1SGTA

Refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
b'VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSGAAVKVRSTKVLQAPGYNGTGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSAYGNELVANEEICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Hydrolase (serine proteinase)
source organism Streptomyces griseus
publication title Refined crystal structure of Streptomyces griseus trypsin at 1.7 A resolution.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1988-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgtA02
3PTBA 1Q2WA 2XC0A 3BTGE 3F9HA 3SU4A 1BA8B 1L1GA 1FLEE 4NGAH 1P2KA 4JCNA 2CN0H 3ESTA 1SGRE 2ZHQH 1DT2A 1B7XB 1RGQA 3AAVA 2ANYA 5TJXA 4AFQA 4KTCA 3CS7A 4FUIA 8GCHF 2QC2A 3RDZA 1GPZA 2BDGA 2SGAA 2ZDLA 3VGCB 5HM2A 1C5PA 1CBWC 2J94A 1F0RA 1V2KT 1EAWA 4YT7H 1ETTH 1O2VA 1ABIH 1WTGH 2LPRA 1DDJA 4NA8A 2RCEA 3RXKA 1GI9B 2FPZA 5EXMA 2UUJB 3IWMA 2Q6FA 4X1SU 5I46H 4CBOA 3TGIE 1HB0B 3RC5A 1QL7A 5JB9S 1BTXA 3SNAA 1RTKA 1XUKA 1UTPA 4NWLA 2WYJA 1GDQA 2PKSB 1ZPCA 1XKBC 3D23A 1EAUA 3TJNA 1Z8GA 1OXGA 2FTLE 2W5EA 2CF8H 2WPJS 1P57B 4AG2A 1XUFA 4ISOA 1UVPA 1PPGE 3NPSA 5E2PA 3U8TH 1JIMA 4XBCA 1TNLA 2RA3A 3IITA 1OWHA 3RU4E 5AHGH 5C1YA 2A1DB 2CHAC 4WH8A 3WY8A 1TLDA 4CH8B 5GXPA 2HWLB 4NSVA 2OC1A 1K2I1 2BD9A 3PMBB 3DHKH 2HPQH 5C1UA 2J9NA 2FIRH 1O3JA 1TB6H 2Z9JA 3ZZCA 8GCHG 2CXVA 4AFZA 2ZU3A 4ZAEA 1LCYA 1OWIA 5J4SA 1ZSJA 2ZFRH 3QWCH 3SGQE 1ETSH 3MYWA 2Y6TA 1O2YA 4K8BA 3VB5A 2EI7A 2VWMA 4JZIA 1YYY1 2FEQH 1ZPZA 4BTUB 1P03A 1QB1A 1OP0A 3BN9A 1DUEA 2THFB 5EQSA 5CE1A 2WUBA 5EPNA 4O3TA 1AZ8A 4BOHA 2IPHA 3QO6A 2VWOA 1TRYA 1G9IE 3B23B 5LPRA 1CHOF 2YOLA 1AD8H 2P94A 2XCFA 4MNXA 4X1QU 1ESAA 3PO1C 3RMOH 3LGVA 2AGIX 2WV5A 3NXPA 3P70B 2O8WA 2B9LA 2GCHF 5C1XA 1LQDB 2FI5E 5F6MA 1C2GA 1C1MA 3UNSA 1HAHH 1GGDB 4HGCA 1W8BH 1BITA 1UVSH 1MQ5A 1QHRB 3BTTE 7GCHF 4Q2KA 1KXCA 2FDAA 2PKSC 1PPFE 4OS7A 4JYTA 1QA7A 3P6ZB 3SHCH 4B74A 4B2BA 2SGDE 4H6TA 3K65B 1H9HE 4XFQA 2G5VA 1DPOA 3F9GA 1BJVA 1HAYB 4J1YA 1GHXH 4YESB 1O3EA 3BEIB 1O0DH 1Y3YA 1HFDA 1Y8TA 2ODPA 2BVRH 2VINA 5DG6A 1TE0A 1WOFA 1JMOH 1TFXA 1H8DH 2XRCA 3PLKA 3RMMH 1C1TA 1BBRK 3CP7A 1J9CH 4A5TS 1V2TT 1ELAA 1Y3XA 1GCTC 1CA8B 3I77A 2BLVA 1JRSA 2V0BA 2NU1E 1O35A 1C9TA 1O5EH 5J4QA 2QXHA 1EZSC 1DE7H 1QY6A 3MU1A 1S85A 3UNQA 3P8OA 1S81A 4CRBA 4JK5A 4BAKB 2GD4B 2M5TA 2HLCA 1LQEA 3GY7A 1FMGA 2BD3A 1O2GH 1O2SA 1B0EA 1LHDH 1Q31A 5L30H 1J8AA 1KTTB 3M37A 4X0WU 3VB3A 5C5NA 2ZHEH 2AGGX 4ISIH 2HRVA 1C1NA 3D65E 2ZGJA 1RTFB 1D3PB 1YCPH 5EU8A 2V35A 1BTYA 1GG6C 1SGTA 1XUGA 2VWLA 1O33A 2WPHS 2I6SA 1OYQA 4XSKU 1O3NA 2STBE 3H7TA 1GJ7B 1FQ3A 2PTNA 2ANMH 1W12U 3NK8A 1CSOE 2QV1A 1YPHC 2ZFSA 2SGQE 1UTOA 1MCVA 2F9UA 1YLCA 1SSXA 4FU8A 1E36B 4IC5A 2TRMA 1EB1H 2OC7A 1W3CA 3S9CA 3TJOA 2CGAA 3TNTA 1NFXA 1P3CA 4AFUA 4LZ4B 1QFKH 3FFGA 5T6GA 3MWIU 3VPKA 5L6NH 1O34A 1O5AB 2SFAA 1FUJA 1Y3VA 1HJ9A 1IQEA 4FXGH 3M5OA 2AMQA 3EDXB 1ABJH 3TVJB 1ZRBA 4X6MA 3U98H 2A45B 1JOUB 3TK5A 1ESBA 3ZZDA 3F1SB 1J16A 2OQUA 1P3EA 3H5CB 4CREA 1HAPH 4X1RU 2ZFFH 3D49H 9ESTA 1O39A 1EXFA 2SNVA 1C9PA 2H1UA 1P9UA 1P06A 1YPJH 2VVVA 1O31A 1O3OA 2VB0A 3DA9B 4X2YA 4KGAA 4ZKSU 1WU1A 2UUYA 4WH6A 3CENA 4MNYA 3LU9B 3RXRA 2GTBA 1EUFA 2XWAA 3RU4D 1A5GH 2J4IA 4X6PA 3TGJE 3OY6U 4B2AA 3PROA 3M3TA 1GI5A 3ZVFA 1V3XA 2VIPA 1A1RA 3KQCA 2QGRA 3SV8A 1HRTH 2ZGCA 3E3TA 1H1BA 4BANB 3KQEA 3VB4A 1KXDA 3ZZ7A 3TU7H 1SC8U 4Y71A 2BY8X 1ELGA 4MTBA 1ELDE 1BCUH 4MDSA 1GMCG 3VFEA 2B7DH 4GCHG 1MTWA 1EZQA 3HK3B 3K2UA 3BEUA 4F4OC 4XOJA 3BG8A 1SI5H 4I8JA 1MH0A 1K1JA 4FUGA 1GBAA 1SGFG 5E0HA 2AGEX 2YNBA 1DUAA 2VU8E 4NA7A 2A0QB 1ELTA 1AUTC 5JBBS 4YT6H 3Q3YA 2ZF0H 2FESH 1VCPA 1O2KA 2BX4A 4OGXA 5DP8A 3MFJA 2BLOA 2D26C 1BTUA 3HK6B 4MPXA 1QQ4A 1W7GH 3V7TA 1P0SH 2K1QA 2ZDVH 3BF6H 3OY5U 1HJAC 3AW1A 3V3MA 1YCPK 1O5GH 3GCOA 4NIXA 1NFUA 4ZHMU 3QDZB 3W94A 4AX9H 2Y5HA 1C2IA 4X2WA 4B71A 4CHAC 1VITH 2ZDNA 4YOJA 3ZV8A 2ZNKH 4CRFA 1GL1A 5GCHG 1G37A 3FAOA 2CF9H 1GJCB 2AEIH 3FP7E 4ZKOU 2Y5FA 1TYNA 1NO9H 5HXFA 3ZZ3A 1A5HA 1UHBB 1O2LA 1SGIB 1GJBB 3GY2A 1HLTH 1MTVA 3LC5A 4WMFA 4YLQH 2BD8A 3A80A 1CE5A 7LPRA 2GT8A 3ZVAA 2A32A 4NIWA 4DJZB 1S82A 2SNWA 4F49A 4WMDA 4AGKA 1LTOA 3ATKA 2F91A 3A8BA 1QBVH 1NRNH 3RXDA 1TA6A 4AN7A 1K1PA 1C1OA 4Y10E 2PKAB 1IQFA 1Z1JA 1GI2A 2C90B 2FX4A 1KXFA 1OYTH 1P8VC 2BTCE 1C2DA 1O2MA 2BZAA 2TBSA 3RXLA 1O3FA 3MH6A 1BBRH 1P01A 3BTQE 2Y80A 2HNTC 2RG3A 1ZPBA 1C5WB 2FWWA 1THSH 2FP7B 5IDKA 1TGCA 3QN7A 4B2CA 2ZO3H 4IS5A 4HTCH 4NG9H 4X8TH 2ZU4A 1FI8A 1GHBG 2P3FH 3OSYA 5DP5A 4O03A 1V2QT 1OWEA 4AG1A 3TITA 1Z71A 1RRKA 2STAE 1E37B 2ZFPH 4TPYA 3ZVGA 1O3IA 3H7OA 3RU4T 1C2JA 1MKWH 1NFWA 2NWNA 1TA2A 3PMJA 1ANCA 2QXIA 4JZDH 3RXUA 3MNSA 1MBQA 3SUGA 1O3PB 1W10U 3M5LA 3SNDA 2CJIA 3M61U 3N7OA 1G3EA 2GV7A 1DS2E 1NRQH 2A7CA 4BTIB 3STJA 2G8TA 2ZPQA 4Y8YA 1ZR0A 1CVWH 2GP9B 2AH4X 1GVKB 3UWJH 2V3HH 3HGPA 4Q7YA 1UJ1A 7KMEH 4JZ1A 4E7RG 1BBRE 1LPGB 3A7TA 1TPOA 3VB6A 2ZZUH 1C5LH 2F9BH 2PUQH 2ZHFH 1GCTB 3GY3A 1HAIH 1QJ1B 3I78A 2BOHB 2P16A 1NRRH 1KY9A 2QN5T 1HIAB 4KKDA 1WCZA 1SGCA 2OD3B 1SR5C 1K1MA 2GZ7A 2ZECA 5B6OA 4CH2B 3DT0H 1O2IA 