1SGTA

Refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSGAAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Refined crystal structure of Streptomyces griseus trypsin at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase (serine proteinase)
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA02
1HXEH 1MU6B 3A87A 2BD4A 1TOCB 2A31A 4CRAA 1BBRH 1AQ7A 1K1JA 1GI3A 2UUJB 3AAUA 4OGXA 1GHBG 2OC1A 2Z9JA 3KEEA 3P70B 4SGBE 3V12A 1QBOA 1NM6A 5C3NA 2FMJA 2ZA5A 3M37A 1TONA 3SJOA 1MU8B 1P3EA 1ANCA 5GJ4B 5FCRA 2F83A 5L2YH 3E8LA 3SV2H 3T27A 1EQ9A 1AVWA 2ZQ1A 1UK3A 2EA3A 2GCHF 2B7DH 2BY7X 1LQDB 7KMEH 2AIQA 1S6HA 3OSYA 1DXWA 1BMLA 4B71A 4NA7A 3TVJB 5FPYA 1C1TA 1UVUH 3V7TA 1EAUA 3UOPA 2HRVA 3SU6A 1F0SA 2WPMS 5ESBA 1TPPA 3A8DA 1DS2E 4OS4A 7ESTE 3VGCC 4HZHA 5FBEA 4ABBA 5F8TA 2UUFB 1BBRK 1PPGE 1AKSA 3RXJA 3SV9A 5C2ZA 2VNTA 3UQVA 1RJXB 3A83A 2QXJA 4O9VA 1EB1H 1AVXA 1O2SA 3TU7H 1IQKA 4FUDA 2CHAC 3K65B 2IJOB 2OCVB 4A5TS 3LGYA 1Z1IA 1SQOA 4CRCA 1GBAA 4WMDA 2PGQB 1HIAA 2A45B 1ESAA 1PQ5A 3M5NA 3DA9B 5FXLA 1GBMA 3Q3XA 3GDUA 1KXAA 1FXYA 1VCQA 1QRXA 1K2I1 2KAIA 3BTTE 4CR5A 1FIWA 1GDQA 1OSSA 1TBRH 3E3TA 3QUMP 2ZZUH 3MU1A 3IWMA 3TGJE 1SHYA 2Z3DA 6LPRA 1QQUA 5TCCA 1GBTA 3RXGA 1B7XB 2BXUH 4JYTA 3PROA 5E0JA 4RN6A 3PTBA 1IQEA 1GHYH 2B9LA 2OP9A 4UD9H 4ZH8A 2JETB 4WWYA 2DE9A 2H1UA 1XUJA 2SGQE 4UFFH 4F4OC 4FUHA 5I46H 1GI0A 3IG6B 2ZCHP 5F6MA 1V2OT 1TLDA 4UONA 3UFAA 6GCHF 4DCDA 4B74A 2FOGA 1ARBA 4DY7B 2GKVE 2WPLS 1VCPA 4AN7A 1ESTA 3RC4A 5LGOA 2C8XB 4ZMAH 1BTWA 1KXCA 1C5UA 4CRBA 1O37A 4LZ4B 2VVUA 1AO5A 1CA0C 2A32A 2G8TA 2B5TB 1TPOA 3TLOA 1C1MA 1Y3VA 3RDZA 4CHAC 1AN1E 4CH8B 2BD8A 4ABAA 1N6XA 1Z8IB 1CVWH 1C2HA 1H9LB 4D9QA 1C5NH 5TCAA 3NPSA 1GMCF 1T4VH 2HOBA 4B75A 2WYJA 4ISIH 1DE7H 1G36A 4E05H 4XBBA 1XUGA 5FPSA 2ZDNA 1ZJKA 2FODA 1CO7E 1PPCE 1SGNE 4J1YA 1P09A 1BT7A 3U9AH 2GDEH 3A80A 1OPHB 1G3EA 3MYWA 1O3PB 1ZTLA 3RXUA 1O3OA 1O3DA 5FAHA 1P2OA 3TNTA 1YPGH 3WY8A 2FO9A 3GCTF 1O2QA 1IQFA 4WMEA 5C5OA 5HMAA 2FI3E 3V0XA 1OOKB 2FOEA 2PUXB 3A84A 4X1NU 3T26A 3RC6A 4JK6A 2ZDAH 2J2UA 3UNQA 1YPKH 5TJXA 1SG8B 2Z6BD 5AVDA 1CGHA 1JBUH 3R3GB 2GV6A 5T6FA 1INCA 8GCHG 2F9VA 3MHWU 1BIOA 1MKXH 3A7WA 4GLYA 4U30A 3BEFB 1JXPA 4O3TA 1AWHB 1P03A 3UQOA 3EYDA 3LOXA 1O3GA 4KKDA 5DP7A 4B76A 2HWLB 1BRBE 2SGPE 3DFJA 1OS8A 4Z0KA 2OBOA 2ZGBH 3SBKA 3H7TA 3RXSA 2K1QA 1RRKA 5C20A 1ESBA 1IQIA 3B9FH 4B2CA 2QF0A 1O2XA 2IN2A 1A0JA 3RMNH 1BMMH 4K3JA 4NIYA 4YOIA 3F68H 1B0EA 2TGTA 1IQMA 2H6MA 1MD8A 3ZV8A 3H7OA 1BTPA 1HAPH 2G55A 1QB1A 3EDXB 4I33A 5DP4A 1D3QB 3D65E 2BMGB 5J4SA 2WV4A 3STJA 4IW4E 3LJOA 1BRCE 4F49A 5DPAA 5B6OA 1GHWH 3A7TA 3CP7A 3S9BA 1MKXK 3ATKA 2WPKS 3E0PB 4ISHH 5I25A 4BAQB 2FEQH 4TY6A 1L0ZA 3RXPA 3RXLA 1GBHA 2FTLE 1GWAA 1QRWA 1E36B 2O8WA 4FXGH 2FX4A 2VWOA 2PV9B 4AYYB 4ISOA 1N8OC 7GCHG 2ZFPH 2PWXA 1SI5H 4MVNA 2VVCA 4ABFA 4TY7A 3RP2A 3UNRA 1S84A 5G4BA 2EI6A 4NSVA 4YLUA 5T6DA 4WF8A 3U1IB 1TNKA 1YBWA 1P2MA 1XMNB 2C90B 3O8RA 5EQSA 1C5MD 1P04A 1HNEE 1ZRBA 1ZZZA 1BMNH 3ZZ3A 4OGYA 3RU4E 1W12U 1RTKA 4Y0ZE 1G30B 2Y82A 1C5ZB 5FX5A 1F2SE 3ZZAA 4D7GA 1MD7A 3QK1A 1XUHA 3SNEA 1TQ0B 3M5MA 1KXFA 1HCGA 3E16B 2F9PA 4NZLA 4VGCC 2VU8E 4GCHF 2A0QB 2H9HA 2XWBI 2FS9A 1V2QT 2DUCA 3K6YA 1CU1A 4XOJA 1O2WA 3NXPA 2BD9A 2QA9E 3SI3H 2ZWLH 1IAUA 4HI3A 1UTNA 3JZ2B 6ESTA 1O2PA 1CT0E 2Y6TA 4ZXYH 3KNXA 3EQ0H 2P59A 5EOKA 4BXWA 2WYGA 1NROH 5K0HA 3FP8E 1KY9A 2O8LA 1V2VT 1DVAH 1TABE 2M5TA 1P0SH 1V6DA 1MQ6A 3RXIA 1BCUH 2ZU3A 4BAMB 1H1BA 3UNSA 1MUEB 1QTFA 3RLYH 3BTDE 2BOKA 1AZZA 3S7HB 1AE5A 5A09A 1WSSH 4UE7H 3SOSA 3M5LA 3UY9A 1O2KA 1Y5UT 1RIWB 1LHDH 2YOLA 3A8AA 3U1JB 2SGAA 1XXDA 2AFQB 5CHAC 1LPGB 2WINI 1C5XB 1AVGH 2FS8A 4DVAU 1EATA 2Y7ZA 4CREA 1GJAB 2TIOA 1HAXB 4DURA 2BM2A 2O9QA 2P3UB 1K1LA 4Y8YA 1O5BB 2A7JA 1BHXF 3S69A 1SQTA 1ELEE 4JZ1A 1EOJA 1HJ8A 1NFXA 4LK4A 4B2BA 4H6SB 5E0HA 1O5FH 3M61U 1C9PA 2ZQ2A 3PMHB 1SMFE 4ZXXH 3SGQE 1TNIA 1THRH 4O3UA 4Y11E 4ZROA 1GHXH 2NU0E 1GCDA 1P8VC 1RS0A 3K2UA 1O3JA 3HGPA 2ZF0H 3URDA 1CT2E 2C8WB 4K2YA 1VGCC 2WPIS 2GCTC 2TBSA 4CRDA 2G00A 1QQ4A 2Y81A 1V2NT 1YC0A 2V35A 3VB6A 4X6OA 4I32A 3P8OA 1ETRH 3F9HA 1TIOA 4CBOA 4FU9A 1P01A 4MG3A 2SGEE 2ZTZA 1K1IA 4GHTA 3BEUA 4WJG2 3BSQA 1SQAA 1HJAC 4WY3A 3SU1A 1S6FA 3DT0H 1C2DA 2NWNA 1MZDA 4ABDA 1E0FD 1C9TA 4KTUA 2RDLA 2W5EA 5AFZH 1W7XH 1UVOA 2ODYB 4AG2A 1FY4A 2FP7B 5C1UA 2PHBA 3F6UH 3ATMA 5JYIA 1NO9H 1J15A 1UTPA 3OY5U 5A8ZA 3NWUA 1OX1A 1QHRB 1RGQA 3U69H 1XXFA 2QY0B 3Q3YA 4AGJA 1NRRH 2A7HA 4E7NA 2H5DA 3P6ZB 1CA8B 3UR6A 2A4RA 2BQ7B 2G52A 1AB9B 1ZRKA 1EAXA 4INKA 1UVSH 3LGWA 3GISB 3UTUH 1H9IE 2CN0H 3LT3A 2C3SA 4Q7ZA 1P06A 2BVXH 1GDUA 3A7XA 2WPJS 2JH6D 3PYHA 1OP8A 3QN7A 1ELDE 1GI8B 1P2QA 3M3VA 1OWEA 3RXAA 1GHZA 1ZSJA 2FOMB 3BG4B 5GIBA 1GBIA 1DWEH 1MTNC 1KIGH 1JOUB 3DD2H 2J94A 1G3BA 2SFAA 4IN2A 1V2MT 1G32B 5LH8A 1QB9A 2GCHG 3GY4A 1A2CH 1DICA 1HDTH 2EEKA 2C93B 1CHOG 3P95A 1PPBH 2J9NA 4X6NA 2ZEBA 1N1LA 1O36A 4NIWA 1DANH 1NPMA 1SB1H 2ZDMA 4TWWA 1MTVA 1AUJA 1F0RA 3QX5H 2XWAA 2P95A 4FUGA 3MNBA 2EC9H 4DJZB 2C4FH 1DPOA 4BXSA 1Z8JB 3RU4T 1AFQB 1QB6A 