3ATMA

Crystal structure of trypsin complexed with 2-(1h-indol-3-yl)ethanamine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atmA02
5EW2H 5JB8S 4X8SH 3GDSA 1HUTH 1MKWK 1AWHB 1GVLA 2FOEA 1HAHH 4K5ZA 4JK6A 1GBHA 3MU4A 2ZIQH 1AZZA 1AHTH 1GI7B 1KXEA 2VVCA 3MOCA 4HTCH 4Y11E 1TWXB 2HLCA 1BTPA 2C93B 2V35A 2A32A 3GY8A 1UK2A 1GI1A 1GGDC 3RXIA 3RXEA 2A1DB 1QCPA 1A5GH 3A83A 1THSH 1MBMA 2QF0A 1SLVB 3M5OA 2BLWA 1RJXB 1P57B 1GHXH 2FWWA 2GTBA 1O5GH 1UTPA 2FPZA 1ANCA 2BMGB 4LZ4B 4AFZA 4UFGH 2VWNA 1G2LA 2NWNA 2ZHWH 3M35A 4IS5A 3BTGE 3OX7U 2QF3A 1TGCA 1UCYK 1LCYA 2BXUH 3VGCC 2SNVA 3TGKE 4AFSA 2ODPA 4K69A 1ELDE 1EZUC 1ARBA 4TWWA 5AFYH 3UUZA 3T26A 1EPTA 1N8OB 3BTQE 1YPMH 1P9UA 1EP5A 1SSXA 3A87A 1LHCH 1GL0E 1D3QB 1TABE 2ZHEH 3U69H 1GI3A 1NTPA 2GCHF 1MU8B 1MKXH 3RXCA 1Z7KA 3O8DA 1LPGB 3ZZCA 1EZSC 4DT7B 6CHAB 3T29A 2W5EA 2OP9A 2PTNA 3QO6A 1J16A 1HAIH 2D8WA 2WYGA 4JZFH 1UHBA 4B2CA 1W3CA 5EPYA 4ISNA 2ZGHA 1J9CH 1ESBA 1OYQA 2WPKS 2XC4A 3LDXH 5DP8A 2J9NA 2HNTE 3E91A 3P17H 1PPBH 5L30H 2ZFQH 1B5GH 3UTUH 1XUKA 3P8NA 3SUEA 1XKBC 1EZQA 2ZPQA 2OC8A 1C1VH 2BD4A 1KYNA 5EOKA 4IGDA 1O5AB 1GBAA 2XXLA 1EATA 1BTUA 2XC5A 1BJVA 3MO6A 4DY7B 3D62A 1GVZA 4NZLA 3M3TA 1N6YA 1HAPH 1EXFA 4D8NA 1DDJA 3SGBE 1MTNB 2JH0D 3LGTA 1H8DH 3UY9A 1H9LB 2IN2A 1MKWH 3CS7A 3PTBA 2Z9IA 5I25A 1Y59T 1O35A 3PB1E 1MBQA 2XWBI 4Q2KA 2XBVA 1K21H 2PR3A 1SGEE 3D65E 4X8TH 1BMLA 3QGJA 1VR1H 3ZZ5A 1RFNA 2WPMS 4O3UA 1ETRH 5DP9A 2FYQA 2VIPA 2PKSB 3LGUA 1A2CH 4KTCA 2RA3A 5E2OA 3GDVA 1ZPBA 3GYLB 1FQ3A 3KGPA 4JCNA 4X2YA 1P04A 1Z6EA 1Z71A 1CA8B 2AGIX 3NUMA 4E06H 3M3VA 1BMNH 2WUCA 1SG8B 4MLFB 2ZGXH 1TGTA 3S0NA 2EI6A 1KLIH 1O3DA 3SORA 4Y7AA 2ESTE 1W13U 1GHAG 2QXGA 2V3HH 5FAHA 1GBCA 1ACBE 1SGYE 2R9PA 2VWOA 5ESTE 1EOLA 3OSYA 2ULLA 4IC5A 5C5OA 1SLUB 5JB9S 5CHAC 2FI4E 3H5CB 1IQNA 1IQGA 1OS8A 1QB6A 4I33A 3S9AA 1TA6A 2NU3E 4NCYA 1RIWC 1K1PA 2YOLA 3AVZA 5A2MH 1OWHA 4FUIA 1CHGA 6GCHG 1QY6A 3EQ0H 2Z3DA 4B1TA 1RTLA 1O32A 2UUFB 2HGTH 4ASHA 4HFPB 4CH2B 1ZRKA 3LGYA 1SGDE 4XBDA 5AHGH 1CHOF 4NIXA 5GDSH 1VGCB 1C4V2 2ANYA 2BLQA 3BTFE 2GCTB 1QRXA 4X1PU 4YM9A 1XM1A 3M7UA 2Z6BD 1TNKA 1DT2A 4X0WU 3Q77A 3TIUA 1U6QA 1EOJA 5DP3A 3ESTA 1C2JA 1DWDH 5HM2A 4ABAA 1C1SA 1GI8B 3BF6H 3UNRA 2Y5GA 3ZZAA 1TQ7B 1ZTJA 2SFAA 2VWLA 3NPSA 2FESH 1VZQH 2XBXA 1T32A 1F0UA 1GJ4H 1TMBH 1BBRE 2XW9A 2BLOA 1LHEH 1QURH 3F9GA 4FUBA 1A3BH 5C20A 1TIOA 3RLWH 1BTXA 1YP9A 2UWOA 2ZHDA 4BOHA 1BQYA 1LPZB 3A84A 1AVGH 1BRCE 3K6YA 3KQDA 2W26A 4X8VH 2G00A 5LGOA 1EASA 7KMEH 3RUOA 1O3AA 4AYVB 1GMDF 2BYAX 4OGYA 1A4WH 2A5AA 1BTHH 1KDQA 2STAE 4AGJA 1NFUA 2G81E 1C5PA 4JK5A 3AW1A 1S0RA 1WTGH 1K1IA 3MNXA 4WWYA 2ZTZA 3SU6A 1Z1IA 1A1RA 2P95A 2Z9JA 7ESTE 1E0FD 3TK9A 2W7SA 3VB7A 1BMAA 2SGPE 3RC5A 4BAMB 4INLA 3O8RA 1A5HA 2ZU2A 3URDA 2ZCLP 4Y79A 1HJAB 5FX5A 4XFQA 4ZMAH 2BZAA 3GCNA 1HXFH 1BBRH 2G5NA 2ZZUH 3GCTG 3RXPA 2BDYA 5HMAA 1OP0A 4Z6AH 2V3OH 3SU3A 4D9QA 1NRQH 1QL9A 2GDEH 5C2ZA 3L6PA 2QN5T 4U30A 3SQHE 1QIXB 1XKAC 3E1XB 2CGAA 1QFKH 6ESTA 1A0LA 4MNVA 4ISHH 1ZTKA 2Z9KA 1O3BA 1UK4A 2M5TA 3RXJA 3GCHB 3GICB 1C2EA 3Q00A 2AIQA 1P9SA 2CN0H 3RDZA 3M37A 4ABHA 1YPHE 1LO6A 3BTEE 1O38A 4CHAB 1AQ7A 3BIVH 2D2DA 3I29A 1J17T 3ATKA 2QY0B 1ELAA 2ZFTA 1PPEE 2RCEA 1UK3A 1G3EA 4AFUA 2G55A 4ZROA 3F1SB 4ABJA 5E0JA 2ANKH 2FOCA 1GGDB 3F68H 4IBLH 3A85A 1VJ9U 1QQUA 4CBOA 1G32B 5JBBS 1EAWA 7GCHF 4J2YB 1MMJN 1DLEA 1K1LA 3RXUA 1XXDA 2ODYB 1S84A 4ZXXH 2ZWLH 1K9OE 1ELGA 3U98H 3RXRA 3PLKA 1MD8A 3BG8A 2RA0A 1P12E 1CE5A 3MYWA 1RRKA 3QN7A 1EZXC 4FVBA 2BD5A 2F91A 2BY6X 2H2ZA 2G8TA 2FM2A 4KELA 1DVAH 4XSKU 3VGCB 4CRCA 4B74A 2BM2A 4TPIZ 4I7YH 1DWBH 1VITG 4FXGH 1BCUH 1G3BA 1MU6B 1HCGA 4UONA 4ISIH 1E38B 5F8XA 3ZVAA 2A7HA 1FY8E 2VIVA 7LPRA 3SU0A 2VH0A 1EP6A 1P10A 1EAXA 1GWAA 3RXVA 3OY5U 5L2ZH 1LVMA 1BRBE 5HM9A 1V2TT 3PYHA 4ISLA 2O8UA 1ETTH 3SI3H 3SJIA 1SFQB 3RC4A 2P3TB 4DW2U 5TCAA 1NFYA 4GCHG 1HAYB 4WH8A 5E0HA 4BXSA 1OP8A 3QZRA 1F5LA 4ZXYH 3P8FA 1GBJA 2ZKSA 1C1TA 1TOMH 1ZPCA 3MO3A 1O33A 8GCHG 1ZZZA 1O37A 4NIYA 2RDLA 1PPZA 1O2YA 3SUDA 2OLGA 3RU4T 2OXSA 1QL8A 1V2JT 2H5DA 3ZZ3A 2PWXA 1GHZA 3MI4A 3D23A 1AUJA 1NROH 2ALVA 1BB0B 1L4DA 5GCHG 1AVWA 1ESAA 1F5RA 2VWMA 3HKIB 3ZYEA 2XNIA 3T2NA 5A09A 4ZHAA 1SOZA 3M5LA 3LC3A 2I6QA 2ZA5A 2A4GA 3MH4A 1A7SA 3S69A 1GBEA 3TNSA 5AVDA 1UMAH 1XXFA 3GY3A 3ODFA 4ZUHA 1BOQA 1ZYOA 5DG6A 1IQEA 2CJIA 1LQDB 4X6OA 1C1MA 4D9RA 2HALA 2EA3A 3UQVA 3TK5A 3QGNB 5AF9H 1BHXF 1FPCH 2BVSH 2NU2E 1SPJA 5JPMH 4R8TB 2PUQH 3SV6A 3ENSB 1FN6A 1C5UA 3E16B 2BB4A 1D6RA 3ZVEA 1DSTA 1T31A 2QXIA 1TNGA 3VB5A 2ASUB 5BPEA 1HYLA 4GHTA 3ZYDA 4ZKRU 3A86A 3F9HA 3BEIB 3LT3A 3RXOA 2B8OH 5A0CA 2FYRA 2XCFA 1HV7A 4ABFA 1AI8H 4KTUA 1NT1A 4B76A 4A1XA 1HAVA 3BG4C 3IWMA 3RMOH 4U32A 1EPTC 3HKJB 5EXLA 1AKSB 2VJ1A 2ZG0H 1G30B 4BTTB 5CHAB 2CV3A 2FXRA 3RXFA 3SJKA 1GCTC 3A7TA 5T6GA 1GMHF 2XWAA 1EAIA 1OYTH 1Z8RA 1ZSJA 4H6TA 1RIWB 1O3KA 3KCGH 3V0XA 1AFEH 1QGFA 1AZ8A 1PQAA 3PWCA 4ZH8A 1SBWA 1P06A 2PUXB 3LONA 3SOSA 1KXAA 1B0EA 2ANWA 2DUCA 1O3MA 1DSUA 1XX9A 4WXIA 3TJOA 1CQQA 5EW1H 1UTNA 3H7OA 2A0QB 1SGFA 2OBOA 