WWBA 1FPCH 4MVNA 1AB9C 1C1OA 4ABEA 3TGJE 3ENSB 3UOPA 1FIZA 1Y3XA 4K1TA 3ZVCA 1UK3A 4MNYA 4CRDA 3I77A 2F9OA 5DP7A 1AI8H 3MO3A 3H7OA 1C1TA 3RM0H 2HPQH 1YYY1 5HM9A 1ZHMA 3MNBA 3MO9A 2STBE 2FOBA 5E0JA 4NFEA 1J14A 5EU8A 2XW9A 4VGCC 3RXVA 1ZYOA 1GWAA 4Q63A 1YPHC 1B5GH 3MI4A 2QA9E 2A1DB 3MH7A 3ODDA 3HKJB 3BTQE 2A5IA 3R3GB 5A8ZA 1XX9A 2O8TA 1ELFA 3EA7A 1GCTB 2AH4X 2BY6X 2GV6A 1ANEA 1AN1E 2ZPRA 2ZTZA 1RGQA 1C2GA 1QIXB 2BY8X 3KF2A 3QK1A 1CE5A 4A92A 4OS4A 1QJ7B 2QY0B 1GVLA 2JETC 2VJ1A 1MAXA 4FUJA 2BD2A 3A7YA 4Q7ZA 1HAHH 4BAKB 1O3OA 1W0JD 1XKAC 1IQIA 3ZVBA 1BDAA 1WOFA 4E05H 1HJ9A 5L30H 2G5VA 5JB8S 1ELVA 1VGCC 2WV4A 1HYLA 4WXVA 1MTSA 2BVSH 1CSOE 1T4UH 1AU8A 1NRPH 1XUJA 1WV7H 1J15A 2Q1JA 3P95A 2BYAX 2V3HH 1S0RA 2ZGXH 5C1UA 1CT0E 3PMBB 1Q3XA 2JJ1D 1BA8B 1P9UA 1MKWK 2Z9IA 1CBWC 1V2RT 1G3DA 5GPIB 3RU4E 4K2YA 4X8UH 1FMGA 2J9NA 4F48B 1DDJA 1GI2A 1HAZB 2A7HA 3GDSA 1C2MA 1FQ3A 3MH6A 1GDQA 1SKYE 2WHXA 1BMFD 2GMTC 1E79D 1SR5C 2BD3A 4XOJA 1ANBA 4Y7AA 3SGAE 4B2BA 4DIIH 1EATA 3DSGA 4Q2KA 4R0IA 4Y79A 1MCTA 3ZZ6A 1MTNC 3ZVDA 1EOLA 1SQRA 4WJG2 2ZECA 4LZ4B 5KEDA 4BTIB 2F9UA 3M37A 3S69A 3U1IB 4H6SB 1UTQA 5GCHF 3TPIZ 4TYDA 2V6NA 2VGCB 4FUIA 3TLOA 1A7SA 7LPRA 1H9LB 1IOEA 1MQ5A 1P12E 6LPRA 2A2QH 3GISB 5GCHG 5PTPA 1UCYK 3LGIA 4TY6A 3RLYH 1ZMJA 2PV9B 1P0SH 3ZVGA 4Y8YA 4GCHF 4CHAC 1FY3A 1DT2A 4CR5A 5C94A 2AS9A 1SLWB 1NBMD 2D2DA 2RA3A 1DUEA 3EE0B 3QGJA 4IC5A 1GJ5H 1SBWA 1EJAA 2WUCA 4JZDH 4GCHG 1W2KH 2A5AA 1O35A 2QV1A 3RXAA 3MH4A 2BOHB 1YPLH 5DO4H 2AEIH 3Q3KA 3RXFA 2EEKA 4WH8A 4AYYB 1A1RA 1MTVA 2GTBA 1GI1A 3LJOA 1DY9A 1ZMNA 2P8OC 4ACBA 1ELGA 1TMTH 3GY8A 3A87A 1T8OA 4CH2B 1BT7A 1EAWA 4Z6AH 4X2WA 2P3TB 1QL7A 3TVJB 3UFAA 1BITA 