3SNAA 1C1OA 3M3TA 1BRUP 1HRTH 2QXGA 3KN2A 1C4U2 2ANWA 2PSYA 5F03A 2Z9GA 1LKAA 3SJ9A 1GI4A 4THNH 1SL3A 1ELVA 1C5QA 4H4FA 1THPB 1TNLA 5IYTA 1QY6A 3I29A 1A61H 5HM2A 1MBMA 4ASHA 3TK9A 1GJ7B 4ISLA 4IGDA 1C5TA 3TNSA 5FPTA 2UWOA 4ZKNU 2R2MB 2FWWA 1FMGA 1XKAC 1LQEA 5JDUB 1BA8B 4J2YB 2GTBA 4A1XA 1B0FA 3MU8A 3VB3A 5FCKA 5IDKA 3E91A 3Q3KA 2A4OA 4FVBA 1A0LA 3ZYDA 4X0WU 2THFB 1TNJA 1QRZA 1K22H 1MKWH 3E90B 5EXNA 1WQSA 1LDTT 2F91A 4DIIH 2WV5A 2I6SA 4IN1A 3KGPA 1Z6EA 2STBE 3SU0A 1P2IA 1SBWA 6CHAC 2VIPA 1Z8GA 4Q7YA 6GCHG 2RA3A 2P8OB 4ABHA 4AOQA 2QYIA 4YZUA 1O5GH 3QTVH 7LPRA 4QT8C 1LO6A 4X1RU 4X2VA 3RXFA 4MNXA 1WU1A 1TMTH 4X6PA 3SQHE 4A92A 1GG6B 4E7RG 1Y5AT 3LDXH 1D3PB 3UUZA 1ID5H 3T62A 4A1VA 4ABGA 1C2LA 1O3EA 3SJKA 4IMQA 1HXFH 4AB8A 3PMJA 4XBDA 1ZMLA 2ODPA 2SNVA 2VH6A 1C2JA 2W3KA 3TJVA 2FOCA 3E1XB 1J8AA 1ETSH 2P94A 2PR3A 1P2KA 1MQ5A 1NRPH 3NKKA 2D26C 2ANKH 2AYWA 2JH0D 1MKWK 1ZTJA 3KQDA 1GMCG 1OWJA 1O2MA 5C67A 1C2FA 2V3OH 5T3HA 3QZRA 2ZDVH 1MZAA 2BY8X 2GZ9A 4A7IB 1O39A 3ZVAA 1NRNH 2GZ7A 3LGIA 2G51A 1GMDF 1LHFH 1BMAA 1TBZH 1ELGA 3RXTA 2R0KA 1BTXA 1C5RA 3PMAB 3EA9A 3P92A 1UTQA 2GMTB 2V6NA 4A1TA 1FAKH 3A8BA 1EOLA 5CE1A 3SUGA 1JWTA 1D3DB 4LXBH 1HBTH 1AFEH 5JBTA 2TGPZ 2FOBA 1VCWA 4JZIA 1EUFA 1O2TA 1RD3B 5JPMH 1ZOMA 3BTME 3G01A 1C5VA 5EU8A 1TPAE 1TRNA 1P02A 5GCHF 3BF6H 1SGEE 2B0FA 3TK5A 4NWLA 3EGKH 3CS7A 1NC6A 3ATLA 2BZ6H 2QGRA 1TYNA 5DK1A 2HPQH 3HK6B 1V2ST 2ZP0H 1Y5BT 1M9UA 1C5PA 2FLRH 2ZU1A 4E06H 1PPFE 1YYY1 3URCA 3QGNB 1O3KA 1A46H 1K1OA 1ZGIA 2FOFA 3TJUA 2W7UA 1DX5M 1Q3XA 3UWJH 1D4PB 1GI2A 1HFDA 1GHVH 1O3CA 3ZVFA 3W94A 4NA9H 4GSOA 5DO4H 3VGCB 2VWLA 4XDEA 4MPUA 3MU4A 1MAXA 1WBGB 1KXBA 2BLVA 1P3CA 2VINA 2ZDLA 3QO6A 3C27B 1HV7A 1JRSA 8ESTE 3GCNA 2FIRH 2OC7A 3CENA 1HYLA 3ESTA 2ZGHA 3KL6A 1QA7A 2ZU2A 4FUBA 2ZHQH 2CHAB 1FAXA 5A8XA 1MCVA 3A82A 1AIXH 4YLQH 3ZVGA 1LVYA 3MMGA 4RKJB 1XUIA 3D62A 1HB0B 3GCHB 2XTTB 2VGCB 1GJBB 3LONA 4R8TB 5JB8S 5ETXA 4JCNA 1A0HB 2P16A 2BLOA 2VIVA 2UWPA 5A2MH 1GMHF 4Y71A 3M35A 4KTCA 2R0LA 5LPFA 1W10U 4I31A 1HAZB 2XBXA 3F1SB 5A0BA 1F0UA 2XC4A 2CGAA 1GJDB 3FVFB 2AERH 1O2UA 4JYVH 1Y59T 2V3HH 4NCYA 4AX9H 4JZEH 4KP0A 3A7ZA 3KQCA 5A0AE 4X2XA 1F92A 1GGDB 2CV3A 1ZGVA 1L4ZA 3VB5A 1ABIH 3FP7E 1EZSC 1MTUA 1VITF 5DP9A 1D6RA 1ELCA 1FLEE 1V2TT 2PKSC 3A89A 2JH5D 2VVVA 4GCHG 1FI8A 3ZVDA 1V2WT 4B2AA 1GJ6A 1SVPA 3FZZA 3S9AA 1O5CB 4Y7BA 1UTLM 4Y8XA 1CBWB 1FONA 1Z71A 1DUEA 3GY2A 3M7QA 2OQ5A 3A8CA 5H4IB 5ABWA 1BB0B 4TPIZ 4XFQA 2SNWA 3PV4A 1OYTH 1HAOH 1O30A 1QCPA 3BTEE 1V2UT 1O2RA 2ALVA 1S0RA 2OC8A 2W3IA 1WAYB 1AE8H 2D8WA 1SFIA 5PTPA 3ZVCA 3A81A 1GBEA 2GZ8A 4BAOB 1TGTA 2RCEA 5HGGA 2AH4X 4ZKOU 5JBAS 1DM4B 3BTGE 3ZZ7A 1ARCA 1HAYB 1SGYE 4UEHH 1FIZA 2PTCE 3TGKE 2O8UA 1GCTB 2VWNA 3RMLH 3UREA 1GJCB 3RLWH 2Q1JA 4I8KA 1LPKB 2OQUA 4OS2A 2HNTF 5EQRA 3BTKE 1YPHC 1FDPA 2BZAA 5F8XA 2EI7A 2HNTC 1PFXC 3MO3A 3SGAE 4AG1A 2ZGJA 4HGCA 1TX8A 4FU8A 2BYAX 1ZTKA 3M3SA 1JMOH 1C5LH 5BPEA 1PQAA 3TH2H 2A2QH 2ASUB 4YM9A 2UUKB 2DE8A 1Y3WA 1VITH 3F9FA 3O8BA 2ZHFH 2ZHEH 4DT7B 8LPRA 3M5OA 1PPEE 1YPLH 2FPZA 1EXFA 1AD8H 1DDJA 3RXQA 1EKBB 1W0YH 3OYPA 1P2JA 3PO1C 1TA6A 1KLIH 1PQ8A 2UUYA 4INHA 1EJMA 1EASA 1SGQE 3SNBA 1UHBB 2ZHWH 1TMUH 1DWDH 1O2OA 1ZHPA 2SGDE 2H2ZA 2BX4A 1O3NA 1D3TB 2BDAA 2VH0A 4I8LA 2ZG0H 3M7TA 4GVUA 1UO6A 2Z3CA 3V3MA 2BDCA 1RTLA 2J4IA 2LPRA 1A3EH 1MBQA 4Y76A 3OY6U 3MNSA 1EPTC 1L2EA 5AF9H 4CRFA 2A5AA 4ZHMU 4PROA 2QCYA 4BAKB 4IC6A 1BQYA 3U8OH 2QV1A 4NFFA 2GD4B 1KTSB 1CQQA 3ZYEA 1LMWB 1IHTH 2R3UA 3LPRA 4U01A 2VIQA 1MAYA 2FESH 5DG6A 1N8OB 3NCLA 3HKJB 5T6GA 3LH3A 2BDBA 2JKHA 1SGTA 1E38B 4D8NA 5GWZA 5EG4A 3TH3H 3VPKA 2A2XH 2A5IA 1NESE 2BQ6B 1TGCA 4YOJA 4OS6A 1YCPM 4KELA 3A85A 1P9SA 1OWKA 2Y5HA 1S81A 1O33A 1SGIB 1WV7H 1OWDA 4K60A 1DY9A 3A86A 3LC5A 3OX7U 4BNRA 1OP0A 1AZ8A 2ZKSA 1HLTH 1XX9A 4B1TA 1K28D 4YT6H 1OWIA 1Y8TA 4VGCB 3PMBB 1ACBE 2ALPA 2ZU5A 8GCHF 1BOQA 2BY6X 2FI5E 1LHCH 1KDQB 4O03A 1E37B 2BLWA 2Q6GA 4K5ZA 3TK6A 2VJ1A 4MDSA 4NGAH 5J4QA 1YPJH 2ZFRH 3BEIB 1J14A 1LPZB 2FOAA 1TRMA 1UHBA 1AMHA 2ZDKA 1FQ3A 2XBVA 2YNAA 3B23B 2A4GA 1GBJA 4CBNA 1QURH 1YGCH 4YO9A 2ZU4A 5L30H 1H4WA 1GI6A 4IMZA 4OS7A 4JYUH 1C1UH 1GI1A 1EZQA 1GBLA 4WVPE 2OINA 5AHGH 2BB4A 3Q00A 4YTAA 1BITA 1O35A 2F9UA 1FV9A 3K6ZA 2Z9LA 1YPHE 1YPEH 3SU2A 2FDAA 3LKWA 1O3LA 3SU3A 5CHAB 1FY8E 1O2HA 3F9GA 3GY8A 2D2DA 5EPNA 2HNTE 1FN8A 3AW0A 2ZTYA 4JZFH 1S83A 2LNCA 1C2MA 1C1QA 4YOGA 1DWBH 2OC0A 3M7UA 1XUFA 1BTUA 2SGFE 1YLCA 1AB9C 1TOMH 2PW8H 3N7OA 4Y79A 1UCYH 1O34A 3SNCA 1O2NA 1K21H 1VJAU 1BHXB 1IHSH 4BTTB 3FZDA 2FX6A 3P8GA 1H8IH 1QL8A 5E2OA 1BUIA 1SC8U 3RXCA 2ZCKP 3BG4C 2BDIA 2AMQA 2F3CE 1C4V2 3UIRA 1ELBA 1QBNA 1VGCB 3I77A 3PLKA 3KF2A 1DUAA 3KHVA 1KDQA 3H5CB 4B73A 1CE5A 2Y5FA 3TITA 3MFJA 1V3XA 1W14U 3ITIA 1RTFB 2ZNKH 2C8YB 4JK5A 2FYRA 1SR5C 4K1TA 3UPEA 1HJAB 4X1PU 2XBYA 2ZCLP 1Y3XA 9ESTA 1XVOA 3T2NA 3W95A 1UCYK 5K7RA 1O2VA 3GICB 3RXHA 3SZNA 1QJ7B 1PYTD 4SGAE 2AGEX 3R0FA 1F5LA 5FHTA 3RXBA 1NS3A 2WUBA 3JZ1B 2RG3A 2RA0A 3ZVEA 1C1VH 1SLUB 2TGAA 2FI4E 3MU5A 1KLTA 2D1JA 2GT8A 1G3CA 2W7SA 1C4Y2 1GBCA 1C5YB 