1SGTA

Refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSGAAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords TRYPSIN
publication title Refined crystal structure of Streptomyces griseus trypsin at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA02
3T29A 2FOCA 3UR6A 1IQNA 3RXDA 1YPGH 2CF9H 4BTUB 4CRCA 1O5DH 2VWOA 2GV7A 1TGCA 4CREA 2VVCA 2NU1E 1XKAC 3RXSA 1DOJA 2QXHA 5BPEA 3ZZDA 2C3SA 1GMDF 1OS8A 4OS4A 5FPYA 3MNXA 1P2IA 2O9QA 3T26A 1GBKA 1QB1A 1O0DH 2HGTH 1SQOA 1THSH 2PTNA 1QR3E 2TPIZ 1PQ5A 3SNCA 4AORA 3BTGE 2NWNA 3HKIB 3BG8A 4K8YA 1VCPA 4ZH8A 2WPLS 3LGTA 1EX3A 5E2OA 1O2HA 3PLBA 1AO5A 1P8VC 1F0SA 2A7CA 4VGCB 1A5GH 2ZNKH 1BBRH 2K1QA 3EYDA 1AUTC 2AYWA 1W13U 5DP5A 1HYLA 3LT3A 2ZFQH 3QO6A 1O3FA 3KQBA 3F9FA 5DPAA 2BOKA 1KLTA 1MCTA 1W7XH 1UTNA 1V2JT 1YLDA 3SHCH 3GDUA 4FUCA 4AZ2B 5G4BA 3OTJE 1ABJH 1X7AC 4AFSA 2ZHDA 3V0XA 4ABHA 2Z9KA 2EC9H 5C1YA 3RU4T 1CGIE 4ZKSU 1S6HA 2ZHWH 5L2YH 3ZV9A 4Q80A 2P95A 3SV8A 1O2JA 3ZV8A 3DFLA 2NU2E 2PGQB 3UWJH 1C5VA 1GDNA 1XUIA 3H5CB 3PROA 1PPZA 2A5AA 1JXPA 1N8OC 2CXVA 2DE9A 1J15A 2FTMA 3ZVAA 3TVJB 3QTVH 5DP6A 5GXPA 1XX9A 1PYTD 1TX6A 1TNHA 3O8BA 1EZUC 4ISNA 1HNEE 3A7WA 5EPYA 3BIVH 1BOQA 6CHAB 1VGCB 1O3HA 1BHXF 1XUHA 4E05H 1C5PA 2FOFA 3P17H 4NSVA 2BLQA 2P3UB 1FMGA 4MQAA 1LVMA 2P3FH 1SI5H 1HDTH 1UHBB 1UTMA 8LPRA 3RXQA 1PQ8A 3A82A 1MTNC 3PO1B 1FY8E 1UK2A 1DFPA 1IAUA 2OP9A 4IMZA 5T6GA 2C4FH 1H8DH 1K21H 3SZNA 3E3TA 4ABGA 2Z7FE 1NM6A 3BTEE 3SJ8A 1RTFB 4NWLA 7GCHG 2ANWA 4B75A 2OTVA 4UFGH 1G32B 1AGJA 1DVAH 3LJOA 3V12A 3FP6E 3GDSA 4B74A 2W3IA 1C5QA 3GYLB 4ZKOU 3GY6A 1ZTJA 2GP9B 2HOBA 1PQAA 3VGCC 3RXFA 1YPMH 2F9UA 1O2NA 1SBWA 4AGJA 1BB0B 5AF9H 1BHXB 1O2SA 3A80A 1CE5A 2BY7X 1O36A 5FX5A 3SJIA 1BTXA 3BIUH 3P95A 4IC6A 5LGOA 2AIPA 1QGFA 1C4U2 5GIBA 3RUOA 1MZDA 1SG8B 1K1NA 1HFDA 1F0UA 2QN5T 1IOEA 1FY3A 5F8XA 3MYWA 4LZ4B 4HFPB 5DGJA 3EA8A 2ZU4A 4MVNA 1AB9B 3TNTA 1CT4E 3SV6A 1QJ7B 3QZRA 1BTYA 2PV9B 4DGJA 2G8TA 1AWHB 3QUMP 1TALA 1C4V2 1L2EA 2ZDLA 4KKDA 3M36A 2VIOA 2QC2A 4KTSA 4MPVA 1CSOE 2CJIA 1V2MT 2GV6A 1GGDB 3PMBB 5HM2A 1O2OA 3FFGA 4MPUA 4X0WU 3OU0A 3EDXB 3U69H 3VB4A 2PKSB 1P9UA 1NZQH 1O3AA 4I33A 2UUKB 2HVXA 3E8LA 1XUKA 4O9VA 3RXPA 1G37A 3LC5A 3RDZA 1TQ7B 4R0IA 2HNTF 1YPEH 2ZCKP 1JIMA 2F3CE 2G51A 1EKBB 1Q31A 3FVFB 7GCHF 1K1IA 3L3TA 3D62A 1FIZA 4BTIB 5K0HA 1MQ5A 1XUFA 2YNBA 2XC4A 1SPJA 4KTUA 3ZZ3A 1C5ZB 1UJ1A 1V2VT 4X8SH 4H6TA 1KXCA 3KF2A 2ZGBH 1DANH 1MTSA 4JZIA 3WY8A 5C3NA 1OWJA 4CH8B 2B0FA 1P04A 1W0YH 4PROA 3P8FA 2VNTA 1HUTH 5ABWA 1ELCA 1Z8RA 4XDEA 3HK6B 2GDEH 2BDHA 2DE8A 1RJXB 2JETC 4TY7A 1DY8A 1UTLM 1VITG 2BDIA 3ODDA 2Z94A 2ZQ2A 4TPYA 1UCYE 2WPMS 1YPHE 3A86A 1O2TA 2C8XB 1O2ZA 1YP9A 1E0FD 1TNGA 2VVVA 2BLWA 1Z6EA 4GUXA 4KTCA 2DUCA 4MPXA 3QGJA 1ZGVA 3NPSA 3C1KA 4JYVH 4B76A 1C2DA 3F1SB 4LZ1H 4U01A 1BZXE 4Q7YA 1LVBA 3RMMH 4B1TA 1H1BA 3MMGA 5GPIB 1HAHH 1O3CA 2UUJB 1UTPA 1GI8B 4INHA 4X1QU 1GBBA 3QTOH 3AW1A 3LGUA 2XCNA 3RXRA 5HYOA 3RC5A 2VIDA 5C67A 2BQWB 4WXVA 1S85A 5HM9A 3ATMA 3SQEE 4Y0ZE 1MD7A 1S83A 1WV7H 3PYHA 2FI5E 1BBRK 1PYTC 3ATWA 8KME2 2FM2A 1JRSA 3CS0A 3JZ2B 2WUBA 4GCHG 3A85A 2BVRH 3NUMA 5EPNA 1ELVA 1QL9A 3PLPA 4DT7B 3LONA 3ZZBA 2Y82A 1RTKA 4IN2A 4RN6A 2ZU1A 3A89A 3UY9A 1GHZA 1SFIA 3FANA 2B9LA 1FAXA 1GI5A 1O2PA 3LC3A 2VVUA 1ANCA 1UO6A 1OSSA 1A3BH 3FP8E 5C1UA 3ELAH 1TB6H 3KQDA 3LIWA 1KXDA 1N1LA 5AVDA 1SGCA 1PPCE 1Q3XA 3GCNA 1NPMA 2V3HH 5A0BA 4J2YB 1EOJA 1VITF 2Z9IA 4O03A 1MTWA 1ESBA 4NWKA 2AMQA 1L4DA 1NS3A 4WVPE 1MBMA 2FS8A 4ABAA 1ID5H 3TGIE 1EB2A 1AN1E 1OYQA 1ELGA 1ZPZA 2XBVA 5AFZH 4Z0KA 1MQ6A 3BSQA 3ZZCA 1DICA 1JMOH 1O2YA 1GBLA 1MCVA 2CF8H 1KXAA 1B5GH 1LHFH 4IGDA 2UWLA 1SR5C 3S0NA 3PMAB 4H4FA 1TYNA 1NESE 3NKKA 2ODYB 2AERH 2NU3E 2BDYA 1GWAA 1J17T 1EJNA 4OGXA 1IHSH 4OS5A 3QK1A 4Z6AH 1QRZA 4JZDH 2ANYA 1INCA 4OGYA 3ZVEA 1J8AA 2BLOA 1O2UA 2QF3A 3MU0A 3TITA 1T8OA 3M7QA 1DX5M 1NN6A 1UK3A 4ZHLU 1GG6C 3D49H 2VGCC 1ZHPA 2ZDVH 4CRGA 3LJJA 1DUAA 3B9FH 1ABIH 4MNYA 3PV4A 3QZQA 1V2OT 1GJBB 4GCHF 1MU8B 1ORFA 3MHWU 1MUEB 4NGAH 3FZZA 2PHBA 1CU1A 1BRBE 1PPBH 4AB8A 2ZDNA 3SU5A 2B5TB 2SGQE 4UFEH 2ZGJA 1C2IA 1ZHMA 4WMEA 5GWZA 4ZKNU 1BTUA 1TBRH 2FOGA 3GY2A 1GI2A 1KIGH 3HPTB 2BY9X 1THRH 3VXFH 3VB7A 1ZZZA 5FAHA 1AQ7A 3TU7H 1NRPH 4AFUA 2PUQH 1O5EH 5EQRA 3UQOA 2A2XH 2A4GA 1EAWA 1O3DA 2Z3DA 4FU7A 2ZPRA 1O34A 3SHAH 1AE5A 2ZU5A 4I31A 3G01A 3LGYA 3KNXA 1FY4A 5DP8A 1Z7KA 2SGPE 1QBVH 2FYRA 1WYKA 4K2YA 1NTPA 4GSOA 1AE8H 2Q6FA 1Z1JA 3GY7A 2OINA 1TMUH 2I6QA 1T32A 3KQEA 1CA0B 1EP6A 1E37B 3LH1A 3SGBE 1TONA 2FDAA 1ZOMA 4AX9H 1T31A 3EGKH 2BXTH 1DPOA 5C1XA 3BTTE 1BMNH 1SB1H 4NZQA 4FUHA 4I7YH 3QLPH 4X2WA 3ZVCA 3RC4A 3GCHB 5A2MH 3DD2H 1OP8A 3MO3A 4I32A 3GY4A 1DDJA 2A31A 1P3EA 5CHAB 1LKAA 4DJZB 3M7UA 3PM3A 1F5LA 1ZPBA 4I8LA 1Y3UA 3DT0H 1CGHA 5BRRE 3TH2H 1T8NA 1TRMA 4BAKB 1FQ3A 4CHAB 5LPRA 1H8IH 1SL3A 2LPRA 4K69A 1GBAA 3QWCH 1V3XA 1WAYB 2KAIA 3F9HA 4X6NA 3MH4A 1WTGH 1LO6A 2A4OA 3TK9A 1GPZA 4K8BA 2IN2A 3EA9A 2BMGB 1QQ4A 4Y11E 2Y7XA 1D3PB 2SNVA 1AHTH 2ZFTA 4ZKRU 5DP3A 1P9SA 2I6SA 2ILNA 4TWWA 1Z6JH 2SGAA 1EZQA 5TCAA 