2XBXA 3ODFA 1ETTH 3HKIB 3I29A 2AGEX 3MNSA 5JPMH 1IQJA 1K2I1 5EJZA 1WYKA 1JOUB 1JWTA 5GXPA 4K8YA 4SGBE 3WY8A 3LH3A 4FETA 2OINA 3D49H 1HJ8A 3OY6U 5ESBA 3TITA 3TNSA 2YMSD 3VB7A 3SJ8A 2GX4A 3NZIA 3T29A 2Z3DA 2ZWLH 5FAHA 1SGEE 2FOAA 2C8YB 2JDID 3K2UA 3S9AA 3E91A 1VJAU 4NFFA 3O8CA 3OEHD 3SZEA 2XXLA 5C2ZA 3NXPA 4AFQA 1ESBA 3P70B 1AY6H 4JMYA 1LKAA 3M7QA 3M7TA 1BTXA 1C2JA 3E6PH 3VB4A 2HWLB 3JZ2B 2YMSB 2A32A 3PLKA 2H5DA 3E3TA 4X8TH 4Q4LA 2H9TH 1DPOA 1TLDA 2CN0H 2F43B 5JDUB 4WMEA 3AW1A 5FPSA 2FLRH 1PPCE 3N7OA 3ATWA 5HIYA 5AFZH 5DP5A 2HVXA 4ZHMU 4Y76A 5C0UA 1D3PB 2VWMA 2Y82A 1GCDA 5EPNA 3RXOA 3MH5A 2J34A 4DT4A 1TBQH 1SQAA 3U28C 3S0NA 3OTJE 1T8MA 1UTLM 2HLDD 1SC8U 3BTKE 1YWUA 5DP9A 1JRSA 1O3BA 2OBOA 1GG6B 4A1VA 1O3LA 2ZTXA 4J2YB 1BTWA 1BMLA 4TY7A 1RXPA 1GBMA 2FZZA 1TMUH 2OCVB 5I25A 4ZKNU 1K28D 3SUEA 2Z94A 3ZZ4A 2OD3B 7GCHG 1K21H 4HI3A 2CF9H 4CRCA 1K0HA 3NCLA 2Q6FA 1BJUA 4YESB 3H09A 2A31A 2G4UA 1K1MA 4NG9H 3SU3A 1QRXA 6CHAC 1T7CA 1MMJN 1J9CH 1C4Y2 2R9PA 1C5MD 1TNIA 2WPJS 2J4IA 3UQVA 4NA9H 2RA0A 2P16A 2F9BH 3RXTA 1C5SA 2BQ6B 3W1EA 4XDEA 3BIVH 4RSPA 1TPSA 2QGRA 1YKTA 3N7EA 1QB9A 3RXQA 3RXDA 1W8BH 3SGQE 1KLJH 2AIPA 3PWBA 1BTYA 2BLVA 4MTBA 1V2KT 1PFXC 1V2LT 4AORA 3KCGH 2RFKC 1EPTB 3QX5H 4JYVH 3HGPA 2QF5A 5TJXA 2WYGA 1OSSA 3RMNH 2Z9JA 2GJGA 4UEHH 3SORA 5IDKA 3BTHE 1Y5UT 1TRNA 1UVPA 3V7TA 2GCHF 4O3TA 4RKOB 5KGOA 1G2LA 3TH2H 4BOHA 1L4DA 2PKSB 1Y3YA 1NBME 1NROH 3HK3B 1OP2A 1T4VH 2OUAA 1FN8A 4K1SA 2GCHG 3SNBA 1E0FD 3UNQA 1TABE 3ELAH 1ELDE 1Z8JB 4ASUD 3A7TA 2QE7D 1HCGA 4JZFH 4OS5A 1SB1H 4ZH8A 1F0RA 3VGCC 3F9FA 1TBZH 3E1XB 2OLGA 1H9HE 1S6HA 4D7FA 3ZZDA 2YOLA 1P3EA 1DFPA 1ANCA 1B7XB 7KMEH 2BHGA 2C8XB 2C90B 1GI6A 1P10A 