3MH7A 4ISNA 1ELFA 1A4WH 2EI8A 4Y7AA 1C2KA 1DSUA 2BOHB 1WQVH 1J16A 1X7AC 2J34A 2F9NA 3MH4A 5BRRE 1SLXB 2BLQA 4HFPB 1YF4A 2FYQA 3LU9B 1Z8RA 1QNJA 1QA0A 3NUMA 1UVPA 1BJVA 4BTUB 2XNIA 1L4DA 5GCHG 1DXPA 1ETTH 2J92A 2ULLA 3BIUH 2GGVB 1TFXA 2BY5X 2ZFSA 1V2JT 1YM0A 2A1DB 5GPIB 1T31A 1ANDA 3GDSA 5FX6A 2P3TB 1L1GA 1UCYE 4NWKA 1PJPA 1MTNB 1Q2WA 2OD3B 1ZJDA 3RUOA 2BDYA 4OS1A 1T4UH 3GYMA 3HGNA 5FBIA 1TAWA 4X2WA 1GJ8B 2QXHA 2XRCA 4BOHA 2NU3E 3GY6A 3M36A 4XE4A 3MO6A 1MTWA 2ZFTA 4AB9A 2P8OC 2QIQA 4TPYA 1D6WA 2A4QA 4X8VH 2OXSA 1TX6A 4GAWA 1P05A 1V2LT 2A5KA 3K9XB 3KQEA 5LPRA 1T32A 2G4UA 4O97A 1HPGA 1V2KT 3RM2H 4I8JA 2HPPH 2XC5A 3MO9A 3VFEA 3SO3A 4ESTE 1GBKA 2CJIA 1GHAF 1AU8A 2ZC9H 1GPZA 2H9EH 4GPGA 4FVDA 1P12E 4MPVA 3S0NA 1F7ZA 2O8TA 4AZ2B 5HM9A 1B5GH 1NFUA 2XW9A 3SUFA 2HVXA 1ZYOA 1C1PA 5A0CA 4AFZA 2XCNA 1C5WB 2I6QA 5C1YA 4Q80A 1L1NA 3ZZ8A 3DHKH 1NZQH 1PQ7A 3AVZA 3RXMA 1E35B 1V2RT 2GMTC 1PPHE 1JIMA 2ANMH 5EW1H 2AMPA 4U2WA 5DP8A 2FLBH 4UFGH 1NT1A 5C1XA 3QLPH 1TALA 3STIA 3FANA 1WUNH 1QGFA 2A7CA 6CHAB 1FY5A 1DT2A 1VITG 1BDAA 1GL0E 2QF3A 1W7GH 8KME2 4MNVA 5EODA 1CT4E 1ELTA 4MPXA 1O2GH 3HK3B 1GI5A 4X8TH 3PWBA 3GCTG 1C5OH 1KSNA 1SGFA 2ZFQH 3BN9A 4Y6DA 1O3FA 5EXLA 1FPCH 3AW1A 1H9HE 1SGPE 2QAAA 2H5CA 3FAOA 3SW2B 1CHOF 3BG8A 1DSTA 2CMYA 2ZGCA 1S0QA 1YLDA 1O32A 1OWHA 4I8GA 1GVZA 1C1WH 4D76A 1O38A 4DOQA 4YESB 4K1SA 1Y3YA 3MNCA 4X2YA 3MH5A 2JETC 2QN5T 2NU4E 3MH6A 3RU4D 3NK8A 1K1PA 3OTJE 2J95A 5JBCS 1QBVH 2ZGXH 4Q2KA 3I78A 5E0GA 4ABJA 1QFKH 4K8YA 1HAIH 1EJNA 1KLJH 1LVOA 1O2JA 1BZXE 1FN6A 2WUCA 1GJ5H 4LZ1H 3GCHC 1ORFA 2GVFA 2VGCC 1DY8A 3SU5A 1A5HA 2BQWB 4WH8A 4UFEH 4DW2U 3SUEA 1UK2A 2B8OH 3QTOH 3EE0B 2IOTA 5DJ7A 3L3TA 2Z3EA 4Y0YE 1SOZA 1ZSLA 2BX3A 2AGIX 4Z6AH 1A7SA 5GXPA 2ODQA 1AUTC 1SGDE 1RXPA 4R0IA 1BBRE 3Q77A 3CS0A 3KCGH 1LKBA 4X6MA 3BTHE 1YKTA 3T28A 3LIWA 1K9OE 1GGDC 1O31A 1W13U 1W11U 3ZZ6A 2BDGA 3RXVA 2PLXA 3LH1A 2AGGX 2Z9KA 1DITH 1O2LA 3ZVBA 1A5IA 2Z7FE 2WPHS 4WMFA 2Z9IA 4GHQA 1ZR0A 3MTYA 4H6TA 1ZPZA 1GJ4H 1CBWC 1XVMA 1HAHH 1XUKA 2TGDA 3QZQA 2NU2E 3GYLB 3PLBA 2GT7A 1J9CH 1ZMJA 1WOFA 4ABIA 1YP9A 3SNDA 4FUFA 4MLFB 2VWMA 2XBWA 3TJOA 3ELAH 1GHBF 2TPIZ 2Q6DA 3MNXA 1GDNA 2Y7XA 2PFEA 3P8FA 5DP3A 4M7GA 4NIXA 4U32A 4D7FA 1FJSA 1NY22 2FOHA 2GP9B 1T8LA 1EX3A 2BY9X 1SGCA 1O3HA 1OXGA 3TIUA 3ZZCA 5L6NH 2ANYA 1ZHRA 3BTWE 1TQ7B 3D49H 1CA0B 2ZFFH 2ZPRA 1H8DH 4H42U 1GCTC 1OP2A 1QL7A 4WXVA 4CHAB 1NN6A 1T8OA 4FUJA 1C2GA 1FUJA 1GJ9B 5E2PA 3D23A 4DG4A 1GI9B 4XBCA 1DLKB 1FY3A 3PM3A 3BTQE 1TPSA 1D9IA 9LPRA 3SJ8A 4CR9A 3KIDU 2O8MA 1XKBC 2FM2A 1TE0A 1EAWA 2PKSB 1ANBA 2VB0A 1OYQA 1DFPA 1O3BA 1O2IA 3ZZDA 3PTNA 5C5NA 1A5GH 2CF9H 1VJ9U 1J17T 1IQHA 1HAVB 3ZZ9A 3LGUA 3UWIA 1HAGE 3RC5A 3ZZBA 1TRYA 2C8ZB 2BD3A 5DP5A 4INLA 1VZQH 4UDWH 2J38A 2ZIQH 1C1NA 4RKOB 1O3MA 1O2YA 5A8YA 1W0ZU 1G3DA 4TWYA 3U8TH 2VIOA 1GBDA 1EJAA 1TGSZ 3VB4A 1C2EA 3ODDA 4Y8ZA 1DLEA 1GBBA 4WH6A 3SQEE 4ZKRU 2XXLA 4TYDA 1CGJE 1CHGA 3VXEH 1O2ZA 2Y5GA 4MNWA 2R9PA 3PLPA 3T5FH 4X8UH 1MCTA 1TGBA 1YPMH 2BD7A 1BTZA 3SGBE 1O5DH 1THSH 3AASA 1UTKA 4BAHB 4KTSA 1K1MA 2HGTH 1PPZA 2AS9A 2ZTXA 1QL9A 5DP6A 5ESTE 4ZHAA 1AWFH 3QWCH 4BTIB 2ZO3H 1LHGH 4ZKSU 1U6QA 1LVBA 2ZHDA 3S9CA 3GCOA 5EPYA 4FUEA 3SN8A 1P2NA 4Q7XA 2OTVA 3EAJA 1KYNA 1TGNA 4MTBA 1AGJA 5JBBS 2BD2A 2PUQH 3ODFA 3EA7A 1C5SA 1ANEA 3BTFE 3PO1B 1WCZA 4Y10E 2H9TH 1TWXB 2Q6FA 1RIWC 1KTTB 5EXMA 1O3IA 3F9EA 3ZZ4A 1SSXA 1HAVA 3ATWA 2YNBA 3GY5A 1OKXA 4IBLH 2BHGA 5DGJA 3GDVA 3SHAH 3Q76A 2ZI2H 3FFGA 5JB9S 4FUIA 1TNGA 1BRAA 1SGFG 3UOUA 1BTYA 1Y3UA 4NFEA 1ZPCA 3RXOA 1CSOE 1UMAH 1EPTB 4FUCA 5E8EH 1MMJN 3RXEA 4NSYA 2TRMA 3VEQB 2ZPQA 3RM0H 1K1NA 3TPIZ 1SFQB 2AEIH 1LTOA 3O8DA 4IC5A 1UTMA 3A7VA 3RXKA 4IS5A 5GDSH 1N6YA 2W26A 1GVLA 2NU1E 2OBQA 1V2PT 3QDZB 3ENSB 1O5EH 1T8NA 3LGVA 3MI4A 4K8BA 1S5SA 3GOVB 3HATH 1QJ1B 1W8BH 1TX7A 2BVRH 2PSXA 4AFSA 1BJUA 1IQJA 1ZHMA 3A88A 1UJ1A 5EW2H 2GV7A 1DWCH 1ZMNA 4I7YH 4WXIA 4X1QU 2AMDA 3RXRA 1TNHA 1QIXB 1G2LA 4AGKA 2OLGA 3MWIU 2QXIA 1EZXC 5HXFA 1DOJA 3E6PH 1F5RA 4A6LA 1HGTH 1T8MA 4KGAA 3V13A 1XM1A 4XSKU 3SUDA 3LGTA 5EQQA 3PB1E 2XCFA 2OUAA 1P57B 1MH0A 1MTSA 1HJ9A 1FNIA 3IITA 1EAIA 7GCHF 1W3CA 1NU9A 1FZZA 3HPTB 1ZPBA 1F0TA 1GHAG 1SPJA 1G37A 3B8JA 1GI7B 1BTHH 2V0BA 1O5AB 2PTNA 5SGAE 3SV6A 1C1SA 3U8RH 1NFYA 4NA8A 3EA8A 1A1RA 1YCPH 2PKAB 1O3AA 3HKIB 2R3YA 2UWLA 3L6PA 1KXDA 3ZV9A 1AY6H 1AI8H 4AFQA 1EPTA 4ABEA 1TMBH 4HTCH 1NTPA 1Z7KA 2GCTB 4ZAEA 1SGRE 1WTHD 2STAE 2Y80A 2XYAA 3U98H 3DFLA 3C1KA 1IOEA 2Z94A 1NRSH 3P8NA 3T25A 4FU7A 1HUTH 1P9UA 1QJ6B 2F9BH 3OU0A 3KQBA 1JRTA 2F9OA 4K1EA 4CRGA 1ELAA 2CF8H 1VR1H 3O8CA 1AFQC 3QGJA 2HLCA 2G5NA 4LOYH 1EP6A 3T29A 3DUXH 4X1SU 1QR3E 4CH2B 3SV8A 3MU0A 1JIRA 1A3BH 5LPEA 2FTMA 1UK4A 3E0NB 1GMDG 4D9RA 1LCYA 1YCPK 2GDDA 2VIDA 5AFYH 2CXVA 3FP6E 4GUXA 1SLVB 1GVKB 4K69A 3SU4A 1SOTA 1ZSKA 1P11E 4NG9H 1Z6JH 3MOCA 2P93A 4I8HA 3P17H 4OS5A 1CGIE 3NZIA 3GY7A 3SORA 1LHEH 4JZDH 1W2KH 1GBFA 1F5KU 1UTOA 1E34B 3TGIE 4X8SH 1ABJH 1WTGH 1FY1A 1Q31A 3PWCA 3BIVH 3SJIA 1NFWA 1P10A 1UVTH 2VIWA 1TB6H 3ATIA 5EGMA 3LJJA 1O0DH 2ILNA 3UR9A 1UTJA 4AORA 1L1JA 4ZHLU 1PYTC 4NIVA 5CMXH 1IQLA 3AAVA 2BXTH 1NU7B 2PKAA 1RFNA 1EB2A 2IPHA 2FXRA 3L33A 2BTCE 1C1RA 1S82A 3TH4H 2FZZA 1TA2A 2G5VA 4DGJA 3VB7A 3SHCH 1GG6C 4YT7H 2BVSH 1WYKA 4ZUHA 1SLWB 1NRQH 3ZZ5A 1LVMA 2AIPA 1EZUC 2QC2A 2ZPSA 4NZQA 4AFUA 4DIHH 3LC3A 4BANB 1S85A 1G9IE 1EP5A 1G2MA 1AKSB 1SHHB 3GY3A 2GX4A 3A7YA 4MNYA 2HALA 5L2ZH 4JMYA 4UFDH 4MQAA 3TJNA 1TBQH 3S7KB 1AHTH 2BD5A 5DKMA 1FPHH 5HYOA 4MPWA 3RMMH 3SI4H 2R2WU 1HIAB 1IQGA 3BV9B 3SV7A 5F8ZA 1GMHG 2XC0A 4AYVB 2G81E 2BDHA 3RXDA 1T7CA 2ESTE 3VXFH 1ZLRA 2P3FH 2KAIB 2G4TA 2PGBB 1IQNA 1Z1JA 3RMOH 2ZECA 1GL1A 4RSPA 1C2IA 1KXEA
