1TX7A

Bovine trypsin complexed with p-amidinophenylmethylphosphinic acid (ampa)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen
publication title An oxyanion-hole selective serine protease inhibitor in complex with trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tx7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tx7A02
1GBEA 1TBRH 1NFUA 2YOLA 5GIBA 4K2YA 4WXIA 4DVAU 3R0FA 2AYWA 1Z8RA 1T8MA 1AFEH 2GZ9A 4CH2B 4BAKB 3L3TA 4I8LA 1TRYA 2O8WA 3HATH 1GJ5H 2RA3A 3AW0A 5JBBS 6CHAC 1XUGA 4K8YA 4UFGH 1G32B 4IBLH 4BANB 3DA9B 4F49A 3U1IB 3BTME 1RIWB 1YYY1 1AI8H 1O34A 2A7CA 4AZ2B 3EE0B 4XBCA 1HJ8A 3P8OA 1LCYA 1TPPA 5DJ7A 1C5WB 3SGAE 4CREA 4E05H 4Z6AH 4OS4A 3M5OA 1BMNH 1SGDE 1HIAA 1YLDA 1GMDG 3K65B 1AO5A 1GMHF 3ZZ5A 1C5TA 1T8OA 1P10A 2RG3A 1LTOA 3T62A 3M5NA 4YM9A 1W12U 4NSVA 4ZXYH 1NU9A 3NKKA 1N8OB 2P93A 3RMOH 3VXFH 1ESTA 3M7UA 3UQOA 3WY8A 1XVMA 1AZZA 1ELEE 1P2QA 4GUXA 1NRNH 4ZKNU 2G00A 3I78A 1OYTH 1GJ4H 2XC0A 1Z8JB 4B74A 5F8TA 1GMCG 1KXDA 4JZIA 1K21H 1P02A 1QBVH 2FYRA 3HK6B 1TOMH 3F9HA 2BMGB 4GCHF 1YCPK 2AEIH 1GCDA 2AGGX 2F9VA 3LJOA 2XWAA 3KN2A 4Z0KA 1GHWH 3ZZDA 3RMNH 5L2YH 2D26C 1UVUH 1ELTA 1HXEH 2ZGXH 1P2MA 1GGDC 1SLUB 4RN6A 1FIZA 1AHTH 2ANYA 1GBJA 2F91A 2TIOA 1SQOA 2FI4E 4AX9H 1TA6A 4X1SU 1VCPA 1NS3A 3GYLB 2ZU4A 1GDQA 1UTMA 1WOFA 3ODFA 1THPB 3BV9B 4I31A 3GCOA 2PWXA 4MQAA 5JYIA 3U9AH 1AUTC 1BRCE 2FMJA 2TRMA 3SJKA 3GICB 1SLVB 4ESTE 5LGOA 2VIOA 4DJZB 1KXBA 4HTCH 4X1QU 1A3BH 1ABJH 1RS0A 1TA2A 1BB0B 2J9NA 2Y81A 1TQ7B 1O2VA 1GBKA 3STJA 1PPFE 3ZV8A 4FUEA 3TH4H 3HK3B 3SV9A 1NT1A 3BTTE 3BEIB 5LH8A 2SGFE 1BCUH 1O3LA 1Z8IB 5T6DA 2W3IA 1FI8A 1QB6A 3OY6U 2HNTF 1XM1A 2PTCE 3E91A 4ISLA 2Y5FA 1G3DA 2GV7A 4WF8A 2IN2A 1IHTH 2XWBI 1FY4A 2RCEA 1TRMA 1ZTLA 2A5KA 1XKBC 4PROA 2C8XB 3IITA 1DLKB 2BLWA 2EI8A 5A8YA 3T5FH 1SGFA 1CGHA 2K1QA 4INLA 1BTHH 1H1BA 3EA8A 5K0HA 3RM2H 3UIRA 3VB7A 1BJUA 1SGNE 2BQWB 1UCYH 3RXBA 2RA0A 4YOGA 2PV9B 4TPYA 2BDHA 2VJ1A 2TPIZ 3DHKH 4YOIA 4BNRA 4KTSA 3BTFE 1O3FA 2LPRA 5C3NA 2ZPQA 3MU4A 1VGCC 1D4PB 3BTWE 1BBRK 2H2ZA 5TCCA 1LVYA 3ZYEA 1GG6B 1GMHG 1RJXB 4CH8B 5T3HA 2F9UA 3UFAA 1NM6A 5EOKA 3ZVDA 3BTHE 3A82A 1BJVA 4UONA 1O2IA 4ABIA 4NSYA 1GHXH 3A8DA 1LO6A 2R0KA 1EPTB 3BF6H 1C5OH 1P01A 1ARBA 3M3VA 2W26A 4KTCA 3GCTF 3MO9A 4KKDA 1E37B 1MQ6A 1NRPH 1ELDE 4YTAA 1O3BA 1E0FD 4INKA 1O2LA 3AAUA 2SGAA 4GCHG 1MKXK 1PJPA 2XNIA 2QXIA 5AF9H 1KLTA 2BDIA 2H6MA 7GCHF 4OS7A 3FFGA 1ZHMA 2AGIX 3SV8A 1RXPA 1LHFH 2G8TA 2XYAA 4BAMB 1HAXB 4CRGA 2V0BA 3VGCC 3RXFA 1WSSH 1O2RA 2JH6D 4KP0A 2WPKS 1OXGA 1EOJA 1IHSH 3A89A 4LXBH 2PKSC 1GCTC 1QB9A 1Z8GA 1CSOE 1YBWA 2GMTC 3T27A 1CA0C 4JMYA 2ZCLP 3SBKA 2OP9A 3IWMA 2GP9B 2PLXA 1FY8E 3BTQE 2GCTB 2NU4E 2XC4A 1FUJA 3EDXB 4IMZA 1SMFE 2F9PA 1A2CH 1F0UA 4WH8A 5GDSH 5IDKA 3KGPA 2GZ7A 1MU6B 4NIWA 3DUXH 1KYNA 5FPTA 1FLEE 1GI2A 4Q7YA 2ODYB 2FXRA 1TE0A 3RU4T 2B0FA 3SJIA 3GYMA 5E2PA 1RTLA 1GBDA 1TFXA 5A0BA 2BB4A 1BTZA 1G2MA 3LC3A 4NFFA 5T6FA 3SV7A 2UWOA 3TNTA 1BIOA 2Z9GA 1AE5A 2BM2A 5E0HA 1F5KU 4MPWA 4JZFH 3SJOA 4X2XA 1P2OA 1AMHA 1AVGH 1CBWC 2A4RA 3CP7A 1W11U 2FOBA 1ANBA 4H4FA 2ZGHA 1D9IA 1AWFH 1A4WH 2XBWA 1GI5A 2M5TA 1VZQH 3A87A 2QYIA 1O3DA 7KMEH 1TPSA 2FOEA 4VGCC 4WH6A 2BD2A 1DWEH 1P9UA 3G01A 2R3YA 1QL8A 4J1YA 1DFPA 2STBE 4K8BA 1ZPBA 2VVCA 4WVPE 1F7ZA 1ELCA 4AB9A 3MHWU 2F9BH 4NA8A 4ZHMU 4OS6A 1AFQC 4MNVA 5A09A 5C5OA 2Z7FE 2R2WU 4MNXA 2TGAA 3H5CB 4ABHA 2QA9E 5HGGA 4LOYH 1BDAA 1PQ7A 1HBTH 1GVLA 3QDZB 2VH6A 3QTVH 5EW1H 1DICA 1K2I1 1FN8A 1O3GA 2NU3E 1K1NA 2W5EA 3LC5A 1G3BA 1VR1H 1EPTA 3ATLA 1XUHA 1Y3VA 2Q6FA 4LZ1H 2VNTA 1ELAA 3U1JB 1TYNA 1ZGIA 3ZZBA 4IW4E 1WBGB 3SU5A 2BQ7B 3ENSB 2WPJS 1O35A 3GCTG 3UNRA 3U98H 2VIVA 1OS8A 3W94A 2IPHA 1SOTA 1ARCA 2P8OC 3ATWA 4UEHH 4Y76A 3VEQB 8LPRA 1G36A 1E34B 3A7TA 3D62A 4NIVA 4OGXA 1H9LB 4X8VH 3QTOH 3ZVCA 3DFLA 7GCHG 1DWDH 3FZZA 3SU2A 3GY5A 4ISOA 1GL1A 3RXGA 2BHGA 3SV2H 3LT3A 1YCPH 1O2TA 4JYUH 2ZG0H 1C5UA 4WXVA 1OWJA 3RM0H 1RRKA 3ZZCA 1JWTA 1SGIB 5CHAB 3K2UA 2B5TB 3NK8A 1J14A 4TPIZ 1Z6JH 1THRH 1GCTB 2A4OA 3PLPA 4R0IA 1L4DA 4ZHAA 3VB6A 2OQUA 2G55A 5DP6A 1ZPCA 1VJAU 3L6PA 1WCZA 1IQGA 2ULLA 1TMUH 2Z94A 3LIWA 1ACBE 3CENA 1UTPA 4U32A 1DOJA 2CF8H 2Q1JA 2ZDLA 1C1VH 1O3IA 2CHAB 2OC8A 4J2YB 3TK5A 1IQEA 1TOCB 1O39A 5C67A 1EQ9A 2PW8H 1SFIA 1V2TT 1OOKB 4B2CA 1O3HA 3UQVA 1D6WA 1EJNA 3QLPH 3NCLA 1GHYH 3HPTB 1DWBH 1K28D 1GI7B 3MMGA 1QQ4A 3RU4D 1OWEA 1HCGA 3DD2H 5GWZA 5SGAE 3A7ZA 1C9PA 1GMDF 5HM2A 2D1JA 1GJBB 2QAAA 2R0LA 1H8IH 5FX5A 3RXKA 1ZGVA 1IAUA 1N8OC 1GPZA 3PYHA 2P59A 1GI4A 1M9UA 3E16B 1UVSH 2C8WB 1L4ZA 1EOLA 1TONA 1S5SA 1EZSC 1HNEE 4HZHA 4VGCB 3MO3A 2O8UA 4Y7AA 2W7UA 1MBMA 2BD7A 3E0PB 1BTUA 5EG4A 4H42U 1GJ7B 5DK1A 3ZVFA 3A7YA 4B76A 3DT0H 3O8BA 3E1XB 1P04A 2QF0A 1G30B 3PO1B 1FPHH 3R3GB 1LKAA 2BYAX 1YKTA 3M5MA 2C8YB 4FUIA 4OS1A 1AN1E 1F0TA 1CHOG 2BOHB 1L2EA 4ABBA 8GCHF 4NWLA 2O8LA 3MU0A 2BXTH 1ANCA 2G81E 1BBRH 2GT7A 1XXDA 4X6MA 1AUJA 1D6RA 4U30A 3RMMH 4B71A 1AD8H 1O5GH 1O2HA 1A7SA 3SO3A 5FXLA 5EPYA 1HAVB 5J4SA 4Y8XA 3RXDA 3TH2H 1TX7A 5DP4A 4UE7H 3TGIE 1TPOA 2G4UA 3AAVA 1HLTH 3QWCH 