5EW2H 1KXFA 3GCOA 2QCYA 4D76A 1IQMA 3F2HA 1BTHH 2FYRA 1BRUP 4AN7A 4ZROA 1TGSZ 2XRCA 4I8KA 3VXEH 1O2PA 1O2NA 4CRGA 1YPEH 2VVCA 4YT6H 3D23A 1HAOH 3SOSA 2ALPA 1MKWH 3EA8A 3SNEA 8LPRA 2G8TA 2IN2A 1IQHA 1XKBC 1SGCA 1OYQA 1RIWC 3LKWA 6GCHF 1O2MA 2KR7A 2XYAA 3VB5A 2B5TB 1AIXH 1W7GH 3U8OH 3LGVA 1EZSC 2ZFTA 6ESTA 4K1EA 1ORFA 2Y7XA 3ZZ9A 2VH0A 2J95A 1PQ8A 3IWMA 1T32A 3URDA 3EDXB 1K22H 1F5KU 4Q80A 4M9FA 2OC7A 5C3NA 1HAVB 3CS7A 1RRKA 2WUBA 4K5ZA 1EASA 4TWYA 2BDYA 4ISIH 1FUJA 2OQ5A 4WXIA 3NPSA 1G32B 2FOHA 2HLCA 1Y59T 2VIDA 3LU9B 5GIBA 1CA8B 5JBCS 2A4QA 2IPHA 5FBIA 1HAYB 2UUFB 1HJAC 4I33A 2NU0E 1DWDH 2PKAB 1KDQB 2IPQX 3PM3A 1UCYH 4BXSA 4ABFA 1BMAA 2VWLA 2TBSA 1FAKH 1VZQH 4FUEA 3SI3H 4FVDA 4YO9A 4JYTA 5A8XA 4X6NA 1C1NA 4MQAA 2GZ8A 3A7VA 4QT8C 2EY4C 5J4SA 5HXFA 3FN8A 1N8OC 3A86A 5J4QA 4ABDA 1S82A 3UNRA 2ZU2A 2ZC9H 1GI9B 4YLQH 2R2WU 1INCA 1Z6JH 1G37A 2B0FA 1QHRB 4AB8A 4ZXYH 1OHHD 4O9VA 1O3MA 5K7RA 1LHCH 3F2FA 1IQKA 3GY7A 4MPWA 3RLWH 3RMOH 4FU7A 1G30B 3BSQA 1W10U 1EJNA 1ID5H 1GJ7B 1NESE 3FOAA 4BXWA 5T6DA 2FS9A 2G81E 2FMJA 4ZMAH 8GCHF 5DKMA 5T1VA 1V2PT 2TIOA 1WQVH 2WV9A 2HGTH 1F0SA 3A88A 1KLTA 3DSOA 3DT0H 1BQYA 3F9HA 3HGNA 4E7NA 2BXUH 1EZUC 2ZI2H 3MO6A 8GCHG 4H42U 3HPTB 2UUJB 4OS7A 2SGDE 5ABWA 1WTGH 4RT1A 2FEQH 2XNIA 1O32A 2ZTYA 1GJ9B 2ZFSA 3SJIA 5T6FA 1GHWH 1U6QA 1NFXA 1TGBA 4YOGA 5C20A 1BBRK 2ZGBH 2Z3EA 3AW0A 1FX0B 1ZGIA 4WMFA 2W7SA 1C2EA 1WTHD 1TX7A 1TX6A 1TPPA 3LH1A 3WWFA 4AX9H 3R0FA 1BUIA 1YCPM 1TGTA 3E16B 1G9IE 4Y71A 1YLNA 5E8EH 3MMGA 3SYJA 1A3EH 2QC2A 3MWIU 2W3KA 2XWBI 3ZZ8A 3DFLA 3BTTE 4HFPB 4ABJA 2J94A 1VJ9U 4FUCA 1O2VA 4Y11E 1O5EH 2ZEBA 3BTFE 2M5TA 3AAUA 1EPTA 5EGMA 1SFQB 2BD8A 2P59A 2FPZA 3Q00A 