chains in the Genus database with same CATH superfamily
1HXEH 1MU6B 3A87A 2BD4A 1TOCB 2A31A 4CRAA 1BBRH 1AQ7A 1K1JA 1GI3A 2UUJB 3AAUA 4OGXA 4F48B 1GHBG 2OC1A 2Z9JA 3KEEA 3P70B 4SGBE 3V12A 1QBOA 1NM6A 5C3NA 2FMJA 2ZA5A 3M37A 4AC9A 1TONA 3SJOA 1MU8B 1P3EA 1ANCA 5GJ4B 5FCRA 2F83A 5L2YH 3E8LA 3SV2H 3T27A 1EQ9A 1AVWA 2ZQ1A 1UK3A 2EA3A 2KR7A 1SQRA 2B7DH 2BY7X 1LQDB 2GCHF 7KMEH 2AIQA 1S6HA 3OSYA 1DXWA 1BMLA 4B71A 4NA7A 3TVJB 5FPYA 1C1TA 1UVUH 3V7TA 4ZCNA 1EAUA 3UOPA 2HRVA 3SU6A 1F0SA 2WPMS 5ESBA 1TPPA 3A8DA 1DS2E 4OS4A 7ESTE 3VGCC 4HZHA 2KX4A 5FBEA 4ABBA 5F8TA 2UUFB 1BBRK 1PPGE 1AKSA 3RXJA 3SV9A 5C2ZA 2VNTA 3UQVA 1RJXB 3A83A 2QXJA 4O9VA 1EB1H 1AVXA 1O2SA 3TU7H 1IQKA 4FUDA 2CHAC 3K65B 2IJOB 2OCVB 4A5TS 3LGYA 1Z1IA 1SQOA 4CRCA 1GBAA 4WMDA 2PGQB 1HIAA 2A45B 1ESAA 1PQ5A 4FETA 3M5NA 3DA9B 5FXLA 1GBMA 3Q3XA 3GDUA 1KXAA 1FXYA 1VCQA 1QRXA 1K2I1 2KAIA 3BTTE 4CR5A 1FIWA 1GDQA 1OSSA 1TBRH 3E3TA 3QUMP 2ZZUH 3MU1A 3IWMA 3TGJE 1SHYA 2Z3DA 6LPRA 1QQUA 3OEED 2CK3D 5TCCA 1GBTA 3RXGA 1B7XB 2BXUH 4JYTA 3PROA 5E0JA 4RN6A 3PTBA 1IQEA 1GHYH 2B9LA 2OP9A 4UD9H 4ZH8A 2JETB 4WWYA 2DE9A 2H1UA 1XUJA 2SGQE 4UFFH 4F4OC 4FUHA 5I46H 1GI0A 3IG6B 2ZCHP 5F6MA 1V2OT 1TLDA 4UONA 3UFAA 6GCHF 4DCDA 4B74A 2FOGA 2M2AA 1ARBA 4DY7B 2GKVE 4P02A 2WPLS 1VCPA 4AN7A 1ESTA 3RC4A 5LGOA 2C8XB 4B6FA 4ZMAH 1BTWA 1KXCA 1C5UA 4CRBA 1O37A 4LZ4B 2VVUA 1AO5A 1CA0C 2A32A 2G8TA 5C17A 2B5TB 3F0PA 4HG6A 1TPOA 3TLOA 1C1MA 1Y3VA 3RDZA 4CHAC 1AN1E 4CH8B 2BD8A 4ABAA 1N6XA 1Z8IB 1CVWH 1C2HA 1H9LB 4D9QA 1C5NH 5TCAA 3NPSA 1GMCF 1T4VH 2HOBA 4B75A 2WYJA 4ISIH 1DE7H 1G36A 4E05H 4XBBA 1XUGA 5FPSA 2ZDNA 1ZJKA 2FODA 1CO7E 1PPCE 1SGNE 4J1YA 1P09A 1BT7A 3U9AH 2GDEH 3A80A 1OPHB 1G3EA 3MYWA 1O3PB 1ZTLA 3RXUA 1O3OA 1O3DA 5FAHA 1P2OA 3TNTA 1YPGH 3WY8A 2FO9A 3GCTF 1O2QA 1IQFA 4WMEA 5C5OA 5HMAA 2FI3E 3V0XA 3VG8A 1OOKB 2FOEA 2PUXB 3A84A 4X1NU 3T26A 3RC6A 4JK6A 4XRNA 2ZDAH 2J2UA 3UNQA 1YPKH 5TJXA 1SG8B 2Z6BD 5AVDA 1CGHA 1JBUH 3R3GB 2GV6A 5T6FA 1INCA 8GCHG 2F9VA 3MHWU 1BIOA 1MKXH 3A7WA 4GLYA 2KM0A 4U30A 3BEFB 1JXPA 4O3TA 1AWHB 3GS9A 1P03A 3UQOA 3EYDA 3LOXA 1O3GA 4KKDA 5DP7A 4B76A 2HWLB 1BRBE 2SGPE 3DFJA 1OS8A 4Z0KA 2OBOA 2ZGBH 3SBKA 3H7TA 3RXSA 2K1QA 1RRKA 5C20A 1ESBA 1IQIA 3B9FH 4B2CA 2QF0A 1O2XA 2IN2A 1A0JA 3RMNH 1BMMH 3W1EA 4K3JA 4NIYA 4YOIA 3F68H 1B0EA 2TGTA 1IQMA 2H6MA 1MD8A 3ZV8A 3H7OA 1BTPA 1HAPH 3N99A 2G55A 1QB1A 3EDXB 4I33A 5DP4A 1D3QB 3D65E 2BMGB 5J4SA 2WV4A 3STJA 4IW4E 3LJOA 1BRCE 4F49A 5DPAA 5B6OA 1GHWH 3A7TA 3CP7A 3S9BA 1MKXK 3ATKA 2WPKS 3E0PB 4ISHH 5I25A 4BAQB 2FEQH 4TY6A 1L0ZA 3RXPA 3RXLA 1GBHA 2FTLE 1GWAA 1QRWA 1E36B 2O8WA 4FXGH 1WXRA 2FX4A 2VWOA 2PV9B 4AYYB 4ISOA 1N8OC 7GCHG 2ZFPH 2PWXA 1SI5H 4MVNA 2VVCA 4ABFA 4TY7A 3RP2A 3UNRA 1S84A 5G4BA 2EI6A 2KFWA 4NSVA 4YLUA 5T6DA 4WF8A 3U1IB 1TNKA 1YBWA 1P2MA 1XMNB 2C90B 3O8RA 5EQSA 1C5MD 1P04A 1HNEE 1ZRBA 1ZZZA 1BMNH 3ZZ3A 4OGYA 3RU4E 1W12U 1RTKA 4Y0ZE 1G30B 2Y82A 1C5ZB 5FX5A 1F2SE 3ZZAA 4D7GA 5HKKD 1MD7A 3QK1A 3N7EA 1XUHA 3SNEA 1E1RD 1TQ0B 3M5MA 1NBMD 1KXFA 1HCGA 3E16B 2F9PA 4NZLA 4VGCC 2VU8E 4GCHF 2A0QB 2H9HA 3N7DA 2XWBI 2FS9A 1V2QT 2DUCA 3K6YA 1CU1A 4XOJA 1O2WA 3NXPA 2BD9A 2QA9E 3SI3H 3FKSD 2ZWLH 1IAUA 4HI3A 1UTNA 3JZ2B 6ESTA 1O2PA 1CT0E 2Y6TA 4ZXYH 3KNXA 3EQ0H 2P59A 5EOKA 4BXWA 2WYGA 1NROH 5K0HA 3FP8E 1KY9A 2O8LA 2RFKC 1V2VT 1DVAH 1TABE 2M5TA 1P0SH 1V6DA 1W0JD 1MQ6A 3RXIA 1BCUH 2ZU3A 4BAMB 1H1BA 3UNSA 1MUEB 1QTFA 3RLYH 3BTDE 2BOKA 1AZZA 3S7HB 1AE5A 5A09A 1WSSH 4UE7H 3SOSA 3M5LA 3UY9A 4B6EA 1O2KA 1Y5UT 2AHME 1RIWB 1LHDH 2YOLA 3A8AA 3U1JB 2SGAA 1XXDA 2AFQB 5CHAC 1LPGB 2WINI 1C5XB 1AVGH 2FS8A 4DVAU 1EATA 2Y7ZA 4CREA 1GJAB 2TIOA 1HAXB 4DURA 2BM2A 2O9QA 3WWBA 2P3UB 1K1LA 4Y8YA 1O5BB 2A7JA 1BHXF 3S69A 1SQTA 1ELEE 4JZ1A 1EOJA 1HJ8A 1NFXA 4LK4A 4B2BA 4H6SB 5E0HA 1O5FH 3M61U 1C9PA 2ZQ2A 3PMHB 1SMFE 4ZXXH 3SGQE 1TNIA 1THRH 4O3UA 4Y11E 4ZROA 1GHXH 4ACBA 2NU0E 1GCDA 1P8VC 1RS0A 3K2UA 1O3JA 3HGPA 2ZF0H 3URDA 1CT2E 2C8WB 4K2YA 1VGCC 2WPIS 2GCTC 2TBSA 4CRDA 2G00A 1QQ4A 2Y81A 1V2NT 1YC0A 2V35A 3VB6A 4X6OA 4I32A 3P8OA 1ETRH 3F9HA 1TIOA 4CBOA 4FU9A 1P01A 4MG3A 2SGEE 2ZTZA 1K1IA 4GHTA 5EJZA 3BEUA 4WJG2 3BSQA 1SQAA 1HJAC 4WY3A 3SU1A 1S6FA 3DT0H 1C2DA 2NWNA 1MZDA 4ABDA 1E0FD 1C9TA 4KTUA 2RDLA 2W5EA 5AFZH 1W7XH 1UVOA 2ODYB 4AG2A 1FY4A 2FP7B 5C1UA 2PHBA 3F6UH 3ATMA 5FL7D 5JYIA 1NO9H 1J15A 1UTPA 3OY5U 5A8ZA 3NWUA 1OX1A 1QHRB 1RGQA 3U69H 1XXFA 2QY0B 3Q3YA 4AGJA 1NRRH 2A7HA 