1K1JA 1XM1A 4NA8A 2BB4A 4KELA 2ZI2H 3TGKE 2PSXA 1OWHA 4K5ZA 1RIWC 1ACBE 2C8YB 2GCHG 2FP7B 3MU8A 1FUJA 2XNIA 5T3HA 2F83A 1VCQA 2CHAC 2ZPSA 1Z8JB 2F9PA 1C1TA 5EXNA 3F6UH 1C2FA 1MBQA 4ZUHA 2TGDA 2ZDAH 4JK5A 6ESTA 3GY5A 2ALPA 2BD7A 3SNAA 1QJ1B 2Y80A 3GOVB 5L2ZH 1OP0A 1AVWA 4JYUH 3SV7A 2Z9LA 1SFQB 2GCTB 9ESTA 1BJVA 1EZSC 1SMFE 2BDGA 5J4SA 1BJUA 3A7VA 1QBNA 2O8LA 3JZ1B 3RXIA 3V3MA 2BD9A 4YESB 1O3LA 1O2IA 1V2NT 2UWPA 1IQKA 2QV1A 2ZU3A 3BTKE 1FNIA 1O31A 2YOLA 1FV9A 2YNAA 4K60A 2F9NA 1K1MA 1L1JA 2QXJA 3FAOA 1AFQC 3P8GA 1C5YB 3ZZAA 4MNVA 3IWMA 1OP2A 1W8BH 3E16B 1GHAG 1WQVH 1PQ7A 2VWMA 1BITA 3BEIB 3GY3A 1DY9A 4MG3A 1GCTC 1GHYH 1GJ5H 4DIHH 4MDSA 2OLGA 4X2YA 1B0FA 2STAE 2ZC9H 1A2CH 2ANMH 1UTJA 3ITIA 3SUDA 2A0QB 1ESAA 1ANBA 5DO4H 4ABEA 4JYTA 2SNWA 2VIVA 5FCKA 5DP9A 1GBEA 4B73A 2AMDA 4YTAA 4ISOA 4CRAA 2A5IA 3AVZA 3A8AA 2QAAA 4WY3A 3TIUA 5TJXA 1FXYA 1HAXB 3M5OA 5L30H 1D3QB 1ZTLA 3UREA 3MWIU 5JB9S 2D1JA 2TGAA 1TPAE 2BD4A 3SUFA 3BTWE 3MTYA 4IW4E 4AN7A 2GCHF 1PFXC 2IJOB 1NY22 1ZMNA 3E6PH 3KGPA 2HNTE 1QQUA 3RU4E 2ZDMA 3L6PA 2G5VA 1O33A 3RXKA 1ZMLA 1OXGA 5DKMA 1BMLA 2PTCE 1HAVA 1SGRE 1ANDA 1EB1H 2Z6BD 1DLEA 1K2I1 2P8OB 1OOKB 2B8OH 1RD3B 4NG9H 2PUXB 1AFEH 4AG1A 5CMXH 1SOTA 1W0ZU 1Y5BT 3RLWH 4ISLA 1C5TA 1TOMH 4YT6H 6GCHG 1NRRH 4KP0A 3A7ZA 1ZPCA 3M5LA 7ESTE 4I8HA 1YCPM 1P57B 1O3BA 1A1RA 3GISB 3VPKA 3K6YA 3GCTG 3TJNA 4ASHA 2Y5FA 2VU8E 1E34B 3A8CA 3T28A 1W3CA 1SGPE 1RRKA 3FZDA 1O2WA 4YOJA 4IS5A 4XBCA 3ZYEA 4O97A 1O5FH 4YO9A 1C2KA 1OWKA 3I29A 1H9LB 2AGGX 3SU0A 1GHAF 5C2ZA 2XBYA 2A7JA 2ZPQA 1AD8H 4B2CA 1O30A 4VGCC 2RA0A 1P0SH 3ZZ7A 1B0EA 3V13A 1D3DB 1GJ6A 1TE0A 2O8WA 3M35A 4X6MA 3E0PB 4CH2B 4AOQA 1O2GH 2PW8H 1UMAH 2OC8A 3VXEH 1V2LT 3ENSB 1MD8A 4D9RA 1MAYA 2V3OH 4YT7H 1YF4A 5F8ZA 1M9UA 4FUFA 2BY5X 1THPB 4Q2KA 1DXPA 1S6FA 7LPRA 1O5GH 3SUGA 1IQEA 3A7XA 5FPTA 1EJAA 4FU8A 2G55A 1KXBA 3OX7U 3PWCA 1QFKH 1RGQA 2H5DA 2HPPH 3BEUA 3LGWA 1Y5AT 1H9HE 3PTNA 1QL7A 2C8ZB 3PB1E 4DG4A 4IBLH 1AZZA 2ZA5A 1DSUA 1K22H 8ESTE 2R2MB 3E0NB 2GZ9A 3R0FA 1ZJKA 1ETRH 1VGCC 1GCDA 2PFEA 1G9IE 1T7CA 2H9HA 1ZRBA 1HAYB 3M3TA 4RKJB 1LPZB 1A46H 3TNSA 3PWBA 1O5AB 1O3GA 2ODPA 1C1SA 4IC5A 2ESTE 1WOFA 2IOTA 2G81E 3PO1C 1O3MA 5AFYH 1MU6B 4QT8C 5T6DA 3A83A 4A7IB 4F49A 6GCHF 1DWCH 2BLVA 2XC0A 1TPPA 4D9QA 2BOHB 2H1UA 1KXFA 1QB6A 3F9GA 3K6ZA 4YOIA 5F6MA 2UUFB 2W7SA 3K65B 1F92A 1GI4A 2EI8A 2OD3B 1YC0A 2BVSH 1GBTA 2VWNA 2W3KA 3GCTF 2STBE 1F0RA 3LU9B 2OBOA 2BYAX 4X1SU 2ZCHP 5EXMA 3E90B 4K1TA 1DUEA 4O3TA 4AYVB 1F7ZA 2R9PA 1GBCA 1P03A 1TGSZ 4SGAE 2BY8X 1BTWA 3T62A 5I46H 1LPGB 3BG4B 3QX5H 3ESTA 4JZFH 1TA6A 4ISIH 1MKWK 1BIOA 1TRYA 1J14A 4IMQA 1QY6A 1HGTH 3NZIA 2LNCA 1YPLH 1T8MA 1W11U 1HAIH 1HAVB 5IYTA 1IQIA 1T4UH 4JZEH 1JWTA 4OS2A 1O3EA 1AVXA 3HGNA 3M3VA 1IQMA 4NA9H 1HJAB 3BTDE 1HXEH 4UD9H 3KEEA 1G36A 1AB9C 1EPTA 1K1LA 1GBMA 3BTFE 3QGNB 3RXBA 2AMPA 1C5LH 4ABJA 1DE7H 4E06H 2FS9A 2G52A 3RXVA 1BBRE 2VB0A 4NFEA 5EGMA 1YBWA 1DXWA 4GHQA 4AGKA 1ESTA 3LOXA 5FHTA 4TWYA 1EP5A 2Z9JA 1GGDC 1A5IA 1S82A 3MNCA 1GL1A 3QN7A 1K9OE 5PTPA 1GI1A 2PKSC 1CGJE 1O2LA 2FOMB 1N6YA 1AU8A 2Q1JA 3KN2A 3W94A 3R3GB 1LKBA 5H4IB 1G2LA 1ZSKA 1PJPA 1UCYK 1GI3A 5DG6A 3M7TA 1OYTH 3UIRA 2FESH 2FYQA 4NCYA 2FX6A 2J92A 4KGAA 4X6PA 1CHOG 2FI3E 3IG6B 4RSPA 3U98H 1GBJA 1SGQE 1TGTA 4XOJA 3PMHB 2G00A 1TFXA 2OXSA 3SJOA 2VIQA 8GCHG 1IQLA 1QIXB 5AHGH 4Y8ZA 2AGIX 2C90B 3BTME 4DVAU 1C2HA 3TLOA 5FBEA 4A5TS 1B7XB 1G2MA 3RMOH 5JBAS 5DJ7A 1XKBC 2AS9A 3HATH 3EA7A 1K28D 3RXGA 3S9AA 1NFYA 3OSYA 3U8RH 4U32A 1GBIA 2WYJA 3RC6A 4Y71A 1HBTH 2R3YA 4JZ1A 3GY8A 1ZSJA 5HGGA 1GI7B 1JIRA 2P16A 2VINA 5JB8S 5K7RA 1SGYE 1HJ9A 2J9NA 3U8OH 1PPFE 5JPMH 1E38B 2GDDA 2ZP0H 3B23B 1HRTH 2H6MA 1P2MA 5J4QA 3SJKA 1WSSH 1GI6A 3URDA 1C9PA 3GCOA 3ZYDA 1ELEE 1CT2E 1EJMA 1SGDE 4BAOB 3P6ZB 1LQEA 4K1EA 2FOEA 1HAGE 1O5BB 1WCZA 4X1NU 2RG3A 1EASA 1GHWH 2QGRA 1L4ZA 1Y3VA 2W26A 4XSKU 3F9EA 3RXTA 4XBBA 2J4IA 1BA8B 1C5MD 3MH7A 1L1GA 4YM9A 1EUFA 4DW2U 2ZFPH 4Y8XA 1TNKA 3MH5A 3Q76A 1C2EA 3MU5A 2SGEE 2A45B 2ZECA 5EW1H 1G30B 1CBWB 1RXPA 2Z3CA 2XTTB 3SU2A 3UFAA 1DWBH 1Y3YA 4H42U 1C5XB 3UWIA 4MLFB 5EXLA 1QA0A 3S7KB 1H9IE 1P06A 1S0RA 1NO9H 1UK4A 2ZTYA 4AFQA 1MKXK 3M37A 3NCLA 3Q77A 3T2NA 3DA9B 1NFUA 1HLTH 1CHOF 1P2QA 2QCYA 1FDPA 4B2BA 2SFAA 2H2ZA 5ESBA 1GHVH 1V2WT 1ZYOA 1TIOA 4D8NA 2Y7ZA 3A84A 4CR5A 8GCHF 4TY6A 3SW2B 2TIOA 2JH0D 1J9CH 1FPHH 1EPTB 1ELTA 1SQAA 2GT8A 1QBOA 1O37A 2XW9A 3AAVA 1GMCF 2J34A 3MO6A 2J38A 1N6XA 4XFQA 1C5UA 1UTOA 1KYNA 2QF0A 2XC5A 1AIXH 1TRNA 3CS7A 1A5HA 1GVKB 4DURA 2GVFA 2OC0A 5JBBS 2A4RA 3RP2A 1SC8U 2VH0A 4X6OA 3SQHE 4GHTA 2ZTXA 4FUGA 1IQFA 1QNJA 1TLDA 3PLKA 2A5KA 1KXEA 4NSYA 4ZXYH 4FXGH 3VFEA 1C1NA 1GI9B 5JDUB 1T8LA 2BY6X 1P2NA 3SGAE 1LHCH 1E36B 3LPRA 1LHEH 2FOAA 2ZO3H 3D23A 4I8JA 1V2TT 3MO9A 1ZMJA 2P94A 4UEHH 2GMTB 2ZGCA 1LTOA 1WUNH 5JYIA 3D65E 1UVTH 2VWLA 1KLJH 1EAUA 2GKVE 3MNBA 2BQ6B 1GJCB 3STIA 3KCGH 3PMJA 4WWYA 1ARCA 1AY6H 2GX4A 3LGIA 4D7GA 1TGNA 1GJ4H 1V2ST 4A6LA 5T6FA 1Z1IA 4HZHA 1O35A 1BRAA 2FOHA 4CRDA 3A88A 4MNWA 1C1VH 1C5SA 1D3TB 1YPKH 1Z8IB 3V7TA 