1SGTA

Refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSGAAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Refined crystal structure of Streptomyces griseus trypsin at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase (serine proteinase)
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA02
3GY6A 5AHGH 1UTNA 5DK1A 5ESTE 1GI7B 4NCYA 2ZDKA 1NT1A 2A45B 1O2OA 1LHCH 3FP7E 7GCHF 3LGTA 1XVOA 3LGYA 4FUFA 2YOLA 1ZJKA 3HATH 3ZZDA 4IC6A 3SO3A 2FXRA 1O5GH 1ZTLA 3MH4A 3FZDA 2PSXA 1CHOG 1FXYA 1UTLM 2BY7X 2A0QB 2BLOA 3OX7U 5TCCA 3BG4C 6LPRA 4D7FA 1CGHA 2HOBA 4I8JA 2H9TH 4X1QU 3SV7A 1SG8B 3U98H 4AYVB 1SPJA 4BXWA 1GBBA 2XYAA 5EXMA 2BX4A 3TGJE 1SGCA 2VWLA 1RFNA 3LH1A 1X7AC 1ANDA 3B8JA 4UE7H 1WTHD 2DUCA 1J9CH 2EI6A 4IN1A 4BTUB 4FUIA 4K1TA 2Z9KA 1XM1A 2BY9X 3P8OA 1ESTA 3SUEA 1TYNA 4AZ2B 1IAUA 2QXGA 2C3SA 3TJUA 2AMDA 2ANYA 1AE5A 2BDIA 3E8LA 1CBWB 3R3GB 4D7GA 4NIXA 1CHGA 3MFJA 1Z1JA 2GX4A 3LH3A 4WH6A 5DP4A 2PKSB 4BTTB 1UVOA 5G4BA 2CF9H 1JIMA 2GDDA 1GJ8B 4TWYA 1UTMA 2ZPQA 1C5NH 1ELFA 5EU8A 2GKVE 3SGBE 2QXJA 1D3TB 1OYTH 2TGAA 3VB5A 2A31A 4DCDA 2AGEX 1UVSH 2XTTB 2Y5GA 3BTQE 3G01A 2W26A 3OY6U 2G52A 2G4UA 3M3TA 1BCUH 1VR1H 4U32A 1T8MA 5HGGA 5FX5A 4ZKOU 4GPGA 4ZXYH 3RDZA 3T25A 2FP7B 2HGTH 4INHA 1P3EA 2Q6DA 4Z6AH 4ESTE 3O8DA 3MOCA 1YGCH 3SORA 1C2LA 2XBWA 4BAMB 1P2OA 3SU6A 5BPEA 1HGTH 1MTSA 1S6HA 3S7KB 2FODA 3H7TA 1OWKA 1XKBC 1T8NA 1ZLRA 1ZSKA 1MAYA 3SV9A 1TGTA 2GV7A 5J4SA 1ABJH 4ASHA 5C5NA 1ZSLA 1G3DA 1NY22 3MHWU 1ELEE 1KSNA 3MNBA 1MBQA 5AFYH 3HKJB 5JPMH 1LKBA 1CT2E 1RIWC 5E8EH 3S7HB 1EJAA 3UWJH 3FFGA 1DY9A 2BY6X 2BMGB 2GMTB 3KQBA 1IHTH 2VVUA 2FZZA 3RXUA 5EQQA 3SU3A 2XC0A 3E1XB 1GI9B 1Q3XA 1WYKA 1TRYA 1W12U 2BDAA 2FI3E 1XVMA 3SJ9A 1KXAA 3H5CB 1P3CA 2VIPA 1THRH 2XWAA 5A8XA 5CMXH 2Y6TA 1O2WA 3TNTA 1O2NA 2O9QA 1FLEE 2ALPA 5EPYA 1TAWA 1P0SH 1ZGVA 4Y76A 5GCHF 1GGDC 3SUDA 1LPGB 1VJAU 5LH8A 3ZZ8A 3UPEA 1EAWA 1SGRE 3LGUA 4FUBA 5T3HA 4O3TA 1OXGA 4HGCA 4Y10E 4GCHF 6CHAB 1O2XA 1D4PB 3UWIA 4CRDA 3PWBA 3TH3H 2H6MA 2G8TA 3RXTA 4CRCA 1L1GA 1JOUB 4FUCA 1JBUH 1O3AA 2F91A 1HPGA 2ZFPH 1YM0A 1AD8H 1K1OA 2FOFA 3SZNA 1LKAA 2WV5A 3DUXH 4KTSA 1YPHC 2VH6A 3I29A 1SI5H 1JRTA 3M7QA 3STIA 1W2KH 4B76A 1VITF 2ESTE 1KXFA 2FOMB 2PKAB 1TGNA 2OD3B 3H7OA 2ZTYA 3ZVEA 2O8TA 1FIWA 3GYMA 1UMAH 1L4ZA 2ZU5A 1EZUC 1MQ6A 4NSVA 3SHCH 4BAQB 1NU7B 1GBLA 1E34B 1ZPZA 2EC9H 1TRNA 3SV6A 3M35A 1YP9A 3ZZ6A 1AE8H 3LC5A 3SUGA 3SU4A 1FNIA 1BRAA 1DE7H 3A7YA 2ZDAH 1N1LA 1UO6A 2FI4E 4ZMAH 2ZDLA 1GI8B 1SGNE 1WBGB 1GJ4H 3BIUH 2JH5D 1XX9A 4D9QA 4JZFH 2ZHFH 1P05A 3C1KA 5DP7A 2VIVA 4YT7H 1V2QT 3TGIE 2JH6D 4BNRA 2QXHA 2ZFSA 3GY3A 4ISOA 4WMEA 3O8BA 3P17H 3DD2H 1SOTA 2XBYA 2Z94A 1TGBA 3DFJA 2RA0A 3LGWA 1AQ7A 1QB1A 1P12E 4Y0YE 4I8HA 1GJAB 1SFIA 1K1LA 4Y8XA 1C1RA 1S83A 3W95A 5E2OA 3T62A 1QCPA 4MTBA 3LJOA 3MI4A 1PJPA 3BEIB 3BEFB 4ISHH 1F5KU 2UUFB 1G32B 3RLYH 1O3EA 2VIOA 1SMFE 3O8CA 4MVNA 1TIOA 1LO6A 2FLBH 1DDJA 2HLCA 3E3TA 4JYTA 1G2MA 1UVTH 3MNSA 3A86A 4ABBA 3M5MA 2PKAA 1LHGH 1NN6A 1TQ0B 4TY6A 4I33A 3KQDA 3BG8A 1OWJA 4I32A 3TJOA 1Z8RA 1CO7E 3QWCH 2GCHG 4K8BA 1C5QA 1GMDG 3QTVH 3BTFE 4TWWA 1SLWB 4K1EA 3ODDA 1P10A 1O5CB 3UR6A 3TU7H 3U1IB 1YPEH 3SW2B 4AFZA 3TLOA 1AY6H 1Y5BT 5C2ZA 4Y11E 1MTNC 2Z7FE 4KKDA 1TLDA 1GBIA 2VIDA 3S69A 4CHAC 5CE1A 2FDAA 3F9EA 1WSSH 3PO1B 4M7GA 3UY9A 1OWEA 3SV2H 4CR5A 4XBBA 1GBMA 1GBJA 2ZU2A 1EASA 4NIVA 2IN2A 1BTUA 4AFSA 1TMUH 1FI8A 3F6UH 4K1SA 1E0FD 1EATA 3RXOA 5K7RA 1TOCB 3M36A 2UWLA 5GDSH 1ZSJA 1RD3B 3OYPA 1GJ9B 1K21H 1S84A 4X2YA 1A3EH 5EG4A 1C4Y2 3IG6B 3Q00A 2ZU3A 3ATKA 2ULLA 5HM9A 3GDVA 3KL6A 4BAKB 4JZEH 2A5AA 6CHAC 3CP7A 4F49A 1QB6A 3RU4D 1C1OA 2HNTE 1T7CA 1GHBG 3BTDE 2F9UA 1LPKB 2QYIA 1DUAA 3RXVA 1H9IE 1OP8A 2AYWA 1SGIB 2SFAA 1WCZA 6GCHG 3Q76A 2C8XB 1TX7A 1WV7H 2A2QH 3LT3A 2O8UA 5FX6A 3PTNA 4AFQA 2BDCA 1SLVB 3V13A 4WMFA 3UNRA 1F5LA 3FAOA 1HAYB 1MTWA 4JMYA 2F9OA 3ZZ9A 2OUAA 2R3YA 4MG3A 2BM2A 3E16B 1TBQH 3ZVDA 1P2JA 2BQWB 1UCYK 2FOEA 3BIVH 2ZZUH 3K9XB 1DS2E 2VWOA 1JRSA 4MPXA 1IQFA 1GBAA 2PGBB 1DFPA 2FX4A 4MQAA 3UNQA 2A1DB 3NWUA 2PR3A 1O3KA 2ZFRH 3PMJA 2AFQB 1BB0B 2VWMA 4X8SH 2OC7A 2D26C 4O3UA 1HAPH 1BTYA 1WQSA 3GCTF 2GT8A 1O5FH 2BDHA 1UVPA 4FUEA 1SHHB 8LPRA 5E0GA 1YYY1 2GZ9A 3BTEE 2QC2A 1BDAA 4KGAA 1DITH 3SNBA 3GDUA 2F3CE 3T27A 1RXPA 1SB1H 4SGAE 2FS8A 4A6LA 1YLCA 1Z6JH 2J38A 4ABAA 2ZGCA 1V2WT 1MU8B 1DICA 1ZMJA 1O3CA 1FQ3A 3NKKA 2BHGA 3W94A 1C5PA 1AHTH 1DSUA 2RCEA 4AYYB 1TPAE 3ZZ5A 2W7UA 1C5MD 4FUDA 1AVWA 2GZ7A 3ZVBA 1LHFH 3FZZA 1CT0E 1OSSA 1V2VT 2A7HA 1GBDA 1TPOA 4I8GA 1PYTC 4QT8C 3ZVAA 1SFQB 1KLTA 3KGPA 1HIAB 2ZQ2A 2WPJS 1P2IA 2VU8E 1C5YB 4MNWA 1BJVA 2O8LA 1FPHH 4ZROA 1NRPH 2P8OC 1AIXH 4WF8A 5C20A 2FS9A 2VNTA 4ZKNU 3QGNB 2P3TB 3GDSA 1ZHPA 3M3VA 5J4QA 5F8TA 3RXGA 1RIWB 1KDQB 1GCTC 1QA7A 3TH2H 1MZAA 1O32A 1BJUA 1Y3XA 3SUFA 3KF2A 1YPKH 1F0TA 1F7ZA 4I7YH 3M37A 5EOKA 1W11U 4A1TA 1Y3WA 5CHAC 2FOGA 1SLXB 3BTGE 3PO1C 1SGPE 4DIIH 1XUJA 4XBDA 3VEQB 1VCQA 1AUTC 4U01A 3ZZCA 4B2AA 1IQMA 1BOQA 1W0ZU 1AMHA 1FUJA 1HNEE 4O97A 4E7RG 1O5AB 1DVAH 2FWWA 2SGQE 4FUHA 2H5CA 4AX9H 