4E7NA 2H5DA 3P6ZB 1CA8B 3UR6A 2A4RA 2BQ7B 2G52A 1AB9B 1ZRKA 1EAXA 4INKA 1UVSH 3LGWA 3GISB 3UTUH 1H9IE 2CN0H 3LT3A 2C3SA 4Q7ZA 1P06A 2BVXH 1GDUA 3A7XA 2WPJS 2JH6D 3PYHA 1OP8A 3QN7A 1ELDE 1GI8B 1P2QA 3M3VA 3KQ5A 1OWEA 3RXAA 1GHZA 1ZSJA 2FOMB 3BG4B 5GIBA 1GBIA 1UW7A 1DWEH 1MTNC 1KIGH 1JOUB 3DD2H 2J94A 1G3BA 2SFAA 4IN2A 1V2MT 1G32B 5LH8A 1QB9A 2GCHG 3GY4A 1A2CH 1DICA 1HDTH 2EEKA 2C93B 1CHOG 1E79D 1PPBH 2J9NA 3P95A 4X6NA 2ZEBA 1N1LA 1O36A 4NIWA 1DANH 1NPMA 1SB1H 2ZDMA 4TWWA 1MTVA 1AUJA 1F0RA 3QX5H 2XWAA 2P95A 4FUGA 3MNBA 2EC9H 4DJZB 2C4FH 1DPOA 4BXSA 1VKYA 1Z8JB 1BMFD 3RU4T 1AFQB 1QB6A 3SNAA 1C1OA 3M3TA 1BRUP 1HRTH 2QXGA 3KN2A 1C4U2 2OK5A 2ANWA 2PSYA 5F03A 2Z9GA 1LKAA 1YLNA 3SJ9A 1GI4A 4THNH 1SL3A 5GNDA 1ELVA 1C5QA 4H4FA 1THPB 1TNLA 5IYTA 1QY6A 3I29A 1A61H 5HM2A 1MBMA 4ASHA 3TK9A 1GJ7B 3F2FA 4ISLA 4IGDA 1C5TA 3TNSA 5FPTA 2UWOA 4ZKNU 2R2MB 2FWWA 1FMGA 1XKAC 1LQEA 5JDUB 1BA8B 4J2YB 2GTBA 4A1XA 1B0FA 3MU8A 3VB3A 5FCKA 5IDKA 3E91A 3Q3KA 2A4OA 4FVBA 1A0LA 3ZYDA 4X0WU 2THFB 1TNJA 1QRZA 1K22H 1MKWH 3E90B 5EXNA 1WQSA 1LDTT 2F91A 4DIIH 2WV5A 2I6SA 4IN1A 5EJ1A 3KGPA 1Z6EA 2STBE 3SU0A 1P2IA 1SBWA 6CHAC 2VIPA 1Z8GA 4Q7YA 3DSOA 6GCHG 2RA3A 2P8OB 4ABHA 4AOQA 2QYIA 4YZUA 1O5GH 3QTVH 7LPRA 4QT8C 3UAIC 1LO6A 4X1RU 4X2VA 3RXFA 4MNXA 1WU1A 1TMTH 4X6PA 3SQHE 4A92A 1GG6B 4E7RG 1Y5AT 3LDXH 1D3PB 3UUZA 1ID5H 3T62A 4A1VA 4ABGA 1C2LA 1O3EA 3SJKA 4IMQA 1HXFH 4AB8A 3PMJA 4XBDA 1ZMLA 2ODPA 2SNVA 2VH6A 1C2JA 2W3KA 3TJVA 2FOCA 3E1XB 1J8AA 1ETSH 2P94A 2PR3A 1P2KA 1MQ5A 1NRPH 3NKKA 2D26C 2ANKH 2AYWA 2JH0D 4M9FA 1MKWK 1ZTJA 3KQDA 1GMCG 1OWJA 1O2MA 4RI0A 5C67A 1C2FA 2V3OH 5T3HA 3QZRA 2ZDVH 1MZAA 2BY8X 2GZ9A 4A7IB 1O39A 3ZVAA 1NRNH 2GZ7A 3LGIA 2G51A 1GMDF 1LHFH 1BMAA 1TBZH 1ELGA 3RXTA 2R0KA 1BTXA 1C5RA 3PMAB 3EA9A 3P92A 1UTQA 2GMTB 2V6NA 4A1TA 1OHHD 1FAKH 3A8BA 1EOLA 5CE1A 3SUGA 1JWTA 1D3DB 4LXBH 1HBTH 1AFEH 5JBTA 2TGPZ 2FOBA 1VCWA 4JZIA 1EUFA 1O2TA 1RD3B 5JPMH 1ZOMA 3BTME 3G01A 1C5VA 5EU8A 1TPAE 1TRNA 1P02A 5GCHF 3BF6H 1SGEE 2B0FA 3TK5A 4NWLA 3EGKH 3CS7A 1NC6A 3ATLA 5EIYA 2BZ6H 2QGRA 1TYNA 5DK1A 2HPQH 3HK6B 1V2ST 2ZP0H 1Y5BT 1M9UA 1C5PA 2FLRH 2ZU1A 4E06H 1PPFE 1YYY1 3URCA 2LELA 1O3KA 3QGNB 1A46H 1K1OA 1ZGIA 2FOFA 3TJUA 2W7UA 1DX5M 1Q3XA 3UWJH 1D4PB 1GI2A 1HFDA 1GHVH 1O3CA 3ZVFA 3W94A 4NA9H 4GSOA 5DO4H 3VGCB 2VWLA 4XDEA 4MPUA 4RT1A 3MU4A 1MAXA 1WBGB 1KXBA 5EJLA 2BLVA 1P3CA 2VINA 2ZDLA 3QO6A 3C27B 1HV7A 2V3MA 1JRSA 8ESTE 3GCNA 2FIRH 2OC7A 3CENA 1HYLA 3ESTA 2ZGHA 3KL6A 1QA7A 2ZU2A 4FUBA 2ZHQH 2CHAB 1FAXA 5A8XA 1MCVA 2QE7D 3A82A 1AIXH 4YLQH 3ZVGA 1LVYA 3MMGA 4RKJB 1XUIA 5CHBA 3D62A 1HB0B 3GCHB 2XTTB 2VGCB 1GJBB 3LONA 4R8TB 5JB8S 5ETXA 3ZV9A 4JCNA 1A0HB 2P16A 2BLOA 2VIVA 2UWPA 5A2MH 1GMHF 4Y71A 3M35A 4KTCA 2R0LA 5LPFA 1W10U 4I31A 1HAZB 2XBXA 3F1SB 5A0BA 1F0UA 2XC4A 2CGAA 1GJDB 3FVFB 2AERH 2WSSD 1O2UA 4JYVH 1Y59T 2V3HH 4NCYA 4AX9H 4JZEH 4KP0A 3A7ZA 3KQCA 5A0AE 4X2XA 1F92A 1GGDB 2CV3A 1ZGVA 1L4ZA 3VB5A 1ABIH 3FP7E 1EZSC 1MTUA 1VITF 2KZ4A 5DP9A 1D6RA 1ELCA 1FLEE 1V2TT 2PKSC 3A89A 4TSFD 2JH5D 2VVVA 4GCHG 1FI8A 3ZVDA 1V2WT 4B2AA 1GJ6A 1SVPA 3FZZA 3S9AA 1O5CB 4Y7BA 1UTLM 4P00A 4Y8XA 1CBWB 2WV9A 1FONA 1Z71A 1DUEA 3GY2A 3M7QA 2OQ5A 3A8CA 5H4IB 5ABWA 1BB0B 4TPIZ 4XFQA 2SNWA 3PV4A 1OYTH 1HAOH 1O30A 1QCPA 3BTEE 1V2UT 1O2RA 2ALVA 1S0RA 5C0TA 2OC8A 2W3IA 1WAYB 1AE8H 2D8WA 1SFIA 5PTPA 3ZVCA 3A81A 1GBEA 2GZ8A 4BAOB 5KECA 1TGTA 2RCEA 5HGGA 2AH4X 3OFND 3H09A 4ZKOU 5JBAS 1DM4B 3BTGE 3ZZ7A 1ARCA 2YMSC 1HAYB 1SGYE 4UEHH 1FIZA 2PTCE 3TGKE 2O8UA 1GCTB 2VWNA 3RMLH 3UREA 1GJCB 3RLWH 2Q1JA 4I8KA 1LPKB 2OQUA 4OS2A 2HNTF 5EQRA 3BTKE 2K8IA 1YPHC 1FDPA 2BZAA 5F8XA 2EI7A 2HNTC 1PFXC 3MO3A 3NRLA 3SGAE 4AG1A 2ZGJA 4HGCA 1TX8A 4FU8A 2BYAX 1ZTKA 3M3SA 1JMOH 1C5LH 5BPEA 1PQAA 1MABB 3TH2H 2A2QH 2ASUB 4YM9A 2UUKB 2DE8A 1Y3WA 1VITH 3F9FA 3O8BA 2QF4A 2ZHFH 2ZHEH 4DT7B 8LPRA 3M5OA 1PPEE 1YPLH 2FPZA 2XNDD 1EXFA 1AD8H 1DDJA 2V7QD 3RXQA 1EKBB 1W0YH 3OYPA 1P2JA 2WPDD 3FOAA 3PO1C 1TA6A 1KLIH 1PQ8A 2UUYA 2KCOA 4INHA 1EJMA 1EASA 1SGQE 3SNBA 1UHBB 2ZHWH 5HIYA 1TMUH 1DWDH 1O2OA 1ZHPA 2SGDE 2H2ZA 2BX4A 1O3NA 1D3TB 2BDAA 2VH0A 2GJGA 4I8LA 2ZG0H 3M7TA 4GVUA 1UO6A 2Z3CA 3V3MA 2BDCA 1RTLA 2J4IA 2LPRA 1QZ8A 1A3EH 1MBQA 4Y76A 3EE7A 3OY6U 3MNSA 1EPTC 2EY4C 3DCLA 1L2EA 5AF9H 2RDEA 4CRFA 2A5AA 4ZHMU 4PROA 2QCYA 4BAKB 4IC6A 1BQYA 3OTPA 3U8OH 2QV1A 4NFFA 2GD4B 1KTSB 1CQQA 3ZYEA 1LMWB 4Q4LA 1IHTH 2R3UA 3LPRA 4U01A 2VIQA 1MAYA 2FESH 5DG6A 1N8OB 3NCLA 3HKJB 5T6GA 3LH3A 2BDBA 2JKHA 1SGTA 1E38B 4D8NA 4I86A 5GWZA 5EG4A 3TH3H 3VPKA 2A2XH 2A5IA 1NESE 2BQ6B 1TGCA 4YOJA 4OS6A 1YCPM 5IK2D 4KELA 3A85A 1P9SA 3OEHD 1OWKA 2Y5HA 1S81A 1O33A 1SGIB 1WV7H 1OWDA 4K60A 1DY9A 3A86A 3LC5A 3OX7U 4BNRA 1OP0A 1AZ8A 2ZKSA 1HLTH 1XX9A 4B1TA 3F3BA 1K28D 4YT6H 3KYGA 1OWIA 1Y8TA 4VGCB 3PMBB 1ACBE 2ALPA 2ZU5A 8GCHF 1BOQA 2BY6X 2FI5E 1LHCH 1KDQB 4O03A 3F2GA 1E37B 2BLWA 2Q6GA 4K5ZA 3TK6A 2VJ1A 4MDSA 4NGAH 5J4QA 1YPJH 2ZFRH 3BEIB 1J14A 1LPZB 2FOAA 1TRMA 1UHBA 1AMHA 2ZDKA 1FQ3A 2XBVA 2YNAA 3B23B 2A4GA 1GBJA 3SYJA 4CBNA 1QURH 1YGCH 4RT0A 4YO9A 