1GVKB 4I8KA 4ISNA 2B9LA 5ETXA 1JRTA 2ZDNA 2AMQA 3K6ZA 4AG1A 2F3CE 2AS9A 1L1NA 2GV6A 3MNSA 1UJ1A 4YO9A 1ZTKA 3ATIA 4YZUA 1HXFH 1ABIH 2Y82A 1DY9A 2TGPZ 1H4WA 2JETB 5ABWA 1BRAA 4INHA 2C90B 4YLQH 2W3KA 2TGDA 1DITH 4ZAEA 1SG8B 1C1QA 5IYTA 3SHAH 1HJ9A 2AERH 1UTNA 1NY22 1Y3YA 2CV3A 4F4OC 4DGJA 1GJCB 1ESBA 1MD7A 1O3CA 3QZRA 1QQUA 3VB4A 4GVUA 4NCYA 3GCHB 1ZMNA 5PTPA 3TJUA 4X8UH 2FESH 2I6SA 2ZPRA 1XVOA 2XCFA 2ZECA 4X6OA 3GY8A 5CMXH 3M35A 3A8CA 4D76A 1GHAF 1K1OA 2FOCA 5GCHF 4RKOB 3O8CA 2NU1E 4TYDA 2FEQH 1IQNA 2IJOB 2DE8A 3EQ0H 2FTLE 1Y3XA 1B0EA 1ZSKA 1AQ7A 1JXPA 1NFWA 2A1DB 2PTNA 3BTEE 2R9PA 1HAYB 2NU2E 1O2KA 1BTPA 1SHHB 1YPEH 2ZFFH 3RUOA 2XBXA 2VIPA 3SHCH 3ZV9A 3GY4A 1FY3A 1QR3E 3A88A 1TNLA 3TK9A 1GG6C 3V0XA 4CR5A 1MTSA 3QN7A 2OD3B 1UTLM 4AYYB 3QK1A 1D3PB 1GJAB 2Y7XA 2ANWA 1H8DH 4TWWA 1O2XA 3LH1A 1ZSLA 1Z1IA 4ZUHA 3GY7A 1HFDA 5ESTE 1EPTC 1P9SA 3S0NA 3SU3A 3UNSA 3LGUA 5JBAS 2H5CA 4I8JA 1ZOMA 4MPVA 2QXGA 1P3CA 2CGAA 4O9VA 1HAHH 3ESTA 4K1TA 2BDCA 2Z9JA 3I77A 1EAIA 4CR9A 1WAYB 2GVFA 2ZU5A 2HOBA 4CHAB 5GPIB 1PPBH 2FI3E 1GHVH 2BDAA 8GCHG 1TNJA 4E7NA 4CBNA 4GHTA 5EPNA 2FS8A 1O3EA 1DDJA 1ZSJA 3LGVA 1ZYOA 3MH4A 5FPSA 1ESAA 1QL9A 4K1SA 2ZGBH 1F2SE 3RXSA 5E2OA 4AN7A 1V6DA 4AOQA 1HAVA 2QY0B 1W0ZU 3T26A 5FPYA 1CQQA 1EKBB 1D3QB 4JK6A 3PLBA 1TGSZ 1B5GH 1K1IA 2FX6A 2GCTC 1C1MA 1EP6A 1TWXB 4LK4A 1TNGA 1O2JA 1O38A 4X2VA 5DP3A 1V2WT 1Y5UT 2ZHDA 1GI3A 1ETRH 3ODDA 3TIUA 2J92A 1DS2E 4FUBA 3P17H 1UTJA 4ABAA 1UTQA 3P8FA 1IQIA 1V3XA 2VIDA 3UTUH 5C1XA 2I6QA 2QXHA 1BTWA 1C5QA 1OSSA 3P8GA 5CE1A 2QIQA 4NIXA 4ZKRU 3SU6A 3STIA 1ZJDA 1RGQA 5DG6A 2VWLA 2ANMH 1UO6A 2FLRH 1C1NA 1O32A 2C8ZB 1XUKA 1GHAG 5GCHG 4FUHA 3SNDA 3TPIZ 1V2RT 2BLVA 3P95A 9ESTA 1X7AC 2ZF0H 1T32A 1TPAE 2UUJB 3BG4C 3T25A 1O36A 1RTFB 3A86A 4O97A 1RD3B 1J8AA 3UWJH 4DY7B 1KTSB 1SC8U 1Y8TA 1V2KT 2BD9A 1C2KA 3SORA 1GBHA 3HKJB 3SQHE 1O5BB 1CO7E 4WWYA 3S9CA 2WPMS 1NN6A 1OWKA 1C1WH 3ZVGA 1RFNA 3RXCA 4IGDA 2QC2A 3M7TA 1G3EA 1QURH 5H4IB 4GSOA 2ANKH 2XTTB 1ZHPA 1DSUA 1DUAA 5BPEA 3K9XB 1AE8H 2ALPA 2TBSA 4ASHA 1E38B 3MYWA 3GY3A 2FTMA 5EXNA 1MQ5A 1GHBF 2ZCHP 1O2QA 2SNWA 1CE5A 1O2SA 3VPKA 2C93B 4FUDA 4B2BA 2ZA5A 1C1OA 1NRSH 3AASA 2QXJA 2ZEBA 3UWIA 2ZO3H 1P2IA 3KNXA 1HAZB 1THSH 1YP9A 3V13A 1DXWA 1P03A 4Y7BA 4OS2A 1Z1JA 1QA0A 2C4FH 1GI1A 1IQLA 1SB1H 1KXFA 2BY8X 1TGCA 3A81A 3FP6E 3RLYH 4WMEA 2ZQ2A 2FIRH 4AGKA 1DT2A 3Q3XA 5GXPA 3O8RA 5CHAC 1NU7B 3RC5A 1Z6EA 2UWPA 5LPFA 1QB1A 1GBBA 1Q31A 3MOCA 1J15A 4K3JA 3ATMA 1ELVA 1SVPA 3TU7H 1ZHRA 1O2MA 2P94A 1CT2E 3PROA 5JBCS 2GZ8A 1MAXA 3FP7E 3OX7U 1UK2A 3MO6A 1O5AB 2O8TA 4WY3A 1LPGB 2ZTXA 4I8GA 2DE9A 1V2QT 3V12A 5F8XA 2VWMA 4AFUA 5HYOA 2SFAA 2CHAC 3NWUA 2BVRH 3B8JA 3MI4A 1AIXH 2CN0H 4NA9H 1C2JA 4NWKA 1K9OE 1O3MA 1QA7A 3KCGH 3MH6A 3Q00A 1QIXB 1O3JA 4XSKU 4JYTA 2D8WA 1A3EH 2A2XH 1DANH 1H9HE 1E36B 4AYVB 1WQSA 6GCHG 1W7XH 2Z3DA 1ANDA 2P16A 1TGNA 2ZDAH 2WUCA 3N7OA 4MPXA 3DFJA 1DX5M 1CGIE 2XCNA 2A45B 2JH5D 1N6XA 1GBCA 2B8OH 1RTKA 1FQ3A 5F6MA 1DXPA 1O2PA 3MTYA 1KIGH 2Y5HA 1FV9A 1TALA 1G9IE 3C1KA 1A5HA 1YM0A 3BG4B 1W0YH 1V2NT 2ASUB 1SPJA 1Z71A 2BDYA 1TBZH 2FPZA 1UVPA 5E0JA 3SU0A 1ETSH 5JB8S 1PYTC 1GJDB 1GI6A 2OC0A 2GTBA 3PMAB 4K5ZA 1W7GH 2F83A 2STAE 1QJ7B 2V3OH 1SGCA 3PO1C 3TNSA 2NWNA 3LPRA 4KTUA 4ABEA 1MKWK 1JIMA 1HRTH 1C5PA 5I46H 3RP2A 1V2LT 3TITA 1OWIA 1PQ5A 1C1RA 1LVBA 1GWAA 3PWBA 1T4UH 1W3CA 2BXUH 1CHOF 4IN1A 2PGBB 4Q7ZA 3RXIA 2GCHF 1ZTJA 4AFSA 2HWLB 2V3HH 5JDUB 1QFKH 2FWWA 5BRRE 3TVJB 2ZWLH 3RXVA 3RDZA 1LQDB 1GHBG 1CGJE 5DP7A 1P2NA 1O3NA 2H9EH 1DE7H 4AFZA 1SSXA 4Y71A 4GHQA 1OP8A 1Q3XA 5JPMH 3BTDE 3GY2A 2GDEH 4X0WU 3BIUH 3QGJA 1SHYA 4H6TA 4KGAA 1TIOA 2A0QB 2PKAB 5TCAA 1FAKH 3PM3A 1ZPZA 5LPEA 5AHGH 2G51A 4D9RA 1WQVH 1HV7A 2ZC9H 1WTHD 4RSPA 2UWLA 1XUIA 3A7XA 3SZNA 3UREA 1QRWA 1SFQB 1A61H 2JETC 1XUJA 8KME2 1KXEA 4YT6H 3SQEE 1GI0A 3U69H 2H5DA 1P09A 2GT8A 3TK6A 1S6HA 4B1TA 2UUYA 3S69A 1C5LH 1YPKH 4IS5A 3LH3A 1AB9C 3BTKE 1UMAH 3MH7A 1BZXE 3RXMA 3GISB 1EAXA 1JMOH 3GCHC 1P2JA 2V35A 1O2OA 2FI5E 3ZVBA 1IQMA 4Y79A 1TQ0B 3M3TA 1MTNB 4B75A 3OSYA 3EGKH 1O3KA 3OY5U 4I8HA 1J9CH 4BAOB 1LHDH 3GCNA 3LJJA 5B6OA 4CRDA 1B0FA 2ODQA 1HJAB 4AORA 3FANA 3PMJA 1UK4A 1OP2A 3AW1A 3ZZ8A 1ID5H 1S85A 1VJ9U 4MDSA 5HXFA 1MMJN 2EI6A 4X8SH 1P06A 2HNTE 1MCTA 2A5AA 3QUMP 1C1UH 3A8BA 2BD3A 4CRCA 4NZQA 1K22H 1O0DH 1WV7H 4IC6A 1ANEA 6LPRA 3GY6A 1BA8B 1EZQA 4BXSA 1NTPA 1C2FA 4O03A 2PUXB 1DWCH 4XBBA 2G5VA 4UD9H 2BDBA 1TNHA 5L2ZH 1L0ZA 2C3SA 2GX4A 5FHTA 1INCA 5A0AE 5DP9A 1KSNA 2A7HA 5JB9S 1O31A 1QTFA 3A80A 2Y80A 3PMHB 2BLQA 3TJVA 3EYDA 2BY5X 4YOJA 1T7CA 2LNCA 3M61U 5AVDA 2GDDA 1O2NA 1DM4B 3PTBA 4D7FA 2ZHFH 4CHAC 2FO9A 1FJSA 3VXEH 1ZR0A 4ZROA 1GBMA 3Q76A 4DCDA 2GCHG 3W95A 5EQQA 2ZDKA 1QBNA 5I25A 1F92A 2TGTA 1ORFA 1EATA 1TBQH 4UFDH 3RU4E 3D49H 2O8MA 2BD8A 1AVXA 4DIIH 1IQJA 1FNIA 3KQCA 1EB1H 1C5YB 5E0GA 1O2YA 1V2PT 4DURA 1GJ6A 1OWHA 4D9QA 1O2WA 2SGQE 1GJ9B 4NA7A 1IQHA 1GI8B 3RXJA 2VWOA 2R3UA 1EZXC 4A7IB 5A2MH 1FXYA 1AKSB 3RXLA 3RXPA 3OU0A 1MZAA 1O5DH 1D3DB 2PKAA 3TH3H 1V2MT 1L1GA 3BEFB 1C4V2 4MLFB 5DP8A 1CU1A 1P0SH 