3SO3A 4BOHA 4INKA 3SU3A 3HGPA 2AFQB 3EQ0H 3RMNH 1FIWA 1G3DA 1SQTA 4Y0YE 1MTVA 1LCYA 3RXEA 1ELBA 1TPSA 1P2JA 3A7YA 1O3KA 1O2RA 1YGCH 1FN8A 4YOGA 4F4OC 3URCA 4D76A 2M5TA 5IDKA 2BTCE 3OY5U 1SLWB 2F9VA 1P2KA 4MNXA 3SU1A 1RFNA 1C1PA 1QTFA 5A0CA 2ZHQH 1BQYA 2EI6A 2JH5D 4UFFH 2XXLA 1YPHC 1HAZB 3L33A 4O3UA 1F2SE 3RXCA 1QRXA 3SV9A 2BZ6H 5I25A 2PWXA 1DWDH 2FOBA 1GHBF 1G3EA 3P70B 1QHRB 1MKWH 2PR3A 1C5OH 1NU7B 1EXFA 3SU6A 2QYIA 2FLRH 4WH8A 4CRBA 1DSTA 3A7TA 1XUJA 3ZVFA 2J2UA 4WJG2 3TPIZ 3HKJB 4J1YA 1O2XA 1Z71A 2ZG0H 1QA7A 4YZUA 3RXJA 2W5EA 4OS1A 3A8DA 4WXIA 3Q3YA 1BMAA 1N8OB 2FXRA 1CA0C 1QB9A 1AZ8A 2CMYA 3KQCA 3MH6A 4Y79A 1MTUA 1FJSA 4B2AA 2G5NA 4I8KA 1BT7A 1TX8A 2ZDKA 3NWUA 4WMDA 4NIXA 1P10A 4ABDA 3UOPA 3GCHC 4X1RU 4A1TA 2FEQH 5FX6A 1SGFA 3N7OA 3ZVDA 4JK6A 5CHAC 4XBDA 1GJ8B 3TJOA 2F9BH 5FBIA 1MTNB 5A8ZA 3A87A 3CENA 2A4QA 2WUCA 1DWEH 3M3SA 1SGFG 1FN6A 2P3TB 1L1NA 1J16A 1UCYH 3O8DA 1BTZA 1P02A 4CHAC 3ATLA 2SGDE 1CVWH 4K1SA 3TJUA 2OUAA 1AKSA 2G4UA 1NFWA 1OPHB 2H9TH 1ZHRA 2XYAA 1SGNE 1DLKB 1D9IA 1XVOA 1F0TA 1QJ6B 2GZ7A 3OYPA 1LMWB 3VGCB 3RMLH 2FLBH 4D7FA 5EQSA 2D26C 2R0KA 2P93A 1SHYA 1XXFA 2NU0E 3BF6H 4U30A 2FO9A 1UVPA 4LXBH 2CV3A 1QCPA 3P8OA 1IQJA 2WINI 3F68H 2ZIQH 3HK3B 1UVOA 2AGEX 5FCRA 4BANB 1C2GA 2ANKH 1BUIA 1NC6A 1K1OA 3ODFA 5FXLA 4UFDH 3KHVA 2BVXH 3P8NA 4BNRA 4X2VA 1YKTA 1GBHA 1UTQA 2OC7A 4MTBA 5FPSA 3E1XB 1HAPH 5E2PA 2ZQ1A 5CE1A 1S5SA 1YCPH 1F5KU 2A1DB 1AI8H 1CHGA 4BXSA 1AMHA 2BD5A 3BN9A 1GJ9B 4BTTB 1V6DA 2O8MA 5LH8A 2W7UA 2PSYA 3KL6A 2Y5HA 1GMHG 1HAOH 2VJ1A 1C5RA 1C1QA 2BDCA 4A1XA 3MOCA 2KAIB 1PPHE 3K9XB 3UR9A 1HIAA 2O8TA 1BCUH 2ZTZA 2GCTC 4ZHAA 2R2WU 1JOUB 3TK5A 1KTTB 1FY1A 2FPZA 3NK8A 4WMFA 1IQHA 1A61H 1HPGA 3AW0A 1ANEA 1Y3WA 4E7RG 4NZLA 1TBZH 1BMMH 3EAJA 4R8TB 1NRSH 1TMTH 2ASUB 2Y6TA 5JBCS 1S0QA 3U8TH 3T27A 1FAKH 3RU4D 4DCDA 1NFXA 2HLCA 3RXHA 2PKAA 1BTHH 5A8YA 1MKXH 2A32A 3UTUH 3SJ9A 1KLIH 3LDXH 3H7OA 5ESTE 4Y10E 3BV9B 4NIYA 3SGQE 7KMEH 1XXDA 4YLQH 4X8UH 5ETXA 1WU1A 4HGCA 2F91A 2R0LA 3SU4A 1DT2A 3STJA 3UNQA 2BQ7B 2R3UA 2WYGA 3P92A 3A8BA 1UVUH 3RXAA 1VCWA 2WPIS 4ESTE 1CO7E 2TRMA 2JETB 2Z3EA 1AWFH 1ZGIA 4UDWH 1OWIA 2RA3A 1UVSH 4M7GA 1ELAA 2XWAA 1A7SA 3RM0H 4DOQA 1W2KH 1ZRKA 1YYY1 1SVPA 4A1VA 5B6OA 2ZKSA 2TBSA 3ZZ4A 4XE4A 3Q00A 4NIWA 2JKHA 3EE0B 2QIQA 1A0JA 6CHAC 3MU4A 5F8TA 4WH6A 2QA9E 2GTBA 1GMHF 1D4PB 1VJ9U 2P8OC 4HTCH 3T25A 1MH0A 1O3OA 1AKSB 5GJ4B 1C1UH 1TNLA 5DP4A 1O2VA 3ZZ6A 2BZAA 5E0JA 1EOLA 2J95A 2HALA 1EAXA 1QURH 3FP7E 4LK4A 4JCNA 3T5FH 3VEQB 4ISHH 2B7DH 2ZHEH 1VR1H 1GJAB 1KY9A 4ZAEA 2BD8A 3B8JA 3UUZA 2BHGA 2OC1A 4YLUA 3TH4H 2ZFRH 4CR9A 4CBOA 3SN8A 3E91A 4H6SB 3O8CA 5C20A 3OY6U 5GDSH 4BAHB 2G4TA 4FUBA 5L6NH 1P09A 3CP7A 4B71A 1C1MA 2GGVB 4GLYA 1ELFA 4CBNA 4DIIH 4UONA 2FIRH 1XUGA 4X2XA 5HXFA 1GVLA 9LPRA 1VJAU 2C8WB 2THFB 4FVDA 2GT7A 1G3CA 2EA3A 3SI4H 3UNRA 3SUEA 1O3NA 3ZZ8A 1C5WB 1T4VH 3O8RA 1LQDB 5DK1A 2QY0B 1HIAB 2BDBA 3SBKA 5EG4A 1FI8A 2PGBB 2ZHFH 1XVMA 1P11E 1W12U 3RM2H 2AIQA 1O32A 5EQQA 4NFFA 3LKWA 1LVYA 4OS6A 4E7NA 3M5MA 3MFJA 2F9OA 3TGJE 2UWOA 1CQQA 2BX4A 1W10U 3U9AH 2V6NA 1U6QA 2V0BA 4GAWA 5EOKA 4BAQB 4FU9A 1O39A 2PKAB 1SOZA 2XBWA 1GDUA 3VB6A 3GYMA 3UOUA 1O2MA 2FODA 3U1JB 1ELDE 3DUXH 1Z8GA 4NIVA 3MI4A 1TQ0B 1EZXC 2RDLA 3ATKA 1CA8B 1LPKB 4AB9A 2AEIH 1TMBH 5HMAA 1SGTA 2FWWA 1ZR0A 2HRVA 1WQSA 1TGBA 1TPOA 1LHGH 5A8XA 3I77A 1HV7A 1HCGA 3SNEA 1V2UT 4SGBE 4BXWA 4RKOB 1GG6B 3TJVA 2VGCB 4FUIA 1EQ9A 1MMJN 2XCFA 2OQUA 2ZF0H 1D6WA 1EAIA 3UNSA 1C5NH 1GBFA 1P2OA 4TPIZ 3NXPA 4JMYA 1GI0A 1GMCG 4AFZA 1TNIA 3BG4C 1G3BA 1HB0B 2WPHS 1C1WH 1QL8A 3SNDA 1GHXH 2D8WA 2H5CA 1KTSB 1DITH 1VZQH 1C2LA 2BX3A 2TGPZ 1YCPK 1FZZA 5SGAE 1Y59T 3RXOA 1LDTT 4LOYH 3PTBA 4X8TH 1Y5UT 4Y7BA 1O5CB 1C4Y2 1V2KT 1YPJH 1NT1A 2HNTC 2ODQA 2CN0H 1OX1A 1HJAC 1TX7A 1A0HB 3SV2H 1S81A 1GDQA 2CGAA 5E0GA 3BTQE 3VB5A 4IN1A 4Y7AA 1C2JA 4ZROA 3RXMA 2ZU2A 1RS0A 2SGFE 2Y81A 2O8UA 1D6RA 1GJDB 2FMJA 5C5NA 1KDQA 1ETTH 4TYDA 2ZFSA 2ZGHA 2P59A 4AYYB 2A7HA 2VIPA 3S9CA 3ZZ5A 1P05A 1F5RA 1C2MA 3AASA 4Q7ZA 1FY5A 1AUJA 5GCHG 3UPEA 1RTLA 3ZZ9A 3S7HB 1A4WH 5E8EH 1QRWA 1LVOA 1TABE 2BDAA 3SOSA 2PLXA 1AVGH 1BTPA 5LPEA 4ZHMU 1UTKA 2UUYA 1PPGE 2WV5A 3S69A 1OWEA 4INLA 5A0AE 4Y76A 1DS2E 1OWDA 1GVZA 1FPCH 1FONA 1ZTKA 4THNH 2GD4B 4X8VH 1SGEE 5EODA 1PPEE 2BXUH 2Z9GA 1IQGA 1W7GH 3TK6A 1BRUP 2TGTA 1O3JA 4BAMB 2FTLE 1TNJA 3RLYH 1GHBG 1A0LA 2D2DA 3U1IB 5C5OA 2ZFFH 3AAUA 2ZZUH 1IHTH 3UQVA 4ABIA 1FLEE 2JH6D 3W95A 1GL0E 3LH3A 2FI4E 2WPKS 1BDAA 1ETSH 1SLVB 1L0ZA 2WPJS 5EW2H 2Q6GA 2Y5GA 4GVUA 2HPQH 4GPGA 1SGIB 3H7TA 3Q3KA 2EEKA 1BRCE 4CRFA 2EI7A 4MPWA 2Q6DA 5EU8A 3QDZB 1P12E 1NRQH 3DFJA 1A3EH 1RIWB 1Y3XA 1TWXB 1ZSLA 2QXIA 2OBQA 4DY7B 4FVBA 1V2RT 2XBXA 3SORA 2H9EH 1TBQH 1ARBA 1O3IA 2XRCA 4WF8A 1SSXA 4X1PU 2HWLB 5LPFA 2V35A 1EATA 1HJ8A 2J94A 4FUDA 2VH6A 2CHAB 6LPRA 4I8GA 1YM0A 2ZGXH 1W14U 3MU1A 4OS7A 1XMNB 1P01A 3VB3A 3C27B 1DM4B 4ABBA 1NRNH 3KIDU 2ULLA 3DHKH 2ZWLH 2BD2A 3K2UA 3SNBA 3ZVBA 3MNSA 2OCVB 1CBWC 3BTHE 2WV4A 1KSNA 2QXGA 3ATIA 1V2QT 1E35B 3M61U 1GMDG 1C9TA 1ZJDA 1NROH 4Y6DA 5GCHF 1O38A 3GICB 1P3CA 4U2WA 1OKXA 1JBUH 2IPHA 2C93B 2GZ8A 3SI3H 4K3JA 1MZAA 1C1OA 1SLUB 3GDVA 5F03A 4FUEA 1C1RA 2OQ5A 1HXFH 1NU9A 1LHDH 1SHHB 3I78A 1GBDA 5A09A 5E0HA 1AFQB 2RCEA 2ALVA 3LGVA 2FX4A 3BEFB 2FZZA 1S84A 3IITA 1UHBA 1YLCA 1EPTC 5DP7A 1GJ7B 2ZCLP 1GCTB 1TA2A 3TH3H 2ZEBA 4Q7XA 2BD3A 2VIWA 1WBGB 3S9BA 1K1PA 4FUJA 4Y8YA 1ZLRA 2XWBI 1MAXA 3Q3XA 5JBTA 2NU4E 2BM2A 1TAWA 1KDQB 3ZVGA 4UE7H 1O3PB 4ZXXH 4A92A 3M5NA 1O2KA 1O2QA 1CT0E 1SLXB 3RXUA 3RXLA 1Y8TA 4NA7A 2AH4X 1H4WA 3A81A 4ZMAH 1VITH 1TOCB 4AG2A 1WTHD 4ABFA 2A2QH 4HI3A 2GMTC 1JRTA 5TCCA 1Q2WA 1V2PT