2ZCLP 5C1UA 2PGQB 5L2YH 3BTTE 1O0DH 1WU1A 4I31A 1BQYA 2D1JA 2Z9JA 1C2HA 1BITA 1O2SA 3A85A 2A2XH 1LQEA 1CU1A 4KELA 1AZZA 2ODYB 3PROA 3S0NA 1P2KA 5JBBS 1Z6EA 4UD9H 1C5TA 3MYWA 4DIHH 1GBCA 1PYTD 3VGCB 1C2IA 1AFQB 1M9UA 3GY4A 4BAOB 5GWZA 2CN0H 4X2WA 2C90B 4HFPB 4K69A 5EPNA 5AVDA 5JYIA 5JDUB 1FY3A 1HIAA 3A88A 1CGIE 2A4GA 5BRRE 1F0SA 3A80A 2BLWA 1XXFA 1RTFB 1RTKA 5DP5A 3KQCA 1E36B 2CV3A 4WVPE 4BOHA 1J8AA 2WYJA 3FP8E 1UTPA 4B75A 3VXEH 1A46H 2B7DH 1OWDA 3LGVA 1XXDA 3MH5A 1HFDA 3PV4A 1G3BA 3RXKA 1CE5A 3EA7A 1N8OC 1DSTA 1KDQA 2BD8A 1GJ6A 3E91A 1PPHE 3ZV8A 1QR3E 3RC4A 1C1PA 2FOCA 1K1IA 2QXIA 1W0YH 4Y71A 1LMWB 5A0BA 1HXFH 4U2WA 1MBMA 1SSXA 1HLTH 1WQVH 5JBCS 1S82A 3MU8A 4O03A 3EYDA 4FVBA 2W5EA 3OSYA 1INCA 1W13U 3S9CA 4DW2U 1H8DH 1UK4A 1XKAC 2OCVB 2SGPE 1B7XB 1EJNA 1NRSH 1L4DA 3ODFA 1V2KT 1JIRA 3HK6B 5FBIA 3D49H 5GXPA 1QFKH 5T6DA 1ETRH 2B8OH 1LCYA 3UTUH 1S0QA 3SJOA 1PQ5A 1TBRH 1FMGA 2ZGJA 2OQUA 2D8WA 1IHSH 1P11E 2WUCA 3A83A 1BT7A 1QRWA 1ZMLA 4BAHB 3U1JB 1LHEH 2QGRA 5FAHA 4ZH8A 1PQ7A 4UFGH 5C5OA 1CA8B 4IW4E 4LOYH 3BEUA 1O3NA 1O2PA 2CHAB 1IQGA 4J1YA 1QA0A 1EUFA 3MNCA 1SGFA 3BN9A 3LOXA 1C9PA 1Z8GA 2ZECA 3RMMH 1F5RA 2SNWA 3ZZ4A 1Z71A 3A89A 4GSOA 1GVZA 2OC8A 5I25A 3D62A 5GPIB 1K2I1 1B0FA 2TBSA 1O2RA 1V2LT 2RG3A 4ZXXH 3K2UA 2J9NA 1OYQA 2ZNKH 2B0FA 1CVWH 3IITA 1GDQA 3PMAB 1HBTH 5FPTA 2OTVA 4ABHA 4TY7A 4MPVA 1TE0A 1LPZB 3Q3KA 1O2YA 3RC6A 5DP8A 1AI8H 2XBXA 2PTCE 2AIQA 1DWCH 7GCHG 2P3UB 1QIXB 4H4FA 4DT7B 2Z6BD 1HJ8A 4XE4A 5EQSA 4HZHA 1GBHA 1O37A 1RJXB 5DP9A 5JBAS 4ABIA 2F83A 1DT2A 2FOBA 3RXEA 3A7XA 3T28A 1IQNA 2Z3EA 4TPYA 3T26A 1ARCA 1EPTC 1GBKA 1O31A 2EI8A 1MTNB 2ANMH 1AGJA 1C4U2 4CHAB 2VB0A 4NWKA 1V6DA 4AGKA 1ABIH 1TX6A 4A1XA 2R3UA 5A0AE 2B5TB 1BA8B 1FY1A 1YCPM 1G30B 4H6SB 2OXSA 3URDA 3QDZB 3SNDA 3SU0A 2FEQH 1UCYH 4X6OA 2BDGA 4ABJA 2G5VA 2R2MB 2A5IA 1H9HE 1YLDA 1P2QA 3Q77A 3GY8A 3ATLA 2TGTA 3DFLA 3VGCC 1AFQC 1QQUA 2BD2A 5FBEA 1GHAF 1EKBB 1Z8JB 3L6PA 1F0UA 1EQ9A 2FYRA 3Q3YA 4OGYA 1ELVA 1OPHB 1T8LA 1C1UH 2R2WU 1TX8A 1FZZA 2ZGBH 2G00A 2ZTXA 3QK1A 4YOGA 4ZAEA 3P95A 3P70B 3ZZ7A 2EI7A 2QCYA 4H42U 4IGDA 3SJ8A 1NPMA 3KHVA 1KLJH 5AFZH 1O3DA 2AH4X 4NSYA 4YO9A 3ZYDA 1XUKA 1Y5UT 4CREA 2GCHF 1ESAA 1GMDF 4NFEA 3SOSA 1IQKA 3PTBA 1MKWH 5C3NA 1MU6B 1GI2A 1C1QA 1Q2WA 7ESTE 2ZO3H 3HGNA 1L2EA 1MTVA 1GBTA 2AEIH 2QY0B 3BTKE 1DY8A 2ZU4A 4LZ4B 2GTBA 1GMHF 2NU0E 2QAAA 2PUQH 1DUEA 1C2GA 7LPRA 2H9EH 1ZHRA 2OQ5A 3V12A 1YC0A 2BYAX 1A0LA 4E7NA 3P6ZB 3PLBA 1MUEB 2HNTC 4WXVA 1HAIH 3EAJA 2BOKA 1C5OH 1C5RA 2Q1JA 4B74A 1D3DB 4KP0A 1SLUB 2GT7A 1S85A 1SQTA 1TRMA 4GUXA 8GCHG 1FY8E 5E0JA 4IMQA 4ABDA 1NO9H 2O8WA 1THPB 4XSKU 3SI4H 1EB2A 1MZDA 3UREA 4CRGA 1GHBF 3QZQA 2CHAC 4LZ1H 3U8RH 5A8ZA 3A84A 5DO4H 2W3KA 1O2KA 2V3HH 3SGQE 1O3BA 6GCHF 1QJ7B 4BXSA 2SGFE 3TVJB 2PV9B 1HXEH 1NESE 1G37A 2BY5X 2PFEA 2FOAA 8ESTE 4DVAU 5C1YA 2BDYA 2W7SA 1S0RA 2A7CA 3SHAH 3I77A 1EOLA 1GI0A 4LK4A 1BBRH 2TIOA 1P9SA 2BD3A 2ZA5A 4THNH 4GCHG 5PTPA 1Z8IB 3MO3A 2O8MA 2BQ7B 2ZTZA 4MPUA 2F9NA 9ESTA 1D6RA 2P8OB 1QBOA 1ETTH 2OLGA 1MKXK 1V2PT 1C1SA 3NUMA 4WXIA 1K1MA 3ZZAA 4BTIB 2NU3E 1UK2A 4ABGA 2K1QA 2ZWLH 2P59A 4X2VA 3LPRA 3C27B 3BTHE 4A92A 2F9BH 1SHYA 3UR9A 4GAWA 1GCTB 3SNEA 1F2SE 1BMAA 3NK8A 2ZQ1A 4UEHH 1O3MA 1UHBB 2ODQA 3LC3A 2STAE 4AG2A 1P2MA 4YM9A 3S9BA 3SQEE 5JBTA 5CHAB 1YF4A 1T4VH 3MWIU 2Z9LA 2FLRH 2HNTF 3A8DA 4B2CA 1FONA 3RXRA 5LPRA 4A5TS 1QJ6B 2NU4E 3EA8A 1QY6A 4VGCC 2FM2A 1L1NA 1HAHH 5B6OA 4XBCA 1LVBA 1AWHB 2C8WB 3HPTB 4X6PA 2XC5A 4D8NA 1W3CA 1S81A 1TB6H 3GY2A 1CSOE 3VPKA 4YTAA 4LXBH 1O3LA 1MTUA 1GG6B 3LONA 3KEEA 4AGJA 1KTSB 2BLVA 3A82A 4MPWA 3TK9A 2BXTH 1IQIA 2C4FH 1GVLA 3SU5A 1UVUH 1GI4A 1IQHA 1C1VH 2D2DA 3PMHB 4Y79A 3RXLA 1LQDB 1A61H 3RXSA 1SC8U 4XOJA 1BIOA 3N7OA 2ZC9H 1SQAA 3T29A 1A1RA 2ZCKP 2BDBA 1P57B 1K28D 2CMYA 2HVXA 2OC1A 3GCHC 2G5NA 1ZTKA 4RSPA 1PPCE 1V2ST 5HXFA 1A5GH 4INKA 1QGFA 2HWLB 4BANB 2H1UA 5F6MA 1GHVH 3BF6H 1O34A 1Y59T 1NFWA 2GZ8A 3Q3XA 1GJBB 4A1VA 1JWTA 2SGDE 1N8OB 1ZPCA 5AF9H 1E38B 2ASUB 1QURH 1UHBA 4FVDA 4OS2A 1OX1A 1O2IA 1LVYA 1O5BB 1WOFA 2VJ1A 1UK3A 5FXLA 3QLPH 1J17T 1ANEA 4RKJB 3A8BA 1HB0B 2G81E 1A0JA 2FTLE 1CA0B 1P2NA 4R8TB 2PHBA 4KTUA 2WINI 4AB9A 1CQQA 4WWYA 2HRVA 1TBZH 2SGEE 3PLPA 1KXDA 1VGCC 3AW1A 4I8LA 5FCKA 2BLQA 1Q31A 1TFXA 1MH0A 1QNJA 1TABE 2HPPH 4Y7AA 3CS0A 1FAKH 4J2YB 3GYLB 1P02A 2JH0D 1MKWK 1OKXA 2BTCE 1KYNA 4CBOA 3KIDU 2OC0A 5HYOA 1IQLA 2BQ6B 3FANA 4JYVH 1AUJA 5EW2H 2XRCA 1TNIA 5EQRA 1YKTA 3V0XA 1ZTJA 1IOEA 1YPGH 2ALVA 4NIYA 2FYQA 4B73A 2A32A 3ATIA 1NFXA 3NZIA 2AS9A 1DWDH 1DXPA 1PQ8A 1Z7KA 1VZQH 1TOMH 1BHXF 1CHOF 4Y0ZE 1ZHMA 1GI5A 1JMOH 4X6MA 1O2QA 2ZGHA 2BVRH 2Y7XA 4FUJA 4ABEA 2ZF0H 4RKOB 4TPIZ 1C5XB 1O2TA 2VGCB 4K60A 4CR9A 2PWXA 2EEKA 2JETC 4YZUA 2XW9A 1O30A 5FPSA 4MNYA 3STJA 3P92A 3FVFB 4Q7YA 4CH8B 2ILNA 2GVFA 1ZOMA 1KY9A 2UUYA 4U30A 1MAXA 4AG1A 1C5LH 4DGJA 2A4OA 1GJ7B 2FOHA 4FXGH 1G2LA 3RXHA 5JB8S 2ANWA 1EPTB 3ATMA 1ELTA 3PYHA 3OTJE 1EAUA 2V6NA 4ZKRU 1E35B 1MCTA 1O3GA 1K22H 1BBRK 1D3PB 3MU1A 4JYUH 3A7ZA 5DGJA 1SGTA 3PB1E 3A7TA 1GI1A 1FN8A 3A81A 