1GBTA 1P11E 1TRYA 1DE7H 2ZPSA 1QJ1B 3SQEE 1NY22 5I46H 1NFYA 3ZZAA 1DOJA 4INHA 2BVXH 4IMZA 4I31A 4ISHH 4NIYA 2H6MA 3BG4C 2BD4A 1SGQE 2WYJA 1OPHB 2CV3A 3W94A 2A7JA 2QYIA 4GAWA 3Q76A 4LK4A 3F68H 2XBYA 3RXIA 3FKSD 2Y7ZA 2QXIA 3KEEA 4GPGA 4JK5A 1GJ4H 2THFB 4NWKA 1O2IA 1V2OT 1HRTH 3BTDE 4XE4A 1C5VA 2JH5D 2EI8A 5G4BA 1P2OA 4Y10E 4B74A 1NU7B 4OM9A 2KCYA 1A5HA 1EZQA 3FO8D 3LIWA 3F3BA 1AB9B 1S84A 3RXLA 1EFRD 1HAGE 1HGTH 4RI0A 1MKXH 1C4V2 1GBCA 3LDXH 3RXCA 1YGCH 2C93B 5EOKA 1JIMA 1F92A 1C5LH 1SGFA 3GY3A 1O3EA 1A0LA
chains in the Genus database with same CATH topology
1IQNA 5H4IB 1HBTH 3DFJA 4E7RG 4A1XA 1A4WH 2BTCE 4VGCB 5E0GA 4DJZB 2ANWA 4NA8A 1B0EA 4DCDA 2FOEA 4TPYA 1F0TA 3C27B 1UVSH 2WPMS 4NWLA 3GICB 4GVUA 1TNGA 1FONA 1ZPZA 1UTOA 2NU3E 3LGWA 1SQOA 3PO1C 4XBDA 3SU2A 3TJOA 2CXVA 4DGJA 1TE0A 3ZZ5A 4KELA 1GVZA 3A82A 1V3XA 3JZ1B 3SHCH 2VB0A 1G36A 1GJ6A 2Y5GA 1AVXA 3ATMA 4UFEH 1HAVA 2QN5T 4OS6A 1GI4A 3VB3A 4GUXA 1AO5A 1W12U 2AERH 2H9HA 3TJNA 4LZ1H 2TGAA 2PSXA 3RXKA 4B75A 2JETB 1GI5A 3E8LA 4NA7A 3RXBA 1H8IH 2R3UA 4O3UA 5JBAS 3E0PB 5LPRA 2ZHWH 5EPYA 2PKAA 1KDQA 1EAXA 1QL9A 2BLOA 1P2NA 3T28A 1VGCB 2FIRH 5TCCA 1XUKA 4F4OC 1TGNA 5A09A 2QAAA 2TGPZ 1NU9A 3A81A 1C1WH 3RXHA 1ZSKA 4ZHAA 5FCKA 1UO6A 4CREA 4AFZA 1YCPK 4HZHA 2ZDLA 1SGTA 1GI3A 2F83A 3K6YA 2ZFQH 1W0ZU 3U98H 4AYVB 1C2IA 1SGPE 1D3TB 5JB9S 1H8DH 5A0CA 5DK1A 1N6YA 1CBWB 1P2IA 1XMNB 4XFQA 1UHBB 1O2ZA 2BY9X 2F9PA 2Z6BD 1ARCA 2O8MA 3RMMH 4D8NA 5C5NA 1A46H 1YPJH 2PTNA 1KXAA 2FOFA 1ABJH 5HYOA 2WPHS 2ULLA 1V6DA 3M7UA 1J17T 2GDEH 1UJ1A 1YPMH 1QURH 2KAIB 1FLEE 4FUHA 1GMHF 5F03A 5L2YH 5EXMA 5E0HA 1ANDA 2BDHA 2Q6DA 1AZ8A 1MTNB 1FV9A 3LJJA 3SU5A 3GY5A 3H5CB 4BAQB 