3I77A 3A8DA 2Z9GA 4O3TA 1GDNA 1O0DH 1C5LH 2SGFE 4X1QU 3PTNA 3KN2A 1P3CA 4D7GA 1UTMA 2CF9H 2P16A 1LHDH 1TYNA 2XBYA 1O3OA 4LOYH 1ELFA 1DWEH 3ZV8A 1O3EA 5A0BA 4BXWA 1F0RA 2FLBH 4VGCC 2BDHA 1MH0A 3B9FH 4Y8ZA 1XUFA 1MZAA 3SHAH 1OSSA 2TGAA 1K1NA 4I8JA 3DD2H 1HJ8A 4GPGA 3ZVFA 1FAKH 5BRRE 3A80A 4ABBA 4FUGA 2F83A 5GIBA 1W0ZU 3RXHA 2BD2A 3MNSA 1NU7B 1C1PA 2PHBA 4DG4A 1SGIB 4ZHLU 4XE4A 1C5XB 4XOJA 1ELEE 1OWDA 2BD7A 1YLDA 1NFWA 4K60A 2BD8A 1ELBA 3SBKA 2BVXH 3NKKA 1K1OA 2QC2A 2QXJA 2GZ9A 5EODA 4CRDA 1WV7H 2FS9A 5JBTA 1GI4A 3SNDA 3UREA 1GI6A 3VXEH 3QTOH 2Y82A 1Z8JB 4Z0KA 5LPEA 1O3CA 2H9HA 2W7UA 2VIQA 1TPSA 3GOVB 1LKAA 1BHXB 3W94A 5EQRA 3M7QA 4YOGA 4ABDA 1OWKA 3M61U 1Q3XA 3A7XA 3A8BA 3MU5A 3BSQA 1AUTC 3RXDA 5GXPA 4K3JA 1OWJA 4IW4E 4WH6A 2C8ZB 2GX4A 3ZZ8A 1JMOH 1IQFA 4F4OC 1AE5A 4RN6A 1NPMA 2VIOA 5EG4A 1LQEA 1WQVH 2STBE 4WF8A 1VJAU 1GHBG 1T7CA 4LXBH 3VEQB 1FUJA 1SVPA 1A0HB 4YOIA 1O30A 3TGJE 3LJOA 3N7OA 1ZPZA 1F0SA 2LNCA 2HVXA 3PWBA 4A92A 2AMQA 2Y80A 4AOQA 3PROA 1MCTA 1UCYE 5B6OA 3TK6A 4AYYB 1TRYA 4ABIA 5C1UA 3PMBB 4A5TS 1DWCH 1VCPA 1HAVB 4GLYA 1DANH 2I6SA 2O8LA 1WBGB 3LGIA 3UWJH 4JYVH 1TBRH 4NA7A 1QBNA 2ZC9H 2FMJA 3PM3A 1XVOA 1Y5AT 2NU4E 3VB4A 1MQ5A 4CR5A 1TONA 1GBMA 2UWLA 5JBAS 5IYTA 5GWZA 4DIHH 3GY5A 3FANA 4CRBA 5C5NA 3NCLA 2G51A 1MTVA 1DY9A 3RXKA 3SV9A 1QRZA 1UTJA 4Y6DA 2H9EH 1FPHH 2BVRH 5GPIB 3TPIZ 3QTVH 3M7TA 2ZQ2A 4MQAA 2BDCA 2ZI2H 3B23B 2FI3E 4I32A 1KSNA 3HK6B 1BMMH 3BTWE 3V13A 1YKTA 2BDIA 1AU8A 2PGQB 4YTAA 1HRTH 2QV1A 3GYMA 4LZ1H 5F03A 1P2KA 2OINA 1GJ9B 3AW0A 3K2UA 4ZHMU 1MZDA 2J92A 4X6NA 1HLTH 2ZDKA 1UCYH 4Y0YE 2WYJA 2A7CA 1OPHB 3SNBA 4K1SA 2WINI 1J15A 1UVOA 1C5MD 1FNIA 1ZHRA 3LH1A 4TWYA 3U8TH 4Q7XA 2ZNKH 4Q7ZA 5DO4H 1O3HA 1LPKB 2ALPA 3KNXA 2BTCE 1O2OA 2QGRA 1ANDA 2HRVA 4CRFA 5FX6A 4RSPA 4D7FA 2ZDAH 2A45B 1V2VT 1WU1A 4OS2A 3F9FA 5FCKA 1ZMNA 2AIPA 1Q31A 4RKJB 1XUJA 1A3EH 4I8GA 1ZGIA 3NWUA 4Q80A 1FZZA 1P2NA 2HWLB 2PSXA 1MTSA 1Z8IB 3TJNA 2JKHA 3Q76A 2EC9H 1SC8U 1W0YH 1JRTA 2ZDLA 4AZ2B 3LH3A 1GMCF 4OS1A 1QB1A 3BEFB 2HOBA 3GDUA 8ESTE 1NRRH 2BD9A 3T25A 3VB6A 3LIWA 3SJ8A 3F9EA 5HGGA 2DE8A 5JYIA 2V0BA 1G9IE 2H6MA 5E0GA 1DX5M 1EJAA 2FX4A 1O5FH 3E3TA 4WY3A 4K8YA 5C3NA 1SGPE 2VH6A 3K6ZA 4CH8B 1SLWB 1TGSZ 4BTIB 5C1YA 3HGPA 1O36A 4SGAE 1NN6A 3BG4B 1HGTH 3NXPA 4AB9A 1EPTB 3UR6A 1GMDG 1DM4B 3TH2H 1F92A 3UNSA 2GV6A 1Y5UT 1FN8A 5DKMA 1WSSH 4WXVA 2R3UA 4AORA 1LDTT 3O8BA 4DVAU 1GCTB 1ARCA 1GI5A 4GVUA 1WOFA 2P3FH 3AAVA 2PTCE 1TGBA 5C67A 2TIOA 2BXTH 1C5YB 1FDPA 2FEQH 4AB8A 3L3TA 1IOEA 1HPGA 1ZSLA 3ZVGA 3CENA 1KLJH 1DXWA 1O2PA 3SO3A 1UHBB 4BNRA 5T3HA 2VVUA 2F9PA 1ZGVA 3T27A 1DY8A 2PV9B 2B0FA 4X2XA 3RC6A 1UTLM 3KHVA 1YCPK 1ZJDA 4X1SU 5LPRA 1RXPA 3SQEE 1BDAA 2PKAA 3UOPA 1C5WB 1Z8GA 3LOXA 1ELTA 1ELVA 2FOHA 2Y7XA 1SGCA 1F7ZA 2AH4X 1TFXA 1O3PB 4NSVA 3ZVCA 1NRPH 1RTFB 1UTKA 1DFPA 2H9TH 3ELAH 4Y8YA 1FY4A 3PMAB 4WJG2 3TVJB 1BA8B 2D1JA 4VGCB 1QJ7B 1P2OA 1PFXC 3MU8A 2GZ8A 3LPRA 3VFEA 1KTTB 1YPGH 3MH7A 1C1OA 2R3YA 1O3GA 1TAWA 2BDAA 1P05A 2FOFA 3A88A 1DICA 1B7XB 1C5VA 2QIQA 1C1RA 1V2RT 3SNCA 1NM6A 3VXFH 3P92A 2AERH 4MDSA 1GHYH 1P2QA 3FZZA 2WPHS 3A7VA 1H4WA 3BTHE 2TGPZ 2A5KA 1GG6C 2SNWA 1AIXH 1QQ4A 1ZOMA 4E7RG 4E7NA 1TB6H 1ID5H 1SI5H 3QDZB 1SOTA 3KQCA 4NG9H 4UFEH 1G3DA 2HNTC 3HPTB 4TY7A 4CR9A 1AY6H 3P6ZB 3PMJA 2FDAA 3UR9A 3HK3B 4UD9H 1MAYA 3FZDA 4IN2A 5L6NH 2P8OC 1DITH 3U9AH 2Q6DA 3EAJA 2Z94A 3GCOA 3SHCH 3GISB 1PYTC 1Y3WA 2PGBB 2FTMA 1TNIA 4HZHA 4JYTA 2XCNA 3SV7A 3R3GB 3HATH 2Y5HA 4O03A 1ZRBA 4NFEA 4XDEA 1BRUP 1D3PB 1ZSKA 3ATMA 2AMDA 2VVVA 3LU9B 1GHVH 4B2BA 5IDKA 4XBBA 2YNAA 3PO1C 1C5ZB 2JH6D 1CVWH 4JZ1A 1VCWA 1MTWA 3H7TA 3A8CA 5A8XA 5C1XA 3RM0H 5G4BA 2D26C 3R0FA 1WUNH 3Q3KA 2ZTXA 2FOMB 1GBTA 3QUMP 1RTKA 1J8AA 3BTDE 3BIUH 4ABGA 3HGNA 5L2YH 4GCHF 4NA9H 1O34A 2ZGJA 1N1LA 1P2MA 5A0AE 1O2KA 5HYOA 1C2HA 4H4FA 3P70B 2AMPA 4INKA 1JBUH 2DE9A 1QHRB 2Q6GA 8GCHF 2OC0A 1C5RA 1S5SA 1RS0A 4QT8C 1O2HA 2O9QA 1TNHA 2ZGBH 1FV9A 1NY22 3LJJA 4UDWH 4UFFH 1K1JA 3A82A 3ZZ7A 2P3UB 4Y76A 1C4U2 1JIMA 2C8WB 3ATLA 3TJVA 2CHAC 2ZGCA 3A7WA 1K22H 1KDQB 4O97A 1A61H 2P94A 1C1WH 2BD3A 3SU5A 1GVKB 2O8WA 2Z9LA 4MNXA 3STJA 1GDQA 2BY9X 5E2PA 1QTFA 3JZ2B 4BAHB 2G4TA 1HXEH 1BIOA 3E0PB 2TPIZ 1OKXA 5PTPA 1P3EA 1WQSA 2WV4A 4YT7H 1PQ8A 2ZHQH 2G5VA 5DK1A 1HB0B 3DA9B 2QCYA 4X2VA 2C8XB 2BY5X 1L4ZA 1YCPM 1W11U 1QBVH 1O2RA 4K1EA 2A5IA 1GBKA 1TGNA 3MMGA 1CSOE 5DPAA 1O2UA 3A8AA 4CREA 4U2WA 2WPIS 3T62A 2PKAB 1F5KU 1GJ6A 4X6MA 3RXQA 1AB9C 2FI5E 3UFAA 2IOTA 5JBCS 4NIVA 1V2LT 4X1NU 3M36A 1S83A 2J94A 1DPOA 4TY6A 2XYAA 3NK8A 1K1MA 3Q3YA 2WUBA 4HGCA 1GJCB 2BZ6H 3MO9A 1TRNA 1O2IA 3BN9A 3FP6E 2FOGA 1QL7A 2HNTF 3EA7A 1BJUA 4BTUB 3SNAA 4BAOB 3RMMH 1V2NT 1FY3A 1H9IE 2JETC 3M5NA 1SGRE 3BTTE 3LKWA 3ZVDA 2PSYA 4RKOB 1QR3E 1SLXB 1C5TA 1NESE 3P8GA 3BEUA 1C2GA 1DS2E 1SGQE 1LHGH 4I8LA 1A0JA 4ZKNU 1P02A 2GMTC 3SU1A 1P03A 1AN1E 1DOJA 4GAWA 1T8LA 3ZV9A 1O2VA 3MU0A 1MKXK 2VINA 2WV5A 2ZO3H 5K7RA 3QK1A 1W7XH 4OS6A 5EXNA 1SHHB 5HXFA 6LPRA 2VIWA 3SV8A 1GJ5H 1UTOA 3EE0B 1IQHA 2BY7X 3FAOA 3TGIE 3C1KA 