2QIQA 3U69H 1SGQE 1ELBA 2PTNA 3DHKH 3URCA 2YNBA 3TIUA 1C1MA 4AFUA 1GMCG 5I46H 2J94A 2STBE 3TK5A 4YESB 3PLKA 1GG6C 3RXBA 1AKSB 1NRNH 2BD9A 2FO9A 3SI3H 1O2VA 2HPQH 5TJXA 2CJIA 1IQEA 1XUHA 4YLQH 5DPAA 4AB8A 1QL9A 3D65E 2QF0A 4AN7A 2B9LA 4CRFA 2TRMA 3GISB 1KXCA 4IN2A 1PPEE 1TA2A 4ISNA 5L30H 1TMTH 2UWOA 2Y5FA 1OP0A 2FPZA 1PPBH 2NWNA 4Q2KA 1NRQH 3ZVFA 1WUNH 1O2LA 1SGYE 2VWNA 4B1TA 3LU9B 1A7SA 2UWPA 3VB7A 1PPFE 5F03A 2CGAA 2FIRH 1P03A 1NC6A 4IBLH 3EDXB 1ZR0A 1KLIH 2VIQA 1ZGIA 2A5KA 2I6QA 3ESTA 3EE0B 3IWMA 2G4TA 3U8TH 2ANKH 1UTJA 3M3SA 2ZEBA 1AO5A 2CXVA 4OS5A 3HKIB 1AWFH 4GHQA 1NFYA 2Q6FA 5HM2A 3ITIA 1C5WB 1G3EA 1AN1E 1EPTA 1FAXA 2AERH 1H9LB 1HYLA 3OY5U 1PFXC 1NRRH 1CA0C 1B0EA 2BD7A 4GHTA 4ZHMU 5DKMA 5ETXA 1JXPA 2ZIQH 1G3CA 3UQOA 2QV1A 1O35A 3BTWE 1VCPA 4OS1A 1EAXA 2ZI2H 1GBEA 1RTLA 1ZMNA 1NFUA 5T6GA 4X8VH 1SBWA 5IDKA 2Y5HA 1MKXH 2SNVA 4JK5A 2ZDVH 2WYGA 1O2MA 3F9FA 4D76A 4UONA 5FHTA 3TJNA 3F9GA 3L33A 1BTPA 3EQ0H 1TPSA 1AKSA 3UNSA 3NPSA 1W8BH 1W7GH 1KIGH 4FU9A 1HDTH 3A7WA 3U9AH 1QTFA 1OP2A 1V2MT 3SU1A 1BUIA 3BSQA 3DT0H 3QTOH 5FPYA 1YPJH 4K8YA 1TNGA 1ETSH 3QGJA 3GCNA 3RXDA 3LGIA 4AORA 1O5EH 2XCFA 2C8YB 2GP9B 1O2ZA 1GDNA 1NZQH 2GCTB 2P94A 1DM4B 1VITH 1GPZA 4NA9H 3UOUA 1O3HA 1OS8A 1DWEH 2IOTA 1DANH 1W14U 2ZDMA 1BMLA 5A09A 2NU2E 4K5ZA 4OS4A 1DLKB 1EB1H 1ELAA 2VGCC 2AMQA 1HJ9A 3MH7A 3ZZ3A 1YPLH 6ESTA 5E2PA 1O3JA 1U6QA 2DE8A 3RMNH 3QN7A 4WY3A 1TA6A 3AAVA 2AMPA 5FCRA 3SV8A 2ZCHP 3P8GA 1VCWA 2WPIS 2BOHB 1GDUA 1YCPK 3F9HA 1O36A 5EW1H 4E06H 5DJ7A 1SGEE 1HV7A 1Y5AT 1GWAA 2ZHEH 2PSYA 4NA7A 1MCVA 1O3IA 1ORFA 4NIWA 1PPZA 2ZPRA 1V2RT 4FU8A 1TMBH 3ZV9A 3E0PB 2BZ6H 1D6WA 1SR5C 3NXPA 2G55A 3UQVA 2LNCA 2XXLA 1AZ8A 4OGXA 5JB9S 1QB9A 4MLFB 4Y6DA 1QRZA 3VB6A 1TGSZ 3RC5A 1C5SA 4VGCB 1B5GH 4OS7A 1C1WH 1AU8A 3GICB 1W7XH 1S6FA 1WAYB 1NTPA 1P09A 2FMJA 8GCHF 1QQ4A 4X1RU 1XMNB 1G9IE 2OINA 2THFB 1BTXA 1AB9C 4IMZA 3M5NA 1DPOA 3HK3B 1O39A 1C1TA 1GVKB 2GDEH 4Q7XA 5EODA 3QUMP 3JZ1B 2FI5E 2Z9GA 5F8XA 3SN8A 1ANBA 4JCNA 3ZVGA 2BD4A 2ZFQH 1V2OT 4WMDA 3TK6A 2AGIX 1SVPA 5DG6A 3UFAA 1T32A 2C8ZB 5LGOA 1W10U 3MH6A 1EZXC 1T4UH 3RU4T 1A2CH 5E0HA 2RDLA 2BB4A 1FIZA 1GHXH 3GCHB 1T31A 1OWIA 1UJ1A 2WPMS 1BHXB 4FUGA 4CH2B 3F1SB 1KTTB 3ZZBA 2IJOB 4X1NU 3OU0A 2ZHWH 4KTCA 3EGKH 3AW0A 2WUBA 8KME2 3UIRA 1GJDB 1PQAA 1SQOA 5EXLA 1FY4A 2VH0A 1GHYH 2VIWA 1CT4E 3VFEA 1O38A 3M5OA 1QL7A 1V3XA 2PW8H 2ZDNA 2P16A 1K1JA 1IQJA 1BTZA 4IC5A 1AVGH 1ZPBA 2J2UA 3FP6E 1ZZZA 4Y8YA 5K0HA 1GHZA 1UTKA 4O9VA 1NROH 1LHDH 1ZYOA 1TALA 1C5ZB 1GJ5H 4X0WU 2KAIB 4JZ1A 3K6YA 4FU7A 1NU9A 1EP5A 3E6PH 1TGCA 2JKHA 3LIWA 1A3BH 4K3JA 1L0ZA 5L6NH 3M61U 2BVXH 2R0LA 5SGAE 1ZJDA 5IYTA 3LKWA 3MU4A 1Y3UA 1V2TT 1TONA 3SU2A 3RXPA 1GI6A 2WV4A 4X1SU 2GV6A 1VGCB 3SQHE 1BZXE 1G36A 3M7TA 1O2GH 1O2JA 2XWBI 3RXQA 2GD4B 1CBWC 3SJIA 1C2EA 2FTMA 2Z9IA 3K65B 4NA8A 1LVOA 1XUGA 1FDPA 2Z3CA 3PMBB 3P8FA 2UUJB 2PKSC 2I6SA 4X8TH 2W3IA 4WJG2 3I78A 3A7VA 1D3QB 5GCHG 5TCAA 1MD8A 3TPIZ 1C5VA 5A2MH 1BRUP 3T5FH 3V7TA 1HUTH 2OBQA 1ELGA 1P04A 1ELDE 1TNKA 1HAZB 2IPHA 2GCTC 3VB3A 2V35A 1OWHA 1KXEA 1A0HB 1EP6A 4ZHLU 4DG4A 1QRXA 1KXBA 1TNHA 4PROA 3TH4H 2YNAA 1PPGE 2R9PA 4TYDA 2V0BA 1H4WA 2J92A 1GHAG 1C5UA 2ZGXH 3JZ2B 3VXFH 2TGPZ 1QBNA 3RXMA 1A5IA 3VB4A 4NFFA 3GOVB 1SL3A 5C67A 1AVXA 3DA9B 2ZPSA 2F9PA 2JETB 2P95A 4X2XA 3KN2A 4Q80A 3P8NA 2Y82A 4A7IB 4B71A 2SGAA 1UCYE 2A4QA 2XC4A 2ZKSA 4ISIH 3A8CA 3GY5A 1Y3YA 3TGKE 4WH8A 4INLA 1VITG 3ZVCA 2A7JA 2PLXA 4Q7ZA 2TPIZ 2A4RA 1LVMA 1DX5M 2KAIA 1P9UA 1FJSA 4YOJA 1S5SA 2ZHDA 2GMTC 5DP3A 3GCOA 1YPHE 4NZLA 1ESBA 1HAOH 3D23A 1A5HA 3RM2H 2VVVA 1TNJA 2PUXB 1F0RA 4X1PU 3RM0H 2LPRA 4RN6A 2ZG0H 3RLWH 1T8OA 1GMHG 1HRTH 1TPPA 1QHRB 2H9HA 5LPEA 1GBFA 1FPCH 2ZHQH 1O3PB 4JZDH 1THSH 1C2KA 3RXJA 1XUIA 5ABWA 2P93A 1DWBH 4NG9H 3M7UA 1HAVB 1P8VC 2AIPA 3AVZA 5A0CA 3NCLA 7KMEH 3SBKA 3MO6A 5GJ4B 2RA3A 1J16A 2UUKB 1HJAB 3CS7A 4NGAH 1GJCB 1RGQA 3RUOA 1BMNH 3ELAH 1ZRKA 3KNXA 1C4V2 1SOZA 3WY8A 4NZQA 1SGFG 4H6TA 1FV9A 1ANCA 4ZUHA 2BVSH 1F92A 3PM3A 3TITA 2QF3A 2CF8H 1EOJA 2VVCA 5C1XA 5ESBA 2NU1E 1V2NT 1O2HA 4JK6A 1C9TA 3B9FH 5T6FA 1HAGE 1UTOA 1GL1A 1RRKA 3RU4E 1OOKB 2QN5T 1Z1IA 4X8UH 3K6ZA 1J14A 3BG4B 1MMJN 3MO9A 2VINA 1H1BA 4DURA 1YBWA 2BD5A 1V2JT 2J95A 4JZIA 3SGAE 1EX3A 1BRBE 2GGVB 1BRCE 2OBOA 2F9VA 3RMLH 4DJZB 1K1PA 4DY7B 1J15A 1BBRE 2XCNA 1GMCF 3RXCA 1LDTT 2HALA 3RXIA 2ZFTA 1C2FA 4IS5A 1MD7A 4ZHAA 3SNCA 4MDSA 1ZRBA 3PWCA 4MNXA 3BV9B 1K1NA 1YCPH 4R0IA 4MNVA 1C2MA 1ID5H 5LPFA 4DOQA 4K2YA 2R0KA 2M5TA 1YPMH 4F4OC 2WPHS 4CRBA 1EZSC 2XNIA 1HAVA 1DOJA 4E05H 1K9OE 3LDXH 4I8KA 2G51A 1O33A 1TNLA 5DP6A 1RS0A 2BY8X 5F8ZA 1EAIA 3UOPA 2C93B 1H8IH 1O2UA 3EA9A 2ODPA 1D9IA 2BX3A 3RMOH 4AOQA 1O3FA 1CGJE 3SNAA 4D9RA 3MU5A 4XDEA 4UDWH 3M5LA 3GY7A 5A8YA 1HAXB 1BMMH 2Y80A 1TQ7B 4Y7BA 4UFEH 1GL0E 9LPRA 4YOIA 1E37B 2ZP0H 4B2BA 2J4IA 3T2NA 4GVUA 3BTME 3QX5H 1ACBE 1C2DA 3HGPA 2WPLS 3SJKA 4Z0KA 1FN6A 1BTHH 2OP9A 3ZYEA 4YLUA 2FESH 3E90B 3TJVA 1UTQA 3MNXA 2H5DA 1TWXB 3AAUA 1XUFA 3A8AA 5GIBA 2P3FH 2Y81A 2J34A 4UFDH 4ZKSU 3QO6A 1N6YA 1Y3VA 1NM6A 5L2ZH 1QBVH 5HMAA 2DE9A 3CENA 2Z3DA 1GI3A 3MU0A 1LTOA 4HI3A 3QZRA 4X6NA 1P01A 5EXNA 3MTYA 4NWLA 4YT6H 1ELCA 1EJMA 3R0FA 4CBNA 2Y7ZA 1Y8TA 3ATWA 1QL8A 3L3TA 4Y8ZA 3TNSA 3ENSB 3KCGH 3F68H 1C2JA 3V3MA 4XFQA 2AGGX 3A87A 1O5DH 2BZAA 4OS6A 3GCTG 4ISLA 1FY5A 2QA9E 1A4WH 3S9AA 2BXUH 1AB9B 1C1NA 1EXFA 4ABFA 1HCGA 3B23B 2ZU1A 1O3OA 1N6XA 2TGDA 3E0NB 4GLYA 3MMGA 3UUZA 2Q6GA 1V2UT 1DXWA 2FX6A 2XBVA 3KQEA 1P06A 1MQ5A 3LJJA 4SGBE 5EGMA 3RP2A 3U8OH 4CRAA 1GGDB 1NS3A 1DLEA 2WPKS 2ZFFH 1L1JA 2V3OH 3O8RA 1EZQA 3RXFA 1SGDE 5H4IB 1QJ1B 1GHWH 4HTCH 1VJ9U 1HJAC 3RXAA 1BTWA 4UFFH 1ARBA 1WTGH 1AFEH 2H2ZA 3AASA 1GCDA 2EA3A