2BYAX 3FP8E 3GOVB 1QQUA 2PLXA 1XUJA 2PGQB 2ZP0H 1HAVA 5FBIA 1IQLA 3EA9A 7GCHG 3FVFB 1TNHA 1W7XH 5DPAA 4D9RA 1PPCE 1G2MA 2BY6X 1UVUH 3ITIA 1X7AC 3MHWU 3V0XA 1ZTLA 2ULLA 5TCAA 2JETB 1XUHA 2FOAA 1QRWA 1UMAH 2B8OH 1HAZB 4GPGA 1KIGH 3O8RA 4O3UA 4B76A 2BDYA 1C1VH 2Z6BD 1TGBA 2B5TB 1OWJA 1NRSH 3LOXA 1IHSH 4YZUA 2P8OC 5GCHF 4UFGH 4A1VA 1S0RA 3U8OH 1C4Y2 1AWHB 4I8LA 1U6QA 1ZMNA 4XBBA 1ESTA 1MBMA 2O8UA 4Z0KA 1VJAU 3RXFA 1YPHE 3PV4A 3SU3A 1T8MA 3PO1B 5F8TA 2OBQA 5C3NA 4Y79A 3T62A 2PSXA 5A09A 2PUXB 1SLXB 3E8LA 4I31A 5T6FA 3UQOA 3RXVA 3NUMA 1XVOA 2EA3A 4X2VA 1A3BH 1H9LB 2FO9A 2G52A 1C2EA 3GY6A 3SOSA 2OINA 2PKAA 1S5SA 3U8RH 1LPZB 3EE0B 3QX5H 1CGIE 2FLBH 3ZZ4A 1EJNA 2H6MA 3RXAA 2GCTB 2PTCE 1AGJA 3RP2A 2ALVA 2GCTC 1ARCA 1C5QA 2Y5GA 4UE7H 1C1QA 1VGCB 2F9NA 1GI1A 4TY7A 4MG3A 1UHBA 3BG4B 1MTSA 3O8BA 5DP7A 3BTDE 3E1XB 1BJUA 1BIOA 3ZVEA 3K6YA 3SU0A 3R3GB 1ZMJA 1K1NA 1P2JA 1E34B 4NFEA 5EXLA 3W95A 1GHYH 1HBTH 1GHVH 3T2NA 4R0IA 1O5DH 4YLUA 2BDAA 3C27B 1S83A 3NZIA 1DWCH 6GCHG 1BTHH 1SL3A 2WPMS 2XTTB 2ANWA 2HNTF 1P2OA 3L33A 3SORA 3LGWA 2GDEH 3LONA 5EW1H 2H9EH 5GDSH 1QB9A 1QB6A 5GJ4B 1AWFH 3TIUA 1SGDE 3BG4C 3MH5A 4WXIA 4NZLA 5DK1A 4A1TA 3ZVDA 4MNVA 1QBOA 1QA0A 2FI3E 2HPPH 1BOQA 9LPRA 4NIYA 3T27A 2VVUA 1HJ8A 4NZQA 4YTAA 1YPMH 3MNXA 2FX6A 3RLYH 3SNCA 1WTHD 1O3HA 1D3TB 3KHVA 5FHTA 3AVZA 2EEKA 6CHAB 1O3KA 3F68H 1NS3A 4CR9A 1TPAE 2G4UA 3PLPA 4OS6A 1G2LA 3TJVA 1HPGA 2VH6A 4AGJA 2FTMA 2ZGXH 1C5VA 4E05H 2A7JA 1BB0B 1MTUA 1LVOA 4E06H 4U01A 4GAWA 1IOEA 3SQHE 6GCHF 3AW0A 1Y59T 2ZC9H 1RTLA 1GI7B 1T8LA 1GVLA 3A7ZA 2HGTH 5AFYH 1GBMA 3TNSA 2OP9A 3F9FA 3M3VA 1GBIA 4BAOB 5FBEA 5K7RA 2HVXA 3FZDA 2C93B 2DE9A 1CU1A 1TNJA 2AMDA 2UWPA 4ZHAA 5DP3A 4J2YB 3KGPA 1GHZA 1TWXB 2D8WA 1TPPA 2EC9H 3P95A 3VXFH 2J95A 1B5GH 3BTFE 1C5OH 1O3DA 3GCHC 1W2KH 4FUDA 2OBOA 1GBLA 2VIQA 4CBNA 1T8NA 4DVAU 1FAKH 2FOCA 4ZROA 2W7UA 5JBAS 4DURA 1AVXA 4ABAA 1W0YH 1V2ST 4GUXA 1YPEH 5A0AE 2QYIA 3A7VA 3E16B 2JH0D 1GG6B 1XM1A 3I29A 5JB8S 2FYRA 1LHFH 4I8KA 3ENSB 2ZCKP 1MD8A 2Q6DA 3MMGA 5HGGA 7ESTE 1P05A 3P92A 5CHAC 2QAAA 4FUEA 2FZZA 2ZFQH 2C3SA 4RKJB 1BUIA 2O9QA 3A82A 1TMTH 2WPIS 5TCCA 3EYDA 3RMNH 1DWBH 1RS0A 1PYTD 1EOJA 4WMEA 2W3IA 1XMNB 2Z7FE 1LDTT 4BTTB 1ANBA 2PR3A 1O5CB 3EA7A 3GYLB 2H2ZA 1C5RA 1YBWA 1YF4A 2TGAA 3A7XA 4K5ZA 2IJOB 1JBUH 4H6SB 2ZQ2A 1BHXF 1KTSB 1CHOG 4FU7A 1OWDA 1WYKA 1AUJA 3A8AA 1PPBH 3GDSA 1EZUC 3PMAB 3UNRA 4YOGA 1MU8B 1HYLA 2BD7A 1DITH 1ZTJA 3LH3A 1IQKA 1A4WH 2GCHG 3CS0A 5JYIA 2AS9A 3SJKA 1QNJA 2F9OA 3Q00A 2Z9KA 2VIWA 3ZVBA 3A83A 5EGMA 3UOUA 4JYVH 1TQ7B 3RC6A 1N1LA 3MO9A 2CV3A 4A7IB 2P59A 4ISLA 1D3QB 4ABDA 1BTZA 1ZHPA 2VIDA 4IMQA 1FPHH 2PWXA 2W26A 1VZQH 1EPTA 1HJAB 2W3KA 1MKXK 1FIWA 4NFFA 1K1IA 1SGEE 2C8YB 3RM2H 1SHYA 1IQMA 1OS8A 1C1RA 3SV6A 1V2VT 2QXGA 5GIBA 3KQDA 1KLJH 1UTKA 3PWCA 3T28A 1AN1E 1AFEH 3K6ZA 1EB2A 2VGCB 2G81E 1P11E 4UD9H 1EAXA 3GY4A 2BX3A 4FU9A 5DJ7A 1GMDG 1PQ8A 2H9TH 2WYGA 1O3BA 1WUNH 1MKXH 3STIA 4WXVA 1Z7KA 4A92A 4KTUA 5DP9A 3ELAH 3HGNA 4LK4A 4X8VH 1AFQB 1NT1A 1MTNC 2FYQA 1OPHB 1T32A 3RXTA 1TNGA 1BT7A 1PPEE 3BIVH 3RUOA 3SI4H 4CRAA 4CHAB 5LGOA 5CMXH 2Z9LA 4LXBH 1DY9A 1TBQH 1C2MA 1DY8A 1DWEH 4GVUA 2PFEA 5A2MH 2VWNA 4B73A 2ODYB 2BB4A 1AFQC 3SUFA 1MAXA 1S84A 2G55A 4M7GA 2BD4A 3E91A 3ZZBA 1UTLM 1L0ZA 1SFIA 2Y81A 1MZDA 4DOQA 2ZQ1A 2CHAB 1PPHE 1SVPA 1LMWB 1B0FA 1C5TA 5T3HA 2ESTE 3KL6A 3SHAH 2OUAA 3MH7A 4FVBA 3EQ0H 1HAOH 5C5OA 1GJDB 2BDIA 1FONA 3BTME 2A5AA 1DSUA 3S7HB 2YNAA 1MQ6A 3UFAA 3GCTF 1KXEA 1IQJA 4ZMAH 1EPTC 3E0PB 1BRCE 2TGTA 2A5KA 2Z9IA 3L3TA 1TRMA 4ZKRU 1HV7A 1TMUH 5ETXA 1MUEB 1K1OA 3A87A 1TNIA 1YM0A 1GDUA 3F9EA 1HXEH 1P2MA 2BD5A 1LO6A 3IG6B 1ELEE 3LGTA 3PWBA 4Y8XA 5EOKA 1ZJKA 1YLDA 3SW2B 1PQAA 3QTOH 4CRGA 1FJSA 2Z3EA 3A7WA 3SNBA 2QXJA 4U32A 4D7FA 1OOKB 3ZZ5A 2GZ8A 5C20A 4MPVA 3SU5A 1GMCF 5FX6A 1P2NA 4SGBE 3P8FA 1VCWA 1QL8A 1S0QA 1ZGIA 5I25A 2ZFTA 2SGPE 1SG8B 3AAUA 1GBFA 3LGUA 4O9VA 3EGKH 4U2WA 1O3CA 2ZPRA 4OS5A 3VEQB 1ACBE 1THRH 3ATLA 1EZXC 5JPMH 1V2WT 2FS9A 4Y7AA 1GHAG 1TBZH 2AYWA 5AVDA 3PB1E 1GMHG 4Q7XA 4BXSA 3D62A 5A8YA 2UWOA 4FUHA 1AB9B 4R8TB 1K1LA 2A4OA 2DUCA 2Y82A 1QR3E 1FIZA 3RLWH 3SZNA 4ZXYH 1O2WA 4K8YA 2OLGA 1VJ9U 1WSSH 2BD2A 5JBCS 3GCNA 3M7UA 2KAIA 3LH1A 1O5BB 1ELCA 1ZHRA 1FY8E 2BVSH 4ABJA 1TOCB 1SPJA 3M35A 2VJ1A 1MKWK 3AASA 1LVBA 3S69A 3M36A 4AB8A 3QZQA 3BTHE 3SJOA 1TABE 4NWKA 1IQNA 2C8XB 2C8ZB 5FPSA 2BLQA 3OU0A 1VCQA 1V2PT 2FOMB 1KDQA 4Q7ZA 1G32B 1NN6A 2R9PA 4D76A 3P8GA 1ZYOA 2UUKB 1CGHA 2FOHA 2GV6A 4ZUHA 1L2EA 3A7YA 5DP4A 1FZZA 3PMHB 1UCYH 4ZXXH 2BDBA 2Y7ZA 5A0BA 5FX5A 3U1JB 1KXBA 1A7SA 1C5UA 3O8CA 5LH8A 1K28D 1D4PB 1O3MA 1HGTH 3Q77A 2WPKS 3MU4A 5JDUB 3SGAE 1SBWA 2AIQA 1P09A 1F5LA 1GI6A 1NESE 1TBRH 3QTVH 1C5YB 4K69A 1SLVB 4IW4E 2OQ5A 2TPIZ 1GDNA 4IMZA 2PHBA 4HFPB 1HAGE 1PQ7A 2EI6A 5DGJA 1GBEA 4AB9A 4XE4A 4ABFA 1N6XA 1TALA 4TPIZ 1ZZZA 4A6LA 2FS8A 4GCHF 1K21H 1KDQB 3SJ9A 4NIVA 1A0LA 4K60A 1UK3A 1UVOA 2FM2A 3U1IB 1QGFA 1XVMA 3BSQA 4ZH8A 5FCKA 4H4FA 3UREA 4D8NA 3UWIA 3FP6E 3L6PA 1TMBH 4FUBA 4WVPE 3RXIA 2P3UB 2ZU5A 1GHWH 1DXPA 1GVZA 2Z3DA 1RJXB 2R0LA 2P3TB 1O2HA 1KLTA 