4FU8A 1Y8TA 2VIDA 3SUGA 2BOKA 3PLPA 1CGHA 2EEKA 1Q2WA 1E35B 1SB1H 1SMFE 3GY4A 3MTYA 1UVSH 1G36A 4DIIH 3S7HB 3JZ1B 4K2YA 4TPYA 3RXMA 2ZU4A 1FLEE 1W8BH 3M5MA 1A46H 1UVPA 1YPHC 2UWPA 3G01A 2BLVA 1S6FA 3SNEA 4UE7H 3L33A 1EQ9A 2IPHA 1EJMA 1GBFA 1KXCA 1YPLH 4ISOA 1ABJH 1L1JA 3U1JB 2F9UA 1GDUA 2C8YB 1TPOA 1CGJE 4THNH 5LPFA 1HAZB 1QA0A 5J4SA 1EUFA 1C1QA 1O5EH 1C1NA 4Y7BA 3SJOA 3V7TA 3SGAE 4B75A 1ZLRA 2R2WU 1D6WA 1GPZA 2FOBA 3SUFA 1JIRA 3UWIA 2B9LA 2TGTA 2HPQH 5SGAE 2A31A 1C5OH 3UOUA 1JWTA 1BZXE 3SJ9A 4ESTE 1IQIA 1VITH 1V2KT 1CU1A 1YYY1 5DP4A 5TJXA 4YZUA 5DGJA 3OTJE 3T5FH 2R0LA 3RP2A 3EA8A 5K0HA 1V3XA 1MD7A 1H1BA 1AMHA 1B0FA 4NIWA 3W95A 2GCHG 1J14A 1THPB 3MU1A 3SW2B 3RXTA 1P2IA 1TMUH 1AGJA 1AWFH 2VB0A 4YLUA 1GBIA 5T6FA 4MPUA 2AS9A 3TH4H 3RLYH 1KTSB 3SZNA 2O8TA 3D49H 2NU1E 3AAUA 1O3NA 3SU4A 2GKVE 1W10U 3IITA 4K1TA 3S7KB 5EU8A 2B5TB 2AGGX 4CRAA 2GP9B 2FS8A 1GI9B 2J2UA 1BRAA 4AFQA 1GG6B 3EYDA 4A7IB 3LC5A 2O8MA 3SI4H 1BT7A 1KLTA 3RU4E 1YF4A 5F8ZA 9ESTA 1PJPA 1TLDA 5F8TA 3E90B 2RG3A 1GJAB 4TYDA 1LKBA 2ZFRH 1AD8H 1GHBF 1TALA 2G52A 3QZQA 3P95A 2FZZA 1SHYA 1K28D 1NZQH 4H42U 2OQ5A 3A89A 2R0KA 3SGQE 1E36B 1PPHE 2P8OB 4X1RU 3RU4D 1CBWC 1V2ST 5ETXA 1L2EA 4NZQA 1QJ1B 1C2KA 2FOAA 1EJNA 1AE8H 5FPYA 1Z6JH 2PW8H 2PFEA 1W2KH 4FUJA 5FBIA 1LTOA 1ANBA 1THRH 4CBNA 1LHFH 1T8OA 2UUJB 1O5DH 1SGNE 1T4VH 3DFLA 1GHWH 3RXSA 3KL6A 3Q3XA 1MAXA 1TA2A 1ZTLA 1T4UH 1PYTD 2OC1A 1CA0C 3PO1B 1DE7H 4I8KA 1YM0A 1TE0A 1PQ7A 5EQSA 1TBQH 5EXMA 4NWKA 5DJ7A 1C4Y2 3SU2A 1JOUB 2ZQ1A 1D9IA 1Y3UA 2EI7A 2GDDA 1TPAE 3CS0A 1F0TA 2IJOB 1MTUA 4IMQA 3UQOA 2BX4A 4DOQA 4FUHA 4NA8A 2BY8X 3MNCA 1Y3VA 4KKDA 3KF2A 5J4QA 4JYUH 4FVDA 2GZ7A 3KIDU 3RMNH 3S9BA 1GHAF 1O5BB 2THFB 4B71A 1BBRK 1FY5A 4YOJA 2Y7ZA 1BTYA 2ZDNA 3RXLA 1TX8A 1OP2A 4YLQH 4WMDA 2F9VA 1TNLA 3WY8A 5TCCA 1S81A 1TQ0B 4XBCA 1XUIA 1YPKH 3KQBA 1CHOG 1NRNH 1O39A 2F9NA 2CHAB 3ITIA 1C2FA 1XUGA 4ZKSU 6GCHF 1P8VC 2ZEBA 3RXBA 2QA9E 1ORFA 4AGKA 1DUEA 2TRMA 2J4IA 2KAIA 1GJ7B 1ETSH 5H4IB 1GMCG 1OWEA 1V6DA 4YO9A 2XC0A 1JRSA 1CT2E 3BTKE 3A81A 4NWLA 3GY6A 1YLCA 2SGEE 3EGKH 5FHTA 4IC6A 4JZDH 2C90B 3RXAA 2VU8E 4X8UH 1LVYA 2Z3EA 1TPPA 3OU0A 5EPNA 3ODDA 2OBQA 2ZF0H 2NU0E 3V3MA 1O2ZA 1CO7E 2Y6TA 2BQWB 2SGAA 1ZHPA 1OX1A 1DUAA 1GI0A 4I8HA 3RXGA 3PLBA 4UEHH 2HPPH 1C2LA 2GV7A 1AFQC 4FU7A 1HNEE 2XBWA 1HAXB 1AB9B 1L1NA 2ZU1A 3ZZ4A 1C9PA 2Y81A 3TU7H 1PPCE 1X7AC 1S0QA 1C5NH 2W3IA 1HAGE 4Y71A 1E37B 1QBOA 1V2PT 1WAYB 2VGCC 5CE1A 2JH5D 4FUEA 1W12U 5DP5A 3KEEA 2J34A 1MUEB 1ZMJA 2OD3B 2OUAA 2QYIA 1IHTH 1INCA 2ILNA 3T28A 2JETB 1QJ6B 2ZDMA 1C1UH 1O2GH 1VCQA 4MPWA 4B73A 1UVUH 4NSYA 1DXPA 4LK4A 1Y5BT 1UTQA 3TITA 2R2MB 1C5QA 2P93A 1GCDA 4K8BA 4NFFA 2GT8A 4KGAA 3MWIU 2GMTB 1O2LA 3MH6A 2FX6A 3E6PH 5GJ4B 2B7DH 2ZP0H 2FLRH 3UPEA 2ZPSA 5FBEA 4AG2A 1OOKB 2FODA 5DP6A 5F6MA 1TRMA 4B2AA 1HIAA 4A1VA 5FPSA 8LPRA 4GSOA 3ATIA 1AVXA 1IQKA 1A5IA 1XUHA 1KY9A 2AYWA 1SGTA 2ZU5A 3MNBA 4BAQB 2TGDA 4GHQA 3GCTF 4MG3A 2F3CE 4A1TA 2VNTA 3LGWA 1O2TA 1ZMLA 1IQMA 2CF8H 1C9TA 1Y3YA 1QRWA 4HI3A 2ZDVH 8KME2 1N8OC 3K9XB 1TNJA 1GI2A 3RMLH 1AKSA 4ABEA 3F6UH 3VB3A 2BQ6B 2GT7A 4YESB 3DFJA 2QXHA 1O2WA 1YGCH 4I31A 2FIRH 2EI8A 3RM2H 2A7JA 2G4UA 3MFJA 1NO9H 3DT0H 4KP0A 5FPTA 2H5CA 1TOCB 2WPJS 1HFDA 1YC0A 1GJDB 1O2SA 3MH5A 1WYKA 2F9BH 2A4RA 1V2WT 3FP8E 1F2SE 6CHAC 4J1YA 2LPRA 1QNJA 3TNTA 5CMXH 3AASA 1JXPA 2ZU3A 2Z7FE 4JZEH 1IQLA 1YBWA 2SGQE 2BHGA 2PLXA 7GCHG 2BOHB 1ESTA 2ZFPH 1C2DA 1H8IH 5A8YA 5I46H 1O2QA 4E05H 4WMEA 2ZTYA 1RGQA 4OS4A 1BTZA 1T8MA 1CT0E 1NS3A 2XTTB 3SN8A 4DJZB 4WMFA 3EA9A 2OTVA 2J95A 3SV2H 4CRGA 4GUXA 4AN7A 5E8EH 1V2UT 2QAAA 3VPKA 1TMTH 3EDXB 1W7GH 1V2OT 1PQ5A 2CMYA 1FMGA 1SQAA 4WVPE 2Z3CA 3QWCH 1MQ6A 1KXBA 1MTNC 5JDUB 1OWIA 1FIZA 2BDGA 2A2XH 4X2WA 1RD3B 3I78A 1VITF 1O31A 5ESBA 1XVMA 4H6SB 1O5CB 3ZVBA 3K65B 1GJ8B 1L1GA 1BITA 1GBDA 2GVFA 1SQTA 2ZCHP 3FVFB 3ZZDA 2PKSC 4DGJA 1YCPH 1O2MA 2ZECA 2KAIB 4AG1A 4IN1A 3GY7A 1SQOA 4X6PA 1N6XA 2BQ7B 2ZPRA 1TX7A 3E8LA 4KTSA 2OCVB 3GY2A 2Q1JA 1NU9A 1LVOA 1ABIH 1MCVA 4A6LA 4M7GA 4MTBA 2C3SA 2P59A 3P8OA 1H9HE 3U8OH 1PPGE 1P2JA 5EGMA 1Z1JA 1G2MA 1CT4E 2FP7B 1GL1A 4FUCA 3UNQA 3UIRA 2Q6FA 1FXYA 1QB9A 1O2XA 1D3DB 4MNWA 2K1QA 3S9CA 1O3JA 1HJ9A 1SR5C 1FAXA 4Y10E 1CBWB 1ELCA 4MPXA 5GCHF 1XMNB 3U1IB 1IQJA 2A2QH 2GD4B 3OYPA 3V12A 5LH8A 1UVTH 4PROA 2ZHFH 3ZZBA 3ZZ9A 2CXVA 1C2MA 4IMZA 1O3LA 3O8CA 3B8JA 1NRSH 1KIGH 3STIA 4F49A 1VGCC 3PV4A 1E34B 2H1UA 2GCTC 2ZCKP 1EX3A 1EKBB 4DCDA 1LVBA 3LGVA 1CA0B 2BDBA 2XRCA 1UJ1A 2F9OA 1K2I1 1HAOH 1TX6A 4FUDA 4FU9A 1SFIA 1SL3A 3URCA 4MNYA 3C27B 2UUKB 2BX3A 1BTWA 2GGVB 1L0ZA 2AGEX 1HIAB 2FO9A 3A7ZA 4R0IA 4SGBE 5FCRA 1AO5A 3KQEA 1KXDA 3DUXH 1QA7A 3A7YA 3ATWA 4YT6H 4Y0ZE 4OS5A 2ZFFH 4OGXA 3QLPH 2V6NA 3BTME 5A8ZA 5FXLA 3MHWU 4U01A 3ZZ6A 1D4PB 1GMHG 1O3IA 3PMHB 1TBZH 4O9VA 4BANB 2A4QA 1LMWB 1BUIA 1PPFE 4JZIA 4Q7YA 5T6DA 1YPJH 3U8RH 4FUFA 1O2NA 2ZFSA 1HBTH 1T8NA 1ZR0A 2SGDE 4DURA 2OC7A 1P11E 3FP7E 1WTHD 3M3SA 3IG6B 1EB2A 1S82A 1ZJKA 4Y8XA 1OXGA 4BAKB 1G3CA 4UFDH 1UO6A 4JMYA 1ANEA 2A4OA 2WPLS 3QX5H 2TBSA 1D3TB 1CGIE 4MVNA 1P0SH 3TH3H 4ZKOU 3TJUA 5DP7A 1FIWA 1V2QT 1W14U 1HJAC 1Y3XA 2YNBA 1GBLA 1V2MT 4AX9H 3BV9B 1FONA 3DHKH 3NZIA 3FFGA 4MPVA 5ABWA 2AEIH 9LPRA 1SGFG 5AFZH 2ODQA 2ANMH 3E0NB 1FI8A 1S85A 1IAUA 2W3KA 3TLOA 4NGAH 1C2IA 1KXFA 1EB1H 1AFQB 3CP7A 4OS7A 1P01A 3OY6U 1O3FA 2C4FH 1G37A 2Y5FA 1GJBB 1M9UA 2J38A 1NFXA 1FJSA 1S6HA 2UUYA 2OQUA 1ZHMA 1FY1A 1NC6A 3GCHC 1GBBA 2FTLE 4ZAEA 4D76A 1HDTH 1P09A 4INHA 2VGCB 1EAUA 1IHSH 1O2JA 1YPEH 1C5SA 2AFQB 4CHAC 1DLKB 1WCZA 5EQQA