2ZU4A 5L30H 3AK5A 1H4WA 1GI6A 4IMZA 4OS7A 4JYUH 2IJD1 1C1UH 1GI1A 2XOKD 1EZQA 1GBLA 4WVPE 2OINA 5AHGH 2BB4A 3Q00A 4YTAA 1BITA 1O35A 2F9UA 1FV9A 3K6ZA 2Z9LA 1YPHE 1YPEH 3SU2A 2FDAA 3LKWA 1O3LA 3SU3A 5CHAB 1FY8E 1O2HA 3F9GA 3GY8A 2D2DA 5EPNA 2HNTE 1FN8A 2LP6A 2ZTYA 3AW0A 1S83A 2LNCA 4JZFH 1C2MA 1C1QA 3U28C 4YOGA 1DWBH 2OC0A 3M7UA 1XUFA 1BTUA 2SGFE 3WW7A 1YLCA 1AB9C 1TOMH 2JDID 2PW8H 3N7OA 4Y79A 1UCYH 1O34A 3SNCA 1O2NA 1K21H 1VJAU 1BHXB 1IHSH 4BTTB 3FZDA 2FX6A 3P8GA 1H8IH 1QL8A 5E2OA 1BUIA 1SC8U 3RXCA 2ZCKP 3BG4C 2BDIA 2AMQA 2F3CE 3WWFA 1C4V2 3UIRA 1ELBA 1QBNA 1VGCB 3I77A 3PLKA 3KF2A 1DUAA 3KHVA 1KDQA 3H5CB 4XD7D 4B73A 1CE5A 2Y5FA 3TITA 3MFJA 1V3XA 1W14U 3ITIA 1RTFB 2ZNKH 2C8YB 4JK5A 2FYRA 1SR5C 4K1TA 3UPEA 1HJAB 4X1PU 2XBYA 2ZCLP 1Y3XA 9ESTA 1XVOA 3T2NA 3W95A 1UCYK 5K7RA 1O2VA 3GICB 3RXHA 3SZNA 1QJ7B 1PYTD 4SGAE 2AGEX 3R0FA 1F5LA 5FHTA 3RXBA 1NS3A 2WUBA 3JZ1B 2RG3A 4FOUC 2RA0A 3ZVEA 1C1VH 1SLUB 2TGAA 2FI4E 3MU5A 1KLTA 2D1JA 2GT8A 1G3CA 2W7SA 1C4Y2 1GBCA 1C5YB 3MH7A 4ISNA 1ELFA 1A4WH 2EI8A 4Y7AA 1C2KA 1DSUA 2BOHB 1WQVH 1J16A 1X7AC 2J34A 2F9NA 3MH4A 5BRRE 1SLXB 2BLQA 4HFPB 2KCPA 1YF4A 2FYQA 3LU9B 1Z8RA 1QNJA 1QA0A 3NUMA 1UVPA 1BJVA 4BTUB 2XNIA 1L4DA 3ZIAD 5GCHG 1DXPA 1ETTH 2J92A 2ULLA 3BIUH 2GGVB 1TFXA 2BY5X 2ZFSA 1V2JT 1YM0A 2A1DB 5GPIB 1T31A 1ANDA 3GDSA 5FX6A 2P3TB 1L1GA 1UCYE 4NWKA 1EFRD 1MTNB 1PJPA 1Q2WA 2OD3B 1ZJDA 3RUOA 2BDYA 4OS1A 1T4UH 3GYMA 3HGNA 5FBIA 1TAWA 4X2WA 1GJ8B 2QXHA 2XRCA 4BOHA 2NU3E 3GY6A 3M36A 4XE4A 3MO6A 1MTWA 2ZFTA 4AB9A 2P8OC 2QIQA 4TPYA 1D6WA 2A4QA 4X8VH 2OXSA 1TX6A 4GAWA 1P05A 1V2LT 2A5KA 3K9XB 3KQEA 5LPRA 1T32A 2G4UA 3FO8D 4O97A 1HPGA 1V2KT 3RM2H 4I8JA 2HPPH 2XC5A 3MO9A 3VFEA 3SO3A 4ESTE 1GBKA 2CJIA 1GHAF 1AU8A 2ZC9H 1GPZA 2H9EH 4GPGA 4FVDA 1P12E 4MPVA 3S0NA 1F7ZA 2O8TA 5B6LA 4AZ2B 5HM9A 1B5GH 1NFUA 2XW9A 4TT3D 3SUFA 2HVXA 1ZYOA 1C1PA 5A0CA 4AFZA 2XCNA 1C5WB 2I6QA 5C1YA 4Q80A 1L1NA 2F43B 3ZZ8A 3DHKH 1NZQH 1PQ7A 3AVZA 3RXMA 1E35B 1V2RT 2GMTC 1K0HA 1PPHE 1JIMA 2ANMH 5EW1H 2J5UA 2AMPA 4U2WA 5DP8A 2FLBH 4UFGH 1NT1A 5C1XA 3QLPH 1TALA 3STIA 3FANA 1WUNH 1QGFA 2A7CA 6CHAB 1FY5A 1DT2A 1VITG 1BDAA 1GL0E 2QF3A 1W7GH 3FN8A 8KME2 4MNVA 5EODA 1KMHB 2QF5A 1CT4E 1ELTA 4MPXA 1O2GH 1WDIA 3HK3B 1GI5A 4X8TH 3PWBA 3GCTG 1C5OH 1KSNA 1SGFA 2ZFQH 3BN9A 4Y6DA 1O3FA 5EXLA 1FPCH 3AW1A 1H9HE 1SGPE 2QAAA 2H5CA 3FAOA 3SW2B 1CHOF 1H8ED 3BG8A 1DSTA 2CMYA 2ZGCA 1S0QA 1YLDA 1O32A 1OWHA 4I8GA 1GVZA 1C1WH 4D76A 1O38A 4DOQA 4YESB 4K1SA 3DSPA 3UB0A 1Y3YA 3MNCA 4X2YA 3MH5A 2JETC 2QN5T 2NU4E 3MH6A 3RU4D 2J98B 3NK8A 1K1PA 3OTJE 2J95A 5JBCS 1QBVH 2ZGXH 4Q2KA 3I78A 5E0GA 4ABJA 1QFKH 4K8YA 1HAIH 1EJNA 1KLJH 1LVOA 1O2JA 3F2HA 1BZXE 1FN6A 2WUCA 1GJ5H 4LZ1H 3GCHC 1ORFA 2GVFA 2VGCC 5HIZA 1DY8A 3SU5A 1A5HA 2BQWB 4WH8A 4UFEH 4DW2U 3SUEA 1UK2A 2B8OH 3QTOH 3EE0B 2IOTA 5DJ7A 3L3TA 2Z3EA 4Y0YE 1SOZA 1ZSLA 2BX3A 2AGIX 4Z6AH 1A7SA 5GXPA 2ODQA 1AUTC 1SGDE 1RXPA 4R0IA 1BBRE 3Q77A 3CS0A 3KCGH 1LKBA 4X6MA 3BTHE 1YKTA 2HLDD 3T28A 3LIWA 1K9OE 1GGDC 1O31A 1W0KD 1W13U 1W11U 3ZZ6A 2BDGA 3RXVA 2PLXA 3LH1A 2AGGX 2Z9KA 1FX0B 1DITH 1O2LA 3ZVBA 1A5IA 2Z7FE 2WPHS 4WMFA 2Z9IA 4GHQA 1ZR0A 3MTYA 4H6TA 1ZPZA 1GJ4H 1CBWC 1XVMA 1HAHH 1XUKA 2TGDA 3QZQA 2NU2E 3GYLB 3PLBA 2GT7A 1J9CH 1ZMJA 1WOFA 4ABIA 2EQNA 1YP9A 3KYFA 3SNDA 4FUFA 4MLFB 2VWMA 2XBWA 3TJOA 3ELAH 1GHBF 2TPIZ 2Q6DA 3MNXA 1GDNA 2Y7XA 2PFEA 3P8FA 5DP3A 4M7GA 4NIXA 4ACAA 4U32A 4D7FA 1FJSA 1NY22 2FOHA 2GP9B 1T8LA 1EX3A 2BY9X 1SGCA 2J98A 1O3HA 1OXGA 3TIUA 3ZZCA 2W6JD 5L6NH 2ANYA 1ZHRA 2JJ2D 3BTWE 1TQ7B 3D49H 2YMSD 1CA0B 2ZFFH 5C0UA 2ZPRA 1H8DH 4H42U 1GCTC 1OP2A 1QL7A 4WXVA 4CHAB 1NN6A 1T8OA 4FUJA 1C2GA 1FUJA 1GJ9B 5E2PA 3D23A 4DG4A 1GI9B 4XBCA 1DLKB 1FY3A 3PM3A 3BTQE 1TPSA 1D9IA 9LPRA 2WHXA 3SJ8A 4CR9A 3KIDU 2O8MA 1XKBC 3SZEA 2FM2A 1TE0A 1EAWA 2PKSB 1ANBA 1YWUA 2VB0A 2VBCA 1OYQA 1DFPA 1O3BA 1O2IA 3ZZDA 3PTNA 5C5NA 1A5GH 3DSGA 2CF9H 1VJ9U 1J17T 1IQHA 1HAVB 3ZZ9A 3LGUA 3UWIA 1HAGE 3RC5A 3ZZBA 1TRYA 2C8ZB 2BD3A 5DP5A 4INLA 1VZQH 4UDWH 2J38A 2ZIQH 1C1NA 4RKOB 1O3MA 1O2YA 5A8YA 1W0ZU 1G3DA 4TWYA 3U8TH 2VIOA 1GBDA 1EJAA 1TGSZ 3VB4A 1C2EA 3ODDA 4Y8ZA 1DLEA 1COWD 4F55A 1GBBA 4WH6A 3SQEE 4ZKRU 2XXLA 4TYDA 1CGJE 1CHGA 3VXEH 3OAAD 1O2ZA 2Y5GA 4MNWA 2R9PA 3PLPA 3T5FH 4Z1MD 5KEDA 4X8UH 1MCTA 1TGBA 1YPMH 2YMSB 2BD7A 3PV5A 1BTZA 3SGBE 1O5DH 1THSH 3AASA 1UTKA 4BAHB 4KTSA 2IPQX 5C94A 1K1MA 2HGTH 1PPZA 2AS9A 2ZTXA 1QL9A 5DP6A 5ESTE 4ZHAA 1AWFH 3QWCH 4BTIB 2ZO3H 1LHGH 4ZKSU 1U6QA 1LVBA 2ZHDA 3S9CA 3GCOA 5EPYA 4FUEA 3SN8A 1P2NA 4Q7XA 2OTVA 3EAJA 1KYNA 5KGOA 1TGNA 4MTBA 1AGJA 2K0QA 5JBBS 5DSFA 2BD2A 2PUQH 3ODFA 3EA7A 1C5SA 1ANEA 3BTFE 3PO1B 1WCZA 4Y10E 4YXWD 2H9TH 1TWXB 2Q6FA 1RIWC 3PRDA 1KTTB 5EXMA 1O3IA 3F9EA 3ZZ4A 2W6ID 1SSXA 1HAVA 3ATWA 2YNBA 3GY5A 1OKXA 2JJ1D 4IBLH 2BHGA 5CDFE 5DGJA 3GDVA 3SHAH 3Q76A 2PP6A 2ZI2H 3FFGA 5JB9S 4FUIA 1TNGA 1BRAA 1SGFG 3UOUA 1BTYA 1Y3UA 4NFEA 1ZPCA 3RXOA 1CSOE 1UMAH 1EPTB 4FUCA 5E8EH 1MMJN 3RXEA 4NSYA 2TRMA 4ASUD 3VEQB 2ZPQA 3RM0H 1K1NA 3TPIZ 1SFQB 2AEIH 1LTOA 3O8DA 4IC5A 4DT4A 1UTMA 3A7VA 