1HDTH 1TB6H 3KHVA 1A1RA 4U01A 3ZZ7A 3H7OA 3M7QA 3V3MA 1FAXA 5A8XA 1BHXF 1MKXH 5F03A 4XBDA 1Y59T 5JBTA 2XXLA 1QRXA 1MUEB 4AB8A 4MG3A 4CRAA 4ZMAH 3JZ1B 3PB1E 3RXQA 4ZHLU 2FX4A 2P95A 3F9FA 1V2OT 4XDEA 4FUCA 1AB9B 1TX6A 4DOQA 1C5NH 4A92A 2FOAA 4U2WA 1BOQA 4X2YA 2HLCA 4WMDA 1SLWB 1C2EA 2JH0D 2FOMB 5E8EH 1ELBA 2V6NA 1GL0E 1WYKA 2BX3A 2VU8E 2VB0A 2ZDMA 1SQTA 3BG8A 5J4QA 4I7YH 1HGTH 1SGPE 3SNCA 2ILNA 1K1JA 4R8TB 4AG2A 5EXLA 3UUZA 5DGJA 2ZQ1A 3OYPA 1PPGE 1MBQA 3TJOA 2XC5A 4Y11E 3M5LA 5AFZH 3M3SA 3UR9A 3NUMA 4IC5A 2Z3CA 2PGQB 3FVFB 3GDVA 4SGBE 2A31A 1NROH 1VITF 3HGNA 4Y6DA 4WMFA 2QF3A 3TLOA 3QZQA 2QCYA 2WYJA 3LOXA 3SUEA 1DPOA 3AVZA 1AU8A 1V2UT 1WTGH 1W14U 1ZLRA 2ZI2H 4FU9A 2HALA 4TWYA 1BMLA 1C5SA 2QN5T 1C2IA 2CMYA 1PPCE 3LONA 4FU7A 3JZ2B 1PFXC 1C1SA 1OYQA 4HI3A 3SOSA 3QGNB 1EASA 3NXPA 1MZDA 1MD8A 2AFQB 5FBEA 2ZHWH 2XRCA 3MNCA 4X6PA 3KQBA 4NGAH 1GBLA 1YC0A 2XW9A 1QHRB 3F68H 1O3AA 5FBIA 1FMGA 4NG9H 1LHEH 2QGRA 2UUKB 7ESTE 3RXTA 1EUFA 2Z6BD 3L33A 1C2GA 3LGIA 4QT8C 1YGCH 3O8DA 5DKMA 2VH0A 1ZRKA 4D8NA 1MKWH 3ZZ9A 1SGYE 2R2MB 2XBYA 1W8BH 2WPIS 1QGFA 3PWCA 2PSXA 3P92A 1Q2WA 1CA8B 1DLEA 1S83A 2Q6DA 5HM9A 4RKJB 4XFQA 1NZQH 3F9GA 1IQKA 3Q77A 1F0RA 2PHBA 4NIYA 3RMLH 1HUTH 4XE4A 1BRBE 3D65E 3U8RH 2Z9IA 3SI4H 4YT7H 2ZHEH 9LPRA 1AKSA 2FODA 2IOTA 4HGCA 3RXRA 4YESB 4D7GA 4MVNA 5DP5A 1J17T 2JKHA 1C5VA 4Q2KA 1XXFA 5K7RA 1O30A 4MPUA 4BTTB 1C4U2 3HGPA 3HKIB 3E6PH 1CHGA 1KY9A 1ZRBA 2ZP0H 1ELFA 1C5XB 1EJAA 5HMAA 1SBWA 3CS7A 3V7TA 3Q3KA 1HPGA 1NPMA 5C5NA 1U6QA 4MNWA 3LGWA 1UCYE 3IG6B 1C5ZB 4DT7B 2ZGJA 1O3PB 2DUCA 3U8TH 1OPHB 6GCHF 2EEKA 3RXAA 2BTCE 2FP7B 3URDA 2WV5A 1HAPH 4X1NU 3VB5A 2VIQA 1A0LA 3MU1A 3T28A 1MU8B 3EA9A 2WV4A 4JZDH 1ZMJA 3ZZ3A 1MH0A 4CBOA 1EJMA 1C4Y2 1LMWB 2WUBA 2QV1A 2VINA 1EXFA 5C2ZA 4Y8YA 1SR5C 1K1PA 3SJ9A 2Z9LA 1BMMH 1TLDA 2VGCB 5ESBA 1P11E 3E0NB 3A85A 4XOJA 3SNBA 3TGJE 3LKWA 1TNKA 1SLXB 2BZAA 3KIDU 2OINA 1K1MA 1WU1A 2A5IA 2Z3EA 4FUFA 1QCPA 1T8LA 1KXCA 3Q3YA 1H9IE 1VITG 1AY6H 1IQFA 1DY8A 1UHBB 1AZ8A 3ZVEA 1GDUA 6CHAB 1EZUC 2A4QA 1LHCH 1GBTA 1Y5AT 1MCVA 4Y0ZE 5AFYH 2F9OA 3SGBE 1TRNA 1VCQA 2Y6TA 1L1JA 2J94A 1YPMH 2OC7A 3QO6A 3FAOA 1NFYA 1MTUA 1NRRH 4DIHH 2ZFSA 3UY9A 2BZ6H 1PQAA 3URCA 3MH5A 4CRBA 1TMBH 3QX5H 1D3TB 3I29A 1ETTH 5C1YA 1QRZA 1W10U 2HGTH 2FLBH 2FOFA 2ZKSA 1NRQH 2J4IA 2OBQA 4ABDA 1BHXB 2ZTZA 7LPRA 1YPHC 4IMQA 3P6ZB 2J34A 4CRFA 5A0CA 3KQEA 4GLYA 1SL3A 4BOHA 2PR3A 4Q80A 1EAUA 2HNTC 2WYGA 3RXOA 5G4BA 2ZNKH 3F1SB 3BN9A 2H1UA 3UNQA 3F9EA 1PPZA 3E8LA 1GHZA 2ZFPH 2BOKA 5EODA 1V2JT 1C2HA 2KAIB 1JOUB 2ZFRH 1ZZZA 3A7VA 1SGQE 1MTNC 2GKVE 4AFQA 4FXGH 4ABFA 1V2VT 1LDTT 1EX3A 2BQ6B 1TABE 1SGEE 3K6YA 1O3OA 1Y5BT 1B7XB 3A83A 3PLKA 5FX6A 8ESTE 1XUFA 1GGDB 1C5MD 1GBAA 1HJAC 4BTIB 3SUFA 3D23A 2G4TA 3UR6A 2CXVA 1LVOA 2HRVA 3A7WA 3T2NA 3ITIA 2VWNA 2BX4A 4BAHB 3BSQA 1GBFA 1QJ6B 1E35B 2RDLA 2ZHQH 2ESTE 3MFJA 1FZZA 3S9AA 2ALVA 1CT4E 1ELGA 2PSYA 2BY6X 2EI7A 5EGMA 1LPKB 4BTUB 4OS5A 2UUFB 3MU8A 2OBOA 4DG4A 3ELAH 2OXSA 1O5FH 2H9HA 3BEUA 2SGPE 2XBVA 1YPJH 1BQYA 3CS0A 3SUGA 3H7TA 4FU8A 4GAWA 3VB3A 4B2AA 1O5CB 3TGKE 1DSTA 3ZYDA 3E3TA 1C2MA 1KLJH 4A1TA 1Y3WA 1KDQB 4A1VA 2HPQH 1ZJKA 2ZCKP 4FUJA 2EC9H 1BTXA 5C1UA 2WINI 1QJ1B 2AH4X 4IN2A 1KTTB 4K60A 1S0RA 2BY7X 1BT7A 1XMNB 2SGDE 4HFPB 3GDUA 2ODPA 1GVZA 2WPHS 1PPEE 3BTGE 2PUQH 1UVTH 3U8OH 3MNXA 1SI5H 4NZLA 2FOGA 2ZZUH 3SNEA 4MNYA 1F0SA 4ZH8A 1N1LA 2ZTYA 1NC6A 4I32A 5C20A 4I33A 4O3UA 2AGEX 2VIWA 1C1TA 1UHBA 4ZKOU 1OX1A 5FCKA 1P3EA 1QBOA 1C9TA 1CVWH 1YLCA 2FYQA 3A8AA 5F8ZA 2PFEA 3MNBA 1HYLA 3S7KB 3ZZ6A 3UOUA 4THNH 3UPEA 1F5RA 3BIVH 1G37A 1C1PA 1BMAA 3RC6A 1SOZA 1VGCB 4B73A 1UVOA 3ATKA 4FVBA 3SU1A 4ZXXH 2H9TH 4Q7XA 2G5NA 1VITH 2OQ5A 5TJXA 1UK3A 3MU5A 4GPGA 4X6NA 2OCVB 1VCWA 1LKBA 5DPAA 5EW2H 3GOVB 1S6FA 1O37A 2SGEE 1W13U 1FY5A 2ZFTA 3SI3H 3T29A 3OTJE 1C5RA 1YF4A 2AIPA 3A84A 1PPHE 3SU4A 1LHGH 3B23B 3PMBB 4UFFH 1NFXA 4Y10E 1P12E 1SGTA 1FN6A 3FP8E 1Y3UA 2BVSH 2ZIQH 4DW2U 2GD4B 3RXHA 1FDPA 4TY7A 1S82A 3LU9B 2HVXA 3P70B 1YPLH 1C2LA 4JK5A 4ABJA 5EXMA 3E90B 1MTVA 1BITA 1DUEA 1T31A 2VVVA 1ZMLA 4BAQB 1P57B 2CJIA 4LZ4B 2KAIA 1Z7KA 1O2GH 1V2ST 4UFEH 3PV4A 1WUNH 2P3UB 2Y7ZA 3KQDA 3GDSA 3VGCB 3ZVAA 1PQ8A 3S9BA 2BDGA 4FVDA 1NO9H 1FIWA 4ISHH 4WJG2 3RLWH 1S84A 2GGVB 5L6NH 1OWDA 2J95A 2PKSB 1LVMA 1YPHE 1OP0A 1HAOH 2GMTB 2OTVA 3SNAA 1CA0B 2WPLS 1GI9B 2THFB 5L30H 1OKXA 2YNBA 1J16A 3RXEA 2AIQA 2HPPH 1FY1A 2F9NA 2FZZA 4YLUA 2Q6GA 1AWHB 1A5GH 1UTKA 1MTWA 3PTNA 5DO4H 1UCYK 1C2DA 1K1LA 1YPGH 3SGQE 1BTYA 3M36A 1CT0E 1QY6A 1QNJA 2P3FH 3S7HB 4K1EA 1JIRA 4E7RG 1S81A 4OGYA 1GJ8B 1RIWC 1A0HB 3P8NA 1S0QA 4JYVH 1LPZB 1MAYA 2J2UA 4X8TH 1KDQA 3EA7A 3RC4A 3SUDA 1BBRE 1EB2A 5EQSA 1A0JA 4UDWH 3RXUA 2AMDA 2OLGA 4BXWA 1HIAB 5GJ4B 4E06H 1G2LA 1TAWA 4O3TA 1HAGE 3VFEA 1W2KH 4MTBA 3C27B 1EP5A 3SW2B 1CBWB 1TGTA 1T8NA 2BD5A 1PYTD 1LQEA 1FONA 2D2DA 3LGYA 2FM2A 3KL6A 2BVXH 2ZU1A 1JBUH 1JRSA 1SGFG 4Y8ZA 4M7GA 4ABGA 3FZDA 2W7SA 4X1RU 2ZU2A 3ZZ4A 1SGRE 3EAJA 1GMCF 1TGBA 1XKAC 1AVWA 1YCPM 1UTOA 1A46H 3SJ8A 2CF9H 1DVAH 1G3CA 1AGJA 2AMPA 5EU8A 1FPCH 2FOHA 1F5LA 1GDNA 1O33A 2ZDVH 1AFQB 3SV6A 4JCNA 5LPRA 4JZ1A 4A1XA 3F6UH 2OC1A 2P3TB 4A6LA 5EQRA 2EA3A 1T4VH 1QL7A 4H6SB 4KELA 5FCRA 3B9FH 1TMTH 3UOPA 2FDAA 3KF2A 4JZEH 2Z9KA 3NZIA 2NU0E 1O2ZA 4SGAE 3ZZAA 4TY6A 1N6YA 1GBIA 3LGTA 4ISIH 1TX8A 2FS9A 2A32A 4X1PU 2G52A 1KXAA 1P05A 1XX9A 2ZPSA 2A2QH 2J38A 5FAHA 4NFEA 2SNVA 1HAIH 1O2UA 1IOEA 4Y0YE 6ESTA 1P2KA 2P8OB 3M37A 4ZKSU 2BLOA 2ZGCA 3MWIU 1SQAA 1O5EH 3KEEA 1P8VC 2A4GA 1HB0B 3LDXH 2ZFQH 4K69A 2YNAA 2ZU3A 2BD4A 1BRUP 2VVUA 2Y5GA 1KLIH 1A5IA 3NPSA 4FUGA 4X2WA 1TNIA 2OUAA 4AGJA 1BUIA 2O9QA 5A8ZA 2B7DH 5T6GA 2BY9X 3SN8A 2A7JA 4A5TS 2VGCC 1EAWA 3TJNA 1NESE