4ABGA 4BAMB 3DD2H 2XBVA 6LPRA 4JMYA 4ABBA 4JZFH 4K1SA 3EAJA 3TK6A 1M9UA 4X6NA 2C4FH 3TH4H 1NM6A 2B0FA 4K2YA 4ABHA 1O2QA 2BHGA 2LNCA 2JKHA 4FVDA 5G4BA 3A85A 1EASA 1A61H 1L1JA 1QRZA 5H4IB 2KAIB 1P2IA 1IHTH 1BQYA 1RIWC 1W0ZU 2A4RA 2CMYA 1UCYE 3A84A 5EXNA 1GI8B 1GBTA 1SGYE 1ETRH 1ZOMA 1N8OB 2PW8H 4DGJA 1D6WA 2HALA 4INKA 1T31A 2OTVA 2AERH 2PGBB 1Q3XA 3U9AH 3MO6A 1CBWB 1C5SA 2NU3E 1V2OT 4MNWA 3LIWA 1MTNB 3VGCC 1G3DA 2BMGB 5EPYA 1CQQA 2GT7A 3QUMP 4AZ2B 2FI4E 4IBLH 1ID5H 2QF0A 2BLWA 3MH4A 3UY9A 1ANEA 1TGTA 2PV9B 1OSSA 1GJ9B 3JZ1B 3PM3A 2ZU1A 1AY6H 1W11U 3SU1A 1CT4E 2GX4A 2FOFA 1AQ7A 1EKBB 3ZZ8A 1BZXE 3S0NA 3KEEA 3ZV9A 3OX7U 4DIHH 5E2OA 3UOPA 3E90B 4PROA 1XXFA 2P8OB 4MVNA 3S7KB 1AVGH 3A81A 4I8GA 4IC6A 1OWKA 1QRXA 1WQSA 1AU8A 2IN2A 4B1TA 1CA0B 2ZEBA 3GDUA 4BAHB 1C2FA 2GMTB 2O8MA 4Y8ZA 1MMJN 4UFFH 3PLBA 4I33A 1C5ZB 4WF8A 4CRCA 3ATIA 3P8NA 1C5NH 5BPEA 2NU4E 1TNKA 1D9IA 2BOKA 2ILNA 1O2OA 4OS4A 4UFEH 4GHTA 1AE8H 1VITF 3QK1A 2J2UA 4HZHA 2RA0A 1QURH 1YCPM 3QGJA 1BMLA 4DCDA 3ZZ6A 2QIQA 1V6DA 1GBCA 2Q6GA 1C2LA 1BTPA 1HAXB 2QA9E 1EJMA 1O3LA 1RD3B 3GISB 3MU5A 1E35B 1FPCH 5HMAA 3U69H 5BRRE 1IAUA 1BTWA 1NU9A 4XDEA 1D6RA 2A5IA 2G4TA 1H8IH 2HNTE 1P9SA 1AB9C 1EAIA 1F2SE 4IN2A 3MU8A 1OP8A 1UK4A 2UWLA 3PYHA 1Y3UA 1A2CH 1O38A 1ELFA 1RFNA 4ESTE 1NY22 2D1JA 4GSOA 4KP0A 1F0TA 3ATWA 1J15A 1MAYA 3M3SA 4VGCB 4X1NU 5CHAB 1YPLH 2D2DA 1C1PA 1DFPA 3TH2H 4NSYA 3MNCA 8KME2 5L2ZH 3R0FA 1ZJDA 3E6PH 3DFJA 1TGNA 3RXOA 1TGSZ 4AORA 1MU6B 1MZAA 3G01A 3UR6A 2XW9A 3MI4A 3VB7A 2SGFE 3BEFB 1XX9A 5FCRA 1FDPA 4CR5A 3TLOA 4ZKNU 4JYUH 4Y76A 5EQRA 1HCGA 2G5NA 1LHGH 2R3YA 1QJ6B 4KELA 1ELVA 2EI8A 3RXBA 1O2TA 2ASUB 3SO3A 1GL0E 1Z6EA 1CA0C 2H5CA 4H42U 2PSYA 3SU6A 3KF2A 1IQIA 4QT8C 2ZGHA 1FAXA 1EPTB 3B9FH 1K22H 1T4UH 2NU2E 1KLIH 2A7HA 4BNRA 2G00A 4ABEA 3BTKE 1SGNE 1F0UA 2OC8A 1C2HA 1C4U2 2F9PA 3UUZA 3RXHA 4ISHH 2H5DA 1ZLRA 1J17T 4DY7B 3M7TA 1H4WA 1UO6A 6CHAC 1AVWA 1DLKB 1GJ5H 3TK9A 1NU7B 2Q1JA 1BDAA 1F5RA 2TGDA 4YO9A 2XC4A 3RXCA 1EOLA 1GBDA 4X8UH 3PTNA 1FY3A 1GHAF 2XC5A 5E8EH 4K3JA 5F03A 4D7GA 2ZTXA 3LGYA 1ELBA 1Y5BT 3RM0H 1EQ9A 1O2PA 3LGIA 2I6QA 4YOIA 1A5IA 1YC0A 2A31A 1YPGH 1S6FA 4RSPA 3LPRA 2OXSA 4Y0ZE 3UPEA 4UDWH 1E0FD 1RIWB 1Z8IB 5EW2H 1O5FH 2NU0E 2R0KA 4NCYA 5HYOA 4ISNA 2AFQB 4LZ1H 2ZA5A 4MPWA 2BQWB 5IYTA 2Z94A 2QCYA 3SGBE 2XBWA 3M5NA 1AO5A 2C8WB 1PFXC 5SGAE 2HOBA 3B8JA 4Y0YE 4JK6A 3FANA 3URCA 3RXGA 3KNXA 1NZQH 2J38A 1DX5M 3SJ8A 2BQ6B 4ABIA 3E0NB 1GJ4H 2J34A 5GPIB 1DM4B 1G3CA 1QCPA 4DT7B 1ANDA 1DLEA 3S9AA 1EP5A 2Z3CA 1UTQA 1G3BA 5JBTA 4Y11E 3LC3A 3SQEE 1GCDA 1SOZA 2A4GA 2ZKSA 1O2NA 2WINI 1NFYA 4D9QA 4OS2A 1T8OA 1WBGB 4AYYB 1UTMA 2BXTH 1AE5A 1FV9A 1J14A 3RXPA 1OKXA 3NWUA 2V3OH 2ZIQH 1Z6JH 2ZG0H 4RN6A 1ZTKA 1TRNA 4TYDA 1TX7A 2FMJA 1SQTA 5FAHA 3KIDU 1NRPH 1TX6A 1XUIA 4A1XA 1AKSA 1HNEE 2GDDA 3UQVA 1FN6A 1LKBA 5PTPA 4DIIH 2VH0A 2ALPA 5C2ZA 1F5KU 1UCYK 1FY5A 3FZZA 3MOCA 1CT0E 2TIOA 2R3UA 1BMNH 1YGCH 2F83A 1RXPA 1JWTA 1YKTA 4X1PU 1L4DA 1LVYA 3LJOA 4ASHA 4DW2U 2XNIA 2ZCHP 2ZHWH 2OCVB 4TY6A 4Y6DA 3RXSA 3KN2A 5LPFA 1SMFE 5C67A 1ZMLA 5EQQA 1AI8H 1GJAB 3S9BA 4YM9A 2JH6D 1VR1H 2QF3A 2TGPZ 2XXLA 2BY7X 1O2XA 2JH5D 2QY0B 1DANH 2DE8A 3GICB 1CT2E 1PJPA 3M5MA 3ZYEA 1O2JA 1NPMA 2SGEE 2ZU2A 1SHHB 1FY4A 1C1SA 1L4ZA 1CGJE 4XBDA 5A8XA 1GMDF 1SLWB 2FODA 2BY9X 1C1UH 3T25A 2XWBI 1V2NT 1L1NA 3URDA 1GBKA 1DICA 3Q76A 3SN8A 2ZDAH 2XBXA 1E38B 1GBJA 1TIOA 4VGCC 4X8SH 2J92A 5FPYA 1BRBE 4K1TA 3SUEA 3NKKA 2BDCA 2ZDMA 2VIVA 3F6UH 1DSTA 1NTPA 1O32A 1V2MT 1SFQB 3K9XB 1JRTA 8LPRA 1DWDH 8ESTE 2O8TA 3KCGH 1ZSKA 2V6NA 1BRAA 2XYAA 1UTNA 2P95A 1LHCH 3GY5A 5F8ZA 5HM9A 1TONA 4UONA 1GI0A 2ZHDA 4IGDA 4OS1A 4WJG2 4U30A 1UVTH 1YP9A 1T4VH 1ZRKA 4WY3A 1F0SA 1YPKH 3HKIB 5L2YH 1P02A 2BZ6H 2F3CE 1IQGA 4O97A 1XXDA 2ZTZA 1QJ7B 2F9VA 4WWYA 1SOTA 1EJAA 1W13U 5AFZH 1SGFA 1HUTH 1DOJA 4BAQB 1SLUB 3Q3XA 3ODDA 2FXRA 4INHA 3SV9A 2GVFA 3RXJA 1TAWA 1EP6A 2FOEA 1G30B 3P17H 2AMPA 1GBBA 1ORFA 5FPTA 4Z6AH 1KSNA 1TOMH 1LVMA 2Y7XA 1C5XB 4INLA 5DP6A 1GMHF 3ZYDA 2GZ9A 3MO3A 1ZGVA 1Z1IA 4MLFB 1P04A 2WPLS 1GGDC 2G51A 4B75A 1S6HA 1GI4A 3RMLH 4CRDA 1WAYB 5ABWA 1QIXB 1HIAA 1Y5AT 3QLPH 1PQ5A 1V2UT 1C1WH 1Z8RA 2XBYA 1GHBF 1HAVB 1LHEH 3UIRA 1TQ0B 1THPB 5EG4A 3TGKE 1NC6A 1MD7A 3SV7A 3MNBA 3HATH 3T29A 3SV2H 3TJUA 5DO4H 2GGVB 3GYMA 4MPUA 1P10A 1K9OE 1INCA 1PPZA 1O37A 2ZPSA 2VNTA 1VGCC 1FNIA 4TWWA 1GBHA 4I32A 1UK2A 4AOQA 3RXMA 2ZGBH 4FUCA 1DVAH 1N8OC 1MCTA 3LJJA 3QGNB 1QL9A 2VVCA 5A0CA 1ZSLA 1TX8A 4Q80A 2W7SA 5ESTE 4TWYA 2BDHA 1ZHMA 3GY8A 4FUFA 1EATA 2ZCLP 1HDTH 2AIPA 4UFDH 3GCTG 2UUFB 4I7YH 1IQHA 2ODQA 3KQBA 3A86A 1O2ZA 3ZVCA 4UEHH 3QZRA 5E0JA 1AHTH 1LKAA 1A0HB 2BXUH 2A2XH 3HKJB 2H9HA 2P93A 2GKVE 2VGCC 1HXFH 4HI3A 1QTFA 1TPSA 1BMAA 1F92A 3M7QA 4AFSA 3A8CA 1XKAC 1JIRA 1C5MD 1NROH 1O3AA 1A3EH 2XCNA 4ZHLU 1SGQE 2VIOA 3DFLA 2BQ7B 3EA8A 4IN1A 2O8LA 2FOBA 3BTWE 1BRUP 1P12E 4SGAE 1N6YA 1H9IE 1LPKB 2JETC 4AYVB 3BV9B 4E7NA 1AMHA 3MTYA 1KXAA 2BVXH 3NCLA 2IOTA 2R2MB 2ZWLH 1JXPA 5F8XA 4I8HA 1P2QA 3V12A 3Q3KA 3OYPA 5FXLA 1O30A 1O3GA 2BY5X 4MQAA 5A8ZA 4OGYA 5E0GA 4KTSA 1O36A 1PYTC 