chains in the Genus database with same CATH superfamily
3GY6A 5AHGH 3KYFA 1UTNA 5DK1A 5ESTE 1GI7B 4NCYA 2ZDKA 1NT1A 2A45B 1O2OA 1LHCH 3FP7E 7GCHF 3LGTA 1XVOA 3LGYA 4FUFA 2YOLA 1ZJKA 3HATH 3ZZDA 4IC6A 2RFKC 3SO3A 2FXRA 1O5GH 1ZTLA 3MH4A 3FZDA 2PSXA 1CHOG 1FXYA 1UTLM 2BY7X 2A0QB 2BLOA 3OX7U 5TCCA 3BG4C 6LPRA 4D7FA 1CGHA 2HOBA 4I8JA 2H9TH 4X1QU 3SV7A 1SG8B 3U98H 4AYVB 1SPJA 4BXWA 1GBBA 2XYAA 5EXMA 2BX4A 3TGJE 1SGCA 2VWLA 1RFNA 3LH1A 1X7AC 1ANDA 3B8JA 4UE7H 1WTHD 2DUCA 1J9CH 2EI6A 4IN1A 4BTUB 4FUIA 4K1TA 2Z9KA 2RDEA 1XM1A 2BY9X 3P8OA 1ESTA 2KX4A 3SUEA 1TYNA 4AZ2B 1IAUA 2QXGA 2C3SA 3TJUA 2AMDA 4HG6A 2ANYA 1AE5A 3PRBA 2BDIA 3E8LA 1CBWB 1H8HD 3R3GB 4D7GA 4NIXA 1CHGA 3MFJA 1Z1JA 2GX4A 3LH3A 4WH6A 5DP4A 2PKSB 4BTTB 1UVOA 5G4BA 2CF9H 1JIMA 2GDDA 1GJ8B 4TWYA 1UTMA 2ZPQA 1C5NH 1ELFA 5EU8A 2GKVE 3SGBE 2QXJA 1D3TB 1OYTH 2TGAA 3VB5A 2A31A 4DCDA 2AGEX 1UVSH 2XTTB 2Y5GA 3BTQE 3G01A 2W26A 3OY6U 2G52A 2G4UA 3DSPA 5HKKD 3M3TA 1BCUH 1VR1H 4U32A 1T8MA 5HGGA 5FX5A 4ZKOU 4GPGA 4ZXYH 3RDZA 3T25A 2FP7B 2HGTH 4INHA 1P3EA 2Q6DA 4Z6AH 4ESTE 3O8DA 3MOCA 1YGCH 3SORA 1C2LA 2XBWA 4BAMB 1P2OA 3SU6A 5BPEA 1HGTH 1MTSA 1S6HA 3S7KB 2FODA 5C0UA 3H7TA 1OWKA 1XKBC 1T8NA 1ZLRA 1ZSKA 1MAYA 3SV9A 1TGTA 2GV7A 5J4SA 1ABJH 4ASHA 3U28C 5C5NA 1ZSLA 1G3DA 1NY22 3MHWU 1ELEE 1KSNA 3MNBA 1MBQA 5AFYH 3HKJB 5JPMH 1LKBA 1CT2E 1RIWC 5E8EH 3S7HB 1EJAA 3UWJH 3FFGA 1DY9A 2BY6X 2BMGB 2GMTB 3KQBA 1IHTH 2VVUA 2FZZA 3RXUA 5EQQA 3SU3A 2XC0A 3E1XB 1GI9B 1Q3XA 1WYKA 3F0OA 1TRYA 1W12U 2BDAA 2FI3E 1XVMA 3SJ9A 1KXAA 3H5CB 1P3CA 2VIPA 1THRH 2XWAA 5A8XA 5CMXH 1COWD 1O2WA 2Y6TA 3TNTA 5KEDA 1O2NA 2O9QA 1FLEE 2ALPA 5EPYA 1TAWA 1P0SH 1ZGVA 4Y76A 5GCHF 1GGDC 5T1VA 3SUDA 1LPGB 1VJAU 5LH8A 3ZZ8A 3UPEA 1EAWA 1SGRE 3LGUA 4FUBA 5T3HA 4O3TA 1OXGA 4HGCA 4Y10E 4GCHF 6CHAB 1O2XA 1D4PB 3UWIA 4CRDA 3PWBA 3TH3H 2H6MA 2G8TA 3RXTA 4CRCA 1L1GA 3OFND 1JOUB 4FUCA 1JBUH 1O3AA 2F91A 1HPGA 2ZFPH 1YM0A 1AD8H 1K1OA 2FOFA 3SZNA 1LKAA 2WV5A 3DUXH 4KTSA 1YPHC 2VH6A 3I29A 5C94A 1SI5H 1JRTA 3M7QA 3N99A 3STIA 1W2KH 4B76A 1VITF 2ESTE 1KXFA 2FOMB 2PKAB 1TGNA 2OD3B 3H7OA 2ZTYA 3ZVEA 2O8TA 1FIWA 3GYMA 1UMAH 1L4ZA 2ZU5A 1EZUC 1MQ6A 4NSVA 3SHCH 4BAQB 1NU7B 1GBLA 1E34B 1ZPZA 2EC9H 1TRNA 3SV6A 1E1RD 2KFWA 3M35A 1YP9A 3ZZ6A 1AE8H 3LC5A 3SUGA 3SU4A 1FNIA 1BRAA 1DE7H 3A7YA 3WWBA 2ZDAH 1N1LA 1UO6A 2FI4E 4ZMAH 2ZDLA 1GI8B 1SGNE 3PV2A 1WBGB 1GJ4H 3BIUH 3VG8A 2JH5D 1XX9A 4D9QA 4JZFH 2ZHFH 1P05A 3F2HA 3C1KA 5DP7A 2VIVA 4YT7H 1V2QT 3TGIE 2JH6D 4BNRA 2QXHA 2ZFSA 3GY3A 4ISOA 4WMEA 3O8BA 3FN8A 3P17H 3DD2H 1SOTA 2XBYA 2Z94A 1TGBA 3DFJA 2RA0A 2K0QA 3LGWA 1AQ7A 1QB1A 1P12E 3DSOA 4I8HA 4Y0YE 1GJAB 1SFIA 1K1LA 4Y8XA 1C1RA 1S83A 3W95A 4OM9A 5E2OA 4TT3D 3T62A 1QCPA 4MTBA 3LJOA 3MI4A 2HLDD 1PJPA 3BEIB 3BEFB 4ISHH 1F5KU 2UUFB 1G32B 3RLYH 1O3EA 5HIZA 2VIOA 1SMFE 3O8CA 4MVNA 1TIOA 1LO6A 1EFRD 2FLBH 1DDJA 2HLCA 3E3TA 4JYTA 1G2MA 1UVTH 3MNSA 3A86A 4ABBA 3M5MA 2PKAA 1LHGH 1NN6A 1TQ0B 4TY6A 4P02A 4I33A 3KQDA 3BG8A 1OWJA 3OEED 4I32A 3TJOA 1Z8RA 1CO7E 3QWCH 2GCHG 4K8BA 1C5QA 1GMDG 1YWUA 3N7DA 3BTFE 3QTVH 4P00A 4TWWA 1SLWB 4K1EA 3ODDA 1P10A 1O5CB 3UR6A 3TU7H 3U1IB 1YPEH 3SW2B 4AFZA 3TLOA 1AY6H 3OTPA 1Y5BT 5C2ZA 4Y11E 1MTNC 2Z7FE 4KKDA 1TLDA 1GBIA 2VIDA 3S69A 4CHAC 5CE1A 2FDAA 3F9EA 1WSSH 3PO1B 4M7GA 3UY9A 1OWEA 3SV2H 4CR5A 4XBBA 1GBMA 1GBJA 2ZU2A 1EASA 4NIVA 2IN2A 1WXRA 1BTUA 4AFSA 1TMUH 1FI8A 3F6UH 4K1SA 1E0FD 1EATA 3RXOA 5K7RA 1TOCB 3M36A 2UWLA 5GDSH 1ZSJA 3N7EA 1RD3B 3OYPA 1GJ9B 1K21H 1S84A 4X2YA 1A3EH 5EG4A 1C4Y2 1H8ED 3IG6B 3Q00A 2ZU3A 3ATKA 2ULLA 5HM9A 3GDVA 3KL6A 4BAKB 4JZEH 2A5AA 6CHAC 3CP7A 4F49A 1QB6A 3RU4D 1C1OA 2HNTE 1T7CA 1GHBG 3BTDE 1FX0B 1LPKB 2F9UA 4FETA 2QYIA 1DUAA 3RXVA 1H9IE 1OP8A 2AYWA 1SGIB 2SFAA 1WCZA 6GCHG 3Q76A 4ZCNA 2C8XB 1TX7A 1WV7H 2A2QH 1VKYA 2O8UA 3LT3A 3PTNA 5FX6A 4AFQA 4F48B 2BDCA 1SLVB 3V13A 2GJGA 4WMFA 3UNRA 1F5LA 3FAOA 1HAYB 1MTWA 4JMYA 2F9OA 3ZZ9A 2OUAA 2R3YA 4MG3A 2BM2A 3E16B 1TBQH 3ZVDA 1P2JA 2BQWB 1UCYK 2FOEA 3BIVH 2ZZUH 3K9XB 1DS2E 2VWOA 1JRSA 4MPXA 1IQFA 1GBAA 3OEHD 2PGBB 1DFPA 2FX4A 4MQAA 3UNQA 2A1DB 3NWUA 2PR3A 1O3KA 2ZFRH 3PMJA 2AFQB 1BB0B 2VWMA 4X8SH 2OC7A 2D26C 4O3UA 5HIYA 1HAPH 2W6JD 1BTYA 1WQSA 3GCTF 2GT8A 1O5FH 2BDHA 1UVPA 4FUEA 1SHHB 8LPRA 5E0GA 1YYY1 4RT0A 2GZ9A 3BTEE 2QC2A 1BDAA 4KGAA 1DITH 3SNBA 3GDUA 2F3CE 2HVYB 3T27A 1RXPA 1SB1H 4SGAE 2FS8A 4A6LA 1YLCA 1Z6JH 3F2FA 2J38A 4ABAA 2ZGCA 1V2WT 1MU8B 1DICA 1ZMJA 1O3CA 