3RXKA 2JIZD 4IS5A 2J97A 5GDSH 1N6YA 2W26A 1GVLA 2NU1E 2OBQA 1V2PT 3QDZB 3ENSB 1O5EH 1T8NA 3LGVA 3MI4A 4K8BA 1S5SA 3GOVB 3HATH 1QJ1B 1W8BH 1TX7A 2BVRH 2PSXA 4AFSA 1BJUA 1IQJA 1ZHMA 2F4LA 3A88A 1UJ1A 5EW2H 2GV7A 2KCAA 1DWCH 1ZMNA 4I7YH 4WXIA 4X1QU 2AMDA 3RXRA 1TNHA 1QIXB 1G2LA 4AGKA 5T1VA 2OLGA 3MWIU 2QXIA 1EZXC 5HXFA 1DOJA 3E6PH 1F5RA 4A6LA 1HGTH 1T8MA 4KGAA 3V13A 1XM1A 4XSKU 3SUDA 3LGTA 5EQQA 3PB1E 2XCFA 2OUAA 1P57B 1MH0A 1MTSA 1HJ9A 1FNIA 3IITA 1EAIA 7GCHF 1W3CA 3OE7D 1NU9A 1FZZA 3HPTB 1ZPBA 1F0TA 1GHAG 1SPJA 1G37A 3B8JA 1GI7B 1BTHH 2V0BA 1O5AB 2PTNA 5SGAE 3SV6A 1C1SA 3U8RH 1NFYA 4NA8A 3EA8A 1A1RA 1YCPH 2PKAB 1O3AA 3HKIB 2R3YA 2UWLA 3L6PA 1KXDA 1S6LA 5F53A 1AY6H 1AI8H 4AFQA 1EPTA 4ABEA 1TMBH 4HTCH 1NTPA 1Z7KA 2GCTB 4ZAEA 1SGRE 1WTHD 5DN6D 3MQKC 2STAE 2Y80A 2XYAA 3U98H 3DFLA 3C1KA 1IOEA 2Z94A 1NRSH 3P8NA 3T25A 2WZQA 4FU7A 1HUTH 1P9UA 1QJ6B 2L74A 2F9BH 3OU0A 3KQBA 1JRTA 2F9OA 4K1EA 4CRGA 1ELAA 2CF8H 1VR1H 3O8CA 1AFQC 3QGJA 2HLCA 4OM9A 2G5NA 4LOYH 1EP6A 3T29A 3DUXH 4X1SU 1QR3E 4CH2B 3SV8A 3MU0A 2HVYB 1JIRA 1A3BH 5LPEA 2FTMA 1UK4A 3E0NB 1GMDG 4D9RA 1LCYA 1YCPK 1E1QD 2GDDA 2VIDA 5AFYH 2CXVA 3FP6E 4GUXA 1SLVB 1GVKB 4K69A 3SU4A 1SOTA 1ZSKA 1P11E 4NG9H 1Z6JH 3MOCA 2P93A 4I8HA 3P17H 4OS5A 1CGIE 3NZIA 3GY7A 3SORA 1LHEH 3F0OA 4JZDH 1W2KH 1GBFA 1F5KU 1UTOA 1E34B 3TGIE 4X8SH 1ABJH 1WTGH 1FY1A 1Q31A 3PWCA 1SKYE 3BIVH 3SJIA 1NFWA 1P10A 1UVTH 2VIWA 1TB6H 3ATIA 5EGMA 3PRBA 3LJJA 1O0DH 1NBME 2ILNA 3UR9A 1UTJA 4AORA 1L1JA 4ZHLU 3CNRA 1PYTC 4NIVA 5CMXH 1IQLA 3AAVA 2BXTH 1NU7B 2PKAA 1RFNA 1EB2A 2IPHA 2FXRA 3L33A 2BTCE 1C1RA 1S82A 3TH4H 4Q63A 2FZZA 1TA2A 2G5VA 4DGJA 1YY3A 3VB7A 3SHCH 1GG6C 4YT7H 2BVSH 1WYKA 4ZUHA 1SLWB 1NRQH 3ZZ5A 1LVMA 2AIPA 1EZUC 2QC2A 2ZPSA 4NZQA 4AFUA 4DIHH 3LC3A 1H8HD 4BANB 1S85A 2KCYA 1G9IE 1EP5A 1G2MA 1AKSB 1SHHB 3GY3A 2GX4A 3A7YA 4MNYA 2HALA 5L2ZH 4JMYA 2L6OA 4UFDH 4MQAA 3TJNA 3PV2A 1TBQH 3S7KB 1AHTH 2BD5A 5DKMA 1FPHH 5HYOA 4MPWA 3RMMH 3SI4H 2R2WU 1HIAB 1IQGA 3BV9B 3SV7A 5F8ZA 1GMHG 2XC0A 4AYVB 2G81E 2BDHA 3RXDA 1T7CA 2ESTE 3VXFH 1ZLRA 2P3FH 2KAIB 2G4TA 2PGBB 1IQNA 1Z1JA 3RMOH 2ZECA 1GL1A 4RSPA 1C2IA 1KXEA
chains in the Genus database with same CATH topology
1HXEH 1MU6B 3A87A 2BD4A 1TOCB 2A31A 4CRAA 1BBRH 1AQ7A 1K1JA 1GI3A 2UUJB 3AAUA 4OGXA 1GHBG 2OC1A 2Z9JA 3KEEA 3P70B 4SGBE 3V12A 1QBOA 1NM6A 5C3NA 2FMJA 2ZA5A 3M37A 1TONA 3SJOA 1MU8B 1P3EA 1ANCA 5GJ4B 5FCRA 2F83A 5L2YH 3E8LA 3SV2H 3T27A 1EQ9A 1AVWA 2ZQ1A 1UK3A 2EA3A 2GCHF 2B7DH 2BY7X 1LQDB 7KMEH 2AIQA 1S6HA 3OSYA 1DXWA 1BMLA 4B71A 4NA7A 3TVJB 5FPYA 1C1TA 1UVUH 3V7TA 1EAUA 3UOPA 2HRVA 3SU6A 1F0SA 2WPMS 5ESBA 1TPPA 3A8DA 1DS2E 4OS4A 7ESTE 3VGCC 4HZHA 5FBEA 4ABBA 5F8TA 2UUFB 1BBRK 1PPGE 1AKSA 3RXJA 3SV9A 5C2ZA 2VNTA 3UQVA 1RJXB 3A83A 2QXJA 4O9VA 1EB1H 1AVXA 1O2SA 3TU7H 1IQKA 4FUDA 2CHAC 3K65B 2IJOB 2OCVB 4A5TS 3LGYA 1Z1IA 1SQOA 4CRCA 1GBAA 4WMDA 2PGQB 1HIAA 2A45B 1ESAA 1PQ5A 3M5NA 3DA9B 5FXLA 1GBMA 3Q3XA 3GDUA 1KXAA 1FXYA 1VCQA 1QRXA 1K2I1 2KAIA 3BTTE 4CR5A 1FIWA 1GDQA 1OSSA 1TBRH 3E3TA 3QUMP 2ZZUH 3MU1A 3IWMA 3TGJE 1SHYA 2Z3DA 6LPRA 1QQUA 5TCCA 1GBTA 3RXGA 1B7XB 2BXUH 4JYTA 3PROA 5E0JA 4RN6A 3PTBA 1IQEA 1GHYH 2B9LA 2OP9A 4UD9H 4ZH8A 2JETB 4WWYA 2DE9A 2H1UA 1XUJA 2SGQE 4UFFH 4F4OC 4FUHA 5I46H 1GI0A 3IG6B 2ZCHP 5F6MA 1V2OT 1TLDA 4UONA 3UFAA 6GCHF 4DCDA 4B74A 2FOGA 1ARBA 4DY7B 2GKVE 2WPLS 1VCPA 4AN7A 1ESTA 3RC4A 5LGOA 2C8XB 4ZMAH 1BTWA 1KXCA 1C5UA 4CRBA 1O37A 4LZ4B 2VVUA 1AO5A 1CA0C 2A32A 2G8TA 2B5TB 1TPOA 3TLOA 1C1MA 1Y3VA 3RDZA 4CHAC 1AN1E 4CH8B 2BD8A 4ABAA 1N6XA 1Z8IB 1CVWH 1C2HA 1H9LB 4D9QA 1C5NH 5TCAA 3NPSA 1GMCF 1T4VH 2HOBA 4B75A 2WYJA 4ISIH 1DE7H 1G36A 4E05H 4XBBA 1XUGA 5FPSA 2ZDNA 1ZJKA 2FODA 1CO7E 1PPCE 1SGNE 4J1YA 1P09A 1BT7A 3U9AH 2GDEH 3A80A 1OPHB 1G3EA 3MYWA 1O3PB 1ZTLA 3RXUA 1O3OA 1O3DA 5FAHA 1P2OA 3TNTA 1YPGH 3WY8A 2FO9A 3GCTF 1O2QA 1IQFA 4WMEA 5C5OA 5HMAA 2FI3E 3V0XA 1OOKB 2FOEA 2PUXB 3A84A 4X1NU 3T26A 3RC6A 4JK6A 2ZDAH 2J2UA 3UNQA 1YPKH 5TJXA 1SG8B 2Z6BD 5AVDA 1CGHA 1JBUH 3R3GB 2GV6A 5T6FA 1INCA 8GCHG 2F9VA 3MHWU 1BIOA 1MKXH 3A7WA 4GLYA 4U30A 3BEFB 1JXPA 4O3TA 1AWHB 1P03A 3UQOA 3EYDA 3LOXA 1O3GA 4KKDA 5DP7A 4B76A 2HWLB 1BRBE 2SGPE 3DFJA 1OS8A 4Z0KA 2OBOA 2ZGBH 3SBKA 3H7TA 3RXSA 2K1QA 1RRKA 5C20A 1ESBA 1IQIA 3B9FH 4B2CA 2QF0A 1O2XA 2IN2A 1A0JA 3RMNH 1BMMH 4K3JA 4NIYA 4YOIA 3F68H 1B0EA 2TGTA 1IQMA 2H6MA 1MD8A 3ZV8A 3H7OA 1BTPA 1HAPH 2G55A 1QB1A 3EDXB 4I33A 5DP4A 1D3QB 3D65E 2BMGB 5J4SA 2WV4A 3STJA 4IW4E 3LJOA 1BRCE 4F49A 5DPAA 5B6OA 1GHWH 3A7TA 3CP7A 3S9BA 1MKXK 3ATKA 2WPKS 3E0PB 4ISHH 5I25A 4BAQB 2FEQH 4TY6A 1L0ZA 3RXPA 3RXLA 1GBHA 2FTLE 1GWAA 1QRWA 1E36B 2O8WA 4FXGH 2FX4A 2VWOA 2PV9B 4AYYB 4ISOA 1N8OC 7GCHG 2ZFPH 2PWXA 1SI5H 4MVNA 2VVCA 4ABFA 4TY7A 3RP2A 3UNRA 1S84A 5G4BA 2EI6A 4NSVA 4YLUA 5T6DA 4WF8A 3U1IB 1TNKA 1YBWA 1P2MA 1XMNB 2C90B 3O8RA 5EQSA 1C5MD 1P04A 1HNEE 1ZRBA 1ZZZA 1BMNH 3ZZ3A 4OGYA 3RU4E 1W12U 1RTKA 4Y0ZE 1G30B 2Y82A 1C5ZB 5FX5A 1F2SE 3ZZAA 4D7GA 1MD7A 3QK1A 1XUHA 3SNEA 1TQ0B 3M5MA 1KXFA 1HCGA 3E16B 2F9PA 4NZLA 4VGCC 2VU8E 