chains in the Genus database with same CATH superfamily
1GBEA 1TBRH 1NFUA 2YOLA 5GIBA 4K2YA 4YXWD 4WXIA 4DVAU 3R0FA 2AYWA 1Z8RA 1T8MA 1AFEH 2GZ9A 4CH2B 4BAKB 3L3TA 4I8LA 4OM9A 1TRYA 2O8WA 3HATH 3OEHD 1GJ5H 4ACAA 2RA3A 2KX4A 3UB0A 3AW0A 5JBBS 6CHAC 1XUGA 4K8YA 4UFGH 1G32B 4IBLH 3W1EA 4BANB 3DA9B 4F49A 3U1IB 3BTME 1RIWB 1YYY1 1AI8H 1O34A 1S6LA 2A7CA 4AZ2B 3EE0B 4XBCA 1HJ8A 3P8OA 1LCYA 1TPPA 5DJ7A 1C5WB 3SGAE 4CREA 4E05H 4Z6AH 5EJ1A 4OS4A 3M5OA 1BMNH 1SGDE 1HIAA 1YLDA 1GMDG 4Q4LA 3K65B 1AO5A 1GMHF 3ZZ5A 1C5TA 1T8OA 1P10A 2RG3A 1LTOA 3T62A 3M5NA 4YM9A 1W12U 4NSVA 4ZXYH 1NU9A 3NKKA 1N8OB 2P93A 3RMOH 3VXFH 1ESTA 3M7UA 3UQOA 3WY8A 1XVMA 1AZZA 1ELEE 1P2QA 4GUXA 1NRNH 4ZKNU 2G00A 3I78A 1QZ8A 1OYTH 1GJ4H 2KM0A 2XC0A 1Z8JB 4B74A 3OE7D 5F8TA 1GMCG 1KXDA 4JZIA 1K21H 1P02A 1VKYA 1QBVH 2FYRA 3HK6B 1TOMH 3F9HA 2BMGB 4GCHF 1YCPK 2AEIH 1GCDA 4RI0A 2AGGX 2F9VA 3LJOA 2XWAA 3KN2A 4Z0KA 1GHWH 3ZZDA 3RMNH 5L2YH 2QE7D 2D26C 1UVUH 1ELTA 1HXEH 2ZGXH 1P2MA 1GGDC 1SLUB 4RN6A 1FIZA 1AHTH 2ANYA 1GBJA 2F91A 2TIOA 1SQOA 1BMFD 2FI4E 4AX9H 1SQRA 1TA6A 4X1SU 1VCPA 1NS3A 2KCOA 3GYLB 2ZU4A 1GDQA 1UTMA 1WOFA 3ODFA 1THPB 3BV9B 4I31A 3GCOA 2PWXA 4MQAA 5JYIA 3U9AH 1AUTC 1BRCE 2FMJA 2TRMA 3SJKA 3GICB 1SLVB 4ESTE 5LGOA 2VIOA 4DJZB 1KXBA 4HTCH 4X1QU 1A3BH 1ABJH 1RS0A 1TA2A 1BB0B 2J9NA 2Y81A 1TQ7B 1O2VA 1GBKA 3STJA 1PPFE 3ZV8A 2J98A 4FUEA 3TH4H 3HK3B 3SV9A 1NT1A 3BTTE 3BEIB 5LH8A 2SGFE 1BCUH 1O3LA 1Z8IB 3DSPA 5T6DA 2W3IA 1FI8A 1QB6A 3OY6U 2HNTF 1XM1A 2PTCE 3E91A 4ISLA 2Y5FA 1G3DA 2GV7A 4WF8A 2IN2A 1IHTH 2XWBI 1FY4A 2RCEA 1TRMA 1ZTLA 2A5KA 1XKBC 4PROA 2C8XB 3IITA 1DLKB 2BLWA 2EI8A 5A8YA 3T5FH 1SGFA 1CGHA 2K1QA 4INLA 1BTHH 1H1BA 3EA8A 5K0HA 3RM2H 3UIRA 3VB7A 1BJUA 1SGNE 2BQWB 1UCYH 3RXBA 2RA0A 4YOGA 2PV9B 4TPYA 2BDHA 2VJ1A 2TPIZ 3DHKH 1W0KD 4YOIA 4BNRA 4KTSA 3BTFE 1O3FA 2LPRA 5C3NA 2ZPQA 3MU4A 1VGCC 1D4PB 3BTWE 1BBRK 2H2ZA 2QF5A 5TCCA 1LVYA 3ZYEA 1GG6B 1GMHG 1RJXB 4CH8B 5T3HA 2F9UA 3UFAA 1NM6A 5EOKA 3ZVDA 3BTHE 3A82A 1BJVA 4UONA 1O2IA 4ABIA 4NSYA 1GHXH 3A8DA 1LO6A 2R0KA 1EPTB 3BF6H 1C5OH 1P01A 1ARBA 3M3VA 2W26A 4KTCA 3GCTF 3MO9A 4KKDA 1E37B 1MQ6A 1NRPH 1ELDE 4YTAA 5HIYA 1O3BA 1E0FD 4INKA 1O2LA 1YLNA 3AAUA 2SGAA 4GCHG 1MKXK 1PJPA 2XNIA 2QXIA 5AF9H 1KLTA 2BDIA 2IJD1 2H6MA 7GCHF 4OS7A 3FFGA 1ZHMA 2AGIX 3SV8A 1RXPA 1LHFH 2G8TA 2XYAA 4BAMB 1HAXB 4CRGA 2V0BA 3VGCC 3RXFA 1WSSH 1O2RA 2JH6D 4KP0A 2WPKS 1OXGA 1EOJA 1IHSH 3A89A 4LXBH 2PKSC 1GCTC 1QB9A 1Z8GA 1CSOE 1YBWA 2GMTC 3T27A 1CA0C 4XD7D 4JMYA 2ZCLP 3SBKA 2OP9A 3IWMA 2GP9B 2PLXA 1FY8E 3BTQE 2GCTB 2NU4E 2XC4A 1FUJA 2WHXA 2JJ2D 3EDXB 4IMZA 1SMFE 2F9PA 1A2CH 1F0UA 4WH8A 5GDSH 5IDKA 2V3MA 3KGPA 2GZ7A 1MU6B 4NIWA 3DUXH 1YY3A 1KYNA 5FPTA 1FLEE 1GI2A 4Q7YA 2WV9A 2ODYB 2FXRA 1TE0A 3RU4T 2B0FA 3SJIA 3GYMA 5E2PA 1RTLA 2F4LA 1GBDA 1TFXA 5A0BA 2BB4A 1BTZA 1G2MA 3LC3A 4NFFA 4Z1MD 5T6FA 3SV7A 2UWOA 3TNTA 1BIOA 2Z9GA 1AE5A 2BM2A 5E0HA 1F5KU 2WSSD 4JZFH 4MPWA 4X2XA 1P2OA 1AMHA 1AVGH 1CBWC 2A4RA 3CP7A 3SJOA 1W11U 2FOBA 1ANBA 4H4FA 2ZGHA 1D9IA 1AWFH 1A4WH 2XBWA 1GI5A 5EJLA 1VZQH 2M5TA 3A87A 2QYIA 1O3DA 7KMEH 1TPSA 2FOEA 4VGCC 4WH6A 2BD2A 1DWEH 1P9UA 3G01A 2EQNA 2R3YA 1QL8A 4J1YA 1DFPA 2STBE 4K8BA 2F43B 1ZPBA 2VVCA 4WVPE 1F7ZA 1ELCA 4AB9A 3MHWU 2F9BH 4NA8A 4ZHMU 4B6EA 4OS6A 1AFQC 4MNVA 5C17A 5A09A 5C5OA 2Z7FE 2R2WU 4MNXA 2TGAA 3H5CB 4ABHA 2QA9E 5HGGA 4LOYH 1BDAA 1PQ7A 1HBTH 1GVLA 3QDZB 2VH6A 3QTVH 5EW1H 1DICA 1K2I1 1FN8A 3F2FA 1O3GA 2NU3E 1K1NA 2W5EA 3LC5A 1G3BA 1VR1H 1EPTA 3ATLA 1XUHA 1Y3VA 2Q6FA 4LZ1H 2VNTA 1ELAA 3U1JB 1TYNA 1ZGIA 3ZZBA 4IW4E 1WBGB 3SU5A 2BQ7B 3ENSB 2WPJS 1O35A 3GCTG 3UNRA 3U98H 2VIVA 1OS8A 3W94A 2IPHA 1SOTA 1ARCA 2P8OC 3ATWA 4UEHH 2WZQA 4Y76A 3VEQB 8LPRA 1G36A 1E34B 3A7TA 3D62A 4NIVA 4OGXA 1H9LB 4X8VH 3QTOH 5CHBA 3VG8A 3ZVCA 3DFLA 7GCHG 1DWDH 3FZZA 3SU2A 3GY5A 4ISOA 1GL1A 3RXGA 2BHGA 3SV2H 4HG6A 3LT3A 1YCPH 1O2TA 4JYUH 2ZG0H 1C5UA 4WXVA 1OWJA 3RM0H 1RRKA 3ZZCA 1JWTA 1SGIB 5CHAB 3K2UA 2B5TB 3NK8A 1J14A 4TPIZ 1Z6JH 1WXRA 1THRH 1GCTB 2A4OA 3PLPA 4R0IA 1L4DA 4ZHAA 3VB6A 2OQUA 2G55A 5DP6A 1ZPCA 1VJAU 3L6PA 1WCZA 1IQGA 2ULLA 1TMUH 2Z94A 3LIWA 1ACBE 3CENA 1UTPA 4U32A 1DOJA 2CF8H 2Q1JA 2ZDLA 1C1VH 1SKYE 1O3IA 2CHAB 2OC8A 4J2YB 3TK5A 1IQEA 1TOCB 1O39A 5C67A 1EQ9A 2PW8H 1SFIA 1V2TT 1OOKB 4B2CA 1O3HA 3UQVA 1D6WA 1EJNA 3QLPH 2JIZD 3NCLA 1GHYH 3HPTB 1DWBH 1K28D 1GI7B 3MMGA 1QQ4A 3RU4D 1OWEA 1HCGA 3DD2H 5GWZA 5SGAE 3A7ZA 1C9PA 1GMDF 