1FQ3A 3NKKA 2BHGA 3W94A 1C5PA 1AHTH 1DSUA 2RCEA 4AYYB 1TPAE 3ZZ5A 2W7UA 1C5MD 4FUDA 1AVWA 2GZ7A 3ZVBA 1LHFH 3FZZA 3SZEA 1CT0E 1OSSA 1V2VT 2A7HA 1GBDA 1TPOA 4I8GA 1PYTC 4QT8C 3ZVAA 1SFQB 1KLTA 3KGPA 1KMHB 1HIAB 2ZQ2A 2WPJS 1P2IA 2VU8E 1C5YB 4MNWA 2PP6A 1BJVA 2O8LA 1FPHH 4ZROA 1NRPH 2P8OC 1AIXH 4WF8A 5C20A 2FS9A 2VNTA 4ZKNU 3QGNB 2P3TB 3GDSA 1ZHPA 3M3VA 4RT1A 5J4QA 5F8TA 3RXGA 1RIWB 1KDQB 1GCTC 1QA7A 3TH2H 1MZAA 1O32A 1BJUA 1Y3XA 3SUFA 3KF2A 1YPKH 1F0TA 1F7ZA 4I7YH 3M37A 5EOKA 1W11U 4A1TA 1Y3WA 5CHAC 2FOGA 1SLXB 3BTGE 3PO1C 1SGPE 4DIIH 5EJ1A 1XUJA 4XBDA 3VEQB 1VCQA 1AUTC 4U01A 3ZZCA 3EE7A 4B2AA 1IQMA 1BOQA 1W0ZU 1AMHA 1FUJA 1HNEE 4O97A 4E7RG 1O5AB 1DVAH 2FWWA 2SGQE 4FUHA 2H5CA 4AX9H 2ZCLP 5C1UA 2PGQB 5L2YH 3BTTE 1O0DH 1WU1A 4I31A 1BQYA 2D1JA 2Z9JA 1C2HA 1BITA 1O2SA 3A85A 2A2XH 1LQEA 1CU1A 2KCYA 4KELA 1AZZA 2ODYB 3PROA 3S0NA 1P2KA 5JBBS 1Z6EA 4UD9H 1C5TA 5C17A 3MYWA 4DIHH 1GBCA 4Z1MD 1PYTD 3VGCB 2VBCA 1C2IA 1AFQB 1M9UA 3GY4A 3W1EA 4BAOB 5GWZA 2CN0H 4X2WA 2C90B 3DSGA 4HFPB 4K69A 5EPNA 5AVDA 5JYIA 5JDUB 1FY3A 1HIAA 3A88A 1CGIE 2F4LA 2A4GA 5BRRE 1F0SA 3A80A 2BLWA 1XXFA 1RTFB 1RTKA 5DP5A 3KQCA 1E36B 2CV3A 4WVPE 4BOHA 1J8AA 2WYJA 3FP8E 1UTPA 4B75A 3VXEH 1A46H 1E1QD 1OWDA 2B7DH 3LGVA 1XXDA 3MH5A 1HFDA 3PV4A 1G3BA 3RXKA 1CE5A 3EA7A 1N8OC 1DSTA 1KDQA 2BD8A 1GJ6A 3E91A 1PPHE 3ZV8A 1QR3E 3RC4A 1C1PA 2FOCA 1K1IA 2QXIA 2WHXA 1W0YH 4Y71A 1LMWB 5A0BA 1HXFH 4U2WA 1MBMA 2K8IA 1SSXA 1HLTH 1WQVH 5JBCS 1S82A 3MU8A 4O03A 3EYDA 4FVBA 2W5EA 3OSYA 1INCA 1W13U 3S9CA 4DW2U 1H8DH 1UK4A 1XKAC 2OCVB 1YY3A 2SGPE 1B7XB 1EJNA 1NRSH 1L4DA 3ODFA 1V2KT 1JIRA 3HK6B 5FBIA 3D49H 5GXPA 1QFKH 5T6DA 1ETRH 2B8OH 1LCYA 3UTUH 1S0QA 3SJOA 1PQ5A 1TBRH 1FMGA 2ZGJA 2OQUA 2D8WA 1IHSH 1P11E 2WUCA 3A83A 1BT7A 1QRWA 1ZMLA 4BAHB 3U1JB 1LHEH 2QGRA 5FAHA 4ZH8A 1PQ7A 4UFGH 5C5OA 1CA8B 4IW4E 4LOYH 2V7QD 3BEUA 1O3NA 1O2PA 2CHAB 5CDFE 1BMFD 1IQGA 4J1YA 1QA0A 1EUFA 3MNCA 1SGFA 3BN9A 3LOXA 1C9PA 2EQNA 1Z8GA 2ZECA 3RMMH 1F5RA 2SNWA 3ZZ4A 1Z71A 3A89A 4GSOA 1GVZA 2OC8A 5I25A 3D62A 4AC9A 5GPIB 1K2I1 1B0FA 2TBSA 1O2RA 1V2LT 2RG3A 4ZXXH 3K2UA 2J9NA 1OYQA 2ZNKH 2B0FA 1CVWH 3IITA 1GDQA 3PMAB 1HBTH 5FPTA 2OTVA 3FOAA 4TY7A 4XRNA 4ABHA 4MPVA 1TE0A 1LPZB 3Q3KA 1O2YA 3RC6A 5DP8A 1AI8H 2XBXA 2PTCE 2AIQA 1DWCH 7GCHG 2P3UB 1QIXB 4H4FA 4DT7B 2Z6BD 1HJ8A 4XE4A 5EQSA 4HZHA 1GBHA 1O37A 1RJXB 2J5UA 5DP9A 5JBAS 4ABIA 2F83A 1DT2A 2FOBA 3RXEA 3A7XA 3T28A 1IQNA 2Z3EA 4TPYA 3T26A 1ARCA 1EPTC 1GBKA 1O31A 2EI8A 1MTNB 2ANMH 1AGJA 1C4U2 4CHAB 2VB0A 4NWKA 1V6DA 4AGKA 1ABIH 1TX6A 4A1XA 2R3UA 5A0AE 2B5TB 1BA8B 1FY1A 1YCPM 1G30B 1YLNA 4H6SB 2OXSA 3URDA 3QDZB 3SNDA 3SU0A 2FEQH 1UCYH 4X6OA 2BDGA 2EY4C 3CNRA 4ABJA 2G5VA 2R2MB 2A5IA 1H9HE 1YLDA 1P2QA 3Q77A 3GY8A 3ATLA 2TGTA 3DFLA 3VGCC 1AFQC 1QQUA 2BD2A 5FBEA 1GHAF 5CHBA 1EKBB 1Z8JB 3L6PA 1F0UA 1EQ9A 2FYRA 3Q3YA 3F3BA 4RI0A 4OGYA 1ELVA 2IPQX 1OPHB 1T8LA 4DT4A 1C1UH 2R2WU 1TX8A 2OK5A 1FZZA 2ZGBH 2G00A 2ZTXA 3QK1A 4YOGA 4ZAEA 3P95A 3P70B 3ZZ7A 2EI7A 2QCYA 4H42U 4IGDA 3SJ8A 1NPMA 3KHVA 1KLJH 5AFZH 1O3DA 2AH4X 3DCLA 4NSYA 4YO9A 3ZYDA 1XUKA 1Y5UT 4CREA 2GCHF 1ESAA 1GMDF 4NFEA 3SOSA 1IQKA 3PTBA 2QF4A 1MKWH 5C3NA 1MU6B 1GI2A 1C1QA 1Q2WA 7ESTE 2ZO3H 3HGNA 1L2EA 1MTVA 1GBTA 2AEIH 2QY0B 3BTKE 1DY8A 2ZU4A 4LZ4B 2GTBA 1GMHF 2NU0E 2QAAA 2PUQH 1DUEA 1C2GA 4ACBA 7LPRA 2H9EH 1ZHRA 2OQ5A 3V12A 1YC0A 2BYAX 1A0LA 4E7NA 3P6ZB 3PLBA 1MUEB 2HNTC 4WXVA 1HAIH 3EAJA 2BOKA 1C5OH 1C5RA 2Q1JA 4B74A 1D3DB 4KP0A 1SLUB 2GT7A 1S85A 1SQTA 1TRMA 2WZQA 4GUXA 8GCHG 1FY8E 5E0JA 4IMQA 4ABDA 1NO9H 2O8WA 1THPB 4XSKU 3SI4H 1EB2A 1MZDA 3UREA 4CRGA 1GHBF 3QZQA 2CHAC 4LZ1H 3U8RH 5A8ZA 3A84A 5DO4H 2W3KA 1O2KA 2V3HH 1MABB 3SGQE 1O3BA 6GCHF 1QJ7B 4BXSA 2SGFE 3TVJB 2PV9B 1HXEH 1NESE 1G37A 2BY5X 2PFEA 2FOAA 8ESTE 4DVAU 5C1YA 2BDYA 2W7SA 1S0RA 2A7CA 3SHAH 3I77A 1EOLA 1GI0A 4LK4A 1BBRH 2TIOA 1P9SA 2BD3A 2ZA5A 4THNH 4GCHG 5PTPA 1Z8IB 3MO3A 2O8MA 2BQ7B 2ZTZA 4MPUA 2F9NA 9ESTA 1D6RA 2P8OB 1QBOA 1ETTH 2YMSC 2OLGA 1MKXK 1V2PT 1C1SA 3NUMA 4WXIA 2WSSD 1K1MA 3ZZAA 4BTIB 2NU3E 1UK2A 1W0JD 2QE7D 2K1QA 2ZWLH 4ABGA 2P59A 4X2VA 3LPRA 3C27B 3BTHE 4A92A 2F9BH 1SHYA 3UR9A 4GAWA 1GCTB 3SNEA 1F2SE 1BMAA 3NK8A 2ZQ1A 4UEHH 1O3MA 1UHBB 2ODQA 3LC3A 2STAE 5EJZA 4AG2A 1P2MA 4YM9A 3S9BA 3SQEE 5JBTA 5CHAB 1YF4A 1T4VH 3MWIU 2Z9LA 2LP6A 2FLRH 2HNTF 3A8DA 4B2CA 1FONA 3RXRA 5LPRA 4A5TS 1QJ6B 2NU4E 3EA8A 1QY6A 4VGCC 2FM2A 1L1NA 1HAHH 5B6OA 4XBCA 5DSFA 1LVBA 1AWHB 2XOKD 2C8WB 3HPTB 3PRDA 4X6PA 5B6LA 5IK2D 2KCAA 2XC5A 4D8NA 1W3CA 1S81A 1TB6H 3GY2A 1CSOE 3VPKA 4YTAA 4LXBH 3KQ5A 3OAAD 1O3LA 1MTUA 5GNDA 1GG6B 3LONA 3KEEA 4AGJA 1KTSB 2BLVA 3A82A 4MPWA 3TK9A 2BXTH 1IQIA 2C4FH 1GVLA 3SU5A 1UVUH 1GI4A 1IQHA 1C1VH 2D2DA 3PMHB 4Y79A 3RXLA 1LQDB 1A61H 3RXSA 1SC8U 2AHME 4XOJA 1BIOA 3N7OA 2ZC9H 1SQAA 3T29A 1A1RA 2ZCKP 2BDBA 1P57B 2CK3D 1K28D 2CMYA 2HVXA 2OC1A 3GCHC 2G5NA 2YMSD 1ZTKA 4RSPA 1PPCE 1V2ST 5HXFA 1A5GH 4INKA 1QGFA 2HWLB 4BANB 2H1UA 5F6MA 1GHVH 3BF6H 1O34A 1Y59T 1NFWA 2GZ8A 3Q3XA 1GJBB 4Q63A 1JWTA 2SGDE 4A1VA 1N8OB 1ZPCA 5AF9H 1E38B 2ASUB 