4NA9H 4BXWA 1A0JA 1SQOA 4X6OA 1DXWA 1V2LT 3A88A 3ODFA 3ZZ9A 3TH3H 1A46H 1CHGA 1EX3A 3LT3A 1SB1H 1C2KA 1F7ZA 5GWZA 3T5FH 1QBNA 1W14U 4K1EA 1WQVH 3C1KA 3RC4A 2WUCA 6ESTA 1C4V2 2OC0A 4Y7BA 1O2RA 3A89A 2R2WU 3SNEA 1Y3WA 1SQAA 3O8DA 1VITG 5EODA 3V13A 2RDLA 3SJIA 4JZEH 1O2UA 1FY1A 3BIUH 5DKMA 4THNH 2Z9GA 3ZZAA 3UTUH 1Y5UT 2A4QA 2BM2A 1SGPE 3RXQA 1GI3A 1V2RT 1G36A 2WV4A 3BTEE 3DUXH 1OX1A 3A8DA 3SU2A 4RKOB 3HPTB 5AF9H 1AIXH 3GCHB 1GJ6A 3LKWA 3UR9A 2A2QH 1BHXB 1V2JT 2ZTYA 3JZ2B 3TPIZ 4FUJA 1FXYA 5LPEA 2ZDKA 1WV7H 3OTJE 1GJ8B 1ARBA 2FOGA 2GMTC 5T6DA 1Z8JB 1CO7E 4DG4A 1BMMH 3SUDA 3SI3H 1AKSB 1GWAA 2FLRH 3MU0A 4GLYA 3VXEH 1OP2A 3ATMA 4LOYH 2ZI2H 1AZZA 3GDVA 1UTJA 4GHQA 1D3DB 4X2XA 3SBKA 3LDXH 3T26A 3RXEA 5ESBA 1KYNA 2ANKH 5K0HA 1FN8A 1T7CA
chains in the Genus database with same CATH superfamily
3PTBA 1Q2WA 2XC0A 3BTGE 3F9HA 3SU4A 1BA8B 1L1GA 1FLEE 4NGAH 1P2KA 4JCNA 2CN0H 3ESTA 1SGRE 2ZHQH 1DT2A 1B7XB 1RGQA 3AAVA 2ANYA 5TJXA 4AFQA 4KTCA 3CS7A 4FUIA 8GCHF 2QC2A 3RDZA 1GPZA 2BDGA 2SGAA 2ZDLA 3VGCB 5HM2A 1C5PA 1CBWC 2IJD1 2J94A 1F0RA 1V2KT 1EAWA 4YT7H 1ETTH 1O2VA 1ABIH 1WTGH 2LPRA 1DDJA 4NA8A 2RCEA 3RXKA 2QF5A 1GI9B 2FPZA 5EXMA 2UUJB 3IWMA 2Q6FA 4X1SU 5I46H 4CBOA 3TGIE 1HB0B 3RC5A 1QL7A 5JB9S 1BTXA 3SNAA 1RTKA 1XUKA 1UTPA 4NWLA 2WYJA 1GDQA 2PKSB 1ZPCA 1XKBC 3D23A 1EAUA 3TJNA 1Z8GA 1OXGA 2FTLE 2W5EA 2CF8H 2WPJS 1P57B 2JJ1D 4AG2A 1XUFA 4ISOA 1UVPA 1PPGE 3NPSA 5E2PA 3U8TH 1JIMA 4XBCA 1TNLA 2RA3A 3IITA 1OWHA 3RU4E 5AHGH 5C1YA 2A1DB 2CHAC 4WH8A 3WY8A 1TLDA 4CH8B 5GXPA 2HWLB 4AC9A 4NSVA 2OC1A 1K2I1 2BD9A 3PMBB 3DHKH 2HPQH 5C1UA 2J9NA 1MABB 2FIRH 1O3JA 1TB6H 2Z9JA 3ZZCA 3F2GA 8GCHG 2YMSB 2CXVA 4AFZA 2ZU3A 3F0PA 1LCYA 4ZAEA 1OWIA 5J4SA 1ZSJA 2ZFRH 3QWCH 3SGQE 1ETSH 3MYWA 2Y6TA 1O2YA 4K8BA 3VB5A 2EI7A 2VWMA 4JZIA 1YYY1 2FEQH 1ZPZA 4BTUB 1P03A 1QB1A 1OP0A 3BN9A 1DUEA 2THFB 5EQSA 2WV9A 5CE1A 2WUBA 5EPNA 4O3TA 1AZ8A 4BOHA 2WHXA 2WPDD 2IPHA 3QO6A 2VWOA 1TRYA 1G9IE 3B23B 5LPRA 1CHOF 2YOLA 1AD8H 2P94A 2XCFA 4MNXA 4OM9A 4X1QU 1ESAA 3PO1C 3WW7A 3RMOH 3LGVA 2AGIX 2WV5A 3NXPA 3P70B 2O8WA 2B9LA 2GCHF 5C1XA 1LQDB 2FI5E 5F6MA 1C2GA 1C1MA 3UNSA 1HAHH 1GGDB 4HGCA 1W8BH 1BITA 1UVSH 1MQ5A 1QHRB 3BTTE 7GCHF 4Q2KA 1KXCA 2FDAA 2PKSC 1PPFE 4OS7A 1SQRA 4JYTA 1QA7A 3P6ZB 3SHCH 4B74A 4B2BA 2SGDE 4H6TA 3K65B 1H9HE 4XFQA 2G5VA 1DPOA 3F9GA 1BJVA 1HAYB 1H8HD 4J1YA 1GHXH 3PV2A 4YESB 1O3EA 3BEIB 1O0DH 1Y3YA 1HFDA 1Y8TA 2ODPA 2BVRH 2VINA 5DG6A 1TE0A 1WOFA 1YLNA 1JMOH 1TFXA 1H8DH 1S6LA 2XRCA 3PLKA 3RMMH 1C1TA 1BBRK 3CP7A 1J9CH 4A5TS 1V2TT 1ELAA 1Y3XA 1GCTC 1CA8B 3I77A 4F48B 2BLVA 1JRSA 2V0BA 1E79D 2NU1E 1O35A 1C9TA 1O5EH 5J4QA 2QXHA 1EZSC 1DE7H 1QY6A 3MU1A 1S85A 3UNQA 3P8OA 1S81A 4CRBA 4JK5A 4BAKB 2GD4B 2M5TA 2HLCA 1LQEA 3GY7A 1FMGA 2BD3A 1O2GH 1O2SA 1B0EA 1LHDH 1Q31A 2W6JD 5L30H 1J8AA 1KTTB 3M37A 4X0WU 3VB3A 1NBMD 5C5NA 2ZHEH 2AGGX 4ISIH 2HRVA 1C1NA 3D65E 2ZGJA 1RTFB 1D3PB 1YCPH 5EU8A 2V35A 1BTYA 1GG6C 1SGTA 1XUGA 2VWLA 1O33A 2WPHS 2I6SA 1OYQA 4XSKU 1O3NA 2STBE 3H7TA 1GJ7B 1FQ3A 2PTNA 2ANMH 1W12U 3NK8A 1CSOE 2OK5A 2QV1A 3DSOA 1YPHC 2ZFSA 2JDID 2SGQE 1UTOA 1MCVA 2F9UA 1YLCA 5EJ1A 1SSXA 4FU8A 1E36B 4IC5A 2TRMA 1EB1H 2OC7A 1W3CA 3WWBA 3S9CA 3TJOA 2CGAA 3TNTA 1NFXA 1P3CA 3OE7D 4AFUA 4LZ4B 1QFKH 3FFGA 5T6GA 3MWIU 2V7QD 3VPKA 5L6NH 5KEDA 1O34A 1O5AB 2SFAA 1FUJA 1Y3VA 1HJ9A 1IQEA 4FXGH 3M5OA 2AMQA 3EDXB 1ABJH 3TVJB 1ZRBA 4X6MA 3U98H 2A45B 1JOUB 3TK5A 1ESBA 3ZZDA 3F1SB 1J16A 2OQUA 1P3EA 3H5CB 4CREA 1HAPH 2V3MA 2ZFFH 3D49H 4X1RU 9ESTA 3H09A 1O39A 4XRNA 1EXFA 2SNVA 1C9PA 2H1UA 1P9UA 1P06A 1YPJH 2VVVA 1O31A 1O3OA 2VB0A 3DA9B 4X2YA 4KGAA 4ZKSU 1WU1A 2UUYA 4WH6A 3DSPA 5C0UA 3CENA 4MNYA 3LU9B 3RXRA 2GTBA 1EUFA 2XWAA 3RU4D 1A5GH 2J4IA 4X6PA 3TGJE 3OY6U 4B2AA 3PROA 3M3TA 1GI5A 3ZVFA 1V3XA 2VIPA 1A1RA 3KQCA 2QGRA 3SV8A 1HRTH 2ZGCA 3E3TA 1H1BA 4BANB 3KQEA 3VB4A 1KXDA 3ZZ7A 3TU7H 1SC8U 4Y71A 2BY8X 1ELGA 4MTBA 1ELDE 1BCUH 4MDSA 1GMCG 3VFEA 2B7DH 4GCHG 1MTWA 1EZQA 3HK3B 3K2UA 3BEUA 4F4OC 4XOJA 3BG8A 1SI5H 4I8JA 1MH0A 1K1JA 4FUGA 1GBAA 1SGFG 5E0HA 2AGEX 2YNBA 1DUAA 2VU8E 4NA7A 2A0QB 1ELTA 1AUTC 5JBBS 4YT6H 3Q3YA 2ZF0H 2FESH 1VCPA 1O2KA 2BX4A 4FOUC 4OGXA 5DP8A 3MFJA 2BLOA 2D26C 1BTUA 3HK6B 4MPXA 1QQ4A 5HIYA 1W7GH 2W6ID 3V7TA 1P0SH 2K1QA 2ZDVH 3BF6H 3OY5U 1HJAC 3AW1A 3V3MA 1YCPK 1O5GH 3GCOA 4NIXA 1NFUA 4ZHMU 3QDZB 3W94A 4AX9H 4ACBA 2Y5HA 1C2IA 4X2WA 2GJGA 4B71A 4CHAC 1VITH 2ZDNA 4YOJA 3ZV8A 2ZNKH 4CRFA 1GL1A 5GCHG 1G37A 3FAOA 2CF9H 1GJCB 2AEIH 3FP7E 4ZKOU 2Y5FA 1TYNA 1NO9H 5HXFA 3ZZ3A 1A5HA 1UHBB 1O2LA 1SGIB 1GJBB 3GY2A 5KGOA 1HLTH 1MTVA 3LC5A 4WMFA 4YLQH 5IK2D 2BD8A 4TSFD 3A80A 1CE5A 7LPRA 2J98A 2GT8A 3ZVAA 2A32A 4NIWA 4DJZB 1S82A 2SNWA 4F49A 4WMDA 4AGKA 1LTOA 3ATKA 2F91A 3A8BA 1QBVH 1NRNH 3RXDA 1TA6A 4AN7A 3UAIC 1K1PA 1C1OA 4Y10E 2PKAB 1IQFA 1Z1JA 1GI2A 2F43B 2C90B 2FX4A 1KXFA 1OYTH 1P8VC 2BTCE 1C2DA 1O2MA 2BZAA 2TBSA 3RXLA 1O3FA 3MH6A 1BBRH 1P01A 3BTQE 5EJLA 2Y80A 2HNTC 2RG3A 1ZPBA 1C5WB 2FWWA 1THSH 2FP7B 5IDKA 1TGCA 3QN7A 4B2CA 2ZO3H 4IS5A 4HTCH 4NG9H 4X8TH 2ZU4A 1FI8A 1GHBG 2P3FH 3OSYA 5DP5A 4O03A 1V2QT 