chains in the Genus database with same CATH superfamily
3T29A 2FOCA 3UR6A 1IQNA 3RXDA 1YPGH 3MQKC 2CF9H 4BTUB 4CRCA 1O5DH 1E79D 3F3BA 2VWOA 2GV7A 1TGCA 4CREA 2VVCA 2NU1E 1XKAC 3RXSA 1DOJA 2QXHA 5BPEA 3ZZDA 2C3SA 4YXWD 1GMDF 1OS8A 4OS4A 5FPYA 3MNXA 1P2IA 1NBME 2O9QA 3T26A 1GBKA 3PV2A 1QB1A 1O0DH 2HGTH 1SQOA 1THSH 2HLDD 2PTNA 1QR3E 2TPIZ 1SKYE 1PQ5A 3SNCA 4AORA 3BTGE 2NWNA 3HKIB 3BG8A 4K8YA 1VCPA 4ZH8A 2WPLS 3LGTA 3DSPA 1EX3A 5E2OA 5GNDA 1O2HA 3PLBA 1AO5A 1P8VC 1F0SA 2A7CA 4VGCB 1A5GH 2ZNKH 1BBRH 2K1QA 3EYDA 1AUTC 2AYWA 1W13U 5DP5A 1HYLA 3LT3A 2ZFQH 3QO6A 1O3FA 3KQBA 3F9FA 5DPAA 2BOKA 1KLTA 1MCTA 1W7XH 1UTNA 1V2JT 1YLDA 3SHCH 3GDUA 4FUCA 4AZ2B 5G4BA 3OTJE 1ABJH 1X7AC 4AFSA 2ZHDA 3V0XA 4ABHA 2Z9KA 2EC9H 5C1YA 3RU4T 1CGIE 2J98B 5CHBA 4ZKSU 1S6HA 2ZHWH 5F53A 5L2YH 3ZV9A 4Q80A 2P95A 3SV8A 1O2JA 3ZV8A 3DFLA 2NU2E 2PGQB 3UWJH 1C5VA 1GDNA 1XUIA 3H5CB 3PROA 1PPZA 2A5AA 1JXPA 1N8OC 2CXVA 2DE9A 1J15A 2FTMA 3ZVAA 3TVJB 3QTVH 5DP6A 5GXPA 1XX9A 1PYTD 1TX6A 1TNHA 3O8BA 1EZUC 4ISNA 1HNEE 3A7WA 5EPYA 3BIVH 1BOQA 6CHAB 1VGCB 1O3HA 1BHXF 1XUHA 4E05H 1C5PA 2FOFA 3P17H 5EJ1A 4NSVA 2BLQA 2P3UB 1FMGA 4MQAA 1LVMA 2P3FH 1SI5H 3OFND 1HDTH 1UHBB 1UTMA 1BMFD 8LPRA 3RXQA 1PQ8A 3A82A 1MTNC 3PO1B 1FY8E 1UK2A 1DFPA 1IAUA 2OP9A 4IMZA 5T6GA 2C4FH 1H8DH 1K21H 3SZNA 3E3TA 4ABGA 2Z7FE 1NM6A 3BTEE 3SJ8A 1RTFB 4NWLA 7GCHG 2ANWA 4B75A 2OTVA 4UFGH 1G32B 1AGJA 1DVAH 3LJOA 3V12A 3FP6E 3GDSA 4B74A 2W3IA 3ZIAD 1C5QA 3GYLB 4ZKOU 3GY6A 1ZTJA 2GP9B 2HOBA 1PQAA 3VGCC 3RXFA 1YPMH 2F9UA 1O2NA 1SBWA 4AGJA 1BB0B 5AF9H 1BHXB 1O2SA 3A80A 4ACBA 1CE5A 2BY7X 1O36A 5FX5A 1SQRA 3SJIA 1BTXA 3BIUH 3P95A 4IC6A 5LGOA 2AIPA 1QGFA 1C4U2 5GIBA 3RUOA 1MZDA 1SG8B 1K1NA 1HFDA 5C94A 1F0UA 2QN5T 1IOEA 1FY3A 5F8XA 3MYWA 4LZ4B 4HFPB 5DGJA 3F2HA 3EA8A 2ZU4A 4MVNA 1AB9B 3TNTA 1CT4E 3SV6A 1QJ7B 3QZRA 1BTYA 2PV9B 4DGJA 2G8TA 1AWHB 3NRLA 3QUMP 1TALA 1C4V2 1L2EA 2ZDLA 4KKDA 3M36A 2VIOA 2QC2A 4KTSA 4MPVA 1CSOE 2CJIA 1V2MT 2GV6A 1GGDB 3PMBB 1FX0B 5HM2A 1O2OA 3FFGA 4MPUA 4X0WU 3OU0A 3EDXB 3U69H 3VB4A 2PKSB 1P9UA 1NZQH 1O3AA 4I33A 2UUKB 2HVXA 3E8LA 1XUKA 4O9VA 3RXPA 2KCOA 1G37A 3LC5A 3RDZA 1TQ7B 4R0IA 2HNTF 1YPEH 2ZCKP 1JIMA 2F3CE 2G51A 1EKBB 1Q31A 3FVFB 7GCHF 1K1IA 3L3TA 3D62A 1FIZA 4BTIB 5K0HA 1MQ5A 1XUFA 2YNBA 2XC4A 2IPQX 1SPJA 4KTUA 3ZZ3A 1C5ZB 1UJ1A 1V2VT 4X8SH 4P00A 4H6TA 1KXCA 3KF2A 2ZGBH 1DANH 1MTSA 4JZIA 3WY8A 5C3NA 1OWJA 4CH8B 2B0FA 1P04A 1W0YH 4PROA 3P8FA 2VNTA 1HUTH 5ABWA 1ELCA 1Z8RA 4XDEA 5KEDA 2K0QA 1S6LA 3HK6B 2GDEH 2BDHA 2DE8A 1RJXB 2JETC 4TY7A 1DY8A 1UTLM 1VITG 2BDIA 3ODDA 2Z94A 2ZQ2A 4TPYA 1UCYE 2WPMS 1YPHE 3A86A 1O2TA 2C8XB 1O2ZA 1YP9A 1E0FD 3OEHD 3KYGA 1TNGA 2VVVA 2BLWA 1Z6EA 4GUXA 4KTCA 2DUCA 4MPXA 3QGJA 1ZGVA 3NPSA 3C1KA 4JYVH 4B76A 1C2DA 3F1SB 4LZ1H 4U01A 1BZXE 4Q7YA 1LVBA 3RMMH 4B1TA 1H1BA 3MMGA 5GPIB 3FKSD 1HAHH 1O3CA 2UUJB 1UTPA 1GI8B 4INHA 4X1QU 1GBBA 3QTOH 3AW1A 3LGUA 2XCNA 3RXRA 5HYOA 3RC5A 2VIDA 5C67A 2BQWB 4WXVA 1S85A 5HM9A 3ATMA 3SQEE 4Y0ZE 1MD7A 1S83A 1WV7H 3PYHA 3AK5A 2FI5E 1BBRK 1PYTC 3ATWA 8KME2 2FM2A 1JRSA 3CS0A 3JZ2B 2WUBA 4GCHG 3A85A 2BVRH 3NUMA 5EPNA 1ELVA 1QL9A 3PLPA 4DT7B 3LONA 3ZZBA 2Y82A 1RTKA 4IN2A 4RN6A 2ZU1A 3A89A 3UY9A 1GHZA 1SFIA 5C0UA 3FANA 2B9LA 1FAXA 1GI5A 1O2PA 3LC3A 2VVUA 1ANCA 1UO6A 1OSSA 1A3BH 3FP8E 5C1UA 3ELAH 1TB6H 3KQDA 2YMSB 3LIWA 1KXDA 1N1LA 5AVDA 1SGCA 1PPCE 1Q3XA 3GCNA 1NPMA 2V3HH 5A0BA 4J2YB 1EOJA 1VITF 2Z9IA 4O03A 5HIZA 1MTWA 1ESBA 4NWKA 2AMQA 1L4DA 1NS3A 4WVPE 1MBMA 2FS8A 4ABAA 1ID5H 3TGIE 2GJGA 1EB2A 1AN1E 1OYQA 1ELGA 1ZPZA 2XBVA 5AFZH 4Z0KA 1MQ6A 3BSQA 5T1VA 3ZZCA 1DICA 1JMOH 1O2YA 1GBLA 1MCVA 2CF8H 1E1QD 1KXAA 1B5GH 1LHFH 4IGDA 2UWLA 1SR5C 3S0NA 3PMAB 4H4FA 1TYNA 1NESE 3NKKA 2ODYB 2J97A 2AERH 2NU3E 2BDYA 1GWAA 1J17T 3EE7A 1EJNA 4OGXA 1IHSH 4OS5A 3QK1A 4Z6AH 1QRZA 4JZDH 2ANYA 1INCA 4OGYA 3ZVEA 1J8AA 2BLOA 1O2UA 2QF3A 3MU0A 3TITA 1T8OA 3M7QA 1DX5M 1NN6A 1UK3A 4ZHLU 1GG6C 4ACAA 3D49H 2VGCC 1ZHPA 2ZDVH 4CRGA 3LJJA 1DUAA 3B9FH 1ABIH 4MNYA 3PV4A 3QZQA 1V2OT 1GJBB 4GCHF 1MU8B 1ORFA 3MHWU 1MUEB 4NGAH 3FZZA 2PHBA 1CU1A 1BRBE 1PPBH 4AB8A 2ZDNA 2EY4C 3SU5A 2B5TB 2SGQE 4UFEH 2ZGJA 1C2IA 1ZHMA 4WMEA 5GWZA 4ZKNU 1BTUA 1TBRH 2FOGA 3GY2A 1GI2A 1KIGH 3HPTB 2BY9X 1THRH 3VXFH 3VB7A 1ZZZA 5FAHA 1AQ7A 3TU7H 1NRPH 4AFUA 2PUQH 1O5EH 5EQRA 3UQOA 2A2XH 2A4GA 1EAWA 1O3DA 2Z3DA 4FU7A 2ZPRA 1O34A 3SHAH 1AE5A 2ZU5A 4I31A 3G01A 3LGYA 3KNXA 1FY4A 5DP8A 1Z7KA 2SGPE 1QBVH 2FYRA 2F4LA 1WYKA 