chains in the Genus database with same CATH superfamily
5EW2H 5JB8S 4X8SH 3GDSA 1HUTH 1MKWK 1AWHB 1GVLA 2FOEA 1HAHH 4K5ZA 4JK6A 1GBHA 2IJD1 3MU4A 2ZIQH 1AZZA 1AHTH 1GI7B 1KXEA 2VVCA 3MOCA 4HTCH 4Y11E 1TWXB 2HLCA 1BTPA 2C93B 2V35A 2A32A 3GY8A 1UK2A 1GI1A 1GGDC 3RXIA 3RXEA 2A1DB 1QCPA 1A5GH 1E79D 3A83A 1THSH 1MBMA 2QF0A 1SLVB 3M5OA 2BLWA 1RJXB 1P57B 1GHXH 2FWWA 2GTBA 1O5GH 1UTPA 2FPZA 1ANCA 2BMGB 4LZ4B 5KEDA 4AFZA 4UFGH 2VWNA 1G2LA 2NWNA 2ZHWH 3M35A 4IS5A 3BTGE 3OX7U 2QF3A 1TGCA 1UCYK 1LCYA 2BXUH 3VGCC 2SNVA 3F2GA 3TGKE 4AFSA 2ODPA 4K69A 1ELDE 5HIYA 1EZUC 1ARBA 4TWWA 1S6LA 5AFYH 3UUZA 3T26A 5EJ1A 1EPTA 1N8OB 5C0UA 2QF4A 3BTQE 1YPMH 1P9UA 1EP5A 4B6EA 1SSXA 3A87A 1LHCH 1GL0E 1D3QB 1TABE 2ZHEH 3U69H 1GI3A 1NTPA 2GCHF 1MU8B 1MKXH 3RXCA 1Z7KA 3O8DA 1LPGB 3ZZCA 1EZSC 4DT7B 6CHAB 3T29A 2W5EA 2OP9A 2PTNA 3QO6A 1J16A 1HAIH 2D8WA 2WYGA 2KZ4A 4JZFH 1UHBA 4B2CA 1W3CA 5EPYA 4ISNA 2ZGHA 1J9CH 1ESBA 1OYQA 2WPKS 2XC4A 3LDXH 5DP8A 2J9NA 2CK3D 2HNTE 3E91A 3P17H 1PPBH 5L30H 2ZFQH 1B5GH 3UTUH 1XUKA 3P8NA 3SUEA 2KCOA 1XKBC 1EZQA 2ZPQA 2HLDD 2OC8A 1C1VH 2BD4A 1KYNA 5EOKA 4IGDA 1O5AB 1GBAA 2XXLA 1EATA 1BTUA 2XC5A 1BJVA 3MO6A 4DY7B 3D62A 1GVZA 4NZLA 3M3TA 1N6YA 1HAPH 1EXFA 4D8NA 3N99A 1DDJA 3OEHD 3SGBE 1MTNB 2JH0D 3LGTA 1H8DH 3UY9A 1H9LB 2IN2A 1MKWH 3CS7A 3PTBA 2Z9IA 5I25A 1Y59T 1O35A 3PB1E 1MBQA 2XWBI 4Q2KA 2XBVA 1K21H 2PR3A 1SGEE 3D65E 4X8TH 1BMLA 3QGJA 1VR1H 3ZZ5A 1RFNA 2WPMS 4O3UA 1ETRH 5DP9A 2FYQA 2VIPA 2PKSB 3LGUA 1A2CH 4KTCA 2RA3A 5E2OA 3GDVA 1ZPBA 3GYLB 1FQ3A 3KGPA 1W0JD 4JCNA 4X2YA 1P04A 1Z6EA 1Z71A 1CA8B 2AGIX 3NUMA 4E06H 3M3VA 1BMNH 2WUCA 1SG8B 4MLFB 2ZGXH 1TGTA 3S0NA 2EI6A 1KLIH 1O3DA 3SORA 4Y7AA 2ESTE 1W13U 1GHAG 2QXGA 2V3HH 5FAHA 1GBCA 1ACBE 1SGYE 2R9PA 2VWOA 5ESTE 1EOLA 3OSYA 2K8IA 2ULLA 3NRLA 4IC5A 5C5OA 1SLUB 5JB9S 5CHAC 2FI4E 3H5CB 1IQNA 1IQGA 1OS8A 1QB6A 4I33A 3S9AA 1TA6A 4M9FA 2NU3E 4NCYA 1RIWC 1K1PA 2YOLA 3AVZA 5A2MH 1OWHA 4FUIA 1CHGA 6GCHG 1QY6A 3EQ0H 2Z3DA 4B1TA 3FN8A 1RTLA 1O32A 2UUFB 2HGTH 4ASHA 4HFPB 4CH2B 1ZRKA 3LGYA 1SGDE 2W6ID 4XBDA 5AHGH 1CHOF 4NIXA 5GDSH 1VGCB 1C4V2 2ANYA 2BLQA 3BTFE 2GCTB 5IK2D 1QRXA 4X1PU 4YM9A 1XM1A 3M7UA 2Z6BD 1TNKA 1DT2A 4X0WU 3Q77A 3TIUA 1U6QA 1EOJA 5DP3A 3ESTA 1C2JA 1DWDH 5HM2A 4ABAA 1C1SA 1GI8B 3BF6H 3UNRA 2Y5GA 3ZZAA 1TQ7B 1ZTJA 2SFAA 2VWLA 3NPSA 2FESH 1VZQH 5GNDA 2XBXA 1T32A 1F0UA 1GJ4H 1TMBH 1BBRE 2XW9A 2BLOA 1LHEH 1QURH 3F9GA 4FUBA 1A3BH 5C20A 1TIOA 3RLWH 1BTXA 1YP9A 2UWOA 2ZHDA 4BOHA 1BQYA 1LPZB 3A84A 1AVGH 1BRCE 3K6YA 3KQDA 2W26A 4X8VH 2G00A 5LGOA 1EASA 7KMEH 3RUOA 1O3AA 4AYVB 1GMDF 3UAIC 2BYAX 4OGYA 1A4WH 2A5AA 1BTHH 1KDQA 2STAE 4AGJA 1NFUA 2G81E 1C5PA 4JK5A 3AW1A 1S0RA 1WTGH 1K1IA 3MNXA 4WWYA 2ZTZA 2J98B 3SU6A 5DN6D 1Z1IA 3F0PA 1A1RA 2P95A 2Z9JA 7ESTE 1E0FD 3TK9A 2W7SA 3VB7A 1BMAA 2SGPE 1FX0B 3RC5A 4BAMB 4INLA 3O8RA 1A5HA 2ZU2A 3URDA 2ZCLP 4Y79A 2VBCA 1HJAB 5FX5A 4XFQA 4ZMAH 2BZAA 3GCNA 1HXFH 1BBRH 2G5NA 2ZZUH 3GCTG 3RXPA 2BDYA 5HMAA 1OP0A 4Z6AH 2V3OH 3SU3A 4D9QA 1NRQH 1QL9A 2GDEH 4FETA 5C2ZA 3L6PA 2QN5T 4U30A 3SQHE 1QIXB 1XKAC 3E1XB 2CGAA 1QFKH 6ESTA 1A0LA 4MNVA 4ISHH 1ZTKA 2Z9KA 1O3BA 1UK4A 2M5TA 3RXJA 3GCHB 3GICB 1C2EA 3Q00A 2AIQA 1P9SA 2CN0H 3RDZA 3M37A 4ABHA 1YPHE 3DSPA 1LO6A 3BTEE 1O38A 4CHAB 1AQ7A 3BIVH 2D2DA 3I29A 1J17T 3ATKA 1WDIA 2QY0B 1ELAA 3SYJA 2ZFTA 1PPEE 2RCEA 1UK3A 1G3EA 4AFUA 1NBME 2G55A 4ZROA 3F1SB 4ABJA 5E0JA 2ANKH 2FOCA 1GGDB 3F68H 4IBLH 3A85A 1VJ9U 1QQUA 4CBOA 1G32B 5JBBS 1EAWA 7GCHF 4J2YB 1MMJN 1DLEA 1K1LA 4F48B 3RXUA 1XXDA 2ODYB 1S84A 4ZXXH 2ZWLH 1K9OE 1ELGA 3U98H 3RXRA 3PLKA 1MD8A 3BG8A 2RA0A 1P12E 1CE5A 3MYWA 1RRKA 3QN7A 1EZXC 4FVBA 2BD5A 2F91A 3SZEA 2BY6X 2H2ZA 2G8TA 2FM2A 4KELA 1DVAH 4XSKU 3VGCB 4CRCA 4B74A 2BM2A 4TPIZ 4I7YH 1DWBH 1VITG 4FXGH 1BCUH 1G3BA 1MU6B 1HCGA 4UONA 4ISIH 1E38B 5F8XA 4Q63A 3ZVAA 2A7HA 1FY8E 2VIVA 7LPRA 3SU0A 2VH0A 1EP6A 1P10A 1EAXA 1GWAA 3RXVA 3OY5U 5L2ZH 1LVMA 2AHME 1BRBE 5HM9A 1V2TT 3PYHA 4ISLA 2O8UA 1ETTH 3SI3H 3SJIA 1SFQB 3RC4A 2P3TB 4DW2U 5TCAA 1NFYA 4GCHG 1HAYB 4WH8A 5E0HA 4BXSA 1OP8A 3QZRA 1F5LA 4ZXYH 3P8FA 1GBJA 2ZKSA 1C1TA 1TOMH 1ZPCA 3MO3A 1O33A 8GCHG 1ZZZA 1O37A 4NIYA 2RDLA 1PPZA 1O2YA 3SUDA 2OLGA 3RU4T 2OXSA 1QL8A 1V2JT 2H5DA 3ZZ3A 2PWXA 1GHZA 3MI4A 3D23A 1AUJA 1NROH 2ALVA 1BB0B 1L4DA 5GCHG 1AVWA 1ESAA 1F5RA 2VWMA 3HKIB 3ZYEA 2XNIA 3T2NA 5A09A 4ZHAA 1SOZA 3M5LA 3LC3A 2I6QA 2ZA5A 2A4GA 3MH4A 1A7SA 3S69A 1GBEA 3TNSA 5AVDA 1UMAH 1XXFA 3GY3A 3ODFA 4ZUHA 1BOQA 1ZYOA 5DG6A 1IQEA 2CJIA 1LQDB 4X6OA 1C1MA 4D9RA 2HALA 2EA3A 3UQVA 