1OWEA 4AG1A 3TITA 1Z71A 1RRKA 2STAE 1E37B 2ZFPH 4TPYA 3ZVGA 1O3IA 3H7OA 3RU4T 1C2JA 1MKWH 1NFWA 2NWNA 3WWFA 1TA2A 3PMJA 3F2FA 1ANCA 2QXIA 4JZDH 3RXUA 3MNSA 1MBQA 3SUGA 1O3PB 1W10U 3M5LA 3SNDA 2CJIA 3M61U 3N7OA 1G3EA 2GV7A 1DS2E 1NRQH 2A7CA 4BTIB 3STJA 2G8TA 2ZPQA 4Y8YA 1W0JD 1ZR0A 1CVWH 2GP9B 2AH4X 1GVKB 3UWJH 2V3HH 3HGPA 4Q7YA 1UJ1A 7KMEH 3SZEA 4JZ1A 4E7RG 1BBRE 1LPGB 3A7TA 1TPOA 3VB6A 2ZZUH 1C5LH 2F9BH 2PUQH 2ZHFH 1GCTB 3GY3A 1HAIH 1QJ1B 3I78A 2BOHB 2P16A 1NRRH 1KY9A 4F55A 2QN5T 1HIAB 4KKDA 1WCZA 1SGCA 2OD3B 1SR5C 3GS9A 1K1MA 2GZ7A 2ZECA 5B6OA 4CH2B 3DT0H 1O2IA 2BYAX 3FP8E 3GOVB 1QQUA 2PLXA 1XUJA 2PGQB 3N7EA 2ZP0H 5T1VA 1HAVA 5FBIA 1IQLA 3EA9A 7GCHG 3FVFB 1TNHA 1W7XH 5DPAA 4D9RA 1PPCE 1G2MA 2BY6X 1UVUH 3ITIA 1X7AC 3MHWU 3V0XA 1ZTLA 2ULLA 5TCAA 2JETB 1XUHA 2FOAA 1QRWA 1UMAH 2B8OH 1HAZB 4GPGA 1KIGH 3O8RA 4O3UA 4B76A 2BDYA 1C1VH 2Z6BD 1TGBA 2B5TB 2KZ4A 1OWJA 1NRSH 3LOXA 1IHSH 4YZUA 4RT1A 2P8OC 5GCHF 4UFGH 4A1VA 1S0RA 3U8OH 1C4Y2 1AWHB 4I8LA 1U6QA 1ZMNA 4XBBA 1ESTA 1MBMA 2O8UA 4Z0KA 1VJAU 3RXFA 1YPHE 3PV4A 3SU3A 1T8MA 3PO1B 3EE7A 5F8TA 2OBQA 2M2AA 4Y79A 5C3NA 3T62A 2PSXA 5A09A 2PUXB 1SLXB 3E8LA 4I31A 5T6FA 3UQOA 3RXVA 3NUMA 1XVOA 2EA3A 4X2VA 4I86A 1A3BH 1H9LB 2FO9A 2G52A 1C2EA 3GY6A 3SOSA 2OINA 2PKAA 1S5SA 3U8RH 1LPZB 3EE0B 3QX5H 1CGIE 2FLBH 3ZZ4A 1EJNA 2H6MA 3RXAA 2GCTB 2PTCE 5F53A 1AGJA 3RP2A 2ALVA 3FOAA 2GCTC 1ARCA 1C5QA 2J98B 2Y5GA 4UE7H 1C1QA 1VGCB 2F9NA 1GI1A 4TY7A 4MG3A 1UHBA 3BG4B 1MTSA 3O8BA 5DP7A 3BTDE 3E1XB 1BJUA 1BIOA 3ZVEA 3K6YA 3SU0A 3R3GB 1ZMJA 1K1NA 1P2JA 1E34B 4NFEA 5EXLA 5GNDA 3W95A 1GHYH 1HBTH 1GHVH 3T2NA 4R0IA 1O5DH 4YLUA 2BDAA 3C27B 1S83A 3NZIA 1DWCH 6GCHG 1BTHH 1SL3A 2WPMS 2XTTB 2ANWA 2HNTF 1P2OA 3L33A 3SORA 3LGWA 2GDEH 3LONA 5EW1H 2H9EH 5GDSH 1QB9A 1QB6A 5GJ4B 1AWFH 3TIUA 1SGDE 3BG4C 3MH5A 4WXIA 4NZLA 5DK1A 4A1TA 3ZVDA 4MNVA 1QBOA 1QA0A 2FI3E 2HPPH 1BOQA 9LPRA 4NIYA 3T27A 2VVUA 1HJ8A 4Z1MD 4NZQA 4YTAA 1YPMH 3MNXA 2FX6A 3RLYH 1E1QD 3SNCA 1WTHD 1O3HA 2CK3D 1D3TB 3KHVA 5FHTA 3AVZA 2EEKA 6CHAB 1O3KA 3F68H 1NS3A 2EY4C 4CR9A 1TPAE 2G4UA 3PLPA 4OS6A 1G2LA 3TJVA 1HPGA 2VH6A 4AGJA 2FTMA 2ZGXH 1C5VA 4E05H 2A7JA 1BB0B 1MTUA 1LVOA 4E06H 4U01A 4GAWA 2WZQA 1IOEA 3SQHE 6GCHF 3AW0A 1Y59T 2ZC9H 3OAAD 1RTLA 1GI7B 1T8LA 1GVLA 3A7ZA 2HGTH 5AFYH 1GBMA 3TNSA 2OP9A 3F9FA 3M3VA 1GBIA 4BAOB 5DN6D 5FBEA 5K7RA 2HVXA 3FZDA 3OEED 2C93B 2DE9A 1CU1A 1TNJA 2AMDA 2UWPA 4ZHAA 5DP3A 4J2YB 3KGPA 1GHZA 1TWXB 2KCOA 2D8WA 1TPPA 2EC9H 3P95A 3VXFH 2J95A 1B5GH 3BTFE 1C5OH 1O3DA 3GCHC 1W2KH 4FUDA 2OBOA 1GBLA 2VIQA 4CBNA 1T8NA 4DVAU 1FAKH 5HIZA 2FOCA 4ZROA 2W7UA 5JBAS 4DURA 1AVXA 4ABAA 1W0YH 1V2ST 4GUXA 1YPEH 5A0AE 2QYIA 3A7VA 3E16B 2JH0D 1GG6B 4M9FA 1XM1A 3I29A 5JB8S 2FYRA 1LHFH 4I8KA 3ENSB 2ZCKP 1MD8A 2Q6DA 3MMGA 5HGGA 7ESTE 1P05A 3P92A 5CHAC 2QAAA 4FUEA 2FZZA 2ZFQH 2C3SA 4RKJB 1BUIA 2O9QA 3A82A 1TMTH 2WPIS 5TCCA 3EYDA 3RMNH 1DWBH 1RS0A 1PYTD 1EOJA 4WMEA 2W3IA 1XMNB 2Z7FE 1LDTT 4BTTB 1ANBA 2PR3A 1O5CB 3EA7A 3GYLB 2H2ZA 1C5RA 1YBWA 1YF4A 2TGAA 3A7XA 4K5ZA 2IJOB 1JBUH 4H6SB 2ZQ2A 1BHXF 1KTSB 1CHOG 4FU7A 1OWDA 1WYKA 1AUJA 3A8AA 1PPBH 3GDSA 1EZUC 3PMAB 3UNRA 4YOGA 1MU8B 1HYLA 2BD7A 1DITH 1ZTJA 3LH3A 1IQKA 1A4WH 2GCHG 3CS0A 5JYIA 2AS9A 3SJKA 1QNJA 2F9OA 3Q00A 2Z9KA 2VIWA 3ZVBA 3A83A 5EGMA 3UOUA 4JYVH 1TQ7B 3RC6A 1N1LA 3MO9A 2CV3A 4A7IB 2P59A 4ISLA 1D3QB 4ABDA 1BTZA 1ZHPA 2VIDA 4IMQA 1FPHH 1E1RD 2PWXA 2RFKC 1VZQH 2W26A 1EPTA 1HJAB 2W3KA 1EFRD 1MKXK 1FIWA 4NFFA 1K1IA 1SGEE 2C8YB 3RM2H 1SHYA 1IQMA 1OS8A 1C1RA 3SV6A 4RT0A 1V2VT 2QXGA 5GIBA 3KQDA 1KLJH 1UTKA 3PWCA 3T28A 1AN1E 1AFEH 3K6ZA 1EB2A 2VGCB 2YMSD 2G81E 1P11E 4UD9H 1EAXA 3GY4A 2BX3A 2KCYA 4FU9A 3DCLA 5DJ7A 1GMDG 1PQ8A 2VBCA 2H9TH 2WYGA 1O3BA 1WUNH 1MKXH 3STIA 4WXVA 1Z7KA 4A92A 4KTUA 5DP9A 3ELAH 3HGNA 4LK4A 4X8VH 1AFQB 1NT1A 1MTNC 2FYQA 1OPHB 1T32A 3RXTA 1TNGA 1BT7A 1PPEE 3BIVH 3RUOA 3SI4H 4CRAA 4CHAB 5LGOA 5CMXH 2XNDD 2Z9LA 4LXBH 1DY9A 1TBQH 1C2MA 1DY8A 1DWEH 3OFND 4GVUA 2PFEA 5A2MH 2VWNA 4B73A 2ODYB 2BB4A 1COWD 1AFQC 3FN8A 3SUFA 1MAXA 1S84A 2G55A 4M7GA 2BD4A 3E91A 3ZZBA 1KMHB 1UTLM 1L0ZA 1SFIA 2Y81A 1MZDA 4DOQA 2ZQ1A 2CHAB 1PPHE 1SVPA 1LMWB 1B0FA 1C5TA 5T3HA 1QZ8A 2ESTE 3KL6A 3SHAH 2OUAA 3MH7A 4FVBA 3EQ0H 1HAOH 5C5OA 1GJDB 2BDIA 1FONA 3BTME 2A5AA 1DSUA 3S7HB 2YNAA 1MQ6A 3UFAA 3GCTF 1KXEA 1IQJA 4ZMAH 1EPTC 3E0PB 1BRCE 2TGTA 2A5KA 2Z9IA 5HKKD 3L3TA 1TRMA 4ZKRU 1HV7A 1TMUH 5ETXA 1MUEB 1K1OA 3A87A 1TNIA 1YM0A 1GDUA 3F9EA 1HXEH 1K0HA 1P2MA 2BD5A 1LO6A 3IG6B 1ELEE 3LGTA 3PWBA 4Y8XA 5EOKA 1ZJKA 1YLDA 3SW2B 1PQAA 3QTOH 4CRGA 1FJSA 2Z3EA 3A7WA 3SNBA 2QXJA 4U32A 1YWUA 4D7FA 1OOKB 3ZZ5A 2GZ8A 5C20A 4MPVA 3SU5A 1GMCF 5FX6A 1UW7A 1P2NA 4SGBE 3P8FA 1VCWA 1QL8A 1S0QA 1ZGIA 5I25A 5ESBA 2ZFTA 2SGPE 1SG8B 3AAUA 1GBFA 3LGUA 4O9VA 3EGKH 4U2WA 2AHME 1O3CA 2ZPRA 4OS5A 3VEQB 1ACBE 1THRH 3ATLA 1EZXC 5JPMH 1V2WT 2FS9A 4Y7AA 1GHAG 1TBZH 2AYWA 5AVDA 3PB1E 1GMHG 2WSSD 4Q7XA 4BXSA 3D62A 5A8YA 2UWOA 4FUHA 1AB9B 4TT3D 4R8TB 1K1LA 2A4OA 2DUCA 2Y82A 1QR3E 1FIZA 3RLWH 3SZNA 2L6OA 4ZXYH 1O2WA 4K8YA 2OLGA 1VJ9U 1WSSH 2BD2A 3AK5A 5JBCS 3GCNA 