1Y8TA 4SGAE 3M3SA 5DP6A 1GMHG 1UVOA 2STAE 2Z3CA 1SPJA 3PWCA 2PGQB 2VVUA 3Q3YA 4B2CA 1LMWB 1MZAA 1F0UA 3A8DA 1OYTH 1Z7KA 3LGUA 3IITA 2BDBA 3RXUA 1C5PA 2GD4B 1PPEE 1O3GA 2CGAA 1SSXA 3QTOH 1MUEB 2FP7B 4A6LA 2VVVA 1O2SA 2ALVA 2RDLA 1MU8B 2P3FH 1L1NA 2D1JA 3KQBA 1O2YA 3SJ9A 1UK4A 1O3CA 1RJXB 3ITIA 1PPBH 1UVUH 3QZRA 1HPGA 1QQUA 1ZPBA 1QL8A 4BTUB 1DUAA 2ZQ1A 3EQ0H 3QWCH 1W13U 5CHAC 1GHZA 1YPHE 2GT7A 2Q6GA 5GDSH 2P8OB 5ETXA 1W14U 4JCNA 2A5KA 1CVWH 3P17H 3AVZA 3MFJA 4FUGA 4JZ1A 3GCTF 1ZOMA 2XWAA 3GYLB 3MU1A 1RTLA 3C1KA 3ZZCA 4DG4A 2ZHEH 1O5CB 2AMQA 3S9BA 1GJ8B 1OWKA 1NS3A 4DURA 2P95A 1NRSH 2CF8H 1F5LA 1LVYA 1FY4A 1Y3WA 5FCRA 1AE8H 3S9CA 3UNSA 3PYHA 1QGFA 1LDTT 2BM2A 5E2PA 1O5DH 4B1TA 2NWNA 1YP9A 5BRRE 4INKA 1GBFA 1V2ST 2H9EH 4AB9A 5LPFA 1BBRH 1OWEA 2ZU3A 4F49A 3M5MA 4OS1A 1G2MA 2FS8A 1GBIA 3QZQA 2GZ9A 3MU8A 1LPKB 4WY3A 4NSYA 4Q7YA 1Y5AT 4MNWA 2PWXA 1C5QA 2PUXB 2NU4E 1CU1A 2ZFRH 5K0HA 2Z7FE 1TQ0B 2ODPA 1SG8B 2BZ6H 3ZZ3A 4X2VA 4WWYA 1WSSH 4FUDA 3SV2H 1K1LA 1O3KA 3SUDA 1NZQH 3PLBA 1HV7A 1GJBB 1VCPA 3B8JA 3MHWU 2P3UB 1O2QA 1SQTA 3SW2B 3M5NA 4A7IB 1DWEH 1THPB 1QY6A 2CMYA 5LPEA 2ZQ2A 1VR1H 2R2MB 3RXEA 2FXRA 1B0FA 1E38B 3P6ZB 1CO7E 1GDNA 1O3PB 4I32A 4X2XA 2ZPQA 3KQDA 5HM2A 3ZVEA 1UVTH 4LOYH 4WVPE 2DE9A 2GT8A 2C8ZB 4HTCH 1KY9A 2Y80A 2HRVA 1O34A 3OYPA 4K3JA 1RD3B 2V0BA 2GV7A 1QCPA 1DVAH 1MH0A 5GWZA 4TWWA 1OWIA 4Z0KA 1P01A 3SUFA 1YC0A 1FAXA 1TALA 2W3IA 1WBGB 3M36A 3O8DA 1SOZA 3GY2A 1HFDA 2HNTC 2PTCE 1LTOA 1SOTA 1AWHB 1SVPA 1HIAA 1H1BA 1C1RA 3KQCA 1SI5H 1PYTC 3SNAA 1S85A 1CA0C 6CHAB 1O31A 5A0AE 2ZDNA 2XC4A 2FX4A 3RXSA 4YM9A 1P8VC 1LHDH 2TRMA 1OOKB 3UQOA 1TQ7B 2ANMH 3NKKA 2A4RA 4KTUA 3RC5A 2AIQA 1GDUA 1XUGA 