4GCHF 2A0QB 2H9HA 2XWBI 2FS9A 1V2QT 2DUCA 3K6YA 1CU1A 4XOJA 1O2WA 3NXPA 2BD9A 2QA9E 3SI3H 2ZWLH 1IAUA 4HI3A 1UTNA 3JZ2B 6ESTA 1O2PA 1CT0E 2Y6TA 4ZXYH 3KNXA 3EQ0H 2P59A 5EOKA 4BXWA 2WYGA 1NROH 5K0HA 3FP8E 1KY9A 2O8LA 1V2VT 1DVAH 1TABE 2M5TA 1P0SH 1V6DA 1MQ6A 3RXIA 1BCUH 2ZU3A 4BAMB 1H1BA 3UNSA 1MUEB 1QTFA 3RLYH 3BTDE 2BOKA 1AZZA 3S7HB 1AE5A 5A09A 1WSSH 4UE7H 3SOSA 3M5LA 3UY9A 1O2KA 1Y5UT 1RIWB 1LHDH 2YOLA 3A8AA 3U1JB 2SGAA 1XXDA 2AFQB 5CHAC 1LPGB 2WINI 1C5XB 1AVGH 2FS8A 4DVAU 1EATA 2Y7ZA 4CREA 1GJAB 2TIOA 1HAXB 4DURA 2BM2A 2O9QA 2P3UB 1K1LA 4Y8YA 1O5BB 2A7JA 1BHXF 3S69A 1SQTA 1ELEE 4JZ1A 1EOJA 1HJ8A 1NFXA 4LK4A 4B2BA 4H6SB 5E0HA 1O5FH 3M61U 1C9PA 2ZQ2A 3PMHB 1SMFE 4ZXXH 3SGQE 1TNIA 1THRH 4O3UA 4Y11E 4ZROA 1GHXH 2NU0E 1GCDA 1P8VC 1RS0A 3K2UA 1O3JA 3HGPA 2ZF0H 3URDA 1CT2E 2C8WB 4K2YA 1VGCC 2WPIS 2GCTC 2TBSA 4CRDA 2G00A 1QQ4A 2Y81A 1V2NT 1YC0A 2V35A 3VB6A 4X6OA 4I32A 3P8OA 1ETRH 3F9HA 1TIOA 4CBOA 4FU9A 1P01A 4MG3A 2SGEE 2ZTZA 1K1IA 4GHTA 3BEUA 4WJG2 3BSQA 1SQAA 1HJAC 4WY3A 3SU1A 1S6FA 3DT0H 1C2DA 2NWNA 1MZDA 4ABDA 1E0FD 1C9TA 4KTUA 2RDLA 2W5EA 5AFZH 1W7XH 1UVOA 2ODYB 4AG2A 1FY4A 2FP7B 5C1UA 2PHBA 3F6UH 3ATMA 5JYIA 1NO9H 1J15A 1UTPA 3OY5U 5A8ZA 3NWUA 1OX1A 1QHRB 1RGQA 3U69H 1XXFA 2QY0B 3Q3YA 4AGJA 1NRRH 2A7HA 4E7NA 2H5DA 3P6ZB 1CA8B 3UR6A 2A4RA 2BQ7B 2G52A 1AB9B 1ZRKA 1EAXA 4INKA 1UVSH 3LGWA 3GISB 3UTUH 1H9IE 2CN0H 3LT3A 2C3SA 4Q7ZA 1P06A 2BVXH 1GDUA 3A7XA 2WPJS 2JH6D 3PYHA 1OP8A 3QN7A 1ELDE 1GI8B 1P2QA 3M3VA 1OWEA 3RXAA 1GHZA 1ZSJA 2FOMB 3BG4B 5GIBA 1GBIA 1DWEH 1MTNC 1KIGH 1JOUB 3DD2H 2J94A 1G3BA 2SFAA 4IN2A 1V2MT 1G32B 5LH8A 1QB9A 2GCHG 3GY4A 1A2CH 1DICA 1HDTH 2EEKA 2C93B 1CHOG 3P95A 1PPBH 2J9NA 4X6NA 2ZEBA 1N1LA 1O36A 4NIWA 1DANH 1NPMA 1SB1H 2ZDMA 4TWWA 1MTVA 1AUJA 1F0RA 3QX5H 2XWAA 2P95A 4FUGA 3MNBA 2EC9H 4DJZB 2C4FH 1DPOA 4BXSA 1Z8JB 3RU4T 1AFQB 1QB6A 3SNAA 1C1OA 3M3TA 1BRUP 1HRTH 2QXGA 3KN2A 1C4U2 2ANWA 2PSYA 5F03A 2Z9GA 1LKAA 3SJ9A 1GI4A 4THNH 1SL3A 1ELVA 1C5QA 4H4FA 1THPB 1TNLA 5IYTA 1QY6A 3I29A 1A61H 5HM2A 1MBMA 4ASHA 3TK9A 1GJ7B 4ISLA 4IGDA 1C5TA 3TNSA 5FPTA 2UWOA 4ZKNU 2R2MB 2FWWA 1FMGA 1XKAC 1LQEA 5JDUB 1BA8B 4J2YB 2GTBA 4A1XA 1B0FA 3MU8A 3VB3A 5FCKA 5IDKA 3E91A 3Q3KA 2A4OA 4FVBA 1A0LA 3ZYDA 4X0WU 2THFB 1TNJA 1QRZA 1K22H 1MKWH 3E90B 5EXNA 1WQSA 1LDTT 2F91A 4DIIH 2WV5A 2I6SA 4IN1A 3KGPA 1Z6EA 2STBE 3SU0A 1P2IA 1SBWA 6CHAC 2VIPA 1Z8GA 4Q7YA 6GCHG 2RA3A 2P8OB 4ABHA 4AOQA 2QYIA 4YZUA 1O5GH 3QTVH 7LPRA 4QT8C 1LO6A 4X1RU 4X2VA 3RXFA 4MNXA 1WU1A 1TMTH 4X6PA 3SQHE 4A92A 1GG6B 4E7RG 1Y5AT 3LDXH 1D3PB 3UUZA 1ID5H 3T62A 4A1VA 4ABGA 1C2LA 1O3EA 3SJKA 4IMQA 1HXFH 4AB8A 3PMJA 4XBDA 1ZMLA 2ODPA 2SNVA 2VH6A 1C2JA 2W3KA 3TJVA 2FOCA 3E1XB 1J8AA 1ETSH 2P94A 2PR3A 1P2KA 1MQ5A 1NRPH 3NKKA 2D26C 2ANKH 2AYWA 2JH0D 1MKWK 1ZTJA 3KQDA 1GMCG 1OWJA 1O2MA 5C67A 1C2FA 2V3OH 5T3HA 3QZRA 2ZDVH 1MZAA 2BY8X 2GZ9A 4A7IB 1O39A 3ZVAA 1NRNH 2GZ7A 3LGIA 2G51A 1GMDF 1LHFH 1BMAA 1TBZH 1ELGA 3RXTA 2R0KA 1BTXA 1C5RA 3PMAB 3EA9A 3P92A 1UTQA 2GMTB 2V6NA 4A1TA 1FAKH 3A8BA 1EOLA 5CE1A 3SUGA 1JWTA 1D3DB 4LXBH 1HBTH 1AFEH 5JBTA 2TGPZ 2FOBA 1VCWA 4JZIA 1EUFA 1O2TA 1RD3B 5JPMH 1ZOMA 3BTME 3G01A 1C5VA 5EU8A 1TPAE 1TRNA 1P02A 5GCHF 3BF6H 1SGEE 2B0FA 3TK5A 4NWLA 3EGKH 3CS7A 1NC6A 3ATLA 2BZ6H 2QGRA 1TYNA 5DK1A 2HPQH 3HK6B 1V2ST 2ZP0H 1Y5BT 1M9UA 1C5PA 2FLRH 2ZU1A 4E06H 1PPFE 1YYY1 3URCA 3QGNB 1O3KA 1A46H 1K1OA 1ZGIA 2FOFA 3TJUA 2W7UA 1DX5M 1Q3XA 3UWJH 1D4PB 1GI2A 1HFDA 1GHVH 1O3CA 3ZVFA 3W94A 4NA9H 4GSOA 5DO4H 3VGCB 2VWLA 4XDEA 4MPUA 3MU4A 1MAXA 1WBGB 1KXBA 2BLVA 1P3CA 2VINA 2ZDLA 3QO6A 3C27B 1HV7A 1JRSA 8ESTE 3GCNA 2FIRH 2OC7A 3CENA 1HYLA 3ESTA 2ZGHA 3KL6A 1QA7A 2ZU2A 4FUBA 2ZHQH 2CHAB 1FAXA 5A8XA 1MCVA 3A82A 1AIXH 4YLQH 3ZVGA 1LVYA 3MMGA 4RKJB 1XUIA 3D62A 1HB0B 3GCHB 2XTTB 2VGCB 1GJBB 3LONA 4R8TB 5JB8S 5ETXA 4JCNA 1A0HB 2P16A 2BLOA 2VIVA 2UWPA 5A2MH 1GMHF 4Y71A 3M35A 4KTCA 2R0LA 5LPFA 1W10U 4I31A 1HAZB 2XBXA 3F1SB 5A0BA 1F0UA 2XC4A 2CGAA 1GJDB 3FVFB 2AERH 1O2UA 4JYVH 1Y59T 2V3HH 4NCYA 4AX9H 4JZEH 4KP0A 3A7ZA 3KQCA 5A0AE 4X2XA 1F92A 1GGDB 2CV3A 1ZGVA 1L4ZA 3VB5A 1ABIH 3FP7E 1EZSC 1MTUA 1VITF 5DP9A 1D6RA 1ELCA 1FLEE 1V2TT 2PKSC 3A89A 2JH5D 2VVVA 4GCHG 1FI8A 3ZVDA 1V2WT 4B2AA 1GJ6A 1SVPA 3FZZA 3S9AA 1O5CB 4Y7BA 1UTLM 4Y8XA 1CBWB 1FONA 1Z71A 1DUEA 3GY2A 3M7QA 2OQ5A 3A8CA 5H4IB 5ABWA 1BB0B 4TPIZ 4XFQA 2SNWA 3PV4A 1OYTH 1HAOH 1O30A 1QCPA 3BTEE 1V2UT 1O2RA 2ALVA 1S0RA 2OC8A 2W3IA 1WAYB 1AE8H 2D8WA 1SFIA 5PTPA 3ZVCA 3A81A 1GBEA 2GZ8A 4BAOB 1TGTA 2RCEA 5HGGA 2AH4X 4ZKOU 5JBAS 1DM4B 3BTGE 3ZZ7A 1ARCA 1HAYB 1SGYE 4UEHH 1FIZA 2PTCE 3TGKE 2O8UA 1GCTB 2VWNA 3RMLH 3UREA 1GJCB 3RLWH 2Q1JA 4I8KA 1LPKB 2OQUA 4OS2A 2HNTF 5EQRA 3BTKE 1YPHC 1FDPA 2BZAA 5F8XA 2EI7A 2HNTC 1PFXC 3MO3A 3SGAE 4AG1A 2ZGJA 4HGCA 1TX8A 4FU8A 2BYAX 1ZTKA 3M3SA 1JMOH 1C5LH 5BPEA 1PQAA 3TH2H 2A2QH 2ASUB 4YM9A 2UUKB 2DE8A 1Y3WA 1VITH 3F9FA 3O8BA 2ZHFH 2ZHEH 4DT7B 8LPRA 3M5OA 1PPEE 1YPLH 2FPZA 1EXFA 1AD8H 1DDJA 3RXQA 1EKBB 1W0YH 3OYPA 1P2JA 3PO1C 1TA6A 1KLIH 1PQ8A 2UUYA 4INHA 1EJMA 1EASA 1SGQE 3SNBA