4K2YA 3UAIC 1NTPA 4GSOA 1AE8H 2Q6FA 1Z1JA 3GY7A 2OINA 1TMUH 2WV9A 2I6QA 1T32A 3KQEA 1CA0B 1EP6A 1E37B 3LH1A 3SGBE 1TONA 2FDAA 5C17A 1ZOMA 4AX9H 1T31A 3EGKH 2BXTH 2WSSD 1DPOA 5C1XA 3BTTE 1BMNH 1SB1H 4NZQA 4FUHA 4I7YH 3QLPH 4X2WA 3ZVCA 3RC4A 3GCHB 2QE7D 5A2MH 3DD2H 1OP8A 3MO3A 4F55A 4I32A 3GY4A 1DDJA 2A31A 1P3EA 5CHAB 1LKAA 4DJZB 3M7UA 3PM3A 4RI0A 1F5LA 1ZPBA 4I8LA 1Y3UA 3DT0H 1CGHA 5BRRE 3TH2H 1T8NA 1TRMA 4BAKB 1FQ3A 4FETA 4CHAB 5LPRA 1H8IH 1SL3A 2LPRA 4K69A 1GBAA 3QWCH 1V3XA 1WAYB 2KAIA 5EIYA 3F9HA 4X6NA 3MH4A 1WTGH 1LO6A 2A4OA 3TK9A 1GPZA 4K8BA 2IN2A 4ASUD 3EA9A 2BMGB 1QQ4A 4Y11E 2Y7XA 1D3PB 2SNVA 1AHTH 2ZFTA 4ZKRU 4B6EA 5DP3A 1P9SA 2I6SA 2ILNA 4TWWA 1Z6JH 3PV5A 2SGAA 1EZQA 5TCAA 1K1JA 1XM1A 4NA8A 2BB4A 4KELA 2ZI2H 3TGKE 1E1RD 2PSXA 1OWHA 4K5ZA 1RIWC 1ACBE 2C8YB 2GCHG 2FP7B 3MU8A 2KCYA 1FUJA 2XNIA 5T3HA 2F83A 1VCQA 2CHAC 2ZPSA 1Z8JB 2F9PA 1C1TA 5EXNA 3F6UH 1C2FA 1MBQA 4ZUHA 2TGDA 2ZDAH 4JK5A 6ESTA 3GY5A 2ALPA 2BD7A 3SNAA 1QJ1B 2Y80A 3GOVB 5L2ZH 1OP0A 1AVWA 4JYUH 3SV7A 2Z9LA 1SFQB 2GCTB 9ESTA 1BJVA 1EZSC 1SMFE 2BDGA 5J4SA 1BJUA 3A7VA 1QBNA 2O8LA 3JZ1B 3RXIA 3V3MA 2BD9A 4YESB 1O3LA 1O2IA 1V2NT 2UWPA 1IQKA 2JDID 2QV1A 2ZU3A 3BTKE 2IJD1 1FNIA 1O31A 2YOLA 1FV9A 2YNAA 4K60A 2F9NA 1K1MA 1L1JA 2QXJA 3FAOA 1AFQC 3P8GA 1C5YB 3ZZAA 4MNVA 3IWMA 1OP2A 1W8BH 3E16B 1GHAG 1WQVH 1PQ7A 2VWMA 1BITA 3BEIB 3GY3A 1DY9A 4MG3A 1GCTC 1GHYH 1GJ5H 4DIHH 4MDSA 2OLGA 4X2YA 1COWD 1B0FA 2STAE 2ZC9H 1A2CH 2ANMH 1UTJA 3ITIA 3SUDA 2A0QB 1ESAA 1ANBA 5DO4H 4ABEA 4JYTA 2SNWA 2VIVA 5FCKA 5DP9A 1GBEA 4B73A 2AMDA 4YTAA 4ISOA 4CRAA 1NBMD 2A5IA 3AVZA 3A8AA 2QAAA 4WY3A 3TIUA 5TJXA 1FXYA 1HAXB 3M5OA 5L30H 1D3QB 1ZTLA 3UREA 3MWIU 5JB9S 2D1JA 2TGAA 1TPAE 2BD4A 3SUFA 3BTWE 3MTYA 4IW4E 4AN7A 2GCHF 2XNDD 1PFXC 2IJOB 1NY22 1YWUA 1ZMNA 3E6PH 3KGPA 2HNTE 1QQUA 3RU4E 2ZDMA 3L6PA 2G5VA 1O33A 3RXKA 1ZMLA 1OXGA 5DKMA 1BMLA 3H09A 2PTCE 1HAVA 1SGRE 1ANDA 1EB1H 2Z6BD 1DLEA 1K2I1 2P8OB 1OOKB 2B8OH 1RD3B 4NG9H 2PUXB 1AFEH 4AG1A 5CMXH 1WDIA 1SOTA 1W0ZU 1Y5BT 3RLWH 4ISLA 1C5TA 1TOMH 4YT6H 6GCHG 1NRRH 5C0TA 4KP0A 3A7ZA 1ZPCA 3M5LA 7ESTE 4I8HA 1YCPM 1P57B 1O3BA 1A1RA 3GISB 3VPKA 3K6YA 3GCTG 3TJNA 4ASHA 2Y5FA 2VU8E 1E34B 3A8CA 3T28A 1W3CA 1SGPE 1RRKA 3FZDA 1O2WA 4YOJA 4IS5A 4XBCA 3ZYEA 4Q4LA 4O97A 1O5FH 4YO9A 1C2KA 1OWKA 3I29A 5EJLA 1H9LB 2AGGX 3SU0A 1GHAF 5C2ZA 2XBYA 2A7JA 2ZPQA 1AD8H 4B2CA 1O30A 4VGCC 2RA0A 1P0SH 2OK5A 3ZZ7A 1B0EA 3V13A 1D3DB 1GJ6A 1TE0A 2O8WA 3M35A 4X6MA 3E0PB 4CH2B 4AOQA 1O2GH 2PW8H 1UMAH 2OC8A 2KCPA 3VXEH 1V2LT 3ENSB 1MD8A 4D9RA 1MAYA 2V3OH 4YT7H 1YF4A 5F8ZA 1M9UA 4FUFA 2BY5X 1THPB 4Q2KA 1DXPA 1S6FA 7LPRA 1O5GH 2M2AA 3SUGA 1IQEA 3A7XA 5FPTA 1EJAA 4FU8A 2G55A 1KXBA 3OX7U 3PWCA 2F43B 1QFKH 1RGQA 2H5DA 2HPPH 3BEUA 3LGWA 1Y5AT 1H9HE 3PTNA 1QL7A 2C8ZB 3PB1E 4DG4A 4IBLH 1AZZA 2ZA5A 1DSUA 1K22H 8ESTE 2R2MB 3E0NB 2GZ9A 3R0FA 1ZJKA 1ETRH 1VGCC 3CNRA 1GCDA 2PFEA 1G9IE 1T7CA 2H9HA 1ZRBA 1HAYB 3M3TA 1VKYA 4RKJB 1LPZB 1A46H 3TNSA 3PWBA 1O5AB 1O3GA 2ODPA 1C1SA 4IC5A 2ESTE 1WOFA 2IOTA 2G81E 3PO1C 1O3MA 5AFYH 1MU6B 4QT8C 5T6DA 3A83A 4A7IB 1QZ8A 4F49A 6GCHF 1DWCH 2BLVA 4ZCNA 2XC0A 1TPPA 4D9QA 2BOHB 2H1UA 1KXFA 1QB6A 2L74A 3F9GA 3K6ZA 4YOIA 5F6MA 2UUFB 2W7SA 3K65B 1F92A 1GI4A 2EI8A 2OD3B 1YC0A 2BVSH 1GBTA 2VWNA 2W3KA 3GCTF 3WW7A 2STBE 1F0RA 3LU9B 2OBOA 2BYAX 4X1SU 2ZCHP 5EXMA 3E90B 4K1TA 1DUEA 4O3TA 4AYVB 1F7ZA 2R9PA 1GBCA 1P03A 4OM9A 1TGSZ 4SGAE 2BY8X 1BTWA 3T62A 5I46H 1LPGB 3BG4B 3QX5H 3ESTA 4JZFH 1TA6A 4ISIH 1MKWK 1BIOA 1TRYA 1J14A 4IMQA 1QY6A 1HGTH 3NZIA 2LNCA 1YPLH 1T8MA 1W11U 1HAIH 1HAVB 5IYTA 1IQIA 1T4UH 4JZEH 1JWTA 4OS2A 1O3EA 2QF5A 1AVXA 3HGNA 3M3VA 1IQMA 4NA9H 1HJAB 3BTDE 1HXEH 4UD9H 3DSOA 3KEEA 1G36A 1AB9C 1EPTA 1K1LA 1GBMA 3BTFE 3QGNB 3RXBA 2V3MA 2AMPA 1C5LH 4ABJA 1DE7H 4E06H 2FS9A 2G52A 3RXVA 1BBRE 2VB0A 4NFEA 5EGMA 1YBWA 1DXWA 4GHQA 4AGKA 1ESTA 3LOXA 5FHTA 4TWYA 3FOAA 1EP5A 2Z9JA 1GGDC 1A5IA 1S82A 3MNCA 1GL1A 3QN7A 1K9OE 5PTPA 1GI1A 2PKSC 1CGJE 1O2LA 2KR7A 2FOMB 1N6YA 1AU8A 2Q1JA 3KN2A 3W94A 3R3GB 1LKBA 5H4IB 1G2LA 1ZSKA 1PJPA 1UCYK 1GI3A 3OEED 5DG6A 3M7TA 1OYTH 3UIRA 2FESH 2FYQA 4NCYA 2FX6A 2J92A 4KGAA 4X6PA 1CHOG 2FI3E 3IG6B 4RSPA 3U98H 1GBJA 1SGQE 1TGTA 4XOJA 3PMHB 2G00A 1TFXA 3U28C 1K0HA 4XD7D 2OXSA 3SJOA 2VIQA 8GCHG 1IQLA 1QIXB 5AHGH 4Y8ZA 2AGIX 2C90B 3BTME 4DVAU 1C2HA 3TLOA 5FBEA 4A5TS 4XRNA 1B7XB 1G2MA 3RMOH 5JBAS 5DJ7A 1XKBC 2AS9A 3HATH 3EA7A 1K28D 3RXGA 3S9AA 1NFYA 3OSYA 3U8RH 4U32A 3OE7D 1GBIA 2WYJA 3RC6A 4Y71A 1HBTH 2R3YA 4JZ1A 3GY8A 1ZSJA 5HGGA 2KCAA 1GI7B 1JIRA 2P16A 2AHME 2VINA 5JB8S 5K7RA 1SGYE 1HJ9A 2J9NA 3U8OH 1PPFE 5CDFE 5JPMH 1E38B 2GDDA 2ZP0H 3B23B 1HRTH 2H6MA 1P2MA 5J4QA 3SJKA 1WSSH 1GI6A 3URDA 1C9PA 3GCOA 3ZYDA 1ELEE 1CT2E 1EJMA 1SGDE 4BAOB 3P6ZB 1LQEA 4K1EA 2FOEA 1HAGE 1O5BB 1WCZA 4X1NU 2RG3A 1EASA 1GHWH 2QGRA 1L4ZA 1Y3VA 2W26A 4XSKU 3F9EA 3RXTA 4XBBA 2J4IA 4AC9A 1BA8B 1C5MD 3MH7A 1L1GA 4YM9A 1EUFA 4DW2U 2ZFPH 4Y8XA 2JJ1D 1TNKA 3MH5A 3Q76A 1C2EA 3MU5A 2SGEE 2A45B 2ZECA 5EW1H 1G30B 1CBWB 1RXPA 2Z3CA 2XTTB 3SU2A 3UFAA 1DWBH 