3TK5A 3QGNB 5KECA 5AF9H 1BHXF 1FPCH 2BVSH 2NU2E 1SPJA 5JPMH 4R8TB 1BMFD 2PUQH 3SV6A 3ENSB 1FN6A 1C5UA 3E16B 2BB4A 1D6RA 3ZVEA 1DSTA 1T31A 2OK5A 2QXIA 1TNGA 3VB5A 2ASUB 5BPEA 1HYLA 4GHTA 4XD7D 3ZYDA 4ZKRU 3A86A 3F9HA 3BEIB 3LT3A 3RXOA 2B8OH 5A0CA 2FYRA 3FOAA 2XCFA 1HV7A 4ABFA 1AI8H 4KTUA 1NT1A 4B76A 4A1XA 1HAVA 3BG4C 3IWMA 3RMOH 4U32A 1EPTC 3HKJB 2YMSC 5EXLA 1AKSB 2VJ1A 2ZG0H 1G30B 4BTTB 5CHAB 2CV3A 2FXRA 3RXFA 3SJKA 1GCTC 3A7TA 5T6GA 1GMHF 2XWAA 1EAIA 1OYTH 1Z8RA 1ZSJA 4H6TA 1RIWB 1O3KA 3KCGH 3V0XA 1AFEH 1QGFA 1AZ8A 1PQAA 3PWCA 4ZH8A 1SBWA 1P06A 2PUXB 3LONA 3SOSA 1KXAA 4RI0A 1B0EA 2ANWA 2DUCA 1O3MA 1DSUA 1XX9A 4WXIA 3WW7A 3TJOA 1CQQA 5EW1H 1UTNA 3H7OA 2A0QB 1SGFA 2OBOA 3I77A 3A8DA 2Z9GA 4O3TA 1GDNA 1O0DH 1C5LH 2SGFE 4X1QU 3PTNA 3KN2A 1P3CA 4D7GA 1UTMA 2CF9H 2P16A 1LHDH 1TYNA 2XBYA 1O3OA 4LOYH 1ELFA 1DWEH 2KCAA 3ZV8A 1O3EA 5A0BA 4BXWA 1F0RA 2FLBH 4VGCC 2BDHA 1MH0A 3B9FH 4Y8ZA 1XUFA 1MZAA 3SHAH 1OSSA 2TGAA 1K1NA 4I8JA 3DD2H 3N7DA 1HJ8A 4GPGA 3ZVFA 1FAKH 5BRRE 3A80A 4ABBA 4FUGA 2F83A 3PRDA 5GIBA 1SKYE 1W0ZU 3RXHA 4RT0A 2BD2A 3MNSA 1NU7B 1C1PA 2PHBA 3PV5A 4DG4A 1SGIB 4ZHLU 4XE4A 1C5XB 4XOJA 1ELEE 1OWDA 2BD7A 1YLDA 1NFWA 4K60A 2BD8A 1ELBA 3SBKA 2BVXH 3NKKA 1K1OA 2QC2A 2QXJA 2GZ9A 5EODA 4CRDA 1WV7H 2FS9A 5JBTA 1GI4A 3SNDA 3UREA 1GI6A 3VXEH 3QTOH 2Y82A 1Z8JB 4Z0KA 5LPEA 1O3CA 1YWUA 2H9HA 2W7UA 2VIQA 1TPSA 3GOVB 1LKAA 1BHXB 3W94A 3EE7A 1MABB 5EQRA 3M7QA 4YOGA 3PV2A 4ABDA 1OWKA 3M61U 1E1RD 1Q3XA 3A7XA 3A8BA 3MU5A 3BSQA 1AUTC 3RXDA 5GXPA 4K3JA 1OWJA 4IW4E 4WH6A 2C8ZB 2GX4A 3ZZ8A 1JMOH 1IQFA 4F4OC 1AE5A 4RN6A 1NPMA 2VIOA 5EG4A 1LQEA 1WQVH 2STBE 4WF8A 1VJAU 1GHBG 1T7CA 4LXBH 3VEQB 1FUJA 1SVPA 1A0HB 4YOIA 1O30A 3TGJE 3LJOA 3N7OA 1ZPZA 1F0SA 2LNCA 3W1EA 2HVXA 3PWBA 4A92A 2AMQA 2Y80A 4AOQA 3PROA 1MCTA 1UCYE 5B6OA 3TK6A 4AYYB 1TRYA 4ABIA 5C1UA 2KCYA 3PMBB 5C17A 4A5TS 3OTPA 1DWCH 1VCPA 1HAVB 4GLYA 1DANH 2I6SA 2O8LA 1WBGB 2IPQX 3LGIA 4JYVH 3UWJH 1TBRH 4NA7A 1QBNA 2ZC9H 2FMJA 3PM3A 1XVOA 1Y5AT 2NU4E 3VB4A 1MQ5A 4CR5A 1TONA 1GBMA 2UWLA 5JBAS 5IYTA 5GWZA 4DIHH 3GY5A 3FANA 4CRBA 5C5NA 1EFRD 3NCLA 2G51A 1MTVA 1DY9A 3RXKA 3SV9A 1QRZA 1UTJA 4Y6DA 2H9EH 1FPHH 2BVRH 5GPIB 3TPIZ 3QTVH 3M7TA 2ZQ2A 4MQAA 2BDCA 2ZI2H 3B23B 2FI3E 4I32A 1KSNA 3HK6B 1W0KD 1BMMH 3BTWE 3V13A 1YKTA 2BDIA 1AU8A 2PGQB 2RDEA 4YTAA 1HRTH 2QV1A 3GYMA 4LZ1H 5F03A 1P2KA 2OINA 1GJ9B 3AW0A 3K2UA 4ZHMU 1MZDA 2J92A 2K0QA 2WZQA 1HLTH 2ZDKA 4X6NA 1UCYH 4Y0YE 2WYJA 2WPDD 2A7CA 1OPHB 3SNBA 4K1SA 1UW7A 2WINI 1J15A 1UVOA 1C5MD 1FNIA 1ZHRA 3LH1A 4TWYA 3U8TH 4Q7XA 2ZNKH 4Q7ZA 5DO4H 3OEED 1O3HA 1LPKB 2ALPA 3KNXA 2BTCE 1O2OA 2QGRA 3DCLA 1ANDA 2HRVA 4CRFA 5FX6A 4RSPA 2JJ2D 1E1QD 4D7FA 2ZDAH 2A45B 1V2VT 1WU1A 4OS2A 3DSGA 3F9FA 5FCKA 1ZMNA 2KR7A 2AIPA 1Q31A 4RKJB 1XUJA 1A3EH 4I8GA 1ZGIA 3NWUA 4Q80A 1FZZA 1P2NA 2HWLB 2PSXA 1MTSA 1Z8IB 3TJNA 2L6OA 2JKHA 3Q76A 2EC9H 1SC8U 2V3MA 1W0YH 1JRTA 2ZDLA 4OM9A 4AZ2B 3LH3A 1GMCF 4OS1A 1QB1A 1YLNA 2WV9A 2HOBA 3BEFB 3GDUA 8ESTE 1NRRH 2BD9A 3T25A 3VB6A 3LIWA 3SJ8A 3F9EA 5HGGA 2DE8A 5CDFE 5JYIA 1OHHD 2V0BA 1G9IE 3F2HA 2H6MA 5E0GA 1DX5M 1EJAA 2FX4A 1O5FH 3E3TA 4WY3A 4K8YA 5C3NA 1SGPE 2KFWA 2VH6A 1SQRA 3K6ZA 4CH8B 1SLWB 1TGSZ 4BTIB 5C1YA 3HGPA 1O36A 3FO8D 1NN6A 4SGAE 3BG4B 1HGTH 3NXPA 4AB9A 1EPTB 2YMSB 3UR6A 1GMDG 1DM4B 3TH2H 1F92A 3UNSA 2GV6A 1Y5UT 1FN8A 5DKMA 1WSSH 4WXVA 2R3UA 4AORA 1LDTT 3O8BA 4DVAU 1GCTB 1ARCA 1GI5A 4GVUA 1WOFA 2P3FH 3AAVA 2PTCE 1TGBA 5C67A 2TIOA 4AC9A 2BXTH 1C5YB 1FDPA 2FEQH 4AB8A 3L3TA 1IOEA 1HPGA 1ZSLA 3ZVGA 3CENA 1KLJH 1DXWA 1O2PA 2YMSD 3SO3A 1UHBB 4BNRA 5T3HA 2VVUA 2F9PA 1ZGVA 3T27A 1DY8A 2PV9B 2B0FA 4X2XA 3RC6A 1UTLM 3KHVA 1YCPK 1ZJDA 4X1SU 5LPRA 1RXPA 3SQEE 1BDAA 2PKAA 3UOPA 1C5WB 1Z8GA 3LOXA 1ELTA 1ELVA 2FOHA 2Y7XA 1SGCA 1F7ZA 5C94A 2AH4X 1TFXA 1O3PB 4NSVA 3ZVCA 1NRPH 1RTFB 1UTKA 1DFPA 2H9TH 3ELAH 4Y8YA 1FY4A 3PMAB 4WJG2 3TVJB 1BA8B 2D1JA 4VGCB 1QJ7B 1P2OA 1PFXC 3MU8A 2GZ8A 3LPRA 3VFEA 1KTTB 1YPGH 3MH7A 1C1OA 1H8ED 2R3YA 1O3GA 1TAWA 2BDAA 1P05A 2FOFA 3A88A 1DICA 1B7XB 1C5VA 2QIQA 1C1RA 1V2RT 3SNCA 1NM6A 3VXFH 3P92A 2AERH 4MDSA 1GHYH 1P2QA 3FZZA 2WPHS 3A7VA 1H4WA 3BTHE 2TGPZ 2A5KA 1GG6C 2L74A 2SNWA 1AIXH 1QQ4A 1ZOMA 4E7RG 4E7NA 1TB6H 1ID5H 1SI5H 3QDZB 1SOTA 3KQCA 4NG9H 4UFEH 1G3DA 2HNTC 3HPTB 4TY7A 1COWD 4CR9A 1AY6H 3P6ZB 3PMJA 2FDAA 3UR9A 2F43B 3HK3B 4UD9H 1MAYA 3FZDA 4IN2A 5L6NH 2P8OC 1DITH 3U9AH 2J5UA 2Q6DA 3EAJA 2Z94A 3GCOA 3SHCH 1QZ8A 3GISB 1PYTC 1Y3WA 2PGBB 2FTMA 1TNIA 4HZHA 4JYTA 2XCNA 3SV7A 3R3GB 3HATH 3H09A 2Y5HA 4O03A 1ZRBA 4NFEA 4XDEA 1BRUP 1D3PB 1ZSKA 3ATMA 2AMDA 2VVVA 3LU9B 1GHVH 4B2BA 4I86A 5IDKA 4XBBA 2YNAA 3PO1C 1C5ZB 2JH6D 4TT3D 1CVWH 4JZ1A 1VCWA 1MTWA 3H7TA 3A8CA 5A8XA 5C1XA 3RM0H 5G4BA 2D26C 3R0FA 1WUNH 3Q3KA 2ZTXA 2FOMB 1GBTA 3QUMP 1RTKA 1J8AA 3BTDE 3BIUH 4ABGA 3HGNA 5L2YH 4GCHF 4NA9H 1O34A 2ZGJA 1N1LA 1P2MA 5A0AE 1O2KA 5HYOA 1C2HA 4H4FA 3P70B 2AMPA 4INKA 1JBUH 2DE9A 1QHRB 5T1VA 2Q6GA 8GCHF 2OC0A 1C5RA 1S5SA 1RS0A 4QT8C 1O2HA 2O9QA 1TNHA 2ZGBH 1FV9A 1NY22 3LJJA 4UDWH 3U28C 4UFFH 1K1JA 