3M7UA 4ASUD 2KAIA 3LH1A 1O5BB 1ELCA 1ZHRA 1FY8E 2BVSH 4ABJA 1TOCB 1SPJA 3M35A 2VJ1A 1MKWK 3AASA 1LVBA 3S69A 3M36A 4AB8A 3QZQA 3BTHE 3KYFA 3SJOA 1TABE 4NWKA 2RDEA 1IQNA 2C8XB 2C8ZB 5FPSA 2BLQA 3OU0A 1VCQA 1V2PT 2FOMB 1KDQA 4Q7ZA 1G32B 1NN6A 2R9PA 4D76A 3P8GA 1ZYOA 2UUKB 1CGHA 2FOHA 2GV6A 4ZUHA 1L2EA 3A7YA 5DP4A 1FZZA 3PMHB 1UCYH 4ZXXH 2BDBA 2Y7ZA 5A0BA 5FX5A 3U1JB 1KXBA 1A7SA 1C5UA 3O8CA 5LH8A 1K28D 1D4PB 2KM0A 1O3MA 1HGTH 3Q77A 2WPKS 3MU4A 5JDUB 3SGAE 1SBWA 2AIQA 1P09A 1F5LA 1GI6A 1NESE 1TBRH 3QTVH 1C5YB 4K69A 1SLVB 4IW4E 2OQ5A 2TPIZ 1GDNA 4IMZA 2PHBA 4HFPB 1HAGE 1PQ7A 2EI6A 2QE7D 5DGJA 1GBEA 4AB9A 4XE4A 4ABFA 1OHHD 1N6XA 1TALA 3MQKC 2K0QA 4TPIZ 1ZZZA 4A6LA 2FS8A 4GCHF 1K21H 1KDQB 3SJ9A 4NIVA 1A0LA 4K60A 1UK3A 1UVOA 2FM2A 3U1IB 4ACAA 1QGFA 1XVMA 3BSQA 4ZH8A 2QF4A 5FCKA 4H4FA 3UREA 4D8NA 3UWIA 3FP6E 3L6PA 1TMBH 4FUBA 4WVPE 3RXIA 2P3UB 2ZU5A 1GHWH 1DXPA 1GVZA 2Z3DA 1RJXB 2R0LA 3F2HA 2P3TB 1O2HA 1KLTA 4ABGA 4BAMB 3DD2H 2XBVA 6LPRA 2HLDD 4JMYA 4JZFH 4ABBA 4K1SA 3EAJA 3TK6A 1M9UA 5B6LA 4X6NA 2C4FH 3TH4H 1NM6A 2B0FA 4K2YA 4P00A 4ABHA 1O2QA 2BHGA 2LNCA 2JKHA 4FVDA 3DSGA 5G4BA 3A85A 1EASA 1A61H 1L1JA 1QRZA 5H4IB 2KAIB 2LELA 1P2IA 4P02A 1IHTH 1BQYA 1RIWC 1W0ZU 2A4RA 2CMYA 1UCYE 3A84A 5EXNA 1GI8B 1GBTA 1SGYE 1ETRH 1ZOMA 1N8OB 2PW8H 4DGJA 1D6WA 2HALA 4INKA 1T31A 2OTVA 2AERH 2PGBB 1Q3XA 3U9AH 3VG8A 3MO6A 1CBWB 1C5SA 2NU3E 1V2OT 4MNWA 3LIWA 1MTNB 3VGCC 1G3DA 2BMGB 5EPYA 1CQQA 2GT7A 3QUMP 4AZ2B 2FI4E 3NRLA 4IBLH 1ID5H 2QF0A 5EIYA 2BLWA 3MH4A 3UY9A 1ANEA 1TGTA 2PV9B 1OSSA 1GJ9B 3JZ1B 3PM3A 2ZU1A 1AY6H 1W11U 3SU1A 1CT4E 2GX4A 2FOFA 2XOKD 1AQ7A 3PRDA 1EKBB 3ZZ8A 3CNRA 1BZXE 3S0NA 3KEEA 3ZV9A 3OX7U 4DIHH 5E2OA 3UOPA 3E90B 4PROA 1XXFA 2P8OB 4MVNA 3S7KB 1AVGH 3A81A 4I8GA 4IC6A 1OWKA 1QRXA 1WQSA 1AU8A 2IN2A 4B1TA 1CA0B 2ZEBA 3GDUA 4BAHB 1C2FA 2GMTB 2O8MA 4Y8ZA 1MMJN 4UFFH 3PLBA 4I33A 1C5ZB 4WF8A 4CRCA 3ATIA 3P8NA 4B6EA 1C5NH 5BPEA 2NU4E 1TNKA 1D9IA 2BOKA 2ILNA 1O2OA 4OS4A 4UFEH 4GHTA 1AE8H 1VITF 3QK1A 2J2UA 4HZHA 2RA0A 1QURH 1YCPM 3QGJA 1BMLA 4DCDA 3ZZ6A 2QIQA 1V6DA 1GBCA 2Q6GA 1C2LA 1BTPA 1HAXB 2QA9E 1EJMA 1O3LA 1RD3B 3GISB 3MU5A 1E35B 1FPCH 5HMAA 3U69H 5BRRE 1IAUA 1BTWA 1NU9A 4XDEA 1D6RA 2A5IA 2G4TA 1H8IH 2HNTE 4YXWD 1P9SA 1AB9C 1EAIA 1F2SE 4IN2A 3MU8A 1OP8A 1UK4A 2UWLA 3PYHA 1Y3UA 1A2CH 1O38A 2LP6A 1ELFA 1RFNA 5C94A 4ESTE 1NY22 2D1JA 5FL7D 4GSOA 4KP0A 1F0TA 3ATWA 1J15A 1MAYA 3M3SA 4VGCB 4X1NU 5CHAB 1YPLH 2D2DA 1C1PA 1DFPA 3TH2H 4NSYA 3MNCA 8KME2 5L2ZH 3R0FA 4B6FA 1ZJDA 3E6PH 2K8IA 3DFJA 1TGNA 3RXOA 1TGSZ 4AORA 1MU6B 1MZAA 3G01A 3UR6A 2XW9A 3MI4A 3VB7A 2SGFE 3BEFB 1XX9A 5FCRA 1FDPA 4CR5A 3TLOA 4ZKNU 4JYUH 4Y76A 5EQRA 1HCGA 2G5NA 1LHGH 2R3YA 1QJ6B 3ZIAD 4KELA 1ELVA 2EI8A 3OEHD 3RXBA 1O2TA 2ASUB 3SO3A 1GL0E 1Z6EA 1CA0C 2H5CA 4H42U 2PSYA 3SU6A 3KF2A 1IQIA 4QT8C 2ZGHA 1FAXA 1EPTB 3B9FH 1K22H 1T4UH 2NU2E 1KLIH 2A7HA 4BNRA 2G00A 4ABEA 3BTKE 1SGNE 1F0UA 2OC8A 1C2HA 1C4U2 2F9PA 1YY3A 3UUZA 3RXHA 4ISHH 2H5DA 1ZLRA 1J17T 4DY7B 3M7TA 1H4WA 1UO6A 3N7DA 1AVWA 6CHAC 1DLKB 1GJ5H 3TK9A 1NU7B 2Q1JA 1BDAA 1F5RA 2TGDA 4YO9A 2XC4A 3RXCA 1EOLA 1GBDA 4X8UH 3PTNA 1FY3A 1GHAF 2XC5A 5E8EH 4K3JA 5F03A 4D7GA 2ZTXA 3LGYA 1ELBA 1Y5BT 3RM0H 1EQ9A 1O2PA 3KYGA 3LGIA 2I6QA 4YOIA 1A5IA 1YC0A 2A31A 1YPGH 1S6FA 1WDIA 1SKYE 3SYJA 4RSPA 3LPRA 2OXSA 4Y0ZE 3UPEA 4UDWH 1E0FD 1RIWB 5CHBA 1Z8IB 5EW2H 1O5FH 2NU0E 2R0KA 4NCYA 5HYOA 4ISNA 2AFQB 4LZ1H 2ZA5A 4MPWA 2BQWB 5IYTA 2Z94A 2QCYA 2KCAA 3SGBE 2XBWA 3M5NA 1AO5A 2C8WB 1PFXC 5SGAE 2HOBA 3B8JA 4RI0A 4Y0YE 4JK6A 3FANA 3URCA 3W1EA 3RXGA 3KNXA 1NZQH 2J38A 1DX5M 3SJ8A 2BQ6B 4ABIA 3E0NB 3FKSD 1GJ4H 2J34A 5GPIB 5C17A 1DM4B 1G3CA 1QCPA 4DT7B 1ANDA 1DLEA 3S9AA 1EP5A 2Z3CA 1UTQA 1G3BA 5JBTA 4Y11E 3LC3A 3SQEE 1GCDA 1SOZA 2A4GA 2ZKSA 1O2NA 2WINI 5DSFA 1NFYA 4D9QA 4OS2A 1T8OA 1WBGB 4AYYB 1UTMA 2BXTH 1AE5A 1FV9A 1J14A 3RXPA 1OKXA 3NWUA 2V3OH 2PP6A 2ZIQH 1Z6JH 2ZG0H 4RN6A 1ZTKA 1TRNA 3F0OA 4TYDA 1TX7A 3N99A 2FMJA 1SQTA 5FAHA 3KIDU 1NRPH 1TX6A 1XUIA 4A1XA 1AKSA 1HNEE 2JJ2D 2GDDA 3UQVA 1FN6A 3U28C 1LKBA 5PTPA 4DIIH 2VH0A 2ALPA 5C2ZA 1F5KU 1UCYK 1FY5A 5CDFE 3FZZA 3MOCA 1CT0E 2TIOA 2R3UA 1BMNH 1YGCH 2F83A 1RXPA 1JWTA 1YKTA 4X1PU 1L4DA 1LVYA 3LJOA 4ASHA 4DW2U 2XNIA 2ZCHP 2ZHWH 2OCVB 4TY6A 4Y6DA 3UB0A 3RXSA 3KN2A 5LPFA 1SMFE 1FX0B 5C67A 1ZMLA 5EQQA 1AI8H 1GJAB 3S9BA 4YM9A 2JH6D 1VR1H 2QF3A 2TGPZ 2XXLA 2BY7X 1O2XA 2JH5D 2QY0B 1DANH 2DE8A 3GICB 1CT2E 1PJPA 3M5MA 3ZYEA 1O2JA 1NPMA 2SGEE 2ZU2A 1SHHB 1FY4A 1C1SA 1L4ZA 1CGJE 4XBDA 5A8XA 1GMDF 1SLWB 2FODA 2BY9X 1C1UH 3T25A 2XWBI 1V2NT 1L1NA 3URDA 1GBKA 1DICA 3Q76A 3SN8A 2ZDAH 2XBXA 1E38B 1GBJA 1TIOA 4VGCC 4X8SH 2J92A 5FPYA 1BRBE 4K1TA 3SUEA 3NKKA 2BDCA 2ZDMA 2VIVA 3F6UH 1DSTA 1NTPA 1O32A 1V2MT 1BMFD 1SFQB 3K9XB 1JRTA 8LPRA 1DWDH 8ESTE 2O8TA 3KCGH 1ZSKA 2V6NA 4XD7D 1BRAA 2XYAA 1UTNA 2P95A 1LHCH 3GY5A 5F8ZA 5HM9A 1TONA 4UONA 1GI0A 2ZHDA 4IGDA 1W0KD 4OS1A 4WJG2 4U30A 1UVTH 1YP9A 1T4VH 1ZRKA 4WY3A 1F0SA 1YPKH 3HKIB 5L2YH 1P02A 2BZ6H 2F3CE 1IQGA 4O97A 1XXDA 2ZTZA 1QJ7B 2F9VA 4WWYA 1H8ED 1SOTA 1EJAA 2EQNA 4HG6A 1W13U 5AFZH 1SGFA 