1Y3YA 4H42U 1C5XB 3UWIA 4MLFB 5EXLA 1QA0A 3S7KB 2LELA 1H9IE 1P06A 1S0RA 1NO9H 1UK4A 2ZTYA 4AFQA 1MKXK 3M37A 3NCLA 3Q77A 3T2NA 3DA9B 1NFUA 1HLTH 1CHOF 1P2QA 2QCYA 1FDPA 4B2BA 2SFAA 2H2ZA 5ESBA 1GHVH 1V2WT 1ZYOA 3DCLA 1TIOA 4D8NA 2Y7ZA 3A84A 4CR5A 8GCHF 4TY6A 3SW2B 2TIOA 2JH0D 4TSFD 1J9CH 1FPHH 1EPTB 1ELTA 1SQAA 2GT8A 1OHHD 1QBOA 1O37A 2XW9A 3AAVA 1GMCF 2J34A 3MO6A 2J38A 1N6XA 4RT0A 1C5UA 4XFQA 1UTOA 1KYNA 2QF0A 2XC5A 1AIXH 1TRNA 3CS7A 1A5HA 1GVKB 4DURA 2GVFA 2OC0A 2YMSC 5JBBS 2A4RA 3RP2A 1SC8U 2VH0A 4X6OA 3SQHE 4GHTA 2ZTXA 4FUGA 1IQFA 1QNJA 1TLDA 3PLKA 2A5KA 1KXEA 4NSYA 4ZXYH 4FXGH 3VFEA 1C1NA 1GI9B 5JDUB 1T8LA 2BY6X 1P2NA 2K8IA 1LHCH 3SGAE 1E36B 3LPRA 1LHEH 2FOAA 2ZO3H 3D23A 4I8JA 1V2TT 3MO9A 1ZMJA 2P94A 4UEHH 2GMTB 4Z1MD 2ZGCA 1LTOA 1WUNH 2HVYB 5JYIA 3D65E 1UVTH 2VWLA 1KLJH 1EAUA 2GKVE 3MNBA 2BQ6B 1GJCB 3STIA 3KCGH 3PMJA 4WWYA 1ARCA 1AY6H 2GX4A 3LGIA 4D7GA 1TGNA 3F2GA 1GJ4H 1V2ST 4A6LA 5T6FA 1Z1IA 4HZHA 1O35A 1BRAA 2FOHA 3FN8A 4CRDA 3A88A 4MNWA 1C1VH 1C5SA 1D3TB 1YPKH 1Z8IB 3V7TA 3SO3A 4BOHA 4INKA 4I86A 3SU3A 3HGPA 2AFQB 3EQ0H 3RMNH 1FIWA 1G3DA 1SQTA 3FO8D 1MTVA 1LCYA 4Y0YE 1ELBA 1TPSA 3RXEA 1P2JA 4P02A 3A7YA 1O3KA 1O2RA 1YGCH 1FN8A 4YOGA 4F4OC 3URCA 4D76A 2M5TA 5IDKA 3OAAD 3DSGA 2BTCE 3OY5U 1SLWB 2F9VA 1P2KA 4MNXA 3SU1A 1RFNA 1C1PA 1UW7A 1QTFA 5A0CA 2ZHQH 1BQYA 2EI6A 2JH5D 4UFFH 2XXLA 1YPHC 1HAZB 3L33A 4O3UA 1F2SE 3RXCA 1QRXA 3SV9A 2BZ6H 5I25A 2PWXA 1DWDH 2FOBA 1GHBF 1G3EA 3P70B 1QHRB 1MKWH 2PR3A 1C5OH 3N7EA 1NU7B 1EXFA 3SU6A 2QYIA 2FLRH 4WH8A 4CRBA 1DSTA 1MABB 3A7TA 1XUJA 3ZVFA 2J2UA 4WJG2 3TPIZ 3HKJB 4J1YA 1O2XA 1Z71A 2ZG0H 1QA7A 4YZUA 3RXJA 2W5EA 4OS1A 3A8DA 4WXIA 3Q3YA 1BMAA 1N8OB 2FXRA 1CA0C 1QB9A 1AZ8A 2CMYA 3KQCA 5KGOA 3MH6A 4Y79A 1MTUA 1FJSA 4B2AA 2G5NA 4I8KA 1BT7A 1TX8A 2ZDKA 3NWUA 4WMDA 4NIXA 1P10A 4ABDA 3UOPA 3GCHC 4X1RU 4A1TA 2FEQH 5FX6A 1SGFA 3N7OA 3ZVDA 5HIYA 4JK6A 5CHAC 4XBDA 1GJ8B 3TJOA 2F9BH 5FBIA 1MTNB 5A8ZA 3A87A 3CENA 2A4QA 4TT3D 2WUCA 1DWEH 3M3SA 1SGFG 1FN6A 2P3TB 1L1NA 1J16A 1UCYH 3O8DA 1BTZA 1P02A 4CHAC 3ATLA 2SGDE 1CVWH 4K1SA 3TJUA 2OUAA 1AKSA 2G4UA 1NFWA 1OPHB 2H9TH 1ZHRA 2XYAA 5DN6D 1SGNE 1DLKB 2JIZD 1D9IA 1XVOA 1F0TA 1QJ6B 2J5UA 2GZ7A 3OYPA 1LMWB 3VGCB 3RMLH 2FLBH 4D7FA 5EQSA 2D26C 2R0KA 1H8HD 2P93A 2W6ID 1SHYA 1XXFA 2NU0E 3BF6H 4U30A 2FO9A 1UVPA 4LXBH 2CV3A 1QCPA 3P8OA 1IQJA 2WINI 3F68H 2ZIQH 3HK3B 1UVOA 2AGEX 5FCRA 4BANB 1C2GA 2ANKH 1BUIA 1NC6A 1K1OA 3ODFA 5FXLA 4UFDH 3KHVA 2BVXH 3P8NA 4BNRA 4X2VA 1YKTA 1GBHA 1UTQA 2OC7A 4MTBA 5FPSA 3E1XB 1HAPH 5E2PA 2ZQ1A 5CE1A 1S5SA 1YCPH 1F5KU 2A1DB 1AI8H 1CHGA 4BXSA 1AMHA 2BD5A 3BN9A 1GJ9B 2VBCA 4BTTB 1V6DA 2O8MA 5HKKD 5LH8A 2W7UA 2PSYA 3KL6A 2Y5HA 1GMHG 1HAOH 2VJ1A 1C5RA 4RT1A 1C1QA 2BDCA 4A1XA 3MOCA 2KAIB 1PPHE 3K9XB 3UR9A 1HIAA 2O8TA 1BCUH 2ZTZA 2GCTC 4ZHAA 3F0PA 2R2WU 2JJ2D 1JOUB 3TK5A 1KTTB 1FY1A 2FPZA 3NK8A 4WMFA 1IQHA 1A61H 1HPGA 3AW0A 1ANEA 1Y3WA 2EQNA 4E7RG 4NZLA 1TBZH 1BMMH 3EAJA 4R8TB 1NRSH 1W0JD 1TMTH 2ASUB 2Y6TA 5JBCS 1S0QA 3U8TH 3T27A 1FAKH 3RU4D 4DCDA 3PRDA 2PP6A 1NFXA 2HLCA 1KMHB 3SZEA 3RXHA 2PKAA 1BTHH 5A8YA 1MKXH 2A32A 3UTUH 3SJ9A 1KLIH 3LDXH 3H7OA 5ESTE 4Y10E 3PRBA 3BV9B 4NIYA 3SGQE 7KMEH 1XXDA 4YLQH 3N99A 2XOKD 4X8UH 5ETXA 1WU1A 4HGCA 2F91A 2R0LA 3SU4A 1DT2A 3STJA 3UNQA 2BQ7B 2R3UA 2WYGA 3P92A 3A8BA 4F48B 1UVUH 3RXAA 1VCWA 2WPIS 4ESTE 1CO7E 2TRMA 2JETB 2Z3EA 3W1EA 1AWFH 1ZGIA 4UDWH 1OWIA 2RA3A 1UVSH 4M7GA 1ELAA 2XWAA 1A7SA 3RM0H 4DOQA 1W2KH 1ZRKA 1YYY1 1SVPA 4A1VA 5B6OA 2ZKSA 2TBSA 3ZZ4A 4XE4A 3GS9A 3Q00A 2KM0A 4NIWA 2JKHA 2WHXA 2QIQA 1A0JA 3EE0B 5IK2D 6CHAC 3MU4A 5F8TA 4WH6A 2QA9E 2GTBA 1GMHF 1D4PB 1VJ9U 2P8OC 4HTCH 3T25A 1MH0A 1O3OA 1AKSB 5B6LA 5GJ4B 1C1UH 1TNLA 5DP4A 1O2VA 2QF4A 3ZZ6A 2BZAA 5E0JA 1EOLA 2KZ4A 2J95A 2HALA 2YMSD 1EAXA 3SYJA 1QURH 3FP7E 4LK4A 4JCNA 3T5FH 3VEQB 4ISHH 2B7DH 2ZHEH 1VR1H 1GJAB 1KY9A 4ZAEA 2BD8A 3B8JA 3UUZA 2BHGA 2OC1A 4YLUA 3TH4H 2ZFRH 4CR9A 4CBOA 3SN8A 3E91A 4H6SB 3O8CA 5C20A 3OY6U 5GDSH 4BAHB 2G4TA 4FUBA 5L6NH 1P09A 3CP7A 2CK3D 4B71A 1C1MA 2GGVB 4GLYA 1ELFA 4CBNA 4DIIH 4UONA 2FIRH 1XUGA 4X2XA 5HXFA 1GVLA 2RDEA 9LPRA 1YY3A 1VJAU 2C8WB 2THFB 4FVDA 2GT7A 1G3CA 2EA3A 3SI4H 3UNRA 3SUEA 1O3NA 3ZZ8A 2LP6A 1C5WB 1T4VH 3O8RA 1LQDB 5DK1A 2QY0B 1HIAB 2BDBA 3SBKA 4FOUC 5EG4A 1FI8A 2PGBB 2ZHFH 1XVMA 1P11E 1W12U 2KFWA 3RM2H 2AIQA 1O32A 5EQQA 4NFFA 3LKWA 1LVYA 4OS6A 4E7NA 1W0KD 3M5MA 3MFJA 2F9OA 3TGJE 2UWOA 1CQQA 2BX4A 1W10U 3U9AH 1YLNA 2V6NA 1U6QA 2V0BA 4GAWA 5EOKA 4BAQB 4FU9A 1O39A 2PKAB 1SOZA 2XBWA 1GDUA 3VB6A 3GYMA 3UOUA 1O2MA 2FODA 3U1JB 1ELDE 3DUXH 1Z8GA 4NIVA 3MI4A 1TQ0B 1EZXC 2RDLA 3ATKA 1CA8B 1LPKB 4AB9A 2AEIH 1TMBH 5HMAA 1SGTA 2FWWA 1ZR0A 2HRVA 1WQSA 1TGBA 1TPOA 1LHGH 5A8XA 3I77A 1HV7A 1HCGA 3SNEA 1V2UT 4SGBE 4BXWA 4RKOB 1GG6B 3TJVA 3VG8A 2VGCB 4FUIA 1EQ9A 1MMJN 2XCFA 2OQUA 2ZF0H 1D6WA 1EAIA 3UNSA 1C5NH 1GBFA 1P2OA 4TPIZ 3F0OA 3NXPA 4JMYA 5DSFA 1GI0A 1GMCG 4AFZA 1TNIA 3BG4C 1G3BA 3WWFA 1HB0B 2WPHS 1C1WH 1QL8A 3SNDA 1GHXH 2D8WA 2H5CA 1KTSB 1DITH 1VZQH 1C2LA 2WZQA 2BX3A 2TGPZ 1YCPK 1FZZA 