3A82A 3ZZ7A 2P3UB 4Y76A 1C4U2 1JIMA 2C8WB 3ATLA 3TJVA 2CHAC 2ZGCA 3A7WA 1K22H 1KDQB 4O97A 1A61H 2P94A 1C1WH 2BD3A 3SU5A 1GVKB 2O8WA 2Z9LA 4MNXA 3STJA 3PRBA 1GDQA 2BY9X 5E2PA 1QTFA 3JZ2B 4BAHB 2G4TA 1HXEH 1BIOA 3E0PB 2TPIZ 1OKXA 5PTPA 1P3EA 1WQSA 2WV4A 3F0OA 1PQ8A 2ZHQH 4YT7H 2G5VA 5DK1A 1HB0B 3DA9B 2QCYA 4X2VA 3AK5A 2C8XB 2BY5X 1L4ZA 1YCPM 1W11U 1QBVH 1O2RA 4K1EA 2A5IA 1GBKA 1TGNA 3MMGA 1CSOE 5DPAA 1O2UA 3A8AA 4CREA 4U2WA 2WPIS 3T62A 2PKAB 1F5KU 1GJ6A 4X6MA 3F2FA 3RXQA 1AB9C 2FI5E 3UFAA 2IOTA 5JBCS 4NIVA 1V2LT 4X1NU 3M36A 1S83A 2J94A 1DPOA 4TY6A 2QF5A 2XYAA 3NK8A 1K1MA 1WXRA 3Q3YA 2WUBA 4HGCA 1GJCB 2BZ6H 3MO9A 3VG8A 1TRNA 1O2IA 3BN9A 3FP6E 2FOGA 1QL7A 2HNTF 3EA7A 1BJUA 4BTUB 3SNAA 4BAOB 4ASUD 3RMMH 1V2NT 1FY3A 1H9IE 2JETC 3M5NA 1SGRE 3BTTE 3LKWA 3ZVDA 2PSYA 4RKOB 1KMHB 1QR3E 1SLXB 1C5TA 4P02A 1NESE 3P8GA 3BEUA 1C2GA 1DS2E 1SGQE 1LHGH 4I8LA 1A0JA 4P00A 4ZKNU 1P02A 2GMTC 3SU1A 1P03A 1AN1E 1DOJA 4GAWA 1T8LA 2EY4C 3ZV9A 1O2VA 3MU0A 1MKXK 2VINA 2WV5A 2ZO3H 5K7RA 3QK1A 1W7XH 4OS6A 5EXNA 1SHHB 5HXFA 3KYFA 2VIWA 3SV8A 6LPRA 1GJ5H 1UTOA 3EE0B 1IQHA 2BY7X 3FAOA 3TGIE 3C1KA 4FU8A 1Y8TA 2VIDA 3SUGA 2BOKA 3PLPA 5C0TA 1CGHA 2EEKA 1Q2WA 1E35B 1SB1H 1SMFE 3GY4A 3MTYA 1UVSH 1G36A 4DIIH 3S7HB 3JZ1B 4K2YA 4TPYA 3RXMA 2ZU4A 1FLEE 1W8BH 3M5MA 1A46H 1UVPA 1YPHC 2UWPA 3ZIAD 3G01A 2BLVA 1S6FA 3SNEA 4UE7H 3L33A 1EQ9A 2IPHA 1EJMA 1GBFA 2V7QD 1KXCA 1YPLH 4ISOA 1ABJH 1L1JA 3U1JB 2F9UA 1GDUA 2C8YB 1TPOA 4DT4A 5B6LA 1CGJE 4THNH 5LPFA 1HAZB 1QA0A 5J4SA 1EUFA 1C1QA 1O5EH 1C1NA 3DSOA 4Y7BA 3SJOA 3V7TA 3SGAE 4B6FA 4B75A 1ZLRA 2R2WU 1D6WA 1GPZA 2FOBA 3SUFA 1JIRA 3UWIA 2B9LA 2TGTA 2HPQH 5SGAE 2A31A 1C5OH 3UOUA 1JWTA 1BZXE 3SJ9A 4ESTE 1IQIA 1VITH 1V2KT 1CU1A 1YYY1 5DP4A 5TJXA 4YZUA 5DGJA 3OTJE 3T5FH 2R0LA 3RP2A 3EA8A 5K0HA 2JIZD 1V3XA 1MD7A 1H1BA 1AMHA 1B0FA 4NIWA 3W95A 2GCHG 1J14A 1THPB 3MU1A 3SW2B 3RXTA 1P2IA 1TMUH 1AGJA 1AWFH 2KCPA 2VB0A 4YLUA 1GBIA 5T6FA 4MPUA 2AS9A 3OE7D 3TH4H 3RLYH 3OAAD 3UB0A 1KTSB 3SZNA 2O8TA 3D49H 2NU1E 3AAUA 1O3NA 3SU4A 2GKVE 1W10U 3IITA 4K1TA 3S7KB 5EU8A 3KQ5A 2B5TB 2AGGX 2J98A 4CRAA 2GP9B 2FS8A 1GI9B 2J2UA 2XOKD 1BRAA 4AFQA 1GG6B 3EYDA 4A7IB 3LC5A 2O8MA 3SI4H 2F4LA 1BT7A 1KLTA 3RU4E 1YF4A 5F8ZA 9ESTA 4TSFD 1PJPA 1TLDA 5F8TA 3E90B 2RG3A 1GJAB 4TYDA 1LKBA 2ZFRH 4YXWD 1AD8H 1GHBF 1TALA 2G52A 3QZQA 3P95A 2FZZA 1SHYA 1K28D 1NZQH 4H42U 2OQ5A 3A89A 2R0KA 3SGQE 1E36B 1PPHE 2P8OB 4X1RU 3RU4D 1CBWC 1V2ST 5ETXA 1L2EA 4NZQA 1QJ1B 1C2KA 2FOAA 1EJNA 1AE8H 5DSFA 5FPYA 1Z6JH 2PW8H 2PFEA 1W2KH 4FUJA 5FBIA 1LTOA 1ANBA 1THRH 4CBNA 1LHFH 1T8OA 2UUJB 4ZCNA 1O5DH 1SGNE 1T4VH 3DFLA 1GHWH 3RXSA 3KL6A 3Q3XA 3CNRA 5FL7D 1MAXA 1TA2A 1ZTLA 1T4UH 1PYTD 2OC1A 1CA0C 3PO1B 1DE7H 4I8KA 1YM0A 1TE0A 1PQ7A 5EQSA 1TBQH 2EQNA 5EXMA 4NWKA 5DJ7A 1C4Y2 3SU2A 5HKKD 1JOUB 2ZQ1A 1D9IA 1Y3UA 2EI7A 2GDDA 1TPAE 3CS0A 1F0TA 2IJOB 1MTUA 4IMQA 3UQOA 2BX4A 4DOQA 2RFKC 4FUHA 2JDID 2KX4A 4NA8A 2BY8X 3MNCA 1Y3VA 4KKDA 3KF2A 5J4QA 4JYUH 4FVDA 2GZ7A 3KIDU 3RMNH 3S9BA 1GHAF 1O5BB 2THFB 2M2AA 4B71A 1BBRK 1FY5A 4YOJA 2Y7ZA 1BTYA 2ZDNA 3RXLA 1TX8A 1OP2A 4YLQH 4WMDA 2F9VA 1TNLA 3WY8A 5TCCA 1S81A 1TQ0B 4XBCA 1XUIA 1YPKH 3KQBA 1CHOG 2PP6A 1NRNH 1O39A 2F9NA 2CHAB 3ITIA 1C2FA 1XUGA 4ZKSU 6GCHF 1P8VC 2ZEBA 3RXBA 2QA9E 2J97A 1ORFA 4AGKA 1DUEA 2TRMA 2J4IA 2KAIA 1GJ7B 1ETSH 5H4IB 1GMCG 1OWEA 1V6DA 4YO9A 2XC0A 1JRSA 1CT2E 3BTKE 3A81A 4NWLA 4FOUC 3GY6A 1YLCA 2SGEE 3EGKH 5FHTA 4IC6A 4JZDH 2C90B 3RXAA 3WWBA 2VU8E 4X8UH 1LVYA 2Z3EA 1TPPA 3OU0A 5EPNA 3ODDA 2OBQA 2ZF0H 2NU0E 3V3MA 1O2ZA 1CO7E 2Y6TA 2BQWB 2SGAA 1ZHPA 1OX1A 1DUAA 1GI0A 4I8HA 3RXGA 3PLBA 4UEHH 2HPPH 1C2LA 2GV7A 1AFQC 4FU7A 1HNEE 2XBWA 1HAXB 1AB9B 1L1NA 2ZU1A 3ZZ4A 1C9PA 2Y81A 3TU7H 1PPCE 1X7AC 1S0QA 1C5NH 2W3IA 1HAGE 4Y71A 1E37B 1QBOA 1V2PT 1WAYB 2VGCC 5CE1A 2JH5D 4FUEA 1W12U 5DP5A 3KEEA 2J34A 1YY3A 1MUEB 1ZMJA 2OD3B 2OUAA 2QYIA 1IHTH 1INCA 2ILNA 3T28A 2JETB 1QJ6B 2ZDMA 1C1UH 1O2GH 1VCQA 4MPWA 4B73A 1UVUH 4NSYA 1DXPA 4LK4A 1Y5BT 1UTQA 3TITA 2R2MB 1C5QA 2P93A 1GCDA 4K8BA 4NFFA 2GT8A 4KGAA 3MWIU 2GMTB 1O2LA 3MH6A 2FX6A 3E6PH 5GJ4B 2B7DH 2ZP0H 2FLRH 3UPEA 2ZPSA 5FBEA 4AG2A 1OOKB 2FODA 4RT1A 5DP6A 5F6MA 1TRMA 4B2AA 1HIAA 4A1VA 5FPSA 8LPRA 4GSOA 3ATIA 1AVXA 1IQKA 1A5IA 1XUHA 1KY9A 2AYWA 1SGTA 2ZU5A 3MNBA 4BAQB 2LP6A 2TGDA 4GHQA 3GCTF 4MG3A 3WWFA 3MQKC 2F3CE 4A1TA 2VNTA 3LGWA 1O2TA 1ZMLA 1IQMA 2CF8H 4ACAA 1C9TA 1Y3YA 1QRWA 4HI3A 2ZDVH 8KME2 1N8OC 3K9XB 1TNJA 1GI2A 3RMLH 1AKSA 4ABEA 3F6UH 3VB3A 2BQ6B 2GT7A 4YESB 3DFJA 2QXHA 1O2WA 1YGCH 4I31A 2FIRH 2EI8A 3RM2H 2A7JA 2G4UA 3MFJA 1NO9H 3DT0H 4KP0A 5FPTA 4XRNA 2H5CA 1TOCB 2WPJS 1HFDA 1YC0A 2W6JD 1GJDB 1O2SA 3MH5A 1WYKA 2F9BH 4F55A 2A4RA 1V2WT 1VKYA 3FP8E 1F2SE 6CHAC 4J1YA 2LPRA 1QNJA 3TNTA 5CMXH 3AASA 1JXPA 2ZU3A 2Z7FE 4JZEH 1IQLA 1YBWA 2SGQE 2BHGA 2PLXA 7GCHG 2BOHB 1ESTA 2ZFPH 3FKSD 1C2DA 1H8IH 5A8YA 5I46H 1O2QA 4E05H 4WMEA 2ZTYA 1RGQA 4OS4A 1BTZA 1T8MA 1CT0E 1NS3A 3OFND 2XTTB 3SN8A 4DJZB 4WMFA 3EA9A 2OTVA 2J95A 3SV2H 4CRGA 4GUXA 4AN7A 5E8EH 1V2UT 2QAAA 3GS9A 