2OXSA 4CH8B 4K8BA 4GHQA 1P2JA 2AYWA 1D9IA 2H1UA 1O5FH 8ESTE 1HB0B 5DPAA 4ESTE 4ABHA 1IHSH 1UHBA 2AFQB 1NT1A 4M7GA 5E2OA 2OBQA 1S83A 2BOKA 2VIOA 3OY5U 1JXPA 4BAOB 1O3IA 2FLBH 1L0ZA 1HUTH 3BEIB 2ZIQH 4B2AA 1KXBA 1ZLRA 2ANYA 2J92A 2PHBA 5GJ4B 3RM2H 1YLDA 4NSVA 1XXDA 5EQQA 1SHYA 3RUOA 1CGHA 4CRAA 2KAIA 4D9QA 4CR9A 5C67A 3F9GA 2C4FH 2C8WB 4A1TA 1UTJA 1DSTA 1PPZA 1SLXB 3L33A 1GHXH 4NIXA 5F8XA 1A0HB 1DY8A 1T8NA 2GDDA 3BF6H 1L2EA 1SGFG 2QXJA 1OS8A 1O3FA 1AFEH 1TGCA 3VGCB 2FODA 2OP9A 2CHAC 4UFFH 1NRQH 1QTFA 3PTNA 1V2QT 3K6ZA 1UMAH 1BCUH 4X1RU 4GHTA 1PQAA 1AGJA 1LHGH 1XUIA 3T25A 3MOCA 4YOIA 1NM6A 4UFGH 3AAVA 4MDSA 4ZUHA 1DLKB 1YCPH 2ZU1A 1GBHA 2PR3A 1BZXE 4U30A 1GMCF 3M5LA 2YNAA 1W7XH 3TK5A 1NRRH 2G5NA 1BTZA 2VH6A 4BAMB 1RIWB 4MPVA 1VITF 1A0JA 3SGBE 2SGAA 1GBJA 1Y3VA 4X6OA 3P8GA 6GCHG 2F9NA 2BB4A 2ESTE 3M5OA 3A7XA 2F91A 2WV5A 1O2UA 1F7ZA 1VITG 1TX8A 2D26C 2WINI 5AVDA 2Y5HA 3PLPA 1AFQC 4YOJA 1C5UA 2FI5E 5AHGH 2OQUA 2ZGJA 1SGIB 4IN2A 4XSKU 1Q2WA 3ATKA 4IW4E 4GSOA 4Q7XA 3LGTA 9LPRA 1GBAA 2BDCA 2JKHA 2XCNA 2ZU5A 1SL3A 2GCTC 4X1PU 3RC4A 2BMGB 3PMAB 1ZSJA 1GBLA 2R0LA 5EXNA 1DANH 1HJAB 4H4FA 1GGDC 2GGVB 2EA3A 1NC6A 2V3OH 2G55A 3ATLA 1UCYE 2O8UA 4X1SU 2CJIA 3E90B 1QA7A 1C9TA 4Y6DA 1P05A 1ZZZA 1S5SA 1CHGA 1MD7A 2PGBB 2XBWA 1N8OB 3T27A 5FXLA 3TH3H 1S0QA 2SGPE 3SO3A 1LQDB 1XXFA 3T2NA 2A4GA 1Z1JA 1WAYB 1OWDA 1UTMA 2BQWB 1C5XB 2QF3A 4NIWA 4DT7B 2ZKSA 1RFNA 1ZTJA 4YLUA 2ODQA 3EYDA 1BRCE 3ZV8A 3GY4A 2ZFPH 3STJA 1E35B 2ZCHP 1QR3E 3BIUH 2O9QA 1ZTLA 2WPIS 5FPTA 3CP7A 3SV7A 3SNCA 1ESTA 3GCHC 3S7HB 1BHXF 1G3BA 3QDZB 1LVMA 2I6SA 1C1MA 1KXCA 4ABBA 2BDGA 3GOVB 1D3DB 2VIWA 2ZCLP 1TFXA 5EQRA 4ZKSU 3RXPA 2ZHQH 3TK6A 1GBDA 1YPGH 