5SGAE 3UB0A 1Y59T 3RXOA 1LDTT 4LOYH 4HG6A 3PTBA 4X8TH 1Y5UT 4Y7BA 1O5CB 1C4Y2 1V2KT 1YPJH 1NT1A 4M9FA 2HNTC 2ODQA 2CN0H 1OX1A 1HJAC 1TX7A 1A0HB 3SV2H 1S81A 1GDQA 2CGAA 5E0GA 3BTQE 3VB5A 4IN1A 4Y7AA 1C2JA 4ZROA 3RXMA 2ZU2A 1RS0A 2SGFE 2Y81A 2V7QD 2O8UA 1D6RA 1GJDB 2FMJA 5C5NA 1KDQA 5KECA 1ETTH 4TYDA 2ZFSA 2ZGHA 2P59A 4AYYB 2A7HA 2VIPA 3S9CA 3ZZ5A 1P05A 1F5RA 1C2MA 3AASA 4Q7ZA 1FY5A 1AUJA 5GCHG 3UPEA 1RTLA 3ZZ9A 3S7HB 5FL7D 1A4WH 5E8EH 1QRWA 1LVOA 1TABE 2BDAA 3SOSA 2PLXA 1AVGH 1BTPA 5LPEA 4ZHMU 1UTKA 2UUYA 1PPGE 2WV5A 3S69A 1OWEA 4INLA 5A0AE 4Y76A 1DS2E 1OWDA 1GVZA 1FPCH 1FONA 1ZTKA 4THNH 2GD4B 4X8VH 1SGEE 2KX4A 5EODA 1PPEE 2BXUH 2Z9GA 1IQGA 1WXRA 1W7GH 3TK6A 1BRUP 2TGTA 1O3JA 4BAMB 2FTLE 1TNJA 3RLYH 1GHBG 4Q63A 1A0LA 2D2DA 3U1IB 5C5OA 2ZFFH 3AAUA 2ZZUH 1IHTH 3UQVA 4ABIA 1FLEE 2JH6D 3W95A 1GL0E 3LH3A 2FI4E 2WPKS 1BDAA 1ETSH 1SLVB 1L0ZA 2WPJS 5EW2H 2Q6GA 2Y5GA 4GVUA 2HPQH 4GPGA 1SGIB 3H7TA 3Q3KA 2EEKA 1BRCE 4CRFA 2EI7A 4MPWA 2Q6DA 3N7DA 5EU8A 3QDZB 1P12E 1NRQH 3DFJA 1A3EH 1RIWB 1Y3XA 1TWXB 1ZSLA 2QXIA 2OBQA 4DY7B 4FVBA 1V2RT 2XBXA 3SORA 2H9EH 1TBQH 1ARBA 1O3IA 2XRCA 4WF8A 1SSXA 4X1PU 2HWLB 5LPFA 2V35A 1EATA 1HJ8A 2J94A 4FUDA 2VH6A 2CHAB 6LPRA 4I8GA 1YM0A 2ZGXH 1W14U 3MU1A 4OS7A 1XMNB 1EFRD 1P01A 3VB3A 3C27B 1DM4B 4ABBA 1NRNH 3KIDU 2ULLA 3DHKH 2ZWLH 2BD2A 3K2UA 3SNBA 3ZVBA 2J98A 3MNSA 2OCVB 1CBWC 3BTHE 2WV4A 1KSNA 2QXGA 3ATIA 1V2QT 4B6FA 1E35B 3M61U 1GMDG 1C9TA 1ZJDA 1NROH 4Y6DA 5GCHF 1O38A 3GICB 1P3CA 4U2WA 1OKXA 1JBUH 2IPHA 2C93B 2GZ8A 3SI3H 4K3JA 1MZAA 5EJZA 1C1OA 1SLUB 3GDVA 5F03A 4FUEA 1C1RA 2OQ5A 2WPDD 1HXFH 1NU9A 1LHDH 3OTPA 1SHHB 3I78A 4DT4A 1GBDA 5A09A 5E0HA 1AFQB 2RCEA 2ALVA 1H8ED 3KYFA 3LGVA 2FX4A 3BEFB 2FZZA 1S84A 3IITA 1UHBA 1YLCA 1EPTC 5DP7A 1GJ7B 2ZCLP 1GCTB 1TA2A 3TH3H 2ZEBA 4Q7XA 2BD3A 2VIWA 1WBGB 3WWBA 3S9BA 1K1PA 4FUJA 2L6OA 4Y8YA 1ZLRA 2XWBI 3F2FA 1MAXA 3Q3XA 5JBTA 2NU4E 2BM2A 1TAWA 1KDQB 3ZVGA 4UE7H 1O3PB 4ZXXH 4A92A 3M5NA 1O2KA 1O2QA 1CT0E 2RFKC 1SLXB 3RXUA 3RXLA 1Y8TA 2W6JD 2AH4X 4NA7A 1H4WA 3A81A 4ZMAH 1VITH 1TOCB 4AG2A 1WTHD 4ABFA 2A2QH 4HI3A 2GMTC 3KQ5A 1JRTA 5TCCA 1Q2WA 1V2PT
chains in the Genus database with same CATH topology
3T29A 2FOCA 3UR6A 1IQNA 3RXDA 1YPGH 2CF9H 4BTUB 4CRCA 1O5DH 2VWOA 2GV7A 1TGCA 4CREA 2VVCA 2NU1E 1XKAC 3RXSA 1DOJA 2QXHA 5BPEA 3ZZDA 2C3SA 1GMDF 1OS8A 4OS4A 5FPYA 3MNXA 1P2IA 2O9QA 3T26A 1GBKA 1QB1A 1O0DH 2HGTH 1SQOA 1THSH 2PTNA 1QR3E 2TPIZ 1PQ5A 3SNCA 4AORA 3BTGE 2NWNA 3HKIB 3BG8A 4K8YA 1VCPA 4ZH8A 2WPLS 3LGTA 1EX3A 5E2OA 1O2HA 3PLBA 1AO5A 1P8VC 1F0SA 2A7CA 4VGCB 1A5GH 2ZNKH 1BBRH 2K1QA 3EYDA 1AUTC 2AYWA 1W13U 5DP5A 1HYLA 3LT3A 2ZFQH 3QO6A 1O3FA 3KQBA 3F9FA 5DPAA 2BOKA 1KLTA 1MCTA 1W7XH 1UTNA 1V2JT 1YLDA 3SHCH 3GDUA 4FUCA 4AZ2B 5G4BA 3OTJE 1ABJH 1X7AC 4AFSA 2ZHDA 3V0XA 4ABHA 2Z9KA 2EC9H 5C1YA 3RU4T 1CGIE 4ZKSU 1S6HA 2ZHWH 5L2YH 3ZV9A 4Q80A 2P95A 3SV8A 1O2JA 3ZV8A 3DFLA 2NU2E 2PGQB 3UWJH 1C5VA 1GDNA 1XUIA 3H5CB 3PROA 1PPZA 2A5AA 1JXPA 1N8OC 2CXVA 2DE9A 1J15A 2FTMA 3ZVAA 3TVJB 3QTVH 5DP6A 5GXPA 1XX9A 1PYTD 1TX6A 1TNHA 3O8BA 1EZUC 4ISNA 1HNEE 3A7WA 5EPYA 3BIVH 1BOQA 6CHAB 1VGCB 1O3HA 1BHXF 1XUHA 4E05H 1C5PA 2FOFA 3P17H 4NSVA 2BLQA 2P3UB 1FMGA 4MQAA 1LVMA 2P3FH 1SI5H 1HDTH 1UHBB 1UTMA 8LPRA 3RXQA 1PQ8A 3A82A 1MTNC 3PO1B 1FY8E 1UK2A 1DFPA 1IAUA 2OP9A 4IMZA 5T6GA 2C4FH 1H8DH 1K21H 3SZNA 3E3TA 4ABGA 2Z7FE 1NM6A 3BTEE 3SJ8A 1RTFB 4NWLA 7GCHG 2ANWA 4B75A 2OTVA 4UFGH 1G32B 1AGJA 1DVAH 3LJOA 3V12A 3FP6E 3GDSA 4B74A 2W3IA 1C5QA 3GYLB 4ZKOU 3GY6A 1ZTJA 2GP9B 2HOBA 1PQAA 3VGCC 3RXFA 1YPMH 2F9UA 1O2NA 1SBWA 4AGJA 1BB0B 5AF9H 1BHXB 1O2SA 3A80A 1CE5A 2BY7X 1O36A 5FX5A 3SJIA 1BTXA 3BIUH 3P95A 4IC6A 5LGOA 2AIPA 1QGFA 1C4U2 5GIBA 3RUOA 1MZDA 1SG8B 1K1NA 1HFDA 1F0UA 2QN5T 1IOEA 1FY3A 5F8XA 3MYWA 4LZ4B 4HFPB 5DGJA 3EA8A 2ZU4A 4MVNA 1AB9B 3TNTA 1CT4E 3SV6A 1QJ7B 3QZRA 1BTYA 2PV9B 4DGJA 2G8TA 1AWHB 3QUMP 1TALA 1C4V2 1L2EA 2ZDLA 4KKDA 3M36A 2VIOA 2QC2A 4KTSA 4MPVA 1CSOE 2CJIA 1V2MT 2GV6A 1GGDB 3PMBB 5HM2A 1O2OA 3FFGA 4MPUA 4X0WU 3OU0A 3EDXB 3U69H 3VB4A 2PKSB 1P9UA 1NZQH 1O3AA 4I33A 2UUKB 2HVXA 3E8LA 1XUKA 4O9VA 3RXPA 1G37A 3LC5A 3RDZA 1TQ7B 4R0IA 2HNTF 1YPEH 2ZCKP 1JIMA 2F3CE 2G51A 1EKBB 1Q31A 3FVFB 7GCHF 1K1IA 3L3TA 3D62A 1FIZA 4BTIB 5K0HA 1MQ5A 1XUFA 2YNBA 2XC4A 1SPJA 4KTUA 3ZZ3A 1C5ZB 1UJ1A 1V2VT 4X8SH 4H6TA 1KXCA 3KF2A 2ZGBH 1DANH 1MTSA 4JZIA 3WY8A 5C3NA 1OWJA 4CH8B 2B0FA 1P04A 1W0YH 4PROA 3P8FA 2VNTA 1HUTH 5ABWA 1ELCA 1Z8RA 4XDEA 3HK6B 2GDEH 2BDHA 2DE8A 1RJXB 2JETC 4TY7A 1DY8A 1UTLM 1VITG 2BDIA 3ODDA 2Z94A 2ZQ2A 4TPYA 1UCYE 2WPMS 1YPHE 3A86A 1O2TA 2C8XB 1O2ZA 1YP9A 1E0FD 1TNGA 2VVVA 2BLWA 1Z6EA 4GUXA 4KTCA 2DUCA 4MPXA 3QGJA 1ZGVA 3NPSA 3C1KA 4JYVH 4B76A 1C2DA 3F1SB 4LZ1H 4U01A 1BZXE 4Q7YA 1LVBA 3RMMH 4B1TA 1H1BA 3MMGA 5GPIB 1HAHH 1O3CA 2UUJB 1UTPA 1GI8B 4INHA 4X1QU 1GBBA 3QTOH 3AW1A 3LGUA 2XCNA 3RXRA 5HYOA 3RC5A 2VIDA 5C67A 2BQWB 4WXVA 1S85A 5HM9A 3ATMA 3SQEE 4Y0ZE 1MD7A 1S83A 1WV7H 3PYHA 2FI5E 1BBRK 1PYTC 3ATWA 8KME2 2FM2A 1JRSA 3CS0A 3JZ2B 2WUBA 4GCHG 3A85A 2BVRH 3NUMA 