4B6FA 3FKSD 1QURH 1UHBA 4FVDA 4OS2A 1OX1A 1O2IA 1LVYA 1O5BB 1WOFA 2WV9A 2VJ1A 1UK3A 5FXLA 3QLPH 2LELA 1J17T 1ANEA 4RKJB 3A8BA 1HB0B 2G81E 1A0JA 2FTLE 1CA0B 1P2NA 4R8TB 2PHBA 4KTUA 2WINI 4AB9A 1CQQA 4WWYA 2HRVA 1TBZH 2SGEE 3PLPA 1KXDA 1VGCC 5DN6D 4YXWD 3AW1A 4I8LA 5FCKA 2BLQA 1Q31A 1TFXA 1MH0A 1QNJA 1TABE 2HPPH 4Y7AA 3CS0A 1FAKH 4J2YB 3GYLB 1P02A 2JH0D 1MKWK 1OKXA 2BTCE 1KYNA 4CBOA 3KIDU 2OC0A 5HYOA 1IQLA 2BQ6B 3FANA 4JYVH 1AUJA 5EW2H 2XRCA 1TNIA 5EQRA 1YKTA 3V0XA 1ZTJA 2JDID 1IOEA 1YPGH 2ALVA 4NIYA 2FYQA 4B73A 2A32A 3ATIA 1NFXA 3NZIA 2AS9A 1DWDH 1DXPA 1PQ8A 1Z7KA 1VZQH 1TOMH 1BHXF 1CHOF 4Y0ZE 1ZHMA 1GI5A 1JMOH 4X6MA 1O2QA 2ZGHA 2BVRH 2Y7XA 4FUJA 4ABEA 2ZF0H 4RKOB 4TPIZ 4ACAA 1C5XB 1O2TA 2VGCB 1K0HA 4K60A 4CR9A 2PWXA 2EEKA 2JETC 4YZUA 2XW9A 1O30A 5FPSA 4MNYA 3STJA 3P92A 3FVFB 4Q7YA 4CH8B 2ILNA 2GVFA 1ZOMA 1KY9A 2UUYA 4U30A 1MAXA 4AG1A 1C5LH 4DGJA 2A4OA 1GJ7B 2FOHA 4FXGH 1G2LA 3RXHA 5JB8S 2ANWA 1EPTB 3ATMA 1ELTA 2KZ4A 3OTJE 1EAUA 2V6NA 3PYHA 4ZKRU 1E35B 1MCTA 1O3GA 1K22H 1BBRK 1D3PB 3MU1A 4JYUH 3A7ZA 1SKYE 5DGJA 1SGTA 3PB1E 3A7TA 1GI1A 1FN8A 3A81A 2QIQA 3U69H 1SGQE 1ELBA 2PTNA 3DHKH 3URCA 2YNBA 3TIUA 1C1MA 4AFUA 1GMCG 5I46H 2J94A 4ASUD 2STBE 3TK5A 4YESB 3PLKA 5EJLA 2L74A 1GG6C 3RXBA 1AKSB 1NRNH 2BD9A 2FO9A 3SI3H 1O2VA 2HPQH 5TJXA 2CJIA 1IQEA 1XUHA 1NBMD 4YLQH 5DPAA 4AB8A 1QL9A 3D65E 2QF0A 4AN7A 2B9LA 4CRFA 2TRMA 3GISB 1KXCA 4IN2A 1PPEE 1TA2A 4ISNA 5L30H 1TMTH 2UWOA 2Y5FA 1OP0A 2FPZA 1PPBH 2NWNA 4Q2KA 1NRQH 3ZVFA 1WUNH 1O2LA 1SGYE 2VWNA 4B1TA 3LU9B 1A7SA 2UWPA 3VB7A 1NBME 1PPFE 5F03A 2CGAA 2FIRH 1P03A 1NC6A 4IBLH 3EDXB 3PV5A 5FL7D 1ZR0A 1KLIH 2VIQA 3F2GA 1ZGIA 2A5KA 2I6QA 3ESTA 3EE0B 3IWMA 2G4TA 3U8TH 2ANKH 1UTJA 3M3SA 2ZEBA 1AO5A 2CXVA 4OS5A 3HKIB 1AWFH 4GHQA 1NFYA 2Q6FA 5HM2A 1E79D 3ITIA 1C5WB 1G3EA 1AN1E 1EPTA 1FAXA 2AERH 1H9LB 1HYLA 3OY5U 1PFXC 1NRRH 4F55A 1CA0C 2KCOA 1B0EA 2BD7A 2J97A 4GHTA 4ZHMU 5DKMA 5ETXA 1JXPA 2ZIQH 1G3CA 3UQOA 2QV1A 1O35A 3BTWE 1VCPA 4OS1A 1EAXA 2ZI2H 1GBEA 1RTLA 1ZMNA 1NFUA 5T6GA 4X8VH 1SBWA 2KM0A 5IDKA 2Y5HA 1MKXH 2SNVA 4JK5A 2ZDVH 2WYGA 1O2MA 3F9FA 4D76A 4I86A 4UONA 5FHTA 3TJNA 3F9GA 3L33A 1BTPA 3EQ0H 1TPSA 1AKSA 3UNSA 3NPSA 1W8BH 2QF5A 1W7GH 1KIGH 4FU9A 1HDTH 3A7WA 3U9AH 1QTFA 1OP2A 1V2MT 3SU1A 1BUIA 3BSQA 3DT0H 3QTOH 5FPYA 1YPJH 4K8YA 1TNGA 1ETSH 3QGJA 3GCNA 3RXDA 3LGIA 4AORA 1O5EH 2XCFA 2C8YB 2GP9B 1O2ZA 1GDNA 3H09A 1NZQH 2GCTB 2P94A 1DM4B 1VITH 1GPZA 4NA9H 3UOUA 1O3HA 1OS8A 1DWEH 2IOTA 1DANH 1W14U 2ZDMA 1BMLA 5A09A 2NU2E 4K5ZA 4OS4A 1DLKB 1EB1H 1ELAA 2VGCC 2AMQA 1HJ9A 3MH7A 3ZZ3A 1YPLH 6ESTA 5E2PA 1O3JA 1U6QA 2DE8A 2YMSB 3RMNH 3QN7A 4WY3A 1TA6A 3AAVA 2AMPA 5FCRA 3SV8A 3FO8D 2ZCHP 3P8GA 1VCWA 2WPIS 5KGOA 2BOHB 1GDUA 1YCPK 3F9HA 1O36A 5EW1H 4E06H 5DJ7A 1SGEE 1HV7A 1Y5AT 1GWAA 2ZHEH 2PSYA 4NA7A 1MCVA 1O3IA 1ORFA 4NIWA 1PPZA 2ZPRA 1V2RT 4FU8A 1TMBH 3ZV9A 3E0PB 2BZ6H 1D6WA 1SR5C 3NXPA 2G55A 3UQVA 2LNCA 2XXLA 1AZ8A 4OGXA 5JB9S 1QB9A 4MLFB 4Y6DA 1QRZA 3VB6A 1TGSZ 3RC5A 1C5SA 4VGCB 1B5GH 4OS7A 1C1WH 1AU8A 3GICB 1W7XH 1S6FA 1WAYB 1NTPA 1P09A 2FMJA 8GCHF 1W0KD 1QQ4A 4X1RU 1XMNB 1G9IE 3UB0A 2OINA 2THFB 1BTXA 1AB9C 3GS9A 4IMZA 3M5NA 1DPOA 3HK3B 1O39A 1C1TA 1GVKB 2GDEH 4Q7XA 5EODA 3UAIC 3QUMP 3JZ1B 2FI5E 2JIZD 2Z9GA 5F8XA 3SN8A 1ANBA 4JCNA 5F53A 3ZVGA 2BD4A 2ZFQH 1V2OT 4WMDA 3TK6A 2AGIX 1SVPA 5DG6A 3UFAA 1T32A 2C8ZB 5LGOA 1W10U 3MH6A 1EZXC 1T4UH 3RU4T 1A2CH 5E0HA 2RDLA 2BB4A 2WPDD 1FIZA 1GHXH 5KECA 3GCHB 1T31A 1OWIA 1UJ1A 2WPMS 1BHXB 4FUGA 4CH2B 3F1SB 1KTTB 3ZZBA 2IJOB 4X1NU 3OU0A 2ZHWH 4KTCA 3EGKH 3AW0A 2WUBA 8KME2 3UIRA 2L6OA 1GJDB 1PQAA 1SQOA 5EXLA 1FY4A 2VH0A 1GHYH 2VIWA 1CT4E 3VFEA 1O38A 3M5OA 1QL7A 5EIYA 1V3XA 2PW8H 2ZDNA 2P16A 1K1JA 1IQJA 1BTZA 4IC5A 1AVGH 1ZPBA 2J2UA 3FP6E 1ZZZA 4Y8YA 5K0HA 1GHZA 1UTKA 4O9VA 1NROH 1LHDH 1ZYOA 1TALA 1C5ZB 1GJ5H 4X0WU 2KAIB 4JZ1A 3K6YA 4FU7A 2F43B 1NU9A 1EP5A 3E6PH 1TGCA 2JKHA 3LIWA 1A3BH 4K3JA 1L0ZA 5L6NH 3M61U 2BVXH 2R0LA 5SGAE 1ZJDA 5IYTA 3LKWA 3MU4A 1QZ8A 1Y3UA 1V2TT 1TONA 3SU2A 3RXPA 1GI6A 2WV4A 4X1SU 2GV6A 3ZIAD 1VGCB 3SQHE 1BZXE 1G36A 3M7TA 1O2GH 1O2JA 2XWBI 3RXQA 2GD4B 1CBWC 3SJIA 1C2EA 2FTMA 2Z9IA 3K65B 4NA8A 1LVOA 1XUGA 1FDPA 2Z3CA 3PMBB 3P8FA 2UUJB 2PKSC 2I6SA 4X8TH 2W3IA 4WJG2 3I78A 3A7VA 1D3QB 5GCHG 5TCAA 1MD8A 3TPIZ 1C5VA 5A2MH 1BRUP 3T5FH 3V7TA 1HUTH 2OBQA 1ELGA 1P04A 1ELDE 1TNKA 2IJD1 2M2AA 1HAZB 2IPHA 2GCTC 3VB3A 2V35A 1OWHA 1KXEA 1A0HB 3NRLA 1EP6A 4ZHLU 4DG4A 1QRXA 1KXBA 1TNHA 4PROA 3TH4H 2YNAA 1PPGE 2R9PA 4TYDA 2V0BA 1H4WA 2J92A 1GHAG 1C5UA 1UW7A 2ZGXH 3JZ2B 3VXFH 2TGPZ 3F0PA 1QBNA 3RXMA 1A5IA 3VB4A 4NFFA 3GOVB 1SL3A 5C67A 1AVXA 3DA9B 2ZPSA 2F9PA 1WDIA 2JETB 2P95A 4X2XA 3KN2A 4Q80A 3P8NA 2Y82A 4A7IB 4B71A 2SGAA 1UCYE 2A4QA 2XC4A 2ZKSA 4ISIH 3A8CA 3GY5A 1Y3YA 3TGKE 4WH8A 4INLA 1VITG 3ZVCA 2A7JA 2PLXA 4Q7ZA 2TPIZ 2A4RA 2JJ2D 1LVMA 1DX5M 2KAIA 1P9UA 1FJSA 4YOJA 1S5SA 2ZHDA 2GMTC 5DP3A 3GCOA 1YPHE 4NZLA 1ESBA 1HAOH 3D23A 1A5HA 3RM2H 2VVVA 1TNJA 2PUXB 1F0RA 4X1PU 3RM0H 2LPRA 4RN6A 3MQKC 2ZG0H 3RLWH 1T8OA 1GMHG 1HRTH 1TPPA 1QHRB 