3VPKA 1TMTH 3EDXB 1W7GH 1V2OT 1PQ5A 2HVYB 2CMYA 1NBMD 1FMGA 1SQAA 4WVPE 2Z3CA 3QWCH 1MQ6A 1KXBA 1MTNC 5JDUB 1OWIA 1FIZA 2BDGA 2A2XH 4X2WA 1RD3B 3I78A 1VITF 1O31A 5ESBA 1XVMA 4H6SB 5EIYA 1O5CB 3ZVBA 3K65B 1GJ8B 1L1GA 1BITA 1GBDA 2GVFA 2QE7D 1SQTA 2ZCHP 3FVFB 3ZZDA 2PKSC 4DGJA 1YCPH 1O2MA 2ZECA 2KAIB 4AG1A 4IN1A 3GY7A 1SQOA 4X6PA 1N6XA 2BQ7B 2ZPRA 1TX7A 3E8LA 4KTSA 2OCVB 3GY2A 2Q1JA 1NU9A 1LVOA 1ABIH 3N7EA 1MCVA 4A6LA 4M7GA 4MTBA 2C3SA 2P59A 3P8OA 1H9HE 3U8OH 1PPGE 1P2JA 5EGMA 1Z1JA 1G2MA 1CT4E 2FP7B 1GL1A 4FUCA 5CHBA 3UNQA 4HG6A 4ACBA 3UIRA 2Q6FA 1FXYA 1QB9A 1O2XA 1D3DB 4MNWA 2K1QA 3S9CA 1O3JA 1HJ9A 1SR5C 1FAXA 4Y10E 1CBWB 1ELCA 4MPXA 5GCHF 1XMNB 3U1IB 2XNDD 1IQJA 2A2QH 2GD4B 3OYPA 3V12A 5LH8A 1UVTH 4PROA 2ZHFH 3ZZBA 3ZZ9A 2CXVA 1C2MA 4IMZA 1O3LA 3O8CA 3B8JA 1NRSH 1KIGH 5F53A 3STIA 2GJGA 4F49A 1VGCC 3PV4A 3F3BA 1E34B 2H1UA 2GCTC 2ZCKP 1EX3A 1EKBB 4DCDA 1LVBA 3LGVA 1CA0B 2BDBA 2XRCA 1UJ1A 2F9OA 1H8HD 1K2I1 1HAOH 1TX6A 4FUDA 4FU9A 1SFIA 1SL3A 3URCA 4MNYA 3C27B 2UUKB 2BX3A 5KGOA 1BTWA 2GGVB 1L0ZA 2AGEX 1HIAB 2FO9A 3A7ZA 4R0IA 4SGBE 5FCRA 1AO5A 3KQEA 1KXDA 3DUXH 1QA7A 3A7YA 1K0HA 3ATWA 4YT6H 4Y0ZE 4OS5A 2ZFFH 4OGXA 3QLPH 2V6NA 3BTME 5A8ZA 5FXLA 3MHWU 4U01A 3ZZ6A 1D4PB 1GMHG 1O3IA 3PMHB 1TBZH 4O9VA 4BANB 2A4QA 1LMWB 1BUIA 1PPFE 4JZIA 4Q7YA 5T6DA 1YPJH 3U8RH 4FUFA 1O2NA 2ZFSA 2JJ1D 1HBTH 1T8NA 1ZR0A 2WHXA 2SGDE 3KYGA 4DURA 2OC7A 1P11E 3FP7E 1WTHD 3M3SA 3IG6B 1EB2A 1S82A 1ZJKA 5EJLA 4Y8XA 4Z1MD 4Q4LA 1OXGA 4BAKB 1G3CA 4UFDH 1UO6A 2LELA 4JMYA 1ANEA 2A4OA 2WPLS 3QX5H 2TBSA 1D3TB 1CGIE 2WSSD 4MVNA 1P0SH 3TH3H 4ZKOU 3TJUA 5DP7A 1FIWA 1V2QT 1W14U 1HJAC 1Y3XA 2YNBA 1GBLA 1V2MT 4AX9H 3BV9B 1FONA 3DHKH 3NZIA 3FFGA 4MPVA 5ABWA 2AEIH 9LPRA 1SGFG 5AFZH 2ODQA 2ANMH 3E0NB 1FI8A 1S85A 1IAUA 2W3KA 3TLOA 4NGAH 1C2IA 1KXFA 1EB1H 1AFQB 3CP7A 5EJZA 4OS7A 1P01A 3OY6U 1O3FA 2C4FH 1G37A 2Y5FA 1GJBB 1M9UA 2J38A 1NFXA 1FJSA 1S6HA 2UUYA 2OQUA 5HIZA 1ZHMA 1FY1A 1NC6A 3GCHC 1GBBA 2FTLE 4ZAEA 4D76A 1HDTH 1P09A 4INHA 2VGCB 1EAUA 2KM0A 1IHSH 1O2JA 1YPEH 1C5SA 2AFQB 4CHAC 1DLKB 1WCZA 5EQQA
chains in the Genus database with same CATH topology
5EW2H 5JB8S 4X8SH 3GDSA 1HUTH 1MKWK 1AWHB 1GVLA 2FOEA 1HAHH 4K5ZA 4JK6A 1GBHA 3MU4A 2ZIQH 1AZZA 1AHTH 1GI7B 1KXEA 2VVCA 3MOCA 4HTCH 4Y11E 1TWXB 2HLCA 1BTPA 2C93B 2V35A 2A32A 3GY8A 1UK2A 1GI1A 1GGDC 3RXIA 3RXEA 2A1DB 1QCPA 1A5GH 3A83A 1THSH 1MBMA 2QF0A 1SLVB 3M5OA 2BLWA 1RJXB 1P57B 1GHXH 2FWWA 2GTBA 1O5GH 1UTPA 2FPZA 1ANCA 2BMGB 4LZ4B 4AFZA 4UFGH 2VWNA 1G2LA 2NWNA 2ZHWH 3M35A 4IS5A 3BTGE 3OX7U 2QF3A 1TGCA 1UCYK 1LCYA 2BXUH 3VGCC 2SNVA 3TGKE 4AFSA 2ODPA 4K69A 1ELDE 1EZUC 1ARBA 4TWWA 5AFYH 3UUZA 3T26A 1EPTA 1N8OB 3BTQE 1YPMH 1P9UA 1EP5A 1SSXA 3A87A 1LHCH 1GL0E 1D3QB 1TABE 2ZHEH 3U69H 1GI3A 1NTPA 2GCHF 1MU8B 1MKXH 3RXCA 1Z7KA 3O8DA 1LPGB 3ZZCA 1EZSC 4DT7B 6CHAB 3T29A 2W5EA 2OP9A 2PTNA 3QO6A 1J16A 1HAIH 2D8WA 2WYGA 4JZFH 1UHBA 4B2CA 1W3CA 5EPYA 4ISNA 2ZGHA 1J9CH 1ESBA 1OYQA 2WPKS 2XC4A 3LDXH 5DP8A 2J9NA 2HNTE 3E91A 3P17H 1PPBH 5L30H 2ZFQH 1B5GH 3UTUH 1XUKA 3P8NA 3SUEA 1XKBC 1EZQA 2ZPQA 2OC8A 1C1VH 2BD4A 1KYNA 5EOKA 4IGDA 1O5AB 1GBAA 2XXLA 1EATA 1BTUA 2XC5A 1BJVA 3MO6A 4DY7B 3D62A 1GVZA 4NZLA 3M3TA 1N6YA 1HAPH 1EXFA 4D8NA 1DDJA 3SGBE 1MTNB 2JH0D 3LGTA 1H8DH 3UY9A 1H9LB 2IN2A 1MKWH 3CS7A 3PTBA 2Z9IA 5I25A 1Y59T 1O35A 3PB1E 1MBQA 2XWBI 4Q2KA 2XBVA 1K21H 2PR3A 1SGEE 3D65E 4X8TH 1BMLA 3QGJA 1VR1H 3ZZ5A 1RFNA 2WPMS 4O3UA 1ETRH 5DP9A 2FYQA 2VIPA 2PKSB 3LGUA 1A2CH 4KTCA 2RA3A 5E2OA 3GDVA 1ZPBA 3GYLB 1FQ3A 3KGPA 4JCNA 4X2YA 1P04A 1Z6EA 1Z71A 1CA8B 2AGIX 3NUMA 4E06H 3M3VA 1BMNH 2WUCA 1SG8B 4MLFB 2ZGXH 1TGTA 3S0NA 2EI6A 1KLIH 1O3DA 3SORA 4Y7AA 2ESTE 1W13U 1GHAG 2QXGA 2V3HH 5FAHA 1GBCA 1ACBE 1SGYE 2R9PA 2VWOA 5ESTE 1EOLA 3OSYA 2ULLA 4IC5A 5C5OA 1SLUB 5JB9S 5CHAC 2FI4E 3H5CB 1IQNA 1IQGA 1OS8A 1QB6A 4I33A 3S9AA 1TA6A 2NU3E 4NCYA 1RIWC 1K1PA 2YOLA 3AVZA 5A2MH 1OWHA 4FUIA 1CHGA 6GCHG 1QY6A 3EQ0H 2Z3DA 4B1TA 1RTLA 1O32A 2UUFB 2HGTH 4ASHA 4HFPB 4CH2B 1ZRKA 3LGYA 1SGDE 4XBDA 5AHGH 1CHOF 4NIXA 5GDSH 1VGCB 1C4V2 2ANYA 2BLQA 3BTFE 2GCTB 1QRXA 4X1PU 4YM9A 1XM1A 3M7UA 2Z6BD 1TNKA 1DT2A 4X0WU 3Q77A 3TIUA 1U6QA 1EOJA 5DP3A 3ESTA 1C2JA 1DWDH 5HM2A 4ABAA 1C1SA 1GI8B 3BF6H 3UNRA 2Y5GA 3ZZAA 1TQ7B 1ZTJA 2SFAA 2VWLA 3NPSA 2FESH 1VZQH 2XBXA 1T32A 1F0UA 1GJ4H 1TMBH 1BBRE 2XW9A 2BLOA 1LHEH 1QURH 3F9GA 4FUBA 1A3BH 5C20A 1TIOA 3RLWH 1BTXA 1YP9A 2UWOA 2ZHDA 4BOHA 1BQYA 1LPZB 3A84A 1AVGH 1BRCE 3K6YA 3KQDA 2W26A 4X8VH 2G00A 5LGOA 1EASA 7KMEH 3RUOA 1O3AA 4AYVB 1GMDF 2BYAX 4OGYA 1A4WH 2A5AA 1BTHH 1KDQA 2STAE 4AGJA 1NFUA 2G81E 1C5PA 4JK5A 3AW1A 1S0RA 1WTGH 1K1IA 3MNXA 4WWYA 2ZTZA 3SU6A 1Z1IA 1A1RA 2P95A 2Z9JA 7ESTE 1E0FD 3TK9A 2W7SA 3VB7A 1BMAA 2SGPE 3RC5A 4BAMB 4INLA 3O8RA 1A5HA 2ZU2A 3URDA 2ZCLP 4Y79A 1HJAB 5FX5A 4XFQA 4ZMAH 2BZAA 3GCNA 1HXFH 1BBRH 2G5NA 2ZZUH 3GCTG 3RXPA 2BDYA 5HMAA 1OP0A 4Z6AH 2V3OH 3SU3A 4D9QA 1NRQH 1QL9A 2GDEH 5C2ZA 3L6PA 2QN5T 4U30A 3SQHE 1QIXB 1XKAC 3E1XB 2CGAA 1QFKH 6ESTA 1A0LA 4MNVA 4ISHH 1ZTKA 2Z9KA 1O3BA 