5HM2A 2D1JA 1GJBB 2QAAA 2L74A 2R0LA 1H8IH 5FX5A 3RXKA 2YMSB 1ZGVA 1IAUA 1N8OC 1GPZA 3PYHA 2P59A 1GI4A 1M9UA 3E16B 1UVSH 2C8WB 1L4ZA 1EOLA 1TONA 1S5SA 1EZSC 1HNEE 4HZHA 4VGCB 3MO3A 2O8UA 4Y7AA 3WWBA 2W7UA 1MBMA 2BD7A 3E0PB 1BTUA 2L6OA 5EG4A 4H42U 1GJ7B 5DK1A 3ZVFA 3A7YA 4B76A 3DT0H 3O8BA 3E1XB 1P04A 2QF0A 1G30B 3PO1B 2RDEA 1FPHH 3R3GB 1LKAA 2BYAX 1YKTA 3M5MA 2C8YB 4FUIA 4OS1A 1AN1E 1F0TA 1CHOG 2BOHB 1L2EA 4ABBA 8GCHF 4NWLA 2O8LA 3MU0A 2BXTH 1ANCA 2G81E 1BBRH 2GT7A 1XXDA 4X6MA 1AUJA 1D6RA 4U30A 3RMMH 4B71A 1AD8H 1O5GH 1O2HA 1A7SA 3SO3A 5FXLA 5EPYA 1HAVB 5J4SA 4Y8XA 3RXDA 3TH2H 1TX7A 5DP4A 4UE7H 3TGIE 1TPOA 2G4UA 3AAVA 1HLTH 3QWCH 1GVKB 4I8KA 2W6ID 4ISNA 2B9LA 5ETXA 1JRTA 2ZDNA 2AMQA 3K6ZA 4AG1A 2F3CE 2AS9A 3OTPA 1L1NA 2GV6A 3MNSA 1UJ1A 4YO9A 1ZTKA 3ATIA 4YZUA 1HXFH 1ABIH 2Y82A 1DY9A 2TGPZ 1H4WA 2JETB 5ABWA 1BRAA 4INHA 2C90B 4YLQH 2W3KA 2TGDA 1DITH 4ZAEA 1SG8B 1C1QA 5IYTA 3SHAH 1HJ9A 2AERH 1UTNA 1NY22 1Y3YA 2CV3A 4F4OC 4DGJA 1GJCB 1ESBA 1MD7A 1O3CA 3QZRA 5C94A 1QQUA 3VB4A 4GVUA 4NCYA 3GCHB 1ZMNA 5PTPA 3KQ5A 3TJUA 4P02A 2FESH 4X8UH 2I6SA 2ZPRA 4ZCNA 1XVOA 2XCFA 2ZECA 4X6OA 3GY8A 3DSOA 3M35A 5CMXH 3A8CA 4D76A 1GHAF 2KCPA 1K1OA 2FOCA 5GCHF 4RKOB 3O8CA 2NU1E 4TYDA 2FEQH 1IQNA 2IJOB 2DE8A 3EQ0H 2FTLE 1Y3XA 1B0EA 1ZSKA 3PRBA 1AQ7A 3KYFA 1JXPA 1NFWA 2A1DB 2PTNA 3BTEE 2R9PA 1HAYB 2NU2E 1O2KA 1BTPA 1SHHB 5DN6D 1YPEH 2ZFFH 3RUOA 3PV5A 2XBXA 2VIPA 2KFWA 3SHCH 3ZV9A 3GY4A 1FY3A 1QR3E 3A88A 1TNLA 3TK9A 1GG6C 3V0XA 4CR5A 1MTSA 3QN7A 2OD3B 1UTLM 4AYYB 3QK1A 1D3PB 1GJAB 1E1QD 2Y7XA 2ANWA 1H8DH 4TWWA 1O2XA 3LH1A 1ZSLA 1Z1IA 4ZUHA 2KR7A 3GY7A 1HFDA 5ESTE 1EPTC 1P9SA 3S0NA 3SU3A 3UNSA 3LGUA 5JBAS 2H5CA 3EE7A 4I8JA 1ZOMA 4MPVA 2QXGA 1P3CA 2CGAA 4O9VA 1HAHH 1COWD 4RT0A 3ESTA 4K1TA 2BDCA 2Z9JA 3I77A 1EAIA 4CR9A 1WAYB 2GVFA 2ZU5A 2HOBA 4CHAB 5GPIB 1PPBH 2FI3E 1GHVH 2BDAA 8GCHG 1TNJA 4E7NA 4CBNA 4GHTA 5EPNA 2FS8A 1O3EA 1DDJA 5KEDA 1ZSJA 5HKKD 3LGVA 1ZYOA 3MH4A 5FPSA 1ESAA 1QL9A 4K1SA 2ZGBH 1F2SE 3PRDA 3RXSA 5E2OA 4AN7A 1V6DA 4AOQA 1HAVA 2QY0B 1W0ZU 3T26A 5FPYA 1CQQA 1EKBB 1D3QB 4I86A 4JK6A 3PLBA 1TGSZ 1B5GH 1K1IA 2FX6A 2GCTC 1C1MA 1EP6A 1TWXB 4LK4A 3KYGA 1TNGA 1O2JA 1O38A 4X2VA 5DP3A 1V2WT 1Y5UT 2ZHDA 1GI3A 1ETRH 3ODDA 3TIUA 2J92A 1DS2E 4FUBA 3P17H 2HLDD 1UTJA 4ABAA 1UTQA 3P8FA 1IQIA 1V3XA 2VIDA 4XRNA 3UTUH 5C1XA 2I6QA 2QXHA 1BTWA 1C5QA 1OSSA 3P8GA 5CE1A 2QIQA 3WWFA 4NIXA 4ZKRU 3SU6A 3STIA 1ZJDA 1RGQA 5DG6A 2VWLA 2ANMH 1UO6A 5KGOA 2FLRH 1C1NA 2XNDD 1O32A 2C8ZB 1XUKA 1GHAG 5GCHG 4FUHA 3SNDA 3TPIZ 1V2RT 2BLVA 3P95A 9ESTA 1X7AC 2ZF0H 1T32A 1TPAE 2UUJB 3BG4C 3T25A 1O36A 1RTFB 3A86A 4O97A 1RD3B 1J8AA 3UWJH 3N99A 4DY7B 1KTSB 1SC8U 1Y8TA 1V2KT 2BD9A 1C2KA 3SORA 1GBHA 3DCLA 3HKJB 3SQHE 1O5BB 1CO7E 4WWYA 3S9CA 2WPMS 1NN6A 1OWKA 1C1WH 3ZVGA 1RFNA 3RXCA 4IGDA 2QC2A 3M7TA 1G3EA 1QURH 5H4IB 4GSOA 2ANKH 2XTTB 1ZHPA 1DSUA 1DUAA 5BPEA 3K9XB 1AE8H 2ALPA 2TBSA 4ASHA 1E38B 3MYWA 3GY3A 2FTMA 5EXNA 1MQ5A 2JDID 1GHBF 2ZCHP 1NBME 1O2QA 2SNWA 3F2HA 1CE5A 1O2SA 2V7QD 3VPKA 2KCAA 2C93B 4FUDA 4B2BA 2ZA5A 1C1OA 1NRSH 3AASA 2QXJA 2ZEBA 3UWIA 2ZO3H 1P2IA 3KNXA 1HAZB 1THSH 1YP9A 3V13A 1DXWA 1P03A 4Y7BA 4OS2A 1Z1JA 1QA0A 2C4FH 1GI1A 1IQLA 1SB1H 1KXFA 2BY8X 1TGCA 3A81A 3FP6E 3RLYH 4WMEA 2ZQ2A 2FIRH 4AGKA 5DSFA 1DT2A 3Q3XA 5GXPA 3O8RA 3ZIAD 5CHAC 1NU7B 3RC5A 1Z6EA 2UWPA 5LPFA 1QB1A 1GBBA 1Q31A 3MOCA 1J15A 4K3JA 3ATMA 1KMHB 1ELVA 1SVPA 3TU7H 1ZHRA 1O2MA 2P94A 1CT2E 3PROA 5JBCS 2GZ8A 1MABB 1MAXA 3FP7E 3OX7U 1UK2A 3MO6A 1O5AB 2O8TA 4WY3A 1LPGB 2ZTXA 4I8GA 2DE9A 1V2QT 3V12A 5F8XA 2VWMA 4AFUA 5HYOA 2SFAA 2CHAC 3NWUA 2BVRH 3B8JA 3MI4A 1AIXH 2CN0H 4NA9H 1C2JA 4NWKA 1K9OE 3MQKC 1O3MA 1QA7A 3KCGH 3MH6A 3Q00A 1QIXB 1O3JA 4XSKU 4JYTA 2D8WA 1A3EH 2A2XH 1DANH 5C0TA 1H9HE 1E36B 4AYVB 1WQSA 6GCHG 1W7XH 2Z3DA 3SZEA 1ANDA 2P16A 1TGNA 2ZDAH 2WUCA 3N7OA 4MPXA 2YMSC 3DFJA 1DX5M 5HIZA 1CGIE 2XCNA 2A45B 2JH5D 1N6XA 1GBCA 3F0OA 2B8OH 1RTKA 1FQ3A 5F6MA 1DXPA 1O2PA 3MTYA 1KIGH 2Y5HA 1FV9A 1TALA 1G9IE 3C1KA 1A5HA 1YM0A 3BG4B 1W0YH 1V2NT 2ASUB 1SPJA 1Z71A 2BDYA 1TBZH 2FPZA 1UVPA 5E0JA 3SU0A 1ETSH 5JB8S 1PYTC 1GJDB 1GI6A 2OC0A 2GTBA 3PMAB 4K5ZA 1W7GH 2F83A 2STAE 1QJ7B 2V3OH 1SGCA 3PO1C 3TNSA 2NWNA 3LPRA 4KTUA 4ABEA 1MKWK 1JIMA 3FKSD 4P00A 1H8HD 1HRTH 1C5PA 5I46H 3RP2A 1V2LT 3TITA 1OWIA 1PQ5A 1C1RA 1LVBA 1GWAA 3PWBA 1T4UH 1W3CA 2BXUH 1CHOF 4IN1A 2PGBB 4Q7ZA 3RXIA 2GCHF 1ZTJA 4AFSA 2HWLB 2V3HH 5T1VA 5JDUB 1QFKH 2FWWA 5BRRE 3TVJB 2ZWLH 3RXVA 3RDZA 1LQDB 1GHBG 1CGJE 5DP7A 1P2NA 1O3NA 2H9EH 1DE7H 4AFZA 1SSXA 4Y71A 4ACBA 4GHQA 1OP8A 1Q3XA 4TSFD 5JPMH 3BTDE 3GY2A 2GDEH 4X0WU 3BIUH 3QGJA 1SHYA 4H6TA 4KGAA 1TIOA 2A0QB 2PKAB 5TCAA 1FAKH 3PM3A 1ZPZA 5LPEA 5AHGH 2G51A 4D9RA 1WQVH 1HV7A 2ZC9H 1WTHD 4RSPA 2UWLA 1XUIA 3A7XA 3SZNA 3UREA 2M2AA 1QRWA 1SFQB 1A61H 2JETC 1XUJA 8KME2 1KXEA 4YT6H 3SQEE 1GI0A 3WW7A 3U69H 2H5DA 1P09A 2GT8A 3TK6A 1S6HA 4B1TA 2UUYA 3S69A 1C5LH 1YPKH 4IS5A 3LH3A 1AB9C 3BTKE 1UMAH 3MH7A 1BZXE 3RXMA 3SYJA 3GISB 1EAXA 1JMOH 3N7EA 3GCHC 1P2JA 2V35A 3FN8A 1O2OA 2FI5E 3ZVBA 1IQMA 4Y79A 1TQ0B 