2JJ1D 2H9HA 5LPEA 1GBFA 1FPCH 2ZHQH 1O3PB 4JZDH 1THSH 1C2KA 3RXJA 1XUIA 5ABWA 2P93A 3WW7A 1DWBH 4NG9H 3M7UA 1HAVB 1P8VC 2AIPA 3AVZA 4FOUC 3NCLA 5A0CA 3SBKA 7KMEH 3MO6A 5GJ4B 2RA3A 1J16A 2UUKB 1HJAB 3CS7A 4NGAH 1GJCB 1RGQA 3RUOA 1BMNH 3ELAH 1ZRKA 3KNXA 1C4V2 1SOZA 3WY8A 4NZQA 1SGFG 4H6TA 1FV9A 1ANCA 4ZUHA 2BVSH 1F92A 3PM3A 3TITA 2QF3A 2CF8H 1EOJA 2VVCA 5C1XA 5ESBA 2NU1E 1V2NT 1O2HA 3OE7D 4JK6A 1C9TA 3B9FH 5T6FA 1HAGE 1UTOA 3SYJA 2XNDD 1GL1A 1RRKA 3RU4E 1OOKB 2QN5T 1Z1IA 4X8UH 4XD7D 3K6ZA 1J14A 3BG4B 1MMJN 3MO9A 2VINA 2V3MA 1H1BA 4DURA 1YBWA 2BD5A 1V2JT 2J95A 4JZIA 3SGAE 1EX3A 1BRBE 2GGVB 1BRCE 2OBOA 2F9VA 3RMLH 3KYGA 4DJZB 2W6ID 1K1PA 4DY7B 1J15A 1BBRE 2XCNA 1GMCF 3RXCA 1LDTT 2HALA 3RXIA 2ZFTA 1C2FA 4IS5A 1MD7A 4ZHAA 3SNCA 4MDSA 1ZRBA 3PWCA 4MNXA 3BV9B 1K1NA 4M9FA 1YCPH 4R0IA 4MNVA 1C2MA 1ID5H 4Q4LA 5LPFA 4DOQA 4K2YA 2R0KA 2M5TA 1YPMH 4F4OC 2WPHS 4CRBA 1EZSC 2XNIA 3AK5A 1HAVA 2J98B 1DOJA 4E05H 1K9OE 3LDXH 4I8KA 2G51A 1O33A 1TNLA 5DP6A 1RS0A 2BY8X 5F8ZA 1EAIA 3UOPA 2C93B 1H8IH 2KR7A 1O2UA 3EA9A 2ODPA 1D9IA 2BX3A 3RMOH 4AOQA 1O3FA 1CGJE 3SNAA 4D9RA 3MU5A 4XDEA 4UDWH 1OHHD 3M5LA 3GY7A 5A8YA 1HAXB 1BMMH 2Y80A 1TQ7B 4Y7BA 4UFEH 1GL0E 9LPRA 4YOIA 1E37B 2ZP0H 4B2BA 2J4IA 3T2NA 4GVUA 3BTME 3QX5H 1ACBE 1C2DA 3HGPA 2WPLS 3SJKA 4Z0KA 1FN6A 1BTHH 2OP9A 3ZYEA 4YLUA 2FESH 3E90B 3TJVA 1UTQA 3MNXA 2H5DA 1TWXB 3AAUA 1XUFA 3A8AA 5GIBA 2P3FH 2Y81A 2J34A 4UFDH 4ZKSU 3QO6A 5C0TA 2KCPA 1N6YA 1Y3VA 1NM6A 5L2ZH 1QBVH 5HMAA 2DE9A 3CENA 2Z3DA 1GI3A 3MU0A 1LTOA 4HI3A 1S6LA 3QZRA 4X6NA 1P01A 5EXNA 3MTYA 4NWLA 4YT6H 1ELCA 1EJMA 3R0FA 4CBNA 2Y7ZA 1Y8TA 3ATWA 1QL8A 3L3TA 4Y8ZA 1SQRA 3TNSA 3ENSB 3WWFA 3KCGH 3F68H 1C2JA 3V3MA 4XFQA 2AGGX 3A87A 1O5DH 2BZAA 4OS6A 3GCTG 4ISLA 1FY5A 2QA9E 1A4WH 3S9AA 2BXUH 1AB9B 1C1NA 1EXFA 4ABFA 1HCGA 3B23B 2ZU1A 1O3OA 1N6XA 2TGDA 3E0NB 4GLYA 3MMGA 3UUZA 2Q6GA 1V2UT 1DXWA 2FX6A 2XBVA 3KQEA 1P06A 1MQ5A 3LJJA 4SGBE 5EGMA 3RP2A 3U8OH 4CRAA 1GGDB 1NS3A 1DLEA 2WPKS 2ZFFH 1L1JA 2J98A 2V3OH 3O8RA 1EZQA 3RXFA 1SGDE 5H4IB 1QJ1B 1GHWH 4TSFD 4B6EA 4HTCH 1VJ9U 1HJAC 3RXAA 1BTWA 4UFFH 1ARBA 1WTGH 1AFEH 2H2ZA 3AASA 1GCDA 2EA3A
chains in the Genus database with same CATH topology
3GY6A 5AHGH 1UTNA 5DK1A 5ESTE 1GI7B 4NCYA 2ZDKA 1NT1A 2A45B 1O2OA 1LHCH 3FP7E 7GCHF 3LGTA 1XVOA 3LGYA 4FUFA 2YOLA 1ZJKA 3HATH 3ZZDA 4IC6A 3SO3A 2FXRA 1O5GH 1ZTLA 3MH4A 3FZDA 2PSXA 1CHOG 1FXYA 1UTLM 2BY7X 2A0QB 2BLOA 3OX7U 5TCCA 3BG4C 6LPRA 4D7FA 1CGHA 2HOBA 4I8JA 2H9TH 4X1QU 3SV7A 1SG8B 3U98H 4AYVB 1SPJA 4BXWA 1GBBA 2XYAA 5EXMA 2BX4A 3TGJE 1SGCA 2VWLA 1RFNA 3LH1A 1X7AC 1ANDA 3B8JA 4UE7H 1WTHD 2DUCA 1J9CH 2EI6A 4IN1A 4BTUB 4FUIA 4K1TA 2Z9KA 1XM1A 2BY9X 3P8OA 1ESTA 3SUEA 1TYNA 4AZ2B 1IAUA 2QXGA 2C3SA 3TJUA 2AMDA 2ANYA 1AE5A 2BDIA 3E8LA 1CBWB 3R3GB 4D7GA 4NIXA 1CHGA 3MFJA 1Z1JA 2GX4A 3LH3A 4WH6A 5DP4A 2PKSB 4BTTB 1UVOA 5G4BA 2CF9H 1JIMA 2GDDA 1GJ8B 4TWYA 1UTMA 2ZPQA 1C5NH 1ELFA 5EU8A 2GKVE 3SGBE 2QXJA 1D3TB 1OYTH 2TGAA 3VB5A 2A31A 4DCDA 2AGEX 1UVSH 2XTTB 2Y5GA 3BTQE 3G01A 2W26A 3OY6U 2G52A 2G4UA 3M3TA 1BCUH 1VR1H 4U32A 1T8MA 5HGGA 5FX5A 4ZKOU 4GPGA 4ZXYH 3RDZA 3T25A 2FP7B 2HGTH 4INHA 1P3EA 2Q6DA 4Z6AH 4ESTE 3O8DA 3MOCA 1YGCH 3SORA 1C2LA 2XBWA 4BAMB 1P2OA 3SU6A 5BPEA 1HGTH 1MTSA 1S6HA 3S7KB 2FODA 3H7TA 1OWKA 1XKBC 1T8NA 1ZLRA 1ZSKA 1MAYA 3SV9A 1TGTA 2GV7A 5J4SA 1ABJH 4ASHA 5C5NA 1ZSLA 1G3DA 1NY22 3MHWU 1ELEE 1KSNA 3MNBA 1MBQA 5AFYH 3HKJB 5JPMH 1LKBA 1CT2E 1RIWC 5E8EH 3S7HB 1EJAA 3UWJH 3FFGA 1DY9A 2BY6X 2BMGB 2GMTB 3KQBA 1IHTH 2VVUA 2FZZA 3RXUA 5EQQA 3SU3A 2XC0A 3E1XB 1GI9B 1Q3XA 1WYKA 1TRYA 1W12U 2BDAA 2FI3E 1XVMA 3SJ9A 1KXAA 3H5CB 1P3CA 2VIPA 1THRH 2XWAA 5A8XA 5CMXH 2Y6TA 1O2WA 3TNTA 1O2NA 2O9QA 1FLEE 2ALPA 5EPYA 1TAWA 1P0SH 1ZGVA 4Y76A 5GCHF 1GGDC 3SUDA 1LPGB 1VJAU 5LH8A 3ZZ8A 3UPEA 1EAWA 1SGRE 3LGUA 4FUBA 5T3HA 4O3TA 1OXGA 4HGCA 4Y10E 4GCHF 6CHAB 1O2XA 1D4PB 3UWIA 4CRDA 3PWBA 3TH3H 2H6MA 2G8TA 3RXTA 4CRCA 1L1GA 1JOUB 4FUCA 1JBUH 1O3AA 2F91A 1HPGA 2ZFPH 1YM0A 1AD8H 1K1OA 2FOFA 3SZNA 1LKAA 2WV5A 3DUXH 4KTSA 1YPHC 2VH6A 3I29A 1SI5H 1JRTA 3M7QA 3STIA 1W2KH 4B76A 1VITF 2ESTE 1KXFA 2FOMB 2PKAB 1TGNA 2OD3B 3H7OA 2ZTYA 3ZVEA 2O8TA 1FIWA 3GYMA 1UMAH 1L4ZA 2ZU5A 1EZUC 1MQ6A 4NSVA 3SHCH 4BAQB 1NU7B 1GBLA 1E34B 1ZPZA 2EC9H 1TRNA 3SV6A 3M35A 1YP9A 3ZZ6A 1AE8H 3LC5A 3SUGA 3SU4A 1FNIA 1BRAA 1DE7H 3A7YA 2ZDAH 1N1LA 1UO6A 2FI4E 4ZMAH 2ZDLA 1GI8B 1SGNE 1WBGB 1GJ4H 3BIUH 2JH5D 1XX9A 4D9QA 4JZFH 2ZHFH 1P05A 3C1KA 5DP7A 2VIVA 4YT7H 1V2QT 3TGIE 2JH6D 4BNRA 2QXHA 2ZFSA 3GY3A 4ISOA 4WMEA 3O8BA 3P17H 3DD2H 1SOTA 2XBYA 2Z94A 1TGBA 3DFJA 2RA0A 3LGWA 1AQ7A 1QB1A 1P12E 4Y0YE 4I8HA 1GJAB 1SFIA 1K1LA 4Y8XA 1C1RA 1S83A 3W95A 5E2OA 3T62A 1QCPA 4MTBA 3LJOA 3MI4A 1PJPA 3BEIB 3BEFB 4ISHH 1F5KU 2UUFB 1G32B 3RLYH 1O3EA 2VIOA 1SMFE 3O8CA 4MVNA 1TIOA 1LO6A 2FLBH 1DDJA 2HLCA 3E3TA 4JYTA 1G2MA 1UVTH 3MNSA 3A86A 4ABBA 3M5MA 2PKAA 1LHGH 1NN6A 1TQ0B 4TY6A 4I33A 3KQDA 3BG8A 1OWJA 4I32A 3TJOA 1Z8RA 1CO7E 3QWCH 2GCHG 4K8BA 1C5QA 1GMDG 3QTVH 3BTFE 4TWWA 1SLWB 4K1EA 3ODDA 1P10A 1O5CB 3UR6A 3TU7H 