1UK4A 2M5TA 3RXJA 3GCHB 3GICB 1C2EA 3Q00A 2AIQA 1P9SA 2CN0H 3RDZA 3M37A 4ABHA 1YPHE 1LO6A 3BTEE 1O38A 4CHAB 1AQ7A 3BIVH 2D2DA 3I29A 1J17T 3ATKA 2QY0B 1ELAA 2ZFTA 1PPEE 2RCEA 1UK3A 1G3EA 4AFUA 2G55A 4ZROA 3F1SB 4ABJA 5E0JA 2ANKH 2FOCA 1GGDB 3F68H 4IBLH 3A85A 1VJ9U 1QQUA 4CBOA 1G32B 5JBBS 1EAWA 7GCHF 4J2YB 1MMJN 1DLEA 1K1LA 3RXUA 1XXDA 2ODYB 1S84A 4ZXXH 2ZWLH 1K9OE 1ELGA 3U98H 3RXRA 3PLKA 1MD8A 3BG8A 2RA0A 1P12E 1CE5A 3MYWA 1RRKA 3QN7A 1EZXC 4FVBA 2BD5A 2F91A 2BY6X 2H2ZA 2G8TA 2FM2A 4KELA 1DVAH 4XSKU 3VGCB 4CRCA 4B74A 2BM2A 4TPIZ 4I7YH 1DWBH 1VITG 4FXGH 1BCUH 1G3BA 1MU6B 1HCGA 4UONA 4ISIH 1E38B 5F8XA 3ZVAA 2A7HA 1FY8E 2VIVA 7LPRA 3SU0A 2VH0A 1EP6A 1P10A 1EAXA 1GWAA 3RXVA 3OY5U 5L2ZH 1LVMA 1BRBE 5HM9A 1V2TT 3PYHA 4ISLA 2O8UA 1ETTH 3SI3H 3SJIA 1SFQB 3RC4A 2P3TB 4DW2U 5TCAA 1NFYA 4GCHG 1HAYB 4WH8A 5E0HA 4BXSA 1OP8A 3QZRA 1F5LA 4ZXYH 3P8FA 1GBJA 2ZKSA 1C1TA 1TOMH 1ZPCA 3MO3A 1O33A 8GCHG 1ZZZA 1O37A 4NIYA 2RDLA 1PPZA 1O2YA 3SUDA 2OLGA 3RU4T 2OXSA 1QL8A 1V2JT 2H5DA 3ZZ3A 2PWXA 1GHZA 3MI4A 3D23A 1AUJA 1NROH 2ALVA 1BB0B 1L4DA 5GCHG 1AVWA 1ESAA 1F5RA 2VWMA 3HKIB 3ZYEA 2XNIA 3T2NA 5A09A 4ZHAA 1SOZA 3M5LA 3LC3A 2I6QA 2ZA5A 2A4GA 3MH4A 1A7SA 3S69A 1GBEA 3TNSA 5AVDA 1UMAH 1XXFA 3GY3A 3ODFA 4ZUHA 1BOQA 1ZYOA 5DG6A 1IQEA 2CJIA 1LQDB 4X6OA 1C1MA 4D9RA 2HALA 2EA3A 3UQVA 3TK5A 3QGNB 5AF9H 1BHXF 1FPCH 2BVSH 2NU2E 1SPJA 5JPMH 4R8TB 2PUQH 3SV6A 3ENSB 1FN6A 1C5UA 3E16B 2BB4A 1D6RA 3ZVEA 1DSTA 1T31A 2QXIA 1TNGA 3VB5A 2ASUB 5BPEA 1HYLA 4GHTA 3ZYDA 4ZKRU 3A86A 3F9HA 3BEIB 3LT3A 3RXOA 2B8OH 5A0CA 2FYRA 2XCFA 1HV7A 4ABFA 1AI8H 4KTUA 1NT1A 4B76A 4A1XA 1HAVA 3BG4C 3IWMA 3RMOH 4U32A 1EPTC 3HKJB 5EXLA 1AKSB 2VJ1A 2ZG0H 1G30B 4BTTB 5CHAB 2CV3A 2FXRA 3RXFA 3SJKA 1GCTC 3A7TA 5T6GA 1GMHF 2XWAA 1EAIA 1OYTH 1Z8RA 1ZSJA 4H6TA 1RIWB 1O3KA 3KCGH 3V0XA 1AFEH 1QGFA 1AZ8A 1PQAA 3PWCA 4ZH8A 1SBWA 1P06A 2PUXB 3LONA 3SOSA 1KXAA 1B0EA 2ANWA 2DUCA 1O3MA 1DSUA 1XX9A 4WXIA 3TJOA 1CQQA 5EW1H 1UTNA 3H7OA 2A0QB 1SGFA 2OBOA 3I77A 3A8DA 2Z9GA 4O3TA 1GDNA 1O0DH 1C5LH 2SGFE 4X1QU 3PTNA 3KN2A 1P3CA 4D7GA 1UTMA 2CF9H 2P16A 1LHDH 1TYNA 2XBYA 1O3OA 4LOYH 1ELFA 1DWEH 3ZV8A 1O3EA 5A0BA 4BXWA 1F0RA 2FLBH 4VGCC 2BDHA 1MH0A 3B9FH 4Y8ZA 1XUFA 1MZAA 3SHAH 1OSSA 2TGAA 1K1NA 4I8JA 3DD2H 1HJ8A 4GPGA 3ZVFA 1FAKH 5BRRE 3A80A 4ABBA 4FUGA 2F83A 5GIBA 1W0ZU 3RXHA 2BD2A 3MNSA 1NU7B 1C1PA 2PHBA 4DG4A 1SGIB 4ZHLU 4XE4A 1C5XB 4XOJA 1ELEE 1OWDA 2BD7A 1YLDA 1NFWA 4K60A 2BD8A 1ELBA 3SBKA 2BVXH 3NKKA 1K1OA 2QC2A 2QXJA 2GZ9A 5EODA 4CRDA 1WV7H 2FS9A 5JBTA 1GI4A 3SNDA 3UREA 1GI6A 3VXEH 3QTOH 2Y82A 1Z8JB 4Z0KA 5LPEA 1O3CA 2H9HA 2W7UA 2VIQA 1TPSA 3GOVB 1LKAA 1BHXB 3W94A 5EQRA 3M7QA 4YOGA 4ABDA 1OWKA 3M61U 1Q3XA 3A7XA 3A8BA 3MU5A 3BSQA 1AUTC 3RXDA 5GXPA 4K3JA 1OWJA 4IW4E 4WH6A 2C8ZB 2GX4A 3ZZ8A 1JMOH 1IQFA 4F4OC 1AE5A 4RN6A 1NPMA 2VIOA 5EG4A 1LQEA 1WQVH 2STBE 4WF8A 1VJAU 1GHBG 1T7CA 4LXBH 3VEQB 1FUJA 1SVPA 1A0HB 4YOIA 1O30A 3TGJE 3LJOA 3N7OA 1ZPZA 1F0SA 2LNCA 2HVXA 3PWBA 4A92A 2AMQA 2Y80A 4AOQA 3PROA 1MCTA 1UCYE 5B6OA 3TK6A 4AYYB 1TRYA 4ABIA 5C1UA 3PMBB 4A5TS 1DWCH 1VCPA 1HAVB 4GLYA 1DANH 2I6SA 2O8LA 1WBGB 3LGIA 3UWJH 4JYVH 1TBRH 4NA7A 1QBNA 2ZC9H 2FMJA 3PM3A 1XVOA 1Y5AT 2NU4E 3VB4A 1MQ5A 4CR5A 1TONA 1GBMA 2UWLA 5JBAS 5IYTA 5GWZA 4DIHH 3GY5A 3FANA 4CRBA 5C5NA 3NCLA 2G51A 1MTVA 1DY9A 3RXKA 3SV9A 1QRZA 1UTJA 4Y6DA 2H9EH 1FPHH 2BVRH 5GPIB 3TPIZ 3QTVH 3M7TA 2ZQ2A 4MQAA 2BDCA 2ZI2H 3B23B 2FI3E 4I32A 1KSNA 3HK6B 1BMMH 3BTWE 3V13A 1YKTA 2BDIA 1AU8A 2PGQB 4YTAA 1HRTH 2QV1A 3GYMA 4LZ1H 5F03A 1P2KA 2OINA 1GJ9B 3AW0A 3K2UA 4ZHMU 1MZDA 2J92A 4X6NA 1HLTH 2ZDKA 1UCYH 4Y0YE 2WYJA 2A7CA 1OPHB 3SNBA 4K1SA 2WINI 1J15A 1UVOA 1C5MD 1FNIA 1ZHRA 3LH1A 4TWYA 3U8TH 4Q7XA 2ZNKH 4Q7ZA 5DO4H 1O3HA 1LPKB 2ALPA 3KNXA 2BTCE 1O2OA 2QGRA 1ANDA 2HRVA 4CRFA 5FX6A 4RSPA 4D7FA 2ZDAH 2A45B 1V2VT 1WU1A 4OS2A 3F9FA 5FCKA 1ZMNA 2AIPA 1Q31A 4RKJB 1XUJA 1A3EH 4I8GA 1ZGIA 3NWUA 4Q80A 1FZZA 1P2NA 2HWLB 2PSXA 1MTSA 1Z8IB 3TJNA 2JKHA 3Q76A 2EC9H 1SC8U 1W0YH 1JRTA 2ZDLA 4AZ2B 3LH3A 1GMCF 4OS1A 1QB1A 3BEFB 2HOBA 3GDUA 8ESTE 1NRRH 2BD9A 3T25A 3VB6A 3LIWA 3SJ8A 3F9EA 5HGGA 2DE8A 5JYIA 2V0BA 1G9IE 2H6MA 5E0GA 1DX5M 1EJAA 2FX4A 1O5FH 3E3TA 4WY3A 4K8YA 5C3NA 1SGPE 2VH6A 3K6ZA 4CH8B 1SLWB 1TGSZ 4BTIB 5C1YA 3HGPA 1O36A 4SGAE 1NN6A 3BG4B 1HGTH 3NXPA 4AB9A 1EPTB 3UR6A 1GMDG 1DM4B 3TH2H 1F92A 3UNSA 2GV6A 1Y5UT 1FN8A 5DKMA 1WSSH 4WXVA 2R3UA 4AORA 1LDTT 3O8BA 4DVAU 1GCTB 1ARCA 1GI5A 4GVUA 1WOFA 2P3FH 3AAVA 2PTCE 1TGBA 5C67A 2TIOA 2BXTH 1C5YB 1FDPA 2FEQH 4AB8A 3L3TA 1IOEA 1HPGA 1ZSLA 3ZVGA 3CENA 1KLJH 1DXWA 1O2PA 3SO3A 1UHBB 4BNRA 5T3HA 2VVUA 2F9PA 1ZGVA 3T27A 1DY8A 2PV9B 2B0FA 4X2XA 3RC6A 1UTLM 3KHVA 1YCPK 1ZJDA 4X1SU 5LPRA 1RXPA 3SQEE 1BDAA 2PKAA 3UOPA 1C5WB 1Z8GA 3LOXA 1ELTA 1ELVA 2FOHA 2Y7XA 1SGCA 1F7ZA 2AH4X 1TFXA 1O3PB 4NSVA 3ZVCA 1NRPH 1RTFB 1UTKA 1DFPA 2H9TH 3ELAH 4Y8YA 1FY4A 3PMAB 4WJG2 3TVJB 1BA8B 2D1JA 4VGCB 1QJ7B 1P2OA 1PFXC 3MU8A 2GZ8A 3LPRA 3VFEA 1KTTB 1YPGH 3MH7A 1C1OA 2R3YA 1O3GA 1TAWA 2BDAA 1P05A 2FOFA 3A88A 1DICA 1B7XB