5EXLA 5LGOA 3B9FH 2SFAA 4X8VH 2BD9A 4R8TB 2JH0D 2VU8E 2GZ7A 1AKSA 1CHOF 1IQGA 2BX3A 2FYQA 1EJMA 3KQEA 9ESTA 1XUFA 1BHXB 2H5CA 1MD8A 1NRNH 2FOGA 2XCFA 4FUBA 1GL0E 2SNVA 1CHOG 3M3TA 1X7AC 3UY9A 4NZQA 1FY8E 3F1SB 1TIOA 3U9AH 3BN9A 3LGYA 2BLWA 4AGJA 1GJDB 1MBMA 1D6WA 4IS5A 1NPMA 4GLYA 1RTFB 2AMPA 4XBCA 1QA0A 2V35A 3MTYA 1AVGH 1MU6B 3SV6A 1T31A 1CT4E 1DSUA 2ZGCA 3LC3A 1NTPA 2Z9LA 1LQEA 3BG4B 3KIDU 1HXFH 2PW8H 5JYIA 1O2XA 3UREA 4B71A 3ZYDA 1C5TA 2VINA 3SBKA 1DWCH 2HOBA 1AHTH 3GCNA 3KGPA 1FY1A 1MTUA 2ZP0H 2Z9GA 1QRZA 1P04A 3IG6B 3QGNB 1HLTH 5F8ZA 3RC6A 4XBBA 3VB6A 1GVKB 2BDAA 4MG3A 1C5NH 2D8WA 2Y5FA 2G52A 4X8SH 5IYTA 4B76A 4PROA 1O2TA 1QBVH 3QUMP 1QB6A 3FP8E 4MNVA 2BVRH 1O3HA 1UTNA 3STIA 2FOCA 2ASUB 3I78A 1ELBA 3LT3A 1NFUA 1KLIH 2BX4A 1K1JA 1WQSA 3NK8A 1O3AA 3O8BA 1BTPA 3G01A 3PO1B 4BTTB 1C5OH 3QLPH 3RXGA 1P2QA 2J38A 1C1UH 2ILNA 2F3CE 1PJPA 2ZDAH 4KKDA 1AE5A 1TRMA 3A8BA 1E37B 1V2JT 1FNIA 1XUHA 1FI8A 1EXFA 1GCTC 1GL1A 5ESTE 4HGCA 1WU1A 3DA9B 3EGKH 1BMMH 5C1XA 1LO6A 5T3HA 1E34B 5T6GA 3TJVA 3ZYEA 1O0DH 1XVOA 1HIAB 4MPXA 1FIWA 3DUXH 2PSYA 3KNXA 4JZEH 3SUGA 3OX7U 4IC6A 2WPLS 3TGKE 4DIHH 1MQ6A 1D6RA 1NFWA 1FZZA 2XC5A 5C5OA 3A8AA 2J2UA 5HMAA 4ZXXH 1FJSA 1O5AB 4U01A 2B7DH 3MNXA 1KSNA 4INLA 2A7CA 4AG2A 1F2SE 2DUCA 4RKJB 4YT7H 2XBVA 4JK6A 4AFUA 4MLFB 5FX6A 5JBBS 1QB1A 5LH8A 1TNHA 4X0WU 5DP8A 1O3NA 4I8JA 5L6NH 1C5RA 3L6PA 3F6UH 4O97A 1QQ4A 1PPHE 1A3BH 2FOMB 3U69H 4KGAA 1CQQA 2O8LA 3CENA 4CBNA 1LVBA 4Y8XA 1TYNA 1Z8GA 1TWXB 5JBTA 4DY7B 2GMTB 2IJOB 4NCYA 1GHVH 1BRBE 3T5FH 2SGFE 3LPRA 3Q3XA 1QFKH 3QO6A 1O2WA 1SGYE 4KP0A 3V13A 4X6PA 4U2WA 1ARBA 1O5BB 1ELAA 1OP8A 3P8FA 1PQ5A 1FPHH 5DG6A 1AZZA 5TCAA 1FDPA 1PPFE 