3M3TA 1MTNB 4B75A 3OSYA 3EGKH 1O3KA 3OY5U 4I8HA 1J9CH 4BAOB 1LHDH 3GCNA 3LJJA 5B6OA 4CRDA 1B0FA 2ODQA 1HJAB 2J97A 4AORA 3FANA 3PMJA 1UK4A 1OP2A 3AW1A 3ZZ8A 1ID5H 1S85A 1VJ9U 4MDSA 5HXFA 1MMJN 2EI6A 4X8SH 1P06A 2HNTE 2XOKD 4Q63A 1MCTA 2A5AA 3QUMP 1C1UH 3A8BA 2BD3A 4CRCA 4NZQA 5GNDA 1K22H 1O0DH 1WV7H 4IC6A 1ANEA 6LPRA 3GY6A 1BA8B 1EZQA 4BXSA 1NTPA 1C2FA 4O03A 2PUXB 1DWCH 4XBBA 2G5VA 4UD9H 2BDBA 1TNHA 5L2ZH 1L0ZA 2C3SA 2GX4A 5FHTA 1INCA 5A0AE 5DP9A 1KSNA 2A7HA 5JB9S 1O31A 1QTFA 2RFKC 3A80A 5C0UA 2Y80A 3PMHB 2BLQA 3TJVA 3EYDA 2BY5X 4YOJA 2EY4C 1T7CA 2LNCA 3M61U 5AVDA 2GDDA 1O2NA 1DM4B 3PTBA 4D7FA 2ZHFH 4CHAC 2FO9A 1FJSA 3VXEH 1ZR0A 4ZROA 1E79D 1GBMA 3Q76A 4DCDA 2GCHG 3W95A 5EQQA 3OEED 2ZDKA 1QBNA 5I25A 1F92A 2TGTA 1ORFA 1EATA 1TBQH 4UFDH 3RU4E 3D49H 2O8MA 2BD8A 1AVXA 4DIIH 1IQJA 1FNIA 3KQCA 1EB1H 2KZ4A 1C5YB 5E0GA 1O2YA 1V2PT 4DURA 5CDFE 1GJ6A 1OWHA 4D9QA 4DT4A 1O2WA 2SGQE 1GJ9B 4NA7A 1IQHA 1GI8B 3RXJA 2VWOA 2R3UA 1EZXC 4A7IB 5A2MH 1FXYA 1AKSB 3RXLA 3RXPA 3OU0A 1MZAA 1O5DH 1D3DB 2PKAA 3TH3H 1V2MT 1L1GA 3BEFB 1C4V2 4MLFB 5DP8A 1CU1A 1P0SH 1HDTH 1TB6H 3KHVA 1A1RA 4U01A 3ZZ7A 3H7OA 3M7QA 3V3MA 1FAXA 5A8XA 1BHXF 1MKXH 5F03A 4XBDA 1Y59T 5JBTA 2OK5A 2XXLA 1QRXA 1MUEB 4AB8A 4MG3A 4CRAA 4ZMAH 3H09A 3JZ1B 3PB1E 3RXQA 4ZHLU 2FX4A 2P95A 3F9FA 1V2OT 4XDEA 4FUCA 1AB9B 1TX6A 4DOQA 1C5NH 4A92A 2FOAA 4U2WA 1BOQA 4M9FA 4B6FA 4X2YA 2HLCA 4WMDA 1SLWB 1C2EA 2JH0D 2FOMB 5E8EH 1ELBA 2V6NA 1GL0E 1WYKA 2BX3A 2VU8E 2VB0A 5EIYA 2ZDMA 1SQTA 3BG8A 5J4QA 4I7YH 1HGTH 1SGPE 3SNCA 2ILNA 1K1JA 4RT1A 4R8TB 4AG2A 5EXLA 3UUZA 5DGJA 2ZQ1A 3OYPA 1PPGE 1MBQA 3TJOA 2XC5A 4Y11E 3M5LA 5AFZH 3M3SA 3UR9A 3NUMA 4IC5A 2Z3CA 2PGQB 3FVFB 3GDVA 4SGBE 2A31A 1NROH 1VITF 3HGNA 4Y6DA 4WMFA 2QF3A 3TLOA 3QZQA 2QCYA 2WYJA 3LOXA 3SUEA 1DPOA 3AVZA 1AU8A 1V2UT 1WTGH 1W14U 1ZLRA 2ZI2H 4FU9A 2HALA 4TWYA 1BMLA 1C5SA 2QN5T 1C2IA 2CMYA 2IPQX 2K8IA 1PPCE 3LONA 4FU7A 3JZ2B 1PFXC 1C1SA 1OYQA 4HI3A 3SOSA 3PV2A 3QGNB 3U28C 1EASA 3NXPA 1MZDA 1MD8A 2AFQB 5FBEA 2ZHWH 2XRCA 3MNCA 4X6PA 3KQBA 4NGAH 1GBLA 1YC0A 2XW9A 1QHRB 3F68H 1O3AA 5FBIA 1FMGA 4NG9H 1LHEH 2QGRA 2UUKB 7ESTE 4FOUC 3RXTA 3F0PA 1EUFA 2Z6BD 3L33A 1C2GA 3LGIA 4QT8C 1YGCH 3O8DA 5DKMA 2VH0A 1ZRKA 4D8NA 1MKWH 3ZZ9A 1SGYE 2R2MB 4AC9A 1FX0B 2XBYA 1W8BH 2WPIS 1QGFA 4FETA 3PWCA 2PSXA 3CNRA 3P92A 1Q2WA 1CA8B 1DLEA 1S83A 2Q6DA 5HM9A 4RKJB 4XFQA 1NZQH 3F9GA 1IQKA 3Q77A 1F0RA 2PHBA 4NIYA 3RMLH 1HUTH 4XE4A 1BRBE 3D65E 3U8RH 2Z9IA 3SI4H 4YT7H 2ZHEH 9LPRA 1AKSA 2FODA 2IOTA 3F3BA 4HGCA 3RXRA 4YESB 4D7GA 4MVNA 5DP5A 1J17T 2JKHA 1C5VA 4Q2KA 1XXFA 5K7RA 1O30A 4MPUA 4BTTB 1C4U2 3HGPA 3HKIB 3E6PH 1CHGA 1KY9A 1ZRBA 2ZP0H 1ELFA 1C5XB 1EJAA 5HMAA 1SBWA 3CS7A 3V7TA 3Q3KA 1HPGA 1NPMA 5C5NA 1U6QA 4MNWA 3LGWA 1UCYE 3IG6B 1C5ZB 1EFRD 4DT7B 2ZGJA 1O3PB 2DUCA 3U8TH 1OPHB 6GCHF 2EEKA 3RXAA 2BTCE 2FP7B 3URDA 2WV5A 1HAPH 4X1NU 3VB5A 2VIQA 1A0LA 3MU1A 3T28A 1MU8B 3EA9A 2WV4A 4JZDH 1ZMJA 3ZZ3A 1MH0A 1E1RD 4CBOA 1EJMA 1C4Y2 1LMWB 2WUBA 2QV1A 2VINA 1EXFA 5C2ZA 4Y8YA 1SR5C 1K1PA 3SJ9A 2Z9LA 1BMMH 1TLDA 4TT3D 2VGCB 5ESBA 1P11E 1NBMD 3A85A 3E0NB 4XOJA 3SNBA 3TGJE 3LKWA 3OAAD 1TNKA 1SLXB 2BZAA 3KIDU 2OINA 1K1MA 1WU1A 2A5IA 2Z3EA 4FUFA 1WDIA 1QCPA 1T8LA 1KXCA 3Q3YA 1H9IE 1VITG 1AY6H 1IQFA 1DY8A 1UHBB 1AZ8A 3ZVEA 1GDUA 6CHAB 1EZUC 2A4QA 1LHCH 2WPDD 1GBTA 1Y5AT 1MCVA 4Y0ZE 5AFYH 2F9OA 3SGBE 1TRNA 5KECA 1VCQA 2Y6TA 1L1JA 2J94A 1YPMH 2OC7A 3QO6A 5FL7D 3FAOA 1NFYA 1MTUA 1NRRH 4DIHH 2ZFSA 3UY9A 2QF4A 2BZ6H 1PQAA 3URCA 3MH5A 4CRBA 1TMBH 3QX5H 1D3TB 3I29A 1ETTH 5C1YA 1QRZA 1W10U 2HGTH 2FLBH 2FOFA 2ZKSA 1NRQH 4ASUD 2J4IA 2OBQA 4ABDA 1BHXB 2ZTZA 7LPRA 1YPHC 4IMQA 3P6ZB 1YWUA 2J34A 4CRFA 5A0CA 3KQEA 2JJ1D 4GLYA 1SL3A 4BOHA 2PR3A 4Q80A 1EAUA 2HNTC 2WYGA 5IK2D 3RXOA 5G4BA 2ZNKH 3F1SB 3BN9A 2H1UA 3UNQA 3F9EA 1PPZA 3E8LA 1GHZA 2ZFPH 2BOKA 5EODA 1V2JT 1C2HA 2KAIB 1JOUB 2ZFRH 1ZZZA 3A7VA 1SGQE 1MTNC 2GKVE 4AFQA 2K0QA 4FXGH 4ABFA 1V2VT 1LDTT 2LP6A 1EX3A 2BQ6B 1TABE 1SGEE 3K6YA 1O3OA 1Y5BT 1B7XB 3A83A 3PLKA 5FX6A 8ESTE 1XUFA 1GGDB 1C5MD 1GBAA 1HJAC 4BTIB 3SUFA 3D23A 2G4TA 5F53A 3UR6A 2CXVA 1LVOA 2HRVA 3A7WA 5EJZA 3T2NA 3ITIA 2VWNA 2BX4A 4BAHB 3BSQA 1GBFA 1QJ6B 1E35B 2RDLA 2PP6A 2ZHQH 2ESTE 3MFJA 1FZZA 3S9AA 2ALVA 1CT4E 1ELGA 2PSYA 2BY6X 2EI7A 3F2GA 5EGMA 1LPKB 4BTUB 4OS5A 2UUFB 3MU8A 2OBOA 4DG4A 3ELAH 2OXSA 1O5FH 2H9HA 3BEUA 2SGPE 2XBVA 1YPJH 1BQYA 3CS0A 3SUGA 3H7TA 4FU8A 4GAWA 3VB3A 4B2AA 2W6JD 1O5CB 3TGKE 1DSTA 3ZYDA 3E3TA 1C2MA 1KLJH 4A1TA 1Y3WA 1KDQB 4A1VA 2HPQH 1ZJKA 2ZCKP 4FUJA 2EC9H 1BTXA 5C1UA 2WINI 1QJ1B 2AH4X 4IN2A 1KTTB 4K60A 1S0RA 2BY7X 1BT7A 1XMNB 2SGDE 4HFPB 3GDUA 2ODPA 1GVZA 2WPHS 1PPEE 3BTGE 2PUQH 1UVTH 3U8OH 3MNXA 1SI5H 4NZLA 2FOGA 2ZZUH 3SNEA 4MNYA 3UAIC 1F0SA 4ZH8A 1N1LA 2ZTYA 1NC6A 4I32A 4F48B 5C20A 4I33A 4O3UA 2AGEX 2VIWA 1C1TA 1UHBA 4ZKOU 1OX1A 5FCKA 1P3EA 1QBOA 1C9TA 1CVWH 1YLCA 2FYQA 3A8AA 5F8ZA 2PFEA 3MNBA 1HYLA 3S7KB 3ZZ6A 3UOUA 4THNH 2GJGA 3UPEA 1F5RA 3BIVH 1G37A 1C1PA 2KCYA 1BMAA 3RC6A 1SOZA 1VGCB 4B73A 1UVOA 3ATKA 4FVBA 3SU1A 4ZXXH 2H9TH 4Q7XA 2G5NA 1VITH 