1HUTH 1DOJA 4BAQB 1SLUB 3Q3XA 3ODDA 2FXRA 4INHA 3SV9A 5KECA 2GVFA 3RXJA 1TAWA 1EP6A 2FOEA 1G30B 3P17H 2AMPA 1GBBA 1ORFA 5FPTA 4Z6AH 1KSNA 1TOMH 1LVMA 2Y7XA 1C5XB 4INLA 5DP6A 1GMHF 3ZYDA 2GZ9A 3MO3A 4Q63A 1ZGVA 1Z1IA 4MLFB 1P04A 2WPLS 1GGDC 2HVYB 2G51A 4B75A 1S6HA 1GI4A 3RMLH 1VKYA 4CRDA 1WAYB 5ABWA 1QIXB 1HIAA 1Y5AT 3QLPH 1PQ5A 1V2UT 1C1WH 1Z8RA 2XBYA 1GHBF 1HAVB 1LHEH 3UIRA 1TQ0B 1THPB 5EG4A 3TGKE 3PRBA 1NC6A 1MD7A 3SV7A 2J97A 3MNBA 3HATH 3T29A 3SV2H 3TJUA 5DO4H 2GGVB 3GYMA 4MPUA 1P10A 1K9OE 1INCA 1PPZA 1O37A 2ZPSA 2VNTA 1VGCC 1FNIA 4TWWA 1GBHA 4I32A 1UK2A 4AOQA 3RXMA 2ZGBH 4FUCA 1DVAH 1N8OC 1MCTA 3LJJA 3QGNB 1QL9A 2VVCA 2YMSC 5A0CA 1ZSLA 1TX8A 4Q80A 2W7SA 5ESTE 4TWYA 2BDHA 3OTPA 1ZHMA 3GY8A 4FUFA 1EATA 2ZCLP 1HDTH 2AIPA 1WXRA 4UFDH 3GCTG 2UUFB 2IPQX 4I7YH 1IQHA 2ODQA 3KQBA 3A86A 1O2ZA 3ZVCA 4UEHH 3QZRA 5E0JA 1AHTH 1LKAA 1A0HB 2BXUH 2KR7A 2A2XH 3HKJB 2H9HA 2P93A 2GKVE 2VGCC 1HXFH 3KQ5A 4HI3A 1QTFA 1TPSA 1BMAA 1F92A 3M7QA 4AFSA 3A8CA 1XKAC 1JIRA 1C5MD 1NROH 1O3AA 1A3EH 2XCNA 4ZHLU 3FO8D 1SGQE 2VIOA 3DFLA 2BQ7B 3EA8A 2KCPA 4IN1A 2O8LA 2FOBA 3BTWE 1BRUP 2JIZD 1P12E 4SGAE 1N6YA 1H9IE 1LPKB 2JETC 4AYVB 3BV9B 4E7NA 1AMHA 3MTYA 1KXAA 2BVXH 3NCLA 2IOTA 2R2MB 2ZWLH 1JXPA 5F8XA 4I8HA 1P2QA 3V12A 3Q3KA 3OYPA 5FXLA 1O30A 1O3GA 2BY5X 4MQAA 5A8ZA 4OGYA 5E0GA 4KTSA 1O36A 1PYTC 4NA9H 4BXWA 1A0JA 1SQOA 4X6OA 1NBME 1DXWA 1V2LT 3A88A 3ODFA 3ZZ9A 3TH3H 1A46H 1CHGA 1EX3A 3LT3A 5EJZA 1SB1H 1C2KA 1F7ZA 4ZCNA 5GWZA 3T5FH 2KX4A 1QBNA 1W14U 4K1EA 1WQVH 3C1KA 3RC4A 2WUCA 6ESTA 1C4V2 2OC0A 4Y7BA 1O2RA 3A89A 2R2WU 3SNEA 1Y3WA 1SQAA 3O8DA 2F4LA 1VITG 5EODA 3V13A 2RDLA 3SJIA 4FETA 4JZEH 1O2UA 1FY1A 3BIUH 5DKMA 4THNH 2Z9GA 3ZZAA 3UTUH 1Y5UT 2J5UA 2A4QA 2BM2A 1SGPE 3RXQA 4DT4A 1GI3A 1V2RT 1G36A 2WV4A 3BTEE 3DUXH 1OX1A 3A8DA 3SU2A 4RKOB 3HPTB 5AF9H 1AIXH 3GCHB 1GJ6A 3LKWA 2KFWA 3UR9A 2A2QH 3PV5A 1BHXB 1V2JT 2ZTYA 3JZ2B 3TPIZ 4FUJA 1FXYA 5LPEA 2ZDKA 1WV7H 3OTJE 1GJ8B 1ARBA 2FOGA 2GMTC 5T6DA 1Z8JB 1CO7E 4DG4A 2L74A 1BMMH 3SUDA 3SI3H 1AKSB 1GWAA 5C0TA 2FLRH 3F3BA 3MU0A 4GLYA 3VXEH 1OP2A 3ATMA 4LOYH 2ZI2H 1AZZA 3GDVA 1UTJA 4GHQA 1D3DB 4X2XA 3SBKA 3LDXH 3T26A 3RXEA 4Q4LA 1KYNA 2ANKH 5K0HA 1FN8A 1T7CA
chains in the Genus database with same CATH topology
3PTBA 1Q2WA 2XC0A 3BTGE 3F9HA 3SU4A 1BA8B 1L1GA 1FLEE 4NGAH 1P2KA 4JCNA 2CN0H 3ESTA 1SGRE 2ZHQH 1DT2A 1B7XB 1RGQA 3AAVA 2ANYA 5TJXA 4AFQA 4KTCA 3CS7A 4FUIA 8GCHF 2QC2A 3RDZA 1GPZA 2BDGA 2SGAA 2ZDLA 3VGCB 5HM2A 1C5PA 1CBWC 2J94A 1F0RA 1V2KT 1EAWA 4YT7H 1ETTH 1O2VA 1ABIH 1WTGH 2LPRA 1DDJA 4NA8A 2RCEA 3RXKA 1GI9B 2FPZA 5EXMA 2UUJB 3IWMA 2Q6FA 4X1SU 5I46H 4CBOA 3TGIE 1HB0B 3RC5A 1QL7A 5JB9S 1BTXA 3SNAA 1RTKA 1XUKA 1UTPA 4NWLA 2WYJA 1GDQA 2PKSB 1ZPCA 1XKBC 3D23A 1EAUA 3TJNA 1Z8GA 1OXGA 2FTLE 2W5EA 2CF8H 2WPJS 1P57B 4AG2A 1XUFA 4ISOA 1UVPA 1PPGE 3NPSA 5E2PA 3U8TH 1JIMA 4XBCA 1TNLA 2RA3A 3IITA 1OWHA 3RU4E 5AHGH 5C1YA 2A1DB 2CHAC 4WH8A 3WY8A 1TLDA 4CH8B 5GXPA 2HWLB 4NSVA 2OC1A 1K2I1 2BD9A 3PMBB 3DHKH 2HPQH 5C1UA 2J9NA 2FIRH 1O3JA 1TB6H 2Z9JA 3ZZCA 8GCHG 2CXVA 4AFZA 2ZU3A 4ZAEA 1LCYA 1OWIA 5J4SA 1ZSJA 2ZFRH 3QWCH 3SGQE 1ETSH 3MYWA 2Y6TA 1O2YA 4K8BA 3VB5A 2EI7A 2VWMA 4JZIA 1YYY1 2FEQH 1ZPZA 4BTUB 1P03A 1QB1A 1OP0A 3BN9A 1DUEA 2THFB 5EQSA 5CE1A 2WUBA 5EPNA 4O3TA 1AZ8A 4BOHA 2IPHA 3QO6A 2VWOA 1TRYA 1G9IE 3B23B 5LPRA 1CHOF 2YOLA 1AD8H 2P94A 2XCFA 4MNXA 4X1QU 1ESAA 3PO1C 3RMOH 3LGVA 2AGIX 2WV5A 3NXPA 3P70B 2O8WA 2B9LA 2GCHF 5C1XA 1LQDB 2FI5E 5F6MA 1C2GA 1C1MA 3UNSA 1HAHH 1GGDB 4HGCA 1W8BH 1BITA 1UVSH 1MQ5A 1QHRB 3BTTE 7GCHF 4Q2KA 1KXCA 2FDAA 2PKSC 1PPFE 4OS7A 4JYTA 1QA7A 3P6ZB 3SHCH 4B74A 4B2BA 2SGDE 4H6TA 3K65B 1H9HE 4XFQA 2G5VA 1DPOA 3F9GA 1BJVA 1HAYB 4J1YA 1GHXH 4YESB 1O3EA 3BEIB 1O0DH 1Y3YA 1HFDA 1Y8TA 2ODPA 2BVRH 2VINA 5DG6A 1TE0A 1WOFA 1JMOH 1TFXA 1H8DH 2XRCA 3PLKA 3RMMH 1C1TA 1BBRK 3CP7A 1J9CH 4A5TS 1V2TT 1ELAA 1Y3XA 1GCTC 1CA8B 3I77A 2BLVA 1JRSA 2V0BA 2NU1E 1O35A 1C9TA 1O5EH 5J4QA 2QXHA 1EZSC 1DE7H 1QY6A 3MU1A 1S85A 3UNQA 3P8OA 1S81A 4CRBA 4JK5A 4BAKB 2GD4B 2M5TA 2HLCA 1LQEA 3GY7A 1FMGA 2BD3A 1O2GH 1O2SA 1B0EA 1LHDH 1Q31A 5L30H 1J8AA 1KTTB 3M37A 4X0WU 3VB3A 5C5NA 2ZHEH 2AGGX 4ISIH 2HRVA 1C1NA 3D65E 2ZGJA 1RTFB 1D3PB 1YCPH 5EU8A 2V35A 1BTYA 1GG6C 1SGTA 1XUGA 2VWLA 1O33A 2WPHS 2I6SA 1OYQA 4XSKU 1O3NA 2STBE 3H7TA 1GJ7B 1FQ3A 2PTNA 2ANMH 1W12U 3NK8A 1CSOE 2QV1A 1YPHC 2ZFSA 2SGQE 1UTOA 1MCVA 2F9UA 1YLCA 1SSXA 4FU8A 1E36B 4IC5A 2TRMA 1EB1H 2OC7A 1W3CA 3S9CA 3TJOA 2CGAA 3TNTA 1NFXA 1P3CA 4AFUA 4LZ4B 1QFKH 3FFGA 5T6GA 3MWIU 3VPKA 5L6NH 1O34A 1O5AB 2SFAA 1FUJA 1Y3VA 1HJ9A 1IQEA 4FXGH 3M5OA 2AMQA 3EDXB 1ABJH 3TVJB 1ZRBA 4X6MA 3U98H 2A45B 1JOUB 3TK5A 1ESBA 3ZZDA 3F1SB 1J16A 2OQUA 1P3EA 3H5CB 4CREA 1HAPH 4X1RU 2ZFFH 3D49H 9ESTA 1O39A 1EXFA 2SNVA 1C9PA 2H1UA 1P9UA 1P06A 1YPJH 2VVVA 1O31A 1O3OA 2VB0A 3DA9B 4X2YA 4KGAA 4ZKSU 1WU1A 2UUYA 4WH6A 3CENA 4MNYA 3LU9B 3RXRA 2GTBA 1EUFA 2XWAA 3RU4D 1A5GH 2J4IA 4X6PA 3TGJE 3OY6U 4B2AA 3PROA 3M3TA 1GI5A 3ZVFA 1V3XA 2VIPA 1A1RA 3KQCA 2QGRA 3SV8A 1HRTH 2ZGCA 3E3TA 1H1BA 4BANB 3KQEA 3VB4A 1KXDA 3ZZ7A 