3U1IB 1YPEH 3SW2B 4AFZA 3TLOA 1AY6H 1Y5BT 5C2ZA 4Y11E 1MTNC 2Z7FE 4KKDA 1TLDA 1GBIA 2VIDA 3S69A 4CHAC 5CE1A 2FDAA 3F9EA 1WSSH 3PO1B 4M7GA 3UY9A 1OWEA 3SV2H 4CR5A 4XBBA 1GBMA 1GBJA 2ZU2A 1EASA 4NIVA 2IN2A 1BTUA 4AFSA 1TMUH 1FI8A 3F6UH 4K1SA 1E0FD 1EATA 3RXOA 5K7RA 1TOCB 3M36A 2UWLA 5GDSH 1ZSJA 1RD3B 3OYPA 1GJ9B 1K21H 1S84A 4X2YA 1A3EH 5EG4A 1C4Y2 3IG6B 3Q00A 2ZU3A 3ATKA 2ULLA 5HM9A 3GDVA 3KL6A 4BAKB 4JZEH 2A5AA 6CHAC 3CP7A 4F49A 1QB6A 3RU4D 1C1OA 2HNTE 1T7CA 1GHBG 3BTDE 2F9UA 1LPKB 2QYIA 1DUAA 3RXVA 1H9IE 1OP8A 2AYWA 1SGIB 2SFAA 1WCZA 6GCHG 3Q76A 2C8XB 1TX7A 1WV7H 2A2QH 3LT3A 2O8UA 5FX6A 3PTNA 4AFQA 2BDCA 1SLVB 3V13A 4WMFA 3UNRA 1F5LA 3FAOA 1HAYB 1MTWA 4JMYA 2F9OA 3ZZ9A 2OUAA 2R3YA 4MG3A 2BM2A 3E16B 1TBQH 3ZVDA 1P2JA 2BQWB 1UCYK 2FOEA 3BIVH 2ZZUH 3K9XB 1DS2E 2VWOA 1JRSA 4MPXA 1IQFA 1GBAA 2PGBB 1DFPA 2FX4A 4MQAA 3UNQA 2A1DB 3NWUA 2PR3A 1O3KA 2ZFRH 3PMJA 2AFQB 1BB0B 2VWMA 4X8SH 2OC7A 2D26C 4O3UA 1HAPH 1BTYA 1WQSA 3GCTF 2GT8A 1O5FH 2BDHA 1UVPA 4FUEA 1SHHB 8LPRA 5E0GA 1YYY1 2GZ9A 3BTEE 2QC2A 1BDAA 4KGAA 1DITH 3SNBA 3GDUA 2F3CE 3T27A 1RXPA 1SB1H 4SGAE 2FS8A 4A6LA 1YLCA 1Z6JH 2J38A 4ABAA 2ZGCA 1V2WT 1MU8B 1DICA 1ZMJA 1O3CA 1FQ3A 3NKKA 2BHGA 3W94A 1C5PA 1AHTH 1DSUA 2RCEA 4AYYB 1TPAE 3ZZ5A 2W7UA 1C5MD 4FUDA 1AVWA 2GZ7A 3ZVBA 1LHFH 3FZZA 1CT0E 1OSSA 1V2VT 2A7HA 1GBDA 1TPOA 4I8GA 1PYTC 4QT8C 3ZVAA 1SFQB 1KLTA 3KGPA 1HIAB 2ZQ2A 2WPJS 1P2IA 2VU8E 1C5YB 4MNWA 1BJVA 2O8LA 1FPHH 4ZROA 1NRPH 2P8OC 1AIXH 4WF8A 5C20A 2FS9A 2VNTA 4ZKNU 3QGNB 2P3TB 3GDSA 1ZHPA 3M3VA 5J4QA 5F8TA 3RXGA 1RIWB 1KDQB 1GCTC 1QA7A 3TH2H 1MZAA 1O32A 1BJUA 1Y3XA 3SUFA 3KF2A 1YPKH 1F0TA 1F7ZA 4I7YH 3M37A 5EOKA 1W11U 4A1TA 1Y3WA 5CHAC 2FOGA 1SLXB 3BTGE 3PO1C 1SGPE 4DIIH 1XUJA 4XBDA 3VEQB 1VCQA 1AUTC 4U01A 3ZZCA 4B2AA 1IQMA 1BOQA 1W0ZU 1AMHA 1FUJA 1HNEE 4O97A 4E7RG 1O5AB 1DVAH 2FWWA 2SGQE 4FUHA 2H5CA 4AX9H 2ZCLP 5C1UA 2PGQB 5L2YH 3BTTE 1O0DH 1WU1A 4I31A 1BQYA 2D1JA 2Z9JA 1C2HA 1BITA 1O2SA 3A85A 2A2XH 1LQEA 1CU1A 4KELA 1AZZA 2ODYB 3PROA 3S0NA 1P2KA 5JBBS 1Z6EA 4UD9H 1C5TA 3MYWA 4DIHH 1GBCA 1PYTD 3VGCB 1C2IA 1AFQB 1M9UA 3GY4A 4BAOB 5GWZA 2CN0H 4X2WA 2C90B 4HFPB 4K69A 5EPNA 5AVDA 5JYIA 5JDUB 1FY3A 1HIAA 3A88A 1CGIE 2A4GA 5BRRE 1F0SA 3A80A 2BLWA 1XXFA 1RTFB 1RTKA 5DP5A 3KQCA 1E36B 2CV3A 4WVPE 4BOHA 1J8AA 2WYJA 3FP8E 1UTPA 4B75A 3VXEH 1A46H 2B7DH 1OWDA 3LGVA 1XXDA 3MH5A 1HFDA 3PV4A 1G3BA 3RXKA 1CE5A 3EA7A 1N8OC 1DSTA 1KDQA 2BD8A 1GJ6A 3E91A 1PPHE 3ZV8A 1QR3E 3RC4A 1C1PA 2FOCA 1K1IA 2QXIA 1W0YH 4Y71A 1LMWB 5A0BA 1HXFH 4U2WA 1MBMA 1SSXA 1HLTH 1WQVH 5JBCS 1S82A 3MU8A 4O03A 3EYDA 4FVBA 2W5EA 3OSYA 1INCA 1W13U 3S9CA 4DW2U 1H8DH 1UK4A 1XKAC 2OCVB 2SGPE 1B7XB 1EJNA 1NRSH 1L4DA 3ODFA 1V2KT 1JIRA 3HK6B 5FBIA 3D49H 5GXPA 1QFKH 5T6DA 1ETRH 2B8OH 1LCYA 3UTUH 1S0QA 3SJOA 1PQ5A 1TBRH 1FMGA 2ZGJA 2OQUA 2D8WA 1IHSH 1P11E 2WUCA 3A83A 1BT7A 1QRWA 1ZMLA 4BAHB 3U1JB 1LHEH 2QGRA 5FAHA 4ZH8A 1PQ7A 4UFGH 5C5OA 1CA8B 4IW4E 4LOYH 3BEUA 1O3NA 1O2PA 2CHAB 1IQGA 4J1YA 1QA0A 1EUFA 3MNCA 1SGFA 3BN9A 3LOXA 1C9PA 1Z8GA 2ZECA 3RMMH 1F5RA 2SNWA 3ZZ4A 1Z71A 3A89A 4GSOA 1GVZA 2OC8A 5I25A 3D62A 5GPIB 1K2I1 1B0FA 2TBSA 1O2RA 1V2LT 2RG3A 4ZXXH 3K2UA 2J9NA 1OYQA 2ZNKH 2B0FA 1CVWH 3IITA 1GDQA 3PMAB 1HBTH 5FPTA 2OTVA 4ABHA 4TY7A 4MPVA 1TE0A 1LPZB 3Q3KA 1O2YA 3RC6A 5DP8A 1AI8H 2XBXA 2PTCE 2AIQA 1DWCH 7GCHG 2P3UB 1QIXB 4H4FA 4DT7B 2Z6BD 1HJ8A 4XE4A 5EQSA 4HZHA 1GBHA 1O37A 1RJXB 5DP9A 5JBAS 4ABIA 2F83A 1DT2A 2FOBA 3RXEA 3A7XA 3T28A 1IQNA 2Z3EA 4TPYA 3T26A 1ARCA 1EPTC 1GBKA 1O31A 2EI8A 1MTNB 2ANMH 1AGJA 1C4U2 4CHAB 2VB0A 4NWKA 1V6DA 4AGKA 1ABIH 1TX6A 4A1XA 2R3UA 5A0AE 2B5TB 1BA8B 1FY1A 1YCPM 1G30B 4H6SB 2OXSA 3URDA 3QDZB 3SNDA 3SU0A 2FEQH 1UCYH 4X6OA 2BDGA 4ABJA 2G5VA 2R2MB 2A5IA 1H9HE 1YLDA 1P2QA 3Q77A 3GY8A 3ATLA 2TGTA 3DFLA 3VGCC 1AFQC 1QQUA 2BD2A 5FBEA 1GHAF 1EKBB 1Z8JB 3L6PA 1F0UA 1EQ9A 2FYRA 3Q3YA 4OGYA 1ELVA 1OPHB 1T8LA 1C1UH 2R2WU 1TX8A 1FZZA 2ZGBH 2G00A 2ZTXA 3QK1A 4YOGA 4ZAEA 3P95A 3P70B 3ZZ7A 2EI7A 2QCYA 4H42U 4IGDA 3SJ8A 1NPMA 3KHVA 1KLJH 5AFZH 1O3DA 2AH4X 4NSYA 4YO9A 3ZYDA 1XUKA 1Y5UT 4CREA 2GCHF 1ESAA 1GMDF 4NFEA 3SOSA 1IQKA 3PTBA 1MKWH 5C3NA 1MU6B 1GI2A 1C1QA 1Q2WA 7ESTE 2ZO3H 3HGNA 1L2EA 1MTVA 1GBTA 2AEIH 2QY0B 3BTKE 1DY8A 2ZU4A 4LZ4B 2GTBA 1GMHF 2NU0E 2QAAA 2PUQH 1DUEA 1C2GA 7LPRA 2H9EH 1ZHRA 2OQ5A 3V12A 1YC0A 2BYAX 1A0LA 4E7NA 3P6ZB 3PLBA 1MUEB 2HNTC 4WXVA 1HAIH 3EAJA 2BOKA 1C5OH 1C5RA 2Q1JA 4B74A 1D3DB 4KP0A 1SLUB 2GT7A 1S85A 1SQTA 1TRMA 4GUXA 8GCHG 1FY8E 5E0JA 4IMQA 4ABDA 1NO9H 2O8WA 1THPB 4XSKU 3SI4H 1EB2A 1MZDA 3UREA 4CRGA 1GHBF 3QZQA 2CHAC 4LZ1H 3U8RH 5A8ZA 3A84A 5DO4H 2W3KA 1O2KA 2V3HH 3SGQE 1O3BA 6GCHF 1QJ7B 4BXSA 2SGFE 3TVJB 2PV9B 1HXEH 1NESE 1G37A 2BY5X 2PFEA 2FOAA 8ESTE 4DVAU 5C1YA 2BDYA 2W7SA 1S0RA 2A7CA 3SHAH 3I77A 1EOLA 1GI0A 4LK4A 1BBRH 2TIOA 1P9SA 2BD3A 2ZA5A 4THNH 4GCHG 5PTPA 1Z8IB 3MO3A 2O8MA 2BQ7B 2ZTZA 4MPUA 2F9NA 9ESTA 1D6RA 2P8OB 1QBOA 1ETTH 2OLGA 1MKXK 1V2PT 1C1SA 3NUMA 4WXIA 1K1MA 3ZZAA 4BTIB 2NU3E 1UK2A 4ABGA 2K1QA 2ZWLH 2P59A 4X2VA 3LPRA 3C27B 3BTHE 4A92A 2F9BH </