5EPNA 1ELVA 1QL9A 3PLPA 4DT7B 3LONA 3ZZBA 2Y82A 1RTKA 4IN2A 4RN6A 2ZU1A 3A89A 3UY9A 1GHZA 1SFIA 3FANA 2B9LA 1FAXA 1GI5A 1O2PA 3LC3A 2VVUA 1ANCA 1UO6A 1OSSA 1A3BH 3FP8E 5C1UA 3ELAH 1TB6H 3KQDA 3LIWA 1KXDA 1N1LA 5AVDA 1SGCA 1PPCE 1Q3XA 3GCNA 1NPMA 2V3HH 5A0BA 4J2YB 1EOJA 1VITF 2Z9IA 4O03A 1MTWA 1ESBA 4NWKA 2AMQA 1L4DA 1NS3A 4WVPE 1MBMA 2FS8A 4ABAA 1ID5H 3TGIE 1EB2A 1AN1E 1OYQA 1ELGA 1ZPZA 2XBVA 5AFZH 4Z0KA 1MQ6A 3BSQA 3ZZCA 1DICA 1JMOH 1O2YA 1GBLA 1MCVA 2CF8H 1KXAA 1B5GH 1LHFH 4IGDA 2UWLA 1SR5C 3S0NA 3PMAB 4H4FA 1TYNA 1NESE 3NKKA 2ODYB 2AERH 2NU3E 2BDYA 1GWAA 1J17T 1EJNA 4OGXA 1IHSH 4OS5A 3QK1A 4Z6AH 1QRZA 4JZDH 2ANYA 1INCA 4OGYA 3ZVEA 1J8AA 2BLOA 1O2UA 2QF3A 3MU0A 3TITA 1T8OA 3M7QA 1DX5M 1NN6A 1UK3A 4ZHLU 1GG6C 3D49H 2VGCC 1ZHPA 2ZDVH 4CRGA 3LJJA 1DUAA 3B9FH 1ABIH 4MNYA 3PV4A 3QZQA 1V2OT 1GJBB 4GCHF 1MU8B 1ORFA 3MHWU 1MUEB 4NGAH 3FZZA 2PHBA 1CU1A 1BRBE 1PPBH 4AB8A 2ZDNA 3SU5A 2B5TB 2SGQE 4UFEH 2ZGJA 1C2IA 1ZHMA 4WMEA 5GWZA 4ZKNU 1BTUA 1TBRH 2FOGA 3GY2A 1GI2A 1KIGH 3HPTB 2BY9X 1THRH 3VXFH 3VB7A 1ZZZA 5FAHA 1AQ7A 3TU7H 1NRPH 4AFUA 2PUQH 1O5EH 5EQRA 3UQOA 2A2XH 2A4GA 1EAWA 1O3DA 2Z3DA 4FU7A 2ZPRA 1O34A 3SHAH 1AE5A 2ZU5A 4I31A 3G01A 3LGYA 3KNXA 1FY4A 5DP8A 1Z7KA 2SGPE 1QBVH 2FYRA 1WYKA 4K2YA 1NTPA 4GSOA 1AE8H 2Q6FA 1Z1JA 3GY7A 2OINA 1TMUH 2I6QA 1T32A 3KQEA 1CA0B 1EP6A 1E37B 3LH1A 3SGBE 1TONA 2FDAA 1ZOMA 4AX9H 1T31A 3EGKH 2BXTH 1DPOA 5C1XA 3BTTE 1BMNH 1SB1H 4NZQA 4FUHA 4I7YH 3QLPH 4X2WA 3ZVCA 3RC4A 3GCHB 5A2MH 3DD2H 1OP8A 3MO3A 4I32A 3GY4A 1DDJA 2A31A 1P3EA 5CHAB 1LKAA 4DJZB 3M7UA 3PM3A 1F5LA 1ZPBA 4I8LA 1Y3UA 3DT0H 1CGHA 5BRRE 3TH2H 1T8NA 1TRMA 4BAKB 1FQ3A 4CHAB 5LPRA 1H8IH 1SL3A 2LPRA 4K69A 1GBAA 3QWCH 1V3XA 1WAYB 2KAIA 3F9HA 4X6NA 3MH4A 1WTGH 1LO6A 2A4OA 3TK9A 1GPZA 4K8BA 2IN2A 3EA9A 2BMGB 1QQ4A 4Y11E 2Y7XA 1D3PB 2SNVA 1AHTH 2ZFTA 4ZKRU 5DP3A 1P9SA 2I6SA 2ILNA 4TWWA 1Z6JH 2SGAA 1EZQA 5TCAA 1K1JA 1XM1A 4NA8A 2BB4A 4KELA 2ZI2H 3TGKE 2PSXA 1OWHA 4K5ZA 1RIWC 1ACBE 2C8YB 2GCHG 2FP7B 3MU8A 1FUJA 2XNIA 5T3HA 2F83A 1VCQA 2CHAC 2ZPSA 1Z8JB 2F9PA 1C1TA 5EXNA 3F6UH 1C2FA 1MBQA 4ZUHA 2TGDA 2ZDAH 4JK5A 6ESTA 3GY5A 2ALPA 2BD7A 3SNAA 1QJ1B 2Y80A 3GOVB 5L2ZH 1OP0A 1AVWA 4JYUH 3SV7A 2Z9LA 1SFQB 2GCTB 9ESTA 1BJVA 1EZSC 1SMFE 2BDGA 5J4SA 1BJUA 3A7VA 1QBNA 2O8LA 3JZ1B 3RXIA 3V3MA 2BD9A 4YESB 1O3LA 1O2IA 1V2NT 2UWPA 1IQKA 2QV1A 2ZU3A 3BTKE 1FNIA 1O31A 2YOLA 1FV9A 2YNAA 4K60A 2F9NA 1K1MA 1L1JA 2QXJA 3FAOA 1AFQC 3P8GA 1C5YB 3ZZAA 4MNVA 3IWMA 1OP2A 1W8BH 3E16B 1GHAG 1WQVH 1PQ7A 2VWMA 1BITA 3BEIB 3GY3A 1DY9A 4MG3A 1GCTC 1GHYH 1GJ5H 4DIHH 4MDSA 2OLGA 4X2YA 1B0FA 2STAE 2ZC9H 1A2CH 2ANMH 1UTJA 3ITIA 3SUDA 2A0QB 1ESAA 1ANBA 5DO4H 4ABEA 4JYTA 2SNWA 2VIVA 5FCKA 5DP9A 1GBEA 4B73A 2AMDA 4YTAA 4ISOA 4CRAA 2A5IA 3AVZA 3A8AA 2QAAA 4WY3A 3TIUA 5TJXA 1FXYA 1HAXB 3M5OA 5L30H 1D3QB 1ZTLA 3UREA 3MWIU 5JB9S 2D1JA 2TGAA 1TPAE 2BD4A 3SUFA 3BTWE 3MTYA 4IW4E 4AN7A 2GCHF 1PFXC 2IJOB 1NY22 1ZMNA 3E6PH 3KGPA 2HNTE 1QQUA 3RU4E 2ZDMA 3L6PA 2G5VA 1O33A 3RXKA 1ZMLA 1OXGA 5DKMA 1BMLA 2PTCE 1HAVA 1SGRE 1ANDA 1EB1H 2Z6BD 1DLEA 1K2I1 2P8OB 1OOKB 2B8OH 1RD3B 4NG9H 2PUXB 1AFEH 4AG1A 5CMXH 1SOTA 1W0ZU 1Y5BT 3RLWH 4ISLA 1C5TA 1TOMH 4YT6H 6GCHG 1NRRH 4KP0A 3A7ZA 1ZPCA 3M5LA 7ESTE 4I8HA 1YCPM 1P57B 1O3BA 1A1RA 3GISB 3VPKA 3K6YA 3GCTG 3TJNA 4ASHA 2Y5FA 2VU8E 1E34B 3A8CA 3T28A 1W3CA 1SGPE 1RRKA 3FZDA 1O2WA 4YOJA 4IS5A 4XBCA 3ZYEA 4O97A 1O5FH 4YO9A 1C2KA 1OWKA 3I29A 1H9LB 2AGGX 3SU0A 1GHAF 5C2ZA 2XBYA 2A7JA 2ZPQA 1AD8H 4B2CA 1O30A 4VGCC 2RA0A 1P0SH 3ZZ7A 1B0EA 3V13A 1D3DB 1GJ6A 1TE0A 2O8WA 3M35A 4X6MA 3E0PB 4CH2B 4AOQA 1O2GH 2PW8H 1UMAH 2OC8A 3VXEH 1V2LT 3ENSB 1MD8A 4D9RA 1MAYA 2V3OH 4YT7H 1YF4A 5F8ZA 1M9UA 4FUFA 2BY5X 1THPB 4Q2KA 1DXPA 1S6FA 7LPRA 1O5GH 3SUGA 1IQEA 3A7XA 5FPTA 1EJAA 4FU8A 2G55A 1KXBA 3OX7U 3PWCA 1QFKH 1RGQA 2H5DA 2HPPH 3BEUA 3LGWA 1Y5AT 1H9HE 3PTNA 1QL7A 2C8ZB 3PB1E 4DG4A 4IBLH 1AZZA 2ZA5A 1DSUA 1K22H 8ESTE 2R2MB 3E0NB 2GZ9A 3R0FA 1ZJKA 1ETRH 1VGCC 1GCDA 2PFEA 1G9IE 1T7CA 2H9HA 1ZRBA 1HAYB 3M3TA 4RKJB 1LPZB 1A46H 3TNSA 3PWBA 1O5AB 1O3GA 2ODPA 1C1SA 4IC5A 2ESTE 1WOFA 2IOTA 2G81E 3PO1C 1O3MA 5AFYH 1MU6B 4QT8C 5T6DA 3A83A 4A7IB 4F49A 6GCHF 1DWCH 2BLVA 2XC0A 1TPPA 4D9QA 2BOHB 2H1UA 1KXFA 1QB6A 3F9GA 3K6ZA 4YOIA 5F6MA 2UUFB 2W7SA 3K65B 1F92A 1GI4A 2EI8A 2OD3B 1YC0A 2BVSH 1GBTA 2VWNA 2W3KA 3GCTF 2STBE 1F0RA 3LU9B 2OBOA 2BYAX 4X1SU 2ZCHP 5EXMA 3E90B 4K1TA 1DUEA 4O3TA 4AYVB 1F7ZA 2R9PA 1GBCA 1P03A 1TGSZ 4SGAE 2BY8X 1BTWA 3T62A 5I46H 1LPGB 3BG4B 3QX5H 3ESTA 4JZFH 1TA6A 4ISIH 1MKWK 1BIOA 1TRYA 1J14A 4IMQA 1QY6A 1HGTH 3NZIA 2LNCA 1YPLH 1T8MA 1W11U 1HAIH 1HAVB 5IYTA 1IQIA 1T4UH 4JZEH 1JWTA 4OS2A 1O3EA 1AVXA 3HGNA 3M3VA 1IQMA 4NA9H 1HJAB 3BTDE 1HXEH 4UD9H 3KEEA 1G36A 1AB9C 1EPTA 1K1LA 1GBMA 3BTFE 3QGNB 3RXBA 2AMPA 1C5LH 4ABJA 1DE7H 4E06H 2FS9A 2G52A 3RXVA 1BBRE 2VB0A 4NFEA 5EGMA 1YBWA 1DXWA 4GHQA 4AGKA 1ESTA 3LOXA 5FHTA 4TWYA 1EP5A 2Z9JA 1GGDC 1A5IA 1S82A 3MNCA 1GL1A 3QN7A 1K9OE 5PTPA 1GI1A 2PKSC 1CGJE 1O2LA 2FOMB 1N6YA 1AU8A 2Q1JA 3KN2A 3W94A 3R3GB 1LKBA 5H4IB