4OS2A 3A7WA 2ZHFH 3PB1E 3HK6B 1V2MT 4B73A 4CRBA 3LOXA 4UD9H 1XM1A 2UUKB 3S7KB 1KYNA 1O38A 1DWBH 2BDIA 1MTWA 4KTCA 5F8TA 3RU4T 1GPZA 3P8NA 4OGYA 2VGCC 1UTKA 2UWLA 2ZFFH 1VCQA 3BG8A 4O03A 5FBEA 4I8HA 1LHFH 1XVMA 4CHAB 3SQHE 1O39A 1K1IA 4D7GA 2ZNKH 4DW2U 1EOJA 1AUTC 1H9IE 3ZZBA 4FXGH 4NGAH 1G3CA 1ZR0A 1BRAA 3RP2A 1KXDA 3AASA 3DD2H 1DXWA 1C9PA 5A2MH 2NU2E 1QRWA 3PROA 3SJOA 4X1NU 1TNKA 1HXEH 1THSH 1HAPH 1LVOA 1ZRKA 4RN6A 5CHAB 1HAXB 2VIPA 3ESTA 1LPGB 7ESTE 1TONA 1GHAF 3VXFH 1EUFA 1Z71A 2G51A 3QN7A 1QBNA 2ZDVH 1AVWA 1TA6A 2K1QA 1C5ZB 2TGDA 4K69A 1GHAG 1SMFE 3GCTG 4I7YH 1O2GH 2H2ZA 4I8LA 1A2CH 2P93A 1O36A 3BTEE 1OP0A 2AMDA 4ASHA 1W0YH 2HPPH 3MYWA 4AOQA 1F5RA 2VIQA 3V0XA 1JRTA 1O2JA 4ABIA 1DS2E 1T8LA 1TOCB 1SFIA 1ELEE 1TPOA 3RMLH 2DE8A 1O30A 1K1PA 1RTKA 3P8OA 2WPKS 4X2YA 1ZSLA 3T62A 3UWJH 4AGKA 1P09A 1AD8H 2B8OH 3BEFB 3L3TA 1JBUH 2BD7A 2FO9A 1BBRE 3UUZA 2BY7X 1ZHPA 1TAWA 3CS0A 2ZDKA 1GHBF 4X6MA 2QXHA 3U8RH 3TK9A 1GMDF 1ZHRA 2UWPA 1Y3UA 1WCZA 1TB6H 1C5WB 1OWHA 1GHBG 1W11U 2QIQA 3BTME 5HGGA 4Y8ZA 3RXMA 1O3JA 1GMDG 1DITH 1GJAB 4Y0ZE 4D9RA 3UR9A 1ZTKA 3TJUA 1PPGE 2PFEA 3SI4H 2BXTH 2FTMA 1MBQA 1V2WT 2XC0A 2ZO3H 3ZZ7A 1GI0A 3HATH 4FUFA 3FP7E 5A8YA 3TGIE 4ISNA 4LXBH 1EQ9A 3B23B 3TU7H 3QTVH 1PYTD 2FTLE 1A61H 2HNTF 1Z8IB 1O2LA 2VWNA 1SHHB 1THRH 2I6QA 3A80A 3Q77A 1AMHA 4A5TS 1O2OA 4WH6A 1EKBB 2ZGHA 4FU8A 3TIUA 2AGGX 4TPIZ 3M3VA 3TH4H 1GG6C 1IQFA 1V2NT 1OXGA 1TNJA 4X1QU 2EC9H 3MNCA 4ABGA 7GCHF 1P06A 1IQEA 1Y5BT 2LNCA 1VCWA 1AKSB 1C5YB 1CA0B 1V2UT 4WMDA 2ZCKP 1ETSH 1SLVB 3TNTA 1C2HA 3A8CA 3V3MA 3BTWE 3KL6A 1QBOA 1GI8B 2VIVA 3P92A 3U8TH 3K9XB 2BZAA 1KIGH 1MKXK 2F9VA 3PTBA 1WUNH 5EG4A 1KTTB 1EZXC 1ESAA 2UWOA <