3TU7H 1SC8U 4Y71A 2BY8X 1ELGA 4MTBA 1ELDE 1BCUH 4MDSA 1GMCG 3VFEA 2B7DH 4GCHG 1MTWA 1EZQA 3HK3B 3K2UA 3BEUA 4F4OC 4XOJA 3BG8A 1SI5H 4I8JA 1MH0A 1K1JA 4FUGA 1GBAA 1SGFG 5E0HA 2AGEX 2YNBA 1DUAA 2VU8E 4NA7A 2A0QB 1ELTA 1AUTC 5JBBS 4YT6H 3Q3YA 2ZF0H 2FESH 1VCPA 1O2KA 2BX4A 4OGXA 5DP8A 3MFJA 2BLOA 2D26C 1BTUA 3HK6B 4MPXA 1QQ4A 1W7GH 3V7TA 1P0SH 2K1QA 2ZDVH 3BF6H 3OY5U 1HJAC 3AW1A 3V3MA 1YCPK 1O5GH 3GCOA 4NIXA 1NFUA 4ZHMU 3QDZB 3W94A 4AX9H 2Y5HA 1C2IA 4X2WA 4B71A 4CHAC 1VITH 2ZDNA 4YOJA 3ZV8A 2ZNKH 4CRFA 1GL1A 5GCHG 1G37A 3FAOA 2CF9H 1GJCB 2AEIH 3FP7E 4ZKOU 2Y5FA 1TYNA 1NO9H 5HXFA 3ZZ3A 1A5HA 1UHBB 1O2LA 1SGIB 1GJBB 3GY2A 1HLTH 1MTVA 3LC5A 4WMFA 4YLQH 2BD8A 3A80A 1CE5A 7LPRA 2GT8A 3ZVAA 2A32A 4NIWA 4DJZB 1S82A 2SNWA 4F49A 4WMDA 4AGKA 1LTOA 3ATKA 2F91A 3A8BA 1QBVH 1NRNH 3RXDA 1TA6A 4AN7A 1K1PA 1C1OA 4Y10E 2PKAB 1IQFA 1Z1JA 1GI2A 2C90B 2FX4A 1KXFA 1OYTH 1P8VC 2BTCE 1C2DA 1O2MA 2BZAA 2TBSA 3RXLA 1O3FA 3MH6A 1BBRH 1P01A 3BTQE 2Y80A 2HNTC 2RG3A 1ZPBA 1C5WB 2FWWA 1THSH 2FP7B 5IDKA 1TGCA 3QN7A 4B2CA 2ZO3H 4IS5A 4HTCH 4NG9H 4X8TH 2ZU4A 1FI8A 1GHBG 2P3FH 3OSYA 5DP5A 4O03A 1V2QT 1OWEA 4AG1A 3TITA 1Z71A 1RRKA 2STAE 1E37B 2ZFPH 4TPYA 3ZVGA 1O3IA 3H7OA 3RU4T 1C2JA 1MKWH 1NFWA 2NWNA 1TA2A 3PMJA 1ANCA 2QXIA 4JZDH 3RXUA 3MNSA 1MBQA 3SUGA 1O3PB 1W10U 3M5LA 3SNDA 2CJIA 3M61U 3N7OA 1G3EA 2GV7A 1DS2E 1NRQH 2A7CA 4BTIB 3STJA 2G8TA 2ZPQA 4Y8YA 1ZR0A 1CVWH 2GP9B 2AH4X 1GVKB 3UWJH 2V3HH 3HGPA 4Q7YA 1UJ1A 7KMEH 4JZ1A 4E7RG 1BBRE 1LPGB 3A7TA 1TPOA 3VB6A 2ZZUH 1C5LH 2F9BH 2PUQH 2ZHFH 1GCTB 3GY3A 1HAIH 1QJ1B 3I78A 2BOHB 2P16A 1NRRH 1KY9A 2QN5T 1HIAB 4KKDA 1WCZA 1SGCA 2OD3B 1SR5C 1K1MA 2GZ7A 2ZECA 5B6OA 4CH2B 3DT0H 1O2IA 2BYAX 3FP8E 3GOVB 1QQUA 2PLXA 1XUJA 2PGQB 2ZP0H 1HAVA 5FBIA 1IQLA 3EA9A 7GCHG 3FVFB 1TNHA 1W7XH 5DPAA 4D9RA 1PPCE 1G2MA 2BY6X 1UVUH 3ITIA 1X7AC 3MHWU 3V0XA 1ZTLA 2ULLA 5TCAA 2JETB 1XUHA 2FOAA 1QRWA 1UMAH 2B8OH 1HAZB 4GPGA 1KIGH 3O8RA 4O3UA 4B76A 2BDYA 1C1VH 2Z6BD 1TGBA 2B5TB 1OWJA 1NRSH 3LOXA 1IHSH 4YZUA 2P8OC 5GCHF 4UFGH 4A1VA 1S0RA 3U8OH 1C4Y2 1AWHB 4I8LA 1U6QA 1ZMNA 4XBBA 1ESTA 1MBMA 2O8UA 4Z0KA 1VJAU 3RXFA 1YPHE 3PV4A 3SU3A 1T8MA 3PO1B 5F8TA 2OBQA 5C3NA 4Y79A 3T62A 2PSXA 5A09A 2PUXB 1SLXB 3E8LA 4I31A 5T6FA 3UQOA 3RXVA 3NUMA 1XVOA 2EA3A 4X2VA 1A3BH 1H9LB 2FO9A 2G52A 1C2EA 3GY6A 3SOSA 2OINA 2PKAA 1S5SA 3U8RH 1LPZB 3EE0B 3QX5H 1CGIE 2FLBH 3ZZ4A 1EJNA 2H6MA 3RXAA 2GCTB 2PTCE 1AGJA 3RP2A 2ALVA 2GCTC 1ARCA 1C5QA 2Y5GA 4UE7H 1C1QA 1VGCB 2F9NA 1GI1A 4TY7A 4MG3A 1UHBA 3BG4B 1MTSA 3O8BA 5DP7A 3BTDE 3E1XB 1BJUA 1BIOA 3ZVEA 3K6YA 3SU0A 3R3GB 1ZMJA 1K1NA 1P2JA 1E34B 4NFEA 5EXLA 3W95A 1GHYH 1HBTH 1GHVH 3T2NA 4R0IA 1O5DH 4YLUA 2BDAA 3C27B 1S83A 3NZIA 1DWCH 6GCHG 1BTHH 1SL3A 2WPMS 2XTTB 2ANWA 2HNTF 1P2OA 3L33A 3SORA 3LGWA 2GDEH 3LONA 5EW1H 2H9EH 5GDSH 1QB9A 1QB6A 5GJ4B 1AWFH 3TIUA 1SGDE 3BG4C 3MH5A 4WXIA 4NZLA 5DK1A 4A1TA 3ZVDA 4MNVA 1QBOA 1QA0A 2FI3E 2HPPH 1BOQA 9LPRA 4NIYA 3T27A 2VVUA 1HJ8A 4NZQA 4YTAA 1YPMH 3MNXA 2FX6A 3RLYH 3SNCA 1WTHD 1O3HA 1D3TB 3KHVA 5FHTA 3AVZA 2EEKA 6CHAB 1O3KA 3F68H 1NS3A 4CR9A 1TPAE 2G4UA 3PLPA 4OS6A 1G2LA 3TJVA 1HPGA 2VH6A 4AGJA 2FTMA 2ZGXH 1C5VA 4E05H 2A7JA 1BB0B 1MTUA 1LVOA 4E06H 4U01A 4GAWA 1IOEA 3SQHE 6GCHF 3AW0A 1Y59T 2ZC9H 1RTLA 1GI7B 1T8LA 1GVLA 3A7ZA 2HGTH 5AFYH 1GBMA 3TNSA 2OP9A 3F9FA 3M3VA 1GBIA 4BAOB 5FBEA 5K7RA 2HVXA 3FZDA 2C93B 2DE9A 1CU1A 1TNJA 2AMDA 2UWPA 4ZHAA 5DP3A 4J2YB 3KGPA 1GHZA 1TWXB 2D8WA 1TPPA 2EC9H 3P95A 3VXFH 2J95A 1B5GH 3BTFE 1C5OH 1O3DA 3GCHC 1W2KH 4FUDA 2OBOA 1GBLA 2VIQA 4CBNA 1T8NA 4DVAU 1FAKH 2FOCA 4ZROA 2W7UA 5JBAS 4DURA 1AVXA 4ABAA 1W0YH 1V2ST 4GUXA 1YPEH 5A0AE 2QYIA 3A7VA 3E16B 2JH0D 1GG6B 1XM1A 3I29A 5JB8S 2FYRA 1LHFH 4I8KA 3ENSB 2ZCKP 1MD8A 2Q6DA 3MMGA 5HGGA 7ESTE 1P05A 3P92A 5CHAC 2QAAA 4FUEA 2FZZA 2ZFQH 2C3SA 4RKJB 1BUIA 2O9QA 3A82A 1TMTH 2WPIS 5TCCA 3EYDA 3RMNH 1DWBH 1RS0A 1PYTD 1EOJA 4WMEA 2W3IA 1XMNB 2Z7FE 1LDTT 4BTTB 1ANBA 2PR3A 1O5CB 3EA7A 3GYLB 2H2ZA 1C5RA 1YBWA 1YF4A 2TGAA 3A7XA 4K5ZA 2IJOB 1JBUH 4H6SB 2ZQ2A 1BHXF 1KTSB 1CHOG 4FU7A 1OWDA 1WYKA 1AUJA 3A8AA 1PPBH 3GDSA 1EZUC 3PMAB 3UNRA 4YOGA 1MU8B 1HYLA 2BD7A 1DITH 1ZTJA 3LH3A 1IQKA 1A4WH 2GCHG 3CS0A 5JYIA 2AS9A 3SJKA 1QNJA 2F9OA 3Q00A 2Z9KA 2VIWA 3ZVBA 3A83A 5EGMA 3UOUA 4JYVH 1TQ7B 3RC6A 1N1LA 3MO9A 2CV3A 4A7IB 2P59A 4ISLA 1D3QB 4ABDA 1BTZA 1ZHPA 2VIDA 4IMQA 1FPHH 2PWXA 2W26A 1VZQH 1EPTA 1HJAB 2W3KA 1MKXK 1FIWA 4NFFA 1K1IA 1SGEE 2C8YB 3RM2H 1SHYA 1IQMA 1OS8A 1C1RA 3SV6A 1V2VT 2QXGA 5GIBA 3KQDA 1KLJH 1UTKA 3PWCA 3T28A 1AN1E 1AFEH 3K6ZA 1EB2A 2VGCB 2G81E 1P11E 4UD9H 1EAXA 3GY4A 2BX3A 4FU9A 5DJ7A 1GMDG 1PQ8A 2H9TH 2WYGA 1O3BA 1WUNH 1MKXH 3STIA 4WXVA 1Z7KA 4A92A 4KTUA 5DP9A 3ELAH 3HGNA 4LK4A 4X8VH 1AFQB 1NT1A 1MTNC 2FYQA 1OPHB 1T32A 3RXTA 1TNGA 1BT7A 1PPEE 3BIVH 3RUOA 3SI4H 4CRAA 4CHAB 5LGOA 5CMXH 2Z9LA 4LXBH 1DY9A 1TBQH 1C2MA 1DY8A 1DWEH 4GVUA 2PFEA 5A2MH 2VWNA 4B73A 2ODYB 2BB4A 1AFQC 3SUFA 1MAXA 1S84A 2G55A 4M7GA 2BD4A 3E91A 3ZZBA 1UTLM 1L0ZA 1SFIA 2Y81A 1MZDA 4DOQA 2ZQ1A 2CHAB 1PPHE 1SVPA 1LMWB 1B0FA 1C5TA 5T3HA 2ESTE 3KL6A 3SHAH 2OUAA 3MH7A