2OQ5A 5TJXA 1UK3A 3MU5A 4GPGA 4X6NA 2OCVB 1VCWA 1LKBA 5DPAA 5EW2H 3GOVB 1S6FA 1O37A 2SGEE 1W13U 1FY5A 2ZFTA 3SI3H 3T29A 3OTJE 1C5RA 1YF4A 2AIPA 3A84A 1PPHE 3SU4A 3AK5A 1LHGH 3B23B 3PMBB 4UFFH 1NFXA 4Y10E 1P12E 1SGTA 1FN6A 3FP8E 1Y3UA 2BVSH 2ZIQH 4DW2U 2GD4B 2VBCA 3RXHA 1FDPA 4TY7A 1S82A 3LU9B 2HVXA 3P70B 3N7DA 1YPLH 1C2LA 4JK5A 4ABJA 5EXMA 3E90B 1MTVA 1BITA 1DUEA 1T31A 2VVVA 2HVYB 1ZMLA 4BAQB 1P57B 2CJIA 4LZ4B 2KAIA 1Z7KA 1O2GH 1OHHD 1V2ST 4UFEH 3PV4A 1WUNH 2P3UB 2Y7ZA 3KQDA 3GDSA 3VGCB 3ZVAA 1PQ8A 3S9BA 2BDGA 4FVDA 1NO9H 1FIWA 4ISHH 4WJG2 3RLWH 1S84A 2GGVB 5L6NH 1OWDA 2J95A 2PKSB 1LVMA 1YPHE 1OP0A 1HAOH 2GMTB 2OTVA 3SNAA 1CA0B 2WPLS 1GI9B 2THFB 5L30H 1OKXA 2YNBA 1J16A 3RXEA 2AIQA 2HPPH 1FY1A 2F9NA 2FZZA 2J5UA 4YLUA 2Q6GA 1AWHB 1A5GH 1UTKA 1MTWA 3PTNA 5DO4H 1UCYK 1C2DA 1K1LA 1YPGH 3SGQE 1BTYA 3M36A 1CT0E 1QY6A 1QNJA 2P3FH 3S7HB 3FO8D 4K1EA 1JIRA 4E7RG 1S81A 4OGYA 3NRLA 1GJ8B 1RIWC 1A0HB 3P8NA 1W0JD 1S0QA 4JYVH 1LPZB 1MAYA 2J2UA 4X8TH 1KDQA 3EA7A 3RC4A 3SUDA 2YMSD 1BBRE 1EB2A 5EQSA 1A0JA 4UDWH 3RXUA 2AMDA 2OLGA 4BXWA 1HIAB 5GJ4B 4E06H 1G2LA 1TAWA 4O3TA 1HAGE 3VFEA 1W2KH 4MTBA 3C27B 1EP5A 3SW2B 2AHME 1CBWB 1TGTA 1T8NA 2BD5A 1PYTD 1LQEA 1FONA 2D2DA 3LGYA 2FM2A 3KL6A 2BVXH 2ZU1A 1JBUH 1JRSA 4F55A 1SGFG 4Y8ZA 4M7GA 4ABGA 3FZDA 2W7SA 3OFND 4X1RU 2ZU2A 3ZZ4A 1SGRE 3EAJA 1GMCF 1UW7A 1TGBA 1XKAC 1AVWA 1YCPM 1UTOA 1A46H 3SJ8A 2CF9H 1DVAH 1G3CA 1K0HA 1AGJA 2AMPA 5EU8A 1FPCH 2FOHA 1H8ED 1F5LA 1GDNA 1O33A 2ZDVH 1AFQB 3FOAA 3SV6A 4JCNA 5LPRA 4JZ1A 5B6LA 4A1XA 3F6UH 2OC1A 2P3TB 4A6LA 5EQRA 2EA3A 1T4VH 1QL7A 4H6SB 4KELA 5FCRA 3B9FH 1TMTH 3UOPA 2FDAA 3KF2A 4JZEH 2Z9KA 3NZIA 2NU0E 1O2ZA 4SGAE 3DSGA 3ZZAA 4TY6A 1N6YA 1GBIA 3LGTA 4ISIH 1TX8A 2FS9A 2A32A 4X1PU 2G52A 1KXAA 1P05A 1XX9A 2ZPSA 2LELA 2A2QH 2J38A 3GS9A 5FAHA 4NFEA 2SNVA 1HAIH 1O2UA 1IOEA 2CK3D 4Y0YE 6ESTA 1P2KA 2P8OB 3M37A 4ZKSU 2BLOA 2ZGCA 3MWIU 1SQAA 1O5EH 3KEEA 1P8VC 2A4GA 1HB0B 3LDXH 2ZFQH 4K69A 2YNAA 2ZU3A 2BD4A 1BRUP 2VVUA 2Y5GA 1KLIH 1A5IA 3NPSA 4FUGA 4X2WA 1TNIA 2OUAA 4AGJA 1BUIA 2J98B 2O9QA 5A8ZA 2B7DH 5T6GA 2BY9X 3SN8A 2A7JA 4A5TS 2VGCC 1EAWA 3TJNA 1NESE
chains in the Genus database with same CATH topology
1GBEA 1TBRH 1NFUA 2YOLA 5GIBA 4K2YA 4WXIA 4DVAU 3R0FA 2AYWA 1Z8RA 1T8MA 1AFEH 2GZ9A 4CH2B 4BAKB 3L3TA 4I8LA 1TRYA 2O8WA 3HATH 1GJ5H 2RA3A 3AW0A 5JBBS 6CHAC 1XUGA 4K8YA 4UFGH 1G32B 4IBLH 4BANB 3DA9B 4F49A 3U1IB 3BTME 1RIWB 1YYY1 1AI8H 1O34A 2A7CA 4AZ2B 3EE0B 4XBCA 1HJ8A 3P8OA 1LCYA 1TPPA 5DJ7A 1C5WB 3SGAE 4CREA 4E05H 4Z6AH 4OS4A 3M5OA 1BMNH 1SGDE 1HIAA 1YLDA 1GMDG 3K65B 1AO5A 1GMHF 3ZZ5A 1C5TA 1T8OA 1P10A 2RG3A 1LTOA 3T62A 3M5NA 4YM9A 1W12U 4NSVA 4ZXYH 1NU9A 3NKKA 1N8OB 2P93A 3RMOH 3VXFH 1ESTA 3M7UA 3UQOA 3WY8A 1XVMA 1AZZA 1ELEE 1P2QA 4GUXA 1NRNH 4ZKNU 2G00A 3I78A 1OYTH 1GJ4H 2XC0A 1Z8JB 4B74A 5F8TA 1GMCG 1KXDA 4JZIA 1K21H 1P02A 1QBVH 2FYRA 3HK6B 1TOMH 3F9HA 2BMGB 4GCHF 1YCPK 2AEIH 1GCDA 2AGGX 2F9VA 3LJOA 2XWAA 3KN2A 4Z0KA 1GHWH 3ZZDA 3RMNH 5L2YH 2D26C 1UVUH 1ELTA 1HXEH 2ZGXH 1P2MA 1GGDC 1SLUB 4RN6A 1FIZA 1AHTH 2ANYA 1GBJA 2F91A 2TIOA 1SQOA 2FI4E 4AX9H 1TA6A 4X1SU 1VCPA 1NS3A 3GYLB 2ZU4A 1GDQA 1UTMA 1WOFA 3ODFA 1THPB 3BV9B 4I31A 3GCOA 2PWXA 4MQAA 5JYIA 3U9AH 1AUTC 1BRCE 2FMJA 2TRMA 3SJKA 3GICB 1SLVB 4ESTE 5LGOA 2VIOA 4DJZB 1KXBA 4HTCH 4X1QU 1A3BH 1ABJH 1RS0A 1TA2A 1BB0B 2J9NA 2Y81A 1TQ7B 1O2VA 1GBKA 3STJA 1PPFE 3ZV8A 4FUEA 3TH4H 3HK3B 3SV9A 1NT1A 3BTTE 3BEIB 5LH8A 2SGFE 1BCUH 1O3LA 1Z8IB 5T6DA 2W3IA 1FI8A 1QB6A 3OY6U 2HNTF 1XM1A 2PTCE 3E91A 4ISLA 2Y5FA 1G3DA 2GV7A 4WF8A 2IN2A 1IHTH 2XWBI 1FY4A 2RCEA 1TRMA 1ZTLA 2A5KA 1XKBC 4PROA 2C8XB 3IITA 1DLKB 2BLWA 2EI8A 5A8YA 3T5FH 1SGFA 1CGHA 2K1QA 4INLA 1BTHH 1H1BA 3EA8A 5K0HA 3RM2H 3UIRA 3VB7A 1BJUA 1SGNE 2BQWB 1UCYH 3RXBA 2RA0A 4YOGA 2PV9B 4TPYA 2BDHA 2VJ1A 2TPIZ 3DHKH 4YOIA 4BNRA 4KTSA 3BTFE 1O3FA 2LPRA 5C3NA 2ZPQA 3MU4A 1VGCC 1D4PB 3BTWE 1BBRK 2H2ZA 5TCCA 1LVYA 3ZYEA 1GG6B 1GMHG 1RJXB 4CH8B 5T3HA 2F9UA 3UFAA 1NM6A 5EOKA 3ZVDA 3BTHE 3A82A 1BJVA 4UONA 1O2IA 4ABIA 4NSYA 1GHXH 3A8DA 1LO6A 2R0KA 1EPTB 3BF6H 1C5OH 1P01A 1ARBA 3M3VA 2W26A 4KTCA 3GCTF 3MO9A 4KKDA 1E37B 1MQ6A 1NRPH 1ELDE 4YTAA 1O3BA 1E0FD 4INKA 1O2LA 3AAUA 2SGAA 4GCHG 1MKXK 1PJPA 2XNIA 2QXIA 5AF9H 1KLTA 2BDIA 2H6MA 7GCHF 4OS7A 3FFGA 1ZHMA 2AGIX 3SV8A 1RXPA 1LHFH 2G8TA 2XYAA 4BAMB 1HAXB 4CRGA 2V0BA 3VGCC 3RXFA 1WSSH 1O2RA 2JH6D 4KP0A 2WPKS 1OXGA 1EOJA 1IHSH 3A89A 4LXBH 2PKSC 1GCTC 1QB9A 1Z8GA 1CSOE 1YBWA 2GMTC 3T27A 1CA0C 4JMYA 2ZCLP 3SBKA 2OP9A 3IWMA 2GP9B 2PLXA 1FY8E 3BTQE 2GCTB 2NU4E 2XC4A 1FUJA 3EDXB 4IMZA 1SMFE 2F9PA 1A2CH 1F0UA 4WH8A 5GDSH 5IDKA 3KGPA 2GZ7A 1MU6B 4NIWA 3DUXH 1KYNA 5FPTA 1FLEE 1GI2A 4Q7YA 2ODYB 2FXRA 1TE0A 3RU4T 2B0FA 3SJIA 3GYMA 5E2PA 1RTLA 1GBDA 1TFXA 5A0BA 2BB4A 1BTZA 1G2MA 3LC3A 4NFFA 5T6FA 3SV7A 2UWOA 3TNTA 1BIOA 2Z9GA 1AE5A 2BM2A 5E0HA 1F5KU 4MPWA 4JZFH 3SJOA 4X2XA 1P2OA 1AMHA 1AVGH 1CBWC 2A4RA 3CP7A 1W11U 2FOBA 1ANBA 4H4FA 2ZGHA 1D9IA 1AWFH 1A4WH 2XBWA 1GI5A 2M5TA 1VZQH 3A87A 2QYIA 1O3DA 7KMEH 1TPSA 2FOEA 4VGCC 4WH6A 2BD2A 1DWEH 1P9UA 3G01A 2R3YA 1QL8A 4J1YA 1DFPA 2STBE 4K8BA 1ZPBA 2VVCA 4WVPE 1F7ZA 1ELCA 4AB9A 3MHWU 2F9BH 4NA8A 4ZHMU 4OS6A 1AFQC 4MNVA 5A09A 5C5OA 2Z7FE 2R2WU 4MNXA 2TGAA 3H5CB 4ABHA 2QA9E 5HGGA 4LOYH 1BDAA 1PQ7A 1HBTH 1GVLA 3QDZB 2VH6A 3QTVH 5EW1H 1DICA 1K2I1 1FN8A 1O3GA 2NU3E 1K1NA 2W5EA 3LC5A 1G3BA 1VR1H 1EPTA 3ATLA 1XUHA 1Y3VA 2Q6FA 4LZ1H 2VNTA 1ELAA 3U1JB 1TYNA 1ZGIA 3ZZBA 4IW4E 1WBGB 3SU5A 2BQ7B 3ENSB 2WPJS 1O35A 3GCTG 3UNRA 3U98H 2VIVA 1OS8A 3W94A 2IPHA 1SOTA 1ARCA 2P8OC 3ATWA 4UEHH 4Y76A 3VEQB 8LPRA 1G36A 1E34B 3A7TA 3D62A 4NIVA 4OGXA 1H9LB 4X8VH 3QTOH 3ZVCA 3DFLA 7GCHG 1DWDH 3FZZA 3SU2A 3GY5A 4ISOA 1GL1A 3RXGA 2BHGA 3SV2H 3LT3A 1YCPH 1O2TA 4JYUH 2ZG0H 1C5UA 4WXVA 1OWJA 3RM0H 1RRKA 3ZZCA 1JWTA 1SGIB 5CHAB 3K2UA 2B5TB 3NK8A 1J14A 4TPIZ 1Z6JH 1THRH 1GCTB 2A4OA 3PLPA 4R0IA 1L4DA 4ZHAA 3VB6A 2OQUA 2G55A 5DP6A 1ZPCA 1VJAU 3L6PA 1WCZA 1IQGA 2ULLA 1TMUH 2Z94A 3LIWA 1ACBE 3CENA 1UTPA 4U32A 1DOJA 2CF8H 2Q1JA 2ZDLA 1C1VH 1O3IA 2CHAB 2OC8A 4J2YB 3TK5A 1IQEA 1TOCB 1O39A 5C67A 1EQ9A 2PW8H 1SFIA 1V2TT 1OOKB 4B2CA 1O3HA 3UQVA 1D6WA 1EJNA 3QLPH 3NCLA 1GHYH 3HPTB 1DWBH 1K28D 1GI7B 3MMGA 1QQ4A 3RU4D 1OWEA 1HCGA 3DD2H 5GWZA 5SGAE 3A7ZA 1C9PA 1GMDF 5HM2A 2D1JA 1GJBB 2QAAA 2R0LA 1H8IH 5FX5A 3RXKA 1ZGVA 1IAUA 1N8OC 1GPZA 3PYHA 2P59A 1GI4A 1M9UA 3E16B 1UVSH 2C8WB 1L4ZA 1EOLA 1TONA 1S5SA 1EZSC 1HNEE 4HZHA 4VGCB 3MO3A 2O8UA 4Y7AA 2W7UA 1MBMA 2BD7A 3E0PB 1BTUA 5EG4A 4H42U 1GJ7B 5DK1A 3ZVFA 3A7YA 4B76A 3DT0H 3O8BA 3E1XB 1P04A 2QF0A 1G30B 3PO1B 1FPHH 3R3GB 1LKAA 2BYAX 1YKTA 3M5MA 2C8YB 4FUIA 4OS1A 1AN1E 1F0TA 1CHOG 2BOHB 1L2EA 4ABBA 8GCHF 4NWLA 2O8LA 3MU0A 2BXTH 1ANCA 2G81E 1BBRH 2GT7A 1XXDA 4X6MA 1AUJA 1D6RA 4U30A 3RMMH 4B71A 1AD8H 1O5GH 1O2HA 1A7SA 3SO3A 5FXLA 5EPYA 1HAVB 5J4SA 4Y8XA 3RXDA 3TH2H 1TX7A 5DP4A 4UE7H 3TGIE 1TPOA 2G4UA 3AAVA 1HLTH 3QWCH 1GVKB 4I8KA 4ISNA 2B9LA 5ETXA 1JRTA 2ZDNA 2AMQA 3K6ZA 4AG1A 2F3CE 2AS9A 1L1NA 2GV6A 3MNSA 1UJ1A 4YO9A 1ZTKA 3ATIA 4YZUA 1HXFH 1ABIH 2Y82A 1DY9A 2TGPZ 1H4WA 2JETB 5ABWA 1BRAA 4INHA 2C90B 4YLQH 2W3KA 2TGDA 1DITH 4ZAEA 1SG8B 1C1QA 5IYTA 3SHAH 1HJ9A 2AERH 1UTNA 1NY22 1Y3YA 2CV3A 4F4OC 4DGJA 1GJCB 1ESBA 1MD7A 1O3CA 3QZRA 1QQUA 3VB4A 4GVUA 4NCYA 3GCHB 1ZMNA 5PTPA 3TJUA 4X8UH 2FESH 2I6SA 2ZPRA 1XVOA 2XCFA 2ZECA 4X6OA 3GY8A 5CMXH 3M35A 3A8CA 4D76A 1GHAF 1K1OA 2FOCA 5GCHF 4RKOB 3O8CA 2NU1E 4TYDA 2FEQH 1IQNA 2IJOB 2DE8A 3EQ0H 2FTLE 1Y3XA 1B0EA 1ZSKA 1AQ7A 1JXPA 1NFWA 2A1DB 2PTNA 3BTEE 2R9PA 1HAYB 2NU2E 1O2KA 1BTPA 1SHHB 1YPEH 2ZFFH 3RUOA 2XBXA 2VIPA 3SHCH 3ZV9A 3GY4A 1FY3A 1QR3E 3A88A 1TNLA 3TK9A 1GG6C 3V0XA 4CR5A 1MTSA 3QN7A 2OD3B 1UTLM 4AYYB 3QK1A 1D3PB 1GJAB 2Y7XA 2ANWA 1H8DH 4TWWA 1O2XA 3LH1A 1ZSLA 1Z1IA 4ZUHA 3GY7A 1HFDA 5ESTE 1EPTC 1P9SA 3S0NA 3SU3A 3UNSA 3LGUA 5JBAS 2H5CA 4I8JA 1ZOMA 4MPVA 2QXGA 1P3CA 2CGAA 4O9VA 1HAHH 3ESTA 4K1TA 2BDCA 2Z9JA 3I77A 1EAIA 4CR9A 1WAYB 2GVFA 2ZU5A 2HOBA 4CHAB 5GPIB 1PPBH 2FI3E 1GHVH 2BDAA 8GCHG 1TNJA 4E7NA 4CBNA 4GHTA 5EPNA 2FS8A 1O3EA 1DDJA 1ZSJA 3LGVA 1ZYOA 3MH4A 5FPSA 1ESAA 1QL9A 4K1SA 2ZGBH 1F2SE 3RXSA 5E2OA 4AN7A 1V6DA 4AOQA 1HAVA 2QY0B 1W0ZU 3T26A 5FPYA 1CQQA 1EKBB 1D3QB 4JK6A 3PLBA 1TGSZ 1B5GH 1K1IA 2FX6A 2GCTC 1C1MA 1EP6A 1TWXB 4LK4A 1TNGA 1O2JA 1O38A 4X2VA 5DP3A 1V2WT 1Y5UT 2ZHDA 1GI3A 1ETRH 3ODDA 3TIUA 2J92A 1DS2E 4FUBA 3P17H 1UTJA 4ABAA 1UTQA 3P8FA 1IQIA 1V3XA 2VIDA 3UTUH 5C1XA 2I6QA 2QXHA 1BTWA 1C5QA 1OSSA 3P8GA 5CE1A 2QIQA 4NIXA 4ZKRU 3SU6A 3STIA 1ZJDA 1RGQA 5DG6A 2VWLA 2ANMH 1UO6A 2FLRH 1C1NA 1O32A 2C8ZB 1XUKA 1GHAG 5GCHG 4FUHA 3SNDA 3TPIZ 1V2RT 2BLVA 3P95A 9ESTA 1X7AC 2ZF0H 1T32A 1TPAE 2UUJB 3BG4C 3T25A 1O36A 1RTFB 3A86A 4O97A 1RD3B 1J8AA 3UWJH 4DY7B 1KTSB 1SC8U 1Y8TA 1V2KT 2BD9A 1C2KA 3SORA 1GBHA 3HKJB 3SQHE 1O5BB 1CO7E 4WWYA 3S9CA 2WPMS 1NN6A 1OWKA 1C1WH 3ZVGA 1RFNA 3RXCA 4IGDA 2QC2A 3M7TA 1G3EA 1QURH 5H4IB 4GSOA 2ANKH 2XTTB 1ZHPA 1DSUA 1DUAA 5BPEA 3K9XB 1AE8H 2ALPA 2TBSA 4ASHA 1E38B 3MYWA 3GY3A 2FTMA 5EXNA 1MQ5A 1GHBF 2ZCHP 1O2QA 2SNWA 1CE5A 1O2SA 3VPKA 2C93B 4FUDA 4B2BA 2ZA5A 1C1OA 1NRSH 3AASA 2QXJA 2ZEBA 3UWIA 2ZO3H 1P2IA 3KNXA 1HAZB 1THSH 1YP9A 3V13A 1DXWA 1P03A 4Y7BA 4OS2A 1Z1JA 1QA0A 2C4FH 1GI1A 1IQLA 1SB1H 1KXFA 2BY8X 1TGCA 3A81A 3FP6E 3RLYH 4WMEA 2ZQ2A 2FIRH 4AGKA 1DT2A 3Q3XA 5GXPA 3O8RA 5CHAC 1NU7B 3RC5A 1Z6EA 2UWPA 5LPFA 1QB1A 1GBBA 1Q31A 3MOCA 1J15A 4K3JA 3ATMA 1ELVA 1SVPA 3TU7H 1ZHRA 1O2MA 2P94A 1CT2E 3PROA 5JBCS 2GZ8A 1MAXA 3FP7E 3OX7U 1UK2A 3MO6A 1O5AB 2O8TA 4WY3A 1LPGB 2ZTXA 4I8GA 2DE9A 1V2QT 3V12A 5F8XA 2VWMA 4AFUA 5HYOA 2SFAA 2CHAC 3NWUA 2BVRH 3B8JA 3MI4A 1AIXH 2CN0H 4NA9H 1C2JA 4NWKA 1K9OE 1O3MA 1QA7A 3KCGH 3MH6A 3Q00A 1QIXB 1O3JA 4XSKU 4JYTA 2D8WA 1A3EH 2A2XH 1DANH 1H9HE 1E36B 4AYVB 1WQSA 6GCHG 1W7XH 2Z3DA 1ANDA 2P16A 1TGNA 2ZDAH 2WUCA 3N7OA 4MPXA 3DFJA 1DX5M 1CGIE 2XCNA 2A45B 2JH5D 1N6XA 1GBCA 2B8OH 1RTKA 1FQ3A 5F6MA 1DXPA 1O2PA 3MTYA 1KIGH 2Y5HA 1FV9A 1TALA 1G9IE 3C1KA 1A5HA 1YM0A 3BG4B 1W0YH 1V2NT 2ASUB 1SPJA 1Z71A 2BDYA 1TBZH 2FPZA 1UVPA 5E0JA 3SU0A 1ETSH 5JB8S 1PYTC 1GJDB 1GI6A 2OC